5CEZH

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
231
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIRQSPGKGLEWIGYISDSESTNYNPSLKSRVIISVDTSKNQLSLKLNSVTAADSAIYYCARAQQGKRIYGMVSFGEFFYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPSSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 33
structure length 231
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezH01
1AIFB 1A6AB 4PRNB 3ZDYF 1WBYA 4WFHE 1NLDH 1NBQA 1K4DA 1F6AA 3LAFA 5CMAB 4BZYA 2BHUA 3KYNB 3L3KA 5IG7B 2HTKD 4L4TA 3CX5J 4YE4L 5GGTL 3LV3B 4ZUTA 1UG9A 4JFFE 4X9IA 2E7MA 3HUJB 4M1CD 2OQJB 1S7TB 1MFCH 3ROLA 5C0GB 1BJ1J 2VNCA 2D31A 4OLEA 4P2OB 1TZGL 2NY2C 4U1JA 1FORH 5CGTA 1N8ZA 5TDOA 1LEKA 1XF4A 1YY9D 4LCWB 3UEZA 3I2CH 3SDCC 2DS4A 2HVKA 5TPWL 4O2CA 3RVTD 5T3XH 1H3WM 2J6EL 4RNRB 5ACLA 4Y2DA 3EBAA 3Q3GB 1FLTX 1A14H 4NGHL 2GYSA 2B1AL 2F19L 3VE0A 1XCTB 5KVEL 1L9MA 4R26L 4WI4A 4J6RH 3IDXH 5IMKA 4K3JL 3MLZL 3VRIB 4HWBL 5ICZB 3MFFB 3W0WD 4DEPB 1Q9OB 3GO1H 5HYQA 3UJJH 3OXSB 1JNHB 4QXWA 5CLWA 3QULB 4RAUB 5DVMA 1XMWA 5I6XC 3FQNB 2NY1D 5AG9A 1IVLA 1A2YA 4ORGA 5SWZD 4OB5H 1K5NA 1NAMA 4Z7VF 4OIIH 4G42B 1Y6KR 3OKKA 3VD4A 3HE6C 4DQOL 3KPMB 4GRWF 1OSZA 3BRDA 5ADPH 1NGWA 3WN5C 3T4AA 1JJUA 1XH3B 3OHXB 1MI5E 4LBEA 2JJTA 4MNGA 5E6IC 3NA9L 1U8HA 1IT9H 3NZHL 5KOMC 5DRNA 3VG9C 1AGFA 4Y16D 5DJCB 2D7QA 3ULUE 4WWKC 1E28A 2GT9B 4NBZB 1KTLB 3U9UA 4K07A 5FYLD 3MCLL 2R2HB 4HG4K 1C5BH 3BD5A 4LLMA 4GKNA 2W9DH 2FEDC 3NA4A 3QIBD 2GJ6B 1FVDB 3O2DL 3V8CA 1U8JB 1HSBA 1CLZH 3EZJB 4RWHA 1NEZA 3NN8B 4QHUB 1IGCL 1GAFH 1KLUA 2C7UB 1EFXB 1T0MA 1VERA 5DUMH 3L6FB 3NCJL 3O8XC 2XA8H 5FA3A 5DDHB 3UTTB 3ULUD 1HSAB 4KZEL 1GC1C 5D5MB 2GTZA 4OT1H 4QHNB 4M7LL 5EOQL 4NQEB 1CDIA 4H1LG 4PJXF 1DLFL 1X5IA 5E9DD 5EB9A 5MP6H 2ZPKH 4OIAA 1RY7B 1UB6A 3DETC 1N3NB 2KL6A 4OGXL 5TH2A 1T83A 3IDJA 4S0TD 5HHOB 1X5KA 1LGVA 4D94A 2VE6A 1ED3A 5FHAL 4D0DB 1OGAE 3WO3B 4G8EB 2DL9A 4MNQE 2OP4L 3OAYK 5JO5A 2LU3A 3MV7A 2EXWC 3D0VB 1NCCH 3N0PB 3IFOA 3CU7A 4XZUB 3PWPB 2FLBT 1ODAA 2ZKHL 4XNXH 2IJ0C 4GXVL 3EYUH 4N90E 5BS0D 2MJWA 4IRJD 4NCC1 1WBXB 2WANA 4GG8A 2MKLC 2E7BA 2W65A 1A0QL 4YIQB 5EU6E 1HOCB 1QRKA 3MOBH 2UUDK 2GITB 1CS6A 2XI9A 4HXAH 5GIRB 3RBSA 4MNQD 2GSGB 1R6VA 4XBEL 5CLTA 3FT2B 4CAGA 2FYYA 4PJEE 4NOBA 3RZCA 1GZPB 3V4PL 1DN0B 4ZXBC 4WFFD 4Q9QL 3VFUB 3D2UD 2PYFB 5EH1A 3OB0K 1GGIL 5FO9A 3HRZB 3VXOA 1SJEB 2Z93A 1HHGB 1FNGA 5J6GA 4HKXA 4MJIA 5D7JC 4WENB 2ZUQC 1I3UA 3U1SL 2E9IA 1IGTB 3C8HA 4MXQC 4Y2OA 2A6JA 5JZ7C 4D0BA 1CGWA 5FUZL 4YBLC 1PKOA 1Q8MA 3TH4T 2W0KA 3D6GA 1QR4A 4NPYB 4PD4K 4R7DB 3T1FB 1IFHL 1KLGA 1FVEB 2DB8A 1CE1L 5DQDH 4ZO9A 4X80L 1YNTB 4LCUB 4YHKH 3MLYL 4V1DD 3X13B 4XB7A 2ZSWB 1LEIA 3VRJA 2CK2A 3F8UB 4YFLI 2NY5C 5E6YA 1DEEB 1F3DJ 3DX8B 2YS4A 3SE8L 2Y5EA 1S7VB 2OTUB 5I1JH 4P5KB 2YRPA 4TUJB 3IDNA 3FB6B 5IB5B 2NQCA 4JFFA 4L4JA 4U3CA 4M9PA 1KPRB 5IQ7H 4XAKE 3W0WA 4RBPH 3L5WA 4P4RB 1MHEB 4PG9A 1T5WA 5D7LD 4XPAL 4Z76B 4PLKC 1TETH 3B9KB 4W68A 3FO2A 4PJCE 1X5AA 1DFBH 1H5BA 1U8OB 4S1QH 2DWDB 2IH1B 1T5XA 1GC1H 3RNKB 4CADB 5SX5K 4ALAH 3MLXL 3EO0B 5F97E 1RURH 4M9OA 3CDGA 4JQIL 3RNQB 5DMYA 4R2GD 1CK0L 3KYKL 4WY7L 5HI4D 1RJCA 3S88L 4XAKD 5CAYB 1IGJA 1ZLVK 5KVFH 4TUKH 1C12B 2VRAA 3BN9C 3PNWA 4ZFOB 4OKVB 5FGRA 4NZTH 1LDSA 1A4KA 1QKZH 1VSCA 4ZNEE 5CZVH 1JHKH 3GIVA 3RWIB 3U0TB 1AJ7L 4Y16A 5FO7B 5H35B 2ARJB 4P9ML 2KH2B 4F2MA 3WFEH 1TCRB 3SJVB 2V9QA 2HH0H 5HVHB 2ICES 5C0CB 5SWSE 4LRIA 5EO9A 4QTHA 4YEFA 3ZKMC 5CHNA 4HBQA 3MMEB 1JK8A 2A1WH 4PV9A 4UILH 5D9SA 3QHFH 3QIBA 3LSOB 2ZUWA 4LEXH 1FJ1B 4DKDC 2IPKB 1HXYA 1MI5A 1A4JB 4OUOA 2P46B 3KPPB 4JZJA 4GW1A 3T4YB 5DO2D 1CFTA 3LS5H 3S3PA 4O9HL 4L9LA 1I8KA 1L4IA 1MCQA 2VSCA 3QPXL 3KPNB 3B2UD 4JFZL 1NFDB 5J6HA 4OCSL 3LDBC 5D7KE 1NUGA 1E4XL 3DYOA 4G9DB 4Z6AT 4Y1AD 4CU7A 5HYFA 1UCTA 1FZMA 2X9WA 4MA8H 3U0PA 1QBBA 3PGFH 2J7LA 1LO5A 4WU7B 2ESVB 1KEGL 3OKYA 1L0QA 2IFFL 5F1NA 5GRVK 5CD5D 5JXEC 4ZO8A 3AXLB 4FQ2L 3EJYC 3JWOC 4NHCH 5IFJB 3R8BB 3TIDB 4K8RL 5JIHA 4K23H 4LLQA 4YC2B 3VXRB 3NTCH 3P73B 4I77H 1D9KB 1M05A 2Q76B 4CJ1A 1WT5C 4BQ9A 4YHZL 5F7HA 1HK6A 1D5MB 3CFEA 5D7KD 3W2DH 4OLYH 3NIDE 3RAJL 1UEYA 3RJDA 5DD5H 3CSPA 1ZVSB 2PW2B 2MTPA 1WSST 3MJGX 2NY5H 5I8EA 2P24A 4IRJA 2DOCA 1YMHB 3DV4A 1KGCE 1WV7T 3CLEH 2CIIB 3B8SA 1OGAA 1FL5B 4D2NA 2CJUL 5IEHB 4KPHL 2ZWLT 4MNQA 5IB3A 5C09E 1ZWIA 4N0UE 5DTFA 5FHBL 4LHUD 1XGQA 5IROA 3VWKD 2W9EH 3CVIL 3U6RA 5I17B 3FQXA 1GHFL 4DAGH 5FYJL 1F00I 4MAUL 5J9PA 2HA1A 4ZPVB 3WLWC 2YRZA 1KCSH 5EU6A 1DBJL 2BDNH 5JW5B 1L6ZA 2OZ4L 1KXQE 2VDLL 5EO0A 1U8PA 4OZFH 2XKUA 2VXVL 2VITA 4WTZA 1SJHA 4LMQE 1H3XA 5I71B 3VXUB 3DJ9A 3U7YL 4ZFOL 2QBWA 2WUCH 3SCMB 3GJFH 2C1OB 4MXWH 1ZHNA 3MODL 4ZFGH 1FVCB 1QLEH 1NQBA 4LOUC 2YWZA 4M8QA 4NOFA 5EZLB 5FF6B 3GIZL 4QXTA 4TVPE 1G0XA 4I18A 4RDQF 4LAQH 3RTQB 3JUZA 5DRZB 1E27B 3IAQA 4MXVF 4LP5A 1RZGB 4ZMAT 3QUMH 5HHNB 3MLRH 4P3WA 4OCYH 4PPTA 1QSFB 1HZHH 3HFML 1FFPA 3O3AA 4HSQA 1JZ2A 4YLQT 3WJJA 1IILE 5DJYA 3MREB 7FABH 1QRNB 2EDJA 2G5BB 4TVPD 3GMOB 1KXTB 1PJ9A 5FGSA 2Y07H 5CJOL 4M02A 3RY5A 2GI7A 3QRGL 4YZFE 4JCMA 1EO7A 4Z95L 4XPTL 