3TJEL

Crystal structure of fas receptor extracellular domain in complex with fab e09
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSFNIGRYPVNWYQQLPGKAPKLLIYYNNLRFSGVSDRFSGSKSGTSASLAIRDLLSEDEADYYCSTWDDTLKGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab E09, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL01
3MUHL 5DRWA 1C08A 4KUCF 4S1QL 4OZGB 1AGFA 1T4KB 4HUWB 5JQ6H 3ZKSD 1LNUB 3UTTD 4X9GA 3E3QC 4ZDHB 5TQ2H 4LSSH 4MAYD 4WGVB 2PUQT 5INDA 1TJHL 5J1SC 3G5XB 2NW2A 3PGDA 1SJHA 3WXWL 1B0WA 4JJ5A 1YNTB 4PJHF 3T77A 4PJ8D 4W4OC 1ADQH 1FLTX 1XGTA 1MFDH 1IBGL 5D2NE 4F37F 5DK0B 1INDH 5IM7A 5B8CC 3TF7C 4PJIA 5ID0A 1U8KB 2EICA 3GSXB 3S98A 3VXMD 5EZIH 3B6SA 5IQ9A 3C8HA 4IRSA 5FB8B 1CF8L 3TIDA 1TJGH 4HLJA 5DD0L 3P4MB 4AL8H 3BMVA 1JPTH 1AY1H 3MNWB 5CZXC 3JWDC 4K2UL 3VXTA 35C8H 4BUGA 4G9FA 4WV1A 3L3IB 3QIBB 3QQ4B 1CDIA 2DTML 4GRLB 4JPKH 4NT6A 2CKNA 4UAOB 1PEZA 3O2DL 3Q5TA 2D4FA 5GRUL 2FZ3A 3D3VB 3CU1A 4G7VH 3ARFD 2RFXB 1FSKC 3RWJB 1OTSC 4DZBB 4UT6H 4X6EA 3S34H 32C2A 1FYHB 3PP3K 5ACZA 2KDGA 1NAMB 1JGVL 3HS0B 4X98B 2PN5A 3ZDZE 4MNGA 2HT3C 4GAGL 1RULL 4XPBL 5CZKA 5FUZL 3LV3A 1AKJB 5JPMB 4P9HC 4P4KB 4XCFL 5L88H 5BO1H 1CLYL 5I1HL 1Q9WA 4U31A 5LJYH 2Z8SA 3BVNA 4KK6C 3RNKB 4I2XE 2XZAL 3VWKC 4WUKL 4Y5XA 5C0EA 2NY0C 4ZYKA 1A64A 1ZA3B 1IAKA 1IQWL 1MHCA 1MRDL 3H9SD 4PJDE 4I3GA 4JZNA 1GYAA 5D1ZD 5HGAB 2DM2A 3O3DB 5F96L 1INEH 2DI9A 4R6UA 1S5HA 3NA4A 1IEAB 3FAXA 3DV6A 4F33A 1Q1JL 1QKZH 3OKEA 4Z5RA 4HCRA 4LSVH 4LGSB 4HDIB 3VCLB 5D1XA 3CX2A 1KTRL 1MJ7L 1QA9A 3ZTJH 1DN2A 3NBNA 1FFNB 2GSIB 4NM4H 5C9JB 3O2DA 4L9LC 4MD5B 3TCXA 1QO3A 4OFKA 2NX5B 4UB0L 3IXAB 3T0WA 4Y4HA 3WN5A 5KZCB 3NFSH 4FMFA 2ZCHL 5E99H 3C60C 1JWUB 4CVWA 2H32H 3PV6B 2H2PC 4LKCA 3P0YL 3R06A 4P2QE 5IJVB 3IRZA 1DSFH 5EB9A 5HDQL 2JTDA 4MS8C 4TVPE 1JUFA 1NC4D 4LLQB 1P7QB 3MYJB 1I1YB 5FGBC 3O45A 4M5YH 2A0LC 2XG4A 1JTPA 4RFEB 4S0SD 3U46A 3MGTA 4O2EB 2CUIA 1Q0XL 4P2OC 3IB4A 2XPGA 3OGOE 4RQQA 2XQYK 3EYQC 5K9KA 3X14B 1J88A 3AMKA 2R0WL 4FQIH 4XPGH 4OLYH 3WNMA 5D8JL 2A9NH 4PJEE 3O8XB 1T20A 5ETUB 4UQ3A 2C5DC 1F42A 4UINL 1A7OH 4N0RA 3FHQA 5JR1H 1IARB 5LG1A 3X3FL 4ZPTA 2OZ4A 3RVWD 5DZLA 4U6XA 3JV4B 3G6AB 2DLFL 2UYLA 1ED3A 3F7RA 5FK9B 3SDCB 1HYSD 5DD5L 2F15A 5EBMA 3GSVA 2XICA 4OUUB 1HHGB 3P9WB 2OX5A 3BPCA 2NY1B 8FABB 1QBML 3VFWB 5AWNH 5HBBA 4EN3B 5I19L 3W11C 5E6ID 1UM5L 3GNML 4CMMA 3IJSA 5HGDA 5T3ZH 2X89A 3C8KB 3GKZA 1IC5L 4B53A 2OTWA 2NY4C 2GCYB 4PRPE 4P9ML 4QRTB 2LU4A 3LMJH 3IFLL 3P4OA 2QR0A 4JGJA 1KUMA 3T4YB 5I1IH 5IV2B 1NUGA 4K3DL 1NCWL 5F7EL 1OCWL 3QHFL 4OLVL 5D1QA 4M61B 4DCQB 4P59L 4LLAA 5D1XD 3RIFK 1QLEH 5HGGS 4TUJA 1OSPL 2OS7A 1CE6A 4UU9A 4YPGA 4OCRH 1LE5A 1S7XA 5IBUG 1K3IA 3OAYH 4CMHB 4H25A 2RAMA 3GJFB 4Z7UB 2ZCLL 1JNNH 4QHLB 4LF3B 3RY4A 4HUVB 4PJDF 4EI5C 5DRXA 4KI5E 3ZE0E 5CD3B 5EOCL 2MQCA 2R4SL 5F6HI 2BY0A 4M7JH 3WSQH 1ZANL 3S35H 2D03H 4LQ1A 1U8PA 3RVVC 5HVWA 4X99A 3SO5A 1ZOXA 4ZD3H 5C2UB 5L8KB 2HWZL 1VACA 4YDKH 3P40A 1F6AB 2D7QA 4JFZL 1KN4L 43CAA 3BE1L 1JV5A 1RJCA 4M6OH 3P0GB 3P0VL 4J23A 2OJEB 2AJSL 1U95B 1Z9MA 1RIHL 3H9HB 3KPNB 3A6OA 3UTSD 4PRIE 4WNQB 1S7SA 4QHMA 1FFRA 1CIDA 2YXMA 3CDCA 4J3SA 1ONQA 1OTSD 3BMWA 4NRYB 5D7IB 4OSUH 5ISZD 3TO4A 4ACPA 2DWEB 2HT3D 3ARBC 2ZG1A 3C5ZA 3B2VH 1LDPL 3QEGH 3Q1SH 1FNEA 5GGSY 1IL1B 3PABB 4LDEB 4LBEB 4FQHB 2BSRA 1AFVL 4CW1A 1DBKH 4G9DA 4APQC 1XCTB 4I3SH 3AUVA 3JVGC 4KK6D 4LCYB 4HJ0C 3OF6A 2WIIA 3MR9A 4E0RA 3RHWF 2MPAL 2EDTA 3W9EB 5LQBH 4L8BB 4GKOA 1QFPA 2R56L 2E6QA 4PGEB 3ZDXE 3E6FB 3MUZ1 2PYEE 4YAQA 2HKHH 4X7TB 5F9JB 4X6FA 5D72H 5L6YH 3DBXA 5KSAD 1BHGA 4X5LA 3GO1H 1NKOA 3LQZB 2GK2A 2GK0B 4MLSA 2ZUWA 3BP6B 3PWPD 5C07B 4QXWA 4MDIB 4N1HB 4OB5L 4Y4KB 3WUZA 4NYLB 2GJZB 3TNMB 2GY5A 2QQKL 4WEUD 3KNBA 5CKAA 4P5MA 3QIUB 5BRZA 4OZ4B 1C08B 2AABH 5JA8B 4V1DE 3D18B 3PQYE 3C9NB 3FN9A 1P5UA 3MACL 4YR6A 4HD9A 3EOBB 3HAEB 3BP7A 3TBYA 3SDAB 2Y06L 4X6BA 5EU6B 2WUCL 4PV9B 4HG4J 2EIDA 1D5BA 4WUUA 2CKBL 5DVLA 1OARH 4UUJA 1U91B 3C60D 5CAYB 3BZ4B 3DO7A 3MXWL 4YK4C 2Y07H 1YYML 3ZO0A 3ALWA 3U1SH 1A7QH 3TFKC 1FZKA 2H2PD 4WFED 2XQBH 1FVCA 3U0WL 5HTSA 1CBVH 1EBAA 5I1DA 4MS8D 4PJIB 4Q9QH 4KROC 1NGZA 2VDPH 1RHHB 4W4NA 3MLPA 3GUTB 3RVXC 2HAZA 5EIVA 1ZT1A 3B6SB 2FJGB 2Q20A 3FRPA 3QQ9D 3AS2A 4P2OD 5M94B 2Y23A 1OW0A 1JGDB 5DA4A 3LEVH 2ARJB 3EYQD 5CJXC 2APVA 1UZ8B 3E1F1 4YQXL 1RD6A 1MHEA 3CMOL 3DV4A 2WLZA 2Y5TA 1ZHKA 4HAFA 1WIUA 3FFDB 1QBAA 2Z31C 1CLZL 3VXTB 2ICEA 1C7SA 4G9FB 4KI5F 3ZE0F 4LSTH 3HZKB 2H45A 4KVCL 2EDRA 1LO3L 3PHOA 4NT6B 3QI9D 3TGXA 4R7NA 3RL2A 5BVJA 1I85C 4XT1C 3LRGA 1FG2B 3V9FA 5C3LD 4NFCA 5J1AB 2VDNL 2FGZA 3OKDA 3RGVC 5JDSB 3C5JA 5ACZB 5BMFL 3F62A 5GHWH 1DLFL 4HFUH 2RQ8A 4BZYA 3RWGA 4WI6A 2CKBA 3TYFB 3L5HA 1SEQH 3LV3B 1WBYA 2YC1A 3SJVA 4LIQE 5L2JB 3MCKA 2DLEA 4HK3J 2WP3T 4MVBD 1Q9WB 3L1OH 1NAMH 2BXYA 3BVNB 4GUPA 2XTLA 5TE4L 4H8WL 4RX4D 4JG1L 4OM1L 4F9LC 3NCMA 1A3LL 1GZPA 4LCIL 4AIXA 4ZYKB 2HT2D 1IAKB 4JANB 2DS4A 2HMID 3MRCA 2VQTA 1XF3A 3VWJC 3M17A 3NPSC 4JZNB 1NBZA 1DN0B 1PZUB 5FYKE 4NQCE 1DQDL 3UJJH 2YUVA 2Z0BA 4Y19D 3MLRL 4PJ7E 1DZBA 