5CEZH

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
231
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIRQSPGKGLEWIGYISDSESTNYNPSLKSRVIISVDTSKNQLSLKLNSVTAADSAIYYCARAQQGKRIYGMVSFGEFFYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPSSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 33
structure length 231
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezH01
3RWFA 2VXVL 1WAAA 4G8EA 4F15B 5D7LD 3KPLA 4WJ5A 5H35A 4PUBL 3O4LA 4IRSC 1A1OB 4NHUA 4R4BA 1C5CH 3QIWD 2WLYA 2P48B 4FFWC 4KRPD 5EO9B 1NGXB 1CGXA 3CX5J 1YY8B 4Y19A 2VDNH 3LKRB 2AV7A 4MNQA 3QI9A 1VADA 2FGZA 3HE7A 4MWFB 3S35H 2ZWLT 4M1GL 4YHOL 4OV6F 5KVGL 2JELL 4Z78B 1N3NA 3OXRA 3O6MH 3S37H 4ZOAA 4LIQE 3IKKA 5D7LA 3GI8L 3ALWA 4QKXB 3CCHB 4X0KA 4PGDA 5JW4M 1PY4A 2NLJA 2MCG1 2X7LB 5IK3A 4GBXB 3AM8C 1X4XA 1AE6L 2HKFH 3EOAA 4X6DF 1L6ZA 4CVXA 2FHCA 2IAND 3M8OL 4M6NH 3AS2A 4U6HB 3IF1B 3NFPB 3VFOB 2X40A 2D31A 2H6PA 2OM5A 4H8WH 1OB1A 3KPQB 1VGEL 3TESA 2LTQC 1EPFA 5DF0A 3GI9L 4R0LB 3MLPA 2R69L 1CIUA 3DVIA 3FCTB 1K3ZA 5L7XH 3TBSB 2OR8A 1A7QH 1S7WB 5IMMB 4FXLA 4GRWE 3G6DH 1SBBA 1B4RA 1I8LC 4ODHH 4LHUD 1T1YB 3MRLA 1SY6L 2XZQH 5LCVH 2GSGB 3MRKA 4F37F 4X6CE 3PHQB 1T2XA 4AT6A 1RK0B 4IIQA 2V2TB 3W0WB 5ACMA 1F4XH 1A6PA 3MBED 2FYYB 5IFHL 3QIUA 2EDRA 1YJDH 3P2TA 4LHUA 1T5WA 4LSSL 1FGNL 4FQHB 5KSVA 2B1HL 5DK0A 1JWSA 4GRLD 3KNBB 3CC5A 4HUXB 1P5VA 2UZIH 4DOHB 3UJIL 4WDIA 5GISL 2JCCF 2P8PB 4RWHA 3RY5A 2YR3A 4YFDB 4TNVF 1F11B 4XVSH 4H26B 1TJHL 5I73B 3MBEA 4Q2ZA 3U4EA 3QH3A 4NJ9H 3BQUC 1P7HL 2IADB 4RMUA 1OGTB 1T0NB 3QDJE 1QFUL 1A3RH 4HIHB 3NPSC 3G5XA 4JJHA 4JN1L 4UDTA 3PNWA 3RKDC 2N7BA 4GT7A 1U3HC 4DVRH 5JW4Q 4FQIH 4PRPE 2VDQL 1ZMYA 4TUJB 3HRPA 3SE3A 4Z95L 2R9HC 2CKBB 2CIKA 3TT3L 1CU4L 1JN6B 1T22A 3EKCA 3QUZC 4NP4H 2KPNA 3P9LA 1JNHA 43C9B 1IGMH 2WWKT 3MLRH 4ZFFA 5EWIH 3MROB 2B0SH 1NC4B 5TF0A 5ITBL 3C5SB 3CFEB 4LBEA 5F8QC 3G6JF 3RWHB 1GZPB 3LDBB 3S36X 1QRNE 3KR3H 1PDKA 4YK4B 5SWQB 3UX9B 1ZANL 5IV2B 1TJIH 2EIZB 1XF2B 2C3WA 4MX7A 5JW5B 3P73B 4M7JL 3D39D 4A6YA 5KS9E 3ARXA 4OFIA 4CVZB 4EN3D 4GW4A 2BSTB 4L8CA 5DMIL 5CCKL 1NGZA 3CNKA 5BVPL 2DQGH 3L9RB 4JFDA 5CEYA 3KJ6L 4L9DA 1INQB 4JQVA 1Q9WA 2FATL 3UTOA 2FLRT 5HHPA 1NMCB 3BPNC 2OJZL 3MFFA 1YNTB 3VH8A 5SV4A 3Q2CA 3R0NA 4NZUL 3D39A 3ULUH 1MHPL 1MAMH 4OF5A 1OY3B 2UUDK 5EOCJ 4EN3A 1RZKL 3NCBB 4HHAB 1I8IA 5MP6H 3DVGB 3OKOB 4ZUSB 4JFZL 1CTNA 2HFEB 5ERWB 4PV9B 1GC1H 4W6XB 4Y2DA 3SKUD 3RZWA 3QEGL 1AKJB 3IFOA 6FABH 4R7DB 5DURB 3S4SG 5JZ7D 2F19H 1VHPA 5IKCB 2DMCA 2OX5A 1LO2L 1U8LB 4MA8L 1Z9LA 4QOKE 3S96B 1NFIA 3MLXH 4PJBB 4XNZB 3ZKND 2A77L 2F74A 3JTTB 4JFHD 4PJIB 4IRJC 5FM5M 4KV5E 4LLUA 2P8MB 1MJJB 1J7VR 3MNZA 1FYTE 5LG1A 1QR4A 1BQLH 5T1LA 4M1DH 4L3CA 5SWSD 3U83A 5HPOA 4XT1C 2BSED 5AUMB 5FO8A 2YSSA 4QHKJ 1DQTA 2VE6B 5A43C 5ADPH 4E9LA 2YPLB 3G5VA 4JY6B 4XBEH 3N50A 5CEZE 1N59B 1JVKA 4CL7A 4PB0H 2OSLA 3PUCA 1FE8L 3QG7L 3W82A 4ZXBB 3O8XA 5BZDB 1FFOB 5DJZA 3FT2A 4P4RA 4X6DE 5A2IH 4TRPL 3HNTH 1XIWB 1KENH 2DI7A 4PG2A 4NFDA 1JGEB 3GBML 5CILH 5KW9H 2JJWA 4MQ7A 4I0KA 3O2VH 5I15L 3S8WA 2EDLA 2XWJB 5IB1B 3E6FA 3AMLA 5HJ3B 3X3GL 3P4OA 5JHDB 2VLLA 1EHAA 7CGTA 1YYML 3DETC 3THMH 4HMDA 5JORA 3TNNA 4FP8H 4K8RH 4HUKB 4U33A 5C3LD 1BPVA 2V2WA 1NDMB 4HT1L 4H1LH 1MCJA 5IB4B 1I1FB 2Z4QB 1C5CL 3AS0A 1RK1B 1W72A 2P5ED 5D2NE 3TO2B 1KPRA 5CKAA 4DZ8A 2EDDA 5L8KB 4J3TA 1LDPL 1WT5C 4FQJH 2VDNL 3FQUB 5TDOB 3C5ZC 4PGBA 3WO3B 4OLVH 1EA9C 3S35L 5MERA 1BECA 1YEFH 4EIGB 5F1SA 3O6ML 4KK8C 3S37L 4KDWA 2VR4A 4JN2B 4KHTH 3B9KD 4I18C 4UUJA 2PO6A 1EBPA 4QYOA 3L3KA 2GTZA 2JCCE 2W0PA 2X9XA 3OSKA 4RGNE 1QBMH 3RVXD 2P5EA 2HKFL 1M1SA 5DJ2B 4M7LH 3EGSB 5BS0E 2HN7B 1K8IA 3FQXA 1PX3A 4OLEA 1X3DA 4HK3N 4M6NL 4G6KH 2HT3D 3DX7A 5L2KD 5D71H 4C56D 2DLTA 3RPKA 5CJQH 1I9IH 4PJEB 3SDYL 3DWTA 2ITDA 4P5TB 1XF5B 2CDGB 3QUKA 4YQXH 5L7XL 3QNYA 4H88H 1Z6JT 1A7QL 2X09A 3R06B 2OMNA 5EU4A 2OK0H 2LV4A 3G6DL 4MD4B 4BQ8A 1KG0A 2AEQH 2FX9H 2PYFB 3B2UD 5H8DA 1K6QL 4ODHL 4K7PH 2X89D 1VFAA 3I6KA 3OAZK 4GUPA 2CLRB 3E6HA 2X4TB 3OB0H 4CW1A 5L2KA 2GEEA 2YN3A 4OQTH 4C56A 1P4IH 1ZLWK 2CRYA 2IC2A 5IBTL 5E8EA 4N1HB 1MHEA 1F6FB 4L4VB 4XP6L 3G6JE 2H9GA 1F4XL 1FL5B 5E2UH 4YX2H 4U0RB 3Q6FB 3MV7B 1NBZA 2R0ZH 1XMWA 4PBXA 2I26N 3U1SH 1K9TA 2PUQT 2YRZA 4M48L 4TTDC 2LABA 4J1UA 4JRXE 1TZGH 3HS0B 4AJ0A 2JJTC 1I1YA 1T3FB 2UZIL 3SJVA 3B3IA 4WWKC 4XVSL 3GMOB 1I1AA 4ONGH 3AB0B 3BDYH 1X5YA 2CIIA 3DX9A 1S7TB 2BFVH 3KVQA 2NX5E 5JW4R 1FZJB 2APFA 3JV6B 5E8DL 1EEQA 1LK3H 1QFWM 3WFCL 4H25A 4DVRL 4FQIL 5DYOB 4MJID 4HLJA 4HK3J 4I0CC 1HHHB 3V5HB 3VGAC 2X1QA 1R24A 3UYOD 4I5BA 3O0RH 2R15A 3FN3A 4A6YL 5I8OL 1KOAA 2X4UB 2AJ3B 4OV5B 5EWIL 2XRAH 4WUKH 1DQQA 3G5ZA 5K9KB 5I6XB 3CSPA 3DMMD 3M07A 3HMWL 3RNQB 4XCFH 2Y36L 2IALA 5CHNA 3WKNA 5EZIH 1Q94B 4XMLL 1TZIA 4X98B 2A2QT 5C9KA 2ADJA 3EYQC 4X99B 3PDGA 4YWGH 3PQYD 3BP5B 3BAEH 4IMLA 4LFHD 3P0GB 4TQEH 3C08H 5IJKC 2AEIT 1Q72L 4MSWB 1CDJA 4OLUL 5I74C 2GSIB 3DMMA 2Y06L 1J0YA 1FORL 2EE9A 2NXYB 2J8UB 4NQTA 3LEXB 4NNYB 1D9KB 1G6VK 2YD9A 4OD2A 2XFXA 1JPTL 2FB4H 5DJ0A 4P5KA 2R8SH 3LPFA 3ULUL 