4H1LG

Tcr interaction with peptide mimics of nickel offers structural insights in nickel contact allergy
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
113
structure length
113
Chain Sequence
QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVGASGNTGKLIFGQGTTLQVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 16
structure length 113
sequence length 113
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h1lG00
4OF5A 1FG9C 1NCTA 1QQDA 2VLRB 4YAQB 4QXGL 4NO0D 3U4BL 4IRZL 4P2YA 5FGBA 4M03A 2Q76B 5SX5H 1L0XA 3EYFA 5C0AA 3DOSA 2VQ1B 3O8XD 1GZPA 5EFIB 3VXTB 1SYVB 3QFJE 3ZDYF 1NCBL 1T04B 2NY2B 4I2XB 4M7LT 4HFUH 4OUUA 1PQZB 3EO1A 4H1LB 1DDHB 3U9PH 4OFDA 4Q9RH 4F9PC 3VW3H 4N0CD 4NYLA 5CIPH 1TETL 5ESQA 3RVUC 2Z31C 4O2EA 5T3ZH 4I3RL 4X6CE 1U3HC 1WITA 3IDMB 1MJ7L 1A1OB 2JK5B 3QXDA 1NC4D 1JN6B 5LXGL 1DQML 4HKXB 5HDLA 2VXTH 3M45A 5F1IA 3DETD 3NIDF 5DEZA 3KPSA 4JFXB 3UBXG 3NFNB 1GXEA 2E8ZA 1NJ9A 1LO2H 5I8EA 3T0ED 5KG9A 3BQUC 1BOGB 3RWCB 4Z7WA 4DKEL 3QUZB 1OSPL 4NQCA 3QDAA 3IFPA 5BQ7B 2JLLA 2V6HA 4DUXA 3S36X 4PRIE 2FO4A 2APTA 5KVDL 3UYOD 5IQ7H 1S7UB 1AFVL 2R0ZH 3DUUB 1IRAY 2R9HC 4PBXA 3AVEA 3H7LA 2R1WA 3HR5B 4UOJA 5D7IB 3MA7B 5D7JC 5MEOA 4IMLA 3ZKMC 3LIZH 4JG0L 3OJVC 4RFOL 5JNYB 2H1PH 4LEXH 5F7MC 4L8SA 1KN4H 3KJ6H 4GAGH 4X5XA 3TLRA 3VMNA 3UTTA 3VDAA 4ESKA 1F4HA 2YUZA 3PWLA 4JFFA 2LAGB 2CLZA 1Z9MA 4P46D 3SO3C 4Y4FB 2IH1B 4P49A 4JHAL 4B41A 2K1MA 4FOMA 3IDNA 1GZQB 4TTDD 1WV7T 1MSPA 1DQTA 2IQAA 2AK4E 2ESVA 2HRLA 4FQCH 1MI5A 4K3JH 1F00I 5C09B 4FFYL 3RWHA 5EC2B 2A9NH 5I17B 4W6WB 4OTXL 3QISA 3TNMA 3PWNA 4KKLD 3BT2L 3MOBL 1CLOL 4FZ8H 4F2MB 3B2UD 4R6UA 5EB9A 2DTMH 4GBXB 4YDIL 3VH8A 3VXMB 4E5XA 1HWGB 3CLFL 1BLNA 2XTJD 3HHRB 2X89A 2DWEA 1ADQL 3VXRD 4U1MB 4MXQC 5HVFB 1KTLB 4O2CA 4ODTH 1INEL 1FLRL 5B4MC 5ALBL 3PDOB 3W82A 3U7WH 3IAGC 3DURA 4OZFH 1ZLSL 5KSBF 4E0RB 5FYKH 3L3DA 2QADB 3E1F1 4IS6A 1IM9D 5J6HA 1CN4A 3N50A 4CDGC 3VD7A 4OUOA 5DD5L 1OAXL 3IDUA 4U6HA 3RPIB 4S0SD 3NCEB 1N0XH 4Y2DD 2FD6L 3ILQC 5IB3B 1TQBB 4TOYH 1MCCA 4Q9QH 1AXSA 2YPLD 3KXFD 5AWNH 3HLAA 5BZWA 4HWEL 4F7PA 3U4EB 3RQ3A 1X5XA 3EDFA 5E2TL 4WO4B 2A73A 1U92B 3O41A 1Q72L 4D0DA 2WINA 3TVMB 1DN0A 1A7PL 4NRZA 3KYOA 3PABB 2ZUTA 1NAMA 5BVJB 5HHXL 3VD4A 3KLHD 4EUPB 3LS4L 3RIFK 2OZ4H 3JWOH 4L4TE 2EH7H 2ORBH 7FABL 1RI8A 1A1NA 3LN9A 1QSEB 5EC1B 2BSSB 2B1HH 5FUCC 4F15B 3N1QC 4ODWB 3ARGB 5H37G 3M07A 5D5MF 4Y8AA 1D6VL 1IEBA 5HJ3B 3BIKA 3V6FB 5E9DA 3VFUB 2FJFA 3TH4T 5JW4Q 4P57A 4JZNA 1K4DA 4Z5RB 3W9DA 3PJSB 3BDXA 3LRGA 4PJ9C 1IBGH 2J88L 2I9TA 5F9OL 1ORSB 3TYFA 3DVIA 3EYQD 1AKJA 1CGSH 2Z8WC 2EDFA 2F9BT 2UWEF 4GG6A 4P4KB 5D7SL 2DQGH 4OKVB 4HWUA 5CIPA 3MO1A 3RVWD 3WL9A 5BMFL 4MJIA 2R4SL 4FTVB 1OCWL 3FB7A 4N0UE 3ZE1F 3TBYB 3EGSB 4JFDE 1P7KB 4KXZH 5MI0B 4HZLB 1NKRA 4O58H 1U93A 2GT9B 1LNUA 4MJ6A 3S5LG 3QYCA 5F88A 3RBGA 2DQEL 1OVZA 4LLVA 2W9DH 1G7JB 2VDNH 3UZVB 1WJ3A 5FECB 5E2UL 3QXWA 1NCNA 2NY6C 3GIZL 4E41B 3MBXL 2DQDL 4S1QL 3THMH 4QXUL 1E4KC 1MWAA 3JSSA 1NMCC 3BGMB 4RGND 3RVTC 4ZS6C 4LLDA 5KZCD 1A9EB 4OCRH 2P5ED 1WZ1H 3FQXB 3P30L 4M5YL 1M7XA 4LU5L 3VXQB 1OW0C 2VR9A 4L4VD 3PL6A 4HZAA 1FYTD 1ULVA 2AEPL 3BPNB 2L7UA 3IJSA 1CFNA 3DRTB 3VXOB 4XNUH 4PGEA 1B2WL 1FH5H 3GGWB 1JPTL 1L0QA 1W72A 1QR1B 1CD1B 3S34L 3H42L 3QFJD 3BH8A 4HUUA 5J8OA 2D7QA 4H8WL 4P5TA 2K3TA 4KRNA 4ZODA 5IK3B 1F58L 1GSMA 1ZXQA 2CLRA 5DS8B 5L88H 4XPHL 2BDNL 3GMPA 2HT2D 4CVUA 2BSRA 2KPNA 4XVSH 2VLKE 3OKLA 1I8KA 2H3NB 1DQLL 5E8NB 3EOTL 1FNGB 5ADPL 4K07A 3HNSL 3MLRL 1NGXB 1LEIB 3EO9H 2PXYD 5C0JB 1FJ1A 3LPFA 4J4PA 1F8TL 3T4AA 4FQXB 3VG0H 1CG9A 2YKLH 5I1CH 1UB6B 1EX0A 3S88L 2HTKD 1A7QL 4ZUTA 3P0YL 1UGNA 3V4VL 4HCRL 5HHVL 3CXHK 4HC1H 1X5AA 3O2VH 3VFRA 4HX1A 5BRZE 5MEND 2DICA 4UNVA 4APQC 1K6QH 1OM3H 3O4LA 4AY0A 2G5BA 5ERWA 1N6QH 3HZMA 5CCKH 3EBAA 4C83B 3PGDA 3T0XA 1EXUA 3JV6B 5GS0H 3OZ9L 4PRID 3CZJA 1HHKA 3OJDA 4NQVA 5FF6B 3L7EB 3SOBH 4NM4H 4WW2A 5GJSH 1KIPA 5A43C 3BIAX 4G8GA 4UQ3B 5FGBC 4HF5H 4PG9B 4KKAD 3SPVB 4X99B 3EDKA 2JIXD 5HXMA 3R4DA 1B4JH 1FORL 2X70A 3P4OA 2DL9A 3OX8B 3UX9B 3DX9B 1CD9B 2NY7H 1IAIL 1FFNA 1ZWIB 5CS7A 3VXSB 1TVBB 4MAUH 4N0FB 3CFKA 4PJXF 4LSSL 1OWRM 1V3KA 4PB0H 3FHQA 4G8IB 1IKFL 3KPRE 3ZT5A 4QHLA 4JFEE 4XPGH 4TULL 3IKCB 3RBSA 3BVNA 3MOAL 4XMPH 1OGTB 3BZFA 3B9AA 3SGKA 1V3JA 4Y4HA 2AK4D 3OB8A 5JQ6L 2RGSA 5MHSE 1ZMYA 3IXTB 3FOLA 4P2QA 4UT9L 4CADA 3O3UN 5JW5B 1ACYL 2AEIT 5C1MB 3V8OA 4F7EB 4U0RB 1I7RB 3NZHL 5I30H 5D2LA 3WE6B 3DVGB 5EUKB 2APVA 2O61A 1T7YA 5CGYD 1ETZA 1FC2D 4L9LA 4RGOH 4Z77B 1HKFA 5JUEL 1RZ8A 1MCWM 1Z5LA 2HYMA 2EXWC 4YE4L 4OT1H 4PJGB 1FZKA 1QVOA 2FSEB 4GXVL 5BW7A 5D71H 4FQ1H 3SGEI 1ZHBA 4Z7UE 2P49B 4NC1E 5E6IB 3RUGF 4JY5H 1MEXL 3BE1H 1IZKA 4L8SC 25C8H 3EYUL 4JM2D 3WFEH 4ZNEE 3ZHLA 2YD5A 1FFOA 2FLRT 1HSAB 1XIWD 4R9HA 5JOPE 4Z7NE 4NO0A 1NGPL 1T20B 4S1SH 1YYMH 4JFQA 4BZ1L 1DSFH 5HDBE 4ELME 3O8XA 1NAML 1J12A 2AABH 3PWVA 2EO9A 3R0MA 1UG9A 5T1MB 4ODUB 5JO5B 4JG1L 1RUPH 5GJTL 2B5IB 1N2RB 1OSZA 3I6KB 1CXLA 1QR4A 2RB8A 2X4TA 1S3KH 4BH7B 2J4WH 3CVHB 4AIZA 3MGOA 3AS3A 3GMRB 1M7IB 1NC4A 4GS7C 5FO7A 3BW9B 