4D8PB 3CFIC 5EORH 3CSBA 5KVDL 1S5HB 2VXTL 5HYFA 3DV6B 3TCLA 4F33B 3BQUC 3HE6A 3OKEB 5DJYB 5BZDA 3HCVA 3BIKA 2WMPA 4NC2B 3H42H 4HH8A 4JN2A 4Q9BA 3ZDXF 2F8XC 5A16A 1OGTA 4FHBD 4S1DD 1UQSA 1CG9B 2QQQA 3BO8A 4EI5D 4L4VA 5D7KD 5H37H 3U4AA 4YLQT 4GG6F 3LY6A 3CFDB 2R1YA 5DEGA 4XB7A 3CZJA 8CGTA 3PDOA 3IF1B 3K4DA 4M1GL 4MLIA 3RVVD 3SKMA 4Z95L 2E27H 3WN5B 5C0CD 2DQFA 2RR3A 3SO3B 1KCKA 5C0GA 4LNVA 5HSFA 4MNHB 4UI2A 1E6JL 3TNNA 5E8DH 1XCQB 3I3DA 3R06B 5J3HD 2I9LA 1IC7H 4YGVB 5I1LA 1EJOH 1RY7B 1S3KH 3MLVL 4ISVA 5GJTH 5GRJL 1V05A 1BD2E 4IHOB 3O45B 3VMOA 1C12A 1ZHNA 1BP3B 5ADPH 3B5GA 2HRPH 2XPGB 4ELKB 4ZQKA 3FKUS 4WTXA 2D0GA 3RUGA 4AENB 5K9KB 3LQAL 1YY9D 1PGRB 3V8OA 1MFAL 3LRHA 4NKIL 3ZTNL 3UTTE 1ACYL 3A67L 1KTLA 4FQ1L 1A7QL 1ZA6A 4ZNEE 2X9YA 2CK0L 2YD2A 3P9MA 3QIBC 2ED9A 4APQD 1U8JA 1OWRM 2J4WH 4ZPTB 5HYJD 1BJMA 4UAOC 3SJVD 2J2ZA 4H0HB 2BDNL 5E2TL 1ED3B 2Z92A 3EO0B 1G7IA 1K6QH 3ZYIA 1YEFH 1I7TA 2EXWC 1J8HD 4XVSL 4PJ9D 2OR9H 1R5VB 3FQNA 4ZFFA 5EZLA 3RU8H 1UCBH 1F3RB 3U4BL 1HZHH 1G9NH 3VXME 4L4TA 3LN4B 5HGDB 5LKNA 5DD3H 3DSFL 4DJMA 5ESVA 1SQ2N 4P4KC 3HUJE 3O2VH 3CFKB 2VYRE 1EEZA 3EOTH 5AG8A 2C7UA 5T1LA 2CRZA 4WEBL 3HKFA 1CLOL 4Z7WE 2HH0L 1SBSH 1BBJB 5D1QB 3GI8H 3QUMB 4OFPA 4Y5VC 5EUOB 1FL5B 1GAFL 3OB0K 5J11B 1C7TA 2K9UA 3M8OH 4JFDB 1M1SA 4H5SB 3MRFB 1CE6B 5KS9A 4ZPVA 4F57L 4I48A 3K2UL 3LS5L 3KPRA 4YPGB 3CMGA 3TFKD 2DDQH 5LGJA 2BJMH 4OF5A 2VXSL 2UZIH 4WFHD 2DYPD 2CMRH 2O5YH 1N2RB 4QTIL 5DJAA 2V2TA 5I1KH 1KCRL 5I1GH 2B2XH 5IB5A 1OT2A 3MV8A 5J8OA 4M8VA 1AD9A 4KROD 5IBTL 5DRXB 3SE8H 2VAAB 4PJ7F 1PQZA 3GJFH 1MCCA 4ODVL 4CU7A 3STBA 3QWQB 4X99B 3PIQA 4OD2A 4NNYA 2V6HA 2Z4QB 1UVQA 3A0OA 4D3CH 1HWHB 2YPLE 2Z31D 1CVRA 4RMUA 3KYMA 1ZSDB 3JSSA 4PJ5B 3RL1A 1X6NA 4LLUB 4M7LH 5F1OB 4Q6IB 1A9BA 2BNRA 3UPRB 3H42L 1FAIH 1TJIL 4QHMB 3O4LE 3EYVA 4C4KT 1C16B 4U1HB 3OR7A 1QSFE 5L8LB 5KOMC 3MLTB 1XT5A 4Z8FH 1QFOA 2IQ9L 3BKYL 3L3GB 4EUPG 2GT9A 3IJHA 1BQLL 5GGVL 1T7XA 3C5ZB 2QADD 3O3EB 5CJQL 3QCVH 1M05A 4AEFA 1B6DA 3O8XC 5SWZB 4HKZA 2BSRB 2FX9L 2H2SD 1I3UA 3MRKB 2H26B 4NSKB 5DJ6B 4G9DB 1IC7L 4HIXL 12E8L 4X0KB 1WZ1L 2WIIB 3QO0A 1KSRA 2FLRT 4KU1A 3VW3H 1G9NC 3SDCC 1DQML 4HIJA 1K4CA 4Q58C 3EDKA 5ICXA 5I1EH 1RMFH 3VWJD 2HRPL 3OHXA 4HWBH 2NY7H 2NY1C 2Y4SA 4N90D 1IAMA 1YJDL 3IDNA 4JJHA 4EN3C 2PYFB 2WBWB 2IG2H 2VXQL 3JV6B 4DKDC 5EUKA 4ZUVA 2J8UA 4UOW1 5FO8B 4GO6B 4G8EB 4ODXA 5E03A 4BKLA 5BRZB 3EOYG 3FMGL 4G43A 4G8FB 3IJYB 5DJ8A 2A74B 1M4KA 1I3RA 2DQCL 3BP7B 3NCFB 4X6BB 5JIKA 4KZEL 4U2ZA 4ALAH 5TDNA 2O5ZH 1NGYA 5GIRA 3HUJF 4LLYA 3KXFE 5JIIA 1LEKA 2X1XR 3ARGD 3HAEH 1QYGL 4CMHC 3QDJA 1A6PA 3SY0A 1H3GA 5HHME 3TP4A 3QUZB 5IWLC 3V7AG 4M6ML 2X4QA 1P7KB 4ZSOA 4PV8A 1RUMH 2VWEC 4JQIH 1AH1A 1MNUL 3HG1A 4B7IA 1I8IA 3RKDD 3ARZA 5KANG 3W0WA 3CD4A 2EYSA 1JHLH 1KTDB 1VFOA 2DKUA 4JVPA 4XAWL 4XMLL 5DUML 5TFSL 3OKOB 5MP6L 3UP1A 4ZS7L 5FYLE 1MRFL 3EO1A 2ZZUT 1ZHKB 3CXDL 1KNOA 2M1KA 4U1NA 2BVUA 3E3QE 1KLUB 5DR5H 3QIBD 2CMRL 4GRLD 5JHLH 3BZEB 5SWSD 5C0BD 1YEGH 3N1GC 1IKNA 1K4DB 4PJCA 2BP3A 3TYGH 1L9MA 2VISA 3KG5A 2EXWD 3BEVA 3DX8A 4ZG1A 3EYOA 3GRWH 2LTQB 3JXAA 2IBZY 4PP2A 3C5JB 2QQNL 4LSDA 3C6LB 2APBA 4R4NC 1Y6KR 3ZHKA 1JZ8A 4PJXE 1MAMH 1YPZE 3WUWG 1IC4L 3RWGB 3H3PL 1AO7E 1SJEB 1WBYB 1J1XL 2P7TB 2I24N 4JQVA 1GIGL 4AM0A 5ALCL 4RNRB 4R97B 4GUPB 1UG9A 4ODTH 3FT4B 4N0YL 1WCQA 4XP1H 4PP1C 4NCC1 1ZS8A 4BM7A 2NY2D 2WBJA 3FONA 5LXGH 4G6AC 3EIFA 4LVHB 3ES6B 3WYRA 3GSNL 3U2SB 2V17H 2DIBA 5DMJB 5JXED 1Y18B 3UYRL 4O2CA 3VXUA 3MRCB 1VGEL 3U36A 2NY5H 2WQRA 3ARTA 4UT7H 1S7TA 5IVNA 1E28B 1NBZB 1RUAL 1KULA 1ZTXL 3UTSE 4Z7VA 3OV6A 1HHIB 1I3VA 5ANME 4GW5A 1ORSB 2R0LH 5K9OA 4H88L 5L2KD 2NPLX 5ISZE 1BVKA 1K9TA 1EK3A 3O9WA 4JRYE 4QOKB 4M62H 3QBTB 4HC1A 3TCLB 4Y4KC 4NKQB 3B83A 5E1AA 3HE6B 5BZDB 4J12A 4O2FA 5C09B 3BIKB 4MYWB 1BVLB 2R2BA 4OLWH 5SX5K 1JWMB 3QIUC 1M71B 3O3AB 1OGTB 5EDXA 3PGFL 1UH2A 3SDDA 4QKXB 2R1YB 3VGGA 3FB8B 3GSQA 2G9HB 2RHEA 4HCRH 1G0XA 5KSUB 1DBBL 3QJHA 1CXEA 5KZCD 4JR9H 1YEHL 3PDDA 3VFNB 2NTFA 3ZT6A 2DIAA 2IGFL 4NHCL 5E1HB 5KG9B 5IB4B 4HLZG 2I9LB 3VFSA 1NEZA 2XA3A 3RNQB 3H9ZA 3QHZL 1WISA 4NUGL 3UYPA 4M1CC 3TV3L 4G8GB 4XP9L 3UC0L 4QYOA 3GMOB 1C12B 1NCCL 4MXQC 4NC0B 3GSNA 1YEKL 3ARRA 3QDHA 5GS0L 2AKRA 4ZQKB 1X5KA 5B38G 2ZPKL 3HR5B 2YBRB 4POUB 4JGMA 1OTUD 1KTLB 4LPXA 4KKCC 4GRMB 3HFML 4BK4A 1YMMB 3MRNA 4I0KA 4P5TD 1U8JB 4JM2B 1HH9B 1MCPH 3RKPA 1MWAB 5BXFB 4LEOB 1UWEH 2YMXL 1RUML 4U1KA 4OZHE 1H8SA 2GJJA 1B2WH 3NH7L 3MQIA 4G6KH 3MFFB 2GSGA 3FQNB 1XGQB 4MB3A 1PYWB 4Y8AA 5DTFA 5F1NA 2GITB 2OZ4H 2CGRL 5KSBE 5DJ2A 5LBSH 2OP4H 1DBML 1IGFH 1ITBB 5C0RH 2HFTA 4N5ED 1R24B 4OF0A 4L4TB 5EBWA 5AAWA 1JYVA 3UX9B 4J3WA 5DUPL 2Y72A 1SMAA 1W72B 1RJLB 2NY5C 1HDMA 4WU5A 1A6WH 1L7IL 4ZO7A 4JM4L 3V6FA 2VN7A 5DJXA 5T1LB 1JGUH 3QEUB 4PJXF 3QDMA 4K9EH 1YPZF 1U41A 5CJOH 3BRFA 4JN1H 4DW2L 5IW6A 5B39A 1VSCA 3ZKXC 2XN9B 2Q8BL 4WWKD 5TGBA 4IIQB 4WFGD 3QH3A 5MEQB 4UT9L 4ZPVB 4C57C 4XMPL 2W9DL 5A2KH 5DEFA 4U1IB 4RWYL 3ALXA 5J1TC 4X6DB 2AEPH 3TC9A 5D6CA 2VLKA 1B4JH 1U3ZA 3QUMH 1LDSA 4KJQC 4OGZA 3M45A 5DJAB 