3TJEL

Crystal structure of fas receptor extracellular domain in complex with fab e09
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSFNIGRYPVNWYQQLPGKAPKLLIYYNNLRFSGVSDRFSGSKSGTSASLAIRDLLSEDEADYYCSTWDDTLKGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab E09, light chain
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL01
5HD8D 4ETYA 2E7MA 1YEDA 3EFFB 3G08B 4KGLA 4K71B 4L3CB 5EOTA 3H3PL 4JREC 3SDCA 3OKYA 2X9WA 4X6FA 5GRUH 5E5RB 5K33A 4NQUA 4D9RE 1A4JB 2YD6A 2NY1B 3VRIB 4YDVA 1NCAL 4OCWH 1EA9C 2BY3A 2QKIA 3D3VA 1VADB 4LPVA 5DD5L 3G5XA 3PE9A 4XP1H 3FO2A 5ECJE 1CD9B 4U1JB 3ZTNH 2YPVL 4JFZH 3RNQB 5HHOB 1QYGH 3S34H 5D7LD 4YX2L 1S7WA 3LPWA 3GSUA 1V3LA 4GW5A 4NKOB 5C0AE 5IG7B 1T1XB 2ADFL 3P0VL 2V9RA 4NQSA 4BM7A 2NTFB 1NGZB 4KKBC 4WEMB 2GY7B 3U4EB 1OT2A 4M7ZC 3HUJB 2AABL 4ERSH 3BP7A 4U1IB 5BZDB 2X40A 1T5WB 3WFDH 1OT1A 1HWHB 2R0ZH 1H3PH 3PDGA 5FKAB 5C7XL 1OGTB 1DQDL 1M7IB 1MCHA 4N90D 3KYOA 4H5SB 4TTGA 2VLLA 1DDHB 1UZ6F 1I9IH 3NCFB 3T0AA 4PYGA 1IGJA 4WFHD 2IPTH 2OJZH 3RU8H 3MRCB 4BFBD 5L88L 4OZIB 3GSWA 4H25B 5DMIL 3BGAA 1OAYH 2HKHL 3NIFE 4HV8B 4OGAC 4FZ8H 4P57B 1NL0L 4FQ1H 2VZSA 2RB8A 4CADA 4FXKB 5GGTA 4X99A 5EU6A 4YIQA 5L2KE 1VACA 4UQ2B 1AGBA 4DGVL 5FF6B 1BQHB 4LHUD 2A9MH 4LLMB 4KI5F 4OAWB 3LEVH 1RUAL 3VCLB 3MRHA 1PYWB 1FGNL 4PJ8D 3U0TA 5D6DA 1CDUA 4FMKA 1KCSH 2WM0A 4A6YB 3MX0A 1QD0A 3P77B 3MUGB 4BFIA 3QZWG 4FABL 1IT9L 3HE6B 3QCTH 5IW1A 5B21A 1YQVH 1A1MA 4JZNB 1RZJH 2QHRL 3MRJA 4OQTL 1GC1L 2HJKA 1ZT4A 3WFCH 4N9GA 4OCXL 4U6HB 4OLYH 2XQYG 1I8KA 4HIJA 2VXQL 5TH2B 4KPHL 4F9LC 1U93B 4R4FH 3UC0H 3NZHH 1I3GH 1RIUH 3HR5B 4UQ3B 5EDXA 3MA7A 3ZO0A 1QA9B 1MAJA 3SQBA 1JPGA 1NUGA 2D7TL 3BIKB 3OJDA 5IB4A 3V6FA 2Y06H 4EI6B 3RGHA 4G6KH 1CFTB 1A9EB 3V6ZA 5DI8A 3L9RA 3MJ7A 4DZ8B 2WQ8A 5C08A 4F7MA 1AQDA 1WUNT 3WIIL 3JZ7A 5EA0L 2XZAL 1QO3A 4MYWB 4XMPL 1GYAA 4AH2A 1XGYH 4E0RA 3OZ9L 5D7IF 2VQUA 2D0FA 2HG5A 4GAYB 5CJXC 2ZOKB 3SKOA 3QULA 2XKNB 5ENWB 4L4TA 4WFGE 1L6XA 2VDNL 3IFLL 3MLUL 1CXHA 4LPXA 2WUCH 2YPLB 3RWHA 4LRIC 2UZXB 3U4BL 3CFEB 1VGEH 2H9GB 2GJZB 1RZGA 4ZNEE 3BVNA 1I9IL 5C71A 4MD4B 1I1FB 2ORBH 4BH8A 5IROA 5DQ9B 2QR0B 3N1GC 1QLRA 1FFNA 3OTTA 1IAII 3DXAB 1FBIL 4QF1B 2AJZA 3MV9E 4QHUB 2JB5L 4FP8L 4QXUL 3CNKA 1E6OH 3PGFL 1OAYL 2B4CL 3DUHA 3IAPA 3CFCH 2Q7YB 3GSOB 1IEAA 4DCQA 5BJTA 1NAMA 3T4AA 3PIQB 2AGJL 2VQ1A 3T1WA 1YEKL 2EDFA 3L3JA 4JZJC 1OLZA 1KEGH 1ZHLA 4R7DB 5ENWA 1QFWL 3VG0L 1XGRB 2DLIA 2EDHA 5AD0A 2N1KA 3H9HA 3BWUC 4TUKH 1IC5H 1RUKL 3OJMB 3WO4C 5JXEC 5HHXH 3SDXA 3WXWH 1RJLA 3B9KD 3MTRA 3T0DA 4HGWB 5CINL 4XMKH 3F7VB 3QIWA 4GXVL 5MEOB 1U92B 5TDNB 3MJ6A 3CDYA 2NW3B 1D5MB 1X6LA 2PN5A 1QFUH 1ZHKB 4PRNA 3D39B 5F9JB 4LIQE 3THMH 2B2XH 3KYMB 4YWGH 3KPQA 4HJJH 1T0NB 3MV8D 4QHKI 4UB0H 3GEWB 2KDGA 2OTWB 4HKXA 1QA9A 4XP5H 1A3QA 3RWEA 4HFWB 1JBJA 3GIVA 4ZTPL 1I1AC 4P2RD 1DE4A 1MAML 1F4HA 2CKBH 1ACYL 2WLYA 4QHNB 4DN3L 5B4MD 2X4UB 4P46A 3AUVA 4XCEB 3B5HA 2KZWA 2X1WL 2O5ZL 5JW3L 4R0LC 1ND0A 4F2MA 1T0PB 3QEQA 5CMAA 4J12A 2X1OA 1A14H 1YPZE 4XI5C 3CSGA 2ZZUT 1S7XB 1X5ZA 1JWUA 3C6LA 1CXIA 3LEYH 3GJEB 5F8RC 2ZUUA 1I1AA 1XZ0B 1JNHB 2BVOA 1VFMA 3QEGH 3QG7L 1LK3H 3GSQB 2ZUQB 1B88A 4FS0A 1RUQH 5TE7H 5F9WB 1OSPH 2JCCE 1IGYA 2H26B 2VDPH 2IJ0C 1AHWC 5IVXE 1CU4H 1OD9A 3HZVA 4OLWH 5IHUL 1MFNA 3WN5A 3SE8L 5GJSL 3SGDI 4LSUH 4MZ2A 1A3LH 1FNHA 1IM9A 4XXDB 5F1IA 4NPYB 5T3XD 1JTTA 4LLDA 4RAVA 5E70A 4PP1C 5CJQL 1CFVL 1SYVB 1WCBA 3BDYH 2XG4A 4MNHB 5GS2H 3T09A 4YUEL 1ZSDB 1LQSR 5E9DA 1BD2E 2A6IB 2A9ML 2AXJA 2V17H 4KV5E 4UDUA 4IMLB 1ZLWH 5F6IB 4HKBA 4DUVA 3CJJA 3UZEA 4RRPA 3L3IB 5AYUL 5FCUL 3O45A 5A2LH 4ODVH 1K5NA 4ZUUB 3I6LE 4NOBA 2NX5E 5DFWH 1ZE3C 4M7ZB 1G9NC 3OG4B 1HSAB 5FYJU 4M1CC 4OZ4B 3UZQA 5HYEA 1U8QB 4FNLH 3ZDYF 3FT2A 3UTSE 2GJ6A 4ELKA 1FE8H 3SO5A 3D2UA 2W0LA 1BIIB 5DEGA 4J3WA 5T33L 2I26N 4RGND 3WIFB 5E9DD 1KTDB 1CLYH 2IAMC 3O8XA 2HFTA 3BUTA 5ESAA 3V5DA 3S8WA 3CSBA 2VL5A 1I1AD 4MA3B 4AG4L 2EYTB 3NFNB 1KIRB 5EN2A 5KJRL 1IM3A 4R7NA 3NACH 3OAZK 2DLFH 3K1DA 4U1NA 1JZ7A 1AXSB 4M6NL 3C5SA 3NH7H 2NX5B 2AS5M 3H0TA 3UTOA 1P9MA 2W0FB 5DRXB 4GUPB 4U2ZA 1CE6A 4PJDE 5CGYD 1LNUB 3RUGA 4MXWH 1A6PA 3JV6B 1FO0A 5IBLD 3IU3B 3I02B 4MJ5B 1WIOA 3QG7H 4HT1H 3U36B 2HJLB 3ROOA 4POZD 4WO4A 1JWMA 3U48A 3BX7C 3QDJA 2LU4A 1E28B 3QIUD 4JFXB 3DRQB 4PTTB 4M1DL 2BSSA 2PW2B 3CLFH 4JKMA 4LQFH 2XN9A 2YPLE 4PLKD 1KTRL 4Z7NF 5HY9B 2I5YH 1FHGA 2X2YA 5DMKB 5I75C 5MEQB 1VGEL 1OD7A 2YA2A 3BGMB 4XVJH 1F90L 3L1OL 1A4KA 1JGLH 1AR2A 2BDNL 4M5YH 4YAQB 1Q0XL 4YDJA 2A6DA 4HUWA 2DTML 1QSFE 4AT6B 3WL9B 1F3JA 4GW1A 4RFEA 1QRNB 5D1ZD 1DBBL 4K8RD 5MENE 1G9NL 3WJJC 1AXSA 5K9JH 4GAFB 4YUEH 3KXFD 4NZJA 2D4DA 3WJLC 4N9OB 5I18H 4OBRA 2ATPB 1ZHNB 5FKPB 3STBA 2OZ4L 4MNQD 3MNVA 1IQWL 1FYTD 1NAKL 1D5IL 4I77H 1LO2L 3L3HB 1K8DB 5BOZG 1KB5L 3Q1SH 5GGQH 1OAUH 3AAZA 4E41A 3MRRB 3D9AH 1F4XL 1LP9B 5AUMA 4PJHA 3BYTA 3STZA 4OZIF 4Y8AA 4ELKB 1ED3A 5HGHB 2GJ6B 4J4PA 3QUXB 4OF6A 4RFEB 1HQRB 2UWEE 1GPOH 4JPVH 1N4XH 1I7UB 4KQ3H 1U2HA 3QUYD 3KHQA 1FL5A 2VXQH 1AP2B 2D31A 3GSVA 5IIEA 2XZQH 1MAKA 3ULSB 3UTPD 3TA3A 