1UWEH 4G80B 4GMTH 1T21A 3CPLA 3UPCA 1B0WA 4RBPH 3FFCB 2Z9TA 1S7WA 4Y1AE 4L4TD 1IT9H 2IMMA 5HHPA 4KJYB 3WKNA 4QT5B 3UBXA 2DN7A 5FXCH 1IVLA 3DMMD 4OFYD 4PJ8B 3U9PL 4Q9RL 1UM6H 3M17B 2FZ3A 2FEEL 4NBZB 1JMZA 3F58H 4PV9B 5FO8A 5I74C 3AAZA 3IDJA 3U1SH 5T3ZL 1V3LA 1E28B 4PY8J 3HG1A 3QXAA 1MUJA 3VXNB 2VXTL 3TO4D 5E56A 1AR2A 3QIBA 4ZUWA 1NCCL 3MLTB 1J9CT 1MWAL 1V5JA 4X9HA 4MA1C 1X4ZA 3PNWB 4P46A 3V5KB 3QUMB 1KEGH 2X1OA 3MLUL 4LCYB 1KTKE 5TQ0L 5IQ7L 3GB7A 4MAYD 1RFDH 5E08H 3BO8A 4JY4B 4QXTB 1CFTB 4JFDD 1KPRB 3RY5A 2C1PB 1IQDB 3L3JB 4Z7VF 3O6FD 3B3IA 4DFIA 2V5YA 3NCFB 2XNAA 5HYQA 3VGHA 2H1PL 1LK2B 3FQNB 3TJEH 5F7LB 5A2LH 2VITA 3HPJB 1L7IH 4Y5YA 3KJ6L 4GAGL 3QEQB 3R1GL 3KDMB 4PJEA 1AHWA 1I1RA 5H35A 2A6KB 5DJAA 4LLMB 2C4FU 4R8WH 5CJXA 4WHYH 1AGBB 5C08B 3REVB 5J13B 5DWUH 3VXRA 4L4JA 2UYLA 5FHAL 2B20A 3C08H 2VN7A 1JE6A 5C0IB 1A22B 5C9JA 1IC4H 5DMGC 3X14A 1ZVSA 4FQCL 2I9LA 4K3JL 2CDEA 1F3JB 1IM9A 2KZWA 5IV2B 2VUYA 2YXMA 4KI1A 3OAYK 1J8KA 5DC4B 1BZ9A 4FZ8L 4Y2DA 3WNMA 3O45A 1KB5H 4LLAA 4MCZB 5DMKA 4L3EB 2YPLA 3KXFA 3O11A 4KUZL 3WHXB 2YXFA 2X4QA 4KTDH 3BKYH 4P0DA 1XF2B 5J12C 2HJKB 5CKGA 4PJDE 3C8KA 2X4NA 4I48B 2BHYA 3I75B 4MNGB 3U7WL 5IMMB 2XN9B 5BRZD 3VFNB 3F12A 1FGNH 4X9FA 3STLA 5C0GB 3UTZB 1HHIA 5FYKL 4LDLB 1B0RA 3U48A 2CUIA 3RNQA 3GM0A 4K94H 3ROLB 3B83A 3PL6C 3BESR 5IQ9B 5DJ6B 4XMLH 1TFHA 2OJZH 5L2JA 5HYJB 1QSFD 4KQ4H 4TOYL 5J57B 4Q9QL 3MRKB 2X4PB 1NUNB 1OPGH 1XGQB 4MA7H 2F54E 4NO5B 2H8PB 2YBRA 3UZEA 5I0DA 4OLUH 3EJZC 2R0KH 2EIZA 3C8HA 2DRUA 4NZRH 1WBZB 4P5TC 3CSYA 1AQKH 1X3DA 1KFAH 2FECI 3NACH 4JDZB 3AXLA 4WCYH 3VFTB 3GBNH 3DX7B 2DQIH 4PJ7F 3JWOL 4J4PC 3GSUB 2ORBL 2AV1B 3S37L 3STZB 4FQ2H 2B1HL 2MHAA 5J6GB 3KNBB 4NUJA 4HUVA 2EDKA 3HZYB 4JANA 5MP6H 4OZIE 2D9QB 2JCCE 1QO3A 1MAKA 3BZDA 1WC7B 1OAUL 4CDHA 3H6JA 5DQJB 2P8MA 3O2WH 4CVWA 5ESAA 5I71B 4MB3A 4LCWE 5L0QC 3GMQB 4U1SB 3DXAE 3QDGA 4HIXH 1IBGL 4XWOD 5F7EH 5GGRA 2NQCA 5ITFB 3H9SB 1KCUH 3S5LA 5DGQA 3L3HB 3T1FA 2Q3AA 3WMSA 4WW2C 4S10A 3U46A 1CGSL 4BSWB 4PRHB 4JEGB 1WK0A 3CZFB 3C87A 4L9DA 1AR1C 1S9WA 2EDNA 2HLFC 5FIEA 2CKBB 4L4VA 1FYTA 4MD5A 2Q7NA 4YBHA 1HHGB 1D5MA 1OB1B 1XF3A 4YIQA 3L6FB 2NY4D 4XP4H 2X09A 4P5MA 5D93B 4O58L 5DRNA 3QFJA 1WFNA 2VDNL 4ZO8A 3OPZH 4PJ5D 1SMOA 1JWMA 5D4QA 3DNKA 1T22B 3JV5A 5CGTA 3THML 3SGKC 4XZUA 3WFBH 1EEYB 4Y4HC 1HXYA 4J3SA 2R0LH 4KK6D 3W9EB 3MUY1 4FG6C 5B3JE 1II4E 1KF9B 2ZCHH 4OCRL 1KJMB 1WZ1L 3QG7L 4M4RA 4LOUC 4YHYC 2PXYA 4NWUH 3QA3B 4K2UL 4X6CA 3EYSH 2OTUB 4EBQL 1CFSB 1EFXB 5MEPB 4PB9L 1I8IB 4U6XB 5LVEA 2FIKB 1LE9B 4L9LC 1CD8A 5MENA 2WP3O 2V5TA 4Y1AD 4DQOH 3JWOC 3F7QA 5TGBA 1SBSH 4AENB 4LGSB 5BW7C 5T5NF 2AXFB 3MV9E 3RY6A 4ZG1A 2WUCL 4PRIA 1DFBH 3WNNA 1KCLA 2IAMB 5L88L 1W2KT 5EU4B 2WK2A 4Q9BA 4HKBB 4XVSL 4LIQE 4Y19D 1UCTA 2I07A 4RFNB 4ZXBB 3TO2A 5CHNA 2O5ZH 3ILPB 4TTGA 3O8XC 3SO5A 2E7LC 2DQHH 4P5KB 3GSXB 3VG0L 2JIXA 5FEBA 2AV7A 2YKLL 4MQTB 3SGDI 3F5WB 1LDPH 5D96B 2J8HA 4NRYB 4HC1L 3O2VL 5A3ID 4N0CC 1YJDL 4MLIA 5C8JA 1K6QL 1OM3L 1N6QL 5T3XE 4YXLH 2EC8A 5IMLA 5CCKL 5GSVA 3F7YB 3QXVA 1YY8B 3MRCA 1P53A 1T4KB 3IVKB 5GS0L 5ACLA 3O3AA 3ROOA 2ITDA 5DSCA 1Q38A 2XWBA 4NM4L 5GJSL 3W5MA 3DETC 1WF5A 4RFEA 2AK4A 3ZYZA 4HF5L 4OZGE 1FC1A 1J88A 1ND0B 1OQXA 3T0EC 4BQCA 1A6ZA 4TSBL 5EUOE 3UTSE 2JJWA 4OGAD 3VFOA 2FJGA 2NY7L 3N1PC 2OJEB 3T0WA 3QHZH 2OI9C 1CCZA 1C1EH 2CR6A 4G8EA 1RZKC 4MAUL 2EDOA 1F6AB 1FG2A 1GPOH 2G5RA 5FDWA 1CBVH 3L95A 1DLHA 3EYVA 3WHE0 4ISVA 3VD5A 3WO4B 2Z91A 4QF1B 3U0PB 2VR4A 3V5DA 1G84A 5FHBH 5CWSB 4XMPL 4JM2A 9CGTA 3EO0B 4EIGB 4KK5D 5L8JB 1XIWA 5EDXA 2R0WH 3RWDA 3LDBB 5GSRB 3WUWB 1F45A 4O4YL 4ONHA 3F62A 2Z92B 4OCMC 4P46C 2D31A 5I30L 5ESVA 1PAMA 2ZNXA 4KDVA 2ILLA 4M8VA 5DURB 3M1BB 4TTDC 2WIIA 5DVMA 1MCOH 1RSFA 1D7FA 4HPYH 5FM5O 4K3EH 2AQ1A 4IJ3C 1TPXB 1JHTA 1SJEA 3LKQB 1NEZB 4OT1L 4BJLA 4HS3A 4WNQA 2HJFB 2HMID 2EIDA 5D71L 1XF5B 4FQ1L 5J7CC 3MRNA 5IIEB 1G9EA 3NIGF 4JY5L 3QI9D 5DVNA 3BE1L 4KKLC 25C8L 2CIKB 3WFEL 4ALAH 3TH3T 1CQKA 4Y5YC 3VMOA 1YJDC 5JHDD 1S5IH 4Y5XB 2NTFA 1AHWC 3GSRA 1M4KA 3B2UC 1YYML 1TJGH 4WTZG 4PS4H 43CAB 4F7CA 5DR5H 5CBEA 5CJXC 3JXAA 4TN9A 2AABL 1KLUB 4L4TA 3ARSA 4H5SB 1I7TA 4HK3N 5IBLD 3L5WA 4JFYA 1N0LA 5C7XH 2YUVA 3BP4A 1RUPL 3DMMA 2YZ8A 3BP7A 1IE5A 1A6AB 1B88A 5DO2D 5I8CA 1R5VA 4XX1E 1N3NB 2DWDA 2J4WL 3FCTA 5CP7B 2F54D 2DQFA 2FL5B 5DEGA 2E9WA 5DHVB 5F9JA 2BVQA 3OGCA 5JR1H 3BZ4A 4OZFB 2NY3B 1KIRA 5DYOA 1NUGA 5DRXB 2FB4H 2VDKH 4DZ8B 4NJAL 4GMTL 4Y2DC 2WW8A 1YEEH 2BP3A 1J0JA 4M1GH 3MRQA 1OHQA 3MCKB 4WJ5B 5C0RH 5LQBH 4M7LH 2XIDA 3NFPA 1N5YH 1IT9L 1UVQA 3HS0B 1MY5A 1C5BH 4ODVH 2NLJA 3N0PB 4ZO9A 4JO3L 3X13A 2ZUSA 4Z0XB 1UM6L 1ITCA 4C59B 2EDWA 3QNXB 1AD9A 1SYSA 3F58L 4N0UA 1KLGB 3I50H 3KLHC 1T5WB 4JFDA 2YD8A 1H0DA 4GG6F 3ZLQC 2FJHA 4XAKE 1ZT4A 3O6FA 5K9QG 5DA4A 3HN3A 3BEVA 3OXRB 4MB5A 3OR6A 4WWKD 1MCFA 3QZWB 4HS8H 1JNNH 5L2KB 4F37K 1NFDE 1F97A 4TSAH 3DO7B 1R3JA 1G6RA 1MFDH 5CJ5A 2P48B 4JDVB 4JQXA 4UILH 2HP4A 5SWSE 3QPQD 1ZE3C 5MERA 1NLDH 3MLWH 3GMNB 1KJVB 1RZ7L 3HI1A 4Y4KD 1HIMH 1HCVA 2QL1A 1RFDL 3EYQC 5E08L 3FO2A 1EVTC 3GMOB 