3TJEL

Crystal structure of fas receptor extracellular domain in complex with fab e09
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSFNIGRYPVNWYQQLPGKAPKLLIYYNNLRFSGVSDRFSGSKSGTSASLAIRDLLSEDEADYYCSTWDDTLKGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab E09, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL01
5DGQA 5DMKB 4IRJB 5INDA 5GGVH 2OTUB 3OKOA 5F1IA 4OUOA 4CUCA 3P0VH 2FBOJ 3B43A 4JO3L 4PJ8D 4PY7A 4UDUB 5E8NA 4YGAB 4JO2H 1TLKA 3MGTB 1LO4L 4PV8A 2K9UA 4LCWE 2X4SB 1KPUB 3TIDA 3PQYB 3VXSD 1SBSH 1TNMA 4JE4B 1MFDL 3GUTB 2P8LA 4YXLL 4U6VH 5L9DL 3NCBB 5ICYB 4Z7OF 3WE6A 2D7PA 4JY6A 5HHVH 1E27B 4HLZH 4LHUB 5ENWA 4XNUL 2I07A 3PGDA 4Z77B 3T2OA 3KYMB 4Q0XL 4YPGA 5IB1A 1DBAL 4NJAL 4FZEH 3TF7C 3GSOA 3FN0L 5SWQB 2CDFB 4WFHE 4D9LL 2AS5M 1QSZA 4FZ8H 5J13C 5GRVK 1U8PA 1KBGH 4WV1C 1DQMH 2O61A 5K9OA 4NHCH 2X4RA 1IAII 3REWA 3NAAH 5I8OL 3I3DA 3V7MA 1GXEA 3R1GH 3VD5A 4WO4C 2EE9A 4M43H 3V6OA 5DDHA 4TTGA 1I3UA 4M1GL 2CIIA 4QLRA 3MV8D 1EAJA 1HIML 4LCCA 5ESVB 1MI5A 4GSDL 5C0DB 4FFVC 3ME0A 5T5FH 1IGTA 1T5WA 1KTDB 3G04A 4QRSB 5SX4I 1TMCB 3LVEA 1NC2D 2A83A 3SDDB 1I7TB 2FCBA 5DO2C 5C0JA 1LO0H 3H7BA 4NQEA 5EPMB 4OLEA 1R3JA 1EEQA 1I3RA 1ORQA 3VRIA 2AXFA 4Z76B 1YEKH 5I18L 3BRGC 5FYJD 4RDQG 4X6CE 1A6TB 4EOWH 4FHBD 1U8OB 1C08B 4OF7A 4KVCH 3L3DA 3FQUA 1W0VB 3VH8B 4HWBL 3FQNB 3KDMB 4OCWH 3MROB 4MJ2A 5KVGH 5CIPB 4NKOB 1G9NH 4G8FA 3LN9A 1QA9B 1KPRB 1DQLH 3L5WA 5LWYL 3KR3L 1WZMA 1OWRM 3MLUH 3GSWA 1NGPL 5IVXA 4H8WC 4W4NA 4JDTL 1SVCP 1A1OB 1DQDH 3KPSA 4YC2C 2QTEA 1S5HB 4K23H 2Z8SA 4PJEA 1UM5L 2I5YH 2VLRD 4RIRB 4KROC 3DI3B 4HUNB 5MENA 5IFAH 4OAWB 4ODWA 1WBZA 1CDYA 4PJCA 2VH5H 4X4XA 2C26A 5KVDH 1CD1A 1RURH 5CZKA 4GKSA 2DLIA 4IIQB 4N8CH 3RIFK 3IDIA 5IM7B 3NFSH 2BNQE 2KH2B 3PWLB 4ZOEA 5HHOA 1MIMH 2FSEB 2DL2A 3CFBA 3LQZA 2BSSA 4LU5H 2AJUL 2HJFA 3RDTC 5HDLA 3U79A 4LBEA 3N1QC 1DN2A 5JXAH 3QQ4B 2FEEI 5L88L 1JWMB 4YPJA 4RAHA 1DQTA 1SYSB 5GGTL 5LGHH 5C09A 4JR9L 4KRPC 5FGRA 3LKQB 3U36A 4LIQE 5EOCH 2Q86B 3TVMA 3O9WD 2XTJB 2FD6H 4HT1L 1QQDB 4J8RA 2YUXA 1KCVH 3ETBF 5A2JH 2P5ED 1IKNA 2VLLA 1P4LB 3O6LH 4PGDA 1A02N 3S35X 4ZUWA 4Y4FC 3K80A 1T6WA 3BEVB 4Q6IB 2PCPA 1A14H 4L9LB 1GYAA 1BVZA 2C7UB 3HAEH 4WUUE 1G6RB 4QT5A 5FO7B 4Y2DA 5EU7E 4DKDC 3ROOB 3RGVC 3AROA 4GBXD 2WNGA 4Y4KD 4ZFFA 5ICZA 4OV6F 2R2CA 5E1AB 1K4DB 1KN4L 2PYFA 3QWQB 2V2TA 5H94B 3T4YA 5DD1H 4KK9D 1ZWIB 1CLYL 4MJIB 1IC7L 3FB8B 1FO0B 4WEMB 3RL1A 3MJ7B 4H0IA 1MVFA 2V2XB 1S8DB 1Q0YH 2H6PB 4HS6A 3PWPE 2APTA 4W70A 4WJ5A 2ATPA 1TETH 5GGUA 3SPVA 2VERN 4HUVB 4LMQE 1EIBA 4N5UA 4UDTB 3VXMA 4DK3A 4MA7L 2IAMA 5EBWB 3ZT6A 4GMSL 3SE9L 5BMFH 3LD8B 1QFWH 2YSSB 5I19L 2HLAA 4U33A 4I2XB 4P2YA 1CBVH 3ARGB 5AWNL 3UTSE 1FDLH 1E6JH 1PW3A 4YDLB 1F13A 1NFIA 1Q9OA 3PWJB 4KXZI 4LRIA 4GUPB 1EAPA 1URLA 5CD5D 2XT1B 3IT8D 4M9PA 2ESVD 2UWEB 2VSDA 4O00A 4BH7B 1A7NL 1S7TA 4CVXB 5CJQH 4LEXH 5D7JC 3NFNB 3O45A 2P44B 4OCNC 1OB1B 3D9AH 1FN4A 2OCFD 4NT6A 3N1GC 3UTZA 3ZT5A 3JVGA 3VMNA 2V6HA 4Z7WE 3F5WB 1PKOA 4ZNEE 2GJZB 4U0RC 2EO9A 4J4PD 3RWHA 3SO3C 2BSRA 4HKJA 1JYWA 3C5ZB 5EIIA 2MHAA 1EEZA 1NCAH 2EDQA 3EOTL 5C0CE 1N2RA 1OGAA 3TM6A 1MWAL 5C0IA 3BXNB 3PL6D 3P4LA 2B5IC 2Q3ZA 1PVHA 4XXCA 1FHGA 1G7JA 1FNSL 1TZIA 3BEWB 1EBPA 1ROWA 1UCBL 4BFGA 2GW5A 4K7PH 2XTJD 2VLJB 1CXKA 4IOSD 4WI8A 5D93B 1GGUA 2Y25A 4NO2A 4PY8I 5T1DL 4CN1A 4XMKH 2ICWJ 1UC6A 4PJAE 2BY2A 4ZG1A 2VB5A 4QRRB 1GPOL 3EO0A 2X10A 4XCCH 2F8VA 2DQFA 4H25A 4YQXH 3H3PL 5C0FA 2YD3A 3QG6A 3E6HA 4TSCH 4MD0B 1NGXA 5I1KH 3IU3B 1E28B 3DROA 4UTBL 5KW9H 4L8SB 1G7HB 4NQCB 4I0PB 3SJVE 4J3UA 2W0FA 3ZTJG 3U7YH 3C5JA 3FQWB 3RVVD 4TNVF 4R7NB 3U0TB 4HS3B 5T3XD 4TPRL 5J4MA 3M45A 5D6CB 5DT1H 3ZKQD 3MV9B 2DTML 1VFOA 1INQB 2DQHH 4XNYH 2VQ1B 4PJXA 4YO0A 3GSNA 3OGOE 2W60A 4LLWA 2G60L 2J8HA 3VXUE 5D7LE 4NNYA 4YNYB 3N9GL 1TVHB 4X8JB 2YA1A 2XN9D 3QB7C 4UQ3A 1I1CA 3QG7H 1NDGA 3ZE1E 3CMGA 3S36L 2VQTA 3AAZA 4XCFL 5H35B 2EE3A 4UI2A 1XGYL 4ACPA 4F7MA 1GZPB 2MQ0A 4EUPG 1H5BA 2F58H 4PJDF 1RZ8A 4RMUA 3ULUF 4XC1H 1KJMA 4YBLB 1WWCA 3DHMA 3VFUB 3RVTD 3CSGA 3I84A 4X6FB 1L0XA 5JPNA 4NM4H 1R24A 4OLYH 5KS9F 1ZHNB 2VYRE 3CFIC 4PJGA 4V1DD 4JKKA 4G7VH 2AV7A 3N1MC 2EIBA 3ES6B 3TPUA 3VGHA 5D2LB 1D5ZA 3TNMB 2FR4B 1D5BA 2G5BA 3NZ8B 4JPWH 1S7VB 3JWOH 5DHVB 5SX5K 5T1LB 1UH3A 4X6EA 1JPTL 2AXJA 3RUGF 4PTUB 3IETB 4HLZG 2DM7A 3B6SA 4JPKL 2EE6A 4GRLB 3D69A 4AMKH 3WS3A 2VZ3A 1BJ1J 3P4NA 5GZNC 3DXAB 1KF9B 1PLGL 3IS1X 3GMMB 4O2EA 2X4UB 4M4PA 1FFNB 3ZDYF 4HK0B 3X13A 5CEZL 4GW1A 3A0OA 3MRQB 5FCSH 3BD3A 5EO9B 3EYVA 3CVIL 1EEUA 4NZRL 4LLQA 4EXPX 3SDYL 4P3DA 3KJ4C 4L9DA 1OGTA 2IPTH 3ARBD 5GS0C 1PKQE 3O8XD 2FH8A 4IOIA 2EDRA 3WL9B 4S0SD 1XGUB 2Z91A 4N0UE 2JKXA 4F2MB 4ZQKA 3PWVB 5JOFB 1MLBB 1EZVY 1UENA 3CDCA 5HYJA 1DBBL 3QDJA 5DJ6A 4NQSA 3C60C 3EUUA 5ISZD 5KBNC 4Z9KB 3NH7H 5DHXB 1WBYA 4JFEB 2FZ3A 5EZJA 1U92B 4BM7A 5GGRY 3HZMA 1Y18A 5F93C 3E8UH 4K2UL 1RJYB 2IGFL 2VITB 4LCYA 4NN7C 3JUZA 3MNVB 3VI4E 4DEPB 3DV6B 3O0RH 2DYPB 4RAUB 3BZFA 1FC1A 4MNQD 4OCRL 4P2OD 1DBMH 5FA3A 2ESVA 2DF3A 5IJVB 3T0DA 5AYUH 4C54A 3QDMD 2BHUA 5D7IF 4JRXA 