4RIRB 1U8MA 3RA7L 5F93C 4RMRA 5EWIH 5GRUL 3W0WD 3HN3A 3FT3B 2QQQA 3BPCB 5EO0A 1BZQK 1MQ8A 2GTWB 3F7YB 5HHVL 3HRPA 2B4CH 4OUUB 4GRLB 5C0CE 4NDMB 1U8IA 4WTZA 4HX1B 4WO4D 4L8BA 4L8SB 2FIRT 1CK0H 1Q9OA 2EIDA 4YHYC 3GHEH 1HDMA 3AREB 2NXZB 1PEZA 4HZLA 2Z8VC 3HC4H 3SO3B 3ZL4H 4OFYA 2H3NB 3AAZB 4L4VD 1IM9B 4EQ3A 2I60H 3QHTC 5F89B 2E7CA 2EYRA 5JDJA 3JVGA 3KPSE 1XCTA 4D9QE 3M17A 1PY4A 4RA0C 3VRLE 5J7CC 5F71A 3DWTA 3VRLF 2IPUG 2CDGB 4ZDHB 4OZHA 3PWNB 2VXTH 5FA3A 4ZOAA 4LLVA 3MLRH 3W2DL 5C86A 2W65A 5DJAB 3SE3C 2VXVL 4U6TA 5ALBL 3OR6A 2C3GA 3U0PA 5JPMB 3MREB 4G42B 1HHJB 3TBSA 4XZUA 5B3JF 5IEHB 4XC3H 1FBIH 3T0VA 2W38A 2QSTA 1VESA 1OQOA 1A4KB 1EXUB 1II4E 1J9CT 2ZCKH 4JQIL 3BEWA 5JDSB 4X9HA 4X4ZA 5C0GB 3QEQB 1IC4H 4RFNB 1PX3A 1SYSB 4HUUB 1I8MA 1YEKH 4GKNA 4MD0A 4CRPA 3T2NH 3WSQH 4EDXB 2AEPH 5F97E 4Q74A 5HI5D 2I9LB 4H8WC 4GBXB 4H20L 5IKCA 1VFAA 3IRZA 3C8HA 2CK0H 4NHUA 1MVUB 3S35H 3OXSB 4MVBD 4PJAE 4P49A 4XPFL 3P0YL 1KPUA 3NCCB 1ADQL 1U0QA 3PWJA 4OM1L 4PJFB 1RZGB 3WXVL 3BUYA 3C5SB 1LO0H 3FRPA 4V2CB 3G6AA 1IQDB 5CEZL 5J6GA 4KTEL 3EYFB 5C09D 1I7TA 1RHFA 4C56B 2V2TB 5EBGA 5D7IB 5CJXA 1MHPH 4CNIA 2EIZA 4OI8A 3PQYB 3O0RH 4K2UH 4FA8A 4P5KB 2ZCHH 5FGRA 2HN7A 3X12B 3QO1A 4WU7B 1K2DA 3WS3B 2DYPA 3QHFL 1CQKA 2CH8A 4YK4B 3UBXB 2QHLA 4X6DF 5CBEB 4JLRB 1NBYB 2IAMB 5H35B 2XXCB 3MNWA 3R1GH 4HULB 5BJTB 4WW2C 2DJUA 1A22B 2CO7B 3CK0H 5DMGC 1TZGL 5F70A 2R4RL 3TPKA 1A6VL 2IFGA 3C08L 4JY4B 3PHQA 1BLNA 1FNEB 1T22B 2G2RA 1T7ZA 2NLJB 4X6CB 2P46B 4HT1L 3P4OA 3B3IB 4X9GA 4QTIH 4ELMB 2EDTA 4HIXL 5ACMA 1EEZA 3QUZC 4NBZB 4NO5B 4YGVA 1QFPA 3W39A 3SBWA 1RJZB 4XBPB 3DARA 2DYPB 2VUYA 1AGEA 4M1GL 1R5WA 3LZFH 5EFIB 4F58H 4PY8J 5C8JB 1IGCH 1FVDA 2R2BA 2DQGH 3E8UH 1KXQE 1C5CH 4ZO6A 4LSRL 3HMXL 3NPSC 3P77A 3CX2A 3PWPA 1NCAH 5JO5B 2YUWA 5FM8A 3WV0A 3NZ8A 5CEXB 3MRFB 1PLGH 5MP6L 1Q8MA 3VCLA 5DDHA 1A9BB 4YDLC 2WQRA 4JFDB 3VXOA 3PL6B 4R26H 3NBNA 3C6LD 1PZUB 1DBMH 1DFBL 3ZKQD 5F7MC 4YX2H 3TZVC 3KR3L 4QRTB 5I16B 1MVFA 4U0RC 4PTUA 4ISVA 2BSED 3KJ6H 5CMAB 4OZFG 3B9AA 1U8PB 3K80A 3OF6D 4OKDA 1WVZA 1MF2L 4YFLI 3MGOB 3I6KA 1NAMB 2N4IA 4G6ML 5F3BB 2GAZA 1IC7L 3ZSTA 3VFPB 3NFSH 5JZ7D 3OX8B 4XWGH 4WFFD 5L2JB 2WBJA 3JTSB 5HHPB 4OF5A 3FN3A 4PUBH 3O4LD 1DN0B 4N5ED 4PJ9D 1F3DJ 4H8WL 1MCOH 1A7NL 3BN3B 5F3BA 5HHME 1XGTA 3NN8A 5E5MB 3VD4A 3K0WA 2DQTL 4L8DB 1MCFA 3RWEB 2YK1L 5SV3A 1KCUH 1CTOA 3X14A 1FNFA 1SMOA 2Q6WB 5HDOA 1VDGA 2OXHA 4BK4A 4KC3B 1J0KA 4APQD 3ECBB 1BOYA 2IH1A 5F1KC 3A6CL 4EOWH 3UTTA 3ME0A 4CADB 1BECA 1CN4A 1IC5L 4JN1H 2FEEL 3MCLL 5EBWA 4GT7A 3NIGF 5BV7L 3WLBB 5ITBL 4HQQH 5FYKH 5DF0A 1ORSA 3QUML 5TF1L 4F9PA 4TVSa 1PKQA 4HBCL 1H3TA 5CLTA 5I66A 5IW6A 1WWWX 5IR1B 2P1YA 1I8MB 1R3IH 3WLWC 5C0GA 2QQLH 1AIFA 1RHHB 1BQLL 1YN7A 3LY6A 5ISZB 3MCKA 1FE8L 3P73B 4UT7L 1RIVL 5GGTL 3LIZL 2HTLD 5K59E 3PGDA 1YN6A 2MPAL 4Z7QF 4L5FH 4PYHA 4CVXA 4G80B 4ACPA 2DJ4A 1OB1B 5ALBH 5C6PB 3MUHL 2VH5H 3RA7H 4NRZA 3AMKA 4OGXH 4RQQA 4XVUC 3V2AR 1KTLA 3O6LH 4XC1H 5E2VL 4LSRH 3GSUB 3P4NB 4Z7WE 3QO1B 2MFNA 4QRQB 4Y16B 1NGQH 3MBXL 4NO3B 3GGWA 1MRDH 2BX5A 3VWKC 3C6LC 2VLKD 3OAUH 4LSQL 3O4LB 3TP4A 1DLFH 5CD3A 2XZAH 2PUQT 3CVHL 3NIGE 1OCWL 3T4YB 1AKJA 2W65B 1KJMA 1ZEAL 2W0KA 2WINB 4QT5B 4EJ1C 3T2QA 4ZSOB 1SEBB 1JPSL 4XCYA 3QHZL 3OWEA 5I0ZA 4RFNC 4MMZC 4XTRD 1DCLA 3QI9D 1WAAA 2O61A 1I8LA 4I2XA 5KAQF 4UILL 1LO0L 1OTUD 3IYLW 3MROB 4JFOA 5KOMC 1C1EL 1GGIH 4I18B 4HZLB 1B0RA 3I9GL 5F96H 3W0WA 2GK0A 5D71L 1B2WH 2VKXA 1T1YA 4OGAD 4UINL 1R3LB 1G7MB 4ZO9A 3SPVA 1E6OL 4Y8DC 3IFNH 3OKDA 4KK6C 2HKFH 4X6EB 1RK1A 3QQ3B 3KNBB 4P3DA 3CSPA 1INEL 3M8OH 3T0EC 3GHEL 1KCVH 6FABL 4Y89A 1QSEA 1S9XB 2OZ4H 4HW6A 1ZLVH 3HTLX 4XPAH 1FNAA 2Y7QB 3O3UN 5ITBH 2HT2D 4UAOB 1KF9B 2FO4A 2W9EL 3V5HA 2NY4D 2W91A 1EH9A 1WZKA 3MBEB 4P57A 4TUOA 5T1LA 3QPQD 4FNLL 4HS6A 1U8JA 4PB0L 1DL7L 4V1DD 3UJIL 3F65A 3CVHA 3P9WB 4R90H 4X6FB 1IM3B 1FL3B 3W5NA 1EUUA 1SBSL 3V5HB 3N1FC 5MHSE 4NUJB 3RWCB 3T1FA 2E9JA 1AHWA 4HWBA 5HHQA 3KLAB 2ZUTA 3H3PH 2KQMA 4G9FE 3VWJD 4DKFH 3O2VH 5HSFA 1QSEB 1S9XA 4ETQB 4LAQL 3NPZB 2NR6D 1AGFA 2AJSH 1KG0B 4CL7A 5DUPL 5TE6L 4HKZA 1P2CB 1KJ2H 3OGCA 1P9MC 4R26L 5IMOA 2Z9TA 1CD0A 4YAQA 1I85C 1YYML 4HIHA 1XCQB 5CWSB 1KPRA 4KRPB 4GRLA 1DLFL 3TM6A 4YHKH 4KAQH 4GG6E 2KPNA 4O00A 5E03A 1C16B 2IC2A 3DO3A 2IFFH 3WBDA 3WNMA 4JM4L 4KRNA 2EXYC 3LCYA 4KROD 3C9NB 2DM2A 5CWSA 4M1DH 3EO1A 4LP4A 2D0GA 3ZZ1A 4WEUD 4KI1A 4NOFA 4QRRA 5EN2B 3S3JA 1OAXL 3QDGD 5IW6B 1OTUC 5L9DH 2VB5A 3C6SA 4GG6F 3V5DB 5LVEA 4PJHB 3EZJB 2W0FA 4OBSA 1YNTB 5CIPB 4ZXBA 3GK8L 4BQ9A 4YJZL 3E0GA 3KYAA 5J11C 3O9WA 3UJJL 3LPGA 4Z7NE 1AGDA 2BRRL 4PJDA 4R4ND 4BUGA 4LIQL 3LD8B 1FYHB 5MP6H 4M43H 2F19L 1NLDL 3VXNA 5JXAH 4CGTA 4PJFF 2QL1A 1I9RH 2C3WA 3PDOA 4QXTA 3FQUB 4OZHF 4LKXA 5EZLA 5EPMB 2BJMH 5DJXB 3TVMA 4GMSL 4BQBA 5IQ9B 3EIFA 3MBED 5SV4A 2NY4B 3RL1B 3I75B 4GKNB 3IDUA 4G9DA 4Y2DA 4MNQA 3GSRA 1QHOA 1ULVA 4NSKA 2C26A 4L3ED 1JWMB 5CIPH 4OZ4A 1NUDA 1TPXC 2FB4L 2HLAB 3VFMA 4IRSC 3U30B 5L7XH 4UAOC 2ICWI 1IGIH 4D9LH 5DMKA 1XGQA 4PRPB 1NKOA 5HY9A 1FIGH 1TJIH 3QDGE 1JWSA 2VXTL 2OXGA 3FO9B 