2CGRL 5I1GL 1K4CA 3BESR 4JO1H 4KTEH 4ZYKB 2BOCA 3GMQB 4DKFL 1U8NB 3JWOH 4S1RL 4K2UL 5T5FH 1J05B 1NAKL 2FO4A 4IOFC 5C0IB 4H1LB 4GH7B 5DSCB 2YPLD 4HDIA 4Y4FD 4PJCA 4GMSL 4ZUWB 1GPOH 4GRWH 2X70B 2AXGA 2X4QA 3BP5A 3IVKB 1H3TA 2H9GB 4QRPE 3OB8A 5F6IC 4ZUVB 2HFGL 2XZCL 3JVGA 1L7TH 4ZODA 1EJOH 3PQYB 4KGJA 4WWKD 5DD0H 3RX7A 3ESUF 3QH3B 2XWJB 4HUKB 4JG0L 5IGXH 3K4DA 3I3BA 1G7QB 3DO7B 4F37F 1HEZB 3CVHA 4HHAA 4K3DH 5EBMA 4DN3H 4WFEE 3TZVB 3MR9B 2RR3A 4M7ZC 4AQ1B 3M1BA 4ZNEA 5I73C 4K7PH 1MJ8L 4LVOB 5EWIL 1UH2A 3SKJH 2FLRT 3QEQB 1W0VA 1H8NA 4NQSB 1II4E 5GJTL 4EUPH 1A3QA 1B6UA 1JPFB 1RU9H 4QRPD 4Y1AA 3X3FL 4N1CA 3C5ZB 3MUGB 3B8YA 3L95B 3TPUB 4EN3B 4MD0B 5L6YL 1E6OL 1YNKH 4HWEH 4KJYA 4Q9CA 2LAAA 2DLFL 2ICEB 4LARH 2BY0A 5JR1L 3MQIA 2R1WB 1I8LA 4M7KL 3HMXA 4YHPA 2A0LD 3DETD 3MYZA 4WFED 1RZ8B 3K1DA 1UYWL 4JPKL 4OZIE 3RI5F 5BQ7A 3ZKQD 4IIQA 3C8DA 2G60L 1XIWC 4M03A 1JPGA 1UJ3B 4F15B 1T1XA 4UTAH 4L3CA 2Y6SC 4UI2A 4JKKA 4D3CL 4NC1E 1RUML 3KPSB 5GGRY 3VXPA 4PJ9D 1L6XA 3LRSB 5EOCH 3C6LC 3WFHB 2XICA 1AH1A 1S7RB 1IL1B 3CFJB 4X7SL 3TT3H 3WKMH 3JZ7A 4XCNB 1MRDL 1YEKH 1EK3A 1K2DA 5J57B 5IT2H 3J7HA 4OZ4B 5IK3A 1F4WL 1U8KA 3AAZB 3LB6C 4R8WH 5FAAA 1OP5K 3E8UH 4LHUA 3FN0L 3VWKA 3BRFA 1Q0YL 1TQBC 1YPZF 2X4TA 2CKNA 4X7TA 2IALA 1OAKH 2XPGB 4XMLH 5B39A 4LHJB 2VLKD 3B2VH 1ZA3A 3TN0B 3OWEA 4N5EC 1JGEB 3LKSA 4ZXBD 4PRHD 3GSVB 1J5OH 1AE6H 3E2HB 5KSBF 2KBGA 3RGVB 3S3JA 2AJZA 2CIKA 2RJMA 4HLJA 3D18B 4OD2A 3MZGB 1IEAA 2X4SB 5E99H 1S5HB 5C09A 5D7JD 5I1IH 3KXFE 2Q3AA 2VERN 2ORBL 4MXQD 4Z7OE 5GS0L 1I9RH 3B9AA 2NYYD 1MPAL 5DZNA 1MCLA 3H9SB 1BVKA 3MRPB 5JHDD 1OTUC 4KJQC 4U3HA 3DHJA 1ULVA 5AEAA 4EDXB 2HFFB 3EO9L 3LEYL 2D03L 3QUKB 4G6MH 3O6LH 1XGUB 2R39A 3M17B 3MO1B 5CCKL 1F6FB 4XB8A 4PY7B 3IXTB 3V52L 2J8OA 1G7HB 3FMGH 3KXFD 3TH3T 3TNMB 3LMJH 4A6YB 1NSNH 4RCAA 5HJ3B 3H6JA 2ZG1A 4ONHB 2FZ3B 2OXHA 3U30C 2E7HA 2XQYG 4NZRH 2AJVH 1HH9B 4LVEA 3RWGB 1FZOA 2AK4D 2PTUA 1NC4B 1F11A 4PLKD 5GZNC 3TO4C 2EC8A 4GRLB 1OARL 4NP4H 2V2TB 1M4KA 1R3LB 3U83A 1CXFA 4PJIF 4GAGL 1MQ8A 4I3SH 3K1KC 3O6FC 1CI5A 5F7WC 1GYAA 3GMPB 3VG0H 3RL1B 1G6VK 5BZDB 4P5MA 3F7QA 4Y4FA 3WN5A 3RWDB 4P49A 4YR6B 3GHEL 4WFGE 1EMTL 4YDIH 5DJ0B 2XZQH 3CFCH 5GSRA 2IPUK 1TJIH 5E1HB 1YC7A 3T09A 3LKOB 4P4KC 3OXRA 3MGOA 3AUVA 4JFHD 5GGUB 3QFJB 5TQ2L 4XPFL 4L5FL 4JR9L 3TCLB 1YC8A 2H41A 3W9DA 4WDIA 1CD0A 2ZSVA 5CJXC 1URLA 3RVWC 1BEYH 5CWSB 1KPVB 3BQUD 4X98A 3BPNB 1BIHA 4L1HA 4LSRL 2VDPH 3WIIL 1DQDH 2NY0C 1MOEA 5DJXA 3ZKMD 1CBVL 1DBBL 4M6MH 2O93L 1ZSDA 1T0NB 5MI0B 2HKFL 5B8CA 1J0IA 3P40A 5JOFB 1GGYA 4R4NC 3N50A 3AC0A 5CSBA 1GGBL 3FQRB 4W70A 4QRPA 5JHLL 5ANME 1IGYB 4LVNC 1IGIH 1WC7B 3FOMA 1CL7H 4H8WL 3QG6A 3QZWG 1FSKB 3VWJB 4HC1H 1ZHKA 5FCUL 2DQTL 1BZ7A 5E00A 1KBGL 2VLRD 1P53A 5DQ9B 2E3VA 3GRWL 1KENH 3A0OA 3HC4L 3TBSB 4H26B 1AR2A 3NOIA 4YWGL 5EC2B 1JIBA 3DIFA 1IKNC 5JXED 2BNRE 1IMHC 2QL1A 5IOPA 3IRZA 3OKMA 1ZT1A 3N1GC 5INCB 3LVEA 4MA1C 3LN4B 5DUPL 3BHBB 3QHTC 5H94B 5DJDA 4N0FB 4X9HA 1KTDB 1OCWH 3I6KA 4BJLA 2VXSL 4W4OC 5GS1C 2HRLA 4PJ9A 3MROB 1YEGL 5DHVA 3BXNA 1DVFA 3KLAA 5F9WC 2SEBB 2R0KL 4LASH 2QKIA 3NACL 5F71A 4O4YH 2RQ8A 4Z77B 4OZIA 1BPVA 2JJSC 2OR7A 1WZ1L 3C2AL 4DN4H 1ZLUH 2BNRD 4NKIL 3SGKC 4IOIB 4A6YL 2DD8L 2VO5A 3BZ4B 2IG2L 3UDWC 4GQ9L 1D6VL 2H2SC 4PV8A 3ARDB 5F9JB 4MDJA 5ICXB 3SE4C 5DI8B 2VLKA 3OG4B 3HUJF 3P4NA 3V6OE 4MA3B 1VA9A 4ZXBA 3IETA 4LLWB 1BAFH 4J3XA 2FIRT 4C56B 1JWUB 4RGMB 3UBXA 2YKLL 1KT2B 3EOBA 5TGBA 3RL2A 4LL9A 1NCAL 1BQHA 2CKBA 3IDYC 4QRUA 2VDML 4KY1L 4DZBA 3TA3D 1N2RB 1T4KB 2AXHA 2P5WB 4NKOB 1CF8H 4Q6IC 3WLWD 5BJTB 4PGCB 5F8QC 1MFBH 2P5ED 4UT9H 3JTTA 3VFVA 2AQ3A 3TT1H 2FECI 3GMRB 3LIZL 3KHQA 4QRQB 3BUYA 2ILLA 3NPZB 5BVPH 3C87A 3OR7A 5C0JB 3T0BA 1KIPB 5K9OA 3VDBA 5J3HD 1H0DB 1S9VB 3SY0B 4PG2A 4F58L 1MVFA 1YA5A 5L2KE 1PQZA 1XF1A 5E70A 1YYLL 1Z5LB 4LOUD 1CTNA 1U41A 1D5IH 3BMWA 1T20A 4F57L 4MD4B 4FQJH 3N06B 4AMKH 1U93A 3KXFA 1FIGH 2Q7YB 4IS6B 1AD0B 4I1NB 4HFUL 4FQLL 2DLGA 4X7DC 5FK9B 3TFKC 1JYVA 4HS6A 5IVXE 5J0BA 5D6CB 4HIEA 4JKWA 3K8KA 4NNYB 3CC5A 4ONGH 4Y5VA 1A7BA 2C9AA 1PYWB 1BZQK 3WEXA 1AQDA 4BH7B 3UO1H 1P4LB 1Q1JL 1W0WA 3QXAA 4JFDD 3NBNA 5D1XB 2MHAB 5DRWA 4GKZB 5T33H 5J1AA 3VH8G 1F4YH 3X3GL 4L3EE 1NLBH 4M62H 1KJ2A 4XCCH 5C70A 1WBZB 3C6SA 1Y18A 4HIHB 2CH8A 1S78C 4I2XA 3VFPB 2WMPA 4XVSL 1IAMA 1E4KA 2WWKO 3HR6A 1QNZL 4YQXH 5F1IA 4JM2F 2H32B 2FNBA 4KROC 5A16B 4OZGB 1IEBB 4JDTH 4PJ5D 3BKMH 4IOFD 3V6ZB 5A43C 5HHQB 3DX6A 3E0GA 5EO1B 3NCCB 4U0QB 4RA0C 4RFEB 1VPOL 3TPKA 3QCVL 3UROR 1CZ8H 4PGZA 4LF3B 5D5MF 3T04D 5GHWH 4YX2L 4L3ED 3BQUA 3HI5L 3JV6A 5CBAB 3BEWA 2FSEB 3ZTJG 2FBJL 3WFBH 3ELAT 1S7UA 5HYSB 1M71B 1I9JL 1LK3H 1MY5A 1CLYL 4Z7QF 5BXFA 2VL5B 4D0CA 2GW5A 2Y06H 1ZGLP 43CAA 4E5XB 1JWMB 1FN4B 1A6TA 5HXMA 5AYUL 4DVBA 4KHXH 4DKEL 3KNBA 4B50A 2DMBA 1RUKL 4Z7UB 2DMCA 1BQLL 2CDGA 1B0RB 3T0WA 2NNAB 3LEVL 4JRXB 5C8JA 3NAAL 1NGYB 4OI7A 1CU4L 3LD8C 2FX9H 3QUZD 2FHCA 3VXSB 1NUFA 5JXEA 3WFDL 1FH5H 4M43H 3ES6A 1EDQA 4N8CL 4I3RL 4HK0B 1F8TH 1IKFH 3AU1B 3QDME 4F7TA 2EC9U 1FRGL 3MRCA 1INDH 1JN6B 4Z7VA 1VEOA 3SKOA 