3TJEL

Crystal structure of fas receptor extracellular domain in complex with fab e09
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSFNIGRYPVNWYQQLPGKAPKLLIYYNNLRFSGVSDRFSGSKSGTSASLAIRDLLSEDEADYYCSTWDDTLKGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab E09, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeL01
4DFIA 5DZOA 4ZFGL 1YEDA 4ORZC 3EJYC 4N1EA 4XNUL 4K94C 4Y8AA 1J10A 2IANB 4L3EA 1NGWA 3RTQC 5MENE 5GRZA 1R5VB 1QBAA 1BQHA 4XC3H 4KTEL 1U3HC 4U6VL 2IADB 1HYRC 1M4KA 4HWZB 3VFGH 5ERWB 5CILL 4FQ2L 3T4AB 5DMGC 1HNGA 2M2DA 4KRPD 5CINH 2W65B 3MRMB 4MHHI 1FGNL 2MCPH 1AHWB 3U4BH 4X8XA 3EOAB 5DK0B 4CJ1A 5ILTH 2NNAB 2CUIA 1K6QH 2J12B 4FTVE 4OLUL 3HZMB 3I6KB 1E4KA 3THML 5D2LB 4WFEE 1VSCA 4MS8D 3RGVC 3GMOB 4QF1B 5SWQB 1BFVH 4X4MA 5D7SH 5GRVL 3QUKA 4LP5A 1NAKL 2XZAL 2WW8A 1I8KA 5AEAA 3HNSL 1YN7A 4CMMA 4PJ5B 3WLBB 1HQRA 5F7DA 2J5LC 4JFED 4LAJH 4R4BB 4LEOB 2YD9A 1VENA 1OP3H 5C0AA 4JG0L 1FC1A 4NM4L 5JO5B 4DGIH 1F42A 5J13C 1WWWX 5IVXB 1S7VA 2R0WL 3RFZC 2N1KA 2GK2A 2ICES 2BNRD 1AI1L 1LILA 4CU8A 4GUPA 3O0RL 4PGCA 3QULA 1YA5A 3CSBA 3S5LA 4P46A 3MNVB 5HDOA 5EOTB 4WTWA 3ARFA 4OF3A 1LK2B 3MBED 4GLRI 4X6EA 1M7DA 4NKOB 4ORGB 4OLZL 1KCLA 2R69L 1S8DB 1HINH 4MNQB 1ZA3A 4LPWA 3K46A 5L88H 2Y23A 1JN6A 4KK9D 3KLAA 5EIVA 4JVPA 4ZUSA 3GSNH 4GS7B 3BFOA 3RUGB 1N0XH 3V4VL 1GH7A 5FA3A 3CFJB 1IAKB 4XPTH 1RHHA 4ESKA 2CO7B 2DQGH 1E4KC 1P4LA 3NCFB 3U36B 4BUGA 4DUVA 1A7OH 3TV3L 1R3JA 1EO5A 4NC0B 3LQAL 2W59A 1JK8A 4BFEA 1NANI 4J8RB 1Q38A 1D5IL 3JVGA 3FQUA 4FQIH 5C3LD 4P4RA 4DAGL 4JFDE 4RA3A 5CZVL 1LP9A 4NWTH 4S1QH 3L6FB 4X98A 4J3TA 2CDEA 1UKQA 1NDMB 2ZUSA 2WBWB 4GBXA 1XF4A 3DVGB 1A2YB 4YDLC 4GFTB 3MRIA 5HHOB 2DLFL 3VGFA 1OCWH 4Q2ZB 1RZGA 3INUL 5F70A 1NGQH 3KDMA 3RQ3A 4KJYA 1AGFB 4JQIH 4O4YH 4F37K 4PG2A 3ZE0F 2J8UE 4LVOC 1HZHL 4NO0D 1MHCA 3NACL 1IQWL 4HWBL 4P46C 3ULVC 1A6ZA 3ARFC 3P0VL 5CD5C 3QCVL 3I9GH 1D6VL 2O93L 5JW5B 2HFFA 1U8MB 2P5EB 5FOBA 3DV4A 1FJ1A 3DX9B 5FAAA 4N1HB 2NLJA 3L3OB 4OLWH 5B39B 1DZBA 1NL0H 4OCWL 5MENA 5B4MD 2JJSA 1N5YH 2JKXA 5CJ8A 5TDOB 4XXDA 2VOTA 3HZKA 3ULSB 4N90E 3HMWH 5I6XB 3E6FA 1I85C 3QUZD 1UA6L 1XCTB 3SE4A 3DV6A 4JZJB 2R1XA 5E2UL 3N9GL 2JB5H 4R4ND 3JVGC 3D9AH 4WV1B 1XGTA 4PIRF 3QJHB 5SWSE 2N7BA 3HPLA 3ROLA 1OGTB 4KUZL 2DWEB 1FNHA 4P2RD 2VITA 2B5IB 4GBXC 