4QRSB 4XNMA 3VXQB 1NL0L 1RZIB 4Z5RB 5MP6L 1HQ4A 4Y1AE 5FKPB 4JPIB 5CP3A 2VISB 4G9DB 5F1IA 2NY0D 5JOFA 3O4OB 5FECA 1GC1L 3U7AA 5I76B 3EFDH 4M6AA 2XACC 2R29L 4NO0D 4HF5H 5T33L 6FABL 3WJLC 4YNYB 4WFGE 5D2LA 4TYUA 3UTQA 2VN7A 3SKOA 5I1DA 2HLAA 4B50A 2F19L 4H20H 3FFCD 5ACZB 3VXOA 1CGSL 5JHLH 1ETZA 3BMWA 1ZWIA 1U8JA 3MA9H 4NFBA 1DBJL 1CD8A 1HOCB 3IU4H 2HTLD 4NO0A 3H9HA 1G6RA 1WCBB 2NY2B 4NOFA 1RD6A 2IGFL 1UJTA 2DQJL 3EDDA 2X4SB 3QDJB 4YE4H 4NKMA 5ADPL 3IKCB 4HUVA 1AGFA 2UZXB 4XMPL 5H94A 1RU9H 1QNZH 5E5MB 1WTGT 5IEHB 3GKWL 1IC7L 4ALAL 4Z7QF 2Q3AA 5D7SH 4FQXB 1GOHA 3V7AG 3GMQB 1EO7A 2AVGA 5CILL 5E8OB 5KW9L 1I7RA 3DHMA 3FB7A 5C09E 1DUYB 4GG6A 1ND0B 1QRNB 2DIAA 4P9HH 1W72L 2ADIA 3QRFM 3MGAA 3V2AR 5L2JB 1G9MH 5DA4A 1QBAA 3S3SA 1T21B 1UB6B 4X80H 3VD4A 4IRZH 5KS9B 4YDLC 4OGAC 1S9YA 1MF2L 1A7OH 3RL1B 4FP8L 1C12A 1OTUD 4QRPD 1A2YB 1BBJB 4ZUTA 3SHSA 4YBLB 4KI5D 1J5OL 3U2SB 1BVLB 3TN0D 1BP3B 3I3DA 4ZOCA 4OLWL 5E8PA 4JAMA 1FYHB 4PGEA 5FYJH 3LKQB 2PTVA 3I3EA 5IHZA 1NC2B 3JSSA 1AHWC 1NBYB 4L9LB 4QXGH 3KPSA 3BGMB 4YFEA 4BSVB 5IF0B 1LE9B 3FOLB 1YEFL 5T1KA 1A7RH 1ZLSL 4P57B 4QRPA 3GKZA 4KHTL 3MNVA 3CUPA 2F54D 2JIXD 4UTBH 2I9TB 3GJEA 1QBML 3L3OB 2ZOLA 2VLJE 5DK2A 1KTDA 3FB8B 3G04B 2ADFL 4M7LL 4UILH 4YC2B 3MLTA 4LLVA 5J6HA 4CADA 4FFVD 4ELMA 4Z7NF 4WU5A 5D71L 1IAOB 1I9IL 4QOKB 2VLRE 4NN7C 4Z7WF 1YUHB 2Y4SA 1PZ5B 4YQXL 2BXYA 1OL0A 2LVCA 2J5LC 4RRPA 2OK0L 5LGKA 3AU1A 1ZT4B 4XGZA 4LARH 1D5IH 1I85C 1TPXB 3HZVB 4L3EE 4R2GB 4CDGC 5IWLA 4WFFD 4OQTL 3IJHA 5GS2D 2WIIA 4O5LL 3TLRA 1R5VA 3RIAF 3U4BH 1WWBX 3BP7B 4YDKH 4XXCA 1T1WB 4ZDHA 2AJZA 1G7PA 3VA6A 4TVPE 5TH2A 1YA5A 5E2UL 4U3XA 5C0AA 3U1SL 3MRJA 5EN2A 3BUYB 5T3ZL 3GMMA 1N7MH 1EEYB 3MUHL 4LCUB 1CXHA 1TZGL 4LCIH 5C1MB 3O2WH 2D0HA 1ZHBB 3GSNH 1FJ1A 1UB5B 2A0LD 1CT8B 5DJXA 5IM7A 1J0KA 2ICEA 4GAJH 2H2PD 4PJ7F 2IH3A 4WHYG 5EIQA 3RVTC 2Z31B 3BDYL 3ARBC 1N64H 2EH7L 4HUNB 3ELAT 4NNPH 2BFVL 4ODUB 2FO4A 3RGVB 1S5HA 5EBMA 4HPOH 3PL6D 3FO0L 3ILQC 5DD5L 1LK3L 1WIUA 4PRHD 3GSNA 2VL4A 4P2OA 2YD3A 5HHXL 2IMNA 3WL9B 1ZLUK 1JGLH 4KJPD 5D2NB 1H3PH 5A2LH 4HFWA 4KTDH 1U92A 3EO1B 3ARDD 5DDHA 1TTFA 2IPKB 3QDAA 3VXTB 4OFYD 3I3BA 1U8QA 3IDGA 2R0KH 1BD2D 4S1DD 4WUKL 1YEGH 4EI6A 1A1MA 5IVXB 5C6WH 4LCWD 1WBYB 5DJYA 4XCFL 3KPRA 4RMQA 5EZIL 4RGNB 1YQVH 3T65B 4Y5YC 2YBRA 1S7UA 4MDJB 4R7NA 1HXYB 3CU7A 3RTQC 2YD7A 3FONB 4MAYB 4GW5B 4NKDA 5IEKB 1EO8L 2CMRH 2DJSA 3QXUA 2B4CC 5E7BA 4NUJB 4OUUA 1BD2A 4EI5D 3ARSA 1CDBA 5GS1B 3QNXB 1BQHG 2EDWA 3WDJA 1ACYH 2PYEE 1XEDA 3FQRB 1I7ZB 1FFNB 3EDEA 5ICXB 3MLVH 3QIWB 1A7NH 1IILE 3O41B 1U8MA 4HS8H 4NQEE 4NBXB 4RGOH 3PWPE 4MD5A 1L0XA 2R8SL 5KVEH 4MNHB 4Z7QE 2J8OA 3FRUA 3SE4C 5E08L 3BIBX 3FHAA 1FFRA 4KH2A 4EI5A 4QRRE 2VXQH 3OQ3B 3HE6A 5GZND 4FFYH 5D7JC 3KG5A 2HJFA 3H8NA 3EFDL 4JLRA 3G6JB 1ZEAL 1G6RL 3TBWB 2BOBA 3SO3B 4DVBB 4GAGL 1MIML 5KSUA 2AK4A 1C5BH 5DLMH 5C71A 1YEHH 4H20L 3ARWA 2DQHH 4JRXB 4HKJB 2DM7A 1MWAA 4DQOH 5JHLL 2FJGA 3W39B 1JK8A 1FIEA 3MA9L 5GS0D 3NZHH 3FKUS 1JWUB 4IBLT 1TITA 1OT1A 5ICYA 1N5YH 3VJ6A 2GAZA 2X4PB 1M7DA 4LDEB 3VMPA 4H0IA 1TETH 3WSQL 1BX2B 1CICA 2R1YB 3HAEH 2XKUA 3EYOB 5JPMA 3VFUA 4E42A 4M93B 4ELKA 3T08A 2NX5B 3ARQA 4YE4L 2DIJA 3STZB 1CDYA 3L5XH 4XPGH 1ZK9A 5ISZD 5MENE 3FHQA 1KT2B 4HK0A 2JJVA 3T4AB 3EYUH 4Z8FH 4OB5H 5I16A 5DT1L 5D7SL 3T1WA 2NY4D 2IPUK 1S7VB 4OZFH 4WI4A 2B2XH 4Z7NE 1B0RB 2R2EA 2WANA 3QJFB 3VFGL 2I24N 4NRYB 4WU7A 3P77B 5E4EB 3FJTA 3ULVL 1M7IA 4UBDD 4ZFZB 1WQVT 2YD4A 3HC0B 4QXUH 1HH6B 3UZQA 3TYGL 1JZ7A 4M7LT 3U0TA 4POUB 5IFAH 3G5YB 1A7OL 4LPWA 4JJ5B 4OZFA 2FL5B 3I6LD 2WP3T 3O3BB 3TBTB 5ESQB 4QLRA 1KIQB 3O6LH 1RIHH 3ZTJG 5EBGA 2E9IA 4P4KA 1PEZA 3MUGA 2J2ZA 3A67H 3K4ZA 5FYJL 5I75B 4OFPA 3GGWA 2BSSB 1T89A 3FOMA 2FIRT 4Y4FB 3CVIH 1JZ6A 2FLBT 2XXCB 4G6AD 3WFHB 1A7RL 1MFEH 5GZOD 2NXZD 3HRZB 4MJ5B 5IW1B 4UTBL 1TCMA 4JFOA 2CK0L 5D1XB 1WFTA 3UBXB 5FB8B 4PJ7E 1RUMH 1T1XB 2X1XR 1PSKH 3K1KC 1CI5A 4UILL 4LPVA 1KXQE 1QZ1A 4UQ3A 2XWBB 3GMRA 5ANMA 1MI5B 1OLZA 2PCPB 2F53B 4P59L 4GXUN 2X5PA 1TNNA 1MUJA 4GQ9L 1KJ2B 3O11B 1KJMA 5I1EL 3SPVA 2VH5H 4P23B 5JUEH 2EKJA 1CF8H 4NZTL 3OPZH 2R23A 5IG7A 1CD1B 2IAMA 1MREL 4AL8H 4NM8H 3KS0H 3TO4C 1JNLL 4U1NB 3ZLQC 4YDKL 3C2AH 3F7VA 1P7QD 1IFHH 3AXLA 5BXFA 3MLUH 3VA2C 4JE4B 4KQ3H 5B4MD 2FGWH 1FNAA 1TXKA 1GGIL 1KEMH 1EEUA 4LLYB 4LSQL 5BOZG 2OTPA 3QT2A 3SGDI 1E4JA 2R56L 3FB6A 3UTTA 5FYLE 4LCIL 3PV6A 3O2WL 4PRDB 3V79C 2D0GA 2K7QA 3GSNL 4M03A 1ORSB 2O5ZH 1VA9A 4I0PD 1B6UA 4ISVB 2X05A 1P7QA 3VRIB 3VXNA 5CP7A 4EOWL 5C6PB 1XGTB 2CRMA 2MPAL 4HWEH 5FCUH 1H15B 5HY9B 3EO0A 1CE1H 2DQEL 3QRGL 4JZOB 3LB6C 5IMOB 4NNPL 4NNXA 4PY7A 4POYA 1YEDA 4YEEA 5FYKE 3SY0A 3K4AA 2BCKB 4JG1H 5D1ZA 5J6GB 3QUMB 1MAKA 5HDQH 1A6AB 1P1ZA 3RP1A 3L5JA 1HH9B 4I0PA 5E8NA 2JK5A 1FAKT 1JGLL 3VWKC 3SQOH 3V0VB 1DBKH 3OWEA 4YR6B 3ARGC 4KDTC 1EAPA 4Z7VB 1P5UA 3QIBA 2R0KL 1S7XA 5EG6C 5IOPB 3S98A 1T1ZB 4JZJA 4PJ8D 1TVBA 5E9DB 3UJJL 4HWBH 4V1DD 4ZQKB 1HHIA 1A6VH 3WFBL 5F96L 2VLJB 5E7FA 1S5IH 2V5SA 4G6JH 3IGAB 1YN7B 5KG9B 3MV11 1CFQA 1B2WH 4HEME 2CMRL 4XC1H 2XPGA 5DMKA 1XR8B 4HIIA 