3VXNA 3LDBC 4PRIE 1BAFL 1L9MA 3UMTA 2MCG1 2DDQL 3I6GA 3QULA 2H2PC 5JIIA 1FZKA 3V6BR 1AO7A 1FBIH 5FYJH 1G9MC 1C5DB 4WFFD 3WFCH 1IAIH 3X11B 3QXDA 1T22A 3QUXB 1MRFH 3FN9A 2JJSC 4JN2A 1B2WL 1NAML 4PJBE 2YD6A 2AEPH 3N50A 3GSNH 4TUKL 1J8HD 3T65B 1PZUB 4OGAC 2NZIA 3VI3E 2J3SA 5KOVC 1RFDL 1YN6B 3D5OF 1FL6B 1IZKA 4ZFOA 5J12C 4XB7A 2VAJA 5E8OB 1OTTC 2H32B 3QIWC 4Y1AE 1IZJA 3RKPA 3TH4T 1U3HB 1MCWW 1QHPA 1DEEA 3FB7A 4X6CF 4ZAKB 4MX7B 3C8HA 3KLAB 5SX4H 3GI9L 3F7QA 5J89A 4HQQH 4EUPB 5DK0B 3V7AE 3KNBA 3DX7A 1GGBL 3ILPA 2WQRA 3HZKB 2IBZY 5BOPA 1U36A 1BQHA 1IGCL 5JR1L 4KKLC 1CFSB 2HN7A 2QSCH 3BH8B 3GMQA 4NJ9L 4CRPA 2Q76B 1RZJC 3QCVH 2WM0A 1XCQA 2HMIC 3K81A 3EFDH 5HVHB 3MGOA 1IMHC 3CNKA 5DFTA 3CVHH 3SGDI 3ELAT 3DARA 4KKAC 4TVPH 4PPTA 3DI2B 3GZKA 1P7HL 1OOAA 2B4CH 3VRLE 2AKRB 2YC1A 4PLJD 4JRYD 4LKCA 4JG0L 2BVQB 1MJJB 1G7LB 5ITBH 5E2VL 4JZJC 4O9HL 4K3JL 5EN2B 3RWJB 1MCIA 4HAFA 1X6NA 5HVGB 4IHOB 4IS6A 2EEBA 4L4VB 3P11H 4HPYL 4KJPD 4Q7DA 5HD8D 1LEKA 2ADFL 1YEDA 3UTTB 1X3DA 5J3HC 1SJEB 4F9PA 1X7QB 3CSYB 4TSBL 5IEHA 3E3QC 4PJIB 3B5GA 1RZIA 3LQAH 4XNXH 1WICA 1ERNA 1DZBA 1PX4A 3MRRA 2WINB 1AIFA 2AJZA 5E9DB 1KN2H 2IJ0C 1YEFL 2GJ6B 2DQJL 3TO4B 1BWMA 1CDGA 5CKAA 1CXIA 3T1WA 3CCHB 4H88L 5F7MC 1CDHA 5H37H 4GT7A 4HGWA 4NNXB 5CAYB 3P77B 1G84A 1GGCL 2YRPA 3M8OL 4E41A 4XCYB 3RQ3A 5F21B 2M26A 1QBBA 1RUML 3OJ2C 4P3CL 2IC2A 4G8IB 5CBEA 4F7TA 1FLRL 5T33H 1VSCA 3BN9C 2NY3B 1HH9B 3C8KB 4ZOAA 3EDFA 4M1CD 3TA3B 1BPVA 4JJ5A 1G9ML 1CFVH 1LP9A 3FN3A 4QWWD 3RZWA 4YHML 1WAAA 1OLZA 1VKXA 3QRGH 1ZT1B 4KQ3H 4DZBA 3BH9A 3L3KA 4DZ8B 5B4MC 1K2DA 3QHZH 3D85A 4I77H 3QIUC 2YPKB 1ZXQA 4MNHB 1U8JA 1IGFH 4DUVA 3BMVA 3OKNB 3BIBX 5DWUL 5BZWB 3RA7L 2E6QA 1ITCA 4UB0L 4KDWA 2NX5D 1A6UH 2HRPH 2P43B 4YEEA 3BVNA 1L7TL 1JNLL 2A9MH 4GOSA 4HKBA 4S0TD 2PO6D 2PYEE 5HYQA 1JN6A 4ELME 3IDNA 1ZANH 3H2WA 4L4TB 1F4XL 2ICWI 1NGWB 1MUJB 1KEML 3VE0B 3QWOA 3BP7B 2R23B 4NYLB 1RZJL 2F5BH 3ARBA 3ROLB 3Q0HA 5DQJA 3PHOB 4JFPA 1BD2A 5EZIL 1U8QA 4DGYL 1CWVA 3RJDA 4XP6H 1ZHLA 4U3CA 2AJXH 5D96B 3TBTA 2XKNB 4IDLA 4JPIB 4MD5B 2YXMA 4NC1E 4WHYH 2WUBL 1FH5L 1T0MA 4XP1H 4QRPE 1HHHB 4Z7WF 4WI2A 4KDTA 5INDB 4NQTA 4JREB 3OKOB 2ZUSA 5F1IB 2HKHH 1KCRH 5GRJL 4XVTL 2GKIA 3SDCC 3K8MA 2D0HA 4PY7B 2P1YA 2QLVB 4U1LA 5E8NB 3PWNA 3EOYG 4HWBA 4PV8B 5C07D 3DUHA 2XXMB 1QR1A 1JWUA 5IT2L 3TIDB 4J3WA 1DQQA 3HN3A 2DQDH 4BQ8A 5SWZB 5TDNA 5C8JA 4PRPA 5BOZG 1UVQA 3EZJB 4RX4D 3LV3A 4H20H 4FFYL 1WJ3A 3QEQB 1YA5A 4JY6B 5C0RH 5ENWB 2I07B 3PGDB 4WW2A 3JSSA 4JFYA 5IB1B 4IRZH 1K3ZA 4HXBH 4CN6A 3KPPB 3FJTA 4PRDA 3TBVA 5CJBA 3HLAB 1U8PB 2O61B 1RUKH 1UGNA 5K9OB 3MZGB 2X4RB 2NY3D 4G9FA 1D7FA 4JPVL 3REWB 1OT1A 3D87B 5GSRA 3FMGL 2BJMH 3ARSA 3TA3D 2A1WL 4GAGH 4JZOA 2DQCH 4MLSA 3SE8H 1A1NA 2BVUA 3V2AR 2CIIB 3WXVH 4LCCB 3AB0B 4ZXBC 3O4LD 1U91A 3GIZL 5GGTA 1MI5B 1LGVA 4LLUA 1OCWL 1IGTB 1T5WB 3VDBA 4RFEA 4M7ZB 4M93C 3VXQB 3G04B 1PD6A 4JO3H 4ERSH 2A83B 2R2HB 5C0JB 5DSCA 3H7BB 4NQEB 1LO4H 5DHYB 1UKTA 1R3JB 1NBYA 1ORQB 4FN0A 2AXFB 4MD4A 3VRIB 1QP1A 1JZ5A 1Y6MR 4G6FD 2UY7A 4M7LT 5J57B 1MFDH 3G5ZA 3A67L 1OSPL 4KI1A 5L9DH 1F3DJ 3L3DB 3FQUB 4MVBD 4P2QE 4F37K 2MQ3A 4WO4A 4XNUH 2NY4D 2AAVA 4J6RL 4G8FB 4NJAH 3EHBD 4NRYA 3ULUL 3FN0H 5I1LA 3L5WB 4D9LH 3CH1A 1A9BB 2HTLC 4M6NL 4KQ4L 5T5NF 4ZDHA 3GSWB 3VRJB 5IVXB 5B38A 3UPCA 3IFPA 1I7UB 2EC9U 1XF5A 2PF6A 5EC2A 1IM9B 4ZUSA 2A74A 4EN3C 5I8OH 2AJVL 3KPSB 5I1CL 2YR3A 3AS0A 3PGCA 4PJEB 3Q5OA 2Z92B 5KVMC 5MENB 4ODWB 1J7VR 1QFOA 1WBZB 2G2RA 4PJCB 1CF8L 1HIMH 4X4XB 5B3NA 2YN5A 1ZTXL 1CD1B 3U1SH 4KRNA 4GKSB 4JKLA 1MNUL 1BBJB 4GSDH 4L3ED 3G6DL 5CCKL 1OAKL 1KSRA 3IDIB 4MJ6A 4NKQB 3H9SA 5HHOB 3HMXA 3GMPA 2BSSB 4XVSL 1FZOA 2HJFB 4LGRB 5JQHC 2FNBA 3C6SA 2YPLD 3HUJE 4LBEB 2K7QA 2H8PA 3WLWD 5I18H 3L9RA 5C09B 3U36B 3IU4H 5JW5B 3TVMB 3O4OC 2CPCA 1Y6NR 3Q3GA 1J10A 3IFNL 4NN5B 4W4OC 5DD0L 4J8RB 1AJ7H 3KHQA 4G8GD 4R2GC 5E8EA 1CICC 4LARL 2VLLB 2XICA 4PGDB 3K4AA 3MRBA 4KUZL 4ZUWB 4WU7A 3FHAA 2PCPB 2GAZA 5F7HA 5IP4A 3O6FB 5CSZA 4R0LA 4XP4L 5E4EC 5EU6E 2FX7L 3IDYB 3ZSTA 5LWYH 3KR3H 4Y2DB 5FO9A 1MWAA 3BIAX 1NGPH 3BDYL 2W38A 5CGMA 2NY0C 2R2BA 5AZ2L 1KEGH 3G5VB 4ZFFB 5ID0A 1K8DA 3SE4A 2PYFB 5E8DL 2V2TB 3T4YB 1N7ML 5F7WC 3RDTA 3RNQA 1A21A 4X7DC 1SEBA 3RL1B 4YR6A 3ZZ1A 3K74B 3VI4F 2OTWA 1CT8A 3CLEL 4HS6B 4WJ5B 2ATPB 3HPLA 1ZKAA 5CUSL 3SPVB 3Q5TA 3L3OA 3VXMB 4PJ5B 1G0XA 5EU7C 1FNFA 2J1KA 2EECA 3BD5A 4Y4FA 4X83A 2AJUH 4U1JA 3P2TA 4Z7QE 4KUCF 1TITA 2HLAB 2EO1A 4K94C 5L88H 1RUQL 1NFIB 1Q9OB 3HC3L 5GGTH 4TQEH 1JVKA 1EAPB 1ZLUH 3RGVA 4KTYA 4AM0A 4QYOA 4HT1H 4OZIF 2ZUQB 4Z0BL 1S7TB 3QPQD 5GS0D 1KIRB 4XPFL 3BKJL 4C83A 3VI3F 3O45B 5J6HA 1IM9D 3V0VA 3LEYL 2WWMC 4NBXB 5J8OA 5ILTH 1FN4B 1AQKL 4NT6B 4YX2H 1LE9A 4WEBL 2BNRE 3UTZB 2NXZC 4NO5A 1IQWL 1BMGA 3FFCE 3C2SA 1FV1A 2PKDA 2VIRA 1KN4H 5K93A 3RWHB 1FORL 2X4OA 5D5ME 5EIIB 1UH4A 2MHAB 1EEZB 3CFCL 1N2RB 1OGAB 5L2KD 5C0IB 1X6LA 5KSVA 2HJKA 1LO3H 4MQXC 1P4BL 1G7JB 3P9LA 2CLVA 5FUZL 1MPAL 4HKZA 1JZ2A 5H37G 2OR7A 4MA7H 2DMBA 4GMSH 3SE9H 5D7JA 3DMMB 2F8OA 5I19H 4XAKD 3VRLF 5AWNH 2OS7A 5CLTA 2CR6A 