5L9DH 2D7MA 1MFEL 1F13A 4K71B 2J3SA 4PY8J 43C9A 5T1DL 1I3GL 3WFDL 5DQJA 3ULUH 1PQZB 5EOCJ 1X3DA 3P11L 4QRSA 4CVUA 2V5YA 4DVRL 4Y4HC 3WN5C 4U1SA 4NNYB 3NACL 1BM3L 4PIRF 3RY5A 1UGNA 3MBED 2F5AH 5JORA 5EWIL 5TE7L 1OAXL 5LWYH 4OGYL 2BNQB 4MGXA 3OGCB 3RL1B 1P5VA 3QG7H 4XC3H 4Y19E 2FECL 5DLMH 1TVBB 2BNRB 1IAIM 4R90L 4GAFB 4Y89A 5DT1L 5HVGB 5DC9B 1CD1A 3QCUH 3QEQB 2IANA 4NJ9H 4HV8A 1WBXA 5D96B 5IVXB 1TPXB 4LSRH 1N5AB 1HCVA 3NCYS 2OI9B 4KTEL 3G6DL 4MNQE 4NQXA 4ZO6A 1F8TH 1M05B 3GIZH 4O5LL 3UTZA 2J12B 3BI9X 4HKZB 1EHXA 5C0CE 3BD5A 5F9WB 1FJ1A 4BSVA 3TBTB 3QO0B 4PP1D 4HK3N 1D6VH 2Z91A 4G3YL 4TRPL 1LEGB 5HHXL 4TQEL 3W9DB 4HIJB 3WIIH 4Z78A 4YIQB 5SV3A 3WUWB 1KC5H 4OLUL 4F7TA 1S78C 5HHOA 2HKFH 3DSNA 2WQ8A 1EHLL 4K7PY 1C5CH 1CR9H 2H41A 3T0DA 1GHFH 1XGYH 1E0OB 1Y6NR 1MF2L 3MLUH 4NWTH 4Z77A 2DQJL 1AP2A 2BOCB 1H8NA 4K9EC 4OZHF 5EOQL 4ZUVB 5C07D 5BZWB 1NSNL 2J8UB 4KKNA 2OCFD 4FABH 4I77L 4Y4KD 2D2OA 2IPKA 4KMTL 5CJ8A 1QFWM 3BHBA 3QIUD 2WUBL 4BKLB 3PL6A 5KSBF 4Y1AA 4K55A 3WO3B 5B3JE 3S88L 4KZDH 4CVXA 1ERNA 1NDMA 4QT5B 5DJ8B 5D1QC 2R0KH 5HYJE 1S5IH 3SDAD 2BNUB 4JFPA 5EU6D 3CK0H 5DRZA 5T1KA 2B1HL 1FBIH 5CD5C 3WJLA 3IKCA 5J11C 1A3RH 1ODAA 1FNHA 1G0DA 2XKUA 5T3ZE 1LEKB 2Q7YA 1DQLH 3HC3H 3UJIL 5D70H 3Q2CA 3VDAA 1L0YA 4CU6A 5CCKL 1OB1A 2VLMD 3ME0A 4P23A 1T3FA 2VDRH 4UQ2A 4BZ2H 5IMMB 4QRRB 4DWHA 2R4RH 3MV9B 4PV8B 4A6YL 3K74B 4G5ZH 5AZ2L 4GAYA 3C5SA 4M1CD 4ODHH 3WXVH 5DZOA 3AY4A 4YEEA 1CGWA 1W0VA 1UEYA 3IDMB 4U1MB 3S5LG 1I8IB 4LPVA 4JN1L 4NZRH 5CP7A 3W0WB 3FCTA 5A1AA 4M8QA 3VXPA 5IK3B 3EO1B 4FZEH 3MUGB 4MB4A 4ZODA 5TH2B 4UNVA 1MI5B 4TNVK 5IVOA 4U1NB 4ZFGH 3LZFH 4Z0BH 4HJGB 3VFVB 1T1XA 4Q6IC 3RDTA 1LO4H 5ACMA 3ZKMC 1ETZB 3LD8B 1S9XA 3Q6FA 2XTJB 4U3HA 2J7LA 4LCCA 3GSUA 1LP9E 5BOZG 3BEVB 1PX3A 3EYOB 5IFHL 4I9WD 1ACZA 2GQHA 3VXOA 3ULUL 1HH6B 4D2NA 4R4FL 4GMSH 4ZAKB 1AHWB 1BIHA 3SKJH 5KANI 3C5ZC 5GS3A 3ZYOA 1RURL 3SCMA 2AQ2A 4BQ9A 4R4BB 1H3TA 1UENA 2X44D 4MDJA 2Q76B 4AM0B 5FUOL 4JZJA 2VQ1A 1YYLH 2AJUH 2CRYA 4UNTA 4WY7L 2WBJB 4YJZL 4A6YA 2QTEA 1MH5A 1YDPA 2LV4A 3EGSB 4MQXC 4O2CB 4MHHG 3U36B 5T5NF 5CGYC 1JTTA 1S7TB 1T1YB 2R2HA 3MFGB 1D5MB 4Z7VB 1ZLVH 1GSMA 1QLFA 4NQSB 2BY1A 1A6TA 4KKAC 5DZNA 1LO5A 4YXHL 2B5IB 1N8ZA 5HPMA 4GXUM 1BVKB 3GI9H 4XP6H 5C0AD 4ETYA 3O9WB 2DQIL 2XY2A 4KJQD 1OPGL 5E1AB 4OCXH 2Z8WC 2R2BB 3RBGA 2DQTH 4KK8C 3BW9A 3MLXL 3SDDB 1GVIA 5F7KC 5E9DA 2PR4H 1RUKH 1EIBA 3RWDA 3MZTA 2P42B 4ODBD 1WEJH 2YWYA 3RJQB 5DJ0A 5TF1L 4PRNA 5D4QA 4X4ZA 5E2WL 1A6AB 1QRNA 3ROLA 4OT1H 5DHYA 1Q72H 2COQA 5EU7C 4QTHA 1G7PA 1KCVL 2WV3A 1IT9L 1UXWA 3V5DA 2A6DA 1NAKH 5B3JF 1ZVSA 1N7MH 4WHTA 1U3HA 2AI0H 2Q1EA 5EPMA 3QUZC 4PRHA 4XVJH 3VFSB 4I8DA 3IS1X 3S4SB 1NEZB 2YN3A 5KTEL 2JB6A 1QNZH 2VUYA 3QXTA 4HMEA 4NP4H 4D0CA 5JTWA 4XPHL 4C55A 4HPYL 4Y88A 2FO1A 2SEBA 1GGCL 4LHQB 1AGDB 3NFPA 1KTKE 4IMLA 3AXLA 2G75A 4FMKA 3GSNB 4NQTA 1S5IL 3O11B 1OW0C 1JZ4A 2H3NB 4HT1H 4OZGE 4C54A 2VIRB 1FLRL 4UDTB 2FX8H 4YZFE 5LGHL 4Y4FB 1NCDL 1A0QH 4LCWD 4UILH 1JN6A 4WO4A 1F3DJ 2FHFA 3X13B 4ZFOA 1A2YB 3MNZB 3MRNB 1UM6H 4JRXB 2OTUB 3TBVB 1GGTA 3F6LA 1YMHA 4RMQA 4XCNA 3EZ8A 5EZJA 4XWGL 3KPLA 4RFNB 1ND0A 1CXHA 4CNIA 4L3EB 5FO7A 5F7MC 1NGWB 1IGTB 1IGIL 2LTQC 3CPLB 1W0WA 5JW5A 1G1YA 5F1NB 1MWAH 4RGNB 1KN2L 5DJ2B 3C6LC 4NC1C 3O2WH 5IHZB 3KLSA 5CP3A 3D9AL 3OL2A 4EUPH 3LN5A 4WHYG 3BYYA 3UBXG 1HIML 3MOBL 5DGRA 4OIBA 3EFDL 1LP9F 4R97C 1JPST 1Z6JT 5CKGA 2FJFB 4UTAL 1HDMB 2X4SA 4JY5H 3OR6A 3OBAA 4PFEA 3GMLB 3R8BB 1KXVC 5IHLB 3DIFA 4RZCA 1Z3GH 2D4DA 1CTNA 4N9OB 4NQDA 1NGQL 1OLZA 4OCSL 3QUKB 4QRUA 4UIKL 1GZQA 1W72H 3NZHH 4F80A 2DRUA 5IW6B 4S1SL 3QCTH 5CD5D 4I5BA 4NKDB 4JFDD 5TGBB 1EO8L 3QH3B 4Z0XA 1GH7A 5C0NC 3D3VE 3NIGF 1T1ZA 2EO1A 2OSLA 5J6GB 1N0LA 2VLKB 3G5ZA 4HXAH 4LDOB 3ULUD 3OXSA 4OZFG 4JKPL 3V4UH 3HE6C 2F54B 1AQDB 1CE1H 4WJ5A 3BEWB 7FABH 1KV3A 4F2MB 4XXDA 1V7NH 3NCYP 2J6EH 1EDQA 2BCKA 5MI0B 4P2CG 3OZ9H 3O6FA 3BN9C 1VB9A 1WGOA 4P5KA 1HHKA 1KCLA 2YD5A 4KQ3L 3FAWA 4OTXL 4RAHA 1MJUH 3KLAA 4NFBA 4FP8L 4JFFA 4XPAH 1QTYT 3MO1A 1C5DA 3RZWA 4U3XA 5I18H 4FXLA 1JNLH 1TVHB 2E7MA 3BH9B 4X6CB 3LHPH 4PJ5D 3ELAT 4U6YA 3K8KA 2O26U 3S3SA 3STZB 1CXFA 3RA7H 3S5LB 4JAMA 3RAJL 5D7LA 1S9VB 1DUZB 4CVZB 3DRQA 3UPCA 4UV4H 5HHPB 3QB7C 2VZ1A 4HZLB 3IDJB 2N56A 2P1YA 1B9ZA 3RWIA 2BFVL 4ENEC 4NN5C 4QXTB 1YQVH 2FBOJ 3RQ3A 4FXGA 3UPAA 2IWGA 5F9OH 1MFNA 3QWRA 2D7OA 4O9HH 5A3IC 1HHJB 1FRGH 3F7QA 2NX5E 4PJEB 1VEPA 4E41A 1IAOB 3UTZB 5GGSA 3IXTA 4PJAA 1EEUA 2A83A 5CEZL 2APTA 4JM2C 2A6KA 1JRHI 3QUXD 3VG0H 1PLGL 4J6RL 2E7BA 2GJ6B 5MENB 3QNYB 1I1CA 1OAYH 4NM8L 3RWCB 5GS2H 1UXSB 2PTTA 4NNXB 2ARWA 3O0RL 3FFCB 3DX6B 4YZFF 2AERT 4F7TB 4XB8A 3HZVB 3K81A 5CGYD 5HVHB 5KVFL 2P24A 4P46A 1TFHA 2DM3A 4NQDD 3CVIH 5I8EB 3T2QA 4Z77B 3G6JA 1AP2B 4NO2B 3DXAB 1MPAL 4XWOC 4X80L 3UTQA 1KYOK 1TZIB 2K7QA 4MJIA 2A73B 1A7NH 5JW3H 2HLAA 1T66C 6FABH 4KK8D 4ODSH 4EDXB 4FFWC 4IRJD 4MMXC 1HSAB 1F58L 4GSDL 3D69B 4NGHL 2OXGA 1I8MA 5CFHA 4YHOH 1RJZA 5ESAA 5CS7A 5DRZB 1G7HB 4K7PX 3IKCB 5BV7L 3MRHB 3BXNA 3O6FD 5C8JA 2Q7YB 5FA3A 2XA8L 1T22A 2VABA 3CLFH 