3LQMA 5ICZA 4R90L 3IKCA 2KKQA 2HVJA 5MENA 2AK4E 5DZLA 3VD9A 5I15H 2YN3A 5E6IA 2Z4QB 3MROA 3TO4C 3ZDZF 1J1PL 1B0GA 1HINH 1T1YB 2XPGB 3PWNA 4JFEA 1MCJA 5IFHH 4C4KT 3W0WB 4FXGA 1J0ZA 2HT3C 4Y1AE 3SJVB 1CGYA 3QXUA 3HI5H 4RAVB 2C5DC 1AY1H 4NKIL 5D2LA 4ALAH 1T6WA 5F9JA 4G6KL 3MV8A 1EDQA 3GJFK 2Y5TA 2D0HA 4P4KA 2VE6B 4NJAH 5TDPB 1KCRL 3ZHDA 2MQ0A 5FXCH 2MKWA 4YHPA 5C0RH 4K3GA 3EYUL 4D9QD 1YC7A 1A6VH 4F8TA 3ZT6A 4HKJB 5MEND 1KJVA 1XMWA 4F37K 4MA1C 4HSQA 5SWSE 3PP3K 2YKLL 2IQAB 2B4CC 3FO0L 4Q0XH 1XF1A 5EBMA 4KXZH 4P2CG 1FYTB 3F7YA 5GHWH 3OX8A 4NRZB 4HCRH 4QWWC 4YQXH 1U8QA 4HKBB 4WUKH 3P4OB 4NC1C 5LGJA 3C6LB 4MHHG 4O2CA 4P3WA 4BKLB 1T83A 3QDHA 2Z31A 3DXAA 4U1GB 2BSTB 5E8EB 3BP5A 2UY7A 4NQDB 1KTLB 1EBAA 3OR7A 1OM3H 1FO0L 1N6VA 2A9NH 4XCEA 2BRRH 5KSUB 2ADJB 2WIIA 2RFXB 3CFDB 1INEH 4OF8A 3S3SA 5KZCB 4JLRA 2DYPD 2NY7H 2X4TA 5M95B 1L7IL 1AHWB 5KSVA 2DDQH 2VC2H 2PO6C 5F21B 2J6EL 2C7UA 1D5IH 1RJLB 3HZVB 4EXPX 4NGHL 1YNKH 2ICCA 3X3GL 2VLRE 1X5JA 4DGYH 3CD4A 5DC9B 5FYKL 3BRGC 1YNLH 3K1KC 5DTFA 3ZDYE 4ENEC 4XMKL 4HWBL 4TYUA 1QBBA 1FGVL 2Z31D 1P4BL 1KBGH 4X6BB 2OL3H 2DWEB 4MDJB 1UT9A 4EN3A 4NRYB 1WISA 1GC1H 3IDXL 4D0BB 4P5TD 5CILH 2WBJC 1W72H 5KSUA 1T1ZA 2NX5D 2EXWD 2Z8WC 4ZTOH 3QQ4A 4DW2H 2ZPKL 1QNZL 3X14B 4GXUN 5JMRA 1DBAH 5H37G 2FL5B 3O6KH 5L88H 5IKCB 4WNQA 3E3QE 2EZ0C 2DI9A 4PLNC 4Z8FL 5C07E 2OQJA 3QDJB 3KLHC 4EDXA 3MGAA 1HXMA 1GZQA 2Z35B 4HDIA 1EGJL 1IAKA 3GIVB 3QUKB 5K9QI 5MERA 1VCAA 3BKCH 4M8QA 4PPTA 1G7PA 4JKPL 5C70A 1W8NA 1P84K 1MJJB 2A77H 4P5TA 4GS7B 4IOIB 1EERB 1CLZH 3ECBA 3PJSB 5FO7B 3RRQA 4MB5A 1I7TB 4C56A 2AAVA 2I07A 2H2SD 1WTGT 4ZUSA 3KPLB 5EORH 4WW1B 4NP4H 2WMPA 3TIDB 5E1AB 5EBWB 1BQUA 5C08B 5I1KH 3EYOB 3M07A 4JFQA 5LGHH 2JJTC 4Z7UB 5DJ6B 3SGKC 1A64A 1MREH 2VL5B 2VDNH 1EJ6A 3IFLH 4EI6A 4IOIA 1AGBB 3L5XH 3RJDA 4IRZH 1RSFA 3QJHA 3VFVB 5C0EA 3DV6A 1OY3B 2BNQA 4UIMB 1RJYA 1U3HB 1DN0A 5D5MF 3VH8G 1YC8A 3QEQD 2BSTA 5MERB 1A7NH 5ALCH 3DVNA 2F9BT 3MUY1 3RWJA 3G9VA 1FJ1A 2ZG3A 4MS8C 2OL3B 3TYFA 4RISL 4EIGB 2FATH 3VI4F 1ZWIA 2B1AL 1KCUL 4U1GC 4RMUA 3NCYS 1FH5L 3RTQA 4K3JL 4M8QB 2X4QA 2X4TB 1S3KL 5DD5H 5KAQG 5FM5O 3DPBA 2VZUA 3T2NL 3VGEA 1A6WH 1WT5C 1H0DB 3H9SA 4YXKL 3K2UL 1FL6A 2GK2A 3HE6A 2H9GA 3G6DH 4JQVA 4L3AA 4XZUB 3NGBC 1BFOA 5CFHA 4XVTL 4PBVC 2NYYD 3SDXF 5IG7A 4KJWD 4LF3B 4FABH 2BVPB 2DKSA 3GSVB 5IIEB 3BGFC 1EHLH 2ZSVB 1TCMA 2A1WL 1JHLL 1NMBL 4LEOA 4K8RH 3D69A 3HZMB 1IM9D 4EZMA 1EEYA 1KT2B 5FHAH 4U1JA 3T2OA 3HZKB 2CMRH 2H6PB 1AFVL 3EJYC 1B3JA 1ZANL 3G5VB 2FR4A 4J2XA 3HI1B 1BD2D 4ZFFA 2V2TA 5FYJH 2AV7B 3RTQD 2DWEA 2JIXA 4YHPB 4PP2A 2AKRA 3I9GH 4X6DA 5F96L 2I9TB 1M05B 5FUCC 1QLFB 2IQAA 5JHDA 3LEXA 5DMIH 2ITCA 3LN4A 4FTVA 2BERA 4NM8L 4C56D 43C9A 3LSOB 2FECI 4YZFE 3SY0A 3BZ4B 4LF3A 4XXCC 2E8YA 5D7JC 3EO1B 3TESA 3QUYB 1TIUA 3GMQB 3PJSA 4EUPH 4F7PA 1OW0C 3TBVB 5I2IA 4YR6A 4E41E 4DAGH 4RIRA 5CSZB 4LLWA 1J1XH 1WBZB 3N1MC 2HH0L 3HAEG 2HJKB 2D31B 1J18A 5DJYA 4K3EL 1AKJD 1MIMH 4X8JB 3ARFB 1OHQA 2H8PA 4GAGL 5TH2A 4OGYL 1N8ZA 4YHOL 2EH8L 2Q8BH 3DVNB 3IDYC 1JN6A 3LKOA 2JKXA 4GO6B 4OFYD 1LEIA 1MY5A 5EZLB 4JFFD 5DJ2B 3FTGA 1TITA 2X4PB 5HYIA 3ZTJH 5B8CA 1VERA 4UINH 1HN1A 1XCTB 4OFIA 2PR4H 3TVMB 3HI5L 4NHUB 5F89A 2NW3A 4WENB 5J6GB 1G9MH 2HWZH 5D7LA 5HGBB 4CMMA 4U6VH 3PXJA 3TCLA 1NLDH 1IAMA 4X5XA 3VD7A 1QR4A 2M2DA 1YYMH 3WIIH 1KPUB 1N0XH 1AXTH 5C8JA 5K9KA 3D3VE 1G7QA 3MUZ1 3MRNB 2JIXD 5AYUH 1U3JA 1IJ9A 1B0GB 3D5OF 1WJ3A 4AQOA 1IFHH 1R6VA 3WEXA 3CDGB 4PJBE 1MJ8L 1OAUL 3WFDL 1YPZB 1BGXH 1S9WB 5F7NC 3TBSB 4OF3A 4EUPA 1Q9LB 2VDKL 1UH3A 4TN9A 4C57C 1WV7T 3QQ3A 1I7RA 2DL2A 1FFNB 4UNTA 4ZXBD 5B3JE 2B1HH 4KH2A 4QHMB 4Z7VB 5FIEA 4TVPD 5FGSA 1FFOB 3IJSA 1UA6L 2Y36H 5C92A 3SGDH 3WJJA 1LEGB 1RI8A 4F57L 4KVNL 4HLJA 2DQFB 4JREB 5F3HB 1LILA 3GIZL 3B8SA 3VWJA 5HGGS 3WCYA 3BPOB 2FX7H 5IWLC 4K9EC 2DQUH 3KLAA 4GMTL 1PKOA 5D7IE 1ZHBB 1QP1A 3LQZB 3QUXD 2OSLA 1H15B 5EU6E 2BNRB 4EI5D 3BQUC 3CDCA 4PIRF 5GRJH 3FFCD 3F62A 5DYOA 1FRGH 1KTDA 4TQEL 2ESVA 2FX8H 1MI5B 1QTYT 4PGDA 3LOWA 5DJ8A 1A9EA 3V6ZB 4MB4A 3F12A 4PRDB 4JFFE 5I6XB 5GGSB 1EPFA 2F8VA 1T5XA 1FZOB 4HWZB 3BP5B 5C0BE 4LCIL 1W72L 1SY6L 4ZS6D 1JGVH 3UAJC 4LVOC 3TBWA 4U4BA 4RNRA 2J8UA 4B7LA 3EYQD 2C3VB 3CXHJ 4NWTL 4QRRD 3FB7B 3VFOB 5FGBA 2Z93B 1BFOB 3ULVE 4D3CL 5F88B 5CKAA 1U8MB 3O6LL 4HUUA 1SYSA 1IAOA 4WEBL 4CAGA 3FN0H 1XF5B 2UY6A 3U36A 1I7UA 3O4OB 1T66D 4TRPH 4YZFF 4MAYC 1FDLH 1S3KH 2APWA 4JFYA 4JQXC 2BSSB 5HYSG 1WBXA 5D72H 4O02L 4P4KC 4ODTH 5BXFB 5C0RL 2WINA 4QT5A 4P23A 4MQ7B 2QJDA 3WEXB 2OJEB 5FO8A 4MLSA 4DGYL 1TTUA 3VMNA 1PG7X 4LCUA 2P7TB 4F7EB 4JPWH 4KMTL 2B0SH 2QTEA 1MLCB 4LCWA 3DSFL 1H8SA 1L6ZA 4TPRL 4XP9L 2AK1H 3VDAA 2AP2A 3OBAA 3MLTB 5DGRA 5ETUA 4XB7A 1FAKT 4YC2B 2O61B 4RA3A 2AXFB 4G8GB 5E95B 5D93C 1JGLL 1U92A 4OUOA 2PYEB 3HC0A 3QRGH 4AJ0A 2I24N 1HYRC 3OKMB 3HCVA 2YD9A 2EC8A 4XCYB 3EOBA 3UBXI 5K59F 2NY1D 5T3ZD 4NQCD 5A3IC 5D7KE 4R4NC 5ILTL 3QJFA 1CGWA 2R39A 1OSZB 4J3UA 3TBYB 3TN0C 3O9WD 5FUOL 5TGBA 2P48B 1I1YA 1EGJH 3ZSSA 1U8KB 5I1LB 4AEHL 1E28A 4JFXA 4P3DB 4R8WL 3B9KA 2BJML 1A21A 1CVSC 