1BREA 1AFVL 3KDMA 4QTIL 2VLMD 3TJEH 2F58L 3WIHL 4WUKH 4Z9KB 2OR9L 3MZTA 3HCVA 4WI8A 1HCFX 4WW1B 1DCLA 1FO0A 1JV5A 1E4WH 2Y6SD 2FJFA 4WO4D 1TVBB 2R56L 4HCRA 2HTLC 2XRAL 1MAMH 3OGCB 2XT1B 3LKNA 4S11A 4KGLA 5L2JA 4OV5A 4I4WB 2HJFB 4TYUA 3VD5A 5DYOA 2ADFH 3FT4B 2BNRA 1IC4H 1YNLH 2PW1A 3VCLB 3OGOE 4U6XB 4I0PD 1MEXL 5B21A 1MREH 2PETA 3LN5B 5HI3C 1OD7A 3S8WA 2Q86A 5CJBA 4BKLA 3MRNA 1YECH 2YSSA 3SDYL 1HXMA 3HG1E 3LB6D 3STLB 4C55A 3VFRA 3AY4A 5E1AB 3CK0H 5KSVB 1GIGL 1IGFH 1ITCA 3HC3L 2FYYB 1C8PA 1V5JA 3OAUL 5IESH 5TE4H 3TA3A 4N5ED 3WS3A 2ZCKH 3NFPA 1BIIA 1VFUA 2FJGA 3JV0A 2RBLA 1IC7H 2VDRH 5DUBA 3QR2A 1FNEA 5E8NA 2R0LL 2JK5B 5F88A 4W81A 3O4LE 1WIPA 2EYRB 2DQGL 3F65A 1EO8H 3ARBC 2L4OA 3GK8L 1RIVL 2WBJD 3PGDA 2YBRA 1INEL 1ZGLB 4X6CE 2W1NA 3HG1D 3V6OA 3WHXB 3BZEB 4APQD 1CFVH 4IMKC 5GRJL 1VCAA 4YDJA 4TRPH 5HPMA 1A7PL 1S3KH 1U3HC 1FAIH 1ZXQA 3MRLB 4GUPA 4ONOA 2XN9D 4ZG1A 2EIZB 5H37H 5C08E 4JFOA 5JA9A 1WLHA 5LBSL 4R0LC 1J12A 3HR5A 4L8SB 4DGIH 3C60D 3QQ9D 4ODUA 2Y4SA 4KVNH 3DUSB 3O2VL 3QXUA 5IB4B 3P11H 1EH9A 4XNMA 3K0WA 2EDYA 4M93C 2ZNXA 1ZHBB 2QHRL 1YUHA 1AP2A 2DTMH 5I1HH 1ZT4A 4PGDB 5FUOH 3GSNA 5L2KA 1G9NL 4HZLA 1G9EA 1M7DA 4FQCH 1CDJA 4JFDA 4NBYB 4PR5B 3IGAB 3MLWL 3P4OA 3C9NA 3D39E 2A6IB 1B2WH 1CLCA 2JE8A 3DURB 5C08D 1OSPL 3SKMB 4HLZH 1T7VA 2Z31D 4HGMA 3G6AA 5GZND 3TO4D 4DOHE 3KYOB 3WO4B 4NM8H 2EE6A 5IBLC 4IMLA 1KSRA 3TESA 1CTOA 2E27L 1MCOL 3QZWB 4P2QD 2BOBB 5SWZB 4I13B 3S36L 5I16A 3SO5A 2FBOJ 5D1ZB 4Z78B 3GSWB 4UT6H 5GGSY 4FP8L 4U1KB 5DMGC 3O6FD 3EOAA 2HG5B 2J6EH 2ZP0T 5DA4A 5F8RC 1R24B 5E2VH 3KPTA 3VI4E 4MA7H 4BSWB 4JKMA 1EZVX 3FO1B 1T03H 4CU6A 1YEDA 4PJFB 2F19H 1WZMA 3GSOB 4L3EA 1PBYA 4P4KD 1LP9E 1PZ5A 1MHHB 4F7EA 1AGEB 1WEJL 5DJ8A 3RWFB 1TJHL 4PGEB 4MMXC 3UTPE 4AQOA 1KN4L 2YPKB 5JLZA 1LK2A 5H2BB 3OR6B 1MCRA 4XCFL 4UT7H 5D2LB 4EDWL 1F58H 5BMFL 2NY0D 1YDPA 4PV9B 5KSUA 1KJVA 4OLXL 4OM1H 4AEIH 2FD6L 1OF2B 2YC1A 5DT1H 5DEFB 4ODXB 5GISH 5TDNB 4JAMA 1FBIL 4JRWA 2VZSA 1GCFA 3BI9X 1VKXA 2QSCL 3SE3A 3QUZA 1BBJA 2FRGP 4XP6L 4JANA 3H7BA 3VGHA 3NZHH 3TBVA 5E9DB 4GAJL 3F58H 1A1NA 1AQKL 1N6QL 1T89A 1LILA 2CMRH 2DN7A 4UIMA 5EIVA 5F1NB 1I7TA 4HAGA 4HG4J 2BVQA 4UQ2A 2I26N 4KQ4H 1JHLH 3RY6A 3ZL4L 5IJKC 4JM2C 1CDHA 2DLHA 2XFXB 3FRUB 4WO4A 2ADIB 3MLVL 3G5XA 3EO1B 3GJFK 2B7DT 1KEMH 4IRZH 2E6PA 1WIUA 2XA3A 4HJJH 4PTTA 1WISA 4MS8C 3T0EE 4O5LL 4TNVF 1ACZA 4I0PA 5BS0B 1FLRH 3QDMA 4XGZB 4RWYL 1QP1A 2MOVA 3GNMH 1DQMH 3IFLL 3DUUA 3TBWB 2F5BL 2OK0H 2FL5A 4Z18A 2VC2L 1R5VA 4F7PA 2H2SD 3HE7A 4YAQA 5IB3B 3O9WB 3MC0A 1S7XB 5DF0A 5HVFB 2DQHH 2NXYD 3ALXA 5K9JH 1MNUH 2Y72A 4GAYB 4OCXH 4E9LA 3IS0X 3D2UB 4J3TA 4J23A 1J86A 4MJ5B 2DQCL 2VYRE 2HT3D 2I27N 4PJAE 2AKRB 5D70L 3VA2C 1TJGL 4GBXB 1NDGB 3U9PL 2WBJA 4KXZI 5CEYB 3HG1A 3VH8B 1J10A 4APQA 5I1LA 3LH2L 3RWJA 4OQTH 2BCKA 3G5YB 5FKAA 4XWGH 4RIRA 4X0KB 2VABB 4XAWH 4DW2H 1S7QA 4LDEB 5MERA 4G5ZH 2A6DB 3V6BR 3CFKB 3ZDZE 4XBEH 2XN9A 4P3CH 3QQ4B 4V1DB 1MCCA 3FOLB 4HKJB 3O4LA 4JFEB 4U1HB 3C60A 1T7WA 3RWHB 4X6EB 4ODVL 5C3TA 4QCIA 1K9TA 4LQ1A 2GIYA 2AABH 3DVNA 1A3LL 1EGJH 2EDOA 4U1MB 4WCYL 3MRRB 5FYKE 2DQDL 2P1YA 5EULV 3U4BH 3TO2A 1NJ9B 1XGRA 2DM2A 1QR1A 1SY6H 3H3BC 1HKFA 1N64H 2C1PB 1SVZA 2IQ9L 5EBWB 1C16B 4U49A 5IB1A 3DBXA 3FQUA 1QFUL 1U2HA 1R0AL 5E5UB 5C08A 5D7LB 3NABL 2X4OA 3FT3B 3DGCR 3V0VB 3VD9A 5CIPB 2AW2A 2Z31A 2APFA 3QIUD 3TO4A 4Y4KC 3MV9B 4MD5A 2JJUA 4B7IA 2AEWA 2PYEE 2F9BT 4HBCH 4NNPL 5HGHB 4P2QA 3GHBL 2YZ8A 5ESQA 3QHZL 4IOSD 3O6FA 3QUYC 4WHYG 1K8DB 2EECA 3QIWB 4XVUC 4TSBH 4NZDA 2APBA 4R2GB 5A3IC 5J12B 1OM3H 2AK1H 2AJUL 3IFPB 4KROD 3D39A 3L3DB 4MX7B 1JHTA 2GTWA 4FQIL 4RMQA 2AEPL 5I8OL 1YEIH 4F9PA 1CFQA 2GFBB 2D0GA 4HUWB 2AXGB 1TTUA 4DGYL 2YD8A 1BZ9B 2C4FU 2Y36L 1PX3A 1P2CB 1EV2E 3F7VB 2CK0L 3I6LE 4RAVA 5DS8A 3WD5L 2I5YH 4U1SB 5IV2B 2CDFB 1MCPL 1UZ6E 3BAEH 4XMKL 5JNYB 3FCTB 1NGQL 1V7ML 1CN4A 1XF5B 3WFCL 3O11B 2VL4A 1J8HE 1LP9A 4UUJA 2RHEA 3D3VE 3S88H 3RDTC 3MCG1 4HT1L 4U6YB 5IW3A 4AK1A 1W0VB 3H7LA 32C2B 1QFPA 3IU4H 4OZFG 1X5GA 2YMXL 1FG2A 2R1XB 1EIBA 3FB7B 4NRZA 5DA0B 4U1LA 3TBYA 1QSED 4G8GE 4NN5B 4ELKA 1Q9WA 4JY4B 5HYJD 4ZDHB 2FB4L 5HHME 5CJ5A 4E0RA 4P23D 2J8UB 3GJEB 2L0DA 2P7TA 2LTQB 1IKNA 1G9MH 1N7MH 3QO1A 1JBJA 2P44B 5EG6C 3STZB 1KACB 2DKUA 2HN7B 2BSTA 1FFRA 2AAVA 3INUH 5IVZB 2ED9A 1T80A 2XYCA 5C0BE 4KK5C 3ROOB 3A6CL 2GJZA 3AB0C 3GM0A 2DF3A 4S1SH 3P9LB 6FABH 3MRIB 2WUBH 43C9B 1NCNA 1OTTD 3IJYB 4JFZH 3U2SA 1B4RA 1I8IA 3BKJH 2A2QT 2YA2A 4UMGA 5TFSL 2EXYC 4XP1H 3PWLB 5F7UA 4OAWB 4WNQB 5IKCA 4JDVA 2D7PA 3JV5A 4TSCH 4KJPD 5E8DH 4JCLA 4OLVL 2IFFH 3MRJA 4QYOA 1X4YA 3WE6A 3MJ9A 1KIQA 1XGTB 3BVNA 3LY6A 3P0VH 3FB5A 1IM9D 2X4PA 5C0BD 1LO2H 1TPXB 3IT8D 4KVCH 4QT5B 3RIFK 3VFSA 4TNWK 2C4XA 3ZHLA 4IRSC 3GUTB 2CLVA 2NX5D 4QNPF 2QQNL 5FDYA 4G6KL 3TYGL 1ADQL 1ZVYA 3X11A 5GJSL 1P7KB 4OBRA 4MVBC 4Q6IA 1AKJB 1S9WB 1XR9A 2DICA 2P8MB 3CUPB 3P0GB 3DVIA 3WSQH 2A73A 4C54A 4X4YA 3ARBD 1NLDL 4DCQB 6CGTA 2MKWA 4TSAH 2LABA 4HS8H 1JF1A 4HKBA 2XKNA 3S4SG 5HHVH 3CFDB 4FFVC 1T1YA 3EYSH 3BKCH 2XG5A 4DFHA 4GLRH 1MFCL 1A9BB 1OQOA 3IXAB 4PJAA 