5BQ7B 3ECBB 2UY7A 4ZUUA 5INCB 5GGRA 1NC2B 3D3VE 3K81A 2DJSA 1LNUA 2IBZX 2NY1B 3KYKH 3QDME 1G7PB 5TE7H 1P4IL 4RCAA 4PG9B 3QPXL 5HGDB 4DTGH 4MJ6A 2BNRB 2DQJL 5ADOL 4I3SH 4DVBA 1S7QB 4PG2C 3U7AA 2ATPA 4PRDA 3NTCH 1H8OA 3WIHA 3QB7C 2P5WA 1KEMH 2Q6WA 3R4DA 4L8CA 3UTPE 1IC5H 3DBXA 1VADA 2HTKC 3OV6A 5C8JB 3MBEB 4OGZA 1MREL 4BK4A 4H5SA 3D39E 2R23A 5F93C 4I0KA 4UNUA 5A43C 3FO2B 1I1RA 3H42H 3UPAA 3GHBL 4M8QB 1QR4A 2Y5TA 4AM0B 1AR2A 1C5BH 2FL5B 1L9NA 4ZS6C 3BKML 3OG4B 1MUJB 4TRPH 2ZKHL 2JJSC 5JR1H 1U2CA 1WCBB 2NY5H 1H9VA 3QUYA 3QQ9C 4D9RD 2NW3A 3V8CA 4S10A 2WQRA 3LS5H 4X6CE 3VWKA 4BM7A 5ANME 3U46B 1DE4B 3BZFB 3SE4C 1EMTL 2WZPD 3JUYA 4MB5A 1P9MA 2YPVH 3L3JA 3QO1A 2EXWD 4P5TB 3X12B 1Q9WB 5I0ZA 3AB0C 3FQRA 5BO1H 3L1OH 2B4CL 4X6DF 2EXYD 3H3BC 1G7JB 1MCCA 1EEUA 2HKHL 2HTLC 4EUPA 1M7IB 2EIZA 4JHZA 5IEHA 5C2UB 4KROD 4ZFZA 4U1KB 3HLAB 3RHWK 4G9DB 3BKCH 3EYSH 2CK2A 5GRWA 1F00I 1A02N 2VDKH 4JFDA 3WNNA 5KVFL 1PX4A 3BP5B 3CH8A 5FUOH 1V7NH 4NO0B 1I7ZB 3ES6B 4PJIE 4TTDC 1P53A 4WY7H 5DURD 3WHXB 1J9CT 4G9FE 5IQ9B 4FFZH 1H5BA 2YMXL 1LE5B 3AMKA 3MRNA 2XZQH 4M6OL 2H6PA 3N1GC 1HKLL 1CU4H 2ZUXA 1OLZA 3L3KB 5E1AB 2P8PA 2RFXB 5DD6A 4OLXH 5C07D 4R0LB 1MCEA 1Q94A 5F7EH 4MCZB 3NIDE 1GJIA 3SJVE 3HC0B 1AXSB 5C0CD 3QUYC 4D0CB 2OCFD 4X5WA 3TVMB 3VWKC 1TJIL 1JCKA 3GI8H 4YC2C 1KCKA 3VD4A 3NCCB 1P9MC 3RWGA 3FQTA 2JIXB 2BK8A 4JB9H 5DQJA 4O2EB 2OL3B 3SDXE 3TO2A 3PV6A 1KTLB 5GGUA 3T2PA 5E8EA 1UGNA 5CCKL 2DBLH 3SQBA 4P2RB 5E8DL 2NMSA 3AREA 4PJ8B 1A7QH 3MMEA 2DICA 4Q6IB 5GZOD 3BSZL 5DT1L 4XP4L 3FO1B 5A16A 2MKWA 1FNLA 1KXQE 5GQBA 4X7CC 3N1QC 1A9BA 5SWSA 4UILL 4WW2F 2ED9A 4TUJA 4IRZL 4XCFH 3GUTA 4N8VB 1ZHKA 5CEYA 2IBGA 1H5BC 2MHAB 1DLFL 4JY4A 4LSPH 4KGJA 3CUPB 3ZTNL 1MH5B 3D3VA 4CU7A 4C83A 2EO1A 2BXYA 1JP5A 3QDMA 2ZUTA 1S9VB 2DQTH 4DKDC 3MFFA 4D3CH 4IMLA 2ZPKH 3P4LA 5KZCB 2NR6C 2NY6C 1XGPB 3N0PB 1I4FB 4KXZH 1FZOB 4DN4H 1SJVA 1RZJL 4WEUD 4FXKB 4M7LH 3H9SD 1G9NL 1BD2B 4QRPB 3SHSA 3LH2H 1MAMH 5T1KD 4HGWB 3FCTB 5FK9A 5I8OL 2VXTL 3L7FB 5D6CB 5T3XE 2AQ2A 2QQQA 1C8PA 2IPTH 2GJ6D 3D39A 3QH3B 4ZG1A 2Z8WC 5I1HH 5CLTA 4X7SL 1I3RB 2DQCH 5IF0B 3OXRB 2BSRB 1FYTE 4R2GD 4NBXB 3HRPA 5DVOA 2HWZL 4M1CC 4WI9A 4OLYL 4F7TB 3OBAA 3RJDA 3AREC 5F7HA 3VXOA 4LL9A 1XF2A 4HH8A 3TBTB 1AGEB 3T09A 1ZLVK 4JDZB 4MB4A 5I74C 4X6CA 4AL8H 