4JM2C 3VGDA 1UB6A 4LHUA 3FONA 3ULUH 1HSBA 3LDBB 3H3BC 4MJ5A 1UADC 3Q2CA 3TWCH 1YN7B 5ISZA 4ODVL 4B7IA 1VFBA 4XCCH 3SDAC 1I1FA 2X6MA 4BH8B 2B8OT 1CDIA 2YR3A 4Z7UA 4F9LA 2NZIA 2VDML 4IHOA 5L2KB 4CMMB 2ESVB 2A6IA 1M4KA 4BSWA 1TJGH 2BMKA 4NQVA 2H1PL 2L0DA 4UT9L 2DF3A 3NZHL 1ZXQA 3VJ6B 2P5EE 3RNKB 3V79C 4PJAB 1SEBA 3OAYH 2D9CA 4P23D 3LKRB 4AQ1B 4D2NA 3RL2A 5EFIA 4UTAL 3DXAD 2XNAA 1R3JA 4RAHA 4O58H 4G6AC 4BQ6A 1NCTA 2D7MA 2RFXA 1KCLA 3CFDA 2FR4B 4QRPE 1FZMB 3IJSB 2D3VA 4P4KD 2H32H 2EDYA 1TZHA 4LLWB 4JB9H 1REIA 4O2CB 5IQ7L 2Z92A 3FB5A 2CLRB 3P11L 2LQRA 4K7PL 2H8PB 1NC4A 5HGDA 1CI5A 3G5YA 3FMGH 4NPYA 5T3XH 1IILE 3DSFH 4NRYA 3EAKA 1OAXH 4LVEA 4GKSA 2UYLA 4LDOB 1YQ2A 3CMOH 4OZGA 4FTVB 3QJHB 1JZ8A 2ED7A 2RCSH 1ZWIB 2BDNH 4ODBD 3MRKA 1QLFA 3VXME 4KMQA 4P2RB 2DJSA 4U0QB 2GITA 4IS6B 2YD4A 3CXDL 5EZJA 3O0RL 5EUKA 3IKKA 5CJQH 3IJHB 3MXWL 4WWKC 3CFBB 4HFUL 3MV8B 3WIHL 3IS0X 1M71A 1C5BL 5MI0B 2DQUL 2YS4A 3D39D 4FTVE 1S8DB 2Q6WA 4JO3L 4TUKL 1LEIB 4UQ3A 2ZSWB 4JANB 2R4RH 2AQ2A 4HDIB 5CINH 3QA3B 1N8ZB 1PX4A 3B9KB 4FG6C 2Z31C 2RGSA 4WWKA 3S5LB 5CLWA 4K8RL 4X8JA 3RHWF 5I19L 1JWSB 1NFIB 1JF1A 1WWBX 2ZSVA 2FH6A 2UYLB 1A7RL 2F54B 3WS3A 5A43C 1YECL 4YWGL 4WW2F 1GZQB 2Z35A 3MRMB 1CQYA 1ZLSL 1DQLH 3BO8B 3KYKH 1G0YR 1QNZH 2FIKB 3I6KB 2PYEA 3D39A 1MHPL 4P46C 5I1JL 2GJ6E 4Y0GA 4KK9D 1ONQB 5JPMA 1S9KC 3MCKB 3P73A 1T1XA 4Z8FH 2AQ3A 2A73A 2X1PA 4CN6A 1S5HB 3X11B 3MRHB 3SKOB 4PJBB 1OGAA 4LDLB 4V1DA 3OF6A 2EH7H 5BV7B 3OPZH 3WKNA 4RGMC 1F11A 4C55A 1MRFL 4ZOCA 3TYGL 5K93A 4OLVL 1JRHL 4UOW1 1KUMA 1JNLH 3OGOE 3EDEA 4YHNB 2ICWA 3KDMB 1C7SA 4ODWA 3WSQL 3BISA 5IK3B 1MHHA 3WKML 4EVNA 4GBXA 4PRHE 2YD8A 5HGDB 5JR1H 3KPOB 4FFWC 5I8OL 1OVZA 3Q1SL 3DX9B 3KYOB 3QHZH 1F4XH 3MV11 4HIXH 3F7QA 3VXUD 4YHOH 5GS2D 4ZG1A 4WCYH 4S1QL 1HXMB 5DZOA 1P84J 7FABL 5BRZE 3P9MA 3V0WL 2QV2A 5LQBL 1MWAB 2DBJA 3ZT7A 4KJPC 5KSBA 4NWTH 3GJEA 5IB4B 1BFTA 2Z93A 2WWMD 4BFGA 3MZTA 4MD5A 1A0QH 4JHWH 3MA7B 5DJAA 4PRBA 5D6CA 5C09E 4K2UL 4PP1D 3QUKA 4BKLA 4HK3J 4HIHB 4GAYA 3D85B 4OZHB 2HA1A 2GAZB 4O5LH 3HPJB 5GGSA 3TPUA 2AEIT 1QBML 2IAMA 5ELIA 4OD1H 3JUZA 5KSVB 4N9GB 2JJTA 1R3JB 3SGKA 2X70A 3L3DB 3M8OL 2GJJA 2ZOKA 2E27H 3TH2T 1P6FA 1MCKA 5IT2L 4TVPE 4NT6A 5FEBA 1KEMH 5FYJE 1NCDL 4Q6YA 4OD2B 1CDHA 5HYFA 2BFVL 1MFEL 2OL3L 2ZUSA 2LU3A 1N5YL 3ULVD 1YA5A 3FQTA 1QKZH 3RWIA 1BAFH 4KJQD 4P0DA 3U0WL 1J5OH 4PJFA 5ERWA 3C8KB 2NPLX 1ZVHA 1I1YB 4NC0B 1Q9OB 2K1MA 3IXTA 1HYSC 4JJ5B 2CQVA 1NH6A 5GPRA 4Q9QL 3U1SL 3BMVA 4DTGL 4J23A 4XC1L 5E2VH 4PGJA 5JMOC 2XZCH 2AJXH 4Y2DB 4XP6L 4JRYD 1F58H 1XIWB 1UB5A 4ZD3L 1SJHA 2PCPB 3RGVA 1S8DA 2IMNA 4R0LA 4YHML 4LLMA 2AERT 3Q3GA 5FYJD 3BVNB 4C58B 3MQIA 5CP3A 3HC0B 2CUHA 5MHSD 3AU1A 5DHXB 3D3VB 2YOCA 3CZJA 3B6SB 1ZT1A 3NCJH 1CZ8L 2DICA 3HHRB 4KHTH 4ODXB 4M93C 1XT5A 4S2SA 3O6FA 4PJ8A 2PKDA 4EDWL 1HHHA 4MAYB 5LBSL 1XIWD 3C6SB 4Y19E 3V0WH 4Y2DD 1AGDB 3W11D 1U8OB 3OV6A 1ZA6B 4Q9RH 2DTMH 2CRZA 2F8XC 1KJMB 3LRSB 2DQTH 4AL8L 5IBTH 3JWOL 1M1SA 3U9PL 1QBAA 2C3XA 3S37H 2CLRA 2V2XA 2VLLB 4K3JH 3TPUB 4CVWA 2ERJC 3DRQA 3GIZH 1BBJA 5HDQH 1MRDL 4QTHB 4F80A 4Q6IA 4HJ0D 5T1LD 4PJIA 1MFAL 2YPVH 4JFZL 1JV5B 5L2KD 1Z5LA 1QFWH 5LGJB 2J2ZA 3HAEB 3V6BR 3ZT5A 1UWXH 1FPTH 4XVTH 5DUBB 3LMJL 1TPXB 5ADOL 4XPAL 4D94A 1FAIL 4IRJB 4PGDB 4N0UB 5T5FL 3ZYZA 1FQ9C 2NY4C 2WIMA 4WV1C 2HJLA 3ROOB 5FHAL 1HXYA 3SCMA 1N64H 4P5KA 5T1KD 1BHGA 3DUSA 2BNRD 2VDMH 5FK9B 4PJAA 4EI5B 1I9EA 4IOFD 1UYWH 4HIIB 2EXWC 5HVHC 1FIGL 3EFFA 5I71B 5IF0A 2FJHA 3ISWA 3QEUB 1CE6B 3ULVF 3EZ8A 1MI5A 2WNGA 1FN4B 1IMHC 1Y0LB 5CIPA 5HDLA 4E5XA 3I84A 3MRNA 2P43B 3EYQC 4PGBA 3TA3D 5BCAA 2APVA 4JG1L 5A2IH 5J1SC 5SWZE 2H6PA 1V3KA 1NCBL 4JGJA 2FX7L 5IP4A 4O58L 4OZIE 1V5JA 2XPGA 4WHYH 1QQDB 3V6OC 2LVEA 3BZEA 2LTQB 2PCPA 3RGVB 3ARZA 3BGMA 2YD7A 1DFBH 1FIEA 4ZXBB 1CXFA 4JO3H 4A6YH 1T66C 1BIIA 2FBJH 2AV1B 1ZT1B 1XIWA 5IF0B 1DDHA 2XA8H 5E08L 3BPNC 4QOKD 4TQEH 4LSVL 2W9EH 4LNVA 3C2AL 2F15A 1MHCB 2E7LC 1D6VL 2ZUYA 4M9PA 4HC1L 1RZJL 2QHRH 3QQNA 2HLAA 3VFMB 4K94C 3LN5A 1J0JA 4LDEB 4TNVF 5F7HA 5L0QC 4CN4A 5H94A 4K9EH 5JORB 3QPXL 3P30L 1MCNA 4KRPC 4XNQA 5IMLB 4F15B 2ADGB 4YO0A 2CXGA 3EO9H 4WI8A 4OLWL 5IHUH 3ZKNC 5EPMA 3DOSA 3LRSA 3S6CA 1ZLUK 4OI7A 1KPRB 2UZYB 2DIJA 4OCYH 5DVNA 4HUXA 1ZV5A 3TVMD 5HGAB 4HKXB 3KPMB 4LLYB 4UIKL 4OZGE 4WJ5A 3ZTJG 1LO4H 4PS4H 5HPOA 4KKNA 1AD9B 1TVDA 5DJ6A 1QR1A 5FUOH 2Q3ZA 1A4JA 2H45A 3HNSL 2VZVA 4U1NB 1DANT 2VLRB 3KPTA 1PGRB 4HJ0C 3UYRL 5HI4C 4JO4H 2R1YB 2BNRA 5IMMA 2XWTA 2E6JA 3DI2B 5ABDE 2DLHA 4JY6A 2FO4B 1EHXA 4Q9BA 2F58H 3P2TA 4ZFZA 4X8XA 5CCKH 1MI5D 3BT2H 4JR9L 3SKJH 3SCMB 4JM2D 4ZQKB 1AKJB 4X6DB 4OUUA 4ZPTB 4FG6D 3EO0B 4X7FC 5CAYB 3S5LG 5DEFB 4XWGL 3I2CH 3VW3H 1UKTA 3DBXB 5E2TH 5CJ5A 3WL9A 1FG9C 3UJIH 1I75A 1MWAA 4YGAB 1P4IH 2Y07L 1KIPA 3E6HA 4NM4L 3Q3GB 1G0DA 1H0DA 4HWEH 4R0LB 3DRTB 2BVUA 1WAAF 3HFML 2FL5A 4Q97A 3LKQB 5IHLB 1J88A 4L29B 4BZ2L 4K7PX 1S9VA 2DLEA 3QCVH 3HAEH 4NN7C 4I18A 1P2CA 4NBXB 3O2VL 4MWFA 1BM3L 1ZT7B 5T3XE 5AUMB 4DEPB 3FRPG 3D39E 1MHHB 4IM8A 3SPVB 5DA0B 4P2OB 5IROC 3QULB 4Y5YC 2R69H 3VI4E 3LEVL 