4WW1A 2F5AH 1HI6B 3SKJH 4X5LA 4Y5XC 3L1OH 5EUOF 1MIEL 4O51B 2O5YH 4HMEA 2HVKA 4L3AA 3OAYK 2VLRB 4XPTH 4J3XA 3SE9H 4XCNB 1AP2B 3VFWA 1IGJA 4IM8A 4NHCH 1A7NL 4HS8L 1QLRA 3P4LA 3N0PB 4CU7A 4WO4A 3TCLB 2NMSA 3MGOA 4M8QA 5E1AB 1RFDH 5K9QG 1BVKB 4HC1A 4GS7B 1WEJL 4LOUD 3FRPA 1WC7B 4FZEH 3BJ91 1MWAL 3L95B 4M43H 2VXQL 4OCYL 2LFGA 3V8OA 3UTSE 4FFYL 2IQ9H 3B9KB 3MNWB 4WFEE 4N8CL 4NQDE 3NCFB 2APBA 3UTPE 3FT3A 2Y6SC 4OM0H 3GIVA 1H5BB 4HFUH 4HIJA 3IDJB 4KJQD 5DVLA 4EQ2A 2H8PB 5KTEH 4BFBD 4I77H 2EXWD 2R0WH 5DLML 1R0AL 4ZFOA 2NR6C 1U8KB 1C7TA 3GB7A 5LWYL 4OF3A 3RZCA 2DN7A 3KPPA 3LN5B 4FMFA 4N0CC 4DQOL 1MCWW 2EDQA 5TE7L 25C8H 3CFCH 3NZHL 1O7SA 5JNYB 4HZAA 5EZOH 1S9XB 1A14H 4LCYB 2ICWJ 1SJVA 2G75A 4WENB 5K33A 1V8HA 3A6OA 1OCWL 5FKAB 4U1MB 5IBUB 1MFAL 5IB2B 2P5WE 4Y4KD 1IM9D 4C83B 4HKBA 2WBJB 4MXQD 3CDGB 1MJUL 2NW2A 5E0QA 1FFQA 3MLWL 1U58A 3SGKC 4YBQC 1FDLL 5IB3A 3VGDA 2M1KA 1O7VA 4RBPK 4Y5VB 4JPVL 1X6NA 3VXSE 3RWDB 1PZUB 5MI0C 1CVRA 2B2XL 2DQUL 4Y4KA 4DAGL 4ONOA 1Y0LA 4D0CA 3VMOA 3WS6A 2E3VA 2Y7QB 3SQBA 1FC1A 4JO4H 1MCLA 1XH3A 2NY3B 4F3FA 2ARWA 2AXGB 2C4FT 5DJAB 5I9QC 4L8SA 1BFOB 1FN4A 2CGRH 5AWNH 4DN4L 4R96B 1EVUA 4WW2A 5F9OL 4GXVH 1T03H 4HS6B 4MJIB 1RIHL 1LP9A 1BOGA 1FL6A 4I8DA 3A67L 4PJAF 2VZ1A 4QRTB 1A9BA 1KLGB 4NOBA 4R4NC 5JTWA 2AS5M 1WUNT 1OAQH 5GGVH 4NQSB 4GMTH 4NCDA 4OGXL 4PREB 2NY6D 4KU1A 1MFEL 5HI5D 1A3LH 1G7QB 2VIRA 5C0BD 5D1QC 3NCYS 4JKPL 4F9PA 1QSFA 5C0CB 2MKLC 2VYRE 3VWJA 2WQ8A 1J8HD 4Z0XA 4YHLL 4LSPH 3C6LD 4OZIF 1YY9D 2XYCA 1NEUA 2GW5A 4JR9H 5C0BA 4QTIH 1U8IB 5LGJA 1P4BH 5MEPA 4G6FB 3LKPA 3QDGE 2EE6A 3HR5A 3NVQA 4D94A 3O9WD 5I1AB 1D6VL 1CF8L 3L3JB 1J8HA 3REWA 3LZFL 4YIQA 3QDMD 1FG9C 4AL8L 1DVFC 4JRYE 4PLNC 1WWCA 4MA3B 4RFNB 5KSAC 1QLFB 3NCEB 2AJXH 4U1SB 1F00I 2XZCH 4X4XA 3A0OA 2EEAA 3CFKB 2CPCA 5MENB 3NACL 2NW3A 4KQ3L 2FGWL 3ZHLA 1M7XA 5CAYB 3T2NH 3GSOA 3W9EB 3VD9A 1CLZL 4IOFC 1XCTA 1UYWH 1Q9OB 4APQB 3BHBA 5BV7H 4NWTL 1NBVH 4JEGB 3BZFB 2ORBL 3FFCB 3JUZA 4ZODA 5HYEA 5EUOE 2D4DA 1MFCL 4LPYA 2O5ZL 4Z7WB 4F7TB 1P69B 5HI3D 2RGSA 5EBLA 1CE1L 4N5EC 2EIEA 2IBBA 2ZOKA 3X14A 1BZ7B 1NEZG 5IBLC 4QHLA 4BK4A 3D2UD 1MCHA 4JG1L 5D6DC 4X5WB 1BHGA 3OZ9H 3ZKMD 5C0JB 3MRPB 4MB4A 3L6FA 5IJVA 4YHIB 1V7NH 4HWZB 4RMSA 4LKCB 4CU8A 5DC0A 4N8PA 5HHOB 1IC5H 1S7RB 5F3BB 4J4PC 3ZHKA 4FQ2L 5I18H 3DBXA 1JWMA 2YEZB 3D2UA 3NN8A 3EHBD 1AR1C 3GUTB 3LQZA 1WFUA 4NC1C 2W59A 1HHJB 4TSBL 3PP3K 1CD0A 5EH1A 2NY1C 5GGRB 5AD0A 5HBBA 4PJ7B 4D0DA 2A9ML 1HINH 1RIVH 4G6JL 3PGDB 2EE3A 4HC1L 2VAAA 43CAB 4NC1E 5DEGA 5JQ6H 1B2WL 2D7PA 4N1CA 4QTHB 2IQAA 2DQTL 2O5YL 2JB5H 3RAJH 2FX8L 4XPTL 1XR9A 3NIFF 1GOFA 4HLZG 4NHCL 1ONQB 3TN0B 2X1WL 3ARYA 3HTLX 4AM0A 3V7MA 1T6WA 1UM5H 3HFMH 4D9QD 4EUPG 3DUSB 4QXWA 4JFFB 4UDUB 4ZFOL 4G42B 3BN9D 4LRNL 4HXBL 3LV3A 2ARJA 2XWTB 4FZEL 4M43L 3MRBA 1AH1A 2H1PH 5DO2D 4OUOA 5EIVA 4LSTH 3PWLB 1HZHH 3TP4A 1ERNA 2IQ9L 1FVEB 3IDUA 2GCYB 2JIXB 1TQBC 2M8XA 1DN2A 1B0GB 4OM0L 1MHCA 4QGTA 1TJGH 5JA8B 4HFUL 2EH8H 1ZAGA 4UIMB 1NCWL 1VFBA 3IDNB 3MJ9A 1JPFB 2DOCA 5CD5D 5FUCC 5HYQA 1BIIA 1FO0H 2VLKD 3IT8D 4Q7DA 3WXVH 3VFNA 4P2RB 4V2BA 2J4WH 2XN9E 3QFJB 5ETUB 3JWOH 3CFCL 2C1OB 5EZOL 1S9KC 5D7KD 1A14L 2CLVB 4OZHF 5FA4B 4YGVB 4D9RD 5FUCE 2MMXA 2VDLH 1KJVA 4U6YA 1B88A 4EKXA 3W9DA 3C60C 2EKSB 4B7IA 3Q1SL 4PJAE 2AKRA 4M1CD 3RVVD 4C54A 4G80B 4GAYA 2VLKA 1QR1A 4L8BA 4XP1L 2NTFA 1T7XA 4N0UE 2UVFA 2WP3O 2EE2A 3ARFA 4U2ZA 3GSUA 3GNMH 4K8RD 1N6UA 1R3LA 4ZSOE 2V17H 4XCEB 5E1HB 4JY4B 3P4NA 4RWYH 1KPVA 3FN0H 2W91A 1L0YA 1BF8A 4JFPA 4UINL 4LIQH 1G7LB 4ODWB 2AAVA 2R2CA 3GHBL 3ULUF 3V9FA 4PR5A 5EU5A 1ZA3A 1CE6A 4PLOB 1DEEA 5AAMA 3V6FA 1J10A 2WV3A 3D3VA 4GRMA 3BD4A 4JANB 3QI9C 2BNQB 1S7SA 2BMKA 4LMQI 2CGRL 3BWAA 4OBSA 1GZQA 4O02L 2CUHA 1BOYA 4CMMB 5AYQA 4Y19E 4WEMB 3VCLB 1NFDB 4MNQE 4UTAL 5EU7C 5H37G 4GRWH 1U93A 2FBOJ 2X4RA 2A74A 1EJOH 1Q8MA 4KRPC 1BLNA 4MA1C 1ZHNB 3MRGA 5MHSE 3S34L 1WGOA 5D7LE 3ARDB 5EO1B 1M6OB 1UADC 1IEAA 3IRZA 3MV8D 4WEUD 1F97A 4XVUD 2APXA 2GHWB 1A3LL 5L0QC 3UTSB 1K5NB 1U42A 2MHAB 3QAZB 1DQJA 3G6AA 3S9DB 1KULA 1X5LA 5HYSG 1HIMH 5CIPH 2X42A 3F12B 5FDWB 3VW3H 2OQJB 3WS3A 2I25N 2ESVD 4ZPTA 1OGAD 1ORQB 4XVTL 2IWGA 2WNGA 5GIRA 4N9GB 3SDCD 4WTXA 2GFBA 3VG0L 4WNQB 2OYPA 1OW0A 2ZCLH 2D9QB 4F7MA 1I3RB 4XVJL 3NCJH 4O2CB 2DLHA 1KBGH 4Q9BA 4X4MA 2AXHA 1DANU 3RL2B 3EO9H 1DLHA 2QQLH 3X11B 2HRPL 2AJXL 3Q5TA 1D5XB 1OTSD 3PE9A 1NPUA 5JXED 4JM2D 2XZCL 1T7YA 3SDCA 3LEVL 3MMEA 4U1LB 5CUSH 5TQ2H 3DIFA 4Z76B 3MBEC 2ZNXA 3FQNA 4YUEH 5CWSA 1P2CB 2OTWA 4U7MA 4N9OB 2HT2C 1LNUB 3U7WH 5BV7L 4ZAKA 5DQ9A 3D1MC 3HLAA 1NMAH 2WMPA 4GRLC 2ITCB 4I48B 4X7CC 4KUCD 1CLOH 1CGYA 3UAJD 4BA8A 3BW9A 3EAKA 4JM2A 3NIFE 2D3VA 4FS0A 3TPUB 1G7IA 1QFHA 4LRIA 2GJ6D 1U3HA 5EORL 3IXAB 2Y07L 2UZYB 4QT5A 1Z9MA 5EOTA 1JZ2A 4N0YH 3MYJA 3MO1A 3V4VL 3OZ9L 4QHMA 4UV7H 3MOBH 3R8BB 2RB8A 1XCQB 1YEKH 2BVQA 5DJDB 3RFZC 1ZVSB 2Q86A 1V7NL 5EU6B 1CR9H 1N5AA 1X5IA 1RZ7H 5DRZB 4XP4H 2GJ6A 4ZFGH 3ES6B 5I1IL 4WV1A 2CR3A 4KQ4H 2BJMH 5J12C 2QADB 1T04B 3PJSB 5DS8A 3ROLB 4JQVC 1I3GL 1MELA 1I4FA 4MCZB 2BC4A 3P0YH 3VXME 5TGBB 