4NFCA 2ENYA 3RHWF 4WFGE 4NO2B 1ZVHA 4OZHE 3SGDH 3O6FD 1AR1D 1MRCL 1FVDB 4JG1H 2PETA 3D1MC 3HMXH 1A7NH 2DQFB 2NXYD 4H25B 1OPGL 5C0FB 1RUAL 4K7FA 1N4XL 1WK0A 3E6HB 1AY1H 1NGXB 1S7XA 1QBAA 1DLFL 3DROB 3LN4B 3QIWD 3B9AA 2WWKT 3MRLA 4H8WH 1FNLA 5C0BA 2W0FB 3L95B 2NYYC 3C5JB 3GM8A 2VDQL 1F00I 1S7SA 4HEPG 3PE9A 4LIQL 5I1IL 2BY3A 4HCRL 3KJ6H 1A4JA 4WHTA 5E00A 3SGKC 4OM1L 2FRGP 4XB8A 4FFZL 3DPBA 5EO0B 2QADD 4PJ5D 1YMMA 2YD9A 1IC5H 1B9ZA 3OR6A 1JGDA 4PJXB 4CNIA 3GSNB 3D25A 1MWAH 2W60B 3JTTA 4LLWB 3NACL 4RNRA 3EAKA 1FNSH 3QCUL 1KELL 3FAWA 4KJQC 4DCQA 4JVWA 1SEQH 1JNJA 5F3BA 2HWZL 1UCBH 4UQ3B 4P46D 1NMCB 1NDGB 4Z7VA 4X4YA 3AAZB 1P6FA 3ARYA 3QI9C 3QR2A 1I9EA 4F7MB 2E6PA 1UJTA 2ITDB 1H5BB 2YD5A 4WHYG 2W9LA 3ESUF 4HWUA 5T1DH 1KJMB 4ONFL 3SDXA 1YJDL 1BQHG 1RZGB 4NBYB 5JPNB 4XT1C 1GPOH 1P84J 2DJUA 4HSQA 4YHLH 5J3HD 3H3PH 4WIQA 3UBXI 4PJGB 3DWTA 4PJ9C 2AV7B 4HWEL 4UTBH 3TPUB 2XRAL 1HOCA 4TTDC 1D5ZB 5T3ZD 2G5BB 5JORA 3WHE0 5BRZE 4XPBL 2CRMA 4OI9A 1T20A 4X6EB 4I3GA 4HZLB 3BRFA 3N85L 1YECL 2AJYL 2F54D 4PRHD 2J5LC 3B6SB 2DTMH 1NAMA 1V7ML 5LG1A 3WS3B 4LLYA 5DC9B 3TNNA 1CG9A 3AREA 3P4NB 25C8L 4JDZB 2NZ9C 2G60H 4O2EB 4NO0A 5DVKA 2YOCA 3X13B 2VDLL 4GW1B 4I0KA 4MB3A 2Y9RT 3DO7A 3TO2A 1FYTE 4C56A 2NTSP 4LLQB 3IJHA 3S36H 4P3DB 2WP3T 4JN1L 1OGTB 2D7TH 1XGYH 3BPOB 2ARWA 1WBXA 4IRSD 4IOIB 3DUUA 1K85A 1X4YA 2Z91B 5H2BA 5EA0H 4YHZL 1J8KA 3QIUD 3OKYA 1RHHA 4ZQKB 2VDOL 5FEBA 1Q0XL 5HYJB 4K9EC 1HXYA 3QDJB 5DJ6B 4NQSB 5D1QD 3AY4C 4FTVE 4NWUL 3DX8A 4LPWA 3LRGA 1WBYB 2FZ3B 5EZJB 5HY9A 3JTSA 2R1YA 4OF3A 3KPLA 5KSBE 1Y18B 5CEXA 2CLZA 1NDMA 4GG6E 4RGOL 1F3JA 4BQCA 3BZFB 1S7UA 3FT3A 4PUBL 1J0JA 3VXRA 2QSTA 2EDKA 2PW1A 4KKCD 3VXNB 5A3ID 2B39A 4BUHA 4CBPA 1CLZL 1KB9K 3I6GB 5JPMA 1GZQA 3FL7A 1FZKB 5DMJB 1PLGH 1AO7B 5LCVL 5IK3B 5HPOA 1UJ3C 1XMWA 5E2WL 4XBEL 3H7LA 1F2XK 5CEZH 4UT7L 3C60A 1KACB 2G9HA 1T22B 4FRWA 1OARL 3FO2A 3RIFF 4JN2B 3CVIH 4IJ3B 4NZRH 5TQ2L 1NJ9A 2GT9B 3SDYH 1D6VL 5I1AA 3ARTA 4C58B 4MLIA 4AJ0A 3C2AL 4ZFOB 3E2HB 1DBBH 1DEEB 4XMLL 2PTTA 3FB7B 4U1KA 5FYLL 1UM4L 2R56L 3CUPA 3KNBB 4OLVL 3DX7B 3ILPB 4XP5L 1BQHB 4K2UH 4XPTL 1C12A 2IGFH 2FJHA 2HN7B 3GMQB 3KXFA 3OR7A 1XCQB 4PRNA 3CD4A 4OCRH 5SV3A 5IB5A 2JJSA 2VZSA 1VFBA 3MLWL 3MGOB 4LCWD 3OQ3B 1BAFH 3GKWH 3JBG7 3PHQA 4DN4L 2NQCA 1TTUA 2DM3A 5BO1L 4LKCB 1SJXA 5LGKA 2DJSA 5F70A 1CLOL 1CL7L 4HUMB 1UYWL 2RGSA 1B2WH 1NAMH 4IS6B 5HI5C 1RIVH 4WFHD 1H3UA 1LEKB 3LZFH 3TZVD 3QFJA 4TUKH 1YEDB 4LOUC 1HSAB 1AR2A 4YDIH 5IEHB 2VO5A 1RFDH 1BVKB 4JQVC 3RNKA 3FRPA 1NFDE 1CDJA 3MYZA 4K9EL 3ALPA 2EKSA 1S9YA 2YS4A 1RZIB 1F42A 1CD0A 5GHWL 2EDJA 2GIYA 2VE6A 4OD3H 1U42A 1MCCA 3MRRB 1IGIL 3BGFB 3BZ4A 2AJZB 3PXJA 4J3TA 1GC1C 4MXWH 5C0GB 1GGBH 3V9FA 4APQD 3B9KC 1J0YA 4HGWB 5L0QC 3KLHD 1IGCH 5CILL 5JR1H 4QOKD 4NJ9H 3L1OL 4E41B 3IVKA 2AEIT 2LABA 4JQXC 4JZJA 3VFNB 5CD3A 3MO1A 5E70A 5HVFB 4F7TB 3KHOA 1IE5A 3ZHLA 3VD3A 1H3WM 2Q3AA 3BZDA 1A4KA 1JHTA 3ZHKA 4DUWA 1AFVL 4JJ5B 2Z93A 3HE7D 3EIFA 2F53D 5F7KC 1EO7A 4JHWL 1VKXB 4JG0H 5JOPD 4DZBB 1MHHB 4XVUD 1I8MA 1K2DB 2OLDA 5BJTB 5HI3C 4P5MA 5E2VH 5FK9A 4RAVA 4K3JH 3D85B 3IGAB 2Z8WC 5GS0H 5H8DA 1U8JB 2GSGA 1DEDA 5F9WB 2ED7A 3U0PA 1D3CA 1F58L 5DJYA 4OFVA 2APWA 2XWBA 3O2DL 5B38G 3SN6N 4CU7A 4QHKJ 1QSFE 3BVNB 2FJFB 2FYYA 4HKBB 2XNAA 3WYRA 2NY6D 1PDKA 2AJSL 1JN6B 5HYQB 1DANU 3IDNB 4OFYD 2FL5A 4G6AC 1UQSA 1YEFH 2DQJH 4OKVA 5FM5M 1A6AA 2VUOA 2ZPKL 1SMOA 3DYOA 4RGNB 1CICD 4E0RB 3QWOB 4FQIL 2DQIL 1RK0A 3QQ9C 1ZLUK 1ZA3A 2X1PA 4DVRL 1GGCH 1A3LL 1CE1H 2ZNXA 2R8SL 3W0WA 4I9WD 4JM4H 5DQJB 4JFPB 3M8OH 1BD2B 5CZVL 3S35L 1JFQL 1ZHLB 4PJHA 1RVFH 5C08E 5DRWA 3TBTB 3T0ED 5A43C 4OF8A 4P3CH 3U7AA 4DTGH 4Y2OA 5J1AA 1DCLA 3DETC 1GSMA 1T0MB 4LAQL 2Q87A 2F15A 5IVOA 1QYGL 4QF1A 3CU1A 3V52L 1G9MH 5E5MA 2Q6WA 3FOLA 4N8PA 4Y4HC 3OGCA 2E7HA 3WHXA 4S1QL 1QR1B 4XVJH 1JWUB 2WV3A 4FQ1L 5JMOC 4QGYA 1DQQB 4PJDA 4WUUD 4UUJA 1XGTA 5TDNB 5C8JB 5GS1C 4PRPB 1UVQB 3G5YA 3DSNA 5BW7C 5F8RC 5DWUH 3LV3B 4NC1C 4XAWL 3RA7H 4CMHB 5JXED 4UB0H 3TJHD 5KS9A 2D9CA 5BV7C 3JV4A 4G6KL 2IANB 4WW2B 1JNLH 2NW2B 4JFYB 4WTXA 1GC1L 5F9DC 3WFEL 1KXQE 3NPSC 1Z5LA 3PV6A 1TZHA 4OZHF 4P99A 4HG4J 5IESH 4PRDB 3TBVB 1XF1A 1KEMH 4YK4B 2NY2D 3SDCA 3W11D 3PGFL 1S7RB 4G9FB 4ZO6A 1RZJH 3QP3A 1CFQA 2FATH 3RUGA 2HT2D 5GSRB 4M62L 4JGUA 5EZIH 4DAGL 3J7HA 3WXWL 4JZOB 4UILL 3DGGA 5FHAL 1A1NB 1JPST 4HK3N 4JFDE 5ALBL 4OQTL 5I66A 2WUBH 5CP3A 4O51A 2BVPA 4F80A 5ANME 1U91B 3DUSA 3MXWL 4LLUB 5GRJH 4WI5A 1VFMA 4XVTH 1MSPA 4RFEB 2IH1B 4XBGA 2QV2A 1MH5A 1RJLA 3PP4L 1NEUA 1L4IA 1H8NA 1K5NB 2BXYA 1EO5A 5E6ZA 1T7WA 5DSCB 1G1CA 2E7LC 4TRPL 1NBYB 4MD4B 5IT2H 1NBZA 5JHLL 3QUYC 5J13B 1DN0B 5KZCB 1E4WH 3G5ZB 4FQLL 4R4FH 3IB4A 3VXSE 2P46B 4I18C 4AIZA 1XGRA 2EXYD 5T3ZH 2DS4A 4WO4B 1E0OB 1IM3A 4DUXA 1TFHA 3CX2A 3W82A 1VB9A 1TTGA 4NRYB 3W2DL 4P4KD 5C0CD 2X1XR 1TIUA 2R0LL 4ZXBA 4ZDHB 3RBGA 2OR9H 3RY5A 2FLRT 5B38B 1J1XL 3IFPB 1XF5B 5EC2B 4JPVH 4ZUSB 1XT5A 2A74B 3FMGH 4Y5XC 4PGCB 4ESKA 2CDGA 1YEHH 3CFDA 1ZS8A 2APBA 1S9XA 1LVEA 3MRHA 2G2RB 1IRAY 1QBLL 4UTAL 1OF2A 1U6AH 3DYMA 5TFSL 