1OP3H 2ZNWA 4N1EA 4LGPB 4OZ4A 5HGBB 4H20H 1S9YB 2IADA 2JE8A 1AGFA 2LU7A 2XFXA 2GJ6B 3MLXH 3TJEL 4W68A 3AUVA 4AH2B 1P84K 1Q1JL 1CZ8L 4KI5D 5BXFA 2Z0BA 3RVWC 3X11A 4Q6YA 1R3HA 4AMKH 2V5SA 4J8RB 1T3FB 1T5XA 5GRVK 2IGFH 1X5YA 3AS2A 4R8WL 1DVFB 4DW2H 4N90E 1KTRL 1TVHB 3UPRA 5IB2A 3K0WA 1UA6H 2ENYA 4O02H 1UFUA 1IEAA 3T8XA 4JKMA 2LTQB 3U30C 4KDTA 2BMKA 5BRZA 1JV5B 1IC4L 1W0VA 4RGNC 4NKIH 4PTTA 5HD8D 3GI8H 5DJDA 4XNYH 3D87B 5C0DB 5I1DB 1T2QH 3N9GH 2LFGA 3TIEA 2LAAA 4GG8A 1CXHA 5EZIH 1O5DT 3WEXB 1KB5L 1KG0A 4RAVB 4X4ME 1IFHH 4F7TA 5C92A 4TUJA 1EA9C 3LKRB 2APBA 2J1KA 4GRWH 3D2UD 3DV4A 4QOKD 1HNGA 4FQQB 4N9GA 4O51B 4PRBB 3PWPB 4XT1C 5F3HA 1Q9LA 3DIFA 3VXPA 4ZFFB 5DJ0A 1R3KB 1WBYA 4PJFE 4OCYH 3KYNB 2HT2C 2A6IB 1FGNL 5DA0B 1IILE 4RWYL 1XCTB 5F8RC 1VA9A 1EBAA 4ZOBA 3PGCA 2MOVA 4LPXA 5T3XD 3PIQA 5C0BB 2PXYC 1K3IA 3H9YA 4K7PH 4R97B 4MDJA 2JF1A 1KIQA 3WLWD 2ADGB 1V7NH 1UQSB 3GSNA 4K3HA 2PYFA 4XMLL 5A2JH 4XVJH 5ANMA 2HTKC 5KN5A 2DM2A 2XKUA 4KQ4L 3VJ6B 2HH0L 2PO6D 4X6DE 1A1MA 2VAJA 1OPGL 1G7IA 5I1LA 5BV7B 4MA7L 2EH8L 5D1XB 2OR9H 5FB8A 5F1OB 2R56H 3UTSD 4OLUL 1YNTB 3MYZA 4NZRL 4XTRD 2ZUQC 5IBTH 3RU8H 3RY6C 1AQKL 3AREB 3I2CH 2X4OA 3ZDZF 3QNYB 3HCVB 1JZ5A 3GBNL 2KKQA 3GO1L 4PJHF 1UJ3A 4KKAC 2DQIL 3HMXA 2VWEC 3CFCL 2WBJD 4EQ2A 5D70H 5JMOC 2NNAA 4Z7UA 2OP4H 5ICYA 2E6PA 3CU7A 2ZSWB 4V1DE 1T1YB 4FQ2L 4ZNEA 1ES0B 2ICEA 1ZLUK 3UTOA 2FATH 5MP6L 1MCRA 2F74A 4NNYB 5EN2B 5HHQB 4QRQA 3RWFB 2CDGB 2YMXH 1DQJA 4ELMA 2Y7QB 1Z9OA 2YPVH 4YX2L 3VFSA 1FL3A 5K59F 2GTZA 1WLHA 3HC0A 4EIZC 4HIXL 2P4AB 1U58B 4PJ5A 5D1ZB 4UU9A 5F7EL 2PTUA 4BQ9A 2BY3A 4LKCA 4MXVF 4RA0C 1KCUL 1EGJA 4BSVB 4POUB 3I85A 4F8QA 3CH8A 5IG7A 3HMWH 5CMAB 5DZLA 4U3CA 5J4MA 1A4KA 4HIJA 1D6EB 4EOWH 3QUKA 2PCPB 3NIDE 4XBGB 4LNRA 4D9RD 2KH2B 1KXTB 4CN1A 1XR8A 4LLQA 1OAZH 1WFTA 4PD4J 3QQ3B 5IESL 4UIMA 1TNNA 1Y18A 1SY6H 3QH3A 5F6HI 2OR7A 3MREA 3ARTA 3JV0A 5CGYC 3IDGB 2BRRH 4LPWA 3EAKA 4PJAE 4Y1AA 2XXMB 4IRSD 1PEWA 4NDMB 2W0FB 2DQJH 3TZVB 4BYHA 1DUYB 3LV3B 1TZIB 4R3SA 2A77L 1F13A 1G7HB 3VCLB 1YPZB 4OCNC 3WFBL 4JM2C 1PJ9A 4MNHA 4XXDA 2X5PA 2R0LL 1XIWC 4DCQA 1ZGLA 3TYGH 2Q87A 1J8HB 4HAFA 1KTDB 3S3SA 3G5XA 3NTCH 1K4CB 4NWUL 1RPQA 4J23A 2EDQA 1EEQA 2P5WB 4OZHB 3BZEA 3MROA 4DUVA 5I66A 5LGHH 1YEHH 4QO1A 4HKJA 5IFJA 1RZFL 4QGTA 3GZKA 4WEBH 4O9HH 3U79A 4ZOCA 1JGVH 3TP4A 3Q5TA 1S8DA 1CLYH 5D6CA 1T80A 4HT1L 4OF0A 4GO6B 2GUOB 1T0MA 1XZ0A 4TYUA 1DFBL 1PX4A 3X12B 1MELA 2CDFB 1EERB 3P0GB 5C70A 2DBJA 1HEZA 1GYAA 5KSUA 1TZHA 4XCEB 1FGVH 1U8OB 5F1KC 2X6MA 2O5ZL 5KVEH 4R7NA 3FO9B 4DKAA 4XAKD 3ZKQD 1YMHA 3LD8C 4ZQKB 5CZVL 5J0BA 4PRDB 4ZDHA 4MHHG 2G60H 2OTWB 3MNWB 3ZE2F 3DMMC 1LDPL 1U3HB 2H26B 4QHUB 3TEUA 3OHXA 3VFVB 2ED7A 2J8UE 2CQVA 2M8XA 4YXLL 3OKEB 4N5ED 4OI9A 4XPAH 1WCBA 4X6BB 1WIUA 4JFPB 4ACPA 3BQUB 3WKMH 3V52L 32C2A 2EE6A 1CL7H 3D18A 1NANI 2V7HA 4ETQA 3GSWB 1H3WM 2C4XA 4I4WB 4W81A 3V0VB 4HSQA 2PW1B 4KK8D 4YFLI 4U31A 1AIFB 2OSLB 5TE4H 3MRGA 2XTLA 3GM8A 4BFEA 2ZOLA 3QHZL 5DK0B 1DLFH 3VA2C 1C1EL 3SJVB 1RHHA 1GPOL 1EDQA 4QKXB 2ICWB 4K55A 4C56E 5TFSL 2A74B 1ZLVH 3SY0B 3O6FC 4S0TD 3I84A 1IAII 4H0GA 4PJDA 3IF1B 5FHBL 1PVHA 4MSWA 5IB1B 5GS1A 4MMZC 4ODHH 1OF2A 1Y6KR 4DAGL 5JHDA 4D9LH 4LLUA 3GHEH 4IHOA 1VPOL 2IJ0C 4WU5A 3TNNB 2R0WL 3BH9A 2UUDK 5D5ME 2F19H 3GMLB 4HH9B 4M6NH 2HJLB 4JQXC 5EBMB 4WTZA 2BXYA 4PJCE 2RAMA 2YD3A 1PG7H 1P1ZB 1FSKC 1JK8A 2VZ1A 3KVQA 5HSFA 1MCOL 2X7LB 4HPYL 4K3EL 1MCNA 3BSZL 5CP3A 4FP8H 3WFDH 1EO7A 1FE8H 3MRLA 2F54A 5E6ZA 1U8IA 3WO3B 5HGGS 1G7MA 3A6OA 3H9HB 3MV11 2UWEE 4JRYE 3ARVA 1RK1B 2PW2A 1ZLUH 2P8PA 3KPNB 3HAEH 4JPWH 3WNKA 5DFWH 1S5IL 4NO3B 4PRPB 1NL0H 1BVLB 2NX5B 2X2YA 5T5FH 4MYWB 3P77A 4PS4L 5DR5L 3K80A 2APFA 4LASL 5I1JH 1KYOJ 1JNHA 1UEMA 1T1ZA 5FUOH 2F53D 3ZE1E 3HMXL 3LHPL 1Z0NA 5ECJE 3T4YA 3CFJB 5C7XL 5A16A 1JFQH 1KNOA 3EOAB 4OZIA 2APWA 2JCCA 4KDTC 1JUFA 5MEQA 1P69B 5TJWK 2X1QA 5DVOA 3VGAC 3TCLB 4TNVF 2P44B 1REIA 1WWCA 2V9QA 5K33A 1NGZA 4QNPF 3DX8B 5JR1L 4FXGB 4WWKA 1XCQB 3TA3A 2FB4L 2VDKL 3QUXD 1OTSD 4JM4L 1QTYT 2H9GB 1BVKB 2VH5H 4JQVA 1B90A 1FO0A 1EGJL 1YEEL 3CFDA 2YUWA 4EVNB 4YUEH 5JIIA 3D39E 4LARH 5E5MB 5TDNA 4M1GL 4JPIA 4P9HH 5C0RL 1J0YA 5H2BB 5LQBL 2ZCLL 1IC7L 4M7LL 5EU3A 1N5YL 2QSCH 1YY9D 5TH2A 1YDPA 1C5BL 4V1DD 1JWUA 1QFWM 4ODVL 4OV5A 1A7NH 1S9VA 1QSZA 1SQ2N 1MQKH 4KY1H 5KVFH 1XH3A 4FXKA 4OGYH 4Y4KA 4YJZL 4U1JB 3V95A 4LP5A 1C16A 3IXAA 1NDGB 1GGBH 1YA5A 5EZLB 4HMEA 1UXWA 5CBAA 1T2JA 3CSPA 3MRJA 1F4WH 1JNNL 4WENB 3U9UB 4KVCH 2FEEI 1FAIH 2BJMH 3C5JB 4Q7DA 4TSAL 2P8LA 3V0AC 2XWTA 3GSOB 4OIIL 1ZEAH 1TTUA 3VGBA 4UILL 3G5ZA 4F7MA 5B21A 3MLWL 4O00A 4XWOC 3V8CA 3U0WH 4CGTA 1U36A 4GUPA 1HIML 1R3IH 4ZTPH 1BQHG 2IEPA 3QWOB 1UJ3C 3GSVA 4QRPD 4A6YA 4H20L 4HUWA 43C9B 4YHIA 3MLXL 3BPCA 4X9IA 1VSCA 4PBWD 4S1DD 5IVXA 2F8VA 3IJYA 3MNZB 4OSUL 3I6LD 3C9NA 1LO5B 4XHJD 3Q0HA 4AMKL 1XGRB 2IGFL 2NY4C 5C0CD 5E8PA 1BX2A 5IVZB 3S37X 4PJXE 4YPJA 1ZV5A 2FNBA 3QDMD 4DW2L 4HLZG 2OK0H 5FYLE 2HVJA 3ZE0F 1U8KA 3D2UA 3OF6D 2YR3A 4O02L 1PYWA 5I1AA 2JELH 3LPGA 5IT2H 4B0MM 4HWBA 4ORGB 1WEJH 4KK6C 3FQUA 3P9LA 1QOKA 