4BZ2H 5E6ID 2LU3A 1P7KB 1HINL 3P4MB 4JFDE 1RUQH 4EN3C 1LO0H 3T3MF 3U0WL 5B22A 1U8HA 1MFBL 1IEBA 2IH1A 3LKSA 3RWJA 4BSWA 1I1RA 4Y2DC 2I07A 5LVEA 2JB5L 3I9GH 3RAJL 3D39E 2FX7L 4G7VH 4LVOC 4R8WH 1VKXA 1HHKB 3RHWK 1A6ZB 3P30H 3QDGB 1Q0YL 3TIEB 2YA1A 1E4KA 5TFSL 1UM5L 3HFML 1VDGA 5E6IA 1D5ZA 1VESA 5CEXA 1BFVL 3MJ9L 4KUZL 3QQ4B 1JNNL 3K3QA 4JRYB 5DWUH 2GJZA 4LVHB 5D7IA 2D03H 2ILLA 2Z8WC 4LSTL 4LQ1A 3ZKXB 5EULV 1D5BB 4MJ6B 5D9SB 3ULUE 1X5AA 2CRIA 1TJGL 5K9JH 2EH8L 4IRJA 1QSEA 1LEKB 4Z77A 3B9VA 2RBLA 4G8GA 2ZUTA 3ZKNC 1Q0XH 2F8VA 4NO3A 1K2DB 1ZHLB 3WXVL 2J4WL 5FOBA 3DX6A 3OX8A 1IL1A 4NN5B 3QHZL 3JWOL 2I5YL 2J7LA 1NCTA 3O8XC 3GO1H 4AH2B 3BRGC 1JGDB 5CINL 1CXLA 2LVEA 1GSMA 4PG2C 3LKOA 4OFDA 3GIZL 2J1KA 3K0WA 3LRHA 3ZSSA 2DJ4A 5B39A 2VDPH 3SOBL 5BW7C 5HGAA 2D7TL 5CZKA 1KELH 1YMHA 2G2RA 3GNML 4FXGB 3S5LG 3KPOA 3LIZL 4GSDL 3X13A 1J18A 1DE4A 4OTXH 5T1MA 5D2LF 4PP2A 1RV6X 3FN0L 1AGDA 1PLGH 4LIQL 5M94B 4M4RA 3V6ZA 5T1DL 2VC2H 3VE0B 1KCSH 3H9SD 3QUYD 4YDVB 1FIGL 2E9WA 3BDBA 3DOSA 4HCRH 3KS0J 5CGMA 2HJLB 1CFTB 3VGBA 4WHYH 3BIKB 1LEGB 3GSRA 3WFEH 3VDBA 3ZO0A 5LGHH 4ZUWB 2W65B 3I85A 1T7VA 4L8DB 2LAAA 3SBWA 3SDAB 1U3ZA 1UGNA 3BH9B 2V2XB 1OAZL 3QXDB 1KNOB 3SE8L 4R97C 2BY0A 5EBWB 2FBJH 4LLWA 2APWA 1EJOL 2OBGA 3H9SA 3H7BB 7FABH 4F37K 4U6XA 5F44A 3BI9X 1OARH 4HCRA 1MLBB 3L7FA 3MRRA 4I18A 1NCBL 4XBPB 2R4SH 3KWWA 4KAQH 4JQIL 4MNGA 3MV9A 2P5EE 2X9YA 4DK3A 4ZD3L 1CXIA 3HI6H 4HGWA 1G0YR 1CBVH 4LGPB 4CVUA 3K80A 5AAWA 4PJ8B 4F8QA 3RVXC 3CFBB 5IMLA 4CJ1A 1C16A 1J05B 4JFED 1FVCA 4GG6F 1HIML 1AFVH 1KCKA 2HT3C 1ADQA 3VW3L 4TNVK 3VRJA 2OL3A 1CGUA 4OLZH 4H5SB 4ZTPL 1ZE3C 4X8JA 3KYOA 4XNYL 5JR1L 1KLFA 2XN9B 2DLIA 4J8RB 4JCMA 2ZCLL 1S7QA 1EDQA 4C56E 1FQ9C 2AXJA 3B2UC 3NCJL 4JFEA 4KJYA 3ULVF 2UY6A 5B3JF 5FHAH 1NLDL 1IAIL 3FQTB 1U3YA 3MRHB 1OP3H 2DI8A 2QQLL 5JXAH 1U8OA 2XTJD 3HZYB 4OCRH 1KIUA 4FTVD 4TSAH 1H3WM 2W60A 3OAUH 5CUSL 3KJ4C 1BQHA 3SDDD 4HIXH 4K71C 4YUEL 3RA7H 2JJTA 1UA6H 2EC9U 5IQ7H 2HP4A 3SJVE 5GJTL 3RUGA 5L6YH 4GW1B 5DHYB 5IUSA 4FFZH 1AJ7L 3U7WL 4LLQB 5ADOL 3BP4A 3T3ME 1NCCH 1FNGB 3BGFC 3OKLA 5F3HB 4ELMF 4ETYA 5I17A 1CLOL 4YHPB 4OZIB 3O3DA 2W9DH 1MRCH 1PG7W 3JWDL 5T3ZE 3D0VB 5F7KC 5TQ0L 3JV4B 5DUBA 4OZ4B 3WEXB 1RZJH 3MPCA 3GSQA 2DB8A 1MQKL 2EIBA 1AGBA 5AZEH 5H35B 4G9FA 1JHLL 1RUAL 3CH1B 5DTFA 5DD1H 3WN5A 2DS4A 4N0YL 4LL9A 3MOBL 4Y19B 2AV7B 1YEKL 4MNQB 5DQDH 2KDGA 4XAWL 3VD5A 3MV01 3HE7B 4BZ1H 4RAVA 4MCYA 1CR9L 1YEEH 2OXHA 1N3NB 3OXRB 5ALBH 1RZ7L 1QFWL 1RJZA 2Q8BH 4XP4L 4ZFGL 2O61A 4LHUG 4PGDB 4KMLB 1JPGA 2BJML 3VRLF 5IFJB 3LHPL 3V5KA 4P3DA 2C3VA 3HNSH 3AREB 3DMMC 2UV3A 1F3DH 4X6EA 4YDJA 3P0YL 3EZJB 2D31B 2H6PB 1OB1B 2HJKA 3N9GH 1T20A 4M7ZB 4Q97A 1HCFX 4WGVB 1TTUA 1F90H 5CLTA 4LCCC 2HMID 1ZTXH 2KZ1B 4BQBA 5L0QB 1SEBA 4XP5L 2AEWA 1E27A 4EZMA 2OI9C 1KJ2H 1MCSA 4I3RH 4PY8I 3I9GL 3QUXB 4JPWH 5GGSA 3MRLB 3MRCB 2VXSL 2PTUA 4RMVA 1REIA 3LRSB 1UVQA 4EVNA 1DL7H 1KN4H 1AQDB 3BVNA 3ZTJH 2HT4D 1X4YA 1RJLB 1ZA6A 3FAWA 4IIQB 4PGJA 1U8NA 3D5OF 5D2LE 1BBDL 4LLMA 5DWUL 2NY0C 3KXFB 3QZWB 1H3UA 2D03L 3BPOB 3QIUB 3R0MA 3CVHH 4G43B 4FG6D 3EOYG 2CXGA 5JW3H 4YHYB 4M3JA 1MCOH 3HPLA 1N6QH 5TDPA 1KN2L 3MRQA 5F7UA 1Q9KA 4GQPH 1FV1A 5C0GA 2E5EA 3H7LA 1J0JA 3UZVB 1EFQA 2B8OT 1NAMA 3CZFA 1N4XH 4O9HH 2R1WA 4FQQA 4QEGA 4JFYA 4Q2ZB 4BQ9A 3QH3B 3CVHA 4AENA 3Q48A 1XF4A 2HTLC 5J3HD 2BRQA 2J88L 2MSPA 3GO1L 4WY7H 3NAAH 2ZNWA 3JXAA 3G5XB 3VH8G 1DBBH 4UDTB 1KPUA 2CDFB 4KMQA 4U1IA 4PRNA 4ZUUA 4XPHL 2F8XC 3ESUF 5HPMB 3PWUA 4M02A 2CIKB 5FF6A 1T22B 2C4XA 4WFHE 3TZVD 4NQVB 4JRWA 3EOTH 1KELL 4ZFFB 5KANI 3WIIH 1GHFL 1JUFA 4YZFF 4J6RL 4LBEB 1R3IH 1N0XL 4GG6E 3PF2A 1J0ZA 2CJUH 2PKDA 4LSVH 1PLGL 1IAII 3O81A 4ZTOL 5I71C 5CSGA 5DFWH 4MX7B 1PAMA 3OKEA 4NQCD 5BMFH 1X7QA 1Y6MR 2ZG2A 4OIAA 3LQAL 4ONFH 4GW4B 3FZUC 3VXMB 4HCRL 5F9DC 2VOTA 3L5WA 2A73A 1NGZB 3O6FD 4Q58C 4OZHB 3WFEL 4FQLH 2BDNH 3AAZA 4JFDB 4ODXB 5CEYB 3ULVE 5B3JE 2FCBA 3SGJA 1NANH 2QKIB 1OTUC 5HHPB 2AJSH 1H0DB 1H8SA 5F7LB 3BMVA 4NQCA 1U91A 3IDYC 3MQIA 4Q9QH 4PB9H 1A4JA 3SGEH 1AHWA 4IS6B 3KPSE 5JLZA 4U3HA 1I8IB 3DGGB 1I9JH 4F7EB 3QPXH 4KVCH 1ADQL 5F7HA 1LDSA 4QHNA 2R4SL 2A6IB 3QFDA 1EMTH 5EIIA 4J3VA 2OL3L 2YD5A 3IFOB 4XXDA 1WZ1H 5HXMA 1PQZA 2YPVH 5BRZD 1FRGH 1YMMD 3HI6L 4HPYL 5FYJE 4Q6IB 4O58H 4FZ8H 4TVPH 1CBVL 4ELME 4K9EC 1GAFH 4YHNA 4P9MH 5GS3A 1A6UH 1FLTX 1NFIB 5A3IC 3NCMA 2PN5A 3OXSA 4FFVC 3ARTA 5D93B 5FUOL 3S6CA 4XPBH 1QFWI 5CSZA 4HKZB 4LKXA 3RWGA 4EDXB 5C08A 4KMTH 4P46D 4OLZL 5DJ6A 4ODTH 3WBDA 1I85A 1YMMA 4L3CB 5HYJA 5CBAA 5JIHA 5B21A 4LSRH 3ULSA 3EZ8A 2H26A 1OP5K 5ILTH 3HPJA 4HKXB 1QEWA 4BH7B 5FHAL 5A1AA 3G5VB 4M62H 4Z0BL 4HDIA 5C0AE 2OSLB 5JXAL 2DM3A 4F7CA 2XKNB 3VRLE 2D7OA 5DJZB 3FT2B 2FO1A 4YHKH 4P4RB 4LSDA 1CDGA 4TSAL 4KKLD 5GXBB 5KOVC 5C0RH 3OAUL 1G84A 4TULH 5ESVA 4WFFE 4TOYH 3RA7L 4MZ3A 3O2DH 4MQ7B 2AQ2A 1I7TA 4FFZL 1BQUA 3STBA 3NIGF 4Y8DC 5IESH 4UU9A 4JPKH 2CDEA 2VABA 3EFFB 4HV8B 4ZO8A 3ARBA 4JKWA 5HVWA 2A0LC 3UO1L 1MRDH 4DKFH 4YXLH 4IDJL 2H2PC 4I2XA 1PG7H 2JKXA 5JORB 1FLRH 1OAUH 3IFLH 5CKGA 4CNIB 1JGUH 3PL6C 3CFDA 