4BJLA 2AW2A 3K74B 2Z0BA 2ATPA 4J7RA 4MVBC 5ERWB 1J1OH 1G9EA 3HZKA 2EIZB 5HHXL 2V5RA 3MJ9L 4FQXC 3RWIB 2R23A 1L4IA 2GQHA 5I8CB 4MSWB 1U8JB 2BVPA 5EOQH 3QEGL 3CFJB 3DYPA 4H26A 2JIXB 4YDIH 2BNQB 1B4JL 3QDMD 4JAMA 4N0CC 4NNYA 3KPPB 3BYYA 3TH3T 1BMGA 4HUWB 3TBTA 4Y16A 4OB5H 3BFOA 4RX4A 3VFGL 4CU8A 2PTVA 4ZFGH 3TNMB 1IE5A 1P53A 5JHDE 4AENB 2R2EB 1ZHLB 4R7DA 2HT4D 1E0OB 4L8DA 3O4LA 2VSCA 1J1PH 2X09A 1A3LL 2WWMC 2BVTA 2VITB 4N8VA 4ZNCD 3J8F7 3UTQA 2GJZA 1MAMH 5DO2D 2Q7YA 4N0YH 4NC2B 1BD2A 3B5TA 3C87A 1J05A 2YWYA 1DVFB 2KH2B 3AXLA 1JPST 3R0NA 1N7ML 2R2EA 4AEIL 2PYFA 3GMPA 5HYJB 2HLFC 1MFAH 1FNSH 1SJXA 5HI4D 2ATKA 3KYMA 3ARDB 3LB6C 5I1IL 2NX5A 3BKMH 3UTTD 3AGVA 3MREA 4G42A 5IK3A 2ZSWA 1J11A 3OR6B 5CJOL 3QI9A 5I8OH 2W9LA 5FB8A 3AS2A 5GGQL 1IRAY 5DSCA 4ENED 4P2RA 4G43A 1CL7I 4YXHL 1NMAH 3DX9A 2X4PA 1JUFB 3RHWK 1NC4D 3KPOA 1MJJA 4L3EE 3F6LA 4WTXA 4P4RB 2F53B 3CMOL 1QO3B 3ILQC 4LARL 1IKNC 1Q0YL 4KVCH 1DQLL 4LSUL 2ITDB 4NNXB 4ZUSB 1QRNE 1HK6A 1Z0NA 2VLKE 3HFMH 2Z4QA 3QWQB 5D71H 1RIUL 5E1HB 2OX5A 3O6MH 3QDJD 1ZT7A 1UJ3B 3UBXG 3INUH 4PJCF 2PYED 1GZPB 2XN9D 3U46A 2YMXH 5TFSH 5SWQB 1ZT4B 4HK0B 2NMSA 2WBJB 1AE6L 3JTSA 2X9YA 5FKAA 3A6CH 5JA9A 1JP5A 2XTLA 5J1AB 4A2MA 3LN9A 3O2DA 1CGXA 3JWDL 4N68A 4RNRB 1YEFL 4JE4B 2X4QB 2RJMA 2PXYA 3LQAL 3OZ9H 3N0PB 3C5ZB 5IMKA 2HN7B 5JOPD 4JY5L 3RWDB 4ZFZB 5JHDD 1YMHA 2IADB 2BY0A 4MJ4A 4CNIB 1U41A 3VXOB 1T04B 4OLYL 3BPLC 4KDTA 1G6RA 4YNYA 3EO0A 4IRZL 4Z95L 1YZZA 1TXKA 2DQCL 3SE8H 4RZCA 3RJQB 2EDWA 5I16A 3BN9D 5KZCD 4U1KA 1DBJL 2HT4C 1FSKB 1KT2A 3IAQA 3QXTA 4JRYA 4QXGL 3ES6A 4KUCD 4QXUH 2D7QA 1PG7L 3PNWB 4QRRB 4JFEB 1JZ3A 3TIDA 5T3ZE 35C8H 3L5JA 4PJXB 2P8MA 2BC4B 5K9OA 4G7YL 3ROLB 1BQHA 4Y2OA 5GJTH 5D2LB 4KK6D 4M6NH 3NIDF 8CGTA 1WC7A 4X6CA 4YO0B 1FNSL 2OTPA 5SX5H 4OFKA 1KJ2A 3RVVD 1CFSA 4U6HA 1R5WB 4L29A 2BY1A 3P0VH 3D2UD 4XPHH 2L7UA 4S1RH 4JDVB 3LMJH 1IGMH 1I7RB 1KYOK 1A1MB 1NEUA 4JZNA 4HKJA 2A1WH 1Q9LA 3QSKB 3RGVC 3CUPA 3AS0A 4UILH 1QPPA 4QF1A 2ITDA 4DKDC 1JCKA 5CILL 1MJUL 1MUJA 2YSSB 3RAJL 4RAUB 4EBQH 1B90A 3R06A 3NFPB 3G6AB 1K8DA 3OAYK 2X10A 3W5MA 5IJKA 4NSKB 4PLJD 3P3YA 3L7FA 1YUHA 4QYOB 4M6AA 2R9HC 4CDHA 1V05A 3OKOA 3EFDL 5L8KB 3KWWB 1EIBA 3BH8A 3E2HB 4P48A 1CD1B 1ACYH 5D1XC 5I30H 3VWKD 3KAAA 4W70A 2O5XL 2OJEA 4FQJH 4QHKJ 1S5IL 5I1GH 2E7HA 2WAHA 3MC0A 4HGWA 3GO1H 5HVHB 4DZBA 3ARBB 1N59B 4FQQB 1D6EB 5F44A 4P5TB 4YIQB 1UACH 5EOTB 2EYTA 1NJ9A 1F00I 3HI6L 3U30C 1JPFA 2OR9L 4JQXA 2XRAL 3BMWA 4WI6A 1C08A 4NCDA 5DURD 4H88L 4P5MB 5J12C 3VGAB 2BMKB 2J4WH 4HXAL 1HXYB 1T7VA 4Y4HB 2QEJA 3RZCB 4NO5A 4YGVB 5T5NG 5B39G 1MFEH 2I60L 1EO5A 3RX5A 4PRID 3CSYA 5GGRB 3TF7C 1JHLH 1NMBH 4W81A 1AI1L 1EJOL 4HC1H 4GBXC 2G2RB 5TGBB 1S9VB 5C0ND 2P8PB 1T4KA 5A16A 2VLJE 3RIFF 1U8IB 2P5WA 2P8LA 2MTPA 3IDMB 4U1IA 2XZQL 5F88A 5KVDH 3WHE1 4CW1A 3V95A 2FHBA 2OTUA 1LEKB 3O2WL 4PJDB 1FYTA 5EBLA 4PRAB 4JFOB 5D1QD 1OSZA 1S7UB 3FFCA 4G6AD 1DBBH 3I50H 4I2XB 3H9ZA 3VXNB 1PSKL 1QPXA 4R7NB 3RZWA 4Y5VB 1R3HB 3GMMB 1KJVB 1RFDL 1JNNL 4PRIA 4L3CA 2BP3A 1FDLL 4AH2B 5I17A 1AXIB 4M3JA 5IEHA 5IMMB 4RMWA 1O7VA 2KL6A 4KKLC 3IETA 4BSWB 1WIPA 4PP2B 5F3HA 1MHEB 25C8L 4KROB 3C2AH 4UDTB 5E8DH 1H3XA 3SDCB 5C0FB 4LCCA 4JM4H 4LCWB 4ZFFB 2O26U 3FO1B 2L4OA 4NO3A 3KXFE 4HCRL 4NQDA 4WFHE 4QRQA 3GMRA 2HFFA 1F02I 2FHFA 1I3UA 4IRSD 1KIPB 3E6HB 2VWEE 4LSTH 5GRWA 4LCYA 3IFOA 5J12B 1OPGL 5KVFH 3SJVD 2D7NA 4U6XB 1UWEH 3MFFA 3V4VL 3NCEB 1AD0B 3S4SA 4XC3L 1JWUB 1P5UA 1AP2A 1RUML 3ARBC 1Z9SA 4AG4H 1CIUA 1A7PH 4X4XB 3BI9X 3MLXH 3WUWG 5GIRB 2AI0L 1KTKE 3RVUD 2B7DT 1CE1L 4LOUC 1WGOA 3V0VB 1N6QH 1DEEB 2R56H 1FL3A 4NHCL 1GGUA 4GW5B 3C5JB 4NKOA 4PJ8C 2VABB 1CT8B 3L5WB 2A77L 5EC2A 2R2HB 3V8CA 1VEMA 5EU6B 4TSBL 3I6GB 2FX8L 3U7YL 4GQPH 1E6JH 1ZHBA 1ROWA 4W6XB 3O81A 3VXSB 2ZKHH 3SGJC 1U58A 4LNRA 2BNUA 5JIHA 4POYA 3CC5A 4HS8H 5MEPB 4MQ7A 3CIQA 2VXSL 4AM0B 1NAMH 4NN6B 4O9HL 5BXFA 3WE6B 4YBLB 4N0RA 1ZHNA 3GSNA 2ZPKH 4BK5A 1QZ1A 4Z7QE 5F9AC 4I13B 5H94B 5JORA 1A7OL 5KVEL 3K4ZA 3LN5B 5C2UB 3R06B 2HFGH 3HZYA 5E8OB 2Q86B 4FQCH 2HT3D 5F9DC 5C0JB 1QSVA 3RUGF 1MJ7H 1UB5B 3IU4H 3QHFH 1U3HD 1JZ5A 1JF6A 3AB0B 2PW2A 3JXAA 4AIOA 3DO7A 1PSKH 5I75B 1IEAB 4DCQB 5J13C 3HNSH 3QDGB 3QISA 3R8QA 3IDYB 4QHNA 1ZGLM 5DT1L 1ZAGA 4S1DD 4Z7VA 3VXRD 5EO1B 5C08D 2VUOA 4P2QB 1RY7B 2VN4A 3K8KA 1NFKA 4JFPB 4HPOH 4WFGD 4YHZH 3QDMA 5FV2A 1OAQH 3CH1B 5GGRA 3KPRE 5DWUH 5F7FA 1ORSB 3O8XB 1AGFB 1XGUB 3RZCA 1ADQH 3QBTB 4OM1H 3LHPL 3DI3B 3KYNB 3C5ZC 1LMKA 2HRPL 3WLBA 2C9AA 4Q7DA 2PYEE 1HILA 5FYJL 2VLKB 3JUYA 5L8LB 1P7HL 3A67H 3RY6A 1FFPA 1UJTA 5FDWB 3VWJB 2BNQE 5EWIL 3PV7A 1A7QL 5EBLB 4K94H 3GBML 3INUL 1BWMA 4RQQB 3BP6A 1UKQA 4EUPG 5I1AA 3G6JE 4FFYH 3MLXL 2EZ0D 3B3IA 4MXQD 1N26A 2P8LB 5KG9A 3QCUL 4EOWL 3CZFA 4LKCA 1XCQA 3DX6A 1S7XA 3DHMA 1WQVT 2XA3A 2Z31B 1OGAD 4U33A 2V9QA 4MA8H 4F7CB 3B4NA 1S9WA 1XZ0A 1GAFL 2XTJE 5C9KA 1DANU 3QIBD 3LKSB 3QUMH 1D5ZA 5CP3H 2CDEB 3U4AA 3QIWD 4JEGB 3QXDA 3H8NA 3V8OA 4XPTH 2ZCLL 4X5WB 3BRDA 2BVQB 3BGFB 1BJ8A 3LSOA 4XVSL 1U3HA 4PUBL 4IEFB 1SY6H 2GYSA 5F6HJ 1KN4L 1Q0YH 1WC7B 2FCBA 