5ANMA 5DMJB 1J1XH 1IGCH 2FLBT 3WNKA 3VH8B 5EUKB 1FIGL 1EJ6A 3U4AA 3LKRA 5KVEH 4MD5B 1HIML 4AJ0A 5BZWA 2BRRH 3UJTL 1Y6NR 1QLEH 3D87B 3H7LA 4MQTB 3X13A 1TZIA 4S1RL 4ZTPL 4GRLB 5FYLL 4D9QD 3GMMA 1A7RL 1P84K 5IW6B 1GGCH 1EBAA 4EXKA 1H8NA 1MQKL 4TSAL 2FJGB 3P9LB 3D5OF 2IGFL 4PLKD 1FNSH 4OZIE 4Y88A 1WEJH 3RX7A 4ODBD 3X17A 3I6GA 4PJIA 1BOGB 3PP4L 3FO9A 4G9FA 3VGEA 1OAYL 3G6JB 2CSPA 1W0VA 4Z9KB 3HS0B 3OKMA 2E5EA 1XF5A 3OG6B 1B88A 3BPLC 3PP3H 4X6FB 2Q3AA 3MX0A 3MLZL 4YDJB 1QSZA 3LD8C 4PV8B 4XC1H 4GG8A 4L4TD 1T2JA 2E9WA 1IKNA 2A1WL 3SJVA 4LDEB 4J6RL 4X5LA 4HS3B 4X5XB 2JCCF 5C0IA 3QUMA 4XVUD 2VLMD 2YRLA 4U1SA 3MRLA 4Z7NE 5CEXA 2Y36H 3HNVH 2AEWA 4OM0H 4IDJH 5B3JF 1QZ1A 1YECH 2CGRH 2EDKA 3O11A 3PDDA 1JPSH 5HVHB 3MCLH 1DLHA 1U8QA 4M9OA 3GJFH 3SDXA 3HAEH 2DQFA 1Y18B 1NEZG 1XIWA 5D7KE 1ACYL 2W07A 2WBJB 1SBSH 5CFHA 2NTSP 4H26A 2COQA 3U0PB 2O5YL 1T2XA 4XXCA 3C5ZD 5DTFB 2W0FA 1FAIL 3CVHB 5BJTB 3OXSA 3B6SB 7FABH 3C5JB 1SMAA 1CVSC 3MV8D 3B43A 4NZJA 4AG4L 4OJFL 1OAUH 4YHNA 3LIZH 3MCKA 3IDXH 1F90L 4FFVC 2F9BT 3BHBA 3CLFH 5T1KB 4JFQB 1W72L 4CNIA 5IB2A 4NNXA 1CTOA 4PJ9A 2UV3A 4ZMAT 2FGZA 2JJUA 4F58L 5DC9B 5K9OB 2FJFB 3T0ED 2B8OT 1MI5E 2FCBA 3ILQD 1PZ5A 2IF7A 3CSPA 2OBGA 4X9IA 4HIJB 3WNLA 4RQQB 3VW3L 2V7HB 1IKNC 2HLFC 2BSED 4R2GB 2CLRA 1VHPA 4WUKL 3TYGH 1FG2B 1JPFB 4HUKB 1CICD 1EXUA 3OKEA 4RA0C 1I1YA 2EDLA 1RZ8B 4WWKA 2EIDA 4G6JL 3LKNB 4OZ4B 3REWB 1S7WA 1KG0B 2J6EA 2WMPA 2NW2A 1FYTA 4M7KH 3BYTA 3FN0L 5FGCE 1JIBA 1XIWC 3QDGB 1YNKH 3O2WL 3O41A 4BYHA 1X5IA 3TYFB 1R0AH 2NY0C 2PCPB 2XY2A 4XXCC 1AIFB 1F6AA 2NXYD 4RGMC 4KKCC 4LU5H 4FP8L 4I1NB 5F71A 4O02L 2VXQH 1REIA 1IC7H 5DJ0A 2QL1A 3R06B 4Q0XL 2Z91B 3C8KB 5DWUH 1HWGB 2WNGA 4Z7WF 5I1EH 1HSBA 3RVUD 2NY3D 4PJ9C 3O6LL 5TH2B 3G5ZB 4X4YA 4K2UL 5T5FH 2DLHA 3G5YA 3QIBA 4UIMB 1BX2A 1CFQB 3RVXC 4TTGA 3G9AB 2BJMH 4OZIA 4OCLC 3DUUA 4UI2A 3O4LB 1UT9A 3K2UH 4Z7QE 5J1AB 2VH5L 1H15B 1U8LB 5C0RH 4K3DL 3U7WL 2B0SH 5DJYB 3AVEA 2MMXA 4QXTB 3ZO0A 1RURH 4PJAF 5CS7A 2DTMH 3EIFA 1MNUL 3GM0A 3NAAH 1JGVL 4WWKC 3KJ4B 4JM4H 1OSZB 3LSOA 3VFVA 2XTJD 1VFOA 2BMKA 4GH7B 1YPZF 1ZOXA 5ICYB 2YA2A 4HCRH 5HTSA 1S9YA 1ZLSH 3BUTA 3RVTD 2NY2D 1N59A 1WBXB 4OD3H 4ALAH 3IKCA 3QI9C 5ICZB 1UWEL 4NP4H 4ODTH 4OB5L 1XGYL 3O3EA 4UT7L 3LZFH 1K4CB 4PJFE 4ENEC 4G42A 3V6ZA 2JB6A 1IVLA 2DQIH 