1U3HD 5FDWB 1FORL 3I6GA 1WWWX 2CRMA 5EUKB 2NY2B 3I2CL 2GCYA 2GJJA 4AIZB 1OQXA 4FHBD 3SN6N 3DV6A 3CJJA 3VXNB 5T3XL 1BBDH 3SDCB 4Z7NE 5DVOA 4P59H 1SEQH 4NBXB 3UYRH 5D1QC 1A14L 4EUPG 2I9LA 2OZ4H 4E42B 2RFXA 4MHHG 5I71C 3HZVB 3ILPB 3IKCA 3DGGB 4ODHH 1RK0B 3IDXL 4J6RL 1IAII 3K8LA 3RBGA 4NRYA 3EDKA 3QIUA 1YPZA 3GO1L 4PJDB 3UJJL 3C5JB 5T1DH 2FR4A 1D5ZA 4JPIA 5M7QA 4RGNE 5CILH 4LCWD 4ISVB 2KZWA 4GXUN 5KSBA 5I6XB 1T1WB 4OB5L 5F9OH 3S96A 5IBLD 4Y5YC 2JJWA 5AD0B 5INDB 1TVHA 4KKAC 4OIIL 2NLJA 3QJHA 4FQHA 2ADJA 4F3FB 1YQ2A 3GSQA 5H8DA 4LLVA 3HE6B 5HGAA 5ADPL 3VGGA 4L9DA 4FQQB 2YPLB 5I8KH 2J5LC 5DMJB 1I1YB 3BIKA 1A6WH 4OD1H 1IM3B 2EIDA 1IT9L 2KQMA 5E6IB 4JM4L 3MGOB 4C4KT 3VG9B 4LSTH 5C0ND 4WWKB 3ZKXC 2F54D 2VISB 2R2CA 1C5BL 3BH9B 3TH2T 3MRGA 3ARFA 5I66B 1FYHB 2W9DL 1ZLUK 2AXJA 4M61A 1WZLA 5IIEB 1NFIA 1XCQA 5DEGA 4HH9A 4JHAH 4LEOA 3MRKB 1CLZL 1T04B 3DMMA 1EHNA 2DDQH 4N8PA 4OM0H 2GJ6E 5GGTA 5B3NA 1GAFL 2UY7A 5DUML 3F7YA 4Z5RB 2XA8L 5KSAB 1QSEA 1AGBB 2DI9A 4PREA 2RCSL 5HYJA 3ZMRA 2OLDA 3ZHDA 1J1PL 3O8XB 1UM4H 4P23A 4QWWC 2R0WH 4QRRD 5MP6L 2ZPKL 4UQ3B 3UTTE 5J13C 3KJ4C 3IJSA 2VQ1A 4PJIA 1ZE3C 4NQEE 1RZFH 4YNYA 1J8HA 3FFCD 1C08A 3MSPA 1S5IH 5HHOE 4MCYB 4BQCA 2GJ6D 4JM2D 2R2EA 2HMIC 1JWSA 4X7EC 1NCCL 2P49B 3PXHA 4HWBA 4YHNA 4XRCA 3TBTB 1MJ8H 4JEGB 2WBKA 3L7FB 3H0TA 1MCEA 1KULA 5HVGB 1QACA 2JB6B 4XNXL 1ORSA 4UNUA 1EFXD 3EYUL 3Q6FB 1NBYA 3UTTD 1OWWA 5BVJB 1L0XA 5HHXH 3PWPE 1LO0H 5IEKA 4BFIA 1Q72L 1C7SA 3MOBL 5DGQA 4YJZL 4HXAL 3UJIH 1IM9A 5C0BA 5ERWA 5HHOD 4RRPA 3S37H 4WV1A 4U6HA 3N1QC 5GPRA 1Q9KB 4N8VG 2GSIA 4X6BB 4PV8B 4MDJB 3EDFA 3V5KA 2G60H 1U91B 1S7SB 2IGFH 1J87A 3OQ3B 4ZXBB 4PRHB 4HJGA 2X41A 5IBTH 4PJ8A 5GRYA 4NFCA 4D9LH 5IP4A 4MLSA 3QEHA 1JNJA 4M6NH 3SKUD 2CKBB 4FA8A 5JQ6H 4R97C 2OJEA 5D7JB 4U33A 1T22B 1WZKA 1YN7B 4DVRH 3D69A 5K59F 1T2JA 5EC1B 3OMZA 4FXGA 1ETZA 5LGHH 4HKZA 4U3XA 3SBWA 4YBLB 3O41B 1WF5A 3OX8B 3O2DA 3SGEH 4U1GC 1U3HA 1A64A 3OKEA 5DQDL 5FM4A 1OL0A 3HZYA 5CZXC 5JHDB 3O81A 4YHKL 3I02A 5E4EC 3AFLA 1JP5A 1LD9A 4Y5XA 4HS3A 3UYPA 1QLFA 4YXHH 1QQDA 1NPUA 3TV3H 3PV6A 3E2HC 5I1JL 2E8ZA 4YHYB 5LWYH 1UH3A 2UYLA 3BZFB 4I5BB 1J0HA 2OMBA 4OZGF 3S35X 1AIFA 1A6AA 4KDTA 4PRNA 3V9FA 1FPTL 1ND0B 5CMAA 5IQ7L 5IM7B 5IG7A 3LV3A 1YEHH 4KKCC 4KFZC 4P99A 1TETL 5F3BB 4FG6D 3HUJA 2OQJA 1S7TA 5C0GA 1KIUA 1Z2KA 2AK4B 3BIAX 1DFBL 1JTPA 4S1QL 5C0FB 4LCWA 4AL8H 1GC1L 4ALAL 2V5YA 4OLWL 4XNZB 3B9DA 1KOAA 3E6FA 1RURL 4R4BB 2R23B 4LGSB 1NEUA 5FYJE 2NMSA 4CUCA 1CFNB 2IAMC 4RNRA 4OZFB 1FIEA 3Q3GA 3UZEA 4XVUD 4WHTB 1KCUH 3EFDH 3HMWH 5A3ID 5KVFL 3QNZB 4TUKL 4GJTB 2E9WA 2FX8H 4M8VA 1XCTA 3SEPA 4NZTL 1U3JA 2QQKH 1QKZL 2BERA 3VRIA 5ICZA 3GJFB 3MFFA 4Z7UF 5CZVL 1JHKL 1Q9OA 4FFWC 4OFYA 3GMLB 2CLRB 3MNVB 3OXSA 1JNHA 3WLBB 4RMRA 4ODWB 4HFWB 5C0AD 3B9KD 3QULA 1ORQB 1FFNB 3WFEL 4RAUA 1MVUB 2HH0L 2F54A 2IF7A 2ENYA 3GSRB 1IQWH 3FQNA 1I1AC 1K8IB 5EN2B 4LKCB 1I75A 2A1WL 4UILL 5CS7A 3L7EB 2HLAB 3QHFL 2YD7A 3SJVE 3ZKND 4LEXL 5D2NB 3QUMB 4PJHF 4G42A 3NCBB 3KPRB 3KPMA 2DWEB 4JQXC 4UNVA 1RZJH 3LS5L 1S7WB 1XH3A 5A40E 3OHXA 5EOTB 5A2FA 1CG9B 1UQSB 3AM8A 1NANH 3RDTD 2FATH 3LDBB 4MA8L 1WICA 1H3PH 3PGFL 1NFDE 5J4MA 2W91A 1ZVHA 2VLRB 3F7RA 5DJCA 2R69H 2GT9A 1X5YA 3AREC 1KTLA 5HDBF 4LGRB 2X89D 3SJVD 5HSFA 2R2HA 4NJ9H 1UEMA 5C0CD 2PTVA 2EKSA 5L8KB 2ESVE 1HDMB 3O3UN 5DFWH 12E8H 1RMFH 4K23L 3ES6B 2WWMC 4ZD3H 1WCBB 2GJ6A 3NTCL 1DANT 4I77L 2KKQA 4RX4D 4R7NB 1FVDA 3CGTA 1U8JA 2NR6C 3W2DL 4OLYL 3B6SB 4C57C 4YBQC 3VXRE 4GRWB 4QHUA 3NN8A 5DD5L 3THMH 4CVUA 2C7UA 3Q5YA 1A1OB 1EFXA 3L6FA 3S4SB 5DDHA 3UTTA 1HSAA 5FIEA 5D5MA 1NL0H 3OKOB 4QHNA 4P5TC 4NQEA 2EXYD 3CLEL 4BM7A 1V05A 4DK6A 1N3NA 2ESVD 1DE4B 4QXUH 4JFYB 5HHOA 4KJWC 4OZHF 1EO5A 4J4PC 4JO2L 3UPAA 1N59B 4D0DA 3SDXB 4F33B 2DLTA 4G8EA 1YJDC 2W9EL 5IVOA 1VFOA 1D9KD 4X99B 1FDLH 4DAGL 4EUPB 4IRSD 1MCIA 3D0VA 5ALCH 5DUPH 1LVEA 4OD3H 1UWXK 2N7BA 4HPOL 1MJUH 4CN1A 4XZUA 1QBMH 3PWPA 1BECA 2VXSH 1KCSL 3BYTA 2BDNL 2I25N 1BQSA 3QJFB 4FS0A 1MQKH 4EQ3A 1FNEB 3GFUA 1WBXA 1KB9K 2P5EB 4RFOH 4Y4HB 4YIQA 5EBGA 1HOCA 2GITA 4PJXB 1DSFH 3SDDC 5GIRA 5GQBA 4OF7A 2YBRB 4FZEH 2WUCL 2GSGA 5IW1B 3FT2A 4JHBA 4MXWL 4ZFGL 4FFVD 1J0KA 1GZPA 1QLEL 1DN0A 1KCLA 2E7LC 3VFUA 4NKMB 2PYFA 2V7NB 4MQ7B 4WTZG 3A6BH 3HRZA 2HJKB 4LAQL 2BNUB 1EUUA 1SJEA 3EYQC 4OI9A 1HHGA 1I85C 2AVGA 5KOVC 1Z9SA 4HAFA 2Q3ZA 1WGOA 3QUML 4ODSH 2J88L 2EE9A 3MLRL 5GGQH 1IGTA 3S97C 4OCYL 3WNLA 1HZHL 3VRLE 4POYA 5MENB 2W60B 2NTFB 3T0VA 4PJFF 3VXUD 4NPYA 7FABL 1QSFE 4R7DA 3T1FA 3CDFA 5HD8C 3VFTB 1VEPA 1FVEA 4LPWA 5IJVA 3ME0A 1YNTA 4LCUA 3S98A 3KPLB 3X13A 2ZSWA 3P4OB 4YHOL 2Y07L 3AMKA 3K74B 1EFQA 1QRNE 2A6KA 1OVZA 1DEEA 1KNOA 3DX8A 4EKXA 2OTUA 3MCKB 2E7CA 4P5KA 3RTQD 2NPLX 2DLEA 2HFEB 4TUJA 3EDJA 4JO1L 4KTEL 1R5IB 1W72H 4NFDA 1A7OH 2JLLA 3FB6A 3K2UH 1IE5A 3EHBC 5T5FL 4KKAD 3ZT6A 5IB5A 5EBLB 4PJBF 4KUCF 4HPYH 1A6VH 5HVWA 1L7IH 4PJ5B 1KPRA 1RVFH 1GPOL 1MHEA 4P4RA 4KMTH 3WNKA 3MJ8B 5K9KB 4OF0A 4Z76A 1BLNB 2Q8BL 3DRQB 4QXGH 2WQRA 3B9KA 3OB0H 2UVFA 4NO2B 4ZAKC 1AY1H 1U8OA 5F6IB 2DWDA 2IH1A 1L7TL 2R29H 