5EOTB 2D3VA 3BDYH 1V05A 4XNYL 3STBA 1INQA 5HHOD 1XAUA 2EC9T 1T2QL 2E9JA 3OKOB 3NCJH 1VGEH 4M62L 3N9GL 4RGMB 4X4YB 5I1IH 5ID1A 3R8QA 2BVPA 2IBZX 5IMOB 4WUUB 5EZIL 3DJ9A 2B7DT 3P4NB 3E2HC 2V2TA 3WXVL 3J7HA 2PO6A 1LP9B 3TBSB 2DIJA 5J11B 3SDCD 4U1NB 4GKOA 3OKMA 1BQSA 1UYWH 5TE7H 3MLYH 1HWHB 3PHSA 4G9DA 5EUOA 3UTSA 4X6EA 3QO1B 2D7PA 5HPMB 2EDBA 2ZG1A 4QGYA 3QHFH 1UEYA 5JDSA 4TNWF 2HFFB 4GAJH 1MHEB 2Z35A 1ORQA 4OCYL 3BXNA 3RUGE 5GZND 1JPGB 5D9SB 3RZCD 2FX9H 4EN3D 4WHTA 4MNQB 4R4ND 4K7PL 3LN4A 2WBJA 4LL9A 3RWEA 4P4RB 4CN6A 5F7DB 4B5EA 5DD3H 4APQB 2NZ9D 1DBBH 4OLXH 4XVJL 5B22A 4YQXH 2BY1A 3MJ7A 3T77B 3ZDXF 3RFZC 1ZK9A 3K2MC 1PZ5A 5A3IC 3RIAK 1F90H 3LH2L 5D2NA 1QQDB 5BJTA 3BMVA 2C7UA 3QDJE 3MLZL 5DLMH 3MV8E 4X7DC 1XGPB 2WQ8A 4X9BA 2N56A 5C0AB 3RU8L 4B50A 1JYVA 3ALPA 3I2CL 4JN1H 1A7RL 1GZPB 3WIHH 3LY6A 1ZA6A 1X5GA 4H1LG 4X8XA 3DTXA 2NY2D 4PGCB 4OUUB 4C56D 4CUCA 1IGYB 3EO1B 1CFVL 2GY5A 3LSOA 1QLFA 5D70L 3CNKA 1NCAH 4NYLB 4JFOA 4OGAC 3AM8A 5ESQB 1JF1B 4O2EB 4UAOB 2BNQE 2FATL 4BUHA 3C2AH 5DHYA 1YEFH 4DGVH 3QXDB 4PLOB 4LP4A 2YMXL 1M6OA 2YPVL 4IRSA 1NGYA 3CFBA 5I16A 5F1IB 1LVEA 4ZFOA 3E8UH 1FVDB 3KPSB 2X4SA 5EIIA 1NJ9B 1N7ML 5I8EB 5JW3H 4Z7WB 4QRTA 1H8NA 3QUZD 4KK5C 3HMWL 4DUWA 4GOSA 1LO4L 4NQCB 4XGZA 5GGTA 1FDLH 5E94A 3IFPB 1ZHKA 4EOWL 1N6VA 2FO4B 4XC1H 2VR5A 2IC2A 4XB7A 1OAZL 2I5YH 3L1OH 2UY6A 4G8FA 4JRYD 2R1WB 4CBPA 2B8OT 5MEOB 3JV4A 2BY0A 4IMLB 3W39A 1FO0L 3CDCA 2PF6A 4L8SB 1SVZA 5JLZB 2DQJL 5FGCE 1B3JA 4LLYB 2IANE 2YN5A 1W0WB 3PWLB 4JFFB 1F4XH 1ZVYA 4U1HB 4Z7VE 5GS1C 2LVEA 2CLZB 4LPUA 1RJCA 1CD0A 5EWIH 1KELH 4Y4FD 3TYGL 4XMKH 4KXZI 3IDNB 3QJHA 4UUJA 3HI5H 4OF8A 4I18A 2R2BB 4NCC2 2CLVA 2ESVB 4KWUA 2VXSL 5IBLC 1TJHL 1OGAE 1M7DA 3UBXI 2AVGA 1YEHL 3MUZ1 4PJIB 3RWHB 1HH9A 2AJZA 5C09D 5KSAD 4PYGA 1NFDA 4WEBL 3TNMB 3PWNB 4O9HL 1YEDA 5DO2C 1JGVL 1CLYL 1FIEA 2VDRH 4XXCA 2BNUB 5DT1L 2A0LD 2PYEE 3VXUE 5SWSA 1KOAA 2D4FA 4KROB 1IEHA 4E5XB 4GBXD 4Q6IA 1BLNB 1KSRA 2DWEB 5T1KD 3SE3C 2HFEA 1FGVL 4HIEA 4O2CB 5GRVL 4PJBA 3VMPA 1DL7H 5KVEL 4EJ1C 5FA3A 1FNAA 5I6XC 2Z93A 3DURB 4HBQA 1R5IA 2G60L 5I74B 3L3DB 4IS6B 5IUSA 2WLYA 4MXWL 5DRWB 5J6HB 5ENWA 4Z95H 4CU8A 2YZ1A 5ID0A 4U6HB 1TCMA 3CJJA 1CU4H 3QCVH 4LIQL 4F57H 4L5FH 4M61A 2A6DA 1XR9A 1K2DA 1AXSB 3HPLB 3P4MA 4WWKC 3TA3C 1MFAH 1GIGH 4JE4B 1MLBA 1NBYB 5EO1A 3WKML 4F7PB 4JQVC 1UB5B 3FB5B 1CL7L 4DVBA 1BMGA 3GJFB 2A73B 5GRUH 4WO4D 3O41B 4FQIH 2WINB 4GAYA 3VRJA 1DN0B 3AS1A 4NRZB 3KYOB 3L3KA 3TVMD 1NAMB 4MB4A 3QPQC 4NM8H 4CNIA 1WFUA 4UNTA 4NQEE 4IDLA 4QEGA 4Y4KC 3EHBD 1EAPA 1A1NB 2NXYC 1G7QA 5JDJA 3RJQB 2WQRA 3QIUB 1FZJA 3ZTNL 3DYMA 5EZOL 5FYLD 3ARGD 1IEBB 3BIKB 1H5BA 2I25N 3KJ4C 4PJ7E 2FJFB 2YD4A 4R96A 4P57B 4JZNB 2CGRH 4PJFA 5CSBA 4ELKA 2ARJA 3ARRA 5DI8A 3W9DB 3MRMB 3VGGA 3GHEL 1HOCA 5I19H 4YR6B 2I9TB 1OTUD 3TYFB 2F19L 4M6NL 3MV7E 1AKJB 4JO1H 1QRNE 2F53A 3R06A 4J12A 4YHNA 1NFKA 4QTIH 4H1LH 1PG7L 2PNDA 1B4RA 3EOBB 5CLTA 4U1KA 3P73A 4KK9D 4UOW1 4WTXA 1TTGA 2VAAA 1FE8L 3O6LH 4N9OB 2HRPH 5HD8C 4LDEB 4MJIB 4IOFD 2IPKB 3A67H 4H0IA 1A5FH 2A6JA 3FB7B 1WQVT 2DM4A 4HG4J 3QUXA 4W6YB 4MJ6B 2YS4A 3DWTA 3RKDD 2FCBA 5F88B 4LLVB 5J12B 4QY8A 2BOBA 2XXCB 1NL0L 3Q2CA 3MA9H 5ICZA 4E41D 1J18A 5I1JL 5FUOL 3Q48A 1MWAB 4L3CA 3OBAA 2BNRE 4LLDB 4L29A 4V1DA 1JFQL 2QQKL 1H15A 3BEWA 4FABH 1IGJB 1I9RH 3P0VL 3QPXL 3PL6B 4PJIF 3BD3A 2XRAH 2WMPA 3IJSB 1D9KD 3S35L 3TN0D 1CFNB 1TZGH 2XG5A 3K3QA 3MV8D 2HKFH 4PGEB 2D9CA 3VI4F 5ISZE 2IBZY 4OCLC 1LWRA 3WLWC 4ZFOL 1UT9A 5FKPA 4XAWH 4U1LA 3RWJA 1W72B 2GAZA 2G2RA 1TVDA 2VH5L 3QRGH 4Z7QF 3RI5F 4YUEL 4LARL 4HUUB 2PO6C 3IKKA 2OXHA 1AE6H 1VFBA 4P9HL 3KLDA 3ET9F 5GGTL 4LPYA 1J87A 2CLRB 2YC1B 2QSCL 3CXDH 3UC0H 2BSRB 2ZKHL 5CLWA 5FYJU 1FL5B 1F02I 1I8KB 3OKLB 2YRZA 4G9FE 4XTRC 2C5DC 2YEZA 3EFDH 3NIFF 5DMIL 4MVBD 3LOWA 1C08A 1MQKL 3UJTH 1FJ1B 4OGYL 4AEIH 1CG9B 4FQXD 5IR1A 1RMFH 3O3EA 4ZUTB 1T83C 1GGBL 2YOCA 2WBJC 4PUBH 2WM0A 3FT2A 1BQHA 1FIGH 4PLKD 1JYWA 3VFGH 3T08A 3O4LB 1WZLA 4DJMA 5DQDH 2G5BB 5ERWB 3KWWA 2RBLA 4JKKA 3HZMB 4KVCL 5L0QB 3FB8A 2ITCA 3RNKB 1FAIL 3PGDB 5AZ2H 4RZCA 1EXUB 4DN3H 2X44D 3DHJA 3UJJH 5C0CA 1HHKB 5D2NC 4NQVB 5HVGB 1MCDA 1ZEAL 2WWMC 3QDMA 1KIPB 1MCPL 3MRPB 4G8GB 3WNOA 3OF6A 4GKSA 3U0WL 1RIHH 3OKYA 3P4OB 1S7VB 4ZTPL 3WFHA 1FNSL 1FFNB 4LRIA 3QAZC 2BERA 1QPPA 3P11H 3UTTE 3CFKB 3VXSD 5HHOA 4YHPB 3AM8C 3OB0K 4KMTL 1D5XA 3HKFA 2JJTA 2DLHA 3BP5B 3OKNA 3HNTH 2WWKO 1JTPA 3BVNB 3BZFB 4IRSC 3SDCA 1FZOA 2OK0L 1OAKH 1OL0A 1MI5E 3FOLB 4P2QB 1YEIH 4CADB 2JELL 4PV8B 5IT2L 1CXEA 4IMKA 2HLAB 1IJ9A 1Q9OA 4YHYB 2Z8SA 2N7BA 4UB0H 1K5NB 4BQ8A 1T0NA 4FFWD 4P9HC 5D2LB 4EUPH 3C09C 4KMLB 3BDYL 4EN3A 1ETZB 1MPAL 2PYED 4L9LB 3B9KD 3ESVF 5KSBA 5I1IL 3NCJL 1VGEL 5L7XH 3IFOA 1IGFH 3MUGA 4P23B 1QVOB 4NOFA 5HDQH 2E7HA 1IARB 1ZHBB 2DKSA 1KPVA 3PDDA 4JN2A 5T33L 1FFOB 5F6IC 1UYWL 5TE7L 3MLYL 1Q0YH 4NO0B 4JFQB 3INUH 5F70A 2Q76A 2Q6WA 3O8XB 3VRLF 1UJTA 4JAMA 5ICXA 3NIGE 1MHPH 4U33A 2YD2A 1T04A 1OARH 4GRWF 3WD5H 3MBEB 4C56A 4I18C 4XC3H 4H1LA 1JZ7A 1Y0LB 1J1OH 1DP0A 5DD3L 2X4TB 2AQ2A 1DBBL 4BH8B 4OLXL 4AIZB 2VLJE 