3MV8E 1MCEA 2JK5B 1OCWH 3L3GA 1MIEL 4MJ6B 1M7XA 3F6LA 3VG0L 2Z31A 1K6QL 3H9SB 2AK4D 2VXTH 3NTCL 3GMPB 1FZOB 5EU3A 1QOKA 3C6SB 3D3VE 4WEUD 4MS8C 5GJTH 2H8PB 4U1GC 5T1KA 4Z7UE 2IAND 1FSKB 3L9RB 2HT4C 1QZ1A 1WF5A 4KK8D 1OSPH 3Q3GB 2CXGA 5BV7L 2FB4L 5F7UA 1P1ZB 4EN3A 4X6CA 5E8EB 1F4WL 3QI9D 5E94A 4YC2B 1SJHA 4KROB 4U6HA 1U95A 3T1FA 5ADPH 3MRBB 4WU7B 4J6RH 5CSZB 4YHIA 4R0LB 2DLHA 3HCVA 4M6NH 4Y16C 5FO9B 1MWAB 1XIWD 5JDSA 2BSTA 2ARJA 2R2BB 3GBML 4XI5C 1DJSA 4OIBA 5KVFL 3D2UD 5ID0B 1K8DB 4R9HA 4AG4L 1NGZA 1CL7I 3RDTB 3I02B 5I1CH 1H3TA 4XTRC 4YHKL 3RNQB 5KSBF 5I2IA 2EDYA 2X89D 5ACZA 1SEBB 5CS7A 4GG6F 1CS6A 4YR6B 2OTWB 4GKNA 1CT8B 5HVWA 1CF8H 4KRPB 4LEOA 4MDIA 1Y6KR 1F3DH 1ZTXH 5TDOA 3HPLB 4LPYA 1MNUH 4W4OA 3SKMA 3IKKA 4LLMA 1CXHA 5CCKH 3L3OB 4X4ME 4JKMA 5FGSA 3MBEC 1JYVA 2E8ZA 4Y4FB 4IDJL 4XVSH 2OMBA 3O2VL 4U1JB 3KPRD 4HXAL 2NZ9D 2EIEA 2BNQA 2EIZA 4UQ2A 5CP3H 1BQSA 3MOAL 3P0YH 4OT1L 1J88A 2B7DT 4M8QA 2OXHA 3RGVB 4UU9A 1OD7A 2EYRA 5IBLC 4AM0B 4QYOB 4AIXA 4J12A 1WC7B 2HFGL 3QRFM 3IFNH 5DD0H 2F74B 4LLAA 3K4ZA 4YWGL 4GAJL 3U4EA 3FO0L 4LARH 3BFOA 4HCRA 5ESQA 5HGHA 1P2CB 5IQ7L 2NY7L 4C83B 3ORJA 5E95B 4KUZH 2P5EE 5J6HB 4I1NB 4N68A 1S9VA 4XP4H 1LE9B 2Z35A 5EOTA 1FZJA 3NCJL 5IB4A 4NO5B 3BDYH 1N0XH 4ZSOA 5AZ2H 1GAFL 2ZSWA 5C0ND 1FV1B 3NIDE 2VIRB 1KYOK 4P9ML 5E8DH 4ZTPL 1N7MH 4HFWA 2XIDA 2PXYD 2X4OB 4CAGA 1QFWM 3NOIA 4XHJD 3MUY1 2OK0H 3ISWA 4G42A 2VLKD 3K2MC 4O2FA 2X42A 2HT3C 5KSVB 1FJ1A 2HJKB 3BSZH 2EICA 2BFVL 2FO1A 4HKZB 2IFGA 4PRAB 3PWPA 1OAZL 5DQDL 2CK0L 2MWCA 1F45A 5E5UB 5D7JB 1BQUA 4F8QA 3EYSL 1EGJH 3WFBH 5TF1H 3L7EA 4HPOH 1LEIA 1PSKL 1RUQH 1FNEA 4L5FL 4WVRA 1KJ2L 4P5TB 3HC3H 5FKPA 3UJTH 4OLWH 3UTSA 2FGZA 4KC3B 1MJUL 4U0RB 2GI7A 3EYFA 2EH7H 1ZLVH 1TXKA 4HBCL 4XPFH 2FECL 4K7FB 4BFEA 1SYVB 5TGBB 1M71A 1T2JA 1S7XB 3LEYH 4YBHA 2HTKD 4PRID 3MODH 1AQKH 3MRLB 4WEBH 4P57A 3ARDC 5C0BB 1X5ZA 5CJ5A 1MOEA 4E42A 5JOEA 1MY5A 1S7SB 3TCLA 2ZOLA 5E00B 1NMAH 3MQIA 1FORH 3QWRD 4Z7WA 2N1KA 3VDAA 4ZNEA 1YMMB 3FB5A 3CFCH 3OR6B 1V05A 1Q38A 4CNIB 3D25B 3JTTB 1YQ2A 3K1DA 3TN0C 2EH8L 5HJ3A 5HDQH 4RNRB 5D9SA 5AYQA 5D1XC 1JPGB 5FUZH 1MPAH 4UINL 4DCQB 4JVUA 4G7YL 5F3BB 4HIHA 5DMIL 1MCQA 4Z7VB 2ZCLH 3QCTL 1EHXA 3C09B 2VMFA 2XTJE 4LPCA 1Q94B 2X9WA 2A77H 2X41A 1YUHA 4EBQL 4BQBA 3IXTA 3SDXB 5IJKC 1JPSL 1MRCH 2NY1C 2VN4A 3NN8A 3SGKA 4RMSA 5AG8A 5I8KH 2JJVA 2W92A 1WWAX 5E56A 1RUAH 3NBNA 1N4XH 5E24E 4MDJA 5KJRL 1J9CT 1DLFH 4AEHL 4NQDB 3F58L 1NUDA 2XXCB 1YEEH 5JORB 2A9NL 2BC4B 1T20B 4LIQH 5I1IH 3SJVA 4HCRH 5I8CB 2NTFA 3RU8H 5FA4A 3R06B 1EUTA 3QIBD 2CRYA 4FFZH 5GGRA 5T3XE 4X8XA 1NAMB 1EDQA 2X4QA 3CMOL 3JWDC 4WGWB 4JFOA 3TNNB 3VJ6A 1CG9B 2FWOA 1FFRA 3AREB 4XXDA 1BEYH 4UNVA 3QO1A 1IL1B 3RTQD 3WIIH 3WMSA 4K8RD 3QCUH 4KY1L 5HI4C 3BP6A 3FRPG 3VXUA 3X12A 3DO7B 5D7LA 4WI7A 2D4FA 3TO2B 4K94H 4C56B 5HHMB 1FAIL 2XN9E 3VWKD 3B2VH 4PJ9A 3IJHB 4LQ1A 2LU4A 1WBXB 4UV7L 3DUUB 2X89A 3IAQA 3WS6A 5H2BB 4ZS6C 4ONFH 5D72H 1YJDH 1RHHB 3LH2L 2OP4L 3GEWB 1MFAL 4X80H 3BPCA 2Y5TB 2YPVH 4PGZA 2V5YA 1WEJH 4LQFL 1BFSA 1EPFA 3DX8B 1ZV5A 3IKCA 1JMZA 3JTSB 2R1YB 5GJSL 3KPLB 3S4SA 2V5RA 1N8ZB 3DX6A 4HWEH 4V1DE 4D0DA 3VWJD 2XRAH 3MRKA 2R4RL 5CEXB 2CLZB 1HYSC 2COQA 1UEYA 2WBJD 3HG1D 3O81A 5DUPL 4XPBH 2QQKL 2DBLL 1F3JB 4G6AD 1AXTL 4G80A 3PWUB 4ZO7A 2E27L 1FRGL 3O6KL 2BVOA 3W9DA 1S7UB 3N85H 4M7LH 3FT3B 4OGYH 2RFXA 1YECH 2AJYH 2FX9H 3VXRB 2PW1B 3KJ4B 2F5AL 4R3SA 4UOW1 1V7MH 2BSED 4AEIH 5CWSA 3WNNA 2NR6D 1UZ6E 5JPMB 2CGRL 4UBDC 1GZQB 1YY9C 4MAYD 2DAVA 1DLHA 1FVCA 3HHRB 1BFOA 1I8IB 2VQUA 5CZXD 3C60B 3AY4A 2G9HB 4CMMA 3FO2B 3FQTA 4G6ML 4JFQA 1NJ9B 2OX5A 2HFTA 1LDPH 1I1FA 4JN1H 4JCMA 2UZIL 5I1AB 4HF5L 3BKCL 4NN7B 4FQHA 3O2WH 2ZUVA 1FPTL 1PKQA 4NQDD 4H5SA 4R96B 5F7EL 2VDOH 1Q0XH 5D1ZD 2Z8VC 2GHWB 2PTTB 4N0UA 4U1KB 1T2XA 3LDBB 4NQCE 3G6JE 3CUPB 1ZVSA 3UPRA 2EDHA 3DJ9A 3OF6D 2NLJA 1C12B 1T4KA 1UJ3A 2CRZA 3QNYA 2FJHB 3KXFB 4RGOH 2ZUTA 5GGVL 2X1QA 2DQUH 3MV9E 4WI3A 4LSSL 3OR7B 4CN4A 4PRNB 5IB5B 2V7HA 1IAIM 1CXEA 1K8IB 3G6AA 5D2NC 3F7VA 4JO2L 3JWDL 1EFXD 3QDME 4CW1A 4G3YL 5J12B 4QHNA 5LCVH 4J3OC 5JTWA 1TZGL 4U6VL 3O2DA 5E99L 4XBEH 2E7MA 1S9KC 1FQ9C 4UT7H 1HDMA 2SEBA 1VA9A 4WFFE 3PHSA 1JGLH 1ZLSL 1N5YL 4FQQA 3QFJB 3EYQC 3X3GL 3P3YA 1D6VH 3B9EA 4ODTL 4FZ8L 1A6VL 3RNKB 4TNVK 4J3SA 1J8HE 2BDNH 1E6OL 4RGMC 4HS8L 3QUYD 1F4AA 2LAGB 2VLMD 5EOQL 2VAAA 4Z7UF 1R0AL 2VE6B 3GI8H 4M48H 5EORL 4Y1AA 4S1SL 5EU4A 1C7TA 1CZ8L 1K4CA 1UM4H 1QSED 2VL4A 4M43L 3FO1A 5MEPA 4BKLB 3RY6C 3CX5J 4HD9A 4XP5H 4M9OA 1T0PB 2E9WA 1DVFC 4OTXL 4JM2C 3IVKB 3REVA 1J12A 3LRSA 4JZJB 5T5FL 5CD3B 3MO1B 5AZEL 3RBSA 2JB5L 3MLWH 2BERA 3VFRA 1IGML 2UVEA 1LO0L 4Y19D 5HGAA 1GH7A 2R0ZL 5EWIL 4P23C 1A4KB 1JHTB 5IG7A 1YEKL 2W07A 4JQVA 4DN4H 4YXHL 2BK8A 5BO1H 4P2QD 2FECI 3ZKNC 3CK0L 1L6ZA 5FUCE 1IFHL 4NC0B 1I8MB 4KVCL 4P5MB 3P4MA 5FK9B 4ZUVA 2D7MA 4JRYE 4ZD3L 1CD9B 3WV0A 2UZYB 1CL7H 1UYWH 1FE8H 2LVCA 1GHFL 2X4TB 4IBLT 1SM3H 4OCWL 5KVGL 2BCKA 1HINH 2DI8A 2GSGB 3U0PB 3ULVD 1VPOL 3B9KA 4XX1E 4NQUA 1WISA 5DJYB 1DQLL 1JUFA 5E8PB 3BJLA 3RX8A 4K9EH 2FLBT 