5IHUH 5DD1L 5EO9A 1NGXA 3DECA 1W72B 1YY8A 2LU4A 5HI4C 1A21A 4DZ8B 3VD7A 4UT6H 4OCSH 1ZT7B 4Q9CA 1EGJH 1X5KA 4MWFA 4U6TA 1QHOA 2B4CH 2VQ1A 5JMRA 3LVEA 5TJWK 4BZ1L 1F4WH 4KJPC 4Z78A 1U8PB 5MERB 3HNVH 1YEEL 1VFOA 1IGFL 2APTA 2Q8BL 3MRDB 3HN3A 4KC3B 3KPRE 4U7SA 2DYPA 4R97B 3U30B 2PO6B 4GBXA 3L3KB 2AI0L 2PW2B 4S1DC 3U7YH 3H42H 3RTQA 1J1PH 5EZLA 4PJ5D 1EZVY 1K8IB 4OKDA 3S36H 4U6HA 1TMCB 3IF1A 3NFPA 3PHOB 3QB7C 4KXZH 4AIOA 3DX7B 3KPQA 3W11D 1BD2E 1DQDH 2I9LB 2ICWB 4R0LA 3FCTA 3W0WD 3TBSA 1F90L 3QO0B 3QUKB 4RFOH 1S7WA 3MJ6A 3QNYB 4EI5C 1AD0A 5EU4B 3HE6C 4K3DL 5HVHC 1KG0B 4MQSB 4P2QE 1T1YA 4NT6A 2VQUA 2GSGA 4Y4HD 1VFAB 3I6KB 2XICA 4PP1D 4F9LA 3E6HB 3E0GA 4E0RB 3PHQA 3MLSL 3TF7C 1RK0A 5D7JA 2P44B 4YZFE 3ZDYF 1RQ5A 1NAML 2FR4B 4RFEA 3MV8B 2FYYA 1AXSA 1UJ3B 4HUUB 1NBZB 2DQCH 2P7TB 5GZNC 1JCKA 4JO3H 1ZHKB 3NA4A 1MCFA 3CVHL 1INEL 1JTOA 2AK4E 2COQA 1FCCA 4E41E 1DJSA 1MCOL 4J1UB 2YWZA 1UH3A 1CICC 4M5ZL 1D5MB 2DL2A 1XGYL 3HC4L 4HUXA 5EC1B 5T5NF 1I1YB 1Z2KA 2P8PA 4NWUH 5DI8B 1RI8A 4H26A 5GGUB 2JLLA 1I1AB 2ATPA 4O9HL 4ZO7A 3DX9B 5GS0C 1NC4D 1K3IA 3U9PH 2NYYD 1R5WB 1PJ9A 4JFXB 3FQWB 1SJXA 2HKHL 4AG4L 1DBBL 3VXRE 4AEFA 2NPLX 3AS3A 3CSYA 1YEIL 2DRUA 4DEPB 4N1EA 5T3XL 4ERSL 4I5BB 3PIQA 4LFHG 1MCEA 1CL7H 4NN6C 4K2UH 2YRLA 5B38A 3MROA 1NC4A 3EOTL 3EYSL 4WI8A 3AY4C 4G5ZH 1A5FH 1E0OB 3CFEA 3U79A 3G5ZB 2BX5A 1R3IL 1S3KH 2NY4C 5F9AC 2EIZA 2IALB 5CHNB 4HXAH 4FN0A 5HVGB 5JW5A 4OF7A 4CJ0A 3EBAA 3BO8B 1TZIB 2A6KA 4I9WE 5BMFL 5BVJB 1CGTA 3V5DA 1WCQA 4QXTB 2ADJB 3QPQC 2A6JB 4M5YH 4ONFL 4QCIA 2YZ8A 1UQSA 4PS4H 3L9RA 4IMLB 4GG8B 3RX8A 1AKJD 1A4KA 3E1F1 4YAQB 3QR2A 1INQA 1T89C 4L4TA 3F8UB 1JPSH 4LGSB 2G5BA 5F9WC 2NNAB 3B8SA 3BSZL 5DJ0B 1OAYL 3F7QA 4Q9QL 4XNMB 4HHAA 3GEWB 5IB5B 4FNLH 4ZUSA 2HFEA 5GSVA 1HQ4B 1F13A 4PV9A 1I9JL 1NCNA 1UM6H 3RIAK 5E2TH 3QPXL 4ODVL 3GRWA 3BESR 4ZO6A 4R7DA 4DGVL 1KC5L 4G6AC 1WZ1L 2PTTB 3NIGE 5D2LB 2YPVL 3UTQB 4LVNC 3V6OA 3SKOB 1NEZA 1RIUH 2NXZC 5I1DB 5IKCA 4TVPL 4FZ8L 2Q1EA 1W0WA 2GUOA 4WCYL 2R2HB 4ENEC 5ANME 4KVNH 4PJBA 4P9ML 4Y89A 4C58B 1CDCA 3VXOB 3JTTA 4PJIA 2YPLD 2VDMH 2Y1VA 1ETZB 1C5DB 5FYLH 4KKNA 3LS5L 4ZXBD 2O93L 4XNUH 3H9HB 2P46B 1G6RB 1XIWD 2Q20A 1KTLA 2XZAH 4ODTL 2IEPA 4PLJD 2BY3A 5C2BH 5AUMA 4LSRL 2KBGA 3OJVC 3P3YA 4WW2F 1R6VA 5DD3H 5FYKH 4HLZH 2A83B 5EFIB 3GZKA 4JY6A 4UAOB 3LS4L 4HBQA 4BUHA 4HUVB 1LP9F 1AGFB 2DKSA 5H94B 5JHDD 3BKMH 5BZDA 1S8DB 3L3HA 4R3SA 4YFLI 1T80A 2ZSVB 2BNUA 3S88H 2QQKH 2DLGA 4BKLA 4GKOA 3UTTE 5B4MC 4S10A 5I8KH 1JGEA 4TOYL 4XB7A 1A8JH 4ZS7H 4JHZA 4X9GA 3FB7B 3IDXL 5IB1A 5C7XL 2CK2A 1OVZA 4GG6B 4OAWB 2N56A 5IESL 5JHDA 2ADIB 4JPKL 3H3BC 4EUPA 1AGEB 1KB9K 4H0HB 4JHWH 2V5MA 4LMQE 4I0PC 5MEOA 1FP5A 3SCMD 2VXTL 3UROR 1MEXL 1FLRL 4RISH 3T0AA 5GRYA 1OAKH 1C12B 3WNOA 1FPTL 4FXKA 2BRRH 3HMXH 1JGUL 1NDMA 4ZUTB 5IB4A 1I1FA 2Z4QA 1RK1A 3H0TA 2EO1A 5EDXA 3ZDYE 3VWKA 1EX0A 2JE8A 4B0MM 4JZJC 1AI1H 3FQUA 4JAMB 5TDOA 2W9EH 2B4CL 3WFDH 1DDHB 2P42B 2KQNA 3KPSB 4P5TD 5SWZA 4LASL 5KSBA 5T1KB 1U41A 2GQHA 5D5MA 2HRLA 1BAFH 4YXKL 5DFTA 1F2XK 1FZMB 3CUPB 4TVSa 2MQCA 3LY6A 3GJEB 1A1NA 3H42L 5DK2B 2NY7H 1KTDB 1UM4L 3S36L 3CIQA 3SO5A 4ELMB 2F8OA 4XNXH 5I2IB 4WU5B 4Y5XA 4WO4C 4PJEA 4M8VA 1KCVH 4TPRH 4P5TA 4L4VD 1FBIH 1XF5A 2V7NB 2CDGA 4JKMA 2XA8H 3MV7D 3SEPA 4R90H 1NMBH 2PYFA 4Y16B 3E2HC 3AU1B 3B5TA 4XGZB 4S2SA 2CLRA 4D0BB 5C07A 2X4TA 3BX7C 3DXAB 1EJ6A 3IJHB 5H37H 4XCCH 5C9JB 4LOUC 3UJTL 2E7BA 2YC1B 1FL5A 5TH2B 3MV7A 1FAIH 1DSFL 4XHJD 5C0AB 5HHVH 2DQCL 3MODH 4R9HA 1YQ2A 3MRJB 5EN2B 2BVEA 5C3TA 1I3UA 3GK8L 1ZOXA 2W38A 2X41A 4UZGA 5GGQH 1UXSA 1JHTB 5GRXG 1T3FA 4KJQC 2VMFA 2E6JA 4U2YA 4NWUL 1FC2D 1FJ1B 1MCIA 3F5WB 2EXWC 4KK9D 3X12B 5DJXB 5IM7B 1MY5A 4DWHA 4ETQB 3AVEA 5L9DH 2K7PA 3DSFL 5I19L 1JI2A 1J0HA 2VZUA 3TA3B 5K9OA 4JDZA 4PJ9B 1FZJA 2NY5L 3ALXA 3U9PL 5FIEA 3UTZB 5FGCE 4DTGL 2DTMH 3TGXA 4JCLA 1HQRB 1JFQL 4NM4H 5DYOA 4PIRF 3WUWG 3GSNB 3BN3B 1HHHA 5DK3A 1PKOA 4ORZC 1MCDA 5HYSA 4KRMB 3OKMB 4P2OB 3SGKA 4M9PA 1HYSC 4Y4KC 1F4YH 4MXQC 5E6YA 1OAXH 1ZLVH 1CL7L 4FTVB 5K59F 5M95B 2AJ3A 4K2UL 4OV5A 2VXVH 4RA0C 2V6HA 1U8QB 4KTYA 3ZYOA 5K9KA 3MRNB 1A5FL 4PUBH 1T0PB 5BO1L 4L8SC 1A1MB 3RNQA 1S3KL 2NXYD 1RZGA 5DJYB 1UZ6F 1NQBA 1Q94A 1D9KD 2C1PB 4HUWA 3D25B 4A2MA 1S7UB 5K9QI 3LKNA 1S9WA 1WZKA 4M1GH 4X99A 4YHOH 4NKDB 3BRDA 5A40E 2JELH 1JP5A 3PGCB 1B90A 3BP5A 3CH8A 4OUUB 3LH2L 3BKCH 5KN5A 3BUTA 3GRWL 2GSIA 3BWUC 3VI4F 1INDL 2J8UA 4ZPVB 3UMTA 1AE6H 1CK0H 1LP9E 3LEXA 4FQCH 1U8MB 1YDPA 1EH9A 4QRSA 1RUPL 4F9PC 4P2QB 5IVZB 2B5IC 2XXMB 1RZIA 3IETB 4G8FA 4OD1L 5FKPA 4HJ0D 1SHMA 4JPIA 4G9DA 1VGEH 3QEUB 4Z18A 4H8WC 1F8TL 3GI9H 5I76A 4PGZA 5E2TL 5E99H 3Q3GA 3VDCA 3T0EB 3E3QC 2XV6B 1J8KA 2HJFB 1QSFE 4YNYA 4HBCL 4JLRB 1EXUA 5J1SC 2NY2D 2NY6C 4X9FA 5HI5C 1NFKA 4X6BB 2BOBB 1NKOA 3DUHA 4BM7A 2XI9A 3WV0A 3SDXA 3QDJD 4E41B 2AK4B 2BHUA 1VSCA 2FJGB 3NCCB 4PRPD 2ICES 5C92A 1HOCA 1F6AB 1ROWA 2FEEL 5IFHH 3C6LC 5ICYB 1WCBA 1YY9C 3VJ6B 3PWJB 1M7DB 4JKLA 4LSSH 4NZJA 4MZ2A 1FG2B 3RKDD 4FQXD 3I02B 5JPMB 5C2BL 2X4SA 1DVFA 3QDJA 2LQRA 4E42B 2B1HH 5KSAA 4XCYB 