3F7PC 3MGOB 4YQXL 4EKXA 12E8L 4ZS7L 1NC4B 3DLQR 5FO7B 1A1OA 5E0QA 4R7DA 2MPAL 3K46A 1H9VA 4XXCC 5D5MA 3CPLB 5IEKA 1X5ZA 3CVIL 1JZ4A 4ODXA 1RUQL 3MODH 4N5EC 1S7WB 2AJXH 4WW1A 4MD0A 3WIHL 4Q6IC 3D69B 1HINH 5HHPB 3PGFH 3UBXB 3QUZA 2CH8A 4IDJH 5HYFA 2D03H 4JO2L 2OI9B 5BQ7A 4UINH 4DOHB 1NCAL 5IP4A 4PJ8D 2FZ3B 1S7UA 3DUUA 5E9DE 1E4JA 5FO8B 4KK8C 1DQDH 2UWEA 5J1AB 4JRYA 1FVEA 3AAZB 3IDJB 1ITBB 3HR5A 3NA9H 3HG1B 1KCRH 3QXAB 3C2AL 1YEFL 4DGVL 5F7HA 4OM1H 3MRFA 4K3DH 1FFQA 5EPMB 3L5IA 1MLCA 1RVFL 4RNRB 1U8PA 5KAQF 3D0LA 1RHFA 3QIBB 3E8UL 3MLSL 4KRPD 6CGTA 4JREC 1ERNA 3GBMH 3C6LD 5C3TA 1RZGB 5JW3L 4GG6E 4HUNB 5IMKA 2EC9U 3KGRA 2BSTA 4Y4FA 4O5LH 4QHNB 4M00A 5IFHH 3G6JF 5GS2D 5D72H 4NWTH 5GGRY 8FABA 1JZ3A 3SDXF 2EDYA 5T3ZE 2I5YL 3L1OL 3MUHL 5E2VH 5DD6A 3TJHD 1OQOA 3TM6A 4YO0A 2EDHA 5KSAA 3ARDB 5EC2A 5I17A 2XNAB 5HYQB 2E3VA 3D39A 3T3PF 1U2HA 2AJ3A 3D3VE 3RRQA 4PJEB 1U3JA 1AHWB 2BNRD 3NAAL 5H35B 4NN7C 5DJAB 5I0ZA 4F2MA 1H5BC 2NW3A 4GBXA 5F89B 2QTEA 3TWCH 3L5XH 3CX5K 5DD1H 5C08D 5T1KA 3T0DA 3OQ3B 5B3NA 1KELL 3O81A 4Y89A 4XMKL 4L8DB 1KTLA 4OM0H 4QHKI 1R3LB 3RX8A 5C9JB 5ISZD 3PDOA 3RAJL 5A2IH 1CK0L 3X14B 1ZVSB 3D5OF 4NQXA 4OB5H 5F8QC 1IMHC 2CDEB 1IM9B 5HHME 2JKXA 4YK4C 4ODBD 1RUAL 1BZ9B 1P9MA 2VDRL 4KZDH 4Y2DB 1RUMH 3O45B 4UT6L 5T5NG 1YMME 5IB3A 1X5LA 5IJVB 5DMKB 3OB0H 2YPLB 3KXFB 2DI7A 3O11B 4G9FD 5B8CC 2YD6A 5CKAA 4L3ED 5F71A 3QUXC 4KI5F 1OTSC 2X4QB 4JHBA 2DL2A 3UYRH 4NZUH 1S7SB 2GJJA 1YEGH 3C8KB 3U4EA 2X4NB 3SN6N 1DL7L 3TBTA 3VFPA 5CEXA 3LEXB 4XBPA 5HGHA 4LQFH 1MJ8H 4MA3A 2ICWJ 3FQRA 3T0BA 4Z18A 1YY9C 2EDRA 2XN9D 3F12B 3REWA 3TVMA 3UJIH 1HHIB 3SKJH 4F3FA 3RNQB 4Z95L 4QRUB 4WU7A 1JYXA 1BFOA 1CU4L 3QCVL 1CS6A 1HZHH 4FQPA 4F57L 4KC3B 5HYJD 3ARGA 4K8RH 3S98A 4M02A 5ALCL 5HJ3A 4PG2C 5IVXF 1GIGL 1NMBH 5BCAA 2YBRB 5E4EB 3GI9H 2EIZB 4GT7A 5FYKE 4FQIL 1ORSA 3AXLB 3RP1A 1GOGA 1ZA3A 4NM8L 4D2NA 3CDGA 5IKCA 2Q8AH 3ULSA 5I1HH 2DJ4A 4MZ2A 3H7BB 4PGDA 2W60A 3JVGA 4C54A 1JPSL 5FYJH 3CVHH 3ZDZE 4YHZH 1EEZA 2MHAB 3MFFA 1ZLWK 1MRDH 4NUJB 4HUVB 3VD9A 4JANB 4OKVA 2EYRA 1QO3B 2GSGA 3VWKB 2Z31A 5DK2A 1A2YA 4PJHE 4FFZL 2BXZA 2P8MB 4NNPL 3V6ZA 4S1DC 1P7KA 5ESAB 4DWHA 2CGRL 5E95B 2HT4D 3DUSA 1TXKA 2Q8BH 3RUGA 4XHJC 3ZKXB 3QDGB 5I19L 5D6DA 1G7JA 3U0TB 5E1HB 4TVSa 4Y5VB 3U30B 2J5LC 4E41A 4JO1L 3QEHA 5DHXB 1VEOA 4DZBB 5I15H 2VZ3A 3I02A 4QTIL 5DQ9B 5KZCB 4JRXE 5JORB 3T2NH 2HG5A 2FBOJ 3G6AB 5K59E 4QRRE 3FQXA 3O0RH 1WBXA 1NH6A 1S9WB 1QZ1A 1SJVA 2A1WH 5F1NA 4POZD 4L4VB 1FPTH 3F8UB 4FS0A 3D85B 1FYTB 1HHHA 4LRIC 5C6PB 3X3GH 3O6LL 1D9KA 3TN0A 2VTFA 1DEEA 2HRPL 2VN4A 2W9EH 4IRJB 5GPRA 1WCQA 3DRTA 1XF3B 5FFLA 3MV8A 1A5FL 5GGUA 1J11A 4ODSH 4P9MH 1Z9SA 1ZT7A 1G1YA 4P5MB 3GGWA 5D7JA 2VERN 2JJTC 1FL6A 4XWGH 4F9LA 4X7TA 1JMXA 3AU1B 3CSBA 3QFJB 1CD1A 1QR1A 1D5IH 3MA9L 3VRIB 4M8QA 4J1UA 4HJJH 2AXJA 3SDCC 5IK3A 1HXYB 3QUMH 1YYLH 2OMNA 1FBIH 4D8PA 5DS8A 1LO3H 1ZGLM 3MXWH 2MKLC 3DX6A 3ESUF 3D25A 2H3NA 2VLJD 5B39B 1LE5A 2PXYB 1RZIA 3P3YA 3OTTA 4X6CB 1LEIA 3PXJA 4FQXA 1BGXH 2XRAL 5GZNC 1M05A 1EFXD 4EN3C 1TZGL 4N0YH 5J1TC 5HI5D 4PGJA 4R4NC 2HKFL 1F2QA 3FB6B 4HIHA 5KSVA 4XAWL 3T0EE 1J0ZA 2NZ9C 3ARQA 5L6YH 4KGLA 1J0KA 5TGBB 2YWYA 5C2UB 3PHQA 3S36H 3S6CA 1AE6L 1HILA 1I7UA 2WP3T 4M6OL 4PRIB 4LVOB 2X42A 1CICD 4YHLH 3CXDL 3UC0L 1J10A 3TO2B 1E4XI 2XOTA 3ARBD 4ZXBD 3LB6D 3QCUH 3SPVA 1YQVH 4X99A 4YBLB 3H3BC 5CJBA 5FAAA 2BVOA 4BZYA 2NY2C 3DX9A 2CPCA 2YPKB 3QRFM 3FO0H 4PUBL 3VXSA 1TVBA 1FIGL 1VFAB 3BKJH 1JGEA 3VFGL 4Z7VA 4GW4A 5CFHA 1PY4A 3NN8A 4WV1A 3QXTA 5GSVB 5I8OH 4DN3L 5AZ2L 3MRCB 3BJ91 2FYYA 5GRXG 3ZE2E 3K1DA 3UJJL 1LEGB 4RQQA 4KJWD 5DSCB 2XWBB 1C5CL 1BD2E 4RFEB 1FLTX 5T3ZD 2AK4B 4K9EH 5FM8A 1JJUA 3F65A 4CJ0A 1OGAA 1QLRA 3G08A 1P5UA 3IXTA 3DGGA 1RIHL 2W65B 3B4NA 2ATPB 2VSCA 2OL3A 1U95A 2HKHH 3QUZC 2FJGB 5CJOH 3D3VD 3DVGA 3UEZA 3P11L 4G8EB 5EUKA 3LEVH 2PYEA 3HB3D 3B9KA 4WTWA 2BVTA 5FDWB 4FN0A 1CDCA 2XTJE 1DLHB 3EYVB 2I60H 3HNTL 3VXRE 4NZJA 1QKZH 1WAAF 15C8H 1HH6B 3D6GA 4P2RE 3C5ZB 3V6BR 1S9KC 1HDMB 3KYAA 1DQQA 2BX5A 1E6OH 4OCXL 4W70A 4JM2B 4NJ9H 1KCSH 1XF4B 5I2IA 5F6HJ 5EU5A 1VFMA 1XIWB 2DS4A 2X1XR 1F5WA 4GW5A 5J1SC 1YEIL 3MLVH 4YZFF 4TVPD 3RWDB 3SCMD 3X17A 3LQAH 5HHMD 1DANU 4UB0L 1H3PL 1F42A 2D31B 1RURH 4CMMB 1CXIA 4Y4FC 2XZCH 1VEPA 1T1XB 4HXAH 3BPLC 1FNFA 5T1MA 1PLGH 5JPMB 2WIIB 1NEZG 1YMMD 2X05A 2R2HA 3KXFE 4OF7A 3SKOA 3I6KA 5FYLL 1JHTB 3IS0X 1IGFL 1SJEB 4NN5B 4ONGH 4WNQB 4BH7A 4ONFH 1YUHB 3CVHA 4M93B 1P5VA 1KEMH 5KSAC 3MRNB 1JHLL 4G5ZH 3SKMA 3VFMB 2A83A 3GHBH 1EHXA 4WY7H 2XY2A 1Q0YL 1NQBA 4IOSD 1GGYA 2A0LC 2NTFB 3GSRB 1U9KA 3DHMA 1S7QA 1KT2A 5J89A 1HSBB 4GBXC 1NUDA 5CBEB 2NY1D 4NQEA 3IS1X 3IU3B 3LD8B 4L4TB 2GTWA 1I7TB 4N5UA 5E24E 1UXSA 1MHPL 3L5WB 4QT5A 3FT3A 1OARL 3BP4B 3V0WH 1DBJH 4BK5A 4XC3L 2CKBH 4PJ8A 1J1OL 3DECA 5I8CB 1R5VB 2DWDB 3FCTB 2DQFB 3S96B 4OZFG 3E6HA 1AGEA 5F9JB 2BVQB 2KL6A 3OGCB 1OP9A 5I18H 4UZGA 4AM0A 3BZ4B 4KJQD 5DYOB 2VISB 4NHUA 3QDHA 1X44A 4NPYA 2XA8H 4HG4K 3MV7A 3HUJF 1S7RA 4LVHB 1L6XA 2G75A 4M7ZB 4KQ3H 2Y72A 5GISH 3C6LA 2AJXL 2AGJH 4NKOA 2VB5A 2E6JA 1DUZA 