4JQXA 3KVQA 1JIBA 1T1WA 1OW0C 1F90L 2FYYB 5EOCJ 4JFEE 2XNAB 3I50L 3MLSL 3MJ8B 1DQDL 1IGIH 5IGXL 1UQSB 5JHDD 4OQTA 1JP5A 5IFAL 3UBXB 3BISA 3UZVB 4OLZL 1RK0B 5EBGA 1P5UA 2XQYG 3E0GA 1ZA3B 3T77A 4L8DA 3QQNA 4ETQA 3W0WB 4BQ9A 1RIHL 4OIAA 2BY0A 5D6DC 4LFHD 3EOAA 3HC4H 4QXTA 5DRWB 4QRTA 1MIML 3ILQC 2ERJC 5J1AB 3N0PB 4LU5L 1MAJA 2LV4A 1T21A 3ZKMD 3NIDF 1U2HA 1NBVL 4XTRD 2UZXB 2IMNA 5E5MB 2Q6WB 1VFAA 3FOLB 3MV7D 3EKCA 3EJZD 4JHWH 5EOCL 3OGCB 32C2A 4KI5D 4F8TA 2ZKHH 3WHXB 3VXOA 1P9MC 4QO1A 1BJMA 2GFBA 1OL0A 1P4IH 5JZ7C 4PJDB 2AK1H 4GKZB 4YDJA 4UUJB 3MUGA 1XGTB 3MBED 3RZCC 1OAUL 3G5YB 2CSPA 1F58H 1J87A 3U7WL 3O2DH 3WN5C 5KS9B 3S9DB 4ZOCA 2GUOB 3RVUC 3B8YA 3JV4B 2R0KL 5KSAC 4KMTL 3SDAC 4PP1C 2NX5E 1TZHB 2UYLA 4R26L 4PP2A 1JE6A 3HNVL 5DD1L 4QRUA 3T0XA 2ZPKH 4UIKL 2PYEA 1MCFA 2AXHA 3S8WA 4FQIH 2DQIH 4AYFA 5FYKD 2JCCE 3SDCB 2XQYK 4Y4HA 1CFQB 3FT4A 5IHLB 3RUGB 1A3LH 2R8SH 1DSFL 2ADJA 4MXVE 5CZVH 4EQ2A 5LGJA 4F33A 1JFQH 1TPXC 3DGGB 5C7XL 1F2QA 5FDYA 2R15A 1WV7T 1ZLVK 5BMFL 5HHNB 5I66B 5HGDA 5GS1A 4LAQH 3QFDA 2BVPB 2YXFA 4O51B 1CDBA 2O5YL 5BW7A 3DBXA 1FDLL 3DUSB 2YD2A 4I0CC 3V52H 1KGCD 2A2QT 4XBGB 4QRPA 1MH5B 2KKQA 1RJLB 2J88L 2DD8H 4JQIL 5KVEL 4FQXC 4L4VE 5IHBA 3UTTE 1G7MA 5HDBE 4FQ1H 1NBZB 4LVNC 3MRIA 1KT2A 4WWKD 1TQBC 2GTZA 4UMGA 2I25N 4XAWH 4AIZB 3FFCD 4N0YL 1XGRB 4QXUL 2Z4QB 1IM3B 2GJ6E 1FNGA 1S9WA 5DLMH 1GC1H 1QRND 2D31A 5F3HA 3M17A 4YHOH 4ZXBB 5CGYC 1WIPA 4G8EA 3RWGA 3BQUC 4PJ8C 2DB8A 1NC4B 4RMWA 4M93B 2YUWA 2IBGA 1J0HA 2R39A 1HH6A 3CFDB 5D7IB 1ZS8B 1DUYA 1B0GA 1BZQK 3WBDA 2E7LA 3WXWH 3ARDD 3I6LD 2YZ1A 1S9XB 1KC5L 5FHAH 3D39D 1SY6L 3MX0A 3MRHB 4OQTH 3BE1L 4UAOB 2H41A 3U83A 2WAHA 2XTLA 4OD1H 4I18A 3TT1L 1MY7A 1OF2B 3UDWC 2V5SA 3MXWH 3QJFA 3V5DA 3O4LE 3PXHA 1MHCA 2Z31B 3PP4H 4FQJH 4QCIB 3MA7A 1OVZA 3TBWA 2VR4A 3RWCA 4HMEA 1R5WA 4TRPH 1NCUA 4OI7A 1FGNL 5DTFA 5T1KB 8FABB 5JHLH 1JV5A 4M3KB 4O58L 1AKJD 4TSCL 2W91A 5I1KL 3PUCA 5F6HJ 1WCBA 2EDDA 3LPFA 3MV11 4OQ1A 4PLNC 5KW9L 1UB5A 2GTWA 4EN3B 2R0WH 4X6CB 4Y5XA 3U7YL 3T0WA 4JHZA 3MMEA 1SJHB 3G08A 2EDTA 4MA3A 4U6HB 2CRIA 1U95B 3S37X 3T1FB 3CAFA 1KLGA 2VDRL 3OKLA 2XG5A 4YHIB 1M7IA 2XA8H 5DT1L 3RPKA 2WWKO 1IKFL 4C55A 3ZYIA 5J11C 2VRAA 2NY1D 2O5XL 2DWEA 3HCVB 4U7SA 3X14A 1X5AA 2DQHL 5JDSB 4XNYL 2ED9A 1J1XH 2MFNA 2ARJB 1ONQA 5FM8A 3ZDZE 1KFAL 2Y07L 1NGZB 3MTRA 4IM8A 3AS3A 3PJSA 3WFDL 1Z3GL 5I2IB 2I27N 5ACZB 4U1NA 1LP9F 2YD1A 3BUYB 5GS2H 2ILLA 4HX1A 3QG7L 1HILA 1QBLH 2BVYA 3DX9A 4GKNB 4LEOB 5DEFA 1GOGA 3QDHA 5TDOB 3O4OB 1KJ2A 5LAXA 1YNLH 3SKMB 1Z2KA 3RL2A 4R2GB 2F58L 4LLMB 1MIEH 35C8L 3IDMA 5IIEA 3QUZD 4NZUL 1MCHA 4L3EE 1K6QH 4ALAL 3TESA 4E9LA 5DJXA 5SWZE 2BNQB 5E4EB 2EIZB 4PJFE 4UQ2B 5F6IC 4ONOA 5EBLB 3FAXA 4M8QB 3QEQE 4Y16A 2I9TA 2YPLE 4G7VL 4OF6A 4UU9B 1QKZH 2EYRB 3EYOA 1GGTA 3H9YA 3L5XL 5BRZD 3UO1L 2NY0B 4IRJC 4FFWD 5BV7H 3K4DA 1F4WH 3U4EB 5ESQB 5HGHB 3AC0A 4GQ9L 4G8GE 2VDNL 1NC4D 4PB0L 4ZS6D 4WW1B 5A16B 1R3LA 2Q1EA 1DFBL 2Z35B 5EOTB 4KZDL 1FZJB 2HA1A 4EZMA 5IB4B 5EU6A 4ZSOB 3WJJC 1YEJH 3G6JF 5KVFH 2K7PA 4AG4H 1JZ4A 4U2YA 4HFWB 3U9UA 4YHKH 3NIFE 1R3IH 1G7IA 3O9WC 2YEZA 1CVRA 5DS8B 4G42B 1JJUA 4YLQT 4O2FB 4NZJA 4AH2A 3WUWA 1ZGLP 1FJ1B 3D0VA 2D0GA 1XZ0A 1IAOA 4S11A 1F8TL 4NQEE 5EZOH 3PWPB 3NCMA 1EJOL 5GPRA 3H9ZA 3OX8A 3ARXA 1KTRL 4FTVD 4IDJH 5GRUL 3O2VH 5IMKA 4Z8FH 3L7EB 1LEIB 4GBXC 3MOAH 4OT1H 1FNEB 3NH7L 5T5NG 2NXZB 4Y4KC 4NUGL 3S4SG 5FKPB 3UTSB 3MCKA 3RVXD 2HFGH 3GSRB 3E8UL 2WQ8A 4BZ1L 4KK9C 4YWGH 4H1LA 3EYFB 3FO0H 5C86A 4XPGH 5GZOD 3W9EA 1FP5A 3SDDC 2NY7H 1B4JH 1M71B 1SBBA 3MUZ1 3VGFA 5IVXE 4MYWB 1GIGL 5AYUL 2P4AB 3P9MA 4KAQL 4D9QD 4P57B 4PG9A 4M03A 3LRHA 4E42B 2RHEA 3TCLB 4PJEE 1OWWA 5DVNA 2BNRA 1GAFH 3FTGB 2ZOLB 4GO6B 1RJZA 4YGVA 2YN3A 4P9MH 5FYJL 4ZTPH 4PJCE 4MNGB 1EVUA 3BP5A 3FFCA 3WFCL 4Z7WB 1I8KA 5HDOA 1PG7W 1VACA 5CD5C 2QHRL 3FB5B 5C6WH 2OYPA 1D9KD 3O6ML 3U30B 2AEPL 5HJ3B 5D9SB 5DJ8A 5L2KE 1ETZA 2VL5A 2BFVH 4HV8A 4AEEA 3FCTA 5DQDH 4HIHB 4X5XA 1W8NA 5F1OB 3GSXA 4GW4A 2AVGA 5DEGA 3EYSH 1T0NA 4WI4A 1YYLL 1P7QA 3MYJA 3GSVA 1MQKH 1PSKH 1I9RH 1U8MA 4YIQA 4QNPF 5E0QA 1V8HA 3ARDA 4L5FH 1KJ2H 4HQQL 1YUHB 4XAKE 1AP2B 3A6CL 4N1EA 2EDOA 3IXTB 3UX9B 3L5HA 4J4PC 1MJUH 3DVGA 1QBML 4OZHA 2EYTA 5C6TL 3QCVL 2J2ZA 4FS0A 1QLFA 3PL6C 4MDJB 4PJ7F 5I1HL 3EFDL 3PG2A 2ARJQ 3TN0A 1W0WA 3OWEA 3QPXL 3KYKL 5D1XA 3CVHL 3QJHA 3I9GH 1MHPL 1FG9C 1HK6A 4R90L 3VMOA 1AKJA 2XTJC 1HHGA 2HJLA 3SJVB 5FA4B 4RA3A 4JFFA 2VJXA 1FFOA 4U1MA 4YEFA 2P5WD 2X4QB 4JFOB 4WU5B 3RI5K 3VJ6B 4XXDB 1B0RA 3HI6L 2EH8H 4XPHL 3P11L 4PJ5E 2AXGA 3S3JA 3QO1B 5IJKA 1VEMA 3UPAA 3HPJB 3O3AA 3B3IA 2FHBA 3BP6B 4UINH 3V0WL 3VXUB 1E4KC 5DMIH 5D7LB 5C0AD 3X12B 2QQQA 4HFUL 3T09A 3LQAL 2CO6B 3O41A 5KANI 3BX7C 3WNLA 1CGTA 4ZS7L 4TSAL 3ZKND 3SEPA 3RVVC 1D5XB 5DGRA 1WIOA 4EBQH 5I1JL 3BPLC 4PD4J 4EI6A 1D6EA 1JPSH 2YBRA 1HSBA 1UA6H 2FBJL 1AGCA 3BPCB 2MCPH 2LU3A 2BRRL 4ODHL 2J5LB 4AL8L 1PY9A 3IKCB 3S4SB 1I85C 4K7PY 3DX6B 1KV3A 3F58H 4D0DB 3MRKB 5T33L 2EDFA 4U3XA 2WW8A 3VA6A 1MCNA 5D70H 2A9NH 3QNZB 2RAMA 4ENEC 4H1LH 3TH2T 4R4BA 3BKYH 5EUOE 3W9DB 