1Q0YH 4ZNEA 4TULL 5A2IH 4KK5C 3DTXA 4JZOA 4NT6B 3FB6B 3BZ4A 4KJWD 1ZA6A 4KVCL 5DGQA 1FNFA 4LVNB 3DHJA 4PBXA 2ZJSL 3RWHB 5EBMA 4HHAA 4X7FC 5EU4B 4LGPB 4M6AA 3QIBC 3F7QA 5IB5A 3EO1B 2BVUA 3OZ9L 4NRXA 4WCYL 3ZDXE 4Y19B 5BXFA 5C0FB 3MOAL 3UAJC 4K23L 1EK3A 5EBGA 1TITA 4OTXH 4Y5XA 1WWCA 2VDPL 1KJ2H 3FB5B 1DUYA 3RVWD 1DEDA 3ARTA 3MRHB 3B83A 3C8DA 2YUVA 4FMFA 4Q6YA 1N26A 2DM7A 2OTUA 5IB4B 3VMPA 1X5ZA 1MI5A 2R8SH 4GAJL 1I1AA 3QRGL 4ONOA 2HFEA 2XWBA 3FQWA 4Y4HA 1GC1L 1U95A 2A83A 2JK5B 4X4ZA 3F7RA 4MJIB 2E6JA 4ZSOE 5I0DA 5DSCB 4R7DB 2GTWB 1EUTA 3GI9L 3IETB 1HYSD 4XRCB 4HG4K 3NA9L 3RWEB 5F89B 2VLKD 1YZZA 3PJSA 5FM5O 3GJEB 4K3JH 4NQEE 1GPOH 1DDHA 3JWOC 1G7IB 4NQUA 5F21B 5IJVA 4HUVA 2I60H 1RUMH 1OF2A 1BBJA 4GOSA 1DBJL 4I13B 3VGAB 3NGBB 3SE9H 1YQVH 4MD0A 4U1HB 1TQCB 4QNPF 2NY3B 1MCOL 5C0JA 2J1KA 1IM9D 4E41D 1JTTA 3A67H 4RFEA 5MI0B 4PGDB 4TSCL 5IFHL 4UBDD 2EIBA 4Y5XC 3PQYD 5IFJB 1T5WA 5JNYB 1QVOB 3LMJH 1AFVL 2AEIT 1VERA 5FF6B 1T89A 4NNPH 5ESQA 4YDIH 4TUOB 2GHWB 3QT2A 3MLVL 1I1AC 1K4DB 4FABL 4WO4A 3F58L 3FAXA 5F7NC 4Y4HC 3RA7L 2BNQD 2LTQC 3JWNC 1IM3B 3SGEI 3QNZA 3VXUB 3PP3K 4X6DB 4JRXB 3L3HA 5BMFL 1MLBB 1U42A 5CINL 4ZPVB 1WC7A 3NA4A 2VXSL 3U4BL 4HPOL 1KV3A 1PAMA 1QPXA 1IAOB 3FT2A 1KC5L 3OGCA 1QQDB 2KDGA 1UYWH 3M07A 5J11B 4GKNA 1K5NB 3DROB 4BH7A 5A2KH 4NQCE 2LQRA 1QSFB 4C54A 3QXVA 4PTTA 3SDYH 3BZDA 4NUJB 3GMRA 3S8WA 3O3BA 2UY6A 2IANE 1FAKT 2UYLB 1BFVL 1R5IB 4FQCL 3MA7A 4FQHB 5D7SL 4PJFA 4UQ3B 3PWLB 4LQ1A 5ETUB 4M61A 2YOCA 2GAZA 2RCSL 1PSKH 3IB4A 4KPHL 2Y06H 5EA0H 1FVDA 3QWOB 3WIFB 3LN4B 4CADB 4GAFB 4IJ3B 1IEAB 5LGKA 3IFPA 4GW4B 3T0DA 3CU1A 4ZAKB 1MCSA 4OZFH 2NTFA 2VN7A 1T89C 1OTTD 4WU7A 1PYWA 3O2DA 1WIOA 2C4FU 1I75A 3L3GA 3PDOA 1YMHA 1S7RB 5T33L 5D2LE 4HJ0D 3DOSA 4WO4C 1AJ7L 3JV4B 1YEJH 2VR4A 3J7HA 3MLWH 4ODWB 5GS1B 1FDLL 4XAKD 3MLPA 2O5ZH 1BZ9B 3OKLB 1F45A 4MA8H 4NRYB 4JO2L 2XTLA 1NBZB 4PJ5E 1SEQH 1L0YA 3TJHD 3IRPX 2V5SA 5L88L 1DTUA 1NGXB 2R0ZH 2W60B 1UCBL 1CGYA 2H3NA 5F3HB 4XAWL 5D70H 1N0XL 3GSOB 4H8WC 3KPSD 5IVXE 4JCLA 4OGAC 5CWSB 4XPTL 5JORB 2O5XH 1RULH 5F9JA 1EAPB 3T4YB 4DFHA 4KQ4H 5F72S 4MDIB 1EHLH 4NZRH 3B2VH 4WW2B 5GIRB 1M6OB 5T1LA 4OF6A 1A7OL 4RMWA 3TPUA 5DRXA 3E1F1 3DX8B 3OKDB 4K7FA 1T4KA 1B2WL 4FQIL 5C0BE 3U79A 5IGXH 4LSUH 3IVKA 3MRBB 1R24A 1T1XB 4JY5H 4E41B 