3NGBB 4KVCL 5F7DA 1OQXA 4MAYA 1HYSD 4ZYKB 3GI9H 3BN9C 3Q0HA 3GNMH 1IGYB 2H26A 5JNYA 3O6ML 1XF3B 2VAAA 2DQGL 3E8UL 2VH5L 3MRFA 1WK0A 3PP4H 5EUKB 3GSQA 3GKWH 1UH4A 1CCZA 5T1MA 4DZ8A 3KJ4C 3K3QA 3IDIA 3QIBA 1U3HC 2Y06L 15C8L 2PO6D 2LAAA 1N0LA 4FXLA 1DBML 2GY5A 4ZUTA 4NQED 4TVPL 5CHNB 1CFBA 5EZJB 3ZDZE 4JKLA 4M6MH 1IAKB 3WNNA 4GRWH 5CUSH 1F2QA 3DYOA 1NDMA 3S96A 1GXEA 2ADFH 5F7DB 3LS5H 1EEYB 2NLJA 4PJXF 4OLUH 4GLRI 1MCEA 2PYFB 4JG0L 1JYXA 3T3PF 1JYWA 1NMAL 2DQHL 4YDKH 1XGQB 4JJ5A 4PRPA 4MA7L 5KSAD 2WP3O 4R96A 1T0NA 4MD4A 3HG1A 3N9GL 4NWUL 4P9HL 3L3IA 4U6YA 5KSBB 3EOTH 4FQXB 1FZMA 1JZ4A 2APTA 1K3IA 1TVBA 3FB5B 4Y16D 5D2LF 1NGZA 1UJ3C 4LMQI 4QRUA 4HC1A 2Y5EA 3PHQB 2R0WH 3EDDA 1ACZA 4ZUVB 3RIFK 5C0EB 3FN9A 4F8QA 5MEOA 5LWYL 4UV4L 4JDZB 3PHOB 3EUUA 5H8DA 4XI5D 4ZSOA 2FWOB 2UUDH 3MLZH 5SWSD 1NFDF 1S5IH 3Q48A 4JQVC 3H9HB 1ZA3A 4FFYL 2XWBB 3GSNL 3ZTNL 5F1SA 1AGEB 4X0KA 4PRPD 4BZYA 4IS6A 1UGNA 2ICWB 2R56L 3KDMA 4NHCH 5AAMA 2XRAH 3F7VA 3QIWB 4X4MA 3HNVL 4HWUA 1E27B 1I8LC 1LO2H 3BD4A 4DN4H 3IFPA 3WUZA 5JTWA 4O51B 1FZJB 1SQ2N 4YHIB 3GHBL 4DFHA 3OR7B 1MJ8H 1OGAB 3MLWL 1NBVL 3DX8A 1RZFH 4MX7B 1OP5K 5CKGA 4WTWA 5IBLC 1MCRA 3MSPA 5CZXD 1VGKA 4Q58C 1TVBB 4G80A 5C0IA 3O6FC 4L8CB 2NW2B 3P9MB 3QDJE 4LSTL 2I27N 2EE2A 4PV9A 4NO2A 5J1AA 2IAMD 2XN9E 1KELH 2YPLA 3OKNA 2EKSA 1RHHA 1QSZA 1DUZB 3GI9L 3ULUD 5D70L 2C1OA 3CXDH 5C1MB 3TH4T 4XVUD 3VD5A 4ZTPH 3VFPA 3MOAH 3BAEH 1A6AA 1OF2B 4YE4H 3HCVB 5DUPH 4HBQA 5AWNL 4CMHB 1FC1A 4YC2C 3RWHB 5I1GL 1EFQA 1JMXA 2FEDC 4PR5B 4BFIB 4OCWL 3BKYH 4UUJA 4E42B 3MRJB 4NIKB 3DV6B 3HC4L 1SHMA 3MV9A 5DQ9A 3ZL4L 4H1LG 4CBPA 3H2WA 4UTBH 4NQXB 4TVPH 3HG1D 3MMEB 3TLRA 1OCWH 4TOYL 5D7IA 4KZDH 2IH3B 3BIKA 3IDJA 3GKZA 2CRIA 3NTCH 5DSCB 1RK0A 3EJYD 1MIML 1E4WL 2EDQA 1EJOH 1MOEA 3IJHA 5DRNA 2XY1A 4LLVB 4JRXB 1NFDE 1Q1JH 1CICC 2BNUB 4OF0A 5F9OL 5L0QB 4NBYB 1NBZA 4TPRH 2WIIB 3HC3H 1ETZB 1YECH 3RKDC 3WHE0 4NKMB 1FG2A 3U79A 2CDGA 5GQBA 3IJYB 4F37F 4CU6A 4LLUB 4HCRA 4CUCA 3QXWA 3M17B 2YRLA 4JFYB 5JOPE 4Z7UF 5BMFL 3DYMA 3KPRB 5FYKD 5DS8B 4NRXA 1GGIL 1OGTA 1NCCH 4I4WA 3BEWB 4E9LA 1M7XA 1QSED 5C6TL 2IG2L 5E6YA 1J05B 5C0CB 1UXSA 2CDEA 3ALWA 2EKJA 3BHBA 3F6IA 1VA9A 1J8HA 1GHFL 1CD8A 3JVGC 2HKFL 3RVTC 3SDDB 2V5TA 1X3DA 3MODH 4A6YA 3SKUD 1Y6NR 3KPSD 1JHTB 2F5BH 1KXVC 2AEQL 4IMKC 5D1XD 4OKVA 1I9RL 3PDDA 2NY3D 3EOBB 2GTWA 3MRBA 4UQ2A 4WO4C 4XMLH 4Z5RA 3GMNA 5FCUH 2DKUA 4JO2H 5EC1A 5DLML 5I9QC 1IC7H 2Y5TB 3PDOB 3SKNB 3AREC 3SKMA 1H5BB 2J8HA 4LFHD 2HRPH 1EHNA 4S1QH 1VHPA 1XR8B 3K2MC 1HILB 4JGUA 3G04A 4QOKA 1C1EH 4EBQL 5L9DL 4GKSB 4JFEE 4OSUL 1XH3B 3KVQA 3EYFA 3MRRA 1Y0LA 3RBGA 4LASH 1IGFL 4GRLD 3V4PL 1NCWH 4KI5E 4KKAC 3PV6A 4NZUL 2CUMA 3MNVB 3AMLA 3PQYD 4N8CL 4DKFL 5HHNA 1HINL 5IVXA 5J9PB 2VLMD 5JQ6H 1HHGA 3VI3F 1K9TA 1AE6H 1O0VA 1CL7H 3AROA 1JNNH 4OLVH 4FQIH 1IBGL 3BKYL 3V5KA 5BVPL 5E6IB 4PB9L 5DT1H 3FT3A 4MNGB 4XCFH 1BJ1J 2H2PC 1NBYA 5H35A 5I1EL 9CGTA 2XNAB 1MCPH 3ULSA 2A6DB 5D5ME 4WI3A 5E7BA 1DBKH 5HI5C 5IQ7H 4NUGL 4PJIB 5CS7A 1YMME 5E6IC 1OSPL 1BBJB 1G7QB 1NGWA 3O2DL 4ZS6C 4M03A 3FHAA 4OV6F 1WEJL 2AJVL 3L5XL 3NVQA 3KXFB 4HMCA 4B50A 3DX7A 5C2BH 2P5WD 4QXTB 2OCFD 1A47A 3VGGA 4IRSA 3L95B 4L1HA 5HHQB 1JPTH 1C08B 3LS4L 3MBEA 4TUOB 5D1ZB 5I73B 5EUOE 3MR9A 2FATL 1MSPA 4H1LH 3VXTA 1GHFH 4AT6A 2EIBA 3WDIA 2D03H 1PDKA 1JRHH 1W0WA 5A3ID 4ZAKB 1FN4A 3RI5F 4XT1C 5CP7B 2F5BL 1JN6B 1KIRA 2A0LD 4KTYA 1FORL 5FYLH 1KFAL 2CLZA 3BP4B 4I9WD 2DN7A 1CF8H 4M61A 1B9ZA 4XPHL 4OGZA 2Q76B 3QIUB 5J3HC 2X44D 3MBEC 4LOUD 4LLAA 4PG9A 3RZCD 4I77L 1A5FL 4Z7WB 3CX5K 1HWGB 1D5BA 2WUBH 4HWBH 3IU3A 3WDHA 5BOPA 1FO0B 2NXZD 1C16A 3R0MA 2ICEA 3GUTA 1T20B 4G8GA 3TNNB 4Q2ZB 4WO4B 3DSNA 1DE4B 3ARGD 3D25A 3TBWB 5GJSH 2NZ9C 3TEUA 4I5BB 4PRIE 4ZUUA 3VGHA 3BZ4A 6CGTA 1F4YL 3T0EB 4KKAD 2P7TA 4PRDA 5IVXF 3U9PH 4EKXA 43CAB 1G7JA 1GIGL 3O9WC 4PJ9B 3OAZH 4JM2A 2E7BA 4HHAA 4RGNB 2VKWA 5DEGB 5ICXA 3QCUH 1CICB 1VGKB 1QSFA 3HI6H 1UG9A 4RMSA 4HGMA 2E27L 1KOAA 1D9KD 3FT2B 4EN3C 5EIQA 3MJ8B 2DLGA 5EZOL 2K7PA 1K8IB 4XMPH 4H1LA 2LABA 4OV5A 3HLAB 4UNVA 5HHMD 1H3WM 3D2UB 1CZ8H 2X1XR 4HIEA 3B43A 1N5YH 3U9UA 1F8TH 3W9EB 5F9OH 1SMAA 3QPXH 5KSAC 1T03L 3IDMA 4PJ7A 1FVCB 3OKDB 4XBEL 3GI8H 4IIQA 3DLQR 4OKVB 1JV5A 4QHMA 1FNEA 1T22A 4UB0L 5C3TA 5IB2B 4DK6A 2PW1A 2NY6B 2EDEA 3B8YA 5SX5K 5I1JH 2XIDA 2HYMA 4JVPA 2V2XB 1OB1A 4Y5XC 1BVLA 1DQQB 5J06A 1ZS8A 4PY7B 3O3BB 3STZB 4DTGH 2AJSL 2FDBP 3PGDB 5EU5A 3HUJE 2G60L 1MRCH 3CDGA 4X6EA 5LWYH 5GS0L 1I9JL 1F58L 4YPGA 3W82A 1A02N 4UU9B 1ND0B 2GUOA 2A83A 3H42L 1U95A 4GXUM 5JHDB 3SDAD 1K6QH 2VDLL 1IZJA 1X44A 3H9YA 3T4YA 4TSAL 5LJYH 2YEZB 3MRPA 1A7BA 1NDMB 5FUZL 2ZJSL 3B6SA 4NJ9H 3H7BB 5DVKA 1EHLL 2RQ8A 1Z9OA 1BREA 1FC2D 4W6WB 3P30H 1WTLA 1GCFA 4O2FB 4RBPK 3OJDB 3ZYIA 3N9GH 3R4DA 4P9HH 3THML 2FX9L 2V2WA 2WBJD 5MEQA 1YY8A 4NM4H 1Z6JT 1G7LB 3MOBL 3JTTB 5JOEA 3H7BA 2R9HD 1I1AB 2D7PA 2R4SL 3LKPA 4CJ1A 3F58L 3OKKA 1F4YH 4OZHE 4K94L 3IFNL 1LO4L 3UDWA 1ZVYA 1G7MA 2IPKA 4JG1H 5C09B 5TFSL 1EX0A 3N85H 2FEDD 3DUUA 3OSKA 2BHZA 4WIQA 3T0BA 3S3PA 1HI6A 1WZMA 4KKBD 1FGNH 