3O9WC 3C09B 2R9HD 3OJ2C 4KXZI 5B8CC 3IKCA 1IAKA 1QRND 1VB9A 5CJ5A 3VXRB 3QUZD 1TJHH 1F3DJ 5IEHA 5IIEB 3BKML 4OGYL 1QFUH 1E6JL 4FQXA 3HAEB 4ZO9A 4JN1H 3FO9B 5I8KL 4F33A 5DRWB 2VDQH 1CG9B 4OT1H 1ND0A 1QRNA 2VB5A 1ITBB 4Z95H 4EDWH 4F57H 1LQSR 2MQ3A 5ACLA 1CU4H 1EVTC 5I1LB 2V5TA 4JHWL 1U2HA 1NC2D 5KS9A 3F58H 4X6CF 5HHQA 5HI3C 1B9ZA 1BQSA 1FSKC 2DAVA 1A2YA 3WO4C 4OZFB 1BBJA 1RUKL 4PBVC 2BRRL 1ZANH 4B7LA 4P5MB 3U2SA 3JVGA 2IPTL 1F45A 4JM4H 4M7JH 4P4KB 2BVPB 2Z93A 3LMJH 3ZKMC 3FB5B 3MUGB 1AI1L 5DRNA 1GL4B 4BELD 4J4PA 2VDRH 3TZVB 3G08A 4ODSL 3BGMA 2MFNA 5CCKH 2YXMA 4QOKD 5IF0A 1LE9A 3FOMB 3FOLA 4P57A 4WTZA 3KJ6H 4U1KB 5EUKB 1DQMH 2FATH 4OM1H 2I9TA 1VERA 2XQYG 1ES0A 3LSOB 2OJZH 3L3OA 5DJ8B 3EHBC 4NZUH 1JMXA 1MHPH 2NY7L 1ZXQA 4R2GD 3BD3A 3BZDA 1IAOA 1Z3GH 4JFZH 4XNXL 1CL7I 1QUNA 1FBIL 1YUHA 3QEGH 2AW2A 1PZ5A 2GY7B 5CEZD 1TQCC 1YPZB 1MUJB 3FTGB 3VXPB 3L3DA 2ED8A 4R90L 2RCSL 5IP4A 1CXFA 1OSZB 1YNLL 4GFTB 1CFVH 4XAKE 2SEBB 5KBNC 2BY1A 2R23B 3Q6GH 2IAMB 1DUZA 5K59E 2C3XA 1IARB 1P4LA 3CJJA 4DGYL 1XFPA 5ID1A 1MHHB 5DMJB 5I1JH 1YNKH 4BH8A 3BN9C 3PWNA 3AXLB 2Z31D 2HH0H 2F58L 1UZ6E 5DO2C 5HHVL 3ZKQD 3RGVD 3BUYA 2HFFB 4F2MB 5I1HL 2JJUA 3PV6B 4RA3A 1ZHBA 1UB5A 1CT8A 2X6MA 5DHXB 3VFSA 4K7PY 1IZJA 2XNAB 2DDQL 3QG7H 5CP7B 3VI4E 3VXNB 5CD5C 3BP6A 4TRPH 2VUOA 2WWMC 3C60A 4ODUA 3RGVA 5GGTA 4PY7B 3ARFC 5K93A 1K4CA 3SY0B 3GBMH 1A6WL 2IMMA 2P8LB 3L7EB 2VLKE 3ME0A 5D1ZB 2P1YA 3MRIA 4M1CC 3DUUA 4RGND 4TUKH 3WL9A 4D8PB 2PXYB 3FRPG 5EU3B 2ZUQB 4CMHC 1IGYB 3EO1A 1JPST 4MA7H 3RI5F 3BZ4B 3PWVB 1YYMH 4MAYD 5FUZL 4KK8D 5BS0D 2FEEI 1OAXL 3WD5H 2WQRA 3VXTA 5IR1B 4DUXA 4XX1E 4HH8A 1EAPB 4DJMA 5D7IF 4KV5F 3QIBB 5IVXA 1BVZA 1S7XB 4HT1H 1WBYA 2K1MA 1IGIH 3T65A 1LDPH 3D3VE 4MDJA 1HE7A 1HXYA 1UACH 1HHIB 2ZJSL 3BOVA 4MAYA 4GW5A 1IMHC 1CFQB 1H8OA 1GRWA 2R0LL 1SJEB 3QNXA 5GS1A 3BKCL 4KFZC 5FA3A 2KKQA 3FQRA 1CFSA 2HVKB 1I7ZA 1U6AH 3LAFA 3P9MB 1UH4A 3T0DA 1SM3L 2BHZA 3QIWA 4KTEH 3VFWB 1CDHA 1IGJB 3MLZL 1CK0L 4FQCL 1HWHB 4CN6A 1EHLH 4I3SH 1QLRB 4U6VL 4TTGA 4MNHA 4JZNA 3OKDB 1A7PL 5A2FA 1Q38A 4JRXD 2JJSA 1JBJA 3SDYH 4P3CL 5E99L 4ORGA 4KROB 3G6JA 3MSPA 4LU5H 2QHRH 3O3EA 3EIFA 3FT3B 4DVBA 1K6QH 3D85D 4YPGA 1F3RB 2IANA 2BOCB 4KZDH 4WUUB 4PJ5B 4MXWL 1OW0C 3NBNA 2NX5D 5J13C 1ZV5A 4OIBA 4ZFOB 5HGHA 4NYLA 5IBTH 4U1JB 1M4KA 4XP6H 5DVMA 3RZCB 3W39A 3MUJA 2GT9A 1HKFA 1OQXA 2X4PA 3NGBC 5HHNB 3DO7B 1RULL 2CRZA 3QQ9C 1BX2A 5ID0A 3EYOA 4M48H 3SDCC 4X4ME 4JVWA 2FD6H 4Y4HB 4XBGB 1MFDH 5IW6B 5D96B 2RAMA 5SV3A 1CXKA 4ZAKC 4HKBB 1NCAL 1WWAX 3T4AA 2NW2B 4QO1A 2X2YA 3TM6A 3ZE0F 5IB3B 2KZWA 3CXHK 1OTSC 4Y8AA 4JM2C 2IFFH 2EZ0C 2E27H 2VO5A 4CDHA 1S7VA 5E8DH 1KLUA 2ZUWA 2VTFA 4LRIC 3WFCH 1MY7A 1PBYA 4GRLA 3P77A 5EC2B 1QRKA 1CXEA 4OT1L 3HC0A 4D0CB 3P9WB 4EDWL 3H6JA 4F57L 4A6YH 5I8OH 4IJ3C 4XNQA 1DZBA 3UAJC 3F58L 3JWDC 3G5YA 2ZPKL 4Y4FD 3DURB 4TSCL 5J89A 1IQDB 2FL5A 1H3VA 3O3BA 5ESQA 3HMWH 1GGUA 2ERJB 2Y36H 1HSBB 4WW2B 1KIQA 4WV1C 5D1XD 5FDYA 4XMLH 2ZCKL 3ALPA 5TE6H 2XZZA 2EDJA 4JM4L 5C0EA 1BOGB 4RGMC 3GDBA 3LMJL 1FL3B 4HJGA 4JFQB 3WIHA 4NO5B 1DBMH 2VDRL 3FN9A 3QEQB 1A9BB 2BSSA 5H2BA 2V9TA 3EW3B 2FZ3A 1MI5D 4XPFL 2F53D 1U3JA 2AK1L 3V4PL 1Q72H 4OLUH 1DQML 5FGSA 4MJ5A 2Y06H 1FORH 4WI6A 5IW1A 4OM1L 4GXUM 3KLAA 5ICZA 5FB8A 1JPTH 1QSFB 4P23D 1QQDB 2XKSA 3RUGF 3VWJB 4U1GC 1NL0H 4Z0XB 2XWBA 1K85A 1Z3GL 1MI5A 3QSKB 1E4KC 2X44D 5E6IC 2EC9T 2F53A 2PCPA 3REVA 1NH6A 3V7AE 2R29H 3O11A 5T33H 1GXEA 3DX8B 3QO1B 1Z0MA 1G7MA 5DUMH 1R3JB 5MEPB 2XTLA 4K7FA 3HI5H 1NCDL 1CFVL 3EYVB 5E00A 3WHXB 5E5UB 3Q6GL 4YIQB 1CGSH 3CX2A 3ILPA 2VDOH 4O4YH 5D7IE 2BHYA 4U1NA 5DJCB 1DBJH 5I1JL 1YNKL 4BK5A 4X4XB 1OP9A 2HH0L 3IU3A 4LLYA 2E9BA 4RSVA 5DHVA 1NDGB 1A6TB 2IGFH 2Q7NA 2M2DA 3GSOB 2DQJH 3QHTC 1QSEE 4OF0A 3B9AA 5SX5H 4G8GE 1WISA 3MXWL 4X7SH 4P2CG 4PRDA 2ARJQ 1NLBL 1ORSA 4XMPH 4ISVA 4YEFA 2VDKL 1XGTA 3GMLA 3GKWH 4OGAD 1IC7H 4ALAH 1H15A 5J1AB 4QRUB 5EPMB 3PV7A 4LHQB 4JZOA 5IMOA 5SWSA 2PNDA 1LGVA 2EEDA 2BCKA 3S4SB 5BV7B 2PW1B 2WIMA 5GPRA 1BWMA 1A6AA 5BW7A 1HH9A 5IROC 1W72H 5E9DD 2X4OA 3L6FB 5CJOH 5IJVB 4TUKL 4UV4L 5IMKB 3V0VA 2VLJD 1MNUH 1KB9J 4MA7L 1FSKB 3T0VA 1G9MC 4YR6A 1MF2H 3WD5L 4YFLF 1GPOL 4Z7VA 5DZOA 3RIFF 4FA8A 1JYVA 2VLRD 5CD3B 5IOPA 4MJ4A 1T1ZA 1J5OH 2QTEA 3LQZB 1IGIL 5E9DA 4OLWH 3SBWC 3VFMB 3G9AB 4KDVA 1E6OL 1UACL 1Y18B 3RDTB 2VQTA 4D0DB 3GJFA 5KG9A 5HYIA 2BNRB 4L3ED 3LQAC 1XR8A 3TIDB 3SCMB 3QUYC 4LAJH 2V9QA 1ZLSH 4O51A 4X9HA 2E8YA 4XCNA 1AP2A 1U6AL 1I8KA 1XR9B 4N8VG 4KTEL 5J11B 3DVNB 2ADFH 3TCLA 3WXWH 1EHLL 4I3SL 2BZDA 4AM0B 5E1AA 1S9VB 4RMWA 4RIRA 1BVKA 3ZE0E 2W0LA 5TE4H 1WC7A 3LD8C 5LQBL 4MNGE 4DW2L 3IS0X 3MV9E 4GOSA 3L95A 4P48A 1JNJA 4J3WA 3B9KA 3MNWA 1JYNA 3QBTB 5TPWL 4LU5L 2QHRL 1QA9A 4XX1G 2HVJA 3RNKB 5C8JA 1Q9LA 1Q1JL 4PRIB 1MHCB 2IF7A 3IDJA 4U49A 4KZDL 1TIUA 4O5LH 4HQQL 3RVTD 3LN5A 5HYQB 2WBJD 2UVEA 5GGSY 3ISWA 5F1NB 4EBQH 2Y23A 1S9XA 3QCUH 4LCYA 2MWCA 3IVKB 1V05A 3PG2A 4JDTL 3TBYB 5F6IC 5DSCB 4H1LG 5T3ZH 4JFEE 2X89A 3W9DB 2FD6L 2AKRB 1AO7B 5E24E 1CQYA 2C7UA 1MFDL 3B9EA 5C0FA 1HNFA 1KCUL 5EOQL 3KYMB 