4NQEA 1BQHG 3FQXB 2R2BB 4NWTL 1WAAA 1IGIL 4MNQE 1DP0A 4PYGA 3PL6D 2MOVA 4PP1D 2NZ9C 3W0WD 4M7JH 3TBWB 5DHYA 2EO9A 2YPLD 5IB3A 1DBAL 4L4VD 3UJIL 3HZVA 1NLBH 2EDTA 1NGQL 5DMIL 5L2JA 1ORQB 1T1ZB 1F4YH 1T7WA 3PHSA 4DN3L 4O4YL 4WEBL 5HI3C 4PJHF 5J12C 1IARB 5ADPH 2YS4A 1X5FA 1C5DB 2YRPA 4KZEH 4C4KO 5KS9E 5IM7B 3I9GL 2X4SB 4HT1H 5JMOC 5ELIA 2FATH 4U3XA 4JRYD 4LLMB 5EU6B 1SVCP 1F11A 1CQYA 1NBVH 3VXRE 4NHCH 2ZSWB 4OLWL 1HSAB 2PTVA 1DUZA 4PR5A 1LEIB 2EYRA 1CCZA 5ID1A 3WFZA 4G6FD 2CLZB 1KTKE 5HHOE 1QEWA 5D1QA 5JHLH 2P44B 5CIPB 3E3QE 3IDYB 3O4OB 4NO5B 5I1JH 1XT5A 1H3UA 5LGJA 4DJMA 1LD9B 3MJ8A 2BNUB 3DURA 3ZYJA 4J2XA 1AGDB 2JB5L 5FGBA 5AD0A 1NCNA 3S5LG 2VERN 4KJQC 2V2TA 3HG1D 2A73B 1RK1A 5GGVH 3CFEB 4NQCA 2LFGA 1HHKB 4LPYA 1OAXH 4ZODA 1G7HA 1ZLWH 3W11D 4G8IB 2I9TB 2IANA 4MAYD 5TE7L 3FFCD 1BPVA 2H2SC 1CFNB 1R5VA 2R2HB 1UEMA 5DJ6A 3ZL4H 4HWNA 3OR6A 4RAVA 3TFKD 3IDMA 4G80B 4HWZA 4FOMA 1IC5L 1V5JA 3MLXL 2H26A 2YD1A 2AJXL 2E6QA 5DK0A 3EOAA 1JYXA 3LS4H 3MGTB 3WDHA 5IVNA 3CCHB 2FX8L 4H1LH 2VXVH 2EEBA 1A6VH 5H2BA 3H6JA 2Z0BA 3RWDA 3WEXB 5D2LA 5DEGA 4PRNA 3VRIA 4R90L 4TRPL 5D1QC 2PTTA 2HFTA 5SWQA 1S7XB 2BC4B 1HWHB 2NY5L 3QQNA 2AEPL 1ZVSA 2AXGB 3OAUL 2I5YH 5AZ2L 3TN0B 3PGDB 5C0GB 1A6WH 4PREA 4PJ5A 3WLBA 1FNGB 5E24E 3SKJH 3QR2A 3CFIC 4R4BA 1AD0A 5INDB 3SO5A 2AJSH 1YMMD 2NX5D 5FGBC 2VXUH 1F3JB 4GXVH 3LRSB 3KYOB 4O9HH 1ZT4B 5L8LB 4LPUA 3HB3D 3HNTH 3KYMB 3L1OL 3VGDA 1JV5B 4EDWL 5I76B 3P0YL 3QDJB 1T0NA 1U92B 4JKKA 1DVFB 4WU5A 3CXHJ 5DLML 4OLEA 2CRIA 1UB5A 3GGWB 3SBWA 4L4VB 1A9EA 5EOTA 3BKCL 3EYSL 5C0BA 2VDKL 1FLRL 3WLWC 5C71A 4QRQA 1S8DA 4MNQA 4YE4H 3DO7B 3GMLB 3QWRA 1SVZA 3PWVA 3CFCH 4Y5VA 2XZQL 4G7VL 2CQVA 2F53D 4TN9A 3WJLA 5JW3H 4LVHC 1JPTL 5J6HA 4F7PB 5A2FA 1BGXH 1IAKA 3CFJA 4JRYB 3WD5H 2GSIA 5C3TA 1ZLUK 1NH6A 1TDQA 4HFWB 4MA1C 4PJ7F 3RKDD 1VACB 4G6FB 4LCIH 1RZFH 2E7BA 3SDDD 3W2DL 5KS9A 1MCLA 3CSYA 4YBQD 4U0QB 4WJ5B 1J8HB 3FRPA 3GI8L 5TGBA 1A1NB 5D9SB 3VXRA 1BAFH 4A6YH 1AXIB 3JWOH 4YHIB 1DANT 3RZCB 3TCXA 5F1SA 3LQZB 1RIVL 3WJJA 4GRWF 3HG1B 4LPXA 1EGJA 4Q2ZA 1SM3H 1WFUA 4XNXH 1CE6A 1D5MB 2XOTA 2HJLB 4NQXB 5FHAH 1JUFA 2XXCB 4L1DA 4Z7WB 3SBWC 3VE0A 3V7AE 3FFCB 3BIBX 1YJDL 2XT1B 4EVNB 1KIQB 3MYJA 1EUUA 4XCFL 4YZFF 5E00B 4QRTA 2ZSVB 5MHSE 1DQQA 3L3OA 3ARXA 5FV2A 4Y5VC 1AE6L 1MAKA 3G9VA 