1FL6B 3DARA 5JIPA 4NQUA 2UUDH 4K3EL 3LDBB 3MV7D 1QSEA 1T3FB 3QUZD 4Y16A 3SKUD 1U3YA 4N8CL 2JF1A 4X7SL 3I3BA 4FQPA 1A7PL 4K71C 1TETH 1FNGB 3F7PC 2FHBA 1A14H 1E4KA 4NKOB 4RRPG 1W0VB 5IMOB 4FTVA 3DHMA 3GSWB 4F7EB 1JF5A 5D7LD 2Q7NA 3ETBF 3QCTL 1OTTD 3FCTB 3B9DA 2CLRA 2IALB 2DMBA 5F7DA 1SYSB 4LOUC 3RP1A 3S37X 4HS3A 4WDIB 1U9KA 3RWFB 4M7KL 1I7ZA 1XF1A 1URLA 4U05A 1U8QA 1NBVL 5DS8B 2UVEA 3OAZH 1A1NB 4KV5E 1MAKA 2PO6D 3OKKB 1BJ8A 3BDYH 3TZVD 1CE1L 3GHEL 1CXLA 4E41D 3Q6FB 4JQXA 4XPFH 4ZTPH 2YUXA 3W2DL 1C5BL 4FOMA 4Z7UE 4AEHL 4JO3L 2EECA 4U2YA 5D96C 4YPJA 1Z5LA 2VWEE 4FN0A 2ADJB 2FR4A 4HH9A 3V4VH 4Q74A 2VDOL 1DVFD 1W0YT 1RQ5A 4OAWA 4OQTL 3EBAA 4NBXB 2AJXH 4PRBA 3I02A 1RV6X 1F4WL 4MDJB 4NO5A 3WEXA 4KPHL 1FL3B 1NBQA 1W8OA 5F9WC 3IFNH 1KT2A 3QUYA 4MZ3A 3U83A 4XNYL 1BQHA 2H1PH 4ONHA 3P3YA 3O6ML 4R2GD 1NQBA 5D71L 5EA0L 5HYSA 2X4RB 15C8H 4A6YB 4EBQL 1FNSL 4MJID 4XH2A 1YDPB 1KIUA 4TUOB 5DSCB 4F7PA 2WANA 2R1XB 2DIJA 5I15H 3OKNB 2AV1A 1BF8A 1NFDB 3EDDA 4M48H 1KEML 3QXDA 1LO5B 4KK5D 3NABH 5F9DC 4F37K 3WHE1 2JJTC 3F58H 1HILB 4GS7B 4EDWH 3N9GL 4QOKD 4N0UA 4X4XB 4EJ1C 3LSOA 2CLZA 1SHMA 3D48R 3PHQA 4F9PA 3HNSL 4O02L 5C09D 4QXGH 2DLHA 3KS0J 1SVCP 2ATPA 2VDQL 2IADA 3ARVA 4YFLI 3V4PL 4GW1A 1LD9A 5E9DB 4KVNH 2EZ0D 4HC1H 2D31B 3C2AH 3QNZB 5IGXL 2I9TB 5DJ0B 4FQJL 1I9JL 1J9CT 5J6HA 1T89C 1YEEH 4XGZA 2F19L 5JHDB 4I3RL 2JJVA 4YHML 1VGKB 5DHYB 3MJ9L 2FECI 5JLZA 1HNGA 3MNVB 1UXWB 1YNLH 3T8XA 3MLYL 3SE4A 2WP3O 2YS4A 1F90L 2XWTB 4M3JA 1U3HB 2VL5A 3GMPB 5DQDH 5LCVH 5JW4R 3IT8D 1KPUA 5DHVB 4G8GD 5C07E 2C9AA 3TVMA 4LLMB 4CGTA 4TPRH 2AEQL 2B1AH 5CWSA 4HPOL 3S3JA 3D85B 4HKJB 4OJFL 3T1WA 1FN4A 2DBLL 5IQ7L 2BK8A 1CGXA 3EFFB 1V3LA 1GRWA 1YEJH 3IFOA 3NAAH 3H7BA 3P73A 4XP5H 3HMWL 4R8WL 1MIML 1JF1B 4GBXA 1AJ7L 2HA1A 2ZSWB 3EDFA 3MRGB 5A3ID 1BZ7B 5EU6E 2YWZA 4WO4B 4FFZH 4ZFOB 5F7YC 2JB5L 1DBAH 4G7YH 4JM2D 4WEMB 5E8EB 2EIZA 3VGDA 1JRHH 5IFJA 1T80A 1MFCH 4DFHA 5CHNB 3LD8C 3DI2B 3GBNL 4NDMA 4NQEA 2XTJC 4RAVA 4KY1L 4LVEA 1ND0B 1I7UB 1A14L 2VLME 3IDGB 1Z2KA 4MXVE 3GDBA 1PG7X 4PJIE 4H1LG 5IT2H 1IFHL 2ZKHH 4ZXBA 2HFEA 4ZAKC 1AHWC 2UZYB 3SKNB 3LKPB 3V5HB 3KS0H 1MLCB 3AM8A 4HS6A 4KV5F 2MHAB 3HA0A 3QRGL 1IAIL 2EIEA 5EOTA 4XBEL 3LN5B 1CFNB 1FORL 3MJ9A 4XWOD 5FCUH 2EH7L 2W92A 4Z7UF 3S36X 5K33A 1T66D 4Q0XL 2X4SB 4XC1H 2ZNXA 3OR6B 2IC2A 3VGHA 1QBLL 4FFWD 4IJ3B 2WBJC 3CFCH 5J89A 4C56D 3DIFB 2YD8A 2UV3A 4G9FE 4MJ2A 1UA6H 3WIHL 1BJ1H 4IDJL 4NJAH 1I1AA 1EAPA 2C1OB 1BX2A 3SQOH 3QRFM 3X11B 4I5BB 3VXRB 4X7CC 2ADFL 5KVEH 3LKOB 5DMKB 5D2LB 4I9WE 1T1ZB 2B5IC 4FZ8H 2OSLB 2VUOA 4JEGB 4NHUA 3MLSH 3EYFB 1U8MA 2NY3D 3O9WC 2AJVH 4YC2B 3V6OC 3G5ZB 2O5XH 1R0AL 2AK1H 4EKXA 5DMGD 1RZIB 2RGSA 4AMKL 5GS1A 2HJLA 4QWWC 1B0GB 1GGBH 1TIUA 3NIDE 1BOGA 3BKCL 3SDDC 1R3HB 1FPTL 4S1RL 3MODL 2WAHA 4MQTB 4XP4L 5BS0A 3CFJA 1Q94A 3FT3B 4LL9A 3MJ8A 4P5KB 4UBDD 5D7IF 5KVMC 5T3XH 1GPOH 2VDMH 2GTZA 2AQ1A 3TVMD 1ZE3C 5D6DA 3KLAB 2Q86B 1FYTD 2UWEB 2VC2L 2NR6C 4OGXL 1HOCA 3BSZH 2V2WA 2KUTA 4N9GB 4U6YB 1MCSA 4JPWH 3ET9F 2F53D 3B3IB 3P77A 4NCC2 1RZFL 5IEHB 3WD5L 4JAMB 3RRQA 3FQTA 4LGPB 3LEYL 3CC5B 3RX5A 4JY6A 1KENH 2J8HA 5CGMA 3TN0B 3QEQD 5DJCA 5DUBB 3WFEH 2B4CH 1TQBB 4TVPH 2CDEA 3QFJB 5HI5D 2X1QA 5IMKA 4YXLL 1YEEL 1D3CA 2HN7A 1N3NA 3LIZH 4FXGB 5HDBE 5IB2B 5IEKA 3DMMA 4I18A 3D39A 3AVEA 4Y4FC 3GMRA 4FQXA 4ZXBD 1KIPA 3AAZB 3PWUB 4JHWH 2C3WA 2FIKA 1KJ2H 2A83B 2A6KB 5DQDL 3SBWA 5FHBL 1UWXK 1LO0H 3MCG1 4PRAA 1DCLA 1WWWX 4RFNC 4QO1A 4DUWA 1OAQL 4ONGH 4ZUWA 2ADGB 1J5OH 1R5WA 3WLBA 3ZSTA 4U1JB 3I6KA 1FZJB 4RGNC 1BFVH 2E7LA 3IVKA 4BFGA 4M43L 1R5IB 2VLJA 2QSCL 3HLAA 2JK5A 2FB4H 1E4WL 1RZGB 3K80A 3TA3B 1F3JA 5KN5A 2HFGL 1DBAL 1P2CA 4MXVF 3AGVA 4PJIF 4BH7A 4GMTL 1T7VA 2M8XA 3CDYA 4PG2C 2K3TA 4NBYB 2I07A 5DK2B 4C4KO 2YA1A 3NFNB 2PXYB 4Z7WB 2AK4A 4OM0L 3VGAB 1RJZB 5K9JL 4XMKH 1LE9A 5C6WH 2CDFA 2VQUA 3SKOA 4OCWL 3C09B 3JZ7A 4M5ZL 3VI3E 3ARYA 4TULH 5BS0D 2VABB 4LEXL 1J0JA 2Q8AH 2X5PA 1KB5B 4G6JL 4UTBH 2FWOB 1QSEB 3BWUC 4F58L 4Y16B 2NYYC 1T2QH 3AB0B 4D94A 4HBQA 4QRRD 1K5NA 2Z35B 3STLA 3AREA 2VDLL 4ZUUA 1TDQA 2BVPB 5I17B 4DQOL 2DQUL 3QFDA 1G7QA 5MI0C 1RHFA 3FB7B 2OK0L 4FTVB 5MEPA 1UA6L 1IGYA 4TSBH 4WW1A 4YDIH 1D6EB 1OAZH 1MIEL 4N68A 4H20L 1KIQB 4OCYH 2EE6A 2FBJL 4FFVC 1I1FB 3UEZA 5IG7A 2CLRB 2BOBB 1A1OA 1K8IB 2XWBB 1TMCB 2DQDH 3FZUD 3FTGA 4HS3B 1I9RL 1VA9A 3W5MA 3L95B 1MI5D 1CWVA 5E08H 3NIDF 5EUOE 4LLWA 1XF5A 5GJSH 3T0AA 3T2NL 5JMOC 4JFDE 3OPZH 3RHWK 3LB6D 4FFYL 2B4CC 2NCMA 5CEYB 5E94B 4YWGH 1EO7A 5I1JH 5EU5A 3E8UH 1ZLSL 1HSBB 3U7WH 3HPLA 5I1AB 1YEIH 3K4ZA 4J4PA 1NGPL 5CILH 3P4NB 2P47B 1HWGB 1LK3H 4JO2L 2VOTA 5DVOA 4ZAKD 5CINL 4HUUA 2XZCH 4NRXB 4CN1A 1UC6A 4WTZG 3ULSB 1LEIA 3FO1A 4YUEL 4D9LL 5IJKA 2ORBH 3SGKA 4AJ0A 3ILPA 1A6VL 2VLJD 1VKXA 1YC8A 1CFVH 3L3DA 2BMKA 2XRAL 4H1LB 4Y2OA 1S9YB 3KPSB 5GGRY 3U0TA 3BT2H 4PJ5E 2AGJH 5HDBF 2FSEB 5JPNA 1CD0A 2HG5A 3WHXA 4OLZH 5HVHC 5E7FA 4F7PB 1MVUA 1E4XH 1U92A 3N06B 1P4BL 1XZ0A 5EO0B 5GISL 4AYFA 3P9LA 5C7XL 1YN7B 2C3XA 1XF4B 1ORQA 1F6FB 3EW3B 5AYUL 4N0UB 3RTQA 3LSOB 2CLZB 1S7QA 2X4UA 