2FHFA 2ICES 4KQ3L 2E7BA 1F4YH 2JCCF 4PIRF 4BJLA 1JNHA 4HWZA 4R3SB 1PZ5A 2F54E 4PRHE 4I77L 3U4AA 5CWSB 3RVTC 1WZ1H 4MXVF 4P49A 5C92A 5SWSD 1MELA 1OP9A 4X9BA 1DLHB 4KY1H 1FVCB 1BFOB 1JL8A 2OBGA 4CMMB 1QEWA 4XCEA 3FQTB 1FAIH 2A9ML 5I1GL 1I1FB 1FYTA 4UV7H 1CGSL 5ID1A 5DEZA 2OTPA 4FQHB 5EU5A 4Y7MA 3KPNA 1PKQB 4H5SB 3LH2H 5JZ7D 1QD0A 1CGVA 1MFAH 2F5BL 4N0UB 4F58L 5F6HI 1BECA 2CDEA 4XP6L 5GISH 2IALA 3UPRB 4F9LC 3RVUD 5GJSH 2Y36H 4JVPA 5IBUG 2NLJB 5ABDE 2R4RH 1T4KB 1UJ3B 3QNYB 4G5ZH 1ZHBA 1G1YA 1AD0A 5KSBA 5BS0A 1X5LA 1AXTH 2FH6A 2HKHL 1C8PA 1KCRL 3SCMD 3WSQL 1FRGH 3O6KH 4GG6A 1MFCL 1B6UA 5AD0B 2XPGA 2V7HB 5CMAA 1XFPA 3G6AB 4PJXE 15C8H 3O8XC 1G7QA 3QQ3A 3OXRA 4I5BA 3CC5A 2P47B 3RHWK 4CW1B 4EI5D 5FYLD 1UWGL 2CGRH 1KCUL 1BOGA 4QHNB 1YC7A 2V5MA 2BMKA 3OV6A 1JNNH 3QUML 5I75B 3WO3B 1HDMB 2R9HC 4ZPTA 3T3PE 4UOJA 3VFTA 4OCYL 4EKXA 3S6CA 3I2CH 3K8KA 4LHJB 3S34H 4FQQB 2V7NB 4HXBL 3DRQA 1J11A 4FQXD 4HF5H 3BKCH 4OJFL 4E5XA 4N0CD 4POYA 4P2OC 4UT9L 1FPTH 1MAKA 2X7LA 5F7EH 1RUKL 5KTEL 3NFPA 1EZVX 2VAAB 1EHLL 3MNWA 4DVBA 2LU7A 2BVTA 5D2NA 2BJML 2DQTL 1T1XA 4Y1AB 5EU4B 4L8BA 3NGBC 4TVPE 4RSVA 4L29B 1K4CB 4MGXA 4PB9L 4HG4K 3FO1B 4MB4A 3NCEB 5MEPB 3SE8L 3C6LD 3PDDA 1KLUA 3D0LB 5IBTH 2C3GA 3F7RA 1M6OA 2IEPA 3HE6D 3UTOA 4Y8DC 1NANH 5L7XL 4XCNA 3REVB 3LRSB 4LSSH 1JI2A 4NHUA 1VGEL 5CGYD 4AENA 2ID5A 5FHBH 4HDIA 3BQUD 4ERSL 4X9GA 3VFRB 3JWDH 5LBSH 1IBGH 3ZDZF 4JB9H 4G3YH 3CGTA 3HMWL 5IG7B 2NY5C 1DDHA 3HAEA 4Z7VF 4JO1L 5K33A 3V4VL 2IG2L 4QXWA 2JIXD 1Y0LA 1TZGH 1FGVL 5E99H 2IWGA 3P4MB 1A64A 3WNOA 4ONGH 2WIMA 4HEME 4YFEA 4XNZC 3SDXF 2W9EL 1T89C 1ZLSH 1N5YH 3B9KB 2EC9T 4LSDA 3RY6A 3X3GH 5E6ID 5L0QB 5DRXA 3BMWA 5IW6A 1KB5L 1JUFB 3CFJA 4ODTH 3ULSB 1A6VH 2QR0A 3QDJE 1DVFA 4JM2A 1E6OH 4PJFF 4HS8H 1T1WB 5DC4B 5EOQH 4HC1L 1R0AH 1IQDA 3RKDD 5EORH 4S1SH 1CZ8H 1X5HA 3FQXA 2FIKA 5HHQA 2VOTA 1PYWA 4P23A 4PLJC 1FNHA 2BY1A 4P0DA 3HRZB 3KPTA 3PIQA 3KYOA 2IBZX 1I1AA 4LRNL 3QXUA 2X4PA 1I7RA 3U1SL 4OTXH 3EOAB 2IPKA 2AQ2A 4K3GA 4QXTB 2CUIA 3Q1SL 4KJPC 5AZEH 5HD8C 4QOKE 4QRTB 3D3VD 2JB5H 1VEOA 5IBUB 4OUUA 1IGMH 5FV1L 3BT2H 1H8OA 2E9BA 1T21B 5EWIH 2R0ZH 4D2NA 3QDGD 1CGYA 2EKJA 3ARFD 4L1DA 1VFAB 2X70A 5B3JE 1XGPA 4YXHH 3IU4L 32C2B 3UJIL 4ISVA 1M4KA 3CK0H 4BSJA 4DEPC 3VXOB 1IFHH 2NCMA 1AJ7L 1OY3B 2F53E 4LSQH 4ZD3H 1R3KA 2GFBB 4ODVL 5JOPE 2ATKB 1GHFH 1NEZA 1VPOH 1UADC 2Y4SA 1OAQL 4HJJL 1B3JA 1LD9B 2XKUA 3CSBA 5D6DA 4X98A 1ZMYA 1F90H 1KEGL 4GRWE 2VABB 3I50H 3MLSH 5DRZA 1KCSH 5IGXH 3QUXC 4IRJD 1QSFA 4PP2B 4M1CC 5JA8B 1VHPA 4QRUB 1SY6A 4N9OB 5DJZA 3NABL 1I75A 2PYEB 4QWWC 4OLZH 1KJ3L 4U2ZA 4P2RB 4Y4HB 3C87A 3FT4B 2DWDA 4X7TA 4ZUTA 4J1UA 1F3RB 1RIHH 3VFSB 1HYRC 2ZJSL 1P9MA 2ADJB 2GEEA 3PQYD 5LGJB 2QQNL 4F33B 4OFDA 1U3HC 2YD7A 2XWTA 4DFHA 4I9WE 3SGJC 3H3KA 3ET9F 1YEGH 5DJ2A 5HGDB 5CHNB 2Q8BL 5C08A 3T0EE 2NY5L 3QFDB 3GHEL 5GS1B 3RZCA 4GAYA 2X9YA 1NBVH 3DBXB 4GS7B 4LHUD 4DFIA 3WN5A 1MCBA 4TQEL 2PO6C 4QRPB 5BV7B 2YKLL 3DIFA 2HVJA 3B5HA 4D0BB 1FVEA 5JA9A 5KSAA 4OB5H 1H3VA 3SDAA 3VFVA 1YY8A 3NPSB 4XBPA 1G7MB 3MRIB 4FXLA 2D7QA 5E03A 2Y7QB 1KT2B 1N5AA 3MJ9H 1IC1A 1OAUH 5ILTL 1L0YA 2GTZB 4YX2L 3U7WH 5B21A 3UEZA 4B53A 1H15B 3HKFA 1FNGB 1S9WB 3IJSA 2R0KH 4DQOH 1S78D 5DFVC 3LKNB 4KMTH 1RZFL 2D31B 5TF0A 3QEGL 5F3HB 2MQCA 4R26H 1KJVA 3M17B 3HNVH 3EOBA 4EEEA 4UIKH 4G8EB 3RWGB 4W68A 3WUWG 4YAQA 3SDDD 4DJMA 3MRCA 3TP4A 1RV6X 4GFTB 4ZFGL 2C3WA 1LO3L 3U6RA 1DSFH 1HH6B 2R4SL 1UM6L 1DUYB 1B0GB 12E8H 5AUMA 5J1TC 1I4FA 5TE7L 5C7XH 4X6BA 4EXKA 4LCIH 3ZT7A 3MC0A 4FQCL 1ZGLA 5DJCA 3IJYA 1WWBX 1WAAE 2O5YH 4I18B 4JFDA 5CP7A 3O11A 4Y5YB 1D5MA 3QJFB 3V5DB 3QNXA 4Q6YA 5ANMA 5HGBA 1MHCB 2J88H 4JQIH 5T1MA 3MA7B 2VKWA 4JG1L 5KVEH 1WFOA 3UYRH 3OXSA 4H1LG 3TBWB 2J6EA 4NZTL 3RWCB 3HMXL 1XF4A 1MF2L 5GSVB 2JJUA 5DTFB 1AY1L 2NY3C 2AQ3A 3BQUA 4PJ8A 1WCBB 1CTNA 1UB5B 4H8WL 4U3HA 3TA3C 2GTWB 4N0YH 3DVIA 4Y5XB 2A6IA 3KYAA 3EDJA 4QXUH 3VXSA 3MMEB 3G08B 4RMTA 2LVEA 3OKLB 4P2RD 4RGNE 3KJ6L 3K1KC 3I6KA 2XFXA 2JELL 3DECA 2X40A 2DWEB 1BZ7A 4JCLA 3X14B 7FABL 1KULA 3UDWA 1SVZA 1CE6B 1IC5L 3QH3A 5J7CC 3C08L 4KFZC 4L8CA 1MCOH 4CVZA 5ERWB 1N59A 5I74B 2J4WL 1VEPA 1SEQL 3S3PA 1AHWC 1KC5H 1RUPL 4U1NB 3ZMRA 1SY6H 2OR8A 4HX1B 5DJ0A 5JIHA 3VFGH 2ED8A 3DX9B 5DEFB 1Q9LA 3BE1H 3NZHH 4UOW0 1KJ2B 4MVBC 5LAXB 3VD9A 3TT1H 1Z9OA 2MPAL 2NY4C 3RL2B 1FL3A 3IDMB 5IFJA 5IIEB 3EHBC 1A5FL 4PLKC 3MV8A 2V9RA 2ZWLT 3D48R 1LK3L 5DJXB 2AK4E 1A7PH 4YHLL 4KK5D 1FGNH 2I9TB 4Y16B 3CZFA 4O58H 5JLZB 3D3VA 2IMMA 3EYOB 1NC2A 1VFUA 3QBTB 4BK4A 3GDBA 1W72L 2IANE 2DQGL 4Z7UA 4HIIA 3R0NA 4MJID 2R2EA 2VDRH 1W0YT 2RCSH 3OTTA 4A6YL 4M1DL 2VZUA 1IKFH 1SMAA 1R3LB 4PLOB 3V5HA 4UZGA 4HUUA 2O5XH 3E1F1 4PJHF 5EU6B 1C16A 4FQ2L 1C1EL 1KFAH 2Y07H 2HLFD 1AGDA 3KPQA 1LO5A 3ARGD 4M02A 3U9UB 3WLWC 3WFDH 5AAWA 2JTDA 1Z3GH 2JB6A 1G7IB 2ADIA 4LSVL 4U0QB 4ENED 2YEZB 1T7ZA 4AH2B 3WUWB 3ZYJA 3D0VB 1XZ0B 2D7TL 1IAOB 2ZCKL 1A3RH 3CJJA 2VLRA 5FGCB 3NIGE 35C8H 5JNYA 4NZUH 5F7YC 4UDUA 1X5FA 5EA0L 4ALAH 1T2QL 3OX8B 3MLYL 3GIVA 5IMKB 4H26A 5I6XC 2W65A 4XWGL 3KPRE 3IAGC 5DMGD 5FV2A 