1YN6B 4RSVA 1CS6A 5BRZB 4MCYB 4MJID 1HHJA 1WSST 3G6DL 3RPKA 1P1ZB 3DVIA 4U7SA 1QLRB 4JO2L 1PYWA 2XKNA 12E8L 2OM5A 3SY0B 4CDGC 5I8KL 3UZVB 2HG5B 3PG2A 1RMFL 4GBXD 1F42A 4YDIL 1BQHG 3E1F1 2IEPA 1IKNA 4JZJB 4KDVA 1YYLL 4QNPE 3O2DH 3P4LA 4MJIB 1XGPA 3CFIC 4X6BA 4ONHA 5F7LB 4OCRL 4XPGH 5EG6C 5I1DB 1SBSH 3EO9L 4R4FL 2OK0H 1TQBC 3QZWB 5E2UL 3U9UB 3W39B 3WN5B 1M6OA 4BZ2H 2R29L 3O6KL 4G6JL 1QBLL 1I1RA 3ARFA 1FV1A 3LS4H 5E8NA 5D7SH 1UQSB 3W0WE 3PL6C 4LSSH 5GSVB 4YDLB 5DZNA 4UV4H 2UV3A 4ZOEA 1AQDB 1QFHA 3MNZA 2YD5A 3TYGH 5HYSB 1EUTA 1EK3A 3L3KB 4LFHG 3NPSB 1CFTA 1A14L 1FL6B 2F5AH 4P9ML 3EYVA 5GZOD 1LD9A 5ID0A 2VR4A 5E00A 3UO1L 4JGMA 3EYUH 3BESR 2NY3C 2P4AB 3FB8B 2JF1A 2FRGP 3S35X 4B41A 5I8EA 3S35L 4PBXA 1SYVA 1WCBB 2HTKD 4JG0H 3S5LA 3J7HA 5T5FH 4U3HA 2X4UA 1P4BH 3BDXA 3QI9C 1T2XA 3QUXA 5KN5A 3MNWB 3MGOA 5DEFA 4JANA 2AKRB 3G9AB 2EYSA 3VXUA 4TNWF 4KK9C 4G7VH 4KTEH 3L6FB 3A67L 4YK4C 4Q9RL 3G5VA 1A3RH 3W81A 4LEXL 1DLHA 4JHWL 3PWVA 2XI9A 4PG9B 3MACH 1JHKL 2A73B 5E1AA 5GGVY 4PS4L 5HHVH 1IQDA 5DEZA 3FQNA 4POUB 1QVOB 5JQHC 4M4PA 1AJ7L 1ZTXL 4AEIH 5HVWA 5ICYB 3IT8D 5DD0H 1EGJA 1LO5B 4S1SH 4OZGB 2HAZA 4NCC1 3UTPE 3ZHKA 3LV3B 3KG5A 4IOSD 3U83A 4XCFL 2VJXA 3JV5A 3BIBX 5GGVH 5KVMC 1I4FA 4JFFA 1GGBH 3HG1E 1U9KA 3SCMD 3NTCL 3O8XC 1IGJB 2IWGA 4MNQB 4WI5A 5ACZB 3Q5YA 4ZUWB 4QTIL 3VFSA 3FOMA 4FOMA 3U0TB 4AENA 3DURA 2JTDA 1XF4A 4QRTA 3PP3H 1BQLH 1F4AA 5ACLA 1T7XA 4BZ1H 4PJ7F 3QYCA 4OF7A 1FFQA 5IW1B 2GSIA 2UVEA 5T1DL 2Q3AA 4XNXH 4ZDHA 4WGVB 1X5FA 4BFEA 5BO1L 2AV1A 3QNYA 4YBQC 4LK4A 3S4SB 4BQ8A 4L4TB 4DKEH 4MDIB 2KQNA 4GRWB 4WY7L 3UCRA 1RU9L 2F53E 4JN2A 3T0ED 5IB3A 5J56B 1Z9LA 3UTZB 1XAUA 3RNQA 4ZFOL 5JW3H 3R8BB 5KVGH 3I3DA 1AC6A 1LK2B 1ZVSA 3FQXB 5AZ2H 4YDVB 3KPSA 3KYNA 1ZLUH 4DAGL 4Y7MA 3A6OA 1BFSA 1LO3L 5J3HD 1T5WA 3RWGB 1MFCH 3BUYB 3EJZD 1PY9A 4YEEA 2WBWB 1KB5H 2FD6L 2ARJQ 1MF2H 1X4YA 3IS1X 4KJQC 3IETB 5HTSA 3CAFA 3LRHA 1KN2H 1CDBA 3BD3A 2NXZC 1G0XA 4LQFL 4Z0XB 5FA4A 4N0FA 1DTUA 4XBEH 2NY5C 2DI8A 3T0EA 2G9HB 3TV3H 1Z9MA 2NTSP 2DQCH 5T1KA 4G9DB 4F58L 1L0XA 1SJEB 3BQUB 3QDGA 4Z78B 2VXUL 1OPGH 2RCSL 3SO3C 1UXWA 4UV7H 1UA6H 1KLUA 4MDIA 3VG9B 3UBXA 1T1WA 2XWJB 3B83A 3RU8L 4KHXL 1LEKA 1ZK9A 4TUJA 4M62L 3MUJA 3BXNB 2VLJD 1J87A 3RY4A 2BHYA 5E9DB 2YPKA 3LKRA 5TQ2H 3QXVA 1K4DB 1NPUA 1ES0A 4OLXL 1I8IB 1X5HA 3EGSB 3PQYA 1HQRA 5B38A 2M1KA 2O5XH 4R97B 2VNCA 4Y4FA 3VJ6A 1MCWW 3QWOB 3AM8C 4RWHA 3DV4A 4WRLA 1N6QL 3QUXC 5TDPA 1HOCB 5DD6A 4Y4FC 3ZE1E 1U58B 2ID5A 3O3EB 2J4WL 3EKCA 5CP7A 1GJIA 3C09B 3QQ9D 2FLBT 2VISA 2OI9C 3B2VH 4GW1B 1X4ZA 4M7JH 1VKXA 1FLRH 1OLLA 5KS9E 4HWNA 4F3FB 1SJVA 5DK3A 1F8TL 1RPQA 1VFAB 3L3OA 4OQTH 4LHUB 5GXBB 2H3NA 5T1LB 4LCIH 1N59A 3O4OC 4FQQA 1RIHH 1U93A 4M1GH 5E8PA 5E2UH 3PWLB 2HVKA 1IGFH 1X5AA 3RVXC 1MH5A 2ARWA 5DJ0A 1WAAE 4ZPVA 5EBMB 4NO0B 4I2XE 4KRLB 4FQPA 5I30L 1F3RB 5DVMA 4P3CH 1JGUH 4MJ6B 2D7TH 1TLKA 1E4XH 5ESVB 3HMWL 1X5XA 35C8L 2H32A 1U8NB 2QADC 3U0PB 4MAYD 1UACL 2VAJA 4LPYA 4XP1L 2D7OA 4R3SA 1X5YA 1FZKA 3JV0A 1MCCA 1FL5B 1N0XL 1A1OB 5C6WH 3B9EA 5I76A 4G9FB 1CLZL 3SGJA 1CFNA 3EOAB 1S9YB 4B5EA 3QAZB 1LNUA 5CSGA 2EC9T 4YHZL 2X42A 2Z91B 4YEFA 1KENL 2W1NA 1LP9A 1Q1JL 3I6LD 4K9EL 4PRNB 1OOAA 5FO8B 4K3HA 5D7LB 3FQRB 2J6EA 4XAWH 4UOJA 1AO7B 5T3XL 4JO1H 1H3PL 1TJHL 5E4EB 1A8JH 4AIZB 2YBRB 1FNGB 2FJHB 3QEUA 2F74B 7FABH 3AREA 1F90H 3U4BH 2VXVH 5IESH 1T6VN 5KVFL 3D0LB 2DIBA 2RBLA 2HFEA 5BVJA 5JOFA 4NDMA 3FZUD 1S7RA 3NABH 5CD3B 3GSRB 1PG7H 3I85A 1FH5H 4DK3A 3E2HC 1BBDL 2X5PA 4U1SA 1EVUA 4X7SL 3GMLB 1F3JB 2N7BA 8FABB 1TCRB 5DJXA 3BW9A 7CGTA 2A6JA 4OI9A 1OARL 3R1GL 4MJIA 1A6ZB 1TNNA 4DQOL 1G6RL 3WD5L 1V7NL 4NN5B 3AFLA 2Q8AH 4KXZI 3RPIB 4DOHE 5A16B 1K6QL 3MGTB 1E4KA 4HMDA 3VMPA 5CZVL 1W0YT 4HUMB 4X7TB 1Z2KA 5GGSY 3PWUA 5IR1A 5JIPA 4WI2A 2V5SA 1RZ7H 1ED3B 5HGHA 3C08H 3W9DB 1JFQL 2W0PA 2HP4A 3RFZC 1OTSC 3DTXA 5IVZA 1BJ1H 4X9BA 2QSCL 4WUUD 1JI2A 3VMOA 1RZIB 2H2SC 2X4RB 4GG6A 3HG1B 5ADPL 4MA3A 5GISL 3RAJH 4RFOL 5FOBA 1RIVH 5GGTH 3LEXB 2JK5B 2O5YL 4PJEB 5B22A 3IDGB 4NQCE 1OGAE 4OIAA 4XXDA 5F1IB 3TCLB 5B3NA 2XXMB 5DRZA 4RCAA 4QKXB 1C8PA 1EFXB 1XR9B 2ZCHL 3BSZL 3ELAT 1MFBL 1XF2A 1NEZB 2G60H 2M26A 5CD5D 1T0MB 1PBYA 4U2YA 3GGWB 1RU9H 1DUYB 1JGUL 3NN8B 3NCYP 2Y7QA 2CGRH 4LRNL 1S7VA 1RK0B 1UKSA 3NFPA 4ALAL 5D4QA 2YPLD 4L1DA 4ODUB 3SBWC 5IOPB 1JUFA 3CLEL 4YHLH 2E6QA 4H88H 3O45B 3RVWD 2YD2A 3UDWC 4U1LB 2HLFD 1MCPL 3BO8A 3CFKB 5L8JB 1WLHA 1HSAA 2HTKC 3JV4B 5BRZA 1BEYH 5DJYB 3DVGB 5C0DB 1J7VR 3DGCR 3MYJB 2MCPH 4PJ5E 1AC0A 3K8MA 2XG5A 1MIEL 5GSRB 4DKAA 4Z95H 4UT9H 4XHQA 1WFTA 3MA9H 4KUZL 3ROLA 4JHBA 3QR2A 1IGCL 1ZHKA 3GRWA 3TIEB 2R29H 4U3XA 4AIXA 5SWSB 3P9LB 2C1PB 4PGCB 1D5MA 2ZOLB 1OAZL 2UUDK 5B8CB 3LN4B 2Z8RA 3OPZL 2B39A 2YRZA 4FZ8L 3QNZB 4WWKD 2AK4A 3FTGB 3TGXA 4FXKA 4JFQB 4JRYE 2XFXA 3ZKXC 5E8NB 4FQLH 1FZJA 1SY6A 4FQXD 4XBPA 1QYGL 3S34L 1GOFA 2AV7A 1A6TB 3LB6D 1KEGL 4HUVA 2Q8AL 3VDBA 1JK8B 3BKML 5DJZA 3TC9A 2P47B 3GB7B 2IBZX 2J6EH 3QFJD 3HE6D 5A2JH 2VIRA 2BZDA 2IQ9L 5IFJB 4PV8B 2XFXB 3ARDC 3IGAA 1G7IB 3DNKA 4K7PH 1RMFH 1RJZA 1UM6H 5EU7E 1SVCP 