1EJOL 3ZE0E 3RNKA 5I9QC 3I3EA 5DD0L 3EO0A 4HD9A 4Q9BA 2WLYA 4BH8A 2BC4B 5IGXL 1EX0A 1ZLSH 1V7NH 2X1PA 5L9DH 4QHKI 3PQYE 4IJ3C 3RNQA 4DN3L 3ARTA 3NIFF 1X6LA 4WEBH 3TJHC 2W59A 5EU7C 3UPRB 4NO3B 4K7PL 4J1UB 3SKJL 4WTWA 1C12A 4DUXA 4ZFOA 4M7ZB 5L8LB 4OKVA 1RU9L 3P2TA 2PR4H 1YJDH 3IJHB 2NW2B 1LO3H 2P4AB 4MAYC 2MQ3A 1YNKL 3U0TA 4HWEL 3QEQE 2MWCA 5FO7A 2N56A 5H35A 2ARJA 4N8VB 4Y8DC 2XTJB 2XZAH 1KCVH 1H3UA 3ESVF 1TCRA 2X89A 3SJVA 3I85A 5C0CA 4QWWD 1RHHB 1B0GB 3OF6D 2OX5A 1I9EA 4CNIB 3QPQC 3MMEA 4G80B 3LSOA 1FJ1A 1VFMA 2CLZB 2IPKA 2AV1B 4CN4A 4NZUH 5ITFB 3BDYH 1A4JA 4J3VA 5H37G 3KPPA 3TZVD 4UTAL 3T4YA 1XIWB 4X4XB 2HMID 3KPNA 1U95B 3LKRB 1NFDA 3GB7B 3QEQD 5TJWK 1CXKA 3AROA 4G9DA 4PRBB 1QFOA 5KAQF 5FYKH 2KUTA 5EOCL 4F7MB 4EN3D 5C6PB 3DSNA 4KK8C 3TT3L 1F90H 3CDYA 4WU7A 2ESVA 3WKML 1BX2B 3E6HB 3F62A 3KPSE 3C6LB 1YEKL 3TCXA 4HIJB 3WNNA 5IT2L 3AXLA 2A38A 5T1MB 4NHUB 4R8WL 2B2XH 3VXQB 3WFDH 5IFJA 3E8UL 3TIDA 3K4AA 3G5VB 3VXRA 1CVRA 4F8QA 4HLZG 3P73A 1D9KA 5C0RH 2Q76A 3O3DB 1OAKL 3DLQR 5LQBH 2N7AA 4XMLL 1D5MA 1TQBB 1CDUA 2VWEC 3B2VL 4AM0B 1CFSB 4QTIH 5I74C 4MQSB 4UB0H 1J5OL 2PXYC 1AE6L 5FUCE 1ZVSA 2PW2A 1DQQB 4JRYE 4B7LA 4OCMC 5AG8A 1YMHA 3LOWA 5E99L 5ID1B 2P48B 5I1IL 4DTGH 5TE6H 1FL5A 1YY8B 2E6JA 4MNHB 1JZ3A 5IEHA 2C3GA 1MFNA 1UENA 3H2WA 1I9RL 1AC0A 3LQZB 1OLZA 4LSSH 3RWJB 1D5BB 5DR5H 2B39A 1XT5A 4OGYH 4RIRB 5I30H 1JGDB 5I17A 3H9SE 1NCUA 1T0PB 2XN9B 1HI6B 2XWBB 3TN0D 3JSSA 4NQVB 2LAGB 4G6ML 3MXWH 4ZPVA 3O6LL 2DJUA 2AJSH 5I8CB 5JW5A 2PF6A 4LDLB 3RGVD 3FMGL 3L3IB 4ZO7A 1DLHB 2X40A 5KANI 3LMJL 4G3YH 1NSNL 4WRLA 1ZLWH 4OF8A 3QNYB 3VXUA 4CU8A 3QXTA 1EJ6A 4QF1B 2BNQD 4YO0B 5GGVH 5DFTA 4NZRL 4RGNC 2AJVL 3DBXB 3DOSA 3U30B 2C1OA 4OCRH 5HYIA 3QG7H 3UCRA 3U7AA 1JNNH 1FVCA 4KKCD 2IMMA 2IQAB 3R1GH 5EZLA 5FF6A 4NP4L 2DQJH 3CPLB 3V6FB 1J0JA 4HIIB 3PHOB 3RTQA 5F7LB 4L8SC 2V5RA 3FAXA 5DRZA 4I3SL 1KYOJ 2BHYA 1RZGA 2IPTH 5HHNA 3VG0L 2IAMD 1NCTA 3O2VH 4KHTH 2YA0A 3ARVA 4GMTH 2WIIB 1QSFA 1CQYA 4U7SA 1LE5B 3AS3A 5T1KD 1UKQA 1QLRB 3P77B 4YDIL 3S7GA 2XZQL 3CFCL 3MREA 3OKNB 1TJIL 2XIDA 2HAZA 3WNMA 4RSVA 3MA9L 1FG9C 4P9HH 4C59B 2G5BA 3MV01 4P3DB 4P4KB 3QDGD 2QR0B 4XP5H 3GMOA 5DC9B 2DQUH 4JN2B 4N9GB 1BEYL 2DIJA 4U6TA 4GRLD 1RUQH 4PFEA 3QFJE 1OD9A 2V2XB 4EXPX 1DN2A 2VDPL 2IAND 2E9BA 3EGSB 3U79A 1DQDL 2B1HH 1QFWI 4M6ML 4ZYKA 3GMQA 5D1ZC 1U8NA 4M6OH 4HX1B 1MCHA 3O3EB 4PRIB 1J05A 1X5FA 1BFVH 5C0IA 4H1LA 1MUJB 5DSCA 1IGIL 3QCUH 4ZUWA 1CL7L 2X70A 2NW3B 4LVNB 4HC1L 3IVKA 2H9GA 4ZUVA 3IDIB 3OJDB 4DWHA 2WLZA 1UH4A 3SDAC 1J7VR 4JQVC 3QFJD 1F4XH 1KB5H 1KENL 3SO3C 1FG2B 3OF6A 3PQYA 5LKNA 3M07A 1I3GH 3BZDA 3QH3A 2XWJA 5E5RB 3RVUD 4E0RB 4NKDB 1K6QL 1MRCH 1G7QA 3DO7A 4QGTA 1CDGA 1HEZA 1UZ8B 4KKBC 1EHXA 4EDWH 4U05A 3TZVA 3MR9A 4K94C 3PGCB 5DD1H 3QEQA 1AR1C 1DBMH 4NQSA 4X5LA 1Q9LB 2NR6D 4OLXH 1JPFA 3S35H 3C5ZA 4V2BA 3MUGA 3L95A 3TPUA 4EN3A 4MD0A 5GS1B 5EPMB 2Z4QB 3VMNA 2EDEA 3OPZH 4LASL 5DK2B 3MOQA 3WMSA 2ICEA 1NBZB 5F9WB 4J7RA 4KZDH 4O4YL 1TNNA 1WWAX 2R1WA 4DN4L 4F9LA 1H8SA 2CUHA 3T0DA 3S9DB 1RZ8A 4PJEB 2VN7A 2O5ZH 3HNSH 2D4DA 1GXEA 3QA3B 1P5UA 3LPGA 4J4PD 4UOJA 5TE7H 1UJ3A 3G5ZB 3BMVA 3FQTB 1BAFL 2P42B 2VUYA 4W4NA 5HDQH 5CSGA 1QTYT 2YZ1A 3GGWB 2BVUA 3KPSA 3WFZA 3LRSA 5K9QI 3IDYB 3WFHA 1S7RA 5HGBB 1IL1A 4RGOH 3CFJA 4XPBL 1MFBL 3D87B 4NQXB 4UT9L 4XCNA 1YYMH 3TT1L 4BFEA 1ZTXH 2P5WE 3ET9F 4OZ4A 1RZ7H 3AAZA 1IZJA 2RGSA 3HB3D 4N0RA 5BVPL 3MUY1 3SDDD 4X8JB 1HQ4B 1VDGA 3ARDD 3G6JF 3O9WC 2BJMH 2XPGA 3TN0A 3BPLC 1JGEA 2F5AH 3GSVA 1CD1B 1D5IL 2VIRB 4C56D 5CEZH 2HWZH 3MLSH 3D85D 1AXSB 2AJXH 4AMKL 3RGVA 3BPCB 2GCYB 4MGXA 1NGPH 1FIGL 3D18A 2OMNA 4TULH 3D1MC 3GRWA 2X4SA 4F80A 2DBLH 5E08H 2APXA 1S5HA 1DBAH 1TJGH 3H9HA 3CLFH 2FJHB 4NYLB 1U8MB 2BRRH 3N85H 5FKPB 2O5YH 4ONGL 2OCFD 2XACC 3T3ME 1NBVH 2WIMA 2K3TA 3H9SA 2OI9B 1WAAE 3IAGC 1HINH 3UO1L 5FA4B 3MRPA 5HD8D 5KS9F 4XC1H 3WJLA 2YOCA 5T33L 4EDXA 2HFFA 1F4YL 1DZBA 1NLBL 3QUKA 4M62L 1T66C 4XCCL 4OF5A 1KN2H 3B5TA 4G8IB 5E2TH 1U8IB 2C26A 4KKNA 3QDJD 4U1NB 3M17A 3MO1A 4XI5C 3ETBF 4PY7A 3IXTA 4LIQE 1G7HA 4YQXL 5HTSA 1NGXB 4JVPA 2Q6WB 3TNMA 2DTSA 2ED7A 2Z8WC 3LZFH 4A6YA 3EHBD 3UXFA 4JDTL 5HJ3A 1MCWW 3BKML 1OP5H 5M94B 2OSLB 1L9NA 4KROB 1P9MC 4ONHA 2FZ3A 4K94H 3U7WH 5HGAB 3HC0A 4M4PA 1HWHB 3FO0H 1HH9A 1ES0B 1KPUB 3RWGA 1CZ8L 2XNAB 4AIOA 3QAZC 3QT2A 1NC4A 5DQJB 3PL6C 5GHWL 5SWSB 1TENA 3QWRD 4NC2B 4GRLA 1H9VA 5D1XD 4Z0XB 2V2TA 4I8DA 1R3LA 1MWAH 3WFBL 4MNGE 3T77B 2YPVH 3SPVB 4N5UA 4HF5H 4QEGA 3PDOB 4NNPH 4JFQB 5FM5O 1RUAH 4B5EA 1LK3L 3C5SB 3SE9H 3GMPA 3RL1A 1DL7H 1SHMA 2Y06L 5BZDA 1KFAH 3O6KH 4EI6B 3TJHD 2OTWB 4MHHI 3RWDA 1U2CA 4YR6A 4JGMA 4D9RD 4KHXL 2YEZB 2X1QA 3QQ3B 2D9CA 4MWFB 5DJ0A 3O45B 3UX9B 3LKOA 4OQ1A 1X3DA 2EO9A 4XWOC 5GGUA 3QFJA 5L8JB 5I8OH 4MB3A 5F9AC 3TCLA 3U4EB 4HMDA 1QSEB 2FX9L 5CWSA 1KPVA 1CGSH 4JJ5B 3O2WH 5TDPB 4LSVH 1JF6A 2Y36H 1FH5L 4M43L 5EOCJ 4ZS6C 3WD5H 3KJ6H 1F8TL 1IKFL 3QUXC 3QPQD 2DKSA 1INDL 1IAKB 3VXSE 1T0NA 2W92A 4DFIA 5JOFA 4XMKH 3TJEL 2VZ1A 1QUNA 1CICC 4WUKL 3FQRA 2X09A 4PGJA 2W38A 1IGYA 1E4WL 1UWGH 1WC7A 4RZCB 