5CEZH

Crystal structure of the bg505 sosip gp140 hiv-1 env trimer in complex with an early putative precursor of the pgt121 family at 3.0 angstrom
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
232
structure length
231
Chain Sequence
b'QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIRQSPGKGLEWIGYISDSESTNYNPSLKSRVIISVDTSKNQLSLKLNSVTAADSAIYYCARAQQGKRIYGMVSFGEFFYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPSSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Affinity Maturation of a Potent Family of HIV Antibodies Is Primarily Focused on Accommodating or Avoiding Glycans.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 33
structure length 231
sequence length 232
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cezH01
1P69B 1FLRL 4G7YH 1PLGH 4I2XE 5JHLL 4KH2A 5EO1A 1CGSL 1C1EL 5T3ZD 3K74B 5BRZD 3KYOB 1NCUA 4KRPD 1KB9J 5GRUH 1NCCH 2X44D 4PFEA 4R2GB 5L7XH 2CUHA 3WDJA 1KPRA 2P8MA 3QUKB 2OTWA 3PQYA 4LOUD 5FYLE 3JV4B 2XI9A 2X09A 4WHYH 3MBEC 2C9AA 4OIBA 1J12A 4LP4A 3QZWG 4WTZG 1AGDA 1Z9MA 4RAHA 2OQJB 4YHYB 5CCKL 1NCWH 2VISA 4NKQB 5EULV 5HDQL 5IWLA 2VTFA 1A5FL 3IJSA 4L9LC 5D1QA 5K9QI 2EO1A 1BWWA 3P4MA 4MA1C 2ZOKB 4MCZA 4UQ3B 1S7RA 4M6OH 4LU5H 4QRSA 4Y4FD 4TNWF 3O3UN 4X5LA 3EYFB 4PJ8A 3ARPA 1UA6H 3D2UD 1AE6H 5BS0A 4PS4L 2H9GA 4Y5YB 1MHPL 1W0VB 3ARYA 1A47A 4TNWK 1VKXB 3AB0C 1KN4H 4ODUB 4KQ4H 3UDWA 1PX4A 1NLBH 5FYLD 3GJFB 3GKWL 4ZDHB 5IB4B 1MHHA 1FZOA 3Q48A 4HX1B 2LAAA 4GQ9H 2I60H 3DV4B 2VDPH 1B2WL 3E6FB 3WO3B 3LN4A 3K80A 4M43L 1WT5C 4GUPA 1QOKA 1AJ7L 1IEHA 3DBXA 1KCUL 4M03A 1SBSH 5GGVY 1R3JA 4UV4L 4DN4L 1JGUL 2AK4A 1HINH 3FT4A 3PIQB 1R3IL 3T09A 3WNMA 4TQEL 1TITA 1ZSDB 25C8H 1G9MC 3B8SA 3UXFA 4XCNB 4YHNB 3KLAB 4G5ZH 4X6DA 1Y18A 4LVHC 4Q0XL 2OMNA 4XWGL 1AKJB 1EVTC 4I48B 3L5WB 1IL1B 5D9SA 4BZ1L 5T1MB 4OZGE 2V17H 4FMFA 5HGDA 3TT3H 3O6FA 4Q9RH 3ZZ1A 4H8WC 5HDOA 1F00I 2BSSA 2IBZX 3UROR 3WXWH 1IZKA 5DD0H 5DVNA 3HZKB 4J2XA 3LKQB 2AJSL 4OIIH 1CR9H 4E41B 5AG8A 5DI8B 5C0BB 2DTML 1E6OL 5F72S 3CFKB 1QRNE 3D48R 1OAZH 4J3VA 1CK0L 1MREL 4IDLA 4XVJH 3OKKB 1VPOL 3D0LA 1XEDA 4KMTH 5FHAL 3MLSH 5J9PA 1WUNT 5D71H 4X0KB 3MNVB 5I2IA 3V8CA 4GLRI 2A73A 4WFGE 4OCMC 4POZD 4DCQB 4NQCB 1YYLH 4AM0A 4LSTH 3C5SB 3TNMA 4QO1A 1QFUH 3HG1A 3MRDA 2W0KA 4OCLC 3P73A 1CDBA 5ACMA 2BXYA 4XC3H 3TNNA 2OI9C 3BKML 3ZKND 4LNVA 3SPVB 5JHLH 2Y72A 1CGSH 1C1EH 5KSAA 1ZLVH 5IHZB 1CE6A 4HSQA 3DRTB 2P45B 1IAKA 3LN5A 1CDGA 2HH0L 4L4TB 3QDJB 1MJ7H 4OLVH 5LGJA 5D7LA 3KAAA 4ZPTA 2BHZA 5HGGS 3ARDD 1F42A 3UEZA 4F7EB 3MA7B 5CCKH 5SX5H 5EUKB 2LVCA 4ZXBC 5HDQH 1KGCE 4OF3A 3P4OA 5EOQL 3JV6B 2NY0C 4NO2B 4WFGD 1A5FH 1Z0MA 2FL5A 3VD5A 2RIKA 4R0LB 2LQRA 4HT1L 2AV7A 2X9YA 1HXYA 3H9ZA 3BXNA 4QXTB 3SGJC 2IADA 5D6DC 5J11C 4PS4H 3WLWD 4FABL 3BN3B 1R5WA 2Q3ZA 3KLSA 4C83A 3QXAA 4ONFL 5GRVK 3CJJA 4PTTA 3WFEH 1JNHB 3KPRE 5DD6A 3JTSA 4QOKE 2NR6D 2HFFB 4RA0C 3L1OL 3LKOB 4X7CC 2ITDB 3PE9A 5FK9B 3GKWH 1J5OL 4A6YH 4F37F 5FYKE 1DBJH 4ISVA 4LLWA 1EMTL 4P49A 3HR5B 4I5BA 5AG9A 1UJTA 3EHBC 4BUGA 1NBYB 4PJDF 1U3ZA 4OZIF 5FGCB 4OSUH 1KGCD 1CGUA 5CIPA 1B2WH 3D85A 4P23A 4F37K 4FQ1L 4Z77B 4BZ2L 4M43H 4UOJA 3B5TA 3WJLA 4I18B 3CFBB 1AJ7H 5D1ZB 4BELD 3F5WA 1G6RL 5E1AB 3W0WB 1KCUH 5EPMB 3REVA 3KYNA 5GS0D 4UV4H 1YEGL 3V6OE 1U8OB 1JGUH 2F53B 5E5RB 1B6DA 3ZDXF 1ZVYA 1R3IH 4P5MB 1YC7A 4TQEH 1XCQB 4MQ7A 3EOTL 3KPRD 4HUXA 5DZLA 4K3EH 4PJIE 4P46C 4XWGH 2G75A 4P5TB 2V5SA 3H6JA 1G7LB 4BZ1H 5LGKA 5C3TA 1EO7A 1O7SA 3VXUB 3OAYH 2HWZL 3QO0A 4KTEH 2V7HB 4M93C 5CILL 1KTDA 2JKXA 1J0IA 1RZIB 1HILA 4LBEA 4Y4FA 1QLEL 3RWDA 1KIUA 3D2UA 3HRZB 2AXJA 4KGLA 3HLAB 4I2XA 2DTMH 3A67L 2FX8L 4JN1L 1RJZA 3CSPA 4HIEB 1NEZB 3FT2A 3GB7B 4M3KB 1S78C 4MLIA 3AREC 3RWGB 4HHAB 4WFHE 5K9OA 5IG7A 3I02A 1ROWA 1FL6B 2FO4B 2DMBA 2VXUL 4DGVL 1TCRA 1YNKL 3NH7L 3RKDC 3FB5B 2EDJA 5C0DB 2YZ1A 3BKMH 4MQTB 2WQ8A 1A64A 3PL6C 5D7IA 3DUSA 5H35B 2GT9A 3MLZL 2EC8A 3HPLA 4F7TA 1U95B 4TULH 5KS9F 2XKSA 2FJHA 1VDGA 3ARGC 3OF6A 2VABA 1SJXA 2VLLA 3NVQA 4CVXB 1RHHB 1MFNA 3H7LA 4BUHA 1NGYB 4OBSA 2YZ8A 1LO0L 4WFHD 2CLVA 5FUOH 1D7FA 1UM4L 4HT1H 2UUDK 3KLDA 1A1OB 2ADIA 5IEHA 1G7HB 3LD8C 4HS3B 3D3VE 3O4OB 1A7OL 4CVZB 2P47B 2ZOLA 3INUL 2EXYC 3ARFC 1FVCB 1H5BB 4PIRF 4PJ7B 4ONFH 4QT5B 3G6JB 3BH9A 2IAMC 3HR6A 2I07B 2DN7A 3U0TA 4J3WA 1I3GL 3C09B 3HRPA 3L1OH 3QDGE 4IRSA 3QNZA 5C08E 1J5OH 1ZWIA 2GITA 2HFTA 3LEXA 3U9PL 1EMTH 1FG9C 3MC0A 2W1NA 5LG1A 4LHUG 1FNEB 3RNKA 2X9WA 4JKMA 4PRIB 4S2SA 2H2PD 4OZGA 1JVKA 2YRLA 4JRYB 3V6ZA 1JZ3A 4FQ1H 4HIIB 3FRPG 4LGRB 4BZ2H 5J7CC 3L7FA 4G6ML 1RIUL 1NGZB 2HTLC 4WHCA 4XAWL 1G6RH 1IQDA 5I1IL 4WTXA 3BEWB 1U8MA 4OQTL 1YEGH 3GHBL 3D3VD 3S8WA 4LCWB 1TCMA 2EDOA 3MJ8A 2LTQC 3ZKXB 4J7RA 3VXNA 1FPTL 3EOTH 4XXCA 1JGDB 4KJYA 1QSFE 1HH9A 1NANH 4U1KB 5CJBA 1I7TB 3VCLB 3ARDA 1KIQA 12E8L 2GFBA 3QDGD 4NN5C 4MA8L 4NCDA 1WWBX 5C08D 1AR1C 2W92A 3FOLA 2HWZH 1AD0A 4GKSB 4LAQH 4PPTA 3O6LL 5CILH 2QEJA 4OCXL 1DP0A 5GPRA 4WUUE 3RDTB 4OI8A 5C9JA 3GO1L 2Y5EA 2NY4C 5IIEA 2VZ3A 1P2CB 3G04B 3W9EA 1QLEH 5E6IB 4NKIL 4JGMA 2M1KA 4NZTH 4ZYKB 4O00A 5C07E 1LEIB 3RY4A 1FFPB 3TBTA 1CGXA 3QI9B 3H9HB 