3WJLC 1UVQA 1ZT1B 2F58L 3DARA 2DQTL 4K94L 4D3CL 2FSEB 2W9EL 4PJAB 3RI5F 4GKZB 3ULSA 4YPGA 3SGDI 1TLKA 5GGTA 4YAQA 4QXUH 4MXVF 4N0YH 1OTUC 1YPZB 1XCTA 3LH2L 3MLUH 4EUPG 3LB6D 4I4WB 3WYRA 5JZ7C 2OMNA 2CKBL 3Q0HA 4WV1A 1NUDA 2IPTL 3QJHA 1T1WB 2FD6H 1KIRB 1IT9L 1RIHL 4QHUB 3WIIL 5KJRL 1OGTA 3Q5YA 2YN3A 2PYEB 2DWEA 2EDOA 2QQLH 5BQ7A 3IXTB 3ECBA 5INCA 1UJ3A 3HC3H 3VXSE 4YHLH 4LAQH 1NC2A 3WJJC 3EO9L 3ULVF 3RPIB 1XFPA 5LVEA 3S97C 5CBEB 2DMCA 5TFSL 2NYYC 3E3QC 4GW1A 1OD9A 2P48B 4R6UA 1E4WH 1PG7X 4MQXD 3OB8A 4YXKL 4QYOB 4ZDHB 4YEFA 1J1XL 4KVNH 4BELD 1BD2E 2NY4C 4QRPE 4HC1A 4X7TB 1N64H 2C4XA 2LU3A 2X89A 4YPJA 5I75B 5C8JA 3VI3F 1NMAL 2DAVA 5AWNH 1LEKA 3U6RA 1MCBA 3FO2A 1MIMH 3X3FH 1QLEL 3UBXB 1E6JH 4PB0H 1TPXB 5DO2C 3T2OA 1I8MA 4M8QA 3T65B 2O61B 1L7TL 2FL5A 3EYFB 1Q9LB 3RWIB 1LE9A 2VABB 2F53B 3I6LE 5D72H 1PW3A 3BWAB 2NY7L 2FO4B 1WCBA 4P3CH 2X1WL 1LP9F 4NJ9H 3RBGA 5A1AA 1SMOA 4B7IA 3H7BB 4JPKH 3MLTA 4TVSa 4M1DL 3DETC 5AUMB 3VG9C 5J3HC 3BZFA 1L4IA 2BHUA 5DA0B 3U83A 5IEKB 1MCKA 4WV1C 4Y2DA 3CXDH 1Q1JH 2KH2B 3HE7A 4P5TA 4YGVA 1Q9WA 2EDJA 5I8EA 3T2NH 2X4TA 4HIEB 3SKMB 1IGYA 1CLZH 1GGYA 1UJ3C 4MX7B 3PXJA 4HUXA 2DRUA 3T04D 1M7IA 1GL4B 1MVUB 4MCYA 5HHMD 4NSKA 1I8IB 1DEEB 4U1KA 1YEGH 3PWPB 3EYOB 3D85A 2VN4A 5EO1A 5DUPL 2Y36L 1B0RB 1MHEA 3SY0A 15C8L 4OM0L 4P9HC 1I7ZA 4F7CA 1VPOH 3PHQB 2CGRL 4KK6C 4HXAH 5KOMC 5GS2H 3MCLL 5C0ND 3WHXA 3G6JE 1LE5A 5DUBA 1P5UA 3GSNB 5HHVH 1BOYA 1I3UA 3L3KA 1KCRL 1DBKH 3HFMH 5E8PB 4R0LA 5FDYA 1FSKB 5ACLA 4TVPL 4ODUB 5HGAB 4BJLA 5D5MB 3O2DH 4N0CD 3CK0L 2FH8A 1AXSA 2BSSB 4AH2B 1K2DB 5IBUG 1LO5A 4D0CA 2QR0B 5JQHC 1OAUL 4P2QB 4C4KT 3ULVL 1KIPB 4R3SB 3EHBD 1UENA 3CLFL 1CFBA 4Y2DC 4RGOL 4N5UA 3HE7C 4PRID 2JIXA 4P5TC 2QSCH 1BQSA 1KUMA 3DUHA 2ARJB 5E9DD 5D7JD 4D0DB 1I7UA 3QUXB 5MP6H 1E27B 2PW2B 4CVXB 1S7UA 4P4KB 4PGZA 2WANA 1JF1A 5GSVB 5TDPA 4WNQA 5B38A 4Y4KD 1CXLA 2IFFH 4Z0BH 3G08B 1QUNA 2ADGA 1LO4L 3MV7E 3ARGD 4EI5D 2ENSA 5GRJL 1A3QA 3O6KL 4U3CA 1IGML 4MJ2A 5E70A 3QPQD 4CU6A 3VXMD 1ACZA 2ICEB 4N0FA 2WUBL 2ZOKA 3VXSA 5IFAL 4M7KL 4JKLA 1WBZA 3JSSA 1CI5A 4ZPTB 1S9VA 5IR1B 4N5EC 4R0LC 3P11H 5KN5A 1XGPA 3CX5J 5EOCJ 2DMBA 5T1DH 3H2WA 4F3FA 3I75B 1QLRB 3C6LB 5HD8D 2HLAB 3LEVH 4QRPA 4ISVB 1X44A 4L3AA 5EULV 2L7UA 2P45B 3FCTA 1IAIL 1IC7L 2F5BH 2MFNA 1C5CH 4LPCA 