4GAYB 4C83A 1XGQA 1QR1B 1FO0B 2WBJA 2JB6A 4KK6D 3CDGA 2UY7A 2Y9RT 2NY3D 4EJ1C 2EH7H 5E56A 1WTLA 2HAZA 2XTJC 3GSUB 5F7EH 4UT7H 3RUGE 2IFFL 3RWDA 3FO0H 5ITFB 4DKAA 2E27L 2WAHA 1XGRA 3OBAA 5DD5H 3SDDC 1AXIB 1KPVB 4JFPB 2FRGP 3JUYA 2H32H 4S1RH 3MGTA 3WE6B 3QWOA 1LE5B 5HHXH 3IDIA 4PR5B 3TVMB 5EU5B 2EYTB 3OB0K 3WN5C 1DEEB 3V6FB 4UQ2A 1JZ3A 4MLIA 2R2BA 1DLFL 3WIHL 2DF3A 2AXGA 5DJAA 1GCFA 4K3HA 5F88A 1GIGH 1BFOA 4RX4D 3RU8L 1S7SB 4G9FE 4HIEB 3I50H 4IRSB 3D0LA 3BE1H 3BWAB 2E6QA 3ECBA 4HGKC 1WJ3A 2XG5A 2H32A 2EDEA 4HS6A 5C0CD 4MJIA 3DRTA 5TE6L 2X4RB 3LQMA 2CO7B 3AMKA 1BLNB 5C6TH 1KLGA 2X1OA 1EO8H 2GITA 1DBML 1ZVHA 3IXTB 5CP3H 3V4UL 4NQSA 4RX4A 5F6HI 5KANG 2DQDH 1IEAB 2I27N 4PREA 1X5GA 1G7QA 4Q9RL 3WCYA 2DWEB 4W4OC 32C2B 4G6FD 3SGDH 5C0CA 4URTB 4GRWB 4P2YA 1G7JB 3G6AB 4UT9H 2F15A 3RX7A 2LTQB 2J3SA 3BH8B 2ATKB 4LCCA 2OS7A 5E08H 3WS3B 3PQYA 1AC6A 2HFTA 1VPOH 3C9NA 4X6CB 4DKDC 1G9NL 1BJ1H 4DGIH 4JVPA 1U8IA 5MEND 2HMIC 1ZEAH 1G6RH 5DUML 3QCVL 4GAGH 1MIMH 2P47B 4UOW1 5BJTA 3HI5L 5I1AA 3L3JA 4APQD 3DSNA 1OTTD 4GKSB 5DVKA 3AUVA 5CIPB 1DLHB 2VDOL 4O4YL 4HS3B 2HT4C 1H3XA 1J1XL 1OWRM 5D72H 3CFKA 4YHZL 3MJ7B 3MMEB 3MA7A 3VU2A 3WSQH 5FFLA 2OZ4A 3N1QC 3QCTL 5CWSB 3OMZA 4FG6C 2OTWB 3L3GA 1IBGL 3H9ZA 3FFCA 3MCKB 4X7SL 4XC3H 2P4AB 3HLAB 5DMGD 4PRPB 2FJFB 4Z7WA 1P9MC 3BQUB 3BW9B 5HHOD 3NPSB 3KYNB 4OCNC 1BJMA 5DT1H 1U3HB 4GAFB 3CPLB 3K8MA 3VFGH 3UXFA 5EOTB 1IRAY 5IQ9B 4PG9A 5C0JA 3ULVH 3MO1B 5DD0L 1NKRA 1QO3B 4BSJA 3ETBF 3QUZB 3KYKL 5CJOL 2OJEB 3K46A 4LPXA 2Q86B 4LKCA 5HHOA 1BM3H 1MNUL 1S7RA 3TYGH 5HSFA 4PJDF 1Z5LA 1RVFH 12E8L 5TF1H 1RMFL 2YEZA 3VXUE 3GUTA 5T3XE 5BZWB 1HHJA 2MCPL 3DTXB 3SGJC 1KIPA 1VEOA 5GGRA 5F72S 2GK2A 4JFFD 2VXUL 3PGDA 5CGYD 2EDXA 1C7SA 43CAA 1ZGLB 3WJJC 3GM8A 3GSWA 4CBPA 3QYCA 4NIKB 2IH1B 3LKSB 2Y5TA 3BPNB 3RWJB 3O6FC 4BSWB 2I07B 2CK0H 4K9EH 3TN0A 4NGHL 2GI7A 2FHBA 3WXWL 4JGMA 4JFFA 5B39G 4G42A 5TE4L 3WLBB 4GKZB 2XWTA 4OF8A 1UG9A 2J6EH 4P2RD 4P59H 1FNFA 4MDIB 4NDMA 3PWLA 3QFJD 5D7IB 4GQ9H 4JREC 2F54A 2JIXA 3D18A 3DNKA 5AYUH 1M71A 4X4YB 2PETA 5I1EH 5FGRA 2XT1B 1FYTB 4NZTH 4U1HA 4WGWB 1MREH 4IRJB 4UIMA 5FYKD 5C2UB 1QSEB 3KLHC 2NZ9D 1JPFA 3HZMB 3QWRD 5C08E 1JMZA 4P2RA 1JNLH 2J6EA 4NO3B 3TYFA 3QFJA 3BPLC 1YMME 5ETUA 5HYJE 3VG9C 5FOBB 3OX8B 3C8KB 4EBQL 2C1OA 3QCUL 1GGIH 4LSQH 3M17B 4P46C 2EKSA 2R56H 4X6DB 1YC7A 1ZS8B 1M05B 3LKOB 3QWRA 1X5FA 3D9AL 2Z91B 3T77A 4EOWH 4S1QH 5HGAB 2F5BH 1KGCE 2MPAH 3RPIB 3ARGD 1DBAH 3T3PF 2DQEH 3QRGH 2G2RB 1UKSA 2BNQD 4XCEA 5F7EL 4OKVB 2NZIA 4UT7L 4DZBB 2UWEF 3KPOB 4JY4A 1VGKA 4XRCB 4KKLC 5F93C 1BGXL 2QSCL 4F15C 2YPKB 4PP2B 1K8DA 1AGDB 1G7LA 2VSDA 3TT1L 4S1RL 3D69B 3TJEH 4I2XE 2ZUVA 4PJBF 3BXNB 3LN4A 3L3IB 4JDVB 3BEVB 2BNQA 1UFUA 4DCQA 3GSRB 1GIGL 2VITB 3PL6A 3I50L 2ED9A 3BE1L 3D6GA 2FIKA 2WZPD 2ZUYA 3BKJL 4PRHA 1NFDA 4PV8B 3UTSD 4WFED 1MVUB 4OCXH 3UJJH 4X7TA 1OQOA 4GBXC 3C5ZB 2G5RA 2JCCB 5ENWA 4LLWB 4W81A 3WFBH 5F96H 5JIKA 4U6XB 5BS0B 3ARDA 5EO1A 5C6TL 4Q74A 1M6OA 3MRRB 1QKZL 1IKFH 4I18B 1F2QA 4OFYA 1T0MB 2DQDL 3CSBA 1MIEH 1LO4L 4MNGB 3MV9B 4R0LC 1JYWA 1J12A 5F6HJ 1MH5A 1HEZB 2E6PA 4LCWA 4HGWB 5DVOA 2MHAA 4HWUA 5FGBC 1EHXA 4M6ML 2ADGA 3WIFB 4PJGA 1C16B 4UT9L 3WUWA 1MOEA 5AEAA 3NMEA 1WEJH 2QSQA 4M3KB 5FDWA 1CZ8L 2OQJA 5F1OB 3DV6B 3N85L 4F9LC 1MWAH 3W11C 5EZJA 1ORQA 4OCYH 1VPOL 4DGIL 5J8OA 4Z7OF 4N8CH 4X8JB 3KYOB 1SEQH 4WNQA 5GGVY 2VERN 1S7QB 1IC4L 3CAFA 3ORJA 1R0AH 1E4WH 4PJDE 4PP1C 3ROOB 5LWYH 3X11A 1D5XA 5TE7H 5F7DA 5D72L 3TV3L 4S0SD 2D0FA 4U1LA 5I73C 1E4XL 3WNKA 1LMKA 5KSBF 3QHFL 4RNRA 5D5MF 1BQHB 1OCWH 3LPGA 2EYSA 3NA9L 1P2CA 3D85B 1MFAH 1EO5A 3EOBB 1LNUA 5KAQF 1SYVB 3KDMB 3RUGB 1NJ9A 8FABA 5EOCL 4WWKB 3QXAB 4QY8A 4XC3L 2O5XL 1V3LA 2ITCA 2WUCH 2AXFB 1MJUH 1V7ML 4JO2H 2ED7A 3MLWH 3O3DB 1LO3L 3NZ8B 1FDLH 5EU6D 1RHHA 1N8ZA 4JPVH 1PKQA 3CXHJ 5F89B 3F7YA 1FNLA 3GSQB 1P84J 3IXAA 3P11L 2NY5C 4LEOA 2NYYC 4G9FB 3U4AA 2DQUH 5LXGH 1OM3H 3VGAB 2QADD 5HHME 4DAGH 1E28A 3LDBC 5GQBA 4YK4C 4F7PB 4W70A 5DJDA 5ISZA 3Q0HA 5KVFL 5EU6A 3AY4A 1BM3L 1CLCA 4RAVB 4MCYB 5DRZA 2VN4A 4PYGA 3ES6A 1RJZB 1RVFL 5D1QD 4DN4H 5TF1L 2Q3ZA 5F9OH 3PJSA 4C59B 2WINA 3ROLA 1NMCC 4XP9L 1PY9A 2YKLL 3QDGD 4HX1B 4X6EB 5ESAB 1FNSL 3IDMA 4AY0A 1P7KA 3P4MA 1G7HB 4PJXA 3VI3E 3ZDZF 5JOPE 1T20B 3RY6A 3FFDB 4JRYD 4L4TE 4OGXH 5I74B 4Y1AB 1E27B 4JKPH 3PDOB 5HD8D 4K9EL 2EECA 3BYTA 1UVQB 3V6OC 3T3PE 5JPNB 4YHLH 3QQ4A 2UWEE 3ZHDA 4JRYA 4XNZC 3I6GA 1U8NB 2J6EL 4AYFA 4XTRD 4YH6A 5I8EA 4LLMB 1WZLA 5D9SA 3S7GA 4CKVX 5AYUL 1SY6A 3RWIA 4PJBE 1P6AB 1WK0A 1D6VH 4XH2A 4PJIE 2MKWA 3LZFH 2DBLL 4NUGH 2V7HA 1Q9KB 1FV1B 1HYRC 1WIOA 1JL8A 5DA0B 5CGTA 3N1MC 1K2DA 1NAMB 1ZHLA 4IHOB 1IQWH 2WSKA 2X70B 2AJVL 4FQQB 3S3PA 3DYOA 3NACH 3RWCA 4PJHF 3CVHB 4ZXBC 1XF4B 5HGDB 3VMNA 4Z9KB 1CLZH 1QPXA 1XIWC 1T66D 2OR9H 4BFEA 1B3JA 4PLJC 4RQQB 2J8UF 4NWTH 2ORBH 4ZUUB 4LPCA 4R26H 1F58L 3D87B 1MFCH 1JRHH 2Q8AH 1CQKA 1R3KB 3QULB 4NRZB 4MGXA 5C09B 4S1QL 2F5BL 5FF6B 5CFHA 1RY7B 3FO1B 1UKQA 1DBAL 4FXGA 3U48A 4UOJA 1JGVH 2A1WH 3DI2B 5C0ND 1ZT1B 1DQLH 5JHDE 3SDAD 2LE9A 3VXUB 3GSXB 3SDXF 