3A67H 5JDSB 3VD9A 2W9LA 4X6CA 3B9KD 4JN1H 4LIQH 4K3JL 4B41A 2R0LL 2WZPD 1NDGA 1EFQA 3S7GA 4I4WA 3UBXB 1P4LB 4LMQE 4BK5A 4CW1A 3IKCA 4HCRL 3EYQC 3MCKB 1M71B 3ZKMC 5TF1L 1Q94A 3D18B 1LDSA 1OSZA 3TA3C 1YMME 4O51A 1S9YB 2VXUH 5I66B 3MSPA 1GOHA 3NH7H 4DGVH 4MWFB 5BJTB 4WUUD 1IGTB 1UCTA 1U8PA 1LVEA 1HHKB 2V5MA 4GXUN 4XNMA 3WS3B 4RFEB 2UZIH 1RVFH 1Z2KA 3MLZH 3GSXB 5C07D 2D0FA 3ILQC 4Y88A 2A77H 1RJCA 3LH2H 5E8PB 3L3JA 3KPRA 4LLQB 3GMQA 4QXUL 4ZS7H 1HSBB 3QUMB 4LF3B 3TH4T 5DXWA 4KDWA 2F74A 3HMWL 4F33B 2X1QA 2E27L 1LO0H 5J0BA 2Q6WA 4EUPG 1HQ4B 1UM4H 1ZA3A 1A1MB 1MHEB 3L6FA 1KG0B 3FQRB 5DHXB 4APQA 2MFNA 1YMMD 4P2CG 3R1GL 3RVWC 1YN6B 2GYSA 5JLZA 1KEMH 1QLFB 4RRPG 5FUZL 2LV4A 1I3GH 4YO0A 5HBBA 5CJXC 4R7NB 5IF0A 3DIFB 7FABL 3KPLB 2EH8L 2XY2A 3U9PH 2EIZA 2UYLA 3KPMB 1F3JB 4NO3B 4E0RA 1K4DA 3WHE0 4MXQC 2CSPA 4MA7L 2CDGB 1OQOA 4OD3L 4CJ1A 5GGRA 4G6MH 3VFWA 3WSQH 1RIUH 3WL9B 1AHWC 2P5WE 1NMAL 4XAWH 2YD7A 5I1IH 1C7TA 5E2VL 4OQTH 1D6EA 5DRNA 3GHBH 4OF7A 1E4WH 1CIDA 4HIHB 3H3KA 1TVBB 4YDIH 4HIXL 1J86A 3JBG7 4WI5A 1QFWL 4X5WA 1IGIL 1MCLA 4HW6A 4HKZB 1WWWX 5HVWA 12E8H 5D96B 5L2JA 4MA8H 2EDXA 3N1FC 5ILTL 2UV3A 1RZFH 4WIQA 3SEPA 3BSZL 3BIKA 3PNWB 4QKXB 2I9TB 3O6LH 1ZT4A 4OCXH 3U0PB 5H94A 5TH2A 3GO1H 3VW3L 1S9XB 4Q9QL 4K7FA 3VXMB 4NQEE 5H2BB 4WI8A 3GSVA 4FFZH 4RNRB 2PN5A 2P5WD 1DVFB 1WF5A 3BPNC 5F7KC 2Z4QA 4ZO7A 4HWZB 2DJ4A 1K8DA 3U46A 3VFOA 5F7FA 3N9GL 2R0LH 2HFGH 2Y7QB 1J8KA 4NUJA 3SDAD 4M7KL 2CQVA 4HCRH 4HZLB 5TF1H 5LXGL 4P2OA 5FB8B 3KHQA 4XNZC 4BFEA 4XPHL 4DZBA 4NKOA 1OM3L 4MDJA 4OQ1A 2DLHA 4QYOA 1DQLL 5C0CB 1CDHA 2O26U 5HVHC 3D3VA 4ZFGH 4HWBH 4G42B 2PNDA 2GW5A 3TM6A 4R8WL 5D2LF 4YE4H 2VAAA 2W60B 2BOCB 4YHML 3VFGL 3VWKC 3RWCB 5MERB 3U7YL 3RA7L 3V2AR 1T03H 3UCRA 2JTDA 4NBYB 3G5YA 2YUZA 2F54B 3EAKA 4JPWL 3QWOB 2X1XR 3H3PL 3HMWH 5CJQL 4PG2C 5KOVC 2E27H 4ZOEA 1BQHB 3SDDB 3BMWA 3IJYB 4PJFB 1XZ0B 3BP5A 4K8RD 3NA9L 4NKMB 3S9DB 4R97B 1H15B 2P43B 4FMKA 4OLZL 1LNUB 3R0MA 2VH5L 3IS1X 3R1GH 3W5NA 1LP9B 2OCFD 2V2TA 1KB5B 1HI6B 4PJDE 4OZIE 1LK2B 2DYPB 4C54A 4PJ7F 2IANE 5KZCB 3RPIA 1CFTA 2HKFL 5FUZH 3O0RL 3MRJA 4MNQE 4PRHE 4Q6IC 4AENB 1CDUA 2H3NA 1D5IL 3BN9C 1KJMA 3JWDL 3DUUB 3CXDH 5FF6A 3ZDXE 2ZUUA 5EZIL 3O8XA 3H0TB 3R06B 4FP8L 4E42B 3D0VA 3MV7E 2FR4A 5EZOL 5T3XE 4MA7H 4OD3H 4PGDA 1FORL 4J3TA 3SY0B 3GSNL 5JW5A 2X4NB 1NMAH 2EDFA 3TCLB 5E2VH 1XR9A 1T0NB 1C16A 3T65A 3O9WB 1NMBL 3GM0A 4W81A 3RTQC 2A9ML 2VITB 3QQ3A 4HIXH 5FM8A 5F9DC 3U0WH 1QFWH 2IAND 3T4YA 3DX9B 3I6KA 3MV9B 2G5BB 2RBLA 2EC9U 2V2WB 2YPKA 3IU3B 4JRXA 4Z76B 4N0UB 2VDRL 4S1QL 2P4AB 5ILTH 1MI5A 3EJJX 1NFKA 3BSZH 2WANA 2XWBA 5C0IA 2HMIC 1KCRL 4WW2B 4NNXB 2NY6D 5KTEL 2CRMA 1ZLUK 3VW3H 2E9BA 1YMMA 4X4XB 5T3XD 2ZCKL 3MLUL 1QEWB 2EE9A 4N1EA 4L4VB 3UPRA 2X42A 2EEBA 4Y2OA 4MZ3A 5DEFA 2YUVA 3O6ML 1P7KB 3QXVA 4OLWH 4XGZB 2VDLH 4M4PA 4NN7C 2QBWA 5FECA 1S5IL 4OCWL 5MEPB 3N9GH 1BOGA 5IBTL 1KTLB 3QEQB 4Y16C 2LFGA 1MIEL 4M7KH 4S0TD 4XPAL 4LCCA 1OF2B 5KS9E 2XKNB 4KK9C 1NQBA 4KKBC 4PLNC 1EPFA 5LXGH 4HC1L 4K71B 3RWJA 1EFXD 3LSOA 4XPHH 2CKBA 2CLZA 3FB7A 1WWAX 1OM3H 4AL8L 4PGCA 2QSQA 3FFCB 4NZRL 2AKRB 1DQLH 2N7AA 2QADC 3J7HA 4ODSL 4ONOA 4WO4D 3TFKC 5EN2B 2FBJL 2A74A 1TZIB 1DN2A 4R8WH 2BOBA 3NFPA 5J3HD 4EIZC 4X98B 1HDMA 5HY9A 5A16A 4DUWA 1JZ2A 4YHMH 3VFGH 3STLB 3U30B 2OXGA 3RA7H 2ZPKL 4IMLB 3VA6A 2ARJB 4JPWH 1BFSA 2ZUYA 1P7QB 4QRQA 3H3PH 5CJQH 3FFDB 3U4AA 1BQLL 4JY4A 4XPTL 3H2WA 4OF8A 3NA9H 1I3RA 3WE6A 1NANI 3OX8B 3ULUL 1OW0C 2VH5H 4RZCA 4MYWB 5JPNA 1QFWM 5IP4A 2AQ2A 3S35X 4XNUL 3MRIA 3OGCA 5ISZE 2HKFH 3RP1A 3O0RH 3VXTB 2Q86A 3DTXA 4C56A 1A7QL 5JNYA 1HHGA 3DURA 3QR2A 2EDRA 2XKUA 1BVLA 2CXGA 4TVSa 3BGMA 2MPAL 3C6LC 3T0XA 4WWKC 3SDAA 3CH1A 3JWDH 3JTTB 4ZUWB 2ARJQ 1CLOL 4M1CD 5CJ5A 3TT1L 4CJ0A 4FP8H 5E00A 4R90L 3HE6D 3ISWA 4BQ8A 5F9JB 5EBMA 3BKYL 3TO4B 5I8OL 5EU6E 3GSNH 4QCIB 4O2EA 3IDJB 1NMBH 3IGAA 5I9QC 5HYQB 3C5JB 3L3GA 3TPUA 5IBUB 1EAPB 5ISZD 3CCHA 3RHWF 1MWAB 1G7PA 2BCKB 3RVTD 4E9LA 1PX3A 2VDRH 4S1QH 4JGUA 3RGVD 1WGOA 3G08B 3UTZB 3RHWK 2NW2A 4YGVB 1PEWA 2BFVL 3L5JA 4OZ4A 1WVZA 1LWRA 4P57A 4F7CB 4JZNB 3MLUH 4PJBB 3ABZA 1AY1L 1FV1A 2CR3A 5EU5A 1MHCB 2DDQL 3I9GL 2G9HA 1AGCB 3O6MH 5DJ2A 5F3HB 3L3KA 1C08A 1U8HB 2NXYB 4GRWH 3VFPA 1CIUA 1S5IH 4J12A 4OCWH 4X83A 4LASL 2BNUA 5IHLB 4G9DB 4QHLB 3OR7B 2Q8BL 1ITBB 5IBTH 2XACC 4NT6A 1WBZB 1A6UH 1DLHA 4Y4HB 2V7NB 3DI2B 1NGPL 1V05A 4LLAA 3LQZA 3L3OB 4M6ML 5TDOB 5JXEA 3UPCA 1JYVA 5I30L 2IFFH 4NGHL 2PYFA 3FOMA 1MCHA 5CGMA 5C0BD 3M8OL 3U36A 3MLWL 2J5LC 4TTGA 1L0XA 4NC1C 4AL8H 3QUZC 1BIIA 4PP1D 2YMXL 2ICEB 3MBED 3AGVA 2AERT 4ZFOL 3CUPB 1A3LL 4ODSH 3CU1A 2X1PA 43C9B 3U1SL 2FBJH 4W6WB 3QJHA 4N1CA 3ZTNH 4UZGA 4HMDA 3SKJL 1SJEA 1KLUB 2IANA 2GTWA 1QSEE 3Q2CA 1S9WB 5EBGA 2FWOB 5J13C 2YHGA 5SV3A 4U6YA 3TN0A 5HGHB 2J8UA 4MJ6A 2EYRB 1BQLH 5B39A 4DEPC 1ES0B 3QA3B 1JN6A 4XPTH 4DQOH 4AIOA 2LU7A 4F7MB 1WFUA 4BQCA 4DUVA 1U9KA 4DTGL 3ULUH 3JUZA 1XH3A 1NFDF 3BZFA 1LD9A 1EBPA 4JHWL 2IWGA 1BHGA 3MUGA 1JE6A 1JWSB 4XNUH 1ONQA 3P77B 2HFEA 3VH8B 2WBJB 5C0AB 4JKWA 4KUZL 4YIQB 4QHMB 1XGTB 5BVPL 2WWKO 3PWVB 1INQA 1IAMA 4C4KO 3IETA 5JO5A 1NMCB 