4WHYH 2ZUQB 3FQWA 3NN8A 1D9KD 5EBLA 3ZDYF 3V95A 4DN4H 2F5BH 5DJZB 1P9MA 3ZT7A 4PBVC 4PJDA 5I16A 2ZJSH 1Q9KA 1U8NA 2ATPB 5DQ9B 5SWZE 3MV01 1FFQA 2IADB 1CGSH 5ICYB 3AC0A 1LD9B 5JUEH 2DWDB 1RZKL 2FATH 5H94B 4J7RA 4S2SA 2AV7B 1VADA 2E9IA 4U7SA 2AJ3B 3ZE2E 3WJLC 4DK6A 4RMWA 4AG4H 2VLLA 3EJZC 2NR6D 1DLHA 4R0LA 4FS0A 2F58H 4WI5A 3LDBC 2VO5A 4Y0GA 1P6FA 5C0FA 3Q6GH 1AD0B 4JDVB 3OAUH 4U3CA 2OTPA 4KHTL 2VH5H 1BBDH 4N8VA 4AZ8A 5IFAH 1KCSL 1CL7L 1ZLWH 5GSVA 3KYKL 4QCIA 5CSZA 5BRZE 4TSAL 3KR3H 4OI7A 4P2QA 1UJ3B 2LAAA 1EBPA 1WCBA 5DHVH 3RI5F 3LCYA 2CK2A 4GBXB 4G6ML 4Y4FD 3WJJC 1N4XH 1RZ7H 2NLJA 4K8RL 1KJMA 3IU4L 2R69H 1L0QA 2JLLA 4ODUA 4JRXD 1MEXL 3B8SA 3RDTC 3SGEI 5EU7E 4PUBL 3HNTL 3OXRA 4NDMB 4RAVB 3L3OA 4KRMB 1WAAE 1INQA 4YX2H 5H8DA 5MEOB 2QJDA 4R9HA 1IZKA 3DX7A 1DDHB 1PY4A 2QBWA 2HFEB 4NO3A 3V0WH 4NPYB 4RGND 5EUOF 4GRWB 5DMYA 4WCYH 4RGOH 3H2WA 4HS6B 3RVUC 1H15A 3TJEH 5EOTB 1EVTC 2A1WL 4KAQL 4OZIB 3QO1A 2P8MB 2WWKO 3L3HB 4NWUL 4JFYA 2G60L 5TDOB 1GOHA 3IDXH 3OKMA 5I8KL 2W0FB 1XGRA 2OJZH 1YQ2A 3MRQA 2ARJQ 1T0PB 3ARDA 1AE6L 4KTDL 3U7WL 1CT8A 3QPQC 1FNFA 2JIXA 2MOVA 5I1CH 1N6UA 4HMCA 1I1AB 1KOAA 1EAPB 2H9GA 1T0MA 1BVZA 3MROB 2E8ZA 2PETA 4G42A 3U7AA 4TOYH 3CFBA 1ZVHA 4PRPA 1MFBL 1EHNA 2A38A 1UB5A 4GS7C 5EZOH 4NC1E 3JWOH 5DD1L 3MCLL 2F54D 4MSWB 2HJLB 3QPXL 4K3HA 4PYHA 1OM3L 4JPVL 2VE6B 4MQSB 1NKRA 1BOGB 4X9BA 2EDOA 2VITA 4J3TA 1T0NA 2X40A 3I50L 5HJ3B 3EAKA 2GKIA 4IBLT 1JTOA 4M9OA 1JNJA 2IFFH 4JFEB 3C87A 3DTXA 1FO0B 1H8OA 4K7PL 4PTTA 5I76B 2Z93A 2GTZB 2YPVL 1E4XL 2HT4C 3WL9A 3VDCA 3I6GA 1HOCB 2DQGL 4LAQH 5FHAH 2V2WB 5C2BH 4U33A 3DVNB 1MY7A 1U3HC 4MA8L 2ICWB 1GJIA 2GI7A 4TVPD 1EX0A 1MOEA 3IDIA 1TXKA 5AYQA 4LARL 3VXMA 4J3OC 3CLEL 4QOKE 3ZE2F 2I60H 4MD4A 4JY6B 3RZCD 1CGSL 3PWJB 4DAGH 2FD6H 1T1WB 5DJCB 3G04B 5C09E 1RIVH 2P8LA 4K94L 2ZNWA 3HE7B 5L0QB 1CZ8L 3S37L 4P2YA 3VH8A 1UB6A 4PR5B 1N3NB 3IU3A 4TSCL 3WDJA 5IEKB 3F8UB 1T7WA 4I18B 3SEPA 2V7NA 3GMRB 3HC4L 1K2DA 4FQXB 1KIPB 4PRIA 4WO4C 1A02N 1KG0A 1RIUL 1RUPH 4PG9A 5TQ0H 3I2CH 4HXBL 4M6AA 1PZ5A 3RY6A 3S96B 5D5MA 5GGTL 1B6UA 1OL0A 1MRCH 4ZS6D 2YA2A 3OAUL 4EI6A 5CMAA 5MEND 4XVTL 3MYZA 1EEYB 1SY6H 5E70A 3CH1B 2NTSP 1A6UL 4Q6YA 4PJBA 1WICA 3MREA 4NZTL 1KIRA 3IVKB 4G8GE 3RIFF 1CD8A 4NQVB 2KPNA 3TT3H 1I8KA 4LHUG 2JK5B 3FN0H 3LPWA 4QLRA 3DXAD 1AGEA 2XY1A 4OFYA 4LVNB 1WAAF 5KN5B 4OV5B 1VCAA 2QQLL 3N85H 3TLRA 4G6FD 4XNQA 3EYUH 2PYEA 4IJ3C 1NMAH 3O6LL 4GG6A 4LGRB 1LO2H 1YMME 2WSKA 2AK4B 4CRPA 5FA4A 2GUOA 2VERN 7CGTA 4K8RD 1NMCB 4FNLH 1LE9B 2X4PA 5EC1A 4M7LT 1WF5A 2CDFB 4U6VH 3JWOC 5FKAB 4NNPL 2DJ4A 1T03H 2DLIA 5E5MA 3D2UD 1AR1C 2MQ3A 2YK1H 3O81A 5CEXA 1HKLL 2EDKA 3LH2H 4PB9H 3THMH 1DL7L 4V1DA 4DGYL 1NJ9A 4M6NH 4YC2C 2X4OB 2OMNA 3LKSB 4GH7B 3LRSB 4I0PB 1OF2B 1CK0L 3HHRB 3ARXA 4L4TE 5T5FL 3U7YL 3BP4A 4ZUUB 5IB3B 1EUTA 3QZWG 4XCYB 1J05B 4D0DB 1IQDB 2BRRH 1UJTA 4FQ2H 5GGTA 3GMMB 4LIQL 4OZFA 1IGYB 1KB5H 1CICB 3VFPB 3LEXA 3UROR 1I7RA 4HKBB 5CBAA 1NFKA 3OTTA 1C8PA 2L7JA 4M4RA 3WO4C 3KLHC 1P69B 4LVOB 4JPIA 4MCYA 1L7TL 1S7VA 4RFOH 3TPUA 4KJPC 4BZ1L 1TZGH 4J1UA 2P5EB 3MXVH 1EEQA 2W60B 1G9MH 3PWNB 2XN9E 5HHVH 2IAMA 3EYSH 5ITBL 3KAAA 1KYOJ 3SGEH 5FYKL 2BHYA 2HJKA 3KJ6H 3RWHA 5EU5B 4PB0H 1GL4B 1IGMH 4LCUA 4NKMB 4X6DE 4MCZA 2EYRA 1YEDA 1ZLUH 4X9FA 3EO9L 1KFAL 2V5RA 3PG2A 1H3PH 1IAII 4FQLL 5H35A 2CDGB 4HIIA 2ICWI 1TQBC 3MV8E 2UVFA 3GZKA 1V7ML 2CIKB 2QKIA 1XIWD 5F7NC 5IB1A 4XPTH 4X8JA 1JHKH 3VFMA 3RVUD 4DGIH 4ERSH 1JF6A 1X5HA 3H0TA 4DTGL 5GGUA 2NXZB 4YHKH 3W81A 4JHAH 3PGCB 5C2BL 3ILPB 1RK1B 3MLZL 1VKXB 4PGCB 3SOBH 3BKJL 4F7CA 4K3JL 3L5XL 3P30L 3KWWA 3BAEH 4MJ4A 2BNQE 1PG7L 1MCQA 5HHNA 5JPNB 3BUTA 2HG5B 2W07A 3I6LE 4X5XB 1A47A 3ZKQD 1ZGLA 2PTUA 2XNAB 3I9GL 2BNRE 4WU7B 4KXZI 1TNMA 1MVUB 4H1LH 4F8TA 3MRJA 3KYOB 3ZYZA 4ORZC 3HNVH 4QRPA 3P9LB 5IVXE 3TA3C 4W68A 2DN7A 2MSPA 2DB8A 3S36L 3S35X 3RTQB 1S7QB 3O3BA 4LQFH 5EBLB 1UACL 4BQCA 1SEBA 4OKVA 2V2XA 1GC1L 5GSRA 1QFWI 3PQYD 4NQCA 3WBDA 1DFBL 4P2RA 3VGAC 4PJ7A 1DUYA 3V6ZA 5DO2C 1NLBH 1VADB 5FECB 1RZ8B 1W8NA 1I1RA 1ZT4A 3C09C 2A77L 5JHDD 2AXGA 2HT4D 4OD3H 4UDUB 1HN1A 1KEGL 4J8RB 4ZOEA 2Y36H 2UY7A 4X5WA 3EHBD 5GGQL 3NZ8B 4GW4B 4GLRI 1NUFA 4Y16C 4JM2F 3AB0C 3WFBH 2C1PB 1XR8A 5GZOD 1AXTL 3U0PA 4XI5C 1XFPA 4N8VB 2J8UE 1E4KC 5KJRL 5GSVB 3EZJB 1DQQA 2I27N 4UV7H 4QCIB 1G9MC 4PD4K 1UEMA 3TH2T 3D87B 3IETA 3B9KA 5K9QI 1EFXA 3HI1B 4YDJA 4H0GA 5FO9B 1BMGA 5L7XH 1F4YL 1BD2A 3KPQB 2L4OA 3BRGC 4EEEA 4H26A 1OGAB 5E0QA 1ZWIA 2HLFC 2CO7B 2ZG3A 3DRTA 1SM3L 5J7CC 3OXRB 4JQXC 3L3OB 3E2HB 3D0VA 4FQ2L 5F88B 2P44B 3UTTA 4QRRE 1QD0A 3MV9E 4L8CA 4DZ8A 3F7VA 3C08H 3NCJL 1UWGL 3HZMA 4HGWB 3N50A 2NZIA 4GG8A 4YBHA 2VXUH 1BEYH 4NZJA 4PJ8A 3QO1B 4Y8DC 3W0WE 5EIIB 4X6DF 3FRUA 4HBCL 5EFIB 4R26L 3WIFA 4GRWH 2GEEA 3OKMB 1MI5E 4U0QB 4XCCH 3KJ6L 3MRQB 1X4ZA 5FYJH 4ESKA 2CLVB 2CJUL 1F4XL 2DQHL 2JIXB 2VKWA 1O0VA 3ECBA 2X70A 3KHOA 4PGBA 5CBEA 3V6BR 3QULB 5KSVA 1QLRA 2H9GB 4LNRA 3V5KB 3CVHA 2XTJE 3HUJA 5FYKD 1KXTB 3ARPA 3CSPA 1AR1D 5FCSH 1UB5B 2R0ZH 1JPSL 5I74B 1ZXQA 3QXAB 1H5BB 2R23A 3LPFA 2ZUQC 3VD4A 