1F4YH 1OD7A 1HINL 4QNPE 1X6LA 2L0DA 3PGFL 4EI5B 1UVQB 4LNVA 4IDJL 3V5KA 1WTGT 2DQTL 3AFLA 2NLJB 1J0HA 3X13B 4PREA 2Y6SD 4ZO6A 4WO4C 3FQTB 4LCYA 1SYSB 4N0UB 1MAJA 4JKLA 3TVMC 1DQDL 4XNXH 4JFDB 3UZQA 5E03A 3BAEH 4JY4A 1CFTA 1EHLH 1KPRA 1H0DB 2C1PA 1IQDA 2FJHB 3L3JA 3QZWG 3O6FB 4DEPC 1UACL 3BEVB 2FX7H 3EHBC 2EXYD 4OM1L 4K3DL 3OR6B 4N8PA 2EECA 1MCBA 1A6PA 3FQNA 3HPJA 4AG4H 4RGNE 3KYKH 4F15C 3GBML 2BNRA 1UKSA 3ARGC 4HEME 2P5EE 1R3JB 4JRXD 1G6RB 3MXVH 4JR9H 4QRRD 5E2WH 5F9WB 1BFVH 1GHFH 3F6IA 1JGDB 5MERB 2YK1L 2IALA 5IFHL 4XNMA 3WHE1 1QYGH 3HI1B 3I9GH 1FSKB 1OTUC 1T7ZA 3I3BA 4QWWD 3ETBF 3FTGA 4PP2A 3QO0A 4AL8H 5ISZA 5C0IA 4ZPTA 1VKXA 4H26B 1SMAA 5LWYL 3V7AE 3SGEH 2BK8A 2QV2A 2H2SD 4PRAA 4BKLA 3N85L 3JVGC 2IADB 5IV2A 3FONA 2XFXB 2NY5L 2UY7A 1DBMH 1NDMA 4KK9C 4WFGE 1A3QA 1FFPA 4EXPX 5BXFB 3DRQA 3F7VA 2PTTA 4IOFC 1O7SA 4Q2ZA 4LAQH 2VLKB 3EKCA 4G9FA 3GRWH 4MCZA 3HA0A 3T3MF 4UT7L 3WHXA 1I8LA 3L5XL 5DD1L 3RKDC 1DVFD 5I1GH 3UPRB 5K9QI 4I77H 5D6DC 1IEAB 3T8XB 1G7LA 4OM0L 3MOQA 3WIIH 4MNGA 3FRPG 3NABH 5MENE 2BMKB 4EDWL 5BRZB 5IMMA 1W0VB 2XN9A 4OB5L 5KANI 4PTTB 3UTZA 3U82B 5DJDB 3ZE0E 2RHEA 2VLMD 1PKQE 1LMKA 4DKFH 3TIEB 3DSNA 2NW2B 4GG8B 1D9KC 4UV4H 5IQ9A 3TN0C 2ADJA 1RUML 3BPNC 2AJSH 5DEFA 1KG0B 3CD4A 1PG7X 2R4RH 5HYJA 1Q94B 4OD3H 1C5DA 2VWEE 1YEKL 4F7TB 1UM4H 1VDGA 4F9LC 1BIHA 4TUJB 3UYRL 4GQPH 4NZUL 2VUOA 1RU9L 3DVFA 4TVPH 3ULVH 1KB9J 1YEGL 3DV4B 3O6KL 4HCRA 2OL3L 4N9GB 3QG6A 2H32B 3DIFB 1WBZA 3PWPD 5DJ0B 3T65A 1HYRC 1WBYB 1MJ8L 1NCWH 2GSIA 4GKNA 2CRZA 1IGMH 4UOW0 3UJIL 1NMAL 3SKJL 3RGVA 3PGCB 2UV3A 3PIQB 4MVBC 5INDA 2Y07H 4Q97A 3KPRB 4MDJB 5C0BD 1KIQB 4JFEB 3GSNB 1MCIA 4FQXC 2APXA 1UKQA 2PYFB 5FM4A 4IBLT 1GOHA 5DJYA 3STZA 1CR9H 4P3DA 1TDQA 4RDQG 5KN5B 1IQWL 1BD2D 2XWJB 1X4XA 3EOYG 2Q7YA 2FR4A 2Z8RA 1A1MB 2LV4A 1A6TA 5I1LB 4PLKC 1RIVH 3QQ4A 5F3BA 1NMBL 5D1XD 2RQ8A 5FB8B 4IOIA 2NY5C 4LEOA 3S35X 3GI9L 4PRNB 4U1SA 1P6AB 3B5HA 1MF2H 2X4OB 3GDBA 4GAFB 2B4CH 3ZDXE 3HRPA 5KS9F 3L3HA 5EO0A 2ED8A 4K23L 4BSWA 2H45A 4JKPH 1BIIA 1HQRB 3Q5OA 2DM3A 4PP1C 2B0SH 2ZOKB 1UJ3B 5GS0D 5I1HL 5F7KC 3CZFA 4P2RD 1CL7I 4Z7UB 2FH6A 5ICYB 3CVHL 1NC2B 4YHZL 2CKBA 4WGVB 5DHVH 1MRDL 2ICEB 3ZKND 2F74B 4XH2B 1AJ7H 3KG5A 1I9JH 1UZ8A 4QRQB 2NY4B 1DQJB 4ELMB 5DJZA 3VFSB 1FL3B 4HMCA 2VZSA 2GTZB 5A2KH 4WV1C 4K7PY 4JB9H 4UU9B 4LKCB 2Y9RT 1LDSA 2ATKB 3O3BA 5JW4M 5CEYA 3PDGA 5I15L 4NQDE 2IFFH 3QUKB 2VLJA 3RIAF 4LNRB 1XR8B 4U0RC 4LLQB 1MH5A 1NEUA 3QA3A 1FPTL 4MD4B 1DE4A 2IG2H 4FFWC 1TNMA 4UIMB 3QEGL 2NXZB 3QH3B 3N1MC 3MREB 4GMSH 4U6XA 3CGTA 3B9KC 1AY1H 4ODSL 1BBJB 3CX2A 5HVHC 3ULUH 1AO7E 1G9MH 1LE9A 3SE4C 4Y1AB 1JCKA 4JFHD 4XWGL 3TZVD 4J3XA 4R3SB 1D5IL 3WS6C 4HHAB 5EOCL 3G9VA 2YHGA 1U8LB 4HJJL 1CICA 4MNHB 4XXDB 4HUKB 1FBIL 1LO3L 4DCQB 1ZGLB 3MXWL 2ENSA 5EZJB 2CK0H 4HKBA 3WXWL 4KUCF 1JPFA 1J8HD 3G5XB 3ARBA 4OCWH 4ZXBA 1PD6A 5BVPH 1GJIA 4TNVK 5JHLH 1RK0B 3O2DH 5H94A 4HGKC 3MROB 3CFEA 4U7MA 2BY2A 4HKJB 4N0YL 4WFFE 2DQUH 1JTTA 3PUCA 1JF6A 3MCLL 2ADIA 2B5IC 4I8DA 4E42A 2XZAH 5L6YL 1S8DB 1KJ3H 2DMBA 5D6CB 5D7IF 3S36L 2ERJC 1XZ0B 3RWGB 5EORL 4RBPK 5IVNA 5KTEH 5KSUB 1TZHB 3H3KA 3N1FC 4CKVX 3CSGA 1XFPA 4YC2B 2ZG3A 4BZ2L 1YMHB 2XQBH 3QCUL 1YQVL 4L8BB 1AI1H 3UTPD 4ZDHB 5BOPA 4MQ7B 1QD0A 5IEHA 3MRHA 3ARFD 1UCBL 3D3VA 4PJ8C 1X7QA 3JWDH 4Z8FH 4HEPG 5TQ2H 5I8OL 3LS5H 4HH8A 5D8JH 1WCBB 3V7AG 4CVZA 5CWSA 3QSKB 2C26A 3LKNA 4AEEA 4UIKH 32C2B 2YD1A 5JIPA 2LU4A 4K9EL 4KRPC 5TPWH 3TC9A 3D18B 3C6LC 5I9QC 3OXSA 4X98B 3SCMA 1INDH 4I9WE 3SDDD 3FN0L 2FX8H 5CJOL 2W38A 3JTTA 3MRGB 4OGXH 4WFGD 5IHZA 2ZOLB 3MLPA 1YEJH 3T2PA 5EU7E 3LEVL 3OR7A 3ZKMD 3M1BA 1YMMA 5C86A 1RHHB 3SJVD 1MY7A 3IAPA 5EA0H 2DQCH 3TJHC 3K8KA 2I60L 5DDHA 2Y06H 1NEZA 5HDBF 5ITBL 15C8L 2VC2H 5BV7H 4PJDB 3TT1H 1E6OL 5IIEA 4MSWB 4LRNH 2VDLL 4MHHI 4NJ9L 1P4IH 1LK3H 2CIKA 3FKUS 4LLUB 1MFNA 1FNEB 3FT4B 4IHOB 4NC2B 4ZFGH 4WU5B 4Y5XA 3BH9B 3MLVL 2XZZA 2EKSA 4J7RA 2MNUA 3LQAL 4KTEH 4WHYG 1KLUA 3MACH 1VCAA 4H5SA 2XZCL 4HXAL 5IM7A 3VDCA 2M26A 4YDJA 5DGRA 1I1CA 1PLGL 1QSFE 1CTNA 1Q9KA 3VGEA 4CVXB 5L9DH 3GNMH 4ONGL 1TITA 3MRLB 5C2BH 2F54B 1U8IB 4ONFL 2FL5A 1KEML 1AGCA 4G5ZL 3X3FH 2CMRL 3DO3A 5F44A 2PW2B 4OZFA 5TDPA 3GHBL 4WY7L 2RFXB 3TESA 3IDIB 4YEFA 1X4YA 1EPFA 4I13B 4TNWK 3LN5A 1IAKA 1A02N 3L9RA 3B8YA 3MRIA 2NY0D 3LRHA 1WZMA 4BELD 3P77B 4XPFH 5CD5D 2ARJQ 4JY6B 1I8LC 1JNHB 3SGDH 3WFZA 5I6XB 3MQIA 5C07E 1U8MB 4LSUH 2AXGA 1ZS8B 2O26U 2A9MH 1EJOH 5ANME 3T4YB 5A16B 3V0WL 2GW5A 5J3HD 1KNOB 1DBJL 1FN4A 1PDKA 2CKBL 4OZIB 2FGWH 2JCCB 2CRYA 5MEQB 4Z0XA 1ZHNA 3MNVA 1RZJH 4PJHA 1T5WA 4H8WC 5B38G 2J6EH 4LCWB 5HYSG 5I18L 1NGZB 1SEBA 1I8MA 3DXAB 5IBUG 1I85A 1I75A 4WHCA 4WWKB 3TA3B 5E4IA 4NQSA 3ZTJH 1EO8H 4M1DH 4XPBH 3BYYA 4FFVD 2R1YA 5EIVA 3CIQA 1IGTA 1D5BA 3QZWA 1FO0B 3MMEA 3UCRA 4ZAKD 3CFDB 2OZ4A 1ZHLA 4D0CA 5K9JH 4M1CD 2R23A 4JPIB 4JRXA 3VI3E 3KPMA 2P47B 5FO9B 4QRRA 2DF3A 5EU3B 3VI4E 4U6TA 5TH2B 2X4UA 1YNKL 2GJZA 1YDPB 2GYSA 2NCMA 4OV5B 3HZKB 1KIUA 1CDHA 3W81A 3GMNA 1KJVA 2QQNH 4Z7QE 1XH3B 4FXKB 1O0VA 2NXYB 3L3OA 4AJ0A 4WUKH 4XNXL 5E1AB 3LQAC 