2HAZA 1F3DH 2MPAH 1QSED 3V0AC 2DLFL 3AXLB 3T8XA 2F53E 3AS2A 2VZUA 3MPCA 1CLOH 1INEL 5I1LB 3BZ4B 2BVQB 3TT1H 4YPGA 4R90H 2W38A 4GAFB 2YA2A 4HPOL 1AGBA 1JF6A 2LU3A 2NLJA 1HHHA 4N9GA 5I8OH 1K4CB 1RK0B 4LEOA 2BXZA 5GGTL 1N0XH 4QHKJ 2ARWA 4I0PA 2FGWL 4ZSOB 1EXUA 1DR9A 1UWGH 1QQDB 5DK2B 4S11A 3MRGB 1TZHB 4HLZG 5FGRA 4WDIA 1H8NA 2EIDA 1FIGL 3FCTB 4Q58C 1GGIL 4GG6F 1A6AB 5E8EB 1CGWA 4JG0L 1K9TA 3X17A 4KJQC 5GS1B 3AM8C 2BC4B 4ZTOL 5HGAA 4CKVX 2BJML 4U1IB 1DQML 2F53D 4AG4L 5JW4N 2E7CA 2BFVH 3QUKA 4N68A 4X99B 3JV4A 5DJZB 2OQJA 1AY1H 5J6HB 1U8QB 1XIWB 5LKNA 1DEDA 5F7NC 4YWGH 1N4XL 2QQLL 2O61B 4LASH 4KAQL 1F6AA 2ZOKA 4Q74A 4UQ3A 1TNNA 4L3EB 1BD2E 3EYFA 4N0YH 5D2NC 4N5ED 3P0GB 5F7UA 1NGPH 3GSRA 4M6MH 4Y5YA 3DJ9A 4XXDA 1DQTA 1W0VA 5I30H 1GIGL 4NGHH 1AGFB 5D2LE 3M8OH 1VKXA 3UTSB 4YUEL 1EA9C 5J57B 3LQAL 3HE6A 3T1FB 1OP3H 3KJ4B 5CP7B 2HN7B 2FNBA 3HAEG 1NGXB 3B2VH 1LGVA 4QLRA 1XFPA 2YMXH 2CDEB 2FATL 4ZDHA 5IB4A 2GJJA 1A3LH 1ZHNB 1A7BA 3MV8B 1I8LA 3U1SH 5HD8D 1ACYL 3OPZH 2IBGA 4Y2DC 3DV4A 4ZXBD 3SKJH 5I1DB 3CZJA 2ESVB 5DQDL 4LSSL 3E6FA 2DWDB 2X9XA 4L3CA 1B90A 1O7VA 3MRRB 2Z8WC 2GY7B 4GMTH 4NFCA 3S37X 4OGYL 1BD2D 5SWZE 3RGVA 3WJJC 4GBXC 4PJ7E 5ALBL 3BO8B 4QHNB 4G8GE 1CLCA 3PIQA 3VRLF 1DUYB 3PWUB 1ZSDA 1OVZA 4AEFA 3WHXB 2C4FT 5J6GA 1ACZA 4DTGH 4YHNA 2ERJB 1XGQB 5HYIA 4JY5L 4P3DB 1AKJA 4I48A 3WKMH 1IL1A 1DBML 4JHWH 5T1MA 2EKSB 4W4OA 1JCKA 3EOYG 3EHBD 2XNAB 4WV1B 5BVPH 5FYLL 4HBCL 3CFEB 1RK1B 3DVFA 1J87A 2Q87A 2Y25A 3HZKA 3K2MC 4M1GL 3LKQA 3TZVC 3VFNB 2DLFH 4DUXA 2YOCA 3JXAA 4FFWD 4E41A 3FN3A 5DI8A 4JREB 1INEH 5SWZD 2O5ZL 5C0BA 2YR3A 3CFKA 4HLJA 4JZJB 2Z8SA 5CGYC 2FIKB 4HPOH 2NY3B 4G8GD 5I15L 3RIFF 3OKKA 5SX5K 1RUAH 4X6BB 2GJ6B 2NW3A 3DV6B 3MJ6A 4P46D 3SKUD 2FGWH 3RIFK 3U82B 4NQCA 3C5SA 3G5XB 1FIGH 1GGIH 4JKPL 3BMVA 1CICB 4OI7A 2AAVA 1H3PL 2ICES 3LS4L 4JG0H 3SKOA 1X5AA 3L9RB 3RVUC 5EBLB 3A0OA 4ZTOH 3PGDA 2QL1A 2BJMH 1DQMH 3L5HA 5DVMA 5IHZA 2OK0L 1YEJH 4AG4H 3GM8A 3LKNA 1L6ZA 3DRTA 4AYFA 5I73C 1BECA 1R3HB 4L4TA 4QNPF 1J0ZA 3QDJA 2WSKA 1TFHA 3PWJB 4H0IA 1S78D 3ARED 4F7EA 5JXAL 4AIZB 4F57L 3MA7A 3QBTB 5EUKA 4ONGL 3QDMB 5SWSB 3QIBB 3JV6A 4OFIA 4UU9B 4RGOL 4NO2A 1N4XH 2R4RL 4MA1B 4KAQH 3VFRB 4FQQB 3PJSA 4R0LA 3EBAA 1QSEA 4QXTA 5D93B 4LLYA 4JFPB 3T4AB 2BVOB 4KUCF 1GIGH 5F1IA 4XRCB 3PL6D 5CIPH 1WQVT 4XBGB 4LSPH 3W5MA 1QFHA 5A2FA 4YUEH 2E5EA 1JNHA 3EUUA 3DARA 3BPLB 3LQAH 4H1LB 1OQXA 2W65B 1EBAA 2XTJC 3QP3A 3ARGD 3T0VA 5JTWA 3C8HA 3DO3A 2ITDA 4HWEL 5FK9A 3OAYK 2P1YA 5DMKB 4L8BB 3HR5A 3WEXB 1RJLB 3WO4C 1NBYA 1BOYA 3N1PC 4BZYA 1CE1L 4JFXB 1KXVC 1RMFL 3MRNA 5A3IC 2WWMC 4LSSH 4Z77A 3CVHB 2FGZA 4G43B 4I18A 3CFBA 3KWWA 1IC4L 5D1ZA 5E1AA 4OGYH 3W0WA 4Y1AE 2R4SH 2OYPA 3ARBC 2NY1C 5ALBH 3VDCA 1U8OA 1G6VK 2F53A 1XAUA 3ARFD 4PRBB 5ITBL 3WN5C 4P5MA 3C5ZC 4PJXB 1HKLL 3MLVH 1CDCA 1XCQA 2RQ8A 3KYMB 4S1SL 1K3IA 3ZT7A 1R6VA 2IMMA 4JY5H 2ICWI 4P5TA 1DBMH 4PD4J 4UNUA 3HN3A 4CN4A 3VXUA 1HZHL 4UNVA 1Z9LA 5GISL 2V7HA 5DJCB 5I1EL 2P8LB 5F9AC 5JORA 5ADOL 5FYLH 5IFAL 1RZIA 4HBCH 4JVPA 2E9IA 1CXKA 3KJ6H 4M1GH 2V5RA 2E7HA 4RAUB 4BK4A 3MLXL 3MA9H 2HTLD 2NY2B 4GW5B 4ZMAT 4Y1AD 2O5ZH 2DTSA 1S7TA 5HHVL 4JFEB 4Z0BH 4HIEA 1NEZA 4TOYL 3RWIB 5I15H 3IDYC 3GB7A 4Y8DC 5TQ2L 3L95B 2EICA 3RWGA 1P9MA 1H3XA 3DOSA 1MAML 5CEZE 3CLEL 2VLKE 4HHAA 1CU4L 4PJAB 3P9LB 2VIRB 1AR1D 4JHZA 5DFVD 1R24B 4ZXBA 3RFZC 1FL6A 2FO4A 3X14B 3SDCC 4GW4B 4JR9L 4JKPH 3BW9A 2PF6A 1H3PH 1KJ2B 3LS4H 2EDBA 2NY4D 4CDGC 1B6UA 3IDGB 3SGDI 1NC4D 4HGWB 1X44A 1EX0A 5GRJL 1CL7L 2OK0H 5ANME 1KN2L 1U95A 4PB0L 4N0RA 5GGSY 5JOPE 5D2LA 5IVOA 4ALAL 4G9FB 4IIQB 4RMUA 4CVXA 1F97A 3MO1B 4JFQB 3RL2B 4HGKC 5JXAH 4F57H 1NGYA 3QUXB 4ONGH 4NRYB 4Z7NF 3MBXL 2VLKD 1G7QB 4QHKI 3EYQD 5KAQF 1PSKL 3ZKMD 2R4RH 4Y19B 1W0YT 4PRAB 3TA3D 1QFPA 3OG6B 1FZJB 2K1MA 1VA9A 5J11B 3JWDC 1G7HA 4HS3A 2P5EE 3DECA 4CVZA 5BQ7B 2HJKA 1FVCA 1FVEA 3E8UL 1H5BA 4J4PD 2CK2A 4PJ7A 4QT5A 3G6JA 1TIUA 2XQYK 5FKPB 1BLNA 5T1DL 2I07A 5FCSH 2Y5TB 2CLRB 4FTVE 3ILQD 4G8GA 5BZDB 5JOPD 3VI3F 4XC1L 2I24N 4HWEH 5L9DL 2F54E 5F7YC 3DX6B 1SM3L 2DJSA 3KYKL 1FNEA 1CE1H 4PRIA 1A3RL 1RMFH 4DWHA 4JZOB 4JRYA 3HE7B 2JK5A 5LGHL 1NFDE 1Q0XL 1CD0A 1IC4H 4U7SA 4Y4KB 5CD3B 2CDFB 1B88A 3CAFA 4PRPE 2PYEE 3UJTL 3RVWD 2P5ED 2D7TL 4LCWA 2OX5A 3MZGB 2ZCLL 1HKLH 1QTYT 4GW1B 4R9HA 1JGDA 4S1SH 5GSRA 3GEWB 3LQMA 3M1BB 4FTVD 4U1KA 4ZFFB 4JQXA 3RUGB 1I7TA 3VCLA 1NAMA 4Z7VF 3LEVL 4KWUA 3VJ6B 2F54D 5T1KB 5I0DA 5DK0B 5GISH 3THML 3NPSB 3DVIA 4FQXB 5I1EH 2EDHA 3CSYB 3TBWA 3SCMB 5ADOH 5IFAH 3IXAA 2DQHL 1P2CA 3G04A 3QRGH 4MXQD 3ALWA 5E6IA 5MENE 1XGPB 4U1JB 1SBBA 5LBSH 1FSKC 3WFHB 3MLXH 5EDXA 4ZYKA 2YXMA 1LEIA 1FFPA 3LKRA 1U58A 3QI9A 5KZCD 1Q9LB 3H9HA 2PYED 4PRPD 5JDSA 2ZP0T 5HHVH 4GG6E 5C1MB 3S96B 1OT1A 1ODAA 4TOYH 5TQ2H 2EE2A 3UBXA 5IMKB 4AEEA 4L29A 1MAMH 4PREA 2KZ1B 1CU4H 1EEQA 3MCKA 1M71A 3LB6C 4ESKA 4TN9A 5F71A 1FN4B 3D25B 3D18A 5KG9A 2HLAB 3T0EC 1S9YA 4JKKA 3S3SA 5I66A 4MWFA 3TYGL 3UO1L 1IGTA 4NN6B 1HHKA 1ZLWK 5JPMB 1UFUA 5MEND 3WS3A 4RFEA 4G7VL 4N9OB 1C12B 4UMGA 4HUVA 1U2HA 5GRJH 3GSXA 1T83A 1KN2H 4L3AA 3BRDA 1WSST 3BPCB 4WI4A 4PB0H 2YD8A 1CGTA 