4DKEL 4LRNL 5DYOB 2DJUA 1A5FH 3FQRA 2VITB 4XRCA 1XR9A 5BQ7A 1HINH 3T2OA 3PV7A 2IBBA 5E24E 25C8H 3ARFA 3DTXB 4YHLH 4YO0A 4NZUL 5TPWH 1WVZA 2FEDC 5IVXF 1U58A 4MXWH 4PJFB 5D9SA 3MPCA 1A7RH 3MRBA 3L3KB 1FGNL 2EE2A 2H6PB 1CFSA 5F21B 4KJPD 5E8PA 4JHZA 1FO0H 1YECH 3SE4C 5C6TL 1OP5K 3CSGA 3QZWB 1N59B 2DD8H 2W0PA 4Z7VE 1JWSA 1K85A 1MCKA 5C08B 1T04A 1F11A 3VU2A 1R6VA 4XTRC 4YBQC 4HJJL 3B9VA 2FL5B 5E6ZA 4I4WB 3V6OE 5JO5A 2FLBT 3TN0D 4U49A 4HWUA 3LKNA 1EXUA 3H9SA 2P8LB 3MA9L 4XBPB 4OI8A 1NBYB 3MUJA 4QHNA 5D1ZA 1UJ3C 2AJZB 1BWWA 1RZJL 2FEEL 1S7WB 4GBXC 4GQPH 5TE6L 2G2RA 1IGCL 3U9PH 2ERJB 1K2DB 2MCPH 1P4LB 1WIOA 4J2XA 2J8UF 4PREA 4EZMA 2PTVA 4KHXL 5D5MB 3VFGL 1RUQL 1GGIH 4LPCA 1I9IL 3BD3A 3A6BL 5ID1B 1ULVA 1X5LA 4KXZH 1NCAL 4WW2B 4PJBB 2HTKC 4IOFD 3R0NA 4P3WA 5FIEA 1BAFH 3GBML 4TUKL 1RFDH 1JGEA 1J1PL 5DWUH 3CUPB 3I84A 3TA3D 4N0CC 3WS3A 4TTGA 1G6RL 3QG6A 5ICZA 1HXYA 3E0GA 3TBSA 3D1MC 5FYLL 2QLVB 4OLXL 2VB5A 1NC4A 3DECA 3FOLA 4JO1H 4YGAB 3QA3B 1QFWH 4DN3H 4EOWH 1T2XA 5C0JA 2PXYD 1FV1B 1P6AB 1O5DT 1SBBA 4JY4A 2EKJA 2VR4A 4JRXE 2GUOB 3BGMA 5D7JD 3V52H 5BW7C 2AXFB 2R8SL 5DO2D 1I1AC 2RCSH 1A6ZB 4E42A 1RVFH 3GK8L 4Y2DD 4L3EE 1UYWL 5FM5M 5E5MB 5CZVL 1BQUA 4C58B 5DMIL 5HDLA 5CEXB 1JNHA 4RGNE 2LVEA 3MJGX 4GLRH 5ADOL 3U48A 4RDQF 1FH5H 1N5YL 3D6GA 4AT6A 5MHSD 4XI5D 1M7IB 2I5YH 5ILTL 1JK8B 1U93B 3O41B 4X9IA 5CBAB 3MRMA 1CVSC 5I8CA 1AI1H 5DFWH 1D5IL 3JWDL 2YD6A 4JPIB 5IR1A 1KPRB 4PS4H 4MCYB 2X05A 5E6IA 3TPUB 3VXNA 2YPLD 2XZZA 4U6HB 2VZTA 4Z18A 3ILQC 4Y5VB 2XOTA 2EKSB 4XZUB 1JZ3A 3GJEA 1G0YR 3I85A 2P8PB 3HAEG 3QXWA 1PSKL 1CDCA 1G6RA 2HJKB 1SYVB 1F2XK 4MCZB 3WFHB 3O4LD 2VLKE 4RBPH 1K8DA 3OJDB 1QSFD 2W91A 5I0ZA 1HK6A 5A2JH 2F54E 5T3XE 1C1EH 1MCOH 3HE7C 4HIIB 4UOJA 1JGLH 5L0QC 4JO4L 3MBXL 3SDXB 2GY7B 4X8JB 3VFMB 2X4NB 4P9HL 4RISL 3QDGB 2W0LA 4I18C 1HI6A 5F89B 4CKVX 3H0TB 5GGUB 3BJLA 2JELL 4JLRA 4O58H 4FQXC 1KJ3H 1RU9H 1BOYA 4OGAD 1E27A 2ED7A 3GGWA 4LU5L 4AH2A 5ALBH 4EIGB 2VNCA 2C26A 2E8YA 4HQQL 4ONFL 1DBJL 2X7LB 3M1BA 3KWWB 4X6CE 3PP4L 2OL3H 2IMMA 4LSQL 4KMLB 5HHNB 4YNYB 2X4TB 4HWEL 3HMXL 3EOAB 2HVKA 2IH1B 3VGBA 2WW8A 3MRJB 5JQ6L 3SGJC 4IOIA 4QRPB 1NCBH 3ULVH 3R1GH 3K0WA 1XF2B 3GSRA 4C83A 1HXMA 5TQ2L 2MCPL 1IM9B 3E6HB 3L5JA 4LSSL 5C0IA 2VKXA 4LVNC 3FL7A 3MOAH 5B4MC 2MQ0A 1SEBB 2V2XB 1KBGH 2EXYC 5ESQB 3CCHB 1ADQL 4R3SB 3UTSA 1MFDL 1A3QA 1FCCA 2V5SA 4P2RB 2IEPA 4PGDB 4ZFZB 1INDL 5IOPA 1NFIA 1DUYB 5JZ7C 1NMCC 2YA0A 2FEDD 4QEGA 5ISZA 4BSJA 4JRYA 2GJ6E 2QHRH 1U6AH 5MENE 3MUY1 3GMQB 4BH8B 1TTGA 2AXGB 3WHE0 3KXFD 5EC2A 4R7DB 1UKSA 3BUYB 3FFCE 5EZIL 5EU4B 1FFPB 4X5WB 4XCEA 1MHHB 1IM3A 2P43B 3VRIA 4YHPA 1TJGL 5HHMD 5I8OH 2PW2B 3DVFA 2GAZA 2ZOKA 1QR1A 4I0PC 1PBYA 3NA9H 2A2QT 1JPTL 1AY1L 4XTRD 4AL8L 1S9WB 2D7TH 4O51A 1MUJA 2P5WB 2NMSA 35C8L 3DXAE 3QIWB 4WI2A 1CICC 3DUUA 1WBZA 2CR3A 2VZOA 4JPKL 4RWHA 4QY8A 2RCSL 1CDBA 5FYLD 4LVOC 2NQCA 3ZDZF 3IETB 5KSAA 3MRLB 4XNUH 5E56A 4G7VL 1TITA 3EJJX 4O4YH 4UT6L 3S34L 5H2BB 3WNPA 2VZ3A 3PWPA 1ZWIB 5I66B 3EDEA 2R15A 3SE9H 5TDPB 1U42A 2RJMA 3FN3A 1OAKH 5L88L 5BO1L 4J4PC 4HIHA 1OD7A 3VRJA 1ADQA 1T21A 3KYNB 4L9LA 1R3KB 2CPCA 1LMKA 1WJ3A 4MAYB 1J87A 1EVUA 3HZMB 2BVQA 1ES0B 3C60A 5JOEA 4YHIA 1AO7D 2A9MH 5FYJD 4YEFA 4PJ8B 2NXZC 4D9QE 4OZHA 2P4AB 5F72S 3DETC 1S7RB 3QXUA 1INEL 5CZXD 1FVEA 2ZCKH 4MJ6A 4L8DA 4LLVB 4N0FA 3VMPA 1UCTA 3PHSA 4M1DH 5CIPB 3G5VA 5KSBA 2IPTH 3IGAB 3KPPA 3ULVC 2VDKH 1QKZL 2ESVB 1JPFB 1DEEB 1H0DA 3HZYA 4WI7A 5DI8A 1X5FA 1UKTA 1WITA 4P3CH 4LSVL 4P2OA 4LNRB 3X3GH 2EYTA 3CVHB 3FQXA 4K7FB 4DVBA 4NM4L 4LK4A 4DKFH 1OD9A 1RJYB 4HWZB 1HNFA 5E2UH 1KACB 4POZC 4JRYD 1A4KA 4X6CF 2ZUSA 1NGXA 3CX5K 3NFSL 3RTQC 2R23B 4Q9RH 4L3AA 4YHNA 5E99L 3VXSB 4NO0B 1J0HA 2R2EA 5MERA 1B0RA 3QI9A 2APWA 2ZUTA 1BGXH 1FVDA 2DLTA 1DSFL 4JFED 2FX7H 4RAUB 3VWKD 4L8SA 3QNXA 1U58B 1MCIA 1DE4B 2FJHB 4DGVH 2NY0D 4L5FH 2HFFA 4M5YL 1I4FA 5GRXG 3RVTC 2BC4B 3KPMB 5E8PB 3ILQD 3T0EB 4PJEF 1JWSB 4HIEB 5F1IA 1NFDE 1EGJH 4FQIL 4XPGL 4OLYL 4RX4A 1TLKA 2EDXA 3CFEB 5JMRA 3TESA 1KBGL 2VLRB 2A9NL 1ZV5A 4M00A 5EO9A 5F7LB 1BFOA 2O93L 5F93C 3VJ6A 3OAYK 4JZOB 1A7OL 2YEZA 3CAFA 4U0RB 5JR1L 3FB5A 3H9SB 5E4EB 1U0QA 3HE7D 1YC7A 2NXYB 5DRWB 5IBLC 4QHNB 3QHTC 1AGFB 3TIEA 3JTSA 1P53A 4NIKB 5E9DE 4Y19A 4WGWB 4QXUH 2G2RB 2IH3A 5IESH 3QJFA 5ECJE 4YFLF 2PW1A 3FO0H 5INDB 1NL0H 2NW2B 5JHDE 3TT1H 5AWNL 3PGDB 4HS8H 5E5RB 1SJHB 2OLDA 1X5GA 4JJ5B 3T77B 4F7MA 1RPQA 3H3BC 5T3ZL 1XGTB 4EI5A 2DI8A 4JE4B 5FYKU 3E2HC 2P49B 1CFTA 2ITCA 5IM7B 2H32A 1AC6A 3BIBX 3BZFA 4LP5A 3AROA 3LMJL 1CYGA 5ID0B 2Q87A 3F12A 5C0CA 1GOGA 5I1IL 2AAVA 2A0LD 4XNXH 1FE8H 5IQ9B 1EMTH 3DVIA 4IRSB 3DVGA 4L1HA 1Z9OA 3TIDB 1QLEL 1OP3H 2EC9T 2R2CA 3LKRA 1AGBA 1V3JA 1HXYB 5B4MD 2EXYD 1NC4B 1T6VN 4OCRL 3SQBA 1QACA 5C0JB 2EEBA 1G1CA 4WV1B 3GM0A 2XQYG 1JNNL 3BGMB 1MCDA 2P48B 5EBGA 4K07A 4E42B 1WK0A 2FDBP 4HX1A 1XH3A 2FZ3B 3MX0A 4WENB 4XVUC 4HF5H 1Z0NA 3MRPA 4M7JL 3WSQL 4X6EB 32C2B 3S35L 2D03L 4PGZA 1A1MA 1QHOA 3KDMA 1QQDA 5I74C 4OI9A 4MNGB 4ZD3L 1H5BC 4APQA 3JVGA 4YDKL 3W11D 4MA3A 5HYJA 4GXVH 4I0PD 4AT6B 