3TYFB 3BDBA 2ATPB 3WXWH 3ZE1F 1MAML 1MRFH 3TM6A 1N6VA 3QWOB 4IBLT 5DFVC 1KC5H 1PLGH 1PDKA 3U36B 5DQ9A 2ADFL 1IC4L 1YNLL 1INQB 4JRXD 3TBSA 3V4VH 4H26A 2AQ2A 4UBDC 2JELH 5MEPB 3BD4A 2BSRB 1MREL 2VXUH 5EC2A 4KTYA 1IZKA 1NGZB 1T21B 1YECL 4IM8A 3CX5K 5INCA 3GBNH 1OP3K 3LN4A 5KBNC 3BHBA 3CK0L 1EXUB 5H94A 3D5OF 3Q0HA 5F1SA 1IGFL 4UAOB 2NX5B 4N0FA 4NUGL 1KTDA 5IESL 5TE4L 2ZCKL 1RIUH 3MROA 4TTDC 3KVQA 1IC7L 2VDRL 3MRDB 4JFXB 2SEBA 5IMOB 3HRPA 2M1KA 1RZKL 1XF3B 1F3RB 3BOVA 3V4UH 4Z77A 1EO8L 4MJ4A 1VHPA 1NH6A 4IOIA 3HNVH 3LKQB 3SDDA 3ARBB 3BZ4A 3CNKA 1CFVL 4MJIE 3ARDA 3EYVB 3O0RH 4HK3J 1BD2B 5ICXA 5DI8A 4R6UA 4TRPL 5EDXA 1S3KL 3E3QC 4MA3A 5EORH 4FNLH 2E7LA 4LLWA 4UIKH 5F7FA 4C56A 5DRXA 2UVEA 1JWUA 3P0YH 3CAFA 1KT2A 5BRZB 4DGIL 4UU9A 1T4KA 3IDGB 4R0LB 2P5WA 4KVNL 4NKOA 3WDHA 2YD6A 3P11L 4PGCA 4D8PB 3GMRA 4QRQA 2DTML 5HYEA 2XG4A 4M93B 5I1HL 5FUOL 1LQSR 5F21B 4NJAH 4CDHA 5C0JA 4FQCL 1KIPA 4AG4H 1H0DA 1S9VA 3SY0A 3ZZ1A 3WIHA 1B2WL 1AI1H 4LSUH 1SQ2N 1Z5LA 1SYVA 2BK8A 3W0WE 1MHCB 4NM8L 1D5XB 3QDJA 1WTLA 1SBSH 1R3KB 4XHQA 4MD4A 1YEJH 3IFNH 1C5DB 3BP4B 1PG7H 4XCEB 2Q7YA 3E6FB 4IS6A 1AD0A 4UT6L 5J11C 5FK9A 2ITCB 3TVMC 1YMMB 4YEEA 4FFZH 1WAAA 5E2VL 5SWZE 5ELIA 4MA7L 5D6CA 4NNYA 2X44D 3MLUH 5ISZD 3KS0H 1T03L 1KV3A 2CPCA 1PYWA 3NCYP 2Z35B 2D3VA 4BH7A 1P4LA 2XXCB 1LNUB 2NZ9C 3QWRA 5EZJB 3FZUC 1F4HA 4BZ2H 5D1XA 2MHAA 4PJFE 5FOBB 4GKZA 2V5MA 5CEZD 2R4SH 1MIEH 3H9ZA 3NCEB 5KVMC 4H25B 5FV1L 1G7MB 1WBZA 3TNNB 1MSPA 1ZHLB 4HIHA 4UT7L 1FYTB 2F54B 5I1KH 5MEOB 3VFPA 4LPVA 3QNXB 4NDMB 3N1FC 4BFBD 1F58L 3HS0B 5FYLE 2H32A 5D1ZD 4AEIL 4OM1L 5D2LE 5A16A 4OZGA 1IEBA 3V6ZA 3BH8B 5DT1L 5HHQA 1QG3A 2EYSB 1DBKH 3L3OB 5GISL 5EO1A 5IHZB 1CXLA 4RFEA 4HUNB 1HNFA 4LF3A 1RSFA 1C1EH 4UDTB 3C08H 4PRDB 5F70A 5I18H 5FCSH 5CBAA 1GZQB 2FSEA 4QRRB 5D93C 4OFIA 3F58L 4JM4H 4OBSA 5B3JF 2YD9A 2CMRL 2NY4C 5HYSA 5F96H 1M71A 4KQ4L 1JHLL 3SGJC 3SDXF 5E9DE 3WS6A 4GKSB 2AJ3B 2EKSB 2VL5A 3FFCB 1CGUA 4KKBD 4ZOBA 4PY8J 4E5XA 1JWMA 2DQEH 1FN4A 1ZV5A 2OL3H 4JM2B 1SMOA 4KUCD 4LLYB 1KEML 4IRZL 3HPJB 2Z91B 4Z7UA 3FRPA 1B0RA 4HJJL 5KSAC 3CZJA 4JKLA 4S2SA 1BQUA 2NNAA 4JRXA 5A2LH 1NGYA 3V79C 1FLRL 4JREC 1PSKH 2RCSH 1KJMB 1J1PH 3EJJX 3GNML 1DQML 3VXSA 2F74B 4HEME 4V2CB 5T5NG 3MXVH 4E41D 2OK0L 1R3JB 5DVKA 5BS0E 5DJAB 4HK0A 3AU1A 1FNLA 2JF1A 1JN6A 3IF1B 4P2RD 1BM3H 4ZUUB 5BW7A 5FUCC 2DQHL 5K9JL 1OB1B 1EZVY 3Q5OA 4RMUA 1R3HB 2FH8A 1MNUL 4KI5F 3MTRA 4OCXL 4WW1A 2OR8A 5EU3B 1TVBA 4GXUM 5EU5B 3OGCA 1YN6B 2V7HB 1N5AB 4WFFE 4FMFA 5MEQB 4CKVX 4I4WA 2HJFA 2R4RH 3FT4A 3DTXB 2APWA 1U9KA 3VCLA 3QI9C 1CQKA 4U6XA 1G6RH 3RQ3A 4PB0H 3LN5A 4OQTL 3SKNB 1LDPH 1Q72H 4XWGL 3REWB 2VXQH 1MF2H 5D72H 5C07D 4N0CC 1BVZA 4XAWL 4DW2L 3STLA 2O5XH 4G5ZL 5E1AA 1SM3H 5KSVA 3O9WD 4PIRF 2BY1A 4P3CL 5T1LB 2P8PB 1EVTC 4XT1C 4CGTA 2VN4A 2B0SH 5E0QA 4I9WD 3AS2A 3CH1B 1X4XA 3LPWA 2AABL 1EGJL 5EZIH 4V1DE 2JK5A 3ZYZA 5JPNB 4JFEE 2EYRA 4GBXD 4H5SB 3U4BL 5CP3A 5JOPD 4WU5B 3HNTH 4L4VB 2EDBA 1SY6L 1ACYH 1N64L 5JUEH 1IQDB 4HK3N 1ZGLA 2YUWA 4GFTB 4EZMA 2BSSB 2H26B 3WHXA 2C3XA 3BZEA 5ACZB 4HJ0D 1TZHB 1QFHA 4MQTB 2XY2A 4ZUSB 1TQCC 3MRLA 4MJ6B 3EOYG 3RVVC 3BW9B 2O61B 1OGTB 4KI1A 1N0LA 2EIZA 5IJVB 4ZQKB 4Y4KB 5D7LE 1TXKA 4HBCL 1FE8L 2J3SA 4JFED 4L8SA 1P7QB 1BOYA 4RA3A 2PTTB 1T66D 2A6KB 5CP7B 1N5YH 1KNOB 4YHIB 3DUSA 1A6UH 1N4XH 1O5DT 4YHYC 5IB4A 1T3FB 5DGRA 4TSBL 3QUYB 1OM3L 3RIFF 4TNWF 1ZHBA 2G5RA 3R0NA 5ISZA 2XOTA 2VKXA 2AK1L 4PGDA 2DQFB 1UM6L 2IADB 4UV7H 1FPTH 4XNUH 1YEIL 4PR5A 4R90H 3IGAA 4D9QE 4BYHA 1J1XH 2A6IA 3OKDB 3DURA 3UC0H 1FZKB 2VDKH 3SKMA 4XHJD 5C0AB 3PL6D 4P2CG 3KYOA 3DUHA 3MV9D 2I5YL 5IMMB 2RIKA 1PEWA 2BVPB 2ARWA 4DGVL 4XNZC 1J0YA 5K33A 3QZWA 2BOBA 3BAEL 5SWZA 4OLWH 3T65B 4BH8B 1K85A 5D1ZA 4Z78A 3GSWA 4U1KA 1HN1A 5ANMB 3ULVC 3W9EB 5J06A 1T2QH 2DIBA 3QIWD 2HG5A 1QSZA 1R24A 3PHQB 4BSWA 1VENA 2WP3O 4CL7A 3FO1A 3GKWH 5E2WH 4D9QD 4PJFA 3QXDB 2H1PL 4I0CC 3RDTB 3GSOA 3IU4L 5IW6B 4OLZH 2LVEA 1MHHA 2VLJB 1AGEA 1F2QA 4XWOD 1PG7W 3RWFA 2G75A 4PGEA 1WWBX 1QD0A 2YPKA 2ZCLH 4Y1AE 4L29B 5H2BA 3OR6A 4M6AA 4MZ2A 5D2LA 1G9ML 1N7ML 1REIA 4G9FB 5T3XD 4B53A 2Y5TB 5D2NC 2J8UE 2X4UB 3QUXD 1HQRB 4GSDH 3INUL 4JDZB 4FFYH 1EEYB 5JDSB 3WYRA 1OF2A 3I84A 1CICD 5DEFA 3JTSB 4ODXA 4F7CB 5TDNA 3MBEC 4S1SL 4UINH 3W11C 1AHWC 2LQRA 1HHJB 3PWVA 6FABL 2WUBL 5IVNA 3AB0B 3PIQB 1JPSH 3BKJL 3MACH 5DK0B 5KZCB 4JO3H 4MCZB 4XP1L 5DFVD 2O26U 4KAQH 5E9DA 4P46C 1VEMA 4TSCL 5E8DL 3L9RB 5M95B 3HAEH 5T3ZH 4YPJA 1GOGA 4M3KB 3P0VL 4C4KO 5I19H 1LO2L 3QWQB 5IFAL 4KVCL 1ZLWK 5B4MC 2HT4C 1NC2B 1IAIM 2XFXA 1NCDH 2LU7A 3FRUA 3QFDB 3ARGC 1G1YA 2ADIA 2IBGA 4IRSB 4WHYH 4O2FB 3EO1A 3MRQB 1VFBB 3LHPH 1IJ9A 4O02H 1X6NA 4A2MA 4FQXC 3VFWB 1I1RA 1IARB 2EEDA 4XBPB 5BS0A 3WSQL 1A7RH 4XGZA 1IC5H 3MNZB 4FTVB 1I7UB 1P1ZB 4LLDB 4NO0B 4LLUB 3TBWA 4TSAL 4HS8L 1A7QH 1BJMA 1Z9OA 4L1DA 5HHVL 3B9EA 3EYSL 3O9WA 3BKCL 1S7XA 2R8SH 4JO2H 2DLIA 4XXCA 4GAYA 3D2UA 3CFBB 3BN3B 4MJ5A 3VXMB 5GS2H 3IS1X 2AKRA 3EDEA 3FO9B 4HPOH 4GBXA 1BBDL 1CDBA 5IVXB 5D7SH 3FB8B 1NDGA 4LCCB 3EJZC 5L88H 2ZG3A 2EZ0C 4P59L 1SEQL 