3P9MB 4XNXL 2VLRE 4ALAH 1W72B 4BSJA 4LLQA 3ULUC 4XP1L 4KRMB 4N8CL 1KCLA 2Z8VC 3QUMA 4LF3A 3CH8A 4F33A 3O41A 3K8KA 1DBAL 4ZPVB 1BQSA 2R8SL 2PTTA 1HQ4A 4Q2ZB 1A1MA 1MHEA 4M8VA 5CHNB 1A6TB 3FQRA 4U6HB 3HB3D 4EI6B 3KPOA 3TO2B 1UGNA 2W91A 1L7TL 1SYSB 2R15A 3BPOB 3E8UH 1YPZB 3MREB 5HI5D 1QLFA 4LSUH 5T1DH 3QEQD 3QULB 5HGBB 2J8OA 5L9DH 2XQBL 3DIFA 3VWKD 5KSBF 3KPLA 3VGAB 1SM3H 4Z6AT 1PDKA 4JPVL 3KPMA 5EUOF 2X2YA 3QHZL 4NO3A 3VRLE 4DZ8B 3IFLL 1A3RH 5EO0B 5DJ6B 2CDGA 1HH6B 3STBA 1Q9OB 3B9VA 5LGHH 3DX7B 1Q0XH 2Z91B 4GG8B 3FFCD 3WL9A 5IWLC 5GSVB 4OFYD 3TWCL 4RFOL 3S35L 3MRCA 1RPQA 3TH3T 5D1QC 1JPSL 3UJTH 3F7YB 2YSSB 2D7TH 4KROC 4HIHA 4X7DC 3ZO0A 2Y6SC 4DOHB 3LCYA 2ZCLH 4PJ8C 2D7QA 7CGTA 4XCFL 1L6XA 4JB9H 3A6OA 1N26A 4NM4L 5ALCL 4YBLB 1Z5LB 5SX4H 3LEVH 1OP5K 1P7QD 3RZCB 5INDB 2CUMA 3UDWC 1U91B 3THMH 1LQSR 3PNWA 3U0PA 5DT1L 1L9MA 4UTAH 4GH7B 2DQHH 3PP3K 2FX9H 1LO5B 1S9XA 3WD5H 1G1YA 4NQVA 2IPUK 4XP6L 1DZBA 4J4PA 2CKBL 4GKNB 1TQCC 1AR2A 1E27B 4HWZA 3RTQD 2Y7QA 3MRLA 4OCRL 1CFSA 2V6HA 4ZNEA 4HZLA 2AEQL 4MXWL 1A7NL 5CAYB 3J8F7 5FB8A 4QNPE 5F6HI 5I75B 1GGUA 5H37G 4YFLF 1YQ2A 3KPQB 5TDNB 1WZ1L 3TYGH 3UO1H 1T4KB 4X5XB 3O6FC 4J8RB 2JB6B 4G7VH 1BVKA 5EORL 4G42A 1UH2A 2W60A 4XNXH 1MH5B 2BOCA 2GIYA 5BCAA 3RWCA 3V5KB 5MERA 4XP1H 3FQTB 4N8CH 5EOTB 1U8KA 2X4OB 5HI4C 4Y16D 5HPOA 2F54A 1AD9B 5M94B 3QWOA 1CD8A 1DBAH 1BQHA 4XWOD 5E95B 4ZQKB 2R8SH 3SDDA 3IJYA 4PJFA 4KKBD 4MX7B 4PLJC 2NYYC 1FCCA 1OL0A 4LVOB 1H15A 1LNUA 5K9KB 1ADQA 3RU8L 1GPOH 4U1MB 3MGOB 1KB5A 1HI6A 4WU5B 1L7TH 1L4IA 1LK2A 2QADD 3FB8B 1CXIA 4M7ZB 2XN9B 3CDGB 3FQWB 4R96B 3RWEB 3HUJF 5DFWH 5EC1B 4EI5B 1U2CA 4PJHB 4AENA 1B9ZA 5HHOB 3I75B 4NRXB 2XQBH 5KSAC 3VI4F 4NJAL 3DUUA 1I8KB 1OAXH 4JPVH 1ZMYA 2P42B 1GCFA 5CMAB 3QHZH 4PY7B 1I9JL 3AUVA 1FYTB 3IFLH 3H0TA 5EIQA 1CVRA 3EJZC 3F7VB 4P2QE 1U8IB 2UZYB 2HKHL 2F15A 4K7PY 4P3WA 3NACL 3B83A 5IVZB 3ZHLA 1WITA 3SY0A 2QHRL 2X4NA 1IAII 2VKWA 4UT9H 3TWCH 1F5WA 4RFOH 1JPSH 1T0NA 4HKJB 3DROA 2YUXA 2CPCA 2R9HC 2XIDA 5F9OL 3QCUL 3OZ9L 3MGTB 1WFNA 2VITA 1OD7A 3EYVB 2AJ3B 1CG9A 4EZMA 2R0KL 3DX9A 4GG6A 1WTGT 3LPFA 2G5BA 2J8HA 3MV9A 4NRZB 1QACA 3PABB 4NM4H 2V2WA 3IU3A 4Z76A 4N0UA 5CUSL 4EIGB 3KS0H 3C6LD 4WWKD 5AUMB 5IHUL 5BW7A 1WBXB 3TYFB 4WW2A 4NNXA 5FXCH 3DGGB 1NKOA 5DT1H 3QIUB 2IH1B 1DLFL 2GAZA 4O58H 4P2QD 5GRXG 2H6PB 2UY7A 4L4VA 2N56A 3SJVE 1CFBA 4GAYA 1E4KA 4P23C 4XP6H 3BD4A 2Q7YB 2CKBH 4U1SB 2FDBP 5ICZB 2WLZA 4XGZA 3WJLC 4NQTA 3LQAC 3QEGL 5MEPA 2C1PA 1KTLA 3QEQA 5DQ9B 4OCRH 3VWKA 1BFOB 3SBWA 3F58L 2NY5H 1W0WB 1OF2A 4MXWH 5SV4A 4PJEF 3VGGA 1A7NH 2XKNA 5I17B 1LE9B 5J1SC 5HDLA 4ETQB 4KTDL 4RX4D 4TSCL 4NC1E 4DK3A 2WBKA 2APXA 4F9LA 1WZ1H 3FO1A 3FFCA 3EDKA 4OM1L 4OFYA 4Z7NE 5IB2B 3GIZL 1BBJB 4IJ3C 5EN2A 4OZFB 5EORH 3SJVD 3BQUC 5I1AB 1YECL 4Y4FC 1Y6NR 4X98A 3PXJA 3EKCA 3STLA 4XI5C 5L8LB 1IEAB 4ZD3L 4W6YB 5D4QA 4IMLA 4XBPB 1UC6A 2ARJA 4MSWB 3OTTA 1MQ8A 1P7QA 3D1MC 3FFDA 4HKXB 3HNVH 1BAFL 5D1XB 3L3IB 3UBXG 5F7LB 5IB1B 3ZT6A 3VI3E 4GQPH 3RL1A 2APFA 4DGYH 1MCPL 3OX8A 5FDWB 1BQUA 2D03L 1M6OB 5JZ7D 2JCCB 5J12C 3VWJC 1DANT 2J12B 1WBYB 3T3MF 5EOCL 3V9FA 3Q3GB 3BDYL 4NCC1 1OT2A 4OM0L 3VXTA 2E8YA 5BO1H 4L3ED 1GOGA 3WMSA 4RMQA 4NJAH 3OKDB 2KKQA 4RWHA 4ZUWA 5T1LB 3D9AL 4WEMB 1ORQA 3KLHC 1M7DB 1I9JH 5J56B 4LSVH 4CBPA 1WCBA 4GRWF 5IJVB 5F1OB 5F9JA 2HKHH 3TO4A 4YK4B 3P4NB 4Z7VE 1I75A 2QHRH 3ARZA 3KXFE 4XVTL 1HEZB 3IDJA 1JWUA 4YDJB 5C09B 5HVGB 3QCUH 3OZ9H 5HYQA 4K8RH 3C5JA 1ULVA 3KR3L 1EAPA 4GAJL 4WHTB 4PV9B 4HF5L 1MWAA 3X12B 3P40A 2BCKA 3C60C 4A2LA 3BP7A 5D70L 4U1NB 5CUSH 4Y16A 1QG3A 2R2BB 3G08A 5GGQL 1MEXL 3E2HC 4KI5C 3WLBB 4IRSC 5AEAA 1QYGL 5DJDB 4ZUVB 1F11B 5J1TC 2XWJB 1N6VA 4F7CA 4JZNA 2W0PA 5IROA 4POZC 1IQWL 4FNLL 2EDTA 4PJBA 4IEFB 1T04B 3C2AL 4QHUB 1MHCA 3GMNB 1AGCA 3KXFD 1L9NA 4N0FB 4FFYL 4H0GA 4U4BA 5F3HA 5B8CB 1U8HA 4XHJC 3QEGH 2ZUQC 1U3HB 2GY5A 4G9DA 4QHLA 3ZKNC 3LEYL 4XTRC 3OR7A 1R0AL 4A6YB 4XHQA 2BNQE 5D2NE 1WBZA 3ULUF 4O4YL 3F58H 2V7NA 1AIFB 5TDOA 3L3OA 3RX7A 1T89A 4KJQD 2WWKT 1BBDL 1JHTB 4XXCC 3PDOB 4KTDH 4EDWL 4TSCH 5JHDB 1NFIA 3ARDC 5KVMC 4L9DA 3MNWB 1MCJA 1X5GA 4YDVA 4OM1H 2ICEA 3KPSE 4DVBA 3CUPA 3GIZH 3QPXL 1Q72L 1YECH 1QPXA 1KLUA 5T3XH 3C2SA 1TQBB 3G5ZB 2FWOA 2Q76B 5E7BA 5GIRB 2BNQD 4FS0A 5HGHA 1BAFH 3QA3A 2IFGA 1OTSC 2X4TA 4F7MA 3VXRB 5KSBE 2K3TA 4X8JB 3H9SB 4P2QA 5EUOE 3IDUA 3ZT5A 2BHYA 4TPRL 4QTHA 2A1WL 3CGTA 5I71B 3KPSD 2FIRT 1JWSA 2DD8H 3BDYH 5DF0A 1GH7A 3P77A 3VH8A 2WBJA 4OM0H 5C0AA 4Z95L 4QHMA 1XGTA 4Y2DD 3PWVA 4D9LL 3MLPA 4JFDE 3V0WL 3AXLA 3QAZC 5DURD 1MCIA 3TVMB 3D9AH 3ZYIA 4QRRB 3PGCA 5I1LA 3BZ4A 4GBXD 2BVQA 1B4RA 3RWHB 1NCAL 2LAGB 2NZIA 4G6AC 2YN5A 5E03A 4F15B 4P4KC 1NL0L 1K4CA 2DL9A 1VFBB 1RK0A 3EOBB 3AS3A 4MMXC 5D7SH 4HS8L 4FA8A 5E9DB 4JGJA 1K3ZA 1MY7A 4OCSH 4ZSOA 2GQHA 5DK2A 3FTGB 4APQC 1TZHA 5ENWB 4GAJH 3FCTA 3CMGA 1HE7A 1A6AA 4YR6B 4HF5H 3TBVB 1WC7B 2UUDH 3NABL 3WIIL 5D70H 5GS1A 4JFDD 1S7QA 2BC4A 2GSIB 3TZVD 5DDHB 3N85L 4U1IA 5F88A 1BVZA 3LDBC 5GRZA 1IM9B 3WNOA 4WHYG 1UWXH 4X6DF 4X99A 5CGYD 4ELKA 4J1UB 4ETYA 1JTOA 1IQWH 1XGRA 4FNLH 4M48H 5DJZA 5FIEA 5J4MA 3C2AH 3WHE1 5J6HA 