3HI5H 3ISWA 4XNMA 5DRNA 1L4IA 1J8HA 2NY4D 4PJ9A 4M6OL 5DFVC 1CICD 3PNWA 5F1KC 4HK0A 4LPUA 3QQ3A 2LE9A 5E2VH 5I30H 3IFPA 4Y5XB 3ZL4H 5C0EB 3S8WA 3MLWH 1TCRA 4K23H 4P57A 1MHCB 3VXNB 2P5ED 4AEIH 5KW9H 4X4YA 4OSUL 3ZKXB 5JDJA 2CIIA 2VAJA 1U8OA 5IHBA 3VXRE 3B2VL 5D2LE 3QEGL 3Q1SL 1II4E 1AQKH 1CN4A 2L0DA 4NN7B 4JCLA 3IRPX 1K8DB 1R3IH 3O4OB 1DBKL 1U8HA 4Z5RB 4I3SL 4ETQA 4DOHB 1NCTA 5D1XB 3MA7A 2EEAA 2Y6SC 5DVNA 2FIRT 3SGDI 2ITDA 1BREA 1QA9B 1CDGA 3UTPD 5LQBL 4MNQD 3UYOD 1NFDF 3D0LA 1QO3B 2ERJC 4MAUH 2NXZD 4LASH 4Y4HB 2HKHL 3WFZA 5D72L 3V8CA 1LP9A 3DETD 2DYPA 3WFCH 5L6YL 3FRPG 1U8LA 4AH2B 3RY6C 4EVNA 5J56B 2EDFA 2UWEE 3GO1L 1JFQH 4LKCB 3WKMH 3PF2A 5GGRA 1NH6A 1CQKA 2K7PA 5I75B 1EJ6A 4AIZA 5FDWA 1JUFB 3PWLA 1MCHA 1N6QH 1S7UA 4WW2C 3GMNA 2HVKB 3BZDA 5AZEH 2FRGP 2AABL 5KAQG 3VE0A 1TCMA 5CJXA 1TVDA 4KDTA 3U46B 1FDLH 3MGTB 2Z31A 4C83B 4POZD 3QFJE 4RQQB 4LSPH 1D5ZA 1E6OH 3AS3A 5C0IB 1OARL 3ARBD 5EULV 4IRZH 2D9QB 4KQ4H 2J88H 1I8LA 2Y07L 2R29H 3U1SL 2XZQH 4B50A 4GQ9H 2W65A 1T20B 3B9AA 1R3LA 1G7JA 3L7EA 2G5BA 3FB6A 4KUZH 3PDGA 2XQBL 4UQ3B 2EE9A 3TBWA 2X42A 1I85A 5E00A 1CBVL 5LVEA 5IOPB 4HJ0D 2FGWH 2RB8A 4Q9QL 4U6XB 1PKQA 1NDGA 1WWAX 2UYLB 2VDPL 4YXKH 2DOCA 5IROC 4K94C 5EBMB 5T3ZD 3GSVB 2LVCA 1IKFH 5ERWA 4GKZA 3GEWB 3ESVF 3ARQA 1NLDH 3LEVL 3BPCB 4XCEB 5HD8C 1QFUH 3BPLB 3J7HA 4YHPB 2YKLH 4LHJB 2EDEA 3RWEA 2ZOKB 1QR1B 3L5IA 4CMMB 3IJSB 4ZTOH 1KJVA 4O51B 4JFQA 4F9LA 1KELH 2IPUK 1MCLA 4B5EA 3EJYC 2OTWB 2FEEI 4LSTL 1AGCA 1IEBA 4KJYA 3HRPA 4CJ0A 1XAUA 2PKDA 5HVFB 4IS6A 3VWJA 3P4OB 2QR0B 1NMBH 5IBLD 1VFAA 1VENA 2Q3ZA 5KSAB 2RIKA 4MA7H 1LK2A 4YH6A 2EH8H 2QSTA 2WWMC 1Q0YH 1N64H 4ELMA 1FC2D 5IKCA 3WE6A 5EH1A 4TUJB 5I0DA 2DI7A 1NC2D 1OGAD 5GHWL 4UU9B 4WIQA 3VFTA 1J0ZA 4HFUL 3FO9A 1SEQL 1LE5B 1S7XB 1JYXA 4H25B 2GHWB 4PRDA 4HIHB 1QSEE 3K7UA 1NAML 3L1OL 3UO1H 3VRJB 4V2CB 1LNUA 4YHZH 4ZDHA 5SWQA 5MHSE 4LPWA 4JKMA 3RJDA 5SX4I 4DUVA 1YY8A 2BVQB 3RVXD 4FTVE 4K23L 1X7QA 4ZOAA 4FQCH 2XXMB 4YBLB 5D2LF 1YNTA 1U8PB 3ARGA 4P99A 1VACB 4X83A 3UJJL 4CDHA 4MJ6B 5EORL 1U8KA 4JDTH 2KQNA 3G5VB 2X6MA 43CAB 1JV5B 3OKYA 3BKMH 3K1DA 4LHUD 3KPOA 5FB8A 2DQEH 4PD4J 4BQBA 1S7SB 1NEUA 3FQXB 4OD1H 5CIPH 1EH9A 3P4MA 3MNWA 1ONQB 4XVUD 2UWEF 5BVPH 3RGVD 2APFA 3VD3A 5IHUH 3TO4B 5F7WC 2E27L 3L3IA 3QIBA 3QQ4A 1PAMA 3CVHH 1KLFA 4GRLA 1FNEB 5SWSA 5C0BA 2YHGA 1X6LA 3F65A 4JHBA 1WT5A 3QI9B 5E8DL 2ENYA 4CW1B 5CJ5A 1FVDB 4J3UA 5DFVD 5T33H 4S10A 2OXHA 3HI6H 5A2LH 1EJOL 3RWJA 3MR9B 1S3KL 1UM4H 5GJTL 4DZBA 4L8SB 4E0RB 2MCG1 3JUYA 3KPSE 1NAMA 1J86A 2DL2A 4X98A 2XXCB 2HFFB 4JG0H 4NN6B 4GXUN 3TWCH 1VPOH 5ADPL 3TJHC 4YAQB 1ZEAH 4JKLA 4X6FB 4CN6A 3GHBH 2EC8A 5TJWK 1J1OH 3DBXB 4KRPB 3LS4H 4KGLA 1JZ2A 1CXKA 5EO9B 3QIWC 4N0UE 1ZA3A 3BQUD 5JXEA 2YEZB 2APXA 3T1FA 3KNBB 2X9XA 2J4WL 5FYJU 1FIGH 1FGVH 4P5MB 2B0SH 2GYSA 2BVTA 5DHXB 5JW4N 1Q38A 3SGDH 3NTCH 5HGAA 1I9EA 2MKWA 4YE4H 3TIEB 3DURA 3UJTH 3ZKNC 1K6QL 1WFUA 1YEFL 2MNUA 3A6CH 3S97C 4YR6B 2OR9L 3TBYB 3WLWC 3JV5A 5L2KA 3GJFK 3RU8L 1UCBL 1D5BB 4WUUB 1HZHL 4KH2A 4ZO8A 3TEUA 4KRLB 1MJ8H 1MQKH 4UUJB 1G9NL 3DO7B 3PXJA 5DVKA 1P4IH 2DTSA 4HDIA 2VN4A 1FZKB 3OKLA 5DD3L 4KK9C 1FVCB 1FFNA 1VFMA 3WDIA 5FM5O 5FEBA 4RMRA 2ITCB 1FIEA 2W9EH 3VA2C 4Z7WF 5I1DB 5C9JA 4MD5A 3O2VL 1FZOA 3ZZ1A 3EOTL 3OJVC 3IXAA 1NGZB 4MAYC 4PYGA 1CD9B 1N0XH 1WSST 1J12A 1ZT1B 1JWUA 1SBSL 3CDFA 1Q0YL 3PV6A 3GI8L 4PJ8C 2VXVH 5IJVA 3M8OL 3LKRB 4HGKC 1AGBB 1MHEB 3BX7C 4UNUA 3DV4B 5IP4A 2Y5TB 2DDQL 1P7QA 2ICEB 4PJGA 1I1YA 2BJML 4OIIH 2UZIL 5I71C 4RFEA 2O5YL 1HCFX 1YNKH 1WV7T 4O2EA 2MMXA 3PHOB 5I1KL 5GRYA 5I1GL 2B2XL 2F74A 5CUSH 2A6JA 4R7NB 3BWAA 4HX1B 2PCPA 5DJDA 3RL2B 3D3VD 5BVJB 3SE8L 2QL1A 2K1MA 2YUZA 3OKDB 5ETUA 4HUXA 1RK0A 4GRWE 4W6YB 3KDMB 5HD8D 3K46A 4P5TA 2CKBB 5FYJE 4D3CL 1AKJD 2YC1B 3SJVB 3G6AA 4OZIE 4S1QH 4P4KD 1OOAA 3MCKB 4JDTL 2AEIT 2B20A 4XNMB 5LAXA 5DRNB 3U30B 4QHKJ 1J8HB 4HK0B 4M7LL 4OUUA 1HHGA 3IFPB 1FAIL 1TJHH 1GZPB 4HAGA 8FABA 4NOBA 1M6OA 2XI9A 1UADC 3WXWH 1XF3B 3M17B 3T0EC 3C8KA 4Z8FL 1IBGH 2X41A 1NCNA 2GCYA 4TYUA 1BIIA 4QRTA 4PY8I 5HI3C 5DGQA 3H6JA 3QCVL 5DD6A 2DM4A 4G80A 5IV2A 1P84K 2VMFA 4ZOBA 1U8HB 3HCVB 4U0RC 4M61A 2JCCA 5E4EC 4DCQA 4ETQB 4JN2B 1CF8H 1UM4L 2NXYC 3MA7B 5A16B 1OP5H 1X9QA 1UQSB 4MWFA 5I6XB 4W6XB 3BO8B 4FRWA 3VW3L 4L4VB 4WWKA 5TF0A 5IIEA 5DD0H 5DEGB 4JFEE 4K2UH 3D0LB 3DHJA 3PDOB 5I1EL 2NX5D 1RMFL 2H8PA 4URTB 4CUCA 3SKMB 1OY3B 4LMQI 4HWBL 2NY7L 2DQFB 3WCYA 1J10A 3GJFA 4Z7UA 2DTMH 1J1OL 1F5WA 4J3XA 4QHLA 5C0GB 4EVNB 4LP4A 2IG2L 4HUVA 3O2DH 3TNNB 4WI8A 1V5JA 5GGRB 1HHHA 5GRUH 5I1LB 2D3VA 3B4NA 4ISVB 1JGVH 4OKDA 1P7QD 2BVYA 4RDQG 4GAGH 3VE0B 1RULH 4XPBH 1ZHNB 5FUZH 5A40E 4N1EA 4RSVA 1F6AA 3MBEA 4IRSC 4XCFH 1IM9D 1P7HL 4ALAL 2O5ZL 1CLYH 4NN5B 5I1HH 5C70A 3RUGB 4BA8A 1L9NA 3KPTA 2FH6A 2XZAH 3SE3A 1P4IL 4KTYA 5EIQA 4WUKH 3KPNA 1ZA6B 3O8XD 2W65B 1R3LB 5EG6C 3VXQA 4RIRA 4WV1C 5A2FA 1IQWH 3P9MB 3TBWB 1WTGT 1MRDH 1M7XA 5D7IA 4JDZA 2VZSA 4NRYA 3L7FA 1PKQB 1NDGB 3PWVA 1AXIB 2DWEA 2Z92B 4KRNA 3SDCD 1G7IB 4JQIL 1FC1A 1I7TB 5F96H 2XG5A 2LU3A 5ERWB 4ZFFB 