1TETL 4OKVB 3QH3A 1JZ7A 5DWUL 3TNMB 4GAGH 1B0WA 1RK0B 5I1EL 3M1BB 5IF0A 3F7YB 2AJVH 5CBAB 3NPSB 4E0RB 2YD2A 1LK3H 4JFZH 2BSRA 5T5FL 1KTDA 3VFOA 1KLUB 4F7TA 3SDAA 3QDGE 1QBLL 3KPTA 3TBTA 1AGEA 1QHOA 4NJAL 3ETBF 3A0OA 2P8MB 3F65A 2D4DA 1J0JA 3K2UL 1QHPA 4XVSL 1MRCH 3HI5L 3O9WD 1AC6A 1RURL 3VH8A 5EUKA 4P57B 5ALCH 1YYLH 4MD5A 1C08B 4JM4L 3BE1L 3D2UD 2X6MA 3ARDD 4IIQA 3EJYD 4LDOB 4GRLA 2H2PC 1GGBH 2MPAL 2VDOH 1SYSB 4JANA 3AM8A 3RTQD 4XMPL 4KMLB 2CLVB 3C2AH 4HIIA 4NP4L 1U3HD 4XH2B 3WS3B 1HHJB 4XWGH 4W81A 1PG7H 3VJ6A 3GSWB 1KJVA 2HFGH 4MNGB 4AMKH 2CDFB 1JMZA 2XICA 1BOGA 1E4JA 3GHEL 4MMXC 3RNQA 3WIHL 3G6JA 5BOPA 5C9JA 4Q7DA 5ISZB 3W39A 1NAMH 1W0WB 1WWAX 4DQOH 4KKLD 4FQJH 3TBSB 5T3ZH 4PJHB 4X6FA 5IHBA 2X4UB 5IMLA 1TTGA 4HPYL 2R0KH 2ZUQB 4LCWD 2UUDK 3GEWB 4QTIH 1KELH 1RUAH 3BXNB 3SDAC 4CW1B 2FIKB 4R97C 4P59L 3K4DA 4S0TD 4X5XA 3G6AB 1BFTA 4DWHA 5CEZH 3TO4B 2LU7A 1CDHA 1E28B 4OTXL 5DQ9B 4HBQA 3S36X 3QEUB 4XNMB 3W5MA 2BVTA 3OL2A 4ETQB 1RUPL 4H88L 3NZ8B 3SOBH 2J88L 5FYKU 4J3OC 1ERNA 3ARGB 4EI5B 3QEQE 3QXDB 2QLVB 1JL8A 3V0VB 1Y18A 2XQYK 5FO9B 5IB1A 3ZE0E 1RVFL 4IIQC 1QR1A 5F7LB 3HI6H 2R8SL 4LFHD 4JFPB 4Z7OE 3GMPA 5EU5A 3AM8C 2DD8H 5DTFA 1A8JH 1WZ1H 1HHHA 3CVHA 3KJ6L 1J1PL 2HVJB 1DL7H 3B6SA 3C5JA 4ZFFB 3MV7A 4Y19E 2IBBA 1FFNB 1NCDL 4APQD 1T03L 3L5HA 5DZLA 1UZ8B 2VQ1A 2W38A 3RIFF 4NQDB 1GPOL 1RJLA 5E6IA 5F7MC 4QHLB 5DF0A 5K9OA 4WHCA 3R1GL 4Q9RH 1AGBA 3EGSB 4ODSH 4X6CF 4XPBH 5JIPA 2EDNA 4GW5B 1YQVL 3CDCA 2ORBH 4QRUB 5EB9A 1QNZH 4RQQA 3RPKA 2V7HA 3WSQL 2B39A 4MXWH 3S96B 3PNWA 2UVFA 3T1WA 2R4SH 2X4RB 3VFTB 1FG2A 4MJIE 5JDSB 3HZYA 5T1MA 2PETA 4S1DD 4KI5E 4F80A 4EI6B 1RZ8A 4XP5L 1U8KB 2DKMA 4U1LB 1CZ8L 3LMJL 5C0AD 3REWA 5HVHC 2YBRB 1KG0A 3OKKB 3D25A 3WDJA 4YDIL 4TVPD 5IHZB 3KXFB 2G2RB 1F6LL 1NBYA 3QDGA 3UO1H 4KZDH 3GBNH 4Z8FL 1MEXL 4F8QA 1MFCL 4KQ3H 3EO0B 5DXWA 4P46D 2VDMH 1J87A 4L4JA 3DX7B 3ARFD 2BOCB 4QRSB 5FECB 4Y16B 4S0SD 1U3HB 5K59F 3ALXA 3EDFA 4FG6D 2CKBB 3R06A 4J7RA 2Z91A 1S7TA 3C8KA 3LN5A 2V9TA 4OI7A 4P3DB 1A47A 2DQUH 4M7ZC 4W6XB 5E6IC 1UYWL 1NGYA 4MB3A 5TH2A 1XCQB 3MUHL 2G9HB 2AXFB 4MD4B 5CZXD 3FB8B 2CK0L 1J88A 4ZUVB 1XAUA 5HXMA 3RGVB 4ZOCA 4RFOH 5E8OB 5J1AA 1A7PH 5FGSA 1H15A 1U8LA 2C7UB 5EFIB 1LO2H 2JF1A 3QG7L 2Y06L 4FA8A 5EA0L 2HT3D 3LN9A 3VXUE 1X6LA 4E42B 3SDXF 1B6DA 