5IB3A 1U8QA 1XIWA 4FFYH 3B43A 5EU4B 2YD3A 4MQSB 1H0DB 1JHKL 1IILE 2Q8AL 1RI8A 4R7DB 2O61A 5GXBB 3E6HB 1M7XA 3BHBB 3KDMB 3N0PB 4D9RE 1R0AH 4YFEA 5JA8B 5C0GA 4L3EA 1DN0B 2C5DC 2FH8A 3ROOB 4U49A 4G3YL 1UJ3B 5I19L 5I74C 3RVUD 4FXKB 1AXSB 3TIDB 1AGFA 1BBDH 1CDJA 3UTSA 3C6SB 3X11B 3MV01 3T1FA 3GSUB 3VMNA 2XTJE 4TVPL 1GC1L 3QUZB 4PYGA 5CP7A 4W68A 2HN7A 3WFCL 5IR1B 1I1AD 4WFEE 4U6VH 1NGQL 1NGXA 4FHBD 2CDEA 3KVQA 5C0EB 2VKXA 4LSRL 5B22A 4C55A 1A7RL 1Q72H 2BVTA 4JM2C 4MD5B 2WP3T 5I1DA 4UINL 2ESVA 2ICCA 1A9EB 2DWDA 4D9RD 4ZFZB 1HIML 1RZJL 4MD0B 1MVUB 5F7DA 3BO8A 1FO0B 3HUJE 4QHNA 3HNSL 3PWUA 1MFCL 3VI4E 3WHXA 3DYOA 2EKJA 4M1DH 4B7IA 2XTJD 1XGQA 1IGJB 2X40A 4P3DA 4P2OC 4P4RA 4QXWA 4TPRH 3DX8B 2A1WH 1AGEB 2EKSA 3EO0B 4XVSL 2J4WL 3O3EB 5GZNC 4NOFA 2XNAA 4NSKB 4WV1A 4XZUB 3FHQA 4Y19D 3DSNA 4D9LH 3QFJE 5A3ID 3CFEA 1RK1A 2WWMD 3V0WH 4DKEL 5CLTA 3VFNA 2P46B 2J1KA 4H25A 5C3LD 1UH3A 1HHJB 3OAZH 1FQ9C 3OKMB 3E0GA 3LRSB 3VGBA 1YY8A 3ARBD 2NY1D 3LV3B 1PZUB 1NCAH 1F45A 4JZJA 2FIKA 4OV6F 4UUJB 1NL0H 3K4DA 5CSBA 4X6BA 4HS8H 2GJ6A 2ZUWA 1IAOB 3DV6A 1UXSB 3QT2A 2AI0L 4DKAA 2YPLE 5DMIL 2XRAL 1OGAB 1MFDL 1XGUB 2JIXB 5JW4Q 2EE6A 2VN4A 3CFCL 4PRNB 5L88H 3W39B 3SE4A 5LWYL 3I85A 4PG9A 4PR5B 4XP5L 3WIIH 3QFJD 3ES6B 4WRLA 3NGBB 3L9RA 5EBLA 2BNQA 3N85H 2B4CL 5E4EC 2GTZB 4YHIA 1BMGA 1Y0LB 3QIWC 1R3HA 1KT2B 2VQTA 1I7ZB 1P4BL 4P9HL 2NXZB 3PWJA 1FBIH 1T66C 1FVDB 1FFRA 2A9NL 3O8XC 4PJEE 5HYSB 4AIZA 2R2HB 3QDMA 5T1KD 3VFVB 4HUWB 5SWSA 3GBMH 3QIBA 1DBBL 4UU9A 1VSCA 4FQXD 2A6KB 2YPLD 3Q6GL 1KUMA 2IALB 4FQQA 3VFRA 3WBDA 4EXKA 4XH2B 4IRZL 2ZUTA 1OD9A 2ENYA 3CXHK 3KPPB 1JV5B 2IEPA 4JFPA 1FFQA 5FGBA 3RQ3A 3RWFA 3T4AA 5I19H 2BVOA 4LLDB 2VR9A 4XRCA 4GBXA 1CDIA 2DKMA 3AC0A 4H1LA 2W65A 1J05A 4YGAB 1JPTL 4XNQB 1NGQH 5FM4A 4PRDA 2A6DB 5DMKA 3UYOD 4L8BA 4LSRH 1MRDL 3WEXA 1RJLA 4KZEL 1HYRC 5I1GL 1A7RH 2N1KA 2ADFL 4JFXA 1Z9SA 4UINH 2NNAB 1UB5B 5H37H 5IVXF 2VLMD 4GRLB 3CVHA 3L3HB 4G43A 2FEEL 1IC5L 3R0NA 3Q1SH 5D7IF 3NZ8B 3GFUA 5CINL 3T3ME 3TZVA 5ACZB 1X5XA 1RZJH 3H42L 3BISA 5IMMB 3ULVL 3OKOB 4PRBA 5C86A 3HNSH 2GSGB 4PJXA 4JHAL 1FGNL 2B5IC 1MFCH 3KYMA 4LCCC 3WUWB 2ATKB 4KK8C 4IOSD 2C4XA 3ET9F 2HT4D 2B2XL 5B4MC 4EKXA 3QUYB 4Q9BA 3S3PA 3UTTB 3OB8A 3GMLB 4XVSH 1I1FB 4GRWE 1PAMA 2J4WH 4QRPB 5FKAA 3EZ8A 4HH9B 4NYLB 2JELL 3UZQA 4XT1C 1ZT1A 3WUZA 2P8LA 5B38B 3ROLB 1C7SA 1RFDL 4U3HA 2NY5C 5F9WB 4RAUA 1CN4A 4YC2C 3VD3A 4GW5A 3SE8L 4LVNB 4KI5F 3T1WA 4JFEA 1TPXC 2F58L 5D7JB 3TJEH 1TTFA 5I1HL 2CK0L 3L95A 1I1AA 3S5LB 1EEZA 4WGVB 2VDKH 4JRWA 4EJ1C 3TBSB 1VADB 2WK2A 2AI0H 3P9LA 4CMHB 2J88L 5DMIH 2JLLA 5IMLA 2XRAH 3ZKSD 1MFDH 1R24A 2D9QB 2DWEB 4UQ2B 1JZ8A 2ED7A 3T0EE 4GW4A 5HHME 3CFCH 5DUPL 2BMKB 5LWYH 5JDJA 1KJ2A 2E9WA 5AYQA 2VDQL 1PKQE 3IDGA 1K8IB 4HGWA 2B4CH 1PYWB 3O4LB 4RCAA 2PO6C 1D9KB 1P6FA 3T2OA 3HMXA 3JV0A 3SDAC 1R5VA 4JDTL 1P4BH 4G9FA 3ULUE 3QZWB 4IIQA 4P9HH 5C0JB 2FECI 3SGKA 3MO1A 3DXAB 1NC2D 1WEJH 3QUXA 3V4VL 1F90H 4NRYA 1FNGA 1G7QA 2ENSA 1FNSL 1DBBH 3LB6D 2AJUL 1BEYL 5AZ2L 3Q6GH 4Y19A 2ZNXA 1SY6A 4PRAA 3D6GA 3VG0L 4P2RB 1FZJA 4IRZH 5HHMD 1TTGA 3BUTA 5DUML 4EVNB 1KCVH 4NWUL 3MOQA 5BQ7A 3S4SA 2H45A 2IG2L 2B0SH 4QTIL 4X6CF 1RIVL 3NIFF 2Z31C 1K6QL 5FKPA 2Y5TA 2CLRA 4ZAKB 5ESVA 4UIKL 5A2IH 1JPTH 5FA3B 5EU3B 2R1XA 4ZUTB 1TJGH 4AY0A 3DX6A 3ULUD 1MRDH 3RKPA 3PQYE 4KZEH 3K4AA 5I1GH 1IM3B 1A21A 1MCKA 4ELMB 1MCNA 3HE7A 4RMSA 2X05A 3UPAA 4LLMA 1IC5H 1FGVL 3PDDA 5DJ0B 1ZLUH 5CD3A 2CDFA 4FQ2L 5CINH 3C87A 2DQIL 5KAQG 3H42H 4OFKA 1F2QA 6CGTA 1YNLL 1BJ1H 1RUPL 5I76A 3ULVH 1JF1A 2D0GA 4JHAH 1FGNH 4GW1A 2XQYG 2EDEA 5BS0E 4HKBB 5JXEC 2WIMA 4OCYL 4ZFFA 4PJ5B 2VLJB 5JR1L 3RUGA 1OAYH 2I25N 3QISA 2HVKB 1NCBH 1NSNL 3VJ6A 3SQOH 1LO2L 4OAWA 1BP3B 5T1KA 5TE7L 5DK0A 2NQCA 2UZXB 2VDOL 2JELH 3PQYD 4FQXA 2R1YB 3CSYA 2YPLA 4PGEB 3SCMA 3TBYB 3F8UB 3N1QC 3VFUB 5CD5D 3WIHA 1RJYB 1RFDH 1XGPA 2UWEB 4U1JA 1IGCL 1TMCB 3WFHA 1C5BH 3S36H 4UAOC 3SE8H 1Q9LA 4Z7UB 4KROD 1IEBB 1YDPB 2F58H 3S96A 2Y6SD 4LPUA 4QGTA 4Y5VB 3VRIB 4LNRB 3TN0C 5I1HH 2CK0H 4PJ8D 1MRCL 1I7RB 5E7FA 2ATPB 3OJVC 2A38A 3OKEB 5IMKA 5BS0D 1UH4A 1BJ1J 3QNXB 1D5XB 4K3DL 4PJEA 3QRFM 5C6PB 4O2FB 3WYRA 1FN4A 4PJCB 3D25A 1MQKH 4X6DE 5DUPH 1VGKB 3QUMH 2VDQH 5CSZB 4O02L 1BREA 2DBLL 1C12A 5HYEA 1S7UB 5FHBL 3P9MA 3VFMB 3JZ7A 1NGWB 4U6TA 1YYMH 1ADQL 1W72A 3N50A 4WY7H 1KB5L 1FNHA 1QBML 4KXZH 2QQQA 5EFIB 4I3RH 1W8NA 3V4VH 3D39B 5HYJE 2X4UA 4ZPVA 1BEYH 5AZ2H 4HGMA 3FB6B 4JO3L 3EW3B 1QO3B 4JM2F 4LSDA 5CHNA 1E28B 1A6TA 1P1ZB 1A1NB 4U6HA 4EI6A 3MRBA 2OL3B 4I0PC 3UMTA 3TO2A 5DUMH 4NWUH 5MEOA 5IKCB 3OWEA 3DMMB 1A4JB 4M8QA 4L8SB 1SYSA 2D7PA 2WMPA 3HG1E 3O6FD 4QTIH 1YPZA 1I8MA 3EZJB 3MREA 3MYZA 5FO8A 4U1HA 2OJEB 1A6PA 3GMMA 3QULA 5HGBA 3HI1A 1MFEH 4JDZB 4Q97A 1VFOA 4R2GC 3FMGL 1JZ6A 5HI4D 4JFFE 3JVGA 5GGVL 5D7LE 1VFAB 5HYJD 5EO0A 2M2DA 5DJ6A 4V1DB 2AK1H 3VFTB 2YPVL 4U7KA 1HH6A 1VHPA 4YHYC 1Q9OA 1FGVH 2Z91A 3DX7A 4PLJD 4GG8A 2NYYD 2RCSH 5D5MB 1ZOXA 1OAUH 2DQIH 5ERWB 3F7YA 1YNLH 4OLXL 2YSSA 4PJGF 1RUPH 1X5LA 4LRNL 2HJLB 3EDDA 3BYTA 4HC1A 4MGXA 3FO2B 4Y5YC 4AQ1B 5JR1H 3B4NA 5IOPB 1NSNH 1Z5LA 1NC2A 4OZHF 1LO2H 4H5SB 