5EZLB 3TJHD 1IL1A 2GIYA 1FG9C 3PABA 4LBEA 4FQHA 1JHLL 2NY1D 1Q1JH 4EN3D 2YD4A 4LCYA 4EQ2A 4HWBA 1QPXA 3BN3B 1MJ7H 2CO6B 5ESVB 2P5WD 4M03A 2BY2A 1HYSC 3BP5A 5DR5L 4E5XA 4MX7A 2Y5EA 4KI1A 1EEZB 4PGEA 3PP3H 4UB0H 4QHUA 5JHLL 1X5AA 5JOFA 2C7UB 4KKBC 1YEGL 3RIAF 4X7TA 5F9JA 4Y5XC 3MTRA 4GRWF 2ZCHH 3TYGL 2AK4E 3GRWL 3LQZA 4ELMB 5IKCB 3WLWD 2GK0A 3Q0HA 5CLTA 3P0YH 4OZIF 5C07A 1WFNA 4MDIA 4X7DC 5HDQH 4Y4KA 5KS9B 1MAML 2GJZA 3TNMA 4I48B 3FO9B 1M7DA 3KPRB 3QIUA 4OCMC 4OZ4A 4N8PA 4KK9D 3ROOA 5LGJB 3D18A 4JB9H 4NN7C 3C9NA 4PRDB 3O4OC 4ODTL 2V2TB 1Q0XH 3EOBA 3HAEA 4XP1L 5IB5B 2DMCA 3MV8B 5EU6A 3SDAA 4PV9A 5D1XC 5SWQB 1AD9B 5LXGL 2V17L 1YY8B 2R0WH 3N1FC 1U91A 3S4SG 3BZ4A 1NEZG 1X7QB 3Q48A 5D8JH 2V9QA 2NY5L 4HSQA 3ARGB 4UT7L 3PIQB 4OD2B 4UINH 2YPKA 3X3FH 1UVQB 2Y25A 2P5EE 2R0LL 2DLFH 1RHHA 2AW2A 4KFZC 3KYMB 1T83A 5DD5H 2EDYA 4M62L 3GUTA 5I75C 2ESVD 2FJGA 1A9BB 3T04D 2HTLC 4KMQA 4OLWL 3KPOB 1JGDA 1QBMH 2ARJA 3EYVB 3OR7B 5I19H 1UZ8A 1UM5H 3GNMH 5E8OA 3FFDA 4HCRL 1IC5H 4R4ND 1HQRA 4GAJH 3GRWA 3UTPE 4OFDA 2GT9B 3IJHB 4JR9L 2YD9A 3HZKA 4P9MH 3VXSD 4NO0D 3IFLH 5SWSB 5C0BB 4K3DH 1NCWH 5F7EH 1OCWH 3QHFH 4OLVH 1FG2A 3RPIA 2KZ1B 4RMVA 2ATKA 4P59H 1J0KA 1WWCA 1OAUH 5J1AA 5JDSA 3RI5K 4G6AD 4QRQA 1OSPH 1K4CB 3ULVE 5ICXB 1BFSA 2D0HA 3WMSA 3TYFA 4OIAA 2MJWA 3OJMB 3T0ED 3OHXB 5L2JA 1WZKA 3BPLC 3VFOA 2ZCLH 3G5YA 4HULB 3IDNB 5ELIA 3T0XA 5HI3D 5B39G 2BRQA 2VLRD 2NY2B 5EUKB 4PTUA 5EOCH 3MOQA 4JANA 4XX1E 2R4SH 3T1FB 2IFGA 4ODXB 1MCPL 1ZANH 2L7UA 2NXYD 1UWEL 2FNBA 1DN0A 1UH4A 4G43B 3K8LA 4XBGA 4NUJA 3PJSA 3DURB 5DXWA 2HWZH 5KSAC 1B2WL 2HRLA 1ZHBA 4G6KL 4D8PA 4ZO9A 1I3RB 4JFZH 3SN6N 1KN4H 5L2KB 5TDNB 1NGYB 5GIRB 5C0AA 2OZ4L 3BE1H 5LBSL 4LLYB 2OP4L 3M07A 3P0VH 5DJYA 1IGFL 3CX5J 5C0RL 2AJSH 1RIHH 3S3PA 3OKLB 1CG9A 3QDJB 3SY0B 4HFWA 3CFDA 3QR2A 1OQXA 2X4QB 4ZSOB 1FZOB 3IF1A 1A6WL 3LAFA 1KLGA 2WIMA 1U2HA 1JGUL 1PDKA 1LDPH 4K9EL 2ZG2A 4MXQD 2YSSA 3HG1B 3BOVA 4YBLC 4IRSD 4MNHA 5CJOL 2EYSB 1AFVH 1XCQA 1X4YA 4YGVA 3ALPA 2MPAH 1KNOB 1X5IA 2YRLA 4KKCD 4JKKA 4BJLA 2AEPL 4RCAA 4PJGB 4G9FD 1B4JL 3QUML 1YN6A 4IHOA 1OGAE 4JB9L 5A43C 2BVOA 2R56H 3QQ9C 1FQ9C 5L9DL 4OCLC 2F74B 4GKSA 4ELKA 2A6JB 4PJCB 3BPNB 2QSQA 2VISB 3BWAB 4AENA 2PCPB 5DJDB 3DX8B 5C86A 4LCWA 4PP2B 1IEHA 3TO4C 1SMOA 4HUXB 4OB5H 1RK0B 4P5TB 2QQKH 3EDJA 4RA3A 3QYCA 2F5AL 3OG4B 3QI9C 3EO0A 4P48A 5LAXB 5LWYL 2XYCA 3MACH 4FG6C 4XC3L 3QG7L 2AQ3A 1R5VA 2Y06H 5DLML 2WUCH 4L8SC 1ZS8B 4KKBD 3FONB 3B2UC 2CKBH 2BXZA 4LPTA 1M6OB 4IMKA 4NN6C 1B90A 2ZUXA 3QCUL 3MXWH 3VXUB 1OP9A 1IC1A 1YYMH 3MRRA 4NJ9L 2P45B 3LN4A 1TQCB 4LSRL 1I75A 3U0WH 4LPYA 4GAJL 4MVBC 4KRPC 3CFKA 1BIIB 5FM8A 4GW5B 1F8TL 5K9OB 5DD6B 4G80B 1H9VA 3GIZL 1QVOA 2V7HA 2ZWLT 2HT2C 2OMBA 3ULVF 4O2FB 1BBJA 2HMIC 2GFBA 2JCCB 5F7FA 3QUMA 1OAUL 1RI8A 4MWFB 5EUOA 1D6VL 1FL5A 2N1KA 4WWKB 4JFDA 4H5SA 4YQXH 1L0XA 2EDDA 3MRFA 5IIEB 3WIIL 3CMOH 1FZMA 1KC5L 3GSQB 1CDYA 2H8PB 2HKFL 1CLZH 2WLYA 4Y4HD 3QJHB 3VD5A 1C5CL 1CR9L 4PJFE 1PEWA 4L4JA 4KVCH 4DK3A 1N2RA 1GHFL 4WTWA 1XGYL 1LO3H 2NTFB 4U7KA 2EEDA 1F4HA 3MLUL 2CUMA 4NWTL 4S1DC 1HHHB 1XEDA 4FABL 3CIQA 3T08A 2VAAA 5C08E 2HTLD 2VDNH 4M93B 5BMFH 3R4DA 2BSED 4QYOB 1DLFH 4KZDL 2Z4QA 3MBEB 2R0KL 2AKRB 3CK0L 3NGBB 1FBIL 1ZSDA 4PJ5A 5J3HC 3ZSSA 5TE4H 1A3RL 4H8WH 4LLUA 4Q6IA 4JG1H 3UPRA 4OM1H 1DQLL 3HC3L 5D70L 1A3LH 4RMTA 4LCIH 5HYIA 5FDYA 3VXQB 4RIRB 1C16A 4U1HA 1FNAA 3CJJA 3P2TA 2VDRL 4BZ2L 3MLTA 1V3KA 4JDZB 5D5ME 4I13B 2R4RL 3L7FB 2XWJA 3PWVB 4G5ZL 1EO5A 4U1KB 3L3GA 4ODHL 3WXVL 4LFHG 1DQDH 3ZMRA 1YY9C 3MLRH 1S78D 3O3EA 2GSGB 3TO2A 5DTFB 5KVDH 4NZRL 4PJBE 5SWZA 2VXTH 1Y0LA 3MRKA 4MB5A 2H26A 4NSKA 5DJ6A 1Z9SA 4J3VA 4X0KA 1ZLVK 4FZEL 3QUXA 3RGHA 2YN5A 5EBWB 2JJSA 2DLGA 1AR2A 2X89D 4U1GB 4ZFGL 2KBGA 3LZFL 3BP5B 4Z0BL 3U30C 5DURB 4CJ1A 4E5XB 4MX7B 2B8OT 4PJ9C 3B5TA 4WU5B 2NZ9C 4QHUB 4M1GH 1LO4L 5KBNC 3V6FB 5JOFB 4Z95H 5IW1A 5DJXB 2LABA 4GG6E 3QDMB 2PYFA 5D1QD 1UKQA 1E6JH 4JVUA 3JV6A 3CNKA 5B39B 4GMSL 5FO8A 3PE9A 3SKJL 4HUKB 2E5EA 3IS0X 1M7DB 3MLVH 4G8EA 5GRJH 5DEFB 3U9UA 1BQSA 2VZVA 4IRJA 3ROOB 5D6CB 4G8FA 2CQVA 3IJYA 1ZMYA 1REIA 3IDYB 2A74A 1KPVA 1G7MA 2NW3A 3NCEB 1YYLL 2AJUL 2XFXA 5I6XC 3D25A 4MMZC 4M7ZB 43C9B 1A9EA 3LQAH 1MFAH 5DQJB 1F3DH 4NKIH 3WDHA 3ZTNH 4POYA 1ACYH 3A67H 4QRSB 4FQ1H 1QFHA 2VSCA 1MCFA 2CK0H 1WAAA 4U1SB 3OQ3B 1ZHLA 5HXMA 1FAKT 3MV7A 2YPKB 2W1NA 3QUZA 2W9LA 1L6ZA 1P7KA 2HJFA 4HW6A 5CGTA 5JORB 4RMSA 2BDNH 5E2TH 3BPOB 3GI9L 4XP6L 3I75A 3VD9A 4XVSH 3RX7A 4OCXL 5F7HA 3ZKMD 2DQTL 3DLQR 3U4BH 1KTDA 3QXVA 3WNNA 4H8WC 3OKOA 4PJFF 1CD1B 5DVMA 2PR4L 2IANB 4KDTC 1RUKL 2V5MA 3BESR 3T0VA 4HV8B 1WBXB 5E8OB 3DSFH 1WEJL 3TO4D 2GW5A 5C0DA 3SDXE 5F6HJ 1KLUA 1HQRB 4GFTB 2PO6A 3C5ZD 3QDGE 4OT1L 1CU4H 4NQXB 1I8LC 1Q72L 3TZVA 3BZEA 4MA1B 5SWZD 1K4DA 4WEBH 1NAKL 1CLOH 2IQAA 2HH0H 1N7ML 1FJ1B 4FG6D 4Q9CA 2AI0L 3RPIB 3OF6D 4XVJL 4BSVB 2ATKB 2V5TA 3B2UD 2Z91B 3U79A 1CDUA 1GAFH 4JKWA 4QRQB 2QEJA 3C6LA 2VRAA 4OZGF 1QNZL 4NP4L 2BSTA 4F57H 4Z78B 1R3JA 1DVFA 3K2UH 3LS5H 4MQXD 1SJEA 2QADC 5E2JA 5HHOB 3EUUA 2P7TA 1VERA 2VXSH