3TJEL 3ZDXF 4Z7OE 3EYFA 4YDLB 4YDVA 4KKAD 2HJLA 1CFTA 3WHE1 4QHUB 2FWOB 1E4XI 2CD0A 2A73B 4HZLB 4FQ2H 4ZUWA 3AAZB 4RZCB 1G0DA 3O6KL 3SDAA 1SYSA 3BH9A 3U0PA 2V2XA 4W68A 1J87A 4TSBH 3QA3A 5EBWA 4NO2B 4OCXL 3MTRA 5JDSB 1U91B 4CVWA 1A4JB 1AHWB 3H7BA 4HUMB 2K3TA 4K23L 5JLZB 4U05A 2FDBP 2A9MH 5SWZE 5KSBE 1MLBA 1VFUA 4HC1H 5D5ME 3NFSL 5M7QA 1IKFL 1FGVH 4QHNB 2DQTH 3QFDB 5EIIB 4P5TC 4OFVA 2BY2A 2FX8H 4ZUVA 3T4YB 4EXKA 2XN9D 2HG5B 1Z9OA 4PJ8A 1CFNB 3CFBA 3K74B 1U95B 4V1DA 1DN0A 1OD9A 1J05A 4JHBA 3U6RB 4YHNB 4LNVA 2FJHB 1F02I 3LN9A 4BQ6A 4NN7B 1NGWA 4LRNH 3PDDA 4HXBH 4L3EB 1B0WA 5JDJA 3K7UA 4W4NA 5HGBB 3BPCB 2J5LB 2VL5B 5C08B 4H5SA 5BQ7A 2N4IA 3BDXA 1WZMA 2H3NA 5DJ6B 4S11A 5HYJB 4QHKI 5C07E 1SEQL 4U0RC 2Z8VC 4J8RA 2XQBL 3RHWF 3H2WA 2EXYD 3B6SA 1A64A 1NCWH 1QEWB 1E4WL 3FQTA 4DK6A 3OG6B 4N90D 3MV7E 1EEZB 2CXKA 3W2DL 3HZYA 5GS0L 4F7CB 5AZ2L 5I0ZA 5DZNA 1RSFA 4BUGA 3AB0C 3F6LA 1R3HB 4MD0B 4XHJC 1KTRL 3Q1SH 4JG0H 3VFPB 5DHYA 3QWQB 4LLQA 3ZDZE 2QR0B 3TJHD 5FCSH 4ZYKB 4O00A 5TDNB 4AIZA 4XP1H 2CDEB 3ESVF 2VABB 5GRVL 1BEYL 2WUCL 4Y19D 1TZHA 3K4DA 4MNQD 3ARBB 3QI9D 4OZIA 4JO2L 1I8MA 3HE7D 2EDBA 3N1FC 3JV4A 4OZ4A 3WEXA 3WFZA 1QLEH 5MHSD 3OR7A 4YDIH 3CH1A 1MCPH 4UINH 3CFDB 2HFGL 5LXGL 1OM3L 4LAQL 5I6XC 3GHBH 5D70H 3T8XA 1I9EA 3ARED 1IM9A 4OCLC 1JTTA 4FQ1H 2YD2A 3BRFA 1JIBA 2VQ1B 3CD4A 1QFOA 2Q76A 4NQXB 3SKNA 3HG1E 2DYPB 4O02H 4U31A 5IFJA 3TC9A 3QUXD 1UXWB 3B5GA 4Y5YB 4UTAH 3AREA 4UB0L 1OSPL 2PYEB 3M1BA 3RTQB 2G60L 1H3TA 2NXYC 5EZLB 1XGPB 5INCA 1NGYB 1D9KC 1CTOA 5GRWA 1EUTA 4PJHE 4NQEB 3S34H 3TBVA 4QRQB 3PWPB 1MCQA 2W1NA 3WNPA 3V52L 1W2KT 4K55A 2J8UE 1OF2A 4WEBL 3KXFD 5FK9B 1T7ZA 3O4OC 1NGPL 3QIUD 1AD0B 4QRRB 3QUXA 4L4JA 1JV5B 4NZRH 1DFBH 3MRCA 4NT6B 4W6YB 3LRSA 4XMKH 4MHHI 1AQDA 5F9JA 4N5UA 1RJLA 4OCWL 2VJXA 3B2VL 5E6ZA 5D7JB 5DD6B 4HMCA 4HJ0C 5B38G 4PD4J 4PJDB 4XVTH 3E8UL 3TH3T 3QZWA 3KXFA 5GRUL 1WF5A 4RFEB 1AXSB 3ZT7A 5F1KC 4G43A 3VG0H 3SDXE 5KZCB 1WAAF 2Z92B 3BKYL 2HT2D 3ZDXE 5F7MC 2VRAA 5IVXF 4XVJH 2NY2C 1J1OH 3CLEL 1T5XA 3FO2B 1UCBL 1OPGL 3NABL 1HKLH 4NUGL 1PG7X 3IJSA 3MRMA 4K3JL 1XT5A 2HRPH 3C6LA 3MJ8B 2OTUA 4XWOC 1RJCA 1IQWL 2ATPB 3LEVH 4MB3A 2RFXB 4CRPA 2AJUL 2X10A 1J0IA 3T0XA 5IGXH 3O9WA 2OR9L 5B8CA 2CDFA 4FQXC 3QDMA 2UUDH 3CSYB 1CIDA 3B4NA 4GKNA 5HPMA 3JV0A 4R26L 3EJZD 5HHMB 5F7FA 3U36B 1YZZA 5I1GH 1JRHL 2Q8AL 3MRFB 4PTTA 1N2RA 3PIQB 4NQVA 1K4DB 3VXMD 4UIKH 5B38B 1LEIA 1UENA 3CMOL 1BJ1J 4JFDD 5EORH 5J1TC 2Y07H 4GMSL 1JGVL 1MRFL 2A1WL 1DQLL 1LK2A 3V4VH 3OHXB 4YBLC 2DWDA 5A2KH 2QJDA 4KZEL 2A6KB 1JF1B 2AV1B 3JVGC 3V5DB 1QOKA 4NKOA 3VXMA 4JQXA 4QCIB 1KIRA 5FM4A 1UQSB 4Y2DD 4OZHA 1WBZB 4L9LC 5I1IH 4ODXA 1A4KB 2QKIA 3OJDA 4L4TB 1TENA 3TNMB 3NTCH 3WLWD 1H0DA 4KY1L 2G5BB 3WUZA 1I3GH 5CSBA 3ULUD 2GIYA 4IS6A 1NAKH 1V3MA 3DGGA 4KK5D 1YN6B 1DP0A 4YC2C 5GSVB 4F7EA 3JTSA 2L7JA 1KEGH 3U0WH 3JWNC 1MFBH 2A6IA 4MXVF 4OIIH 1LD9B 1FGVL 3ZE2E 2UWEB 1F42A 4K3EL 2FX7H 3JV5A 5T1LD 4Q6IA 1L7IL 5L8JB 1MCWM 1NEZB 1JYXA 3HB3C 3CK0L 3PABA 5IHLB 1W0WB 1Q0YH 4C4KT 2GUOB 5TFSH 4NCC2 2QHLA 3ZSTA 1TPXC 1HILA 4OD3L 1BFVH 3MJ9H 4KUZH 4R2GC 3C5JB 3IS1X 5I1CL 1VACA 2F9BT 1JNNH 4HKZA 1WFNA 2R4RH 1DR9A 3O3UN 4EDXA 3O8XD 5I66B 4V2CB 2WK2A 2FHFA 1EFXB 1SQ2N 1KTLB 4KRNA 3MFGB 4N0FA 4HKXA 3KPNA 4BH7A 4NPYB 3TO4B 3KYAA 1FH5H 1CDIA 5HVFB 3MOAL 4LDOB 2XKNA 3L3HB 3QHZH 4R3SB 2I5YH 4OZGA 5MEQB 2BNUB 4HH9A 3UC0L 3ET9F 5A16B 2Z31C 4BKLB 5KAQG 5CINH 4D9LL 3BGAA 3RGVC 4MMZC 2DQIL 1GGCL 4N8VA 3QQ3B 3FT4B 4JG0L 1IJ9A 5FV2A 4CN1A 5KVDL 2HLFD 4HG4J 2KH2B 5DGRA 3ZT5A 1YECH 3GIZH 4NSKB 1FHGA 3EFFA 4HV8A 1W0VB 3SOBH 4EUPB 3HI1A 2QQNL 1CVSC 1P6FA 5DUPL 2D7TH 15C8L 2HWZL 4J3OC 4UNVA 5MEOB 5D2NC 2C9AA 2Z8RA 4OSUH 1QLEL 3LIZH 4FABH 1TVHA 4GSDH 4CNIA 4YDIL 4FXKB 2PO6D 3OAZH 4KJWD 1XGUB 1MCPL 1F3JA 3ARRA 3H0TB 4CUCA 3F65A 5D70L 1Z0NA 5T1DH 1ZLWH 4X9IA 3VWKB 1ZT7A 3A6CH 4FQ1L 3RKPA 3GMPB 4YGAB 5A2JH 4RGNC 5INDB 3ARGB 3MOQA 1FIGH 3DRQB 1U8PA 1WAAE 4IMKC 4PBWD 5FO9A 3GSVA 3L5IA 5IVXE 4MAYC 5SWZB 3O4LE 5KSBB 3MRDA 5D5MB 2PW2A 3U46B 4H1LA 5GS1C 1OAZH 3SE8H 1A1NB 2W0FB 4PLKD 3QIWC 2EYRB 3PHOA 3UDWC 4X5XB 5J9PB 1JRHI 2KQMA 1HXMA 2I9LA 4H8WL 4U0QB 2ICWA 4Y5XB 1F4HA 1MFNA 1NCBH 2YWYA 3QO0A 1IAIM 5EU7E 2JJSC 4JQIH 2IBGA 1A9EA 2ZKHH 3EJYD 4ZD3H 1C8PA 3CDFA 4OFKA 1KJ3H 1D6EA 1J88A 4NZRL 1HDMA 2GTWB 1DFBL 4L5FH 2XZQL 4NQDB 1QVOB 4S2SB 5LCVL 4POZD 1T7WA 1BZ9B 2FH6A 5C07B 3SO3C 4XMKL 4Y0GA 4E0RA 4J3UA 3SJVD 4KI1A 3W5NA 1UZ8A 1QBBA 4NRXB 2GK0A 2FR4A 3MV8A 1I1AD 1UJ3A 1NUGA 4ZTPH 4HUUA 5DEFA 2P7TA 3IJYA 5J0BA 1X5ZA 1ZHKA 4XNYH 5CZVH 2IANE 5I1KH 5JR1H 4Z7VF 1YJDL 5T3ZD 4N68A 5EB9A 1BFTA 1CGWA 1D5MA 4X83A 4OQTA 5EC1A 1J1OL 1UXSB 1NLDH 1IAIH 4XWGH 3QXTA 4M93C 5DI8A 4QF1B 1HKLL 2VUYA 1KXTB 5B3NA 2ESVA 5GGUA 2P5WB 3U9UA 1OGAA 3KHOA 1S78D 2BSRA 1L4IA 3OGCA 4JO1H 4PJFA 4NJ9L 5K9OB 4JDZB 3N1GC 4LVEA 1R5WA 4JFXA 1A3RL 3FQWA 5IGXL 1SMAA 2Q7YB 5GJTH 1ZGLM 1AJ7H 3VXSB 5ADOH 3ZE1F 1FZKA 4KWUA 4MXVE 4X6FB 2FSEA 5HYSB 5E4EC 5FEBA 4ZNEA 4BQCA 3QJHB 5I1GL 3JWDH 5JXEA 1GH7A 5TQ0H 4NP4L 1IGML 1FZOB 3MLRL 4UIKL 5MI0B