4NQDB 4H1LG 1S9VA 5INDA 3RZCA 3PV7A 4PLKC 2BNRB 1U91A 3OMZA 1DCLA 4JFFD 2VZVA 5D7LD 2F5BL 5GGRY 3EJZD 4OUOA 1I8LC 1N59B 3PWPB 4JAMB 2HT2C 4X7EC 4GKNA 2R9HD 4OTXL 1E27A 1R3LB 3RVTC 4MA3A 1KIPB 2F5AL 5F96L 2A6IB 4MAYB 3CPLB 1MRCH 5CEYA 1JI2A 1ZTXH 4F8QA 3CC5A 3MQIA 5TE6L 5CBEB 1XF5B 1T2QL 2R2EB 4K3DH 1KACB 4PTUB 2I5YL 2XY1A 4B7LA 4GKOA 1X6NA 2JJSC 1EHLL 1N8ZB 4MNGB 4Z5RB 2Z92B 3CZFB 4B53A 4P5KA 3KPQA 5TDNA 2D0HA 5HPMB 4W4OC 1T4KA 2PETA 4X5XA 4J8RA 2JB6A 3SE3A 1TVHA 2DBLH 2W9DL 3FN9A 3MRHB 2IPUG 3D85D 5I0ZA 5FHBH 3QCTL 2W0FB 5GZOC 3DRQB 1MH5A 1ADQH 5ETUB 5JIPA 4LEXH 2A83B 1S3KH 1O0VA 3S3JA 1KB5H 3V5KA 3FQTA 3R8BB 3IRZA 1FAKT 1GGCL 5EOTA 3QQNA 4RIRB 1QBMH 5JIHA 1UQSB 2X4OA 1RUQL 1ZGLB 4U33A 3H7BB 1AD9A 3OHXB 2AQ3A 2XWTB 3IAQA 5DVKA 3WIFB 4PP1C 4RSVA 3KNBB 5CBAB 4OIAA 3VXSB 4MX7A 2EDWA 1EV2E 2KQMA 4NHCL 5IMOB 2YD4A 3BZDA 5K9KA 4QEGA 4TTDC 4U1MA 3EFFB 3VFSA 3MGOA 2WW8A 4U1GB 5ICYB 4I77L 3FB8A 2VXTH 1A14L 2XN9A 3CDGA 3FQWA 3NA4A 5IVXE 3BQUD 4PP2B 1LMKA 5IFHL 4MZ2A 5EC1A 4EI5A 5IQ9B 5D7IE 2OS7A 4PJHA 3I75A 4NRXA 4XI5D 1OB1B 1FH5H 1TNMA 3NZHL 1KPRB 4RWYL 3FMGH 4Z7WB 4LHUB 3BGFB 3IDNB 2JJWA 4CVUA 1SYVB 3IKKA 5CMAA 4PY7A 1JZ4A 1MWAL 5JHDD 1CF8L 3F7VA 2YPVH 1Q9WB 1OTTD 1U8IA 1Z6JT 2VISB 1E4XH 1A7PL 3QXTA 1VB9A 1VCAA 1YEIL 5IVZA 3TGXA 2AV1B 3QEUB 5D1QB 1AO7B 4EN3B 4NQSB 1FNFA 1HXMA 4HKJA 4R0LC 4LRNH 3MGTA 3VWJD 3EYVA 2AJ3A 3IJHB 5C0FB 1GJIA 1N2RB 2JJUA 5I6XB 5I8EA 4P59H 3S4SG 3PABA 5CFHA 2PKDA 1MF2L 1W2KT 1UM5H 4ZFOA 3BUYB 4KI5E 3TYFA 4NFDA 3OF6D 2WUBH 5FO9A 2QHLA 3KLHD 1FZOB 2D4FA 3VGDA 3HI5L 3E3QE 2F5BH 1UEYA 3QIUA 3VXRD 5A40E 2IH1A 4CVWA 1JPST 2V2XB 2Z35A 5E9DE 3RY6A 2H6PA 2GJZB 2F19L 4M61B 1A6WL 3GSOB 4YX2L 2Q7YA 2ZG1A 4LKXB 4OTXH 4U1SA 5ICZA 3DBXB 4I18C 2AXGB 5D1ZC 2LU4A 3CX5K 5F96H 2C1OB 1R3JB 3GHEL 2EE3A 3TC9A 5DQ9A 2AK4B 1BFOA 3C60D 3G6DL 1W0WA 1ZLSL 1T2QH 4X9GA 5I17A 2I5YH 4GS7B 1LE9A 4QF1B 1LEKA 1WCQA 4ETQA 5HYJA 2LE9A 4KI5D 4N8VB 3LHPL 3QYCA 4IRSD 2EDNA 4P5TC 3RY5A 5HGDB 4X4YB 3SDYL 5IW6B 2BY0A 1RZJC 5IB2A 2DQTH 5FYJU 5E9DD 2W9DH 1IBGH 1YEDB 2A0LD 4OZFA 5I1AA 1MJJB 2NX5E 1WISA 3QCTH 2ADGB 1DE4A 1N64L 2QV2A 4N5EC 4XHJD 2J6EL 2Y06L 5JW4R 1IEAA 1FLRH 2FEEI 4Z78B 4XTRD 3JWNC 1D5BB 4MJIB 4K2UL 5F1KC 3SE9L 4K3GA 5GGTA 4XBPA 3BD3A 2VERN 4X6CE 3AMLA 3NIFE 3BE1L 5IM7B 4NUGL 5EIIB 4EUPB 4HKXA 4K94L 3K7UA 1P9MC 5D1XA 3L3IA 4JFFA 5DC9B 5L8KB 5IB1A 5I2IB 5L2KB 2A73B 3ARQA 1KENL 1J11A 4KV5F 4NHCH 3PHOA 5HD8C 5FDWA 1XR8B 4HD9A 1M6OA 1S7VB 4I3SL 4I77H 2JCCA 3UJIL 1WBYA 2FO1A 3GBNL 2B39A 1BZ7A 1A14H 4I8DA 2H2SD 4RGNB 2BRRL 3UBXI 5IFHH 4FXGB 2NX5D 4M6NL 1TJHL 1FLTX 1ZHBA 3MFFB 1ZAGA 3NZHH 1MHPH 3OKDA 4RWYH 3ZL4L 4NO0B 5T1LA 1F4HA 3SDXF 1KJ3L 5K9JL 1M7DA 1VACB 1JRHL 4ODWB 3ZKQD 1OWWA 1MWAH 1CF8H 5L8JB 5IJVA 3AY4A 4CGTA 1OTSD 1A7PH 1YEIH 4MD4A 1KBGL 5E8OB 2QLVB 1HEZA 2B4CC 4YDJA 3NOIA 4JLRA 5C09A 3UYRL 4I13B 2AV7B 3BRFA 2EH7L 3U48A 4KY1L 2IADB 1BF2A 3OGOE 2VL5B 5DJXB 3O4OC 2R29L 3QJFB 3ZYJA 2VXVL 4P9HC 4PV9A 4FFWC 4WHTA 4AEHL 5JMOC 3X12A 1JYXA 3TEUA 4PTTB 1H5BC 2CIKB 4U1NA 1MF2H 4DN4H 1CFQB 2R2BA 2J8UF 3P4LA 1DFBL 3C09C 1OWRM 3WLBA 1NCDL 3W81A 1NBZB 3HI5H 4LLWB 5DJDA 4ZUVA 1F11A 1PVHA 4G6AD 2EEAA 4Q0XH 4P4KD 2F19H 3HFML 4KXZI 1T04A 5CIPB 4KHXL 4QHUA 1A6WH 3IDMA 4M7LL 4YX2H 2QQNL 3GMNA 1M7IB 4K23L 4N0FA 5EWIL 3BQUA 5FV1L 5C0ND 4APQD 2X6MA 1U3HA 3EO1B 1FG2A 4G6FD 1J0YA 3OV6A 1EERB 5BRZB 1OLLA 4KRPB 2AJSH 3WFBL 1AIFA 3G6DH 4EQ3A 1ZLSH 3ZKXC 1AC0A 3QFDB 5DEGB 1E6OH 5CSGA 4RFNB 1JHTA 5EU7E 3UTPE 1CK0H 1MREH 3PDOA 5JHDA 4HJGB 5E8DL 4JQXC 1VPOH 4D0CA 4ZNCD 3MNWA 5FHAH 3FJTA 3QO0B 4J3OC 4XBEL 2WQRA 2H41A 4BQBA 1J1OL 3ULVC 5BV7B 4LBEB 4Y4FB 3RDTC 1OOAA 3VWJA 3MJ9A 5E6IC 5DLML 1ORSB 1N64H 1V3KA 3D2UB 4NCC2 2Y06H 5IVXA 1KC5L 2UVEA 4I2XB 4NKDB 5CZKA 2YUWA 2Q76A 3QI9C 3SE9H 1XF2A 1MCWM 1SEBA 4U0RB 1UXWB 3FT2B 3UYPA 4IS6B 4NUGH 4K94H 1ED3B 5DJ8B 2HH0H 5BXFB 1J18A 4BKLA 1MFBL 2IJ0C 3UTPD 5KVEL 4FQHB 1ZE3C 5K9OB 3VXRA 2ZSWB 4XVUC 1KENH 3GI9L 4X8JA 2NXZD 1IGML 1EVUA 3ULSB 1G84A 5IBLC 8FABB 4HBQA 4I3SH 5EOQH 1BM3L 1TCRB 3V6BR 3UJIH 3GBNH 1CD1B 2PXYB 2BRRH 3KPNB 1DQQB 3DUSB 4JM2D 4M6NH 2I9LB 4OV5B 1TJHH 4MQXD 3HPLB 1PGRB 5E2UL 1T83C 2FJHB 4FABH 3C60A 3ZL4H 4PJGE 4QRRA 4BSWA 5HHQB 1KJ3H 1UWXK 2WIIB 1BFVL 5K9JH 3RWHA 1JRHH 4ZODA 1OPGL 2NY7L 3OBAA 3SO3B 4RBPK 4LRIA 5GS3A 4YHOL 3B2UD 4C57C 4MB4A 1LO4L 3EOBA 1VFBA 1WWCA 4OZHE 1GYAA 4UBDC 5E9DA 3UYRH 3IAGC 5HHNB 5LCVL 4NBXB 4P2OD 3GJFK 2ADIB 2EH7H 5IT2L 3FTGA 2Y23A 5J1AB 4KY1H 4Z18A 4L8CB 5ENWA 2ZOLB 5GZND 2R29H 4GRLD 4AEHH 2VXVH 4F3FA 4YR6A 1H9VA 3TBVA 1WC7A 3SKMB 3DLQR 2H26B 4UT6L 1I3VA 1UM6L 2GSIA 5DDHA 2WUCL 2DIJA 3NIGF 1SQ2N 3NTCL 1IM9A 1ZKAA 1T1XB 2GITB 4NNYA 1NCDH 1AQKL 3O3BB 1K5NB 3QEHA 5IEKB 4YDLB 5DRZB 1HCFX 4J1UA 4OZGB 3HFMH 3BH8A 3QUYD 4DK6A 5DFVC 4C59B 4M7LH 2QQNH 3L7FB 3VE0B 4K23H 1AQDB 1YEEL 5EU4A 3CVIL 4JE4B 1H0DA 5EWIH 1CTNA 1EEYB 4R7DA 4O2CB 3E6HA 3KDMA 4RAVB 2NX5A 4AEIL 1DN0A 2W0LA 3ROOA 3EGSA 3O4LE 2CRYA 3DUHA 1UJ3A 2FX7L 1EO8L 1JF5A 1QRNB 3MCG1 1AXSA 4FXKA 5EO9A 3TIDA 2FX8H 2C3WA 4LHJB 5C6WH 3IDXL 3CVHL 1J1XL 1KIQB 3C6SA 3X11A 