2QL1A 4WHDA 3BYTA 3L5XH 5FOBA 3UO1H 3WJJA 3MCKB 4X6DE 3CVHA 4DOHB 2G5RA 4KHTL 4NIKB 2DBJA 2F19L 3C5ZD 1QVOA 4M7ZC 3GRWL 2WMPA 3FB6B 2J6EH 4GQ9H 3UTPD 1KYOJ 2VDNH 1JGVH 2UVFA 4HMCA 3O9WA 4PB0H 5HYFA 3QEHA 3P9MB 5IROC 1DFBH 5IEKA 2P5EA 5B22A 4KZDH 3OL2A 4MJ5A 3MOQA 4HHAA 3V95A 2P48B 2VLJD 2BNRB 4OLUH 1RJZB 2X44D 4YGVB 5BQ7A 1ZT7B 4U1HB 3BP5B 4Z7NE 1I8KB 3ALXA 1VACB 4GBXA 1BLNB 4Y4KA 3RFZC 2H2SD 1ITBB 2CK2A 4D9RD 3MLVH 5JO5A 3WFHA 3MUHL 3W39A 4QRRD 1RU9L 4LSRL 4NFDA 4RWYH 3QPQC 1ETZB 1WT5C 2VL5B 2VLKE 5FB8A 1F8TH 4HV8B 4WNQA 3FCTB 4I4WB 1A47A 2K3TA 3WLBA 1EJOH 1KENL 1T6VN 4X5XB 3GSXB 4GW4B 5DEGB 3GMRA 1T0NB 5GRUH 4NQCD 1P7QB 4I0PD 1NUNB 3MYJB 3GSVB 1B0WA 1U8MB 1Q1JL 4YIQB 1I3GL 2Z8RA 4NUGH 2R9HD 4PREA 4RISH 1ZHKA 1QG3A 5ECJE 5HYSA 4BZ1H 3MV9D 3DVGB 2WLYA 4OZHB 2EYTB 4KJWD 4NWTL 1AGBB 2O5ZL 2DKMA 4O02H 3LEVL 1UKQA 4TULH 1QLFB 4JANA 3X3FH 4Z18A 1AH1A 3TN0B 1GIGH 1R3HB 1KTKE 4KAQH 1ZT4A 5I17A 5D1XB 3QJHB 3NCYP 3GKWL 1HHGB 4FXGA 5HTSA 1A1OA 4FP8H 5E08L 3UJJL 4GQPH 4AT6A 3OKMA 1MVUA 4JFFB 4RIRA 1TVBB 2FX8H 1FFOB 4OAWA 4U1MB 2QHRH 3O6FC 1AR1C 1B0RB 3O6MH 1RIVL 4ODBD 2MJWA 3LZFL 4FMKA 1RULL 1EK3A 2NXYC 4J4PA 4X7SL 3B3IB 4YDIL 5IM7A 5EC1A 3DO3A 3MREA 4I8DA 3PL6A 4HH9A 3O41B 3U46A 1YYLH 2DQEL 4O4YL 5B3JF 4OD3L 1HCFX 4YFDB 1HI6A 5IB3A 1CIDA 4TVSa 2DJ4A 3BWAA 5T1LD 4MXWL 3A6CH 2WUCL 3VG9C 3MZTA 4EI6B 4C59B 1G7PA 1D6EB 5FM4A 3RPIA 1HSBB 1AGCB 1QBMH 2QADC 4GRLD 4FNLL 1NMBH 1O7SA 5C6TH 5HBBA 5GQBA 1H0DA 5I1HH 1TJIL 2DL9A 3DXAD 5KAQG 4GH7B 2RJMA 5FO7A 3QPXH 4M6AA 3KYKH 4GRWF 5ITFA 3RIAF 3CX5K 2VDKH 1MHPH 3STLA 1OLLA 4P46C 4R90H 4EIGB 3HAEG 4NSKA 4R4BB 1E4KA 1AC6A 3ALWA 3QUMA 3EGSA 3C9NA 1ZWIA 1DR9A 1JNHB 3MNZA 4HWZB 1PZ5B 1F5WA 4F3FA 2X2YA 1KTLA 4OZGE 5GS0L 3HI6H 4XPHH 3FONA 3JVGC 3AMLA 4NM8L 3QHFL 3V0WH 1DANT 3PP3H 4NRXA 3D18B 4JFED 1WTLA 1QEWB 3FO9A 4XCEB 1OSZA 3CIQA 4HFUH 3QT2A 3O3EA 3TJEH 1I85A 4ZS7H 2P45B 4TSAH 1FYTB 1QSVA 1A1MA 2XN9A 5ID1B 4GUPA 2DYPD 1JF5A 5I1JH 2ZOKA 5EU5B 2A6DB 3TBYA 2CR3A 1ZEAL 2FBJH 5CSGA 4AQ1B 1CE1L 2BRRH 4ODHH 4JM4L 4AL8H 3DMMC 2CDEB 5C0BE 1KPVA 3BDBA 1RVFL 2IALB 1PJ9A 3AU1A 3G5XA 4K55A 4WCYL 4OCXL 4DTGL 2ITCA 1WQVT 4UNTA 3HR6A 1ZHBB 3QUXD 4V1DA 1AD0B 5KSBB 5BS0B 1YMHA 4X9HA 3HI1A 3HG1E 3M07A 4GG6B 2XPGB 5CMAB 2Q8AL 3MPCA 4IRSC 5DQ9A 2LTQB 1X5YA 1YPZE 1LE5A 1G7QB 3TGXA 3QQ3B 3OXRB 4I5BB 4YJZL 3CC5B 4BELD 4KWUA 5E2UH 4XVJL 1A7RH 1CR9L 3T4AA 3RVWD 1NEZG 2RBLA 1C5CH 2I9LA 1U3HD 5KANG 1BOGB 1KB5A 5D1QC 4ZAKD 5DURB 2BMKB 2VXVL 2CKNA 2RQ8A 1S5IL 4ZPTB 4HC1A 3VFTB 4IMLB 5I1GH 5IHUH 4F9LA 3ZE2E 2V17H 5IESL 2J8OA 3DRQB 3HS0B 1CGSH 1MCDA 3OB8A 5IVZA 5ACMA 3OKDB 2X7LB 5GGQL 4S2SB 4KKCC 4XNMA 3NFPB 4GXUM 2XZQL 5A3IC 4S1DD 2FATL 5D2NB 3O8XA 4NQDE 5DYOA 1T1XB 4YH6A 4F58H 3S96A 4L8BB 3LIZL 1NMCC 3RY4A 2CUMA 3IU3A 3SKOA 3HZYB 1KLUB 4NQCA 3G6JA 5DFVD 1M6OB 3LN5A 5ISZA 2ADGA 3AS2A 1L6XA 1ZVYA 4XCNB 4NHUB 3WSQH 4L4VD 4AENB 1MFCH 4HDIB 3ZKXC 3UTTD 1UXWA 3C5SA 2QEJA 3GMNA 3MV9A 4YDVA 1LNUA 3AM8C 4KPHH 3DVNA 2M1KA 2B1AH 3BOVA 4QHMA 4W6XB 3LS5L 1DDHB 1UWGH 3HAEB 4MNQA 4P2OA 4RGMB 1KCUH 3V4UH 1E4WL 2XQBL 2P8LB 4R4FL 3QDMA 5E9DD 3QUMH 2GJ6D 3TO4D 1A0QH 3WE6B 5GRYA 4OV5A 5T3ZL 5IQ9A 4A2MA 4OCYH 1FO0H 3HFMH 5H35A 4YPGB 1GZPA 5T3XH 3GSOB 5DRXB 4N90D 4OJFH 5IW6B 3CFJB 2PTUA 4PJAF 2QR0B 1DVFB 1P6AB 1T3FA 4POZD 2OR9L 4UT9H 2B0SL 4U6XA 5KTEH 1NCWL 3BIKA 1EHLH 1J8HA 5KSUA 1QTYT 1IQDB 2DQTH 1JK8A 1YEHL 2VLME 2F8XC 2P49B 2D7NA 3DYPA 5BCAA 3FQXB 2FIKB 5TPWH 5HHQB 4PB9H 1PYWB 5DDHB 4P23B 3OSKA 3DTXA 3T2NL 5IMOA 5DK2A 1QSEE 3KYOB 1FL5A 5GIRA 3Q2CA 3QDAA 1I1AB 2Y1VA 2X4PB 5L7XH 5L8JB 1U6AL 3VXRE 1YYMH 1S7VA 1X44A 3S37L 4I3RH 3L5IA 1VGEH 3TZVC 3TIEA 1T89A 2VXTL 1IJ9A 4OUUB 4Z6AT 2APVA 3SY0A 2O26U 5GJTL 1I3RB 5LKNA 2J8UE 1P7KA 3HMWH 4Y19E 2C4FT 2X70B 4JO1H 3V4VH 4LSPL 4WV1A 1GCFA 2IG2H 2M2DA 3F62A 4ISVB 1FFNA 1FGVH 1XGQA 4L4TD 3ZE1F 1UXSA 1R3KB 4APQC 5F9AC 3WNMA 2W9EH 4WY7L 5ADPL 1NEZB 4UIMA 5DUML 3KLHC 4JRYA 4PLKD 2UY6A 1KB5H 4BFBD 3EO9L 3ULVE 4X98B 1CXLA 3WKMH 5JOFA 5E2JA 2H1PL 4PJ7A 2YRZA 4HC1H 1X4ZA 3N1PC 2ERJB 4OCMC 5DRZB 1QSFB 1HQRA 4X6DF 5DJZB 2RIKA 2Y06H 3HE7C 4XP9L 4KKBD 5JHDE 4XVUC 2ZSVA 2XA3A 4LRNH 2CMRL 5F96L 4ZUTB 4J1UB 5CLWA 4KZEL 3TEUA 4WI9A 4BH8A 4OFIA 1JHKL 3Q1SH 2XWTB 5GGSA 5SWZD 5IJVA 4JKWA 5A40E 3CFBB 1CU4H 3LQZB 5DJ2B 1GGIL 5C08B 3QEQD 3RZCB 4GAYB 4O5LL 1NFKA 2EEDA 4U7MA 3P0YL 1BF8A 43C9A 4LASL 3KG5A 3WN5B 4Z7NF 3RI5F 2NY6C 3DIFB 3WDIA 2HVJB 3UJIH 4KK6C 4F15C 3B8SA 1FVEB 5KSAB 5FXCH 2ZUWA 3BPNC 3MV7E 4RRPA 3SDAB 1YY8B 4XBPB 3X11A 3QUXA 4KI5E 4ODVH 1IT9L 3CDYA 1N5AB 4LSUL 3RRQA 1OAQH 1X5JA 2W9DL 4QT5B 1FL6A 4HJJH 4LVOC 3T0EC 3MLTA 1MJ7H 2Y6SD 1N0XL 5CKGA 4ONHA 1TPXB 1P53A 3IJSB 5ICZB 3SGJA 1HN1A 2HFFA 1KJVB 1MI5D 3MA9L 1A2YA 3EOBB 3NABH 1CTOA 2EEAA 2NX5A 1KJ3H 2IQ9L 2OK0L 1TJGL 2JJTC 2PO6A 3BAEL 1XR9A 4NQED 5JQ6L 5JW3L 2EE2A 3BSZL 2Z9TA 5GGUB 3CLFH 3U6RB 1QFUH 5FYKE 2ZJSH 2JCCA 5AUMB 2QQNH 3QEUA 4Y5VC 3DOSA 1I4FB 5BXFA 4X6BB 2IAMB 4LVNB 1VADA 2WBKA 1ZGLB 1EGJL 5DJCB 1INDL 2Q8BH 3IJYB 5TF1L 1J1PH 2NY5H 3GHEH 