1C16B 3BAEL 2E7LA 3IDXH 3RGVC 1A4JB 3GMOA 4JHWH 2R2EA 3IJHA 4PJ5E 35C8H 1UXWB 1S9YA 4G42A 3NIFE 5CEZH 3KJ4B 1IGIH 3MRJB 2CO7B 4AG4L 3KYKL 4KVNH 4GLRI 2P8LB 1TQCC 2FDBP 2I24N 1B6UA 4NQDD 1KBGH 3MXVL 4JR9L 2AEWA 3TBVA 2XWTB 1MIMH 3QIWD 1BFVL 1GHFL 2BHZA 3ALXA 3O3DA 5JPNA 2HT4C 5I71C 1X5KA 3G5ZB 4F7MB 1T7XA 2VSDA 3I9GL 5AG9A 4MCYA 2RJMA 4OFIA 4AL8L 1AO7D 3T0EA 4FNLH 3NGBC 3SKNA 3GSVB 1YECH 4A6YB 3FRPA 3CK0H 2V7NA 5HYEA 4HUWB 4YHIB 4JCMA 4HFUL 3MV9B 1A9BB 3BPCB 4POZC 5C0DA 3HR6A 1DJSA 3IJYB 3VW3L 1MCHA 3C9NB 2X9XA 4Y19E 4LAQL 1NGQH 5CZKA 5E8PB 3GRWL 4X4ZA 1N8ZB 2E9IA 2VL5A 1P7QD 1QBMH 1NGWA 4M7JH 5CUSH 2VDQH 1IZJA 2HVJB 5I1GL 1BF8A 3MUJA 1U8KB 3D2UB 4I77L 2HT3D 5I1AB 1PYWB 3MR9A 1X5HA 4QRSB 4FQQA 3ABZA 1G9NH 4PRBA 5F7NC 4WFFD 3UTQA 3WIIL 3OKDA 3AMLA 2DOCA 4ZFFA 3MJ6A 1LO2L 1SBBA 3FQUB 3BWAA 2CIIA 3AC0A 1JYNA 4D94A 1GRWA 4Z0BH 3K4DA 3WIFB 1WIPA 1INQB 4KU1A 5C0BA 1DBAH 4U4BA 3S97C 4R2GD 2BVPB 1IAMA 1UQSA 2R0ZL 4NO2B 4YHKH 2V5MA 2AJSL 4UI2A 1BD2A 4WUUD 2OXGA 5HI5C 3WYRA 2R29H 2R4RL 2V2TB 4OZGB 2PO6B 3OAUH 1A3RH 4WEUD 1UM4L 4NP4H 3LIZL 3MJ9H 2ICES 3OKMB 5D1XA 3AS0A 5EUOB 2R69H 2Z8VC 4TVPL 3UTSB 4LEXL 4X4XA 3ULVL 4I0KA 4QXGH 4X6EB 2XYCA 1WWBX 1KN4L 4HC1A 5SV3A 4FZEH 1CICC 4ZOAA 2Z35B 1ORQB 1XGTB 4U2ZA 1NCWL 3QNYA 5IW1B 3BXNB 4C57C 1IGML 4MMXC 1NCBH 3C8DA 3F6LA 3ARBC 4ZXBC 4YDLB 5IB4A 4WHTB 5EOQH 4JVUA 3ZHDA 3LN4B 2WBJB 3RWEB 3LB6C 2KQMA 4P2RA 2AW2A 3FMGH 1UKTA 3IFNH 3S4SG 1DZBA 3VRLE 3O4OC 2YSSA 1CDGA 3MJ7B 1BJ1J 1FRGH 3R0NA 4I3RH 2P24A 4ZPVB 5D96C 1J86A 4NNYA 1D3CA 4GRWE 1RIVL 2A9NL 3LMJH 3H3PH 3RWFA 4I9WD 2CDGA 2C7UB 4PJGF 4PY7A 4YFEA 4O2FA 3WCYA 1BZ7A 1A7OH 1MF2L 5GRWA 3NCBB 2X9WA 1U3ZA 2B4CL 2M2DA 3W11D 2DTML 4OD1H 1ZA6B 4DKEH 3DTXB 4AQOA 1U8JA 3QAZB 4JKPL 5EBGA 2B0SL 3LZFH 1HQ4A 3LSOB 1DTUA 1QLFB 1MHHA 5EBWA 2PCPA 2K7PA 1CFBA 4ODTL 4JFOB 3RX7A 4HK3J 4CRPA 4AEFA 2IPUK 1F6FB 4P2CG 5JHDE 2IPUG 1I9JL 3HB3C 4RMTA 1JRHH 1M6OB 4QCIA 1NGYB 4NDMA 2CD0A 4ZFOB 4P2OD 2X4SB 4JB9L 3KPSD 4OQTH 5EIIB 5C6WH 1N0XL 1DUYA 4C4KO 2F58H 1YNLH 5GRZA 4QRTB 5AWNL 1RJYA 1QUNA 4KKNA 3DARA 5E94B 4NQCD 3C09B 2IFFL 4G43A 4JZOA 1J8HA 3SCMC 1YN7B 2C3HA 3U2SA 2BHUA 2IMNA 3GJEA 3UP1A 4G8FB 1SJXA 2C3WA 5JTWA 4EEEA 1R6VA 3JV4B 1FFRA 4GMSL 3JBG7 1VHPA 4ZNCD 1AY1L 3U6RB 3ULUL 1VGKA 3G6JE 4HJGB 4DN4H 2OZ4L 5CGMA 3BT2H 1TPXC 2EH7L 1AC0A 1N59A 3SDXE 2EIEA 5GHWH 3MGAA 5C07D 2WANA 4YDIH 3LKPB 3CC5B 3ECBB 5F7FA 1RJZB 3CLFH 3T3PE 1ADQH 3KPPB 5T1LB 3QJHB 4Y5XC 4YPGA 4XCEA 3MRRB 1FVCA 2IH3A 4Z6AT 4OCWL 5BVPL 2CUMA 3TPUB 2UZXB 3DYPA 2NY1C 3W2DH 5JHLL 4JFZH 4DGYH 4ZQKA 1M7DB 2B4CC 4RMVA 2DKUA 1VESA 1HH9B 2AJZB 3ARFA 1QEWA 2CR3A 1NFDB 2VDOH 1YC8A 2P5EA 2IQ9H 5SWQA 2XZAL 3RI5K 1JHKH 4LSQH 4QHUA 1CDYA 5DD5H 1KJ3L 5F7WC 2G9HA 3BUYA 3JUYA 5SWSB 1RJLA 2DQGL 4KJQC 4KROD 4YNYA 1T0PB 2ZUUA 4Q6IB 4X6BA 4L3AA 2X89D 4HIEB 2R1XA 5EO9A 5EU6E 1BOYA 4DGIH 2W9DL 3SDDA 3O6MH 3Q3GA 4F33A 2XQBL 3JWNC 2Z93B 4I4WA 4NFBA 4KI5E 1AIFA 3PWUA 3EYOB 4P3CH 5ENWB 1D5ZA 2YRLA 3U7YH 5DK0A 4X8JB 1JGUH 4G6FD 3SJVA 1CT8A 5ID0B 4K7FA 3JWDL 4Z8FL 3AY4C 1F11A 4HKZA 2ICWA 3L5HA 4BM7A 4JREB 2A6DB 3LS5L 1XR9B 4M61B 1T1WB 1K2DB 3P4MB 3GJFK 1LEKA 1I85C 2VYRE 4HIIA 4MGXA 1D6VH 2YA2A 4XNUL 5EO1B 3BRDA 1FH5L 4HWNA 5TPWL 4ZSOE 1AGDA 4DVBB 4PGBB 4TPRH 5LJYH 2UZIH 2J88H 1MFEH 3TNNA 5SX4H 1NBZA 2CUHA 4GAYB 2R39A 5TDOA 2C1OB 1RV6X 2FWOA 2FX8L 3EW3B 3L3KB 1PKQA 5LGJA 4OGXL 5IVXE 4CNIB 1CDJA 4KHTH 1KULA 2XY1A 4QWWC 1YEJL 1EAPB 1CVSC 3RTQD 1OP3K 4BFBD 2DD8H 2X7LA 1PY9A 3EO9L 5EA0L 5D7SH 3QIUD 5TF1H 2Y06L 5AUMB 2CXKA 2H2SC 4TUKH 3B6SA 2WUBH 4EZMA 5I1CL 4QOKE 3RVVD 3TT1L 4RMWA 4Y0GA 1H5BB 2R4SH 2XT1B 4KHXH 4LRNL 4Z76B 4JRWA 1P4IL 1J1PH 3GMMA 3AGVA 4PJFB 1P4LA 1NCUA 1MCEA 4WI9A 2ARJB 4ELKB 5DI8B 3ZKSD 1CWVA 3VFWA 4JJ5A 4ZFGL 3I6GA 5E2UH 5JOFA 5FYKU 3MBXH 4OIBA 3MACL 4QXUH 1AKJD 3R06B 1WZKA 1KB5A 2QJDA 3SOBL 3ZSSA 1G0XA 2VJXA 5D1QB 3KR3H 4YDKH 4WI6A 1UC6A 3P30H 3OG4B 2LTQC 5L9DL 5CJ8A 4YK4B 3GNML 4U1KB 3OWEA 4X6DB 5HTSA 2VAAB 3TIDA 1ONQA 5C2BL 3KHQA 4LKXA 2PUQT 1B4JL 1KXQE 4QHKJ 1I1AB 3HC4H 3S3JA 2A6JB 3X3FL 1I1YA 4RIRA 1U0QA 1B2WH 3TT3H 3ZZ1A 3E3QE 3QUXB 3IETA 1OTTD 5B38A 5HYSA 2ZSVA 4LCUA 3H42H 4ZAKA 3JWDC 4QY8B 4PB0L 4CMHC 2WV3A 3V5HB 3ZO0A 4XPFL 2VDPH 4OQTA 4L3CB 1CGUA 4XPGL 4U0QB 3D0VB 4L29B 3E6FB 4V1DB 2A9ML 1EJOL 4M9PA 3RL2A 3EOTH 3MJ8A 4GH7B 4JGJA 3QQ9D 2EZ0D 2FGWL 3MRDA 3BEWB 1F8TH 1CGYA 5D2NE 5JMRA 1RZJL 5CAYB 2J6EL 2NR6D 3BKMH 4MZ3A 3TV3H 4R97C 5EZLA 3OKKB 4U1LB 5FKPB 1EO8L 4M1DL 2G2RB 2DM7A 1JZ2A 4RGOL 1A47A 2UZYB 1J0IA 3RGHA 3UROR 3V9FA 3EJZD 5HVWA 1VFBB 3WN5A 3C5JA 5E6YA 3FZUD 4NQDA 4D9RE 5D7KE 3OZ9H 3QIWA 5D1XC 2DI8A 5C0FA 2YEZB 2XKNA 1C08B 2QQNL 5ADOH 3Q6FA 4G6KH 5JIHA 1OP5K 2FHCA 4S1SL 1QLEH 5HY9A 5IR1B 1DSFL 1AO7A 4WUKL 5AD0A 2VE6A 2BC4A 4PJAB 1Q9WA 4L8CA 3IDXL 2XTJC 3O3EB 4JHWL 4EI6A 5EH1A 4NKDA 5GS0C 3QWOA 35C8L 5HPOA 1BQHB 5CEZL 4FQHA 2DJSA 1IGIL 5KAQG 4OFYA 4X5WA 3ZKNC 3KWWB 4RX4D 5HHNA 3FB8B 2ITCB 4MJ2A 1S3KL 4RZCB 1LO5A 4BFGA 1X6NA 1KBGL 5C0CB 1XGRA 3MOAH 3EJJX 1P7QA 5IVZA 1QBLH 1A7BA 5I73C 3TO4A 