4JRXE 3B3IB 3GSUA 4M7JL 5D96C 3QIWD 4CU8A 5IR1A 1U8JB 3FOLB 1MI5E 1PEZA 4NFBA 5DZOA 5C6TL 4XBEH 1GAFL 4TSBL 5C0EA 1T66D 3O8XD 1J1OH 3QQ9C 5C9JB 3I6GB 1KPVB 1RAMA 1YNKH 4P2RE 2GCYB 2QR0B 3M07A 1KC5H 1E4XI 1DVFC 3OAZK 4ZFZA 4J4PC 4NPYB 1A4KB 2AEWA 1NUFA 4MJ5B 4MD0A 1MVUA 2QQKL 3O4LD 1FO0A 4LPYA 2YN3A 4RQQB 1V8HA 1TTUA 1MFBH 1ZVHA 5KVEH 3GI9H 4JRXD 1A0QL 2F8OA 4P4KA 2L7UA 1IGJA 1MI5D 5LAXB 4O51B 1KULA 3DX8A 1QBLL 1BM3H 1AGEA 3EO0A 3IT8D 2IF7A 3O3EA 3FO0L 5DO2C 4NSKA 4XZUA 2BSED 4OD2B 3NCYS 1XCTA 4P2RD 3V5DB 5E2UH 1A7OH 3INUH 1Q0YL 2B20A 3U4BL 2L4OA 1ZLWH 1HHJA 3KPRB 3OKMA 5AWNL 5IVNA 1S7SA 3GMQB 3LRSA 2C7UB 3LV3A 4QOKB 1OPGH 2NY7H 1KJ2L 3IVKB 4UUJA 2F74B 4YHOH 4JQIL 4UTBL 1LO4H 2FHCA 5BVJB 4YAQB 4H20L 4KK8D 1ZA3B 1IAOA 3SDDC 1OGTA 4D0DB 1UXSA 2KUTA 3QXDB 5B4MD 1GSMA 5LCVH 3HMXL 1ZS8A 3G9VA 4HK3J 5IT2H 1MAJA 4RGMB 1OGAA 4R97C 4HULB 2IPTL 2OR7A 3U6RA 1XGUA 2IBBA 3O45B 1CI5A 4CNIB 3MACL 3W39A 3Q0HA 1JL8A 4KHTL 2WUCH 4MB5A 4C56E 3LDBB 4NQUA 4U05A 2GTZA 3NTCH 3AROA 1SY6L 2XICA 1Y0LA 4UDTB 1FPTH 1AQKH 4PJIB 1I7ZA 5D7KD 5TE4L 2RB8A 3PXHA 5JOFB 1OCWL 1NPUA 4NIKB 2K7PA 1FVDA 5FA4B 1ERNA 2FLRT 1CFNB 4R3SB 2R2HA 3OKLB 1U92B 2WV3A 5GGRB 5KVDL 3VFVA 4H1LH 4HUWA 2E7MA 1YEEH 4URTB 3CVIH 2IALA 2DKUA 1D6EB 4JM2A 4NKIH 4AEIH 4DGIL 3GMOB 3FT3B 4OFPA 2EC9T 1JPFB 3O9WC 1CFVL 2X1OA 3KPPA 3Q5YA 1JV5A 2GI7A 1X5YA 5DJYA 1RY7B 2FX7H 1EO8H 2Y36L 4LLDA 1J10A 4UOW1 2J2ZA 4K3JH 4C56D 3CVHH 1J1XH 2BVYA 3LVEA 2PO6D 4IRJB 4HV8A 4O9HL 4BFIB 4M7JH 5AAMA 1JGEA 4XNQA 4QY8A 3IFNL 1WZMA 2APWA 3OJMB 5C6TH 5BW7C 2NZ9D 4TSAL 4XPGL 2A6DA 1GAFH 4WW2C 4TSBH 4HIJB 5H94B 3CSGA 3DVGB 3HB3C 1OP5H 4YBQC 2NNAA 1UB5A 4KV5E 1KIRB 2VUYA 1CTOA 1EIBA 4GRLA 1OP9A 3L3HA 1E4KC 1U6AL 1UVQA 3PP3H 3I50L 3BZEB 1VESA 2R39A 3VFOB 1D5MA 4YHPB 1MCBA 3NZ8A 1SMOA 5HI5C 2FJGB 2R1WA 1MLBB 5L0QB 5ACZA 1PG7L 5HJ3B 4CADB 4KDVA 5IMMA 2QQKH 2V5TA 4PJGA 1DEEA 3OKOA 3V4UL 5JOEA 2M26A 2C3VB 3WIHL 2GSGA 4ORGB 1X5ZA 4HUMB 3SBWC 2Z31D 4QXUH 5H8DA 1A0QH 2ATKA 1GGTA 3OL2A 1ZGLP 2K7QA 3QUYA 3SDXE 4OI9A 3UTTA 4DZBB 1QBLH 4K71C 4OZHA 3GMLA 1I1FA 2D7OA 4F9LC 4QRPA 1DL7L 5AYUL 3FO0H 4HH9A 4NYLA 3X13B 1WZLA 5B38A 5LVEA 3CU7A 3D3VB 1GZPB 1W8OA 4R4BA 3PDGA 4V2CB 2VYRE 1Q0YH 3U4BH 2APVA 3G6JF 5AWNH 2D31B 5T5NF 3U30C 4NQXB 3QDGB 3G5YB 1KJ2H 3WS6A 3WNLA 5C08B 3GDBA 3QIWA 4WEBL 7FABH 3S5LA 4JQIH 2EH8H 2J8UE 3VGHA 5JXED 1KF9B 1HYSC 1IC1A 3TBSA 1U3YA 1RURL 2DICA 3MROA 3HMXH 1UT9A 1EDQA 1Q9KA 1W72L 2IPTH 2DWEA 4UQ2A 1A6VL 3K81A 3DI3B 2BMKA 4JHBA 2YEZB 3V6FA 1TJIL 3LN9A 2R0ZL 1J8HE 2AXHA 5DD5L 1OHQA 3B9KB 4KHTH 1KV3A 2E7BA 5DTFB 1PYWA 3O4LA 5CEXA 4JO4L 1SY6H 3PG2A 1D9KA 1IGIH 1KJMB 4YBHA 1QSFB 1QA9B 2ITCB 1UKTA 4WTZA 5TE4H 2H8PB 3TN0D 3DXAA 3EDEA 5GHWL 3O3DA 2EDQA 2W9EL 2VSCA 4XB8A 3OJ2C 4PGDB 5KVDH 4WUUB 2BNRD 3ULVF 1RHFA 1EZVY 4X80L 3TO4C 1UEMA 1XR9B 2KPNA 1FFOB 4Q9QH 4DGIH 3HC4L 4P2RA 5C07B 1CFVH 1KFAL 3NFSL 4EVNA 3FN0L 4LVEA 1JPGB 1J8HD 2Y36H 4Y5XB 3UTOA 1KYOK 1FNAA 1HN1A 1QLRA 3HAEB 4O9HH 4ZAKA 15C8L 1GZQB 1MUJB 5EU3A 3D5OF 3IFNH 4ZUTA 2XWBB 2YS4A 3AMKA 5DMJB 4TSAH 4XPGH 4XWOC 4KJWC 5FDYA 2BERA 1IM3A 1YMMB 3SKNB 1JRHI 2PR4L 3B6SB 5CGTA 1ZT7A 5FUCC 3UPRB 5IROC 1N7ML 4ELMA 4FG6C 5DEFB 3MV11 1FL3B 2AS5M 5DJ0A 3I50H 5DRXB 1T80A 2NXYC 4I0PD 1PG7H 4K7PX 3I6LE 4BH7A 4GT7A 3ZYZA 3V4UH 3WIHH 2HTKC 3QWRA 1HCVA 4Y4HC 4X4MA 4GLRH 3SN6N 1X5KA 1NJ9B 4HKBA 3U7YH 3MLTB 1T89C 4PJ5A 2VLJA 3L7EB 2HVKA 2CLZB 3NFNB 4R2GD 5IESL 2MKWA 1DL7H 4NWTL 5AYUH 1P4IL 3CFJB 2R1YA 3TBYA 4PGEA 2AGJL 5DYOB 4OLZH 1UACL 2A74B 2UWEA 1QVOA 1HDMB 3TIEB 2R56L 1ZHKB 5HY9B 5A16B 4OGAC 5AZEL 3T08A 1H3TA 4N1HB 4F9PA 1IC7L 5IGXL 5F44A 4Z7UA 1VEOA 2FJFB 3I6LD 4KI1A 2PO6A 1X4ZA 4Y5VA 3VRIA 4LNRA 1D5IH 2APBA 4QRQB 4WEBH 1I7RA 2G60L 1A8JH 3BDBA 2ATPA 4M62L 2R69L 4JY4B 3C08L 5TGBA 1GGBL 2YD6A 5D8JL 5EZIH 1RURH 2VB5A 3NIGE 3QNXA 1D5XA 4O2FA 5EZOH 4PJCA 1W72H 1YJDL 4YXHL 4PLKD 4FZEL 1T0MB 1FORH 4BJLA 2P5WB 3NBNA 4WCYL 2YBRB 5IV2B 1CLYL 2DM2A 1TJIH 4P2YA 2R0ZH 5CSZA 3WNPA 5DD5H 2X4SB 5JNYB 1HHGB 2A9MH 2WBJC 4K94C 4HH8A 4JO4H 1F6FB 1NMCC 3SDAB 1S7UA 2HT2D 4M00A 5C7XL 3VFMA 4X6FB 3N1GC 1NGWA 2Z31A 1G0YR 4E41E 3NCMA 4HS6B 5EB9A 3ILPA 3IF1B 5C0BE 5GHWH 4LCYA 5EFIA 1MLCB 2W9EH 4OB5L 3FZUC 3F7PC 4WUKL 4XPFL 5EBMB 3D39A 1QP1A 3CDCA 1KCRH 1FJ1B 5KTEH 4X80H 1JUFA 5F1NA 3FB6A 4N0CC 1FHGA 1QO3A 4X6EB 1P1ZA 2ZCKH 3NCYP 2BSTB 2FH6A 4NQEB 1A02N 2EDYA 5F1SA 5DVOA 2OL3A 2XXMB 3RIAF 4OGXL 1CXLA 3HCVB 1KFAH 1AKJD 4NQCE 3NFSH 3FN0H 5KSUB 4RA3A 5IKCA 2COQA 2E6JA 3DMMA 2P7TA 1A4JA 1AP2B 2P48B 1DDHB 1X9QA 4L8SA 3CCHB 3DYPA 4HDIB 4PGZA 1JIBA 5EZJB 3RIAK 4IM8A 4JEGB 4OBRA 4LGPB 2RFXA 5GS1C 15C8H 1F4WL 3MXWL 1MIEH 1VENA 5GZOD 4XPAH 1HWGB 4JDZA 4E41D 2P44B 4OUUA 4L4TE 3SDXA 3QDJE 4HC1H 3P3YA 3K46A 2PR4H 1U41A 1AFVL 1VFAA 3SQBA 4V1DA 2O93L 3VFTA 3MODL 1FZKB 2ICWJ 3DETC 4NZJA 1KJVA 4NZRH 3VG9B 2BZDA 5JZ7C 2G9HB 3L3KB 1C08B 1XIWC 5D5MA 1MJUL 1N5AA 2EIEA 2QSTA 4LCIL 2NCMA 4NQCD 2AABL 2OP4L 3LOWA 4HJJL 5ERWA 4ZOBA 4TTDD 3GUTB 4HUUB 2HJLA 1UKQA 4ODTL 1YA5A 4X4ZA 5L6YL 2WINB 4WNQB 1RUKL 3FO2A 4LPXA 2ZPKH 3EFDL 2VAJA 5M7QA 5IOPA 4H5SA 