3WFBL 3TJHC 4HPOL 3V8OA 3T08A 5JXEC 4JFDB 1TQBB 1U3YA 5CP7B 3O11B 1D5MB 1IGJA 1PEZA 1W72A 3QNXB 3UJTL 5ANMB 5HGBB 2YKLH 4GMTH 3GSUA 4OLWL 5T1MB 1KGCE 3OXSB 4PJBF 1BFVL 5CINL 2EH7L 1XF4B 3UYPA 1S7QA 2NY2C 4IHOA 5CJOL 3FT2A 3W11C 4A6YA 4L4VA 2F9BT 4P3WA 4PJ8B 2HT2C 3MODL 1SJEA 3CU7A 3KPSD 1DUZA 3FQRA 2YHGA 3SBWC 5C07A 4LPVA 3SKJL 4FA8A 1Q9WA 5MEND 2A6IB 3OAZH 3VXSB 4G9DA 2AERT 4LL9A 1MCKA 4QKXB 4ZMAT 1RZFH 2IPUG 4A2LA 3QEGH 4RX4A 3I6KB 3I75A 2XFXB 3LPGA 1NMAL 2BSRB 1BZ7B 4HKJB 1QRNE 4N8VA 4ZO9A 3QH3B 5HHOD 5DZOA 2HKFL 5HDQL 4ZFGH 4BFIA 4CVZB 3L6FA 2R4SH 2XZCH 1UM6H 1TZIB 4OFPA 5TE7H 5C09D 4JLRA 4WFED 2ORBL 3TVMD 4FQCH 5DJ0B 4F7EA 3I6LE 2ZCLL 3L3JA 1Q9LB 3D39E 2ZCHL 2EXYC 3MLXL 4RGNC 4FMFA 1W8OA 2W0PA 3TA3A 2A77L 4B41A 3RWEA 1T1YA 5IFJB 1ZT1A 5DZNA 3GBNL 4DZ8A 5HYSG 1X5GA 3GRWA 4P4KC 3ULUE 4OZGF 3O4LA 4NZTH 1UZ8A 3EO0B 3QAZC 4JFZL 4Y2DD 2AEQL 5I8KL 3VD4A 5J11B 1MF2H 3QG6B 3CZFB 1LK2A 2APFA 1NC2B 4MMXC 1UCTA 3PDOA 5BZWA 4M7KL 4Z7UB 1YEEL 1T03L 4HIIB 5KN5A 4Q9QL 2VXSL 1AHWA 3PP3K 2R2EB 2IPUK 3RU8L 5FECA 2JELH 3V5HB 3GFUA 4HUUB 1T66D 7FABH 3WHE1 5C3TA 3VXMD 3TBSA 3S88L 5EO1A 4YO0B 1C16B 3C08H 4J7RA 1BEYL 1QO3A 1OP5H 1VGKA 3KPQB 1LO5B 3WIIL 1EFQA 4NNYB 2J4WH 4K3DH 5F6IB 2JB6B 1RUPH 2ADIB 2H9GA 4JPIA 4JY5H 4KK8C 3MLZH 3ZDYE 4K94L 3B2VL 1BZ9A 2W0LA 3DSFL 4MSWA 3TCXA 1E4JA 4YK4C 5D71L 2VLRB 2MPAH 1YPZF 5JNYB 4WUKL 1RZ8B 3UZQA 1A5FH 5D72L 3BI9X 2ZG3A 3FHQA 4JKPL 3GIVB 3CXDL 1LK3H 4X80L 4H26B 2YPVL 1R24B 2MKWA 1XIWC 4R97B 1WEJL 4L3EA 2W65B 1DQJA 1XEDA 5FUOH 5SWZA 3BGMA 2Q7YA 4PJFA 5FOBB 3GK8H 4JO4H 1W72H 3CVHB 2DQGH 3QEQA 4PD4K 2YPLA 1D5BB 3Q6GH 3TFKD 2L7JA 1QVOB 2KQMA 4ELMF 3ZE2F 4QHLA 1OGAD 3KS0H 3O9WB 4M7LL 4OGYL 5TQ0L 4A6YH 4M1DH 1NPUA 2FX9L 3KPPA 3R8QA 3QEHB 2R1XA 4G8GA 5IEKB 2P5EB 5EG6C 3HLAA 4MCZA 4MJ5B 3D69B 3HI5L 4HHAB 4AEIL 5D7IE 2ZG2A 4FQ2H 3DMMD 5LQBH 1C1EH 1O5DT 3RX5A 1ODAA 5BQ7B 4RFOL 2BRQA 1U8NA 4OZ4A 3EFFA 4GBXB 4LSVH 4Y4KB 3EYVB 4IEFB 4I3SH 5JO5B 3WFHB 1LDPL 3W39B 1CVSC 2OM5A 1FCGA 2XZAL 2ZCKH 5FB8B 1NKOA 4ETYA 4WNQB 3B2UC 3VXQA 1QFPA 3WLBB 3O2WL 1TCMA 4POUB 4TYUA 1T2QH 2R2HA 3OKEA 3MLYH 4QTHA 3GMRB 2NW3A 5DHYA 1W2KT 2N7AA 2XZZA 3MLPA 1CGWA 5IROA 4XWGH 1YZZA 3MUJA 1UACL 4NBZB 3MOBL 5C0NC 5FM5O 4PREB 1DBJL 1I9JL 2J7LA 5DK3A 2E6JA 1ZHKB 5K9JL 3HZMB 2PXYC 4KHTH 5HYSB 2F19H 3BW9A 4UNUA 4LCYB 4RBPH 3GRWH 4S1RL 4HUWA 4XHJC 1Q72L 2DQUL 2ZUYA 2ZG1A 4JANB 3VFMA 5FA3B 2ESVB 1ZT4B 1NCCL 1A9BA 3QISA 2OZ4A 4JRXB 5I17B 1FSKC 3LHPL 5IMMA 5MI0C 2C5DC 3LB6D 3X17A 3VRJA 1WT5A 4D9QE 1G9EA 1I7UA 1IM9A 4FXGB 3QULB 1J5OL 2BXZA 1C7SA 4AT6B 5AAMA 5M95B 3OKMB 2Z92A 1MVUB 4AQOA 4HJ0D 3SGEI 5C6PB 2B1HL 4GXUN 3QXDB 3ZHDA 4R0LC 1JGLL 3CDGA 1RU9H 3PF2A 4XHQA 1MCPL 1BBJA 4LSRH 4UV4L 3TYGL 1A3QA 4F57L 1ZLWH 2C3VA 5EC1B 2BDNL 4NFBA 2HTKC 1KENH 3MREB 3GMLA 1T7VA 3SE4C 2OL3L 5L2KA 2J8UF 1HHIA 3PL6B 1TCRA 4HH9B 3U2SA 4TVPD 3U46B 4R4NC 1I8LC 3CXHJ 4AY0A 2E7CA 2QKIA 3GI8L 4M48L 5F88A 2PN5A 1Q1JH 2XG4A 4OCSL 1WVZA 1WWWX 1I3GH 1HI6B 2VXUL 5IB3B 3BWAB 5JW4R 3ZDXE 5JW5A 1G7PB 4RFNC 3RPIB 5IFHL 2IBBA 2XACC 3HB3C 4NWTH 2O5ZH 3OG6B 4KTDL 3LEVH 2QSVA 3CFKA 1H0DB 3O6FA 4M00A 3ULVF 2HH0L 4ZSOE 2WLZA 1CQKA 4F7CA 2E9IA 2AV1A 5ITFB 5F9OL 2IADA 3STLB 5FYJU 4NSKB 3G5VA 1WGOA 3QUMB 2YC1B 3EGSB 3C9NB 5ETUA 3QIWA 5E08H 3GM0A 1EVTC 4NRZA 3UJJH 1KXVC 4ZTOL 2Y23A 1CFTA 3MNZB 4B5EA 1T5XA 4RA0C 4F3FB 1V3LA 5D7KD 1FE8L 1KTLB 2AI0L 4LLVA 1SM3L 4X99A 4HGMA 3BPLB 5HYJD 1HINL 3FONB 5CEYA 5BZDA 3QDJD 2P5WE 1RULH 4NC2B 5FO8A 1BVLA 4X7SH 3OAUH 5FKAA 4DKFL 4LLDA 2KL6A 2V2WA 4PJ5A 4NRXB 3FO9B 3HUJF 1OSZB 3FRUA 3EO1A 4GRMA 3O3EB 1WTGT 2DQEH 1KNOA 4O4YH 5C0AE 1GJIA 2X09A 1AIFB 1A1MB 1H9VA 2XN9B 4K3EH 2ZOKB 4P46A 2WUCH 5J0BA 4KI5F 3TBYB 3QIBC 4X7EC 1OT2A 4JRXD 1PG7X 2BOBA 1HZHH 4FNLH 3GJFA 1KIRA 3HC4L 2A0LD 4WDIA 4XZUA 1KPVB 1TJIH 3AU1B 3G5XB 5ALCH 3GNMH 3RTQC 1AO7D 3IAPA 4M61A 5CBEB 2ITCB 4K8RC 1IARB 4P5TC 1EXUA 4BSVA 4V1DB 5TH2A 4MNGE 1YMHB 3HI1B 3VWKC 5TDPA 1LP9B 5DQ9B 2ZKHL 3BP4A 1LE5B 3BH9B 3L3KB 2X6MA 5EUOA 3T4AB 2VXQH 1P4IL 2OZ4H 2AK1L 3TLRA 4BA8A 2I9LB 4TUOA 1KB5B 2F54A 2GCYA 4PRHA 2VZOA 5L2JA 4NM8H 5LXGL 5JDJA 3QHFH 3CDFA 1X5IA 4XX1G 4Z7QF 5DZLA 3VW3L 5SWSE 2GITA 2DOCA 2IFFL 2P8MA 3DMMA 5A2LH 1CFBA 3VWJC 2X9XA 3IF1A 3WD5L 2WBJC 1EEYA 3NMEA 4KK6D 4JFHD 1P5VA 1EJ6A 5IVZB 4IOFD 4DK6A 4XWOC 1FVDA 2X4NA 4XNMB 2X05A 1ZEAH 1ACYH 1BX2A 4IRSA 3ARBB 3O8XB 5DYOB 5DFWH 3S96B 2NR6C 1U8QB 3LMJL 3SKOB 1V7NH 3QIUA 4MAYC 4WCYH 3LN4A 4OCXH 3C09C 2DIBA 3G6JB 5CZXC 1ULVA 3L95A 5D1QA 2DIJA 3LN5B 3IFLH 2ADGB 3EJYD 3UP1A 5ISZB 4OM0L 3V5KA 4LPXA 5D5MF 2DD8L 5F7FA 4LMQI 2Q8AH 3OAZK 1UXWB 3C5SB 4U1LB 3GMNB 4RRPG 3PWNB 3UZEA 4YDVB 1LNUB 3UTQA 3B5TA 5EO0A 3DVNB 1L7IL 1S3KH 2D03L 1CR9H 4NO3A 2AEWA 4QHMB 1UWEL 2C3XA 5D1ZC 4MNQB 2EYSA 4P2OB 2C1OA 3QDMB 2VXVH 1WIUA 5FYLE 4PS4H 1S5IH 4TUJA 4M5YL 4OV5B 4AIOA 3C8DA 3NGBB 5IQ9B 4TOYH 4X7CC 3S97C 4XGZA 3ZSSA 4BZYA 5DLML 2O93L 4K71B 2ITDA 4YHOL 3TT3L 4E41D 3K46A 3AREC 3EDDA 1T3FB 5GS3A 4MA1C 1RZGA 4U6XB 5GGQH 1MLCA 3BIKB 4M8VA 2XZQH 1J8HB 5KSUB