1FLRL 2A74A 4RBPH 4WW2B 5JPNA 2VDKH 1HZHH 4WU5A 4YR6B 5E99L 5AZEL 3VGFA 4OZGF 4J6RH 1YYLH 4PRHD 4PJGB 2YBRA 4QRSA 3VRJA 3CFEA 3HUJA 3GMQA 5SWSA 4JM2F 4ZTOL 1TTGA 3T2PA 4NZTL 4I3SL 1GGYA 1TZHB 4LEXH 4Z7OE 1J0HA 2R0LH 4PY7A 3NA9L 5JLZA 4M5ZL 3EFDH 3BWAA 3U46B 5GGUB 2YK1H 1QBLH 3O2WH 4KU1A 3MV7B 4OLXH 3CU7A 4FTVD 5DDHB 4PV8A 5DJCA 1DZBA 1K2DB 3WUWB 2G5RA 2NYYC 2QLVB 4XX1G 3NOIA 4WU5B 4G8EB 2CSPA 5SWZD 3GBNL 1INQA 1ADQA 1J8HD 3TWCL 3D0VA 4XRCA 1KACB 1UWGL 1JNJA 1IZKA 1NEZG 1DEDA 5JW4N 1UCBH 4TTDC 5J4MA 4TOYH 3LQAH 3TZVD 3SE9H 3P4NA 5IV2B 4ZPVB 4MQXC 5C08E 1BZ7A 3FB6A 5TDOB 5T1MB 1U36A 4GQ9H 4HS8L 1TJGL 2AEWA 2FYYB 4N90E 5ICXB 5T3ZL 2MHAA 4HJGB 3QRFM 3EJJX 3PWJB 3CCHB 2VLRA 3LIZH 4X83A 3CC5B 3MRMA 5FGCB 1YEJL 4QHUA 5HDBE 4LNRB 3KYKL 3UYPA 3AS3A 4GRMA 3OXSA 2E8ZA 2P42B 4KUZH 4N1EA 1L0YA 4LBEB 2VLJA 4XXCA 3UTSB 5ANMA 3PIQA 2CRMA 3QFDB 1UM4H 4PD4J 4ONOA 4RMQA 1K4CB 5GS0H 2WP3T 3QT2A 5I74B 3TYFB 1IAIM 4LIQH 4M6OL 5E94B 1D5ZB 4PFEA 1FYTE 4PTUB 3BZFA 3VWKA 5F7KC 4R6UA 4O02H 5D7JA 4BSVB 5F7WC 2FO1A 4GG8A 4E0RB 5FYKE 3T8XA 3TO4B 3AC0A 3FJTA 3OKEA 2IANE 3PQYE 5JUEL 5IWLA 5ID1A 1F45A 4QXWA 2YRPA 5C9JB 2OMNA 2P49B 1DUYA 5INDB 3UXFA 2I07B 4I0PD 3VFTB 5DLMH 3OMZA 2ZKHL 3WFEL 3O3AB 4HIEB 4L8SC 1WWAX 4PB0H 2OYPA 4M9OA 5LBSH 2X05A 1BAFL 1ZMYA 1N3NA 3SDYL 5C0NC 1NGXA 4MQSB 1HHKB 1L0QA 5SWZA 4JPIB 3UJTL 2CLVA 2OP4L 1QSFB 5HHNB 2IAND 4ELMA 3HNTH 4PJHF 1OM3L 1WZLA 4Z76A 5FO9B 3RX8A 1IEHA 5CEZD 4G8GD 5HDQL 5JIIA 4O2EA 1A2YB 4XNZB 2J88H 4Y1AD 5FM5M 1D5XB 5EO9B 4GG6B 2P5ED 4GFTB 5F1NB 2XQBL 5GZNC 3M1BA 1CK0L 2BRQA 5AZ2L 5E0QA 5CZVH 3U4EA 2NTFA 4OZFA 1Y6KR 5EZIH 4W68A 1N2RA 3NZ8B 5DHVB 1WFUA 3B2VL 5DQJA 4K7FB 4ONFH 2YKLH 2LFGA 2DLTA 4MNGA 4U7KA 1KENH 1KGCD 4MLIA 4ZXBC 3H9SE 2R2BB 1IARB 1HNGA 5IB5A 3TJEH 3EJZC 4JY6B 2ZP0T 4XVSH 1D9KA 2HFEB 3D18A 5BVJB 2VSDA 1UCTA 5DJ0B 1WEJH 2AJVH 3VFGH 4NQVB 5BS0D 3GM8A 4Y1AA 3I3BA 5J57B 3DIFB 5L2KA 3L1OH 1U8HB 2LTQC 5D2LE 1H15A 3JBG7 3BJLA 1AQKH 1GH7A 1S7RB 4LGRB 1BVKA 3Q6FB 4P3CL 1FVEA 4Z18A 5DUMH 4JY4A 5E8EA 2KBGA 1WICA 2JCCF 4QGTA 3RVTD 1ZGLP 3MLZL 4CVZA 4X4YB 1MCDA 2D03L 2XTJD 1N7MH 4HGKC 2EO1A 4LU5L 3HR6A 2IF7A 4ESKA 5IBUB 2OR7A 4IRJC 4M6ML 1Q9WB 2CIKB 4R3SB 4S10A 2VC2L 4JJHA 3VXPB 4IDJL 4YXLH 4U1HB 3KWWA 3VGBA 3OKOB 3BT2L 4JR9H 3P11H 2DQDL 4OIIH 3OKEB 3BH9A 2FBOJ 3MLWH 3OB0H 4WI9A 2GCYA 4QY8B 3LHPH 2HT2C 3NCMA 4HKZB 1N64L 1XF4B 4M4RA 3DXAE 3TJHC 1EMTH 4G3YH 1Y18A 4UUJB 3OL2A 2ERJB 1MWAH 2I5YL 5J6HB 4WVRA 1P4IL 1BFVL 1PQZA 5E4IA 1S7WB 1JTOA 4G8IA 3JWDC 5J11B 4KRMB 1A6AB 3QH3B 2NY2C 2VYRE 5FKPA 2CXKA 3RUGB 3UTSA 3MYZA 2WW8A 5FGBC 4R9HA 1A2YA 5TQ2L 2DQIH 4OLZH 4XGZB 4K3DH 4NQCA 3T3PE 1Z3GH 4G8FB 4P23C 5LG1A 1E4XL 1DP0A 4OZFH 2NY5H 3PGCB 3STLA 4HJGA 2MHAB 3Q5OA 4GSDH 3ULVH 2HVJB 4Q6IC 5EUOF 1HQ4A 2FSEB 1QVOA 4M93B 2EDDA 1WIUA 4JVUA 3A0OA 1C5DB 3G6JA 5IUSA 4GKZB 4QHLA 4UTBL 3WFBL 1XH3A 3DX8B 3ZKMD 1T21B 2COQA 4URTB 5ADOH 3T0EE 3VE0B 3SKJL 2DIAA 2IQ9H 5D7LE 2YN5A 3QP3A 4ZNEA 1IAOB 5F6IC 1GVIA 1KV3A 3V7AG 1S7TB 3BPCA 2OI9B 1AR1D 4Y4HD 4U1MB 4YDKL 3RUGE 2G75B 4Z7WF 4X0KB 2MWCA 2C3VA 3U0WH 3AY4A 3CU1A 4P2QE 2Q20A 1UVQB 3IF1A 2Y07H 4RFOH 4Y4FB 4Y4KD 5IGXL 4G5ZL 4HWZA 1KELL 1WBZA 1PD6A 4P59H 4L9LA 3AY4C 3ARBD 1ZGLB 2IALA 1T3FB 1S78D 2NNAA 3G5XB 3FOLA 5AG8A 2YPKB 4ZFOA 2YC1B 5GGUA 3BXNA 4XPBL 4PRBB 5D6CB 1DUZA 2PO6A 4WHTB 3REVB 2MOVA 1WZ1H 2V7HB 4NNPL 3FZUC 4FQXA 5HJ3A 1EZVY 5F7YC 2X7LA 3SOBL 3GRWL 1N6UA 4MAUH 2XTJC 3O11B 1HDMB 4A6YL 4FZEL 5DD3H 4F7TB 5F9WC 1CLCA 1KFAH 5LKNA 1DQTA 1M7DB 3ARFD 5E2WL 1ORQB 3O6FB 4GRMB 3RDTD 4NKDA 1PW3A 4MQTB 4OJFL 1IGML 3UPAA 2E9WA 4LL9A 4LPTA 5DHYA 1BZ9A 2QQKH 3MFGB 4AMKH 5I74C 3RKPA 1K3ZA 3TJHD 1CFQA 2YA0A 3WNPA 4S0SD 2PXYD 1I7ZA 1W0VA 5IM7A 4GG8B 4DFIA 4I3SH 3IVKA 4K07A 4L9DA 5FB8B 3K4AA 2HJFA 4IMLA 1YPZA 1JGDB 5TE4L 2A9NL 2EDXA 3BAEL 3GSXA 2GEEA 2P24A 3RDTA 1HI6B 1BIHA 2ZWLT 2YMXL 3TT1L 5C07B 4IIQC 3RTQB 5DR5H 4CN1A 5CJBA 1CDGA 3O3DA 4V1DE 4JZOB 3NIFF 1G6RH 3WD5H 5IJVA 4AEHH 4LRIA 1TTFA 4I3RL 3NH7L 5LCVH 1TZIA 2GTZA 3ARYA 1Q9WA 1HE7A 4H20H 4YLQT 2AJUH 2UZIL 3X3FL 3ILPA 4L8CA 3P0GB 2FYYA 2CO6B 1ZS8B 3S37X 4LSVH 3BEVA 5JW5A 1RZFL 1X7QA 3F5WA 4OD2A 4PRHA 4X4ME 2B20A 1L7TH 2J1KA 4RGOH 1WCQA 4X6DE 3MRDB 3H3KA 4PLOB 2XZZA 4YFEA 4TSCH 4J6RL 4QCIB 1U91A 5EH1A 2A6KB 2DD8L 1KYOJ 4OGYH 3CH8A 1UZ8A 2WV3A 1WF5A 4XTRC 4FRWA 2P5EB 5KSAA 5FUCE 3VXMD 1M6OB 5JW5B 5D96C 3FQNB 3ZDXF 1RJCA 3SDXB 4OCYL 2OP4H 4MJIE 1QFWM 1DBJH 4ONHB 3N1PC 2GFBA 4RISH 1KPVB 3HMXH 4MXQC 4F2MB 1K5NB 2Y9RT 1TMCB 1S7SB 4G8EA 3I50L 3FQWA 4P46B 1JYVA 1J86A 2FEEI 5DJCB 1U6AL 4PB9H 1A6WL 2BOCA 4Y5YA 3UPCA 2F53D 3KPNB 4ORGB 3MRQB 3RVWC 3IDNA 5IVNA 4MCZB 1X9QA 1SEQH 3JSSA 1CTNA 1JF5A 4FQ2L 3QIWC 2F54E 3C60B 4IBLT 4JDTH 3QQ4B 4MWFB 2ENYA 1LK3L 3FQWB 1NANI 3NIDE 4UOW0 1IFHL 2VDOL 5ESAB 5LGHL 4GAGH 2E5EA 1VFOA 5FV1L 2DS4A 5KG9B 4EDWH 4XWOC 3X13B 2J3SA 3AS1A 4Q2ZA 3D1MC 1LE9B 2GIYA 4HLZG 3PHSA 3QZWA 4HEPG 5HYJD 3L9RB 1EFXA 3MJ7B 1NGXB 1NCCL 2C4XA 2F53A 4Z7UE 1DVFD 2Q76A 1XGRA 4HG4K 4HXBH 3ET9F 1PLGL 1IAIL 3VXMB 1A7PL <