1AKJD 3UYRL 1KB9J 5BV7C 4HH8A 4Y2DC 1JGUH 1HHHB 5CEYA 4Y4HC 4LCYB 5D1QB 3VH8A 4B41A 3ULVH 4NQCB 2EDTA 2E8YA 3G5YA 2NY3C 4ODHL 3NFNB 4KRLB 4X0KA 5CEXB 4JHWH 1GGCH 2VABA 4BUGA 2WK2A 3ULUF 4QKXB 1KTRL 1SJXA 3VDCA 2A6DA 3CFKA 4MDIB 3NZ8B 5T1DL 3D25B 2IFGA 3LKPB 3QQ4A 1OPGH 4V1DA 1T7ZA 4KI5C 4LKXB 2HJLB 3FOLA 4HKJA 4Z0BH 4JFEA 4PJDE 4U1HA 2CRZA 5CILL 3OAZH 4X8XA 3RWHA 4X6EA 2NY2D 5DJZB 5F9OL 4U1MA 4YHMH 1ZGLM 2APTA 3MRRA 4Y5YB 3SDCD 1NJ9A 4KV5E 1UGNA 1DP0A 2C1PA 4HGWB 4DK3A 2J88H 3WUZA 2CR3A 5EBWA 3GSXB 1C16A 5AUMB 1TZIB 5I8KL 1FNHA 4FOMA 3I75B 1U0QA 1HNGA 1A6WL 2J5LB 4OD1L 2JJTC 5D7LA 3FT3A 3V0VA 2XXMB 2YPLE 5CIPA 1E0OB 3LQAC 3MV9A 2ZUXA 3FZUD 1T1ZA 3BSZH 5ABDE 5ADOH 1ADQA 4LSTL 5HGHA 4YHOH 3VGBA 5HDOA 1U92B 2FX7H 4Q6YA 4M7JH 3ZKXB 4EEEA 4CVXB 1K8DA 3QIWA 2R0ZH 4GO6B 1OW0A 3CCHB 3KYMB 2GHWB 8FABB 2DJ4A 4GG6B 4JHAL 1NMCC 3IFPA 3GEWB 3L3DA 5LXGH 2DDQL 4MX7A 4OM0L 3HE6D 3ZYOA 5J1SC 3M8OH 4YUEH 4HW6A 2GFBA 3P9MB 2VUOA 4HUWA 4KUZH 1BZ9A 2Q8BH 1UM4L 4G6FD 3RKDC 1P2CA 3X12B 2R0WL 3F7VA 5E6ID 4B0MM 4C58B 4U1SA 1CVSC 4M1DH 5IV2A 2CDFA 2Z8RA 4KWUA 3WXVH 4IEFB 4PJEF 1RZFL 1CD9B 1ROWA 3KJ4B 4DZ8A 5J13B 2NY4D 5JNYA 3FCTA 3HI6H 4PYHA 1XF5A 1S5IL 1CICA 3O11A 4M5ZH 5TQ0H 3VFMB 2FEDD 4QO1A 4U6YA 1B4JH 3MV8B 2K7PA 4IHOB 32C2A 4QY8B 1MY7A 4YFEA 2Q20A 2R1XA 3FB7A 5KSAD 2XTJC 4JY4A 4ZDHA 1YEEH 5HHXL 3O8XD 3UTQB 1LO0L 2V5TA 2J8UA 1U8LB 3GJEA 4UZGA 4JB9H 1MIMH 5BV7H 3UJIL 2FCBA 5F3HB 3S37L 1N0XH 3STZA 2HN7A 4XX1E 1ZKAA 3BPOC 5IVZA 4J3UA 1CWVA 1EERB 2Q7NA 2FGWH 1FC1A 3RZCC 2V2WB 3ROOA 2IGFL 4U0RC 3ZE2F 1CD8A 4LNVA 1JVKA 3P9LA 5BZWB 2H2PC 3MRIA 43C9A 5IBTL 3IJYA 4D9LL 4LIQH 2EXWD 2VLKE 4RRPG 4TPRH 4M6NL 4PRHE 3AVEA 3PWLA 3PWJB 4OAWA 4X6CB 3ZT5A 4WNQA 5JQ6L 3VGDA 3ZE1E 1O7SA 1DQJB 3HTLX 3QI9D 4DVRL 1RIHH 4R97B 1NAMH 2HTKC 1XGTA 4IDLA 5LGHL 4PJCF 3Q2CA 5HDLA 4BQ8A 5I1CH 4M1CC 4QT5A 3F12B 1GOHA 2PN5A 3UAJC 4JO4H 3GUTA 1CFBA 1JRHH 4U1GB 1YY9C 2DRUA 1IAOB 3ZDXE 5AZEH 3LQAH 5E4EB 4RMSA 4YXHL 3L5HA 4ODTH 1DDHB 5JHDE 3RVTC 2VZVA 3TV3L 4OSUH 1GGTA 1UVQB 1P7KA 2VAAB 1AKJA 1S9WA 2P8MA 2Y25A 3LRHA 4OFKA 5LWYL 2IMNA 3CUPA 4X5XB 4XPGH 5GGVY 5T3ZD 2BVYA 4NRXB 3PWNB 4DCQA 1BVLA 2ATKB 3H9HB 3B43A 2J4WH 2H8PB 2QSTA 5F1KC 3UTSB 2VR9A 2BNQB 4ONFH 2X4NB 3CFDA 5JZ7D 2BXZA 1YEHL 5KVGH 2VDOH 1A9BA 3ALWA 3RHWK 3IXAA 4ESKA 1IAIH 5GSVB 5FDWA 1A9EA 4FABH 3BO8B 5EUKA 2ADGB 1H5BC 4AL8L 3SGDI 2NY1C 4AIZA 2DI7A 4TVSa 2AK4E 3EOTH 3VXNA 3O4OC 1PKQA 1F13A 3VMOA 3SDCA 2ID5A 2VR5A 4PP2B 4X7CC 1U58B 1CT8B 3PHSA 2IAMB 2IEPA 1KCUL 2I60H 5FGBC 4E42A 1X5ZA 4ZTOH 3EFDL 3HMWL 2CR6A 1E4JA 3HZVA 2FX8L 5T1KB 2BY3A 4LU5H 4I2XE 3ILPA 3DGGA 1RK0A 2UWEB 2QQKL 5E2JA 1OTSC 4U31A 4PJDA 1UKTA 2W0FB 3HC0B 4MMZC 3C5JA 2HP4A 3ZDYE 3QDGB 1QEWA 5GS2D 3EYFB 4I0KA 4YK4C 1SEBB 3L5XH 5BO1H 1IQWL 4ISVA 4JFHE 2W0LA 5EUOB 4LRIC 1T1WA 1I7RB 2IANB 1QOKA 1JNLH 5I2IB 1I1AB 5AD0A 5INDA 3W5MA 4EI5C 3QIBC 4JN1H 3NIDF 2UZIH 4F3FA 4TTGA 1NMAH 1I4FB 1RZJL 3HE6A 3BP6B 1GGUA 2K1MA 5D7IB 4JZJC 4FQQA 2YPLA 1A6PA 4L9LC 3B3IB 3KPRE 1I1YA 2FATL 4I48B 3ULUC 3BN9D 1IM3A 4P2YA 4M1GH 5ALBL 1H3PL 1O7VA 5E6IA 1MLCB 3MA9H 2ZZUT 2R69L 4GS7C 3K80A 4WWKA 3MX0A 5E8OB 4NJ9L 5ICYB 3AREB 2VISA 3BH9A 2VLRE 4X9GA 1W72B 2VZOA 3NFSH 12E8L 5I66A 3QO0B 1RMFL 2FHFA 4ZD3L 1F6LL 2VB5A 2VQUA 3QYCA 4LRNH 2FWOB 5IIEA 2EDXA 1DEDA 3BT2H 2AP2A 1NUDA 1Z0MA 3KPRD 2OM5A 3MRKA 1T04A 1A21A 5EU4B 2ERJC 2QJDA 3N9GL 3THML 3VDAA 3T0EB 4Z7VE 1E4XI 3MBED 3W11D 1W2KT 2ZOLB 5IR1B 4TUOB 5GRUH 3T2QA 4Z5RA 5KSAA 2VDQH 4FQ1H 1AGBA 2CUMA 4NCC2 4GRWE 1NL0L 1OOAA 2F8VA 3O8XA 2VJXA 4MQXC 4UQ3A 4P5TB 5JPMB 4QXUL 4XP4H 4P46D 1V3MA 4LFHG 3PF2A 1K6QH 3S34H 3BE1H 3EJYD 4MCYA 5B4MD 1FDLL 5IROC 5ALCL 3ARGD 3GI8H 4OD3L 1A3RH 4LNRB 1MJUL 4O00A 3TBTA 3BGFC 4XNYH 3L7FA 1RK1B 1QBML 5HHPB 5GRZA 2A77H 2JB6A 3B5HA 4YXKH 3HZKB 2D7TH 4L8DB 3Q6FA 1MQKL 5BVJA 4IDJH 4RFOL 3PP4H 4JZNB 3CFIC 4WIQA 5CJQL 3S5LG 1OHQA 1DQLH 1DSFL 4ZFFB 1VGKB 1BFTA 1JZ5A 1CDCA 3PG2A 2P5EE 4FZEL 2LV4A 3SDDB 5ENWB 1Q9KA 1TIUA 3RX5A 4PJXE 4X6BA 2Z8VC 4L4TD 5ESVB 5IQ9B 4YZFF 1EBAA 4HXBH 4HGKC 1U91A 3RUGB 1S7SA 3A6BL 3Q48A 4Y8AA 4PRHA 3BISA 5DRXB 4LPXA 4I18C 2OYPA 2GAZB 3D85B 4K3HA 3V7MA 3FJTA 5FYLH 3KPQB 5DC4B 2WINB 4UU9B 2YD2A 4ODSL 2XTLA 5GGQL 3EJZD 1MJJB 4YDVA 5D7JA 2EZ0D 4XPBH 4HV8B 1T22A 4Y2DD 1YN7A 1H3GA 3KPOB 3LN9A 4Y4HD 5HGGS 5EC1A 4KK9C 4MB5A 4WI9A 1TTGA 3MUHL 2NY3D 3O41A 3WJJC 3OX8A 2HRPH 5MENE 4O2EB 2PYEB 1OAUH 3RIAK 5JHDA 2PUQT 3L5JA 5KVDH 5LAXA 1MLBA 1KELH 1JI1A 3ULUH 4KI5D 2MCPL 4JFDE 2CDEB 1SYVB 1Q0XH 4EOWH 5FOJA 3QDJB 3ECBB 1W72L 3MA7B 1A7OL 2MNUA 4X9FA 3K2UL 1RZIB 5FECB 3BZFA 4I5BA 4KTDH 5HI4C 4FZ8H 5E5MB 4UTBH 4HPYL 1A6VL 1CYGA 5GGRB 4OFVA 5IHUH 1L7IL 1ND0A 1RVFL 4NM4H 5IM7A 5MEND 1Z9MA 4KMTL 5JW4Q 3VW3H 2OI9C 4HULB 5F3BA 4QXGL 4U1IA 4AY0A 4PJ5E 5KAQG 1Q38A 3JUYA 2AK4A 1AY1L 5J1TC 1D7FA 5EIIB 5C0FA 4NWTH 1IBGH 2R29L 4ZAKB 1NFKA 4ETQB 5L7XH 5IHLB 2VR4A 4R4BA 5I9QB 2R23A 1ZLSL 5F7KC 1A6ZB 1V7NL 2I07B 4XCYB 5L9DL 4KMLB 4AH2B 1CFNA 1RZKC 3OBAA 1NCBH 4OZFA 2B4CH 3G08B 4N0YH 4JY5H 2IPUG 4WEBL 3D3VB 4WHTA 