1XGUB 4GKSB 3DV6A 1UWEL 2V2WA 4HUMB 5DJ2A 5E2JA 3VWJD 1C12A 1ACYH 4ZUVA 1AR1D 1DR9A 4ORGA 4UTAH 2HLFD 3WFHB 4FNLL 2P45B 2W9LA 1YECL 4HDIA 5EOTA 1MCJA 2JTDA 3BI9X 1MVFA 1ZSDB 5JUEH 3LVEA 4YE4H 4MAYA 4WI5A 5IMOA 1Z6JT 4UDUA 5BS0E 1NGQL 3U1SL 3QUYB 2PR4H 3SDCB 1MEXH 3U36A 1QBML 3EYUH 4U05A 2F8OA 5CUSL 2VDQL 1ZKAA 2WWKT 3TZVC 5K9OA 5DTFB 3GJFH 5L8LB 1CE6A 4WDIA 4P2QD 1NGPH 1G9NL 1Q9OB 1CQYA 1RULH 1NAMH 3RVXD 5KANG 3SE8H 1T0NB 2BCKA 4EN3B 2J8UB 4X6DF 2VABB 4Z0BL 4NN6C 1KEGL 5GJTH 1DBAL 2OQJA 4YZFE 1KJ2B 2HVKB 3IFOB 5F7DA 3MUGB 1AD0A 4YHKL 4P23D 4PJBE 2QSTA 2R29L 3H0TA 3T77A 5J9PA 3S4SA 3OAUL 5EU6D 3Q5YA 4NP4L 4LHUG 1WISA 3MJ9L 5JXED 5LAXA 1L7TH 2R69L 3KYMB 3P9MA 4LVNB 4LQ1A 4A2MA 3RKPA 1L7IL 4LHUD 1XGPA 4U49A 2Q6WB 1LO0H 1RAMA 4FZEL 4MJ5B 4XNQA 1S5HA 4JAMB 3GUTA 2W59A 4UDTB 3DBXB 4GQ9H 5ICXB 1F6LL 5LBSH 1OT1A 4X7FC 5AYQA 4M5ZH 1FZMB 5D7LE 3MV01 3ULVF 4PGCA 5E8DH 4C56B 5DWUL 5EOQL 2DIAA 2QQLH 3MBED 1IGYA 4KAQH 3C08L 3FAXA 3FMGL 2C3VA 3IFNL 1H8OA 1HHJA 1JF1A 3ARFC 1FRGL 1BWMA 4PGZA 4U1GC 4U3XA 3LMJL 4R7DB 3H3PL 5D5MB 3EJYD 4WGWB 5IEKB 4P2OA 4ODXB 3ES6A 4XCNA 1FVDA 1A7OL 4PJCB 4WW1B 4MD0B 1NCCH 4I5BA 4NSKA 2H2PD 5E00B 1MWAH 5F7UA 5IF0A 1QSFA 4LGRB 4OD1L 5DRZA 4GRMA 1HYSD 3KPTA 3LZFL 4KTDL 1AQDA 3BKYL 3HUJE 3MLUH 3LEYH 4PJAF 3SDDC 5TQ0H 1QHPA 1TCRA 1G9NC 2UWEB 1EAJA 4JRYB 1FVEB 4NRXA 4AIXA 1JTOA 5HGAA 3BMWA 5C0EB 3HG1D 1W72H 3MRFB 1JRHL 1MLCB 2MKWA 1U8PB 1T7WA 2NPLX 1NAKH 3D0LB 1OT2A 3H8NA 4K94L 1ZLVK 2F53E 5JLZA 1FV1A 3QIBD 5C07A 3R1GH 4OQTL 4XNZC 5IVOA 4LLYA 5K9KB 2OJZL 2F58L 1W0WA 1YNLL 5IMKB 5BOZG 4U1HA 2HFTA 1QFWH 2GIYA 2BSTB 3BPLB 5FHAH 4R4FH 1IC1A 5GRYA 2R0KL 1GVIA 8FABB 2DLGA 3NCYS 2R2BA 1VADA 3FAWA 3SKUD 2P42B 5DD6B 1KFAL 3NACL 3CUPB 2BRQA 1CXFA 4YO0B 4WCYL 1OP5H 5KSAB 4PJIA 3EDJA 2NTSP 1EBPA 3D39B 3ARDD 3HRZA 4DN4L 2AJ3B 4Z78B 5GHWL 2BNUA 1YN6B 2NW3B 3ZDYE 2VQTA 4KUZH 3ULUF 5T1KB 2SEBB 3G6DH 4DVRH 3CCHA 3LKSA 3S7GA 2V2XA 3HAEG 3O2WL 5FM5M 2NY0C 2GY7B 3L5JA 3W2DL 2YA1A 5CD5C 4JFZL 1A8JH 3A0OA 3ZYOA 4ETYA 4DGYL 2B39A 2J8UF 4NQXB 3T3ME 2AI0H 4MWFA 1BVZA 4GRLD 4ERSH 5J3HC 2QR0A 5DRWA 2VDOL 3MZTA 2IQ9L 1JHKL 4LSQL 4XHQA 1BREA 5D7KD 3BYTA 5I1EH 1K85A 4ZUSB 3SQOH 3OGOE 1DEDA 5ELIA 3HPLA 3ARPA 4J6RH 1QBBA 5IW3A 3UO1H 3HZVA 4FFVC 2QKIA 3W0WD 1NBYA 4XP4L 4ZAKC 4WVRA 4HV8B 2LE9A 1UB5A 3FB5A 4K94C 4M1CC 3TBTB 3VFPB 5CEXB 1L9MA 4DGIL 5AG8A 4QRPE 4XBPB 3GJFA 3O6ML 1J05B 5HGHB 3OPZL 4MA3B 3FQRB 3REWB 2VDMH 2YRPA 3UAJD 4F3FB 1K8IA 1E27A 2Y5EA 5AAMA 3I6LE 4DEPB 4P3CL 4WU7B 3U7YL 3OJMB 2CRMA 2ZCHL 4XP9H 4Y19A 1JGUL 4ZYKB 3RTQA 5C0CE 4EQ3A 2D0FA 3S37H 2LVCA 1BFOB 5SWZE 3EYSL 3QDME 3QIUA 4PJXB 4HK0B 4LLWA 1HI6B 4JPKH 5GQBA 1OAUH 2PTVA 1IAIM 1BQLH 5IOPA 4PJCF 5IWLA 1TLKA 4DQOL 4KFZC 3PQYD 4TPRL 3MRMA 4MX7A 4QXWA 2UZIL 3WN5C 1MFEL 1SBSL 4YR6A 3QIWC 5HHOE 2EDTA 2WIMA 4TUOA 3NZ8A 3WLBA 1ZA3B 3CDGB 5IKCB 1LD9A 4KHTL 3ULSB 1ZVHA 3NBNA 4PGDB 2W60B 5BS0D 3TFKD 3UXFA 5GZOD 5E70A 2DD8L 1CFQA 3EOBA 1EEZB 2DQHL 4CW1A 3MFFB 5TF1L 5KS9E 3B2VH 4TUKL 2EYRB 2WUBL 2GSGB 1BWWA 2Z31B 5DK2B 1A2YB 3VWKD 2IPKA 2MFNA 4KHXL 4GJTB 1V3MA 3V6ZB 1J1PL 5E99H 3DUSB 4OI8A 3RUGB 2W0PA 4IIQA 3BFOA 3QDGD 2P7TB 1JNLH 5DUPH 4RDQF 1KPUA 3VE0A 1UH4A 5KSBE 5IFAH 3QEHB 4U1IB 1GL4B 5KVGH 4NNXB 3I02B 3TO4C 1EUTA 2HT3C 4JLRB 1RZKH 1UZ6F 2HG5B 1XF1A 3QG7H 1CTOA 1WBXB 3KR3L 4YDKL 3UDWA 2JJSA 1U8HB 2ZCKH 4OIAA 2XQYK 5F1NB 4K2UH 3GKWH 1IGJA 1HHHB 4EBQH 3D85D 1D9KB 4MLSA 3TN0B 4H25B 1DEEB 3HE6D 2XQYG 2VLRE 4PB9H 3QDJB 5FCUH 3HC4L 1PFCA 1PKOA 3MV8B 4IRJD 1R24A 5GGUB 1B6DA 4KKCD 3FQWA 1ZT7B 3TT3L 1MVUB 5D7JB 4R2GC 5DD0H 1FL6B 4KJPD 4RGMC 4X7TB 1JWSA 3T2OA 4XCYA 3QULA 4MAYC 2AEQH 1UWGH 2RCSH 1SM3H 1EUUA 3DROB 4I2XE 1P2CB 1CBVL 3RHWF 3HTLX 5D7LD 2F5AH 4M8QB 4J1UB 3RWIA 2XI9A 3FOMB 1R0AH 2VDPL 3NVQA 3K8MA 5J11C 2WUCH 3M8OH 2DYPB 2E6QA 5B39G 4D8PB 3QWQB 2YC1A 3QI9A 3RL1B 2MJWA 3T2QA 3DX6B 1FL5A 3D25B 3H9ZA 3SO3B 2BNQB 1LE5B 1RZIB 1J1XH 3N06B 3G5YA 1M05B 3P40A 3QFDA 4YLQT 5E5UB 3KPLA 3KLAA 3MC0A 5TE6H 3BKML 1YQ2A 5DJCB 3TV3L 4HIHB 5KSVB 4BA8A 2L7JA 1YJDH 1P84J 1TJIH 3ARXA 5CSGA 4RX4A 5E8OA 4CU6A 1KN2H 4ZTOH 2HN7A 3PHQB 1I7UB 1HILB 3RNKA 4CN4A 3HE7D 2ARWA 4HMDA 3WNPA 1ED3B 1X5FA 3MRPA 4ALAL 3BN9D 3VGDA 3SE3A 2QSQA 2O5XH 5D7IE 3VWJA 5ADOL 1YPZF 4G6KL 3W11C 1QLEL 5EU7C 1TJGL 4TSBH 2BVOB 3MRBA 1S7VA 3G6JA 3G5VB 1EHAA 3SDXA 5FGCB 4LF3A 1R5WA 1VACB 5A1AA 4OZHF 1M71A 2XPGA 2IANB 1JGEB 3DVNB 4YHPA 1S7TA 4Z7VB 4GW4B 5J06A 1KXVC 1KC5H 3NN8B 4QYOB 5FKAA 4UAOC 4WV1B 5AEAA 3BP5A 4I0PD 4PR5A 2FYYB 5I75C 4HGWB 4EDXA 4RQQB 1S9XA 1DN2A 4GXUN 1SY6A 3HI6H 4J3WA 1QBLL 4OAWA 4P2OC 5DJ8A 2XV6B 4Z7OF 4EXKA 1OGAB 1QLRB 3G08B 5ETUB 3WFCH 3JUZA 3DGGB 4LCIH 4PV8A 5C09E 3ZT6A 5I1KH 2XACC 2HLAA 2OL3B 4O4YH 5GGVH 1U95B 4KKBD 4UTAL 1VFUA 3PV6B 1K8DA 5ACZA 1K5NA 2X4RA 5BO1H 1HXMB 4OLYH 2PYEB 3VXUB 3B9KB 5AAWA 5HVHB 5IB5A 3SHSA 3VXME 4GKZA 3BHBA 4X6FA 1LQSR 3I50L 4LSVH 4P23A 4RAUA 3C5ZD 1DQQB 5EU6A 5H37H 3K74B 4NKMA 4WHDA 1F3DJ 2PR4L 2X9YA 3NPSC 5JXEA 5LG1A 5I2IB 5EU5B 4CU7A 2W07A 4GW5B 4HS8L 5GGQH 4KZEH 4LMQI 4G6MH