3ZDZF 3DVNB 4NQDA 3VXQB 3V5HB 2Z9TA 2BNRA 1MRFL 2X4RB 4NWTH 1P4IH 4OLEA 4PJFF 4L4TD 4XCCL 3T77A 3QDJD 4F2MB 1DJSA 2AGJH 5L2KD 5KANG 1UACH 3UJJL 3OXSB 3HPJB 1LP9F 2I60L 4PJDB 3MGAA 2DMCA 4OZIB 2VDPL 1GHFL 4PY8J 2IANB 2R56H 5FGCE 1FCGA 1J8HA 3HC0A 5AZEH 3RX8A 1N59A 3PWPA 4JAMA 1IC7H 5IGXH 1RQ5A 4GRMB 1A7QH 4X7SL 4MNQB 4PRHB 5KSVA 4TVPE 1R3LA 3NPZB 1KIPA 4U6YB 2EO9A 3BESR 5CP3A 2A6IA 3W0WE 4MAYA 3CPLA 3FONA 4M62H 2R69H 2NY6B 3C08H 4EDXB 4BQ6A 5CBEA 1XF5A 2R2EA 4PTUA 3MV7B 4WI7A 1YJDH 1DQJB 1N8ZA 4MNGA 4Z5RA 4FZEH 2Z92A 2ERJC 1LD9B 2XFXB 3BKYH 3CZFA 1CDYA 4WCYH 5HPMA 4ERSL 4WENB 4YPJA 3VXUE 3RAJL 4MNHB 1TLKA 5CWSB 3RJQB 4D9QE 1INQB 3CFDB 4WV1C 5EC2B 3CNKA 2FZ3B 5F8RC 1T1WA 2W0FA 5C7XH 3DRQA 4PLOB 2VL4A 5D1ZD 5ETUA 4TVPD 2A83A 4JREC 3W0WD 4NJ9L 4RIRA 3V95A 1UQSA 1OAZL 1EFXB 4XPFH 1ZGLA 4WUKH 1T6VN 1AGBB 3KYOA 3H7BA 4JZJC 4WW2F 4GXUM 3OHXA 1CGYA 3JV5A 2NY3C 4KU1A 4KMTL 2XWTA 4N9GB 3WIFA 1IKFL 3MLSL 4LEOB 1F3DJ 1MNUL 3S5LG 1CS6A 4PBVC 2ZNWA 4WO4B 3VXSA 5ITFB 3B8YA 1I4FB 2VE6B 1YYLL 5IMOA 2DRUA 4P5TD 2DDQH 3DO7B 3EFFA 4WDIB 3I9GH 3VXUD 5ESQB 4OLUL 2PCPB 1NDMB 3EDFA 5F6IB 4XCEB 1Z3GL 5FYKU 1CICC 4D9QD 3SE4C 4XC3L 1I3UA 2Q8BH 4PP2A 3BD5A 3V52L 1F4WH 3MXWH 5IQ9A 5HGAB 1OB1A 2Q20A 4ACPA 5KS9B 1J88A 4U6XB 1UG9A 4LHUA 4Z7WA 3IDNA 1MJ7L 3MLWH 1SYVA 4OLVL 3UTQB 1VEMA 4UT7L 4HK3N 4YFLI 1AFVH 4ODUA 3FRPA 3MODH 3T0WA 1Q9WA 3GJFA 4QRTB 2B1HL 2AV1A 3NCEB 1MJUH 3QEUA 3QIBC 3H9YA 4HX1A 1AO7A 3W2DL 4EN3A 4NQSA 4LFHD 1F6AB 4LCIH 2AABH 2OP4H 5E8NB 4HJJH 2CRIA 3NCJL 4ODTH 3IJHA 5C0FA 1RZ8B 3GSRB 5D93C 1N2RA 3QH3B 5L6YH 1RUKH 4XXDB 5FGBC 2EYTB 3EFDH 2HT3C 3B9DA 3WFEL 2RJMA 1S7WB 1A2YB 3G6JE 4TUJB 3BIAX 4Q6YA 3HE6B 4NM8L 5F7EL 3BPLC 3BUYA 3STZB 1MRFH 1QFWI 4XCCH 4A6YL 3MUZ1 4XCNA 1DBJL 2Y1VA 4NDMB 2JJSA 3UC0L 1G0DA 3UJJH 3KLAA 2V2XA 5ELIA 1A3QA 3L5WA 1GHFH 2GJZA 3DHJA 4OSUL 4PRIE 4M61A 5ISZB 2KH2B 3GSOA 4JRYE 2EEDA 4L3CB 2PXYD 4LKXA 4DFIA 4KUZH 4X7SH 1I1YB 3BP4B 2AXGA 2MWCA 3RGVB 2C1OA 4YJZL 4PJ9B 5DRWB 1VEPA 3MUHL 4LCWE 4RMVA 4OZFH 1B4JL 5JIKA 3V79C 3MJ9L 2G5RA 4D2NA 1QHOA 5J6GB 4QF1A 2D2OA 4K3EL 4MAUL 5DHVB 4N8VA 5EU6B 1XGYL 2ZUVA 3U79A 3S98A 2WP3O 3OQ3B 5GGTH 4ERSH 4X4YA 4KDTA 4KTEL 4X0KA 1S5HB 3MNVA 4POUB 3RAJH 5IW6A 4LARL 4DCQA 1T7ZA 3T2NL 3ULVE 1I7UB 1YEDA 4PRID 5MI0B 1FIEA 1MJJA 4JRYD 2ADGA 4GFTB 5CKGA 1MSPA 2NY2C 4Z78A 1D5BA 4NJ9H 4MJIA 2X7LB 3SPVA 4L1DA 2QKIB 1P53A 4M4RA 4LCWD 1FE8L 5IM7A 4EUPA 5EIIA 1IKFH 1I1AC 1MNUH 1O5DT 3MBEB 2NW3B 5ESAB 5L2KA 5ACLA 3IS0X 2M8XA 4PJBF 2X5PA 1XR8A 4I3GA 1S7VA 2XT1B 1YNTB 4L9LB 4OLUH 4RRPA 3A6BL 3F12B 4P9ML 1Z3GH 2QQLH 3ULVD 4I0KA 3RDTD 2L7JA 3SKOB 3V52H 3PGDB 5E6ID 4FXGA 3MFFA 4TULL 3LKNB 4FFVD 4NO0A 3QI9D 4UNTA 1IZJA 3AB0B 1QRND 5MP6L 4UT7H 2RGSA 1VACA 4ODWA 3GIVB 4IIQC 1QNZL 2HFFA 3SGKC 3LKOA 2DMKA 4P48A 2FATH 2B1HH 3QUXC 1MVFA 4U2ZA 4XVUD 5E8OA 3W2DH 5FUOL 2OBGA 1ACYH 3PJSB 2E7LA 5IBLD 4F7PB 3NCJH 5DQDH 1QSEB 4HK0B 4LLYB 3S34L 4XMLL 2VL5A 1D3CA 4YDKL 5DJXA 2PW2B 2DQJL 3QJFA 1FZMB 5F1IB 3LKPB 5EPMA 2CIKA 4GJTB 2GK0B 1CFQA 4NM8H 5F7EH 2UVFA 4M02A 1X5FA 5E2JA 1MCDA 4YXLL 1NBZA 4GKZB 2BSRB 3UC0H 4LVHB 5JIIA 2EIBA 1T5XB 2OTUB 1G7LA 3MRNB 1RZ7L 4N8PA 5F6HJ 4BFGA 3HE7C 1M7IA 1TDQA 1ZHLB 4UBDD 4CN6A 3KWWB 1A6ZB 5HHXL 2VR4A 3MRFB 4Y4KC 3EO1A 1N3NB 5DJAB 5BRZA 4XMPL 1JZ7A 1B4JH 3HRZA 4JFOB 3HLAA 3MJ9H 2VMFA 3F6IA 1QZ1A 4KK5C 3QFDA 5DEGA 3QPQC 3O2VL 4QOKD 1MCFA 1T22B 1QPPA 4MAUH 4HJGA 1X7QB 1XGYH 1IVLA 5FYKD 3KYAA 3QHFL 5B39G 2DKSA 4LAQL 3CXHJ 4LARH 1FO0L 1IGFL 4PV8B 1MCSA 5JORB 3NPSC 2H32B 4FQXC 3T2NH 3PUCA 4PY8I 3SCMC 4F8TA 4W4NA 3K8LA 1H3GA 1ORSA 1L0YA 3VXME 3FB5A 4NZTL 1PG7W 2OI9B 4FOMA 4LP5A 5C0DA 4NKDA 1Z9OA 2EECA 1S7TB 5KOMC 1SVZA 5H35A 4LIQL 4RMRA 1Y6KR 1UXWA 4QWWD 1FE8H 4IS6A 1ED3A 5DJ8A 1F4XL 5BXFA 5ID0B 2JE8A 1EJOL 4ZNEE 5IW1B 4FQHA 3GRWA 2ZSWA 1RHHA 5ICXB 2YWZA 2AXFB 3TF7C 3ULSA 5I1CL 4LGSB 4ZXBB 4AIXA 4FQCL 4CL7A 2NY0B 8FABA 5KJRL 4ZO8A 3RPKA 3BW9B 4RGOH 3A6BH 1CD1A 1IJ9A 4P9MH 4KKCC 2PXYA 3QQ9D 2DM3A 3KPNA 4NN6C 1BD2B 1A1OA 1OARL 1DQQA 5C0CE 2I9LA 2UZIL 1RVFL 4OV5A 1CXEA 3VXMD 3OB0K 1DVFD 5D2LB 3CDYA 2XA8L 1JWMB 2A77L 4OT1L 4YH6A 3LH2L 4OLYL 5HHQA 5MP6H 2WIIA 4ZS7L 4MMZC 3HHRB 4NC2B 1QNZH 4M3JA 2HT4C 4IRJD 4IMKA 5F21B 4EEEA 3IXTB 3PWNB 1NCTA 5HI3D 2EZ0D 2ZJSL 3ZDZE 2VN7A 4PJFE 5HHNA 5BZWB 4YZFF 3P0VL 4QXGL 5HHPB 5J1AA 4L8CA 2C3HA 3FO9B 3S34H 4HIIA 4XMLH 3TESA 4YDKH 5ABDE 4AQOA 4HAFA 1LP9E 2DQJH 4M9OA 5DO2D 2HJKB 1FVEB 1NGZA 5SWZB 4AT6B 1N0LA 3BPOC 1KEML 2H26A 3SKMA 5C0CD 3BEWA 4JVUA 1BLNB 1FC1A 1IKNA 2YD2A 5M95B 3ZE0F 4G8GB 1EUTA 1OAKL 5ITBH 1PD6A 2DS4A 1T1XA 5GGUB 4YXLH 4KVNL 3DYMA 3O3BA 5E56A 1K5NA 4P46B 3VGAC 5IEKA 5DRZA 3JVGC 1PZ5B 1FFNB 1RZ7H 1HZHH 2JK5B 3ARVA 4M93B 4GKSA 3SDDD 1M1SA 3VE0A 3WSQL 5IJKA 1AQDA 1G7IB 5HHXH 3RDTA 1EEYA 4O2CA 4RAVA 1F3RB 1E4WL 1TZGL 2VZTA 4DN3L 4YDIL 1UADC 4XMPH 2XOTA 2DYPD 5TF0A 1T6WA 1QRNA 5GSRB 3O2VH 1CXHA 3MV9E 2N4IA 4HXAL 3AREB 1NAMB 3B3IA 4N0UE 5DMGC 4YBLC 1M05B 1R3KB 4G8FB 1P4LA 1RZFL 1U8JA 3QHFH 4EQ2A 3CLEH 4M7LT 3RZCC 3O2WL 4P0DA 1FO0H 1IGFH 3RJDA 3TBWB 1WAAE 3IXAB 1WV7T 3I6GA 4FQJL 1LK3L