4IJ3B 5DO2C 4JLRB 3C8KA 3QNZA 3B2UC 1CE6A 3UJTH 2PR4L 1YJDL 3DXAB 1LO3L 3GJFA 2ZOKB 4NIKB 4CVZB 3GMLA 2CLRA 5HHMB 3MNVA 3MYJB 4G43B 4MAYB 3WLBA 1EHAA 4ODWA 1FV1B 4HFWA 1UACH 2XZAL 1KCVL 1ORQA 3I9GH 1CLOH 1FFNA 4DKAA 1MVUA 3ARXA 3RKDD 4BSVB 5E94B 3GSRA 1K8IA 1I8LC 5EN2A 1CGTA 3H8NA 4LKCA 3L7EA 2HLAA 1NMBH 5D2NA 3QUMA 3G04B 2BMKB 2ZJSH 4R3SB 4BZ1H 3KPRA 4NZUL 2DWEA 3BDYL 4IIQC 4WHDA 2ICWB 1MAKA 2X6MA 1FFQA 4AEFA 4ELMB 1S7WA 4UNTA 3MBEA 3U4AA 3T0XA 1PD6A 5DHYB 1JF5A 5EOTA 1CG9A 1UQSA 3MV7D 2VLME 1UXWB 4XNQB 5FYKL 4K7FB 5EZOH 1WFTA 2VLRA 1F90L 2KDGA 1G7JB 4S2SB 1WQVT 2XTJD 4XVJH 3HLAB 5KW9H 2K9UA 4GQPH 3VD3A 5KG9B 3LQMA 1HDMA 2B2XL 3IKKA 1WCBA 4K9EC 5C0RL 4R7NA 5LQBL 1F02I 4PJHB 1CIUA 3ARGA 1WT5A 3B6SA 3WNOA 1XIWD 4UB0L 5F72S 2BXYA 2FIKB 3DRTB 1A1OA 4UDUA 5I74B 4HUUB 3S4SA 2H2PD 1E6JH 2PXYB 2OS7A 2VLLB 5IMLB 1KB5B 3OKOA 1G1CA 1KJ3H 3MFGB 3MRBB 2GK0B 1AO7B 4K7PX 4Q2ZB 4DTGL 5TE6L 1DE4A 2YXMA 3C6LD 4JFYA 1M7XA 5C6TH 2AGJL 2YUVA 3NPSC 1ZANH 5SV3A 3SGEI 1N59A 1Z6JT 1G7IB 3SDXA 1J8KA 4LSSL 4F33A 5IWLC 5DR5L 4OGYL 3HZMB 3VXTB 5I30L 3EFFB 4YBHA 5CSZB 4U6VH 4X99A 4PTUB 3UAJD 4G8FB 4EUPA 4UAOC 3DROB 3MGAA 2V9TA 1XFPA 3ARZA 3L3JB 5C86A 4NUGH 2IH3B 3MXWL 4AENB 3OG6B 2YUXA 2AJSL 3MLTB 5DWUH 2A9MH 3QJFA 2XN9E 5GRVL 1MJ7L 2YHGA 2P5EA 3LS4H 1QFWM 4G3YL 1NDMB 4WFHD 4Y4HA 1RZKH 1B90A 4PJXA 4TQEH 3CVHH 4H0IA 1EA9C 3DVGB 1WTGT 3IRPX 4JFFD 5GGVL 5MHSE 3JWDC 5IW1A 3WNPA 4OZHB 2W0PA 4OCRL 3QG7L 3Q5TA 1JNNL 4XPHH 5DLMH 3NCMA 4NO5B 4RGNB 4OTXH 3R1GL 5HY9B 4NKMA 2V7NA 4MQ7A 2DQJL 4JFPB 4WUUB 5DMKB 2HJKA 2BNUA 1OTUD 4KJQD 4PJ7B 2AEQL 3IDMB 4RAHA 2IPTL 4EXKA 4X9BA 1FGVH 3HMXH 3V5HB 5A2IH 3DX9B 4KHTL 4GMTL 4OCWH 4P2QE 5MENA 2W60A 5MHSD 1FNSH 2R15A 4Y4FC 2NTFA 3EAKA 4YDKH 5ISZB 1BOGB 3IU3A 2DYPB 5ID0B 1UCBH 3VFTA 4P9HL 1OTSD 1I7ZB 4XP5L 1UWXH 2DQUL 3KPLA 5SWQA 3GZKA 3N1MC 2ED8A 1RJYB 1PFCA 3DI2B 1RUQL 2CQVA 4KRNA 3MCKA 4XC3H 2B1HL 4QRSB 2HFEA 1U42A 1RPQA 1R5IA 2D2OA 4QHLB 4M6OL 2MMXA 5L0QC 4EI5D 1CGVA 5EBLA 4HWZB 4XBGB 1RJLB 1BFVL 5B8CC 5FM8A 2C3VB 4K9EH 4PJ5A 1NANI 1MI5D 3DX7B 3QCUL 1FHGA 2AJYH 2HT2C 4MXVE 4PRIE 3MJ8A 5K9KA 5C7XH 1BLNA 2BY2A 2G9HB 3NGBC 3DRQA 4XH2A 4NO2A 3CXDH 1F4XL 3T2PA 1KB5L 1SMAA 2Z9TA 1UXSA 3SDAB 4NN7C 2G75B 3SQOH 2A0LC 3SO3B 1I3GL 4OUUB 2BC4A 4XXDB 5I1DB 1MRCL 1JYWA 4JKPH 3RVWD 3H42H 3L1OH 1QA9B 2ZUYA 5F7DB 3KWWB 4H20H 3UPRA 4GW5B 5DD1L 4NO3A 5LCVH 3WUWG 2EH7L 4J1UA 4PRID 1DBML 4PJBB 4NUJB 2I24N 1K3IA 5HI5C 3S5LB 3S35L 3IJHA 4R4ND 3T08A 2NW2A 3MRMB 1IEHA 3NH7H 4PJ9C 2D9QB 1DVFC 4OGAC 3OPZL 3PWVB 4QHMB 1B0WA 4N8VA 5IFHH 4KZDL 1Q94B 1V3LA 3EYOB 1MWAB 4HUVB 3B83A 1RHHA 1B0GA 4MQXD 4QRTB 4PGBB 4X6DB 4CNIA 4E41B 4G80A 2O5ZL 3HNSL 4AT6A 1OGAD 4W6YB 4MJ2A 2CO7B 2CLZA 4P2RB 2AV1A 5TE7L 3L3HB 5ITFA 1P5VA 3FFDB 1BGXH 3JWDH 1A8JH 1XIWA 4NC1C 3WCYA 2YUZA 4X4XA 3BYYA 5HDQL 4FXKB 1F3JB 1U95A 3LKRA 3L5IA 3VFNB 3GB7A 4TVPH 4OF6A 5EFIB 3HA0A 4WW2B 4PRBA 4N90D 5IVXF 4F7MA 1QVOB 4JY6B 4WTXA 4RGOL 4CMMB 1JGLL 3OAZK 4ODBD 1BX2A 3E6HA 2H6PB 5EU6D 3C6LA 3GBML 1YYML 3H3PH 4NSKB 4ZFZB 1F4AA 1ZTXL 3MUJA 4HIJA 3C2SA 1RZ7L 3LCYA 5T1MA 1I9IH 4NHUA 2NYYC 3MJ7B 3PP3H 3VXQA 1KIRB 1CR9H 1RJZB 3ORJA 3G5VA 5C07B 3GM8A 5F7YC 3O3DA 2BJML 2BVOB 4HUMB 3VGFA 4PG2C 4PB9L 4AM0A 2ZUVA 1CFSA 3MRFA 2D7NA 2F5AL 3IAPA 3Q1SH 2MCG1 3BPLB 4HC1A 5CEZL 1EPFA 2HWZL 3MLSL 5FO8B 2AJXL 1DQQA 1D3CA 1A02N 1NGPL 4GRMB 3ZE2E 4TULL 1RULH 3UTZB 2DBLL 5E08L 5CKGA 3P30H 5ID1A 4LAJH 1DBAL 3CLFL 1KXVC 1VB9A 1YY8A 3RWEB 2F8OA 4MNHA 1G9MC 2BRRL 3N85L 2O5YL 4RQQB 1NBVL 4LQFH 3LQZA 4HWNA 4NQTA 4LCIH 5ESAB 3UZVB 1O0VA 2F53B 4KK9D 1A1MB 1D5BA 4Y5VC 1HINL 4HEPG 1JGDA 4N1EA 4XC1L 1DTUA 5GZOC 2J2ZA 1MCKA 5F89B 1HI6A 2XWBA 3MNWB 3D0LB 1KN2L 4NQVA 5E2TL 5DJ2B 4S1DC 1PW3A 3RWCB 1NKOA 1YPZE 1UA6H 5I8CA 1H15B 3L3IA 1E4KC 3ABZA 4XMPH 1DLHA 1HH6B 5FGBA 3LZFL 4GAFB 4GG6F 1AC6A 1AXIB 2R2BB 1X5LA 3QNYA 5KSBE 5F7MC 4G6JH 4K94L 5DD6A 4QF1A 3TFKD 4JZOB 3NVQA 3U7WL 5T5NF 4AEHH 4YO0A 1A7NH 4ACPA 3FO0L 4PD4J 2IQAA 3HAEG 3QAZB 3CPLA 3PL6B 5DHVH 3V6FA 2AS5M 4HIIA 3BQUC 1DJSA 3K3QA 1MWAL 3PHOA 3BGMB 1T1ZB 2YPVL 3MGTB 4HF5L 5E7BA 3I3DA 1FE8H 1RUAL 4EI5A 2I9TB 1A5FH 1WVZA 3SE9L 1S8DA 3Q6GL 2V17H 1DL7L 1S78D 1KFAL 1QFWH 2WIIA 3O6KL 1LE5A 4LPCA 3C09C 1QLRA 1WFOA 1X5JA 3P77A 2JB5H 3OKNA 4K3EH 3W39B 1D6EB 1UM6H 2M8XA 3QP3A 4PLJC 4JPWH 4M48H 4P3DA 4P4KA 3TWCH 2QR0A 3V7AE 2B20A 1BFSA 4JN2A 2CKBH 4N9GA 5SWSD 3VA6A 1FQ9C 3FN3A 1I8MA 5I75C 2L7UA 1M7IB 1CGSL 3O2WL 4LSVL 2V2XA 5CJXA 3EGSA 1JE6A 1AGCB 1QSEE 3KJ6L 4DGVH 5HYJE 2NTSP 4ZNCD 3VJ6B 5CGYC 4HX1A 4DZ8B 3QUXB 3R06B 3O3EA 4PRIA 3F7PC 4KDVA 4NNXB 1MUJA 4PJIE 1CICB 1CCZA 1UWGL 4OLUH 4EIGB 1MFEH 2NW3A 3WXWL 1AXTH 1MRFL 5EA0H 3IDIA 3OJDA 1P7HL 3CMGA 2H1PH 1EUTA 1KC5L 4LSQH 1PLGL 2A74B 2EIBA 4X6CF 4K71C 3V4VL 3B5GA 3GSUB 4POZC 2JELL 3D9AH 2EYTB 2VXUL 3U46B 4NKDA 1SYSB 1BP3B 1XZ0B 1UZ8A 2Y7QB 1EEZB 3GBNL 5LVEA 1DUZB 3PGCA 3B4NA 1F5WA 2DM7A 3AY4C 4X6FB 1Q9LA 4PS4H 4YGAB 1RIUL 3TA3C 5GGSB 5E2UH 5CGMA 4JJHA 4W4OA 5GS1A 2NX5E 5EPMA 1JPTH 4MSWB 2Z4QA 5DK2A 1NBZA 1KGCD 2HFTA