4X6DE 5F6HI 3MREB 3UTSE 5JW4Q 2XWJB 2FECL 4PJ7B 5DVKA 4GBXD 1U8OA 5EZOH 3IAPA 2VDRL 3CIQA 1IAIM 1T04B 4P5MA 2Z35A 3FRUB 5J13B 5EUOE 1PD6A 4U6HB 4AEIL 1QSFE 2VAAB 1EHXA 4ZUTA 2RIKA 4OLVH 1YEJL 3HUJE 3LEYH 1CXKA 5L8JB 3FJTA 1CDUA 4L3EB 4M43H 3TF7C 3S35X 4GRWB 4Z7VB 1BQHB 1MRDL 3UDWA 1KYOK 4P9HH 3QEQA 4NT6A 1MSPA 2Q87A 3NN8B 4HMEA 5AG9A 5D70L 2DIAA 3AGVA 1MCFA 4FN0A 1JGLH 4ZS6D 2H1PL 2O5XL 1RULL 5I1GL 2NXZD 3BGMB 3UPRA 4HKBB 5MEND 1EHLL 2A38A 3VFRA 4DUXA 1UKTA 2Z31B 2H9GA 1P2CA 5IGXL 4LSUL 4K07A 1KFAL 1ZT7B 3FB5A 2IG2H 4GT7A 4NWUH 4WFFE 3MRHA 1H0DA 1KPUA 1I8KB 1YN7B 4XBGA 1CN4A 5E4EB 3KJ4C 4FTVD 3GJFB 4BSVA 2K7QA 5L0QC 5E08H 2GKIA 3DXAB 3HAEB 3CC5A 4DKFH 2HTLD 4YDLB 1S7VB 3QIWD 1VA9A 3TZVD 4AZ8A 4KDWA 4MJIA 2GTWA 4O2CA 1OPGH 4FQQB 4I0PD 4EXPX 1BF2A 2IC2A 4NNYA 4GUPB 4LVOB 3RWEA 5F89A 4KZEL 3H0TA 1RUQH 3QULB 3BZEA 3QUML 5ABDE 2VZSA 3MCG1 3S36H 2PN5A 3GJEA 5HHNA 3UDWC 2A9NL 3ARFB 4K9EC 4LRIA 1JGUL 4X6EB 1GHFH 4LASH 4NHCL 4LVNC 1ZA3B 4OZIF 1JN6B 4ZUSB 3KLAB 3WFBL 4GKOA 1TIUA 4JFXA 3UZQA 1NLDH 1F3DJ 3BAEH 5FA3B 2VDLH 4I77H 5F96L 2I24N 3QUYD 2XYCA 4PGDA 4ONFH 5D1XA 1JHLH 1L0XA 3WL9A 3VWKD 2AW2A 1R3JB 3IFNH 4JZNB 2AJUL 5FCUL 5FUZH 4IOIB 5JNYA 1JK8B 3EOTH 1X5XA 1JWMA 4F57H 3CNKA 3FQUB 4P4RB 3CZFA 5EU6E 3N1FC 4KDTC 1HH6A 1LP9B 4X98B 2DOCA 5B8CA 4MVBC 4QY8B 4GBXB 5E7BA 1UH2A 1XF4B 1K4DA 2PO6A 3PHOA 3MRIB 3DX6A 4U33A 5CP7A 4YBHA 3ZL4L 3KPQB 2J4WH 1IM3A 3KDMB 3MLRL 2C5DC 3VXUA 2IAMC 4X6DA 2E9BA 4OI9A 4KI5C 3UTSA 4YHZH 2DJUA 4ZPVA 3I3DA 4LSQH 1A6ZB 2VLRE 3MA9L 1IAOA 4LRIC 1KXVC 1JMXA 5TE6L 2A74B 4J4PA 1K5NA 5EUOA 2F54E 1QSFA 5EPMB 3LEXA 4J3VA 1OOAA 1CK0L 1FJ1B 4DZ8A 3TC9A 2NR6D 1QFWL 3HUJA 4FFYH 2J2ZA 1TQCC 1DBBH 4HZLA 2UYLA 2VDQL 4FQHA 2PR4L 3PWLA 1FCGA 5ETUA 5CJBA 4WI5A 2I5YL 1M1SA 5SWZB 1T0MA 1V3LA 4RAHA 5TE4H 1UQSA 4UOW1 3QWOA 4XXDB 3VG0L 1WWBX 5D1XC 3RNKB 3LN4A 4NUGL 3SKJL 3WN5B 3VFPB 3E6FB 1BBDH 2APTA 2ZUUA 5HBBA 1UXSA 2VXUL 4GXVL 4O9HL 4ZAKA 1ONQA 2R1XB 2Y5EA 3ARSA 1J18A 4RFNC 5MEOA 5HYJE 12E8L 3DYMA 1GZQA 5FYJE 2Z9TA 3HPLB 4M1CD 3ROLB 3P73A 5KSAB 1ND0B 2PYFA 5C0EA 4RBPH 3AB0B 4YX2L 5B8CC 1N7MH 4HDIA 4N90D 2PO6C 5B3JE 4HS6A 5TDNA 1I3GH 1V8HA 4DKAA 1QRKA 4ODWA 3BPNB 1LNUB 5EZLB 4HIXH 4XNYH 2XKSA 4J1UA 3WO4C 1BZ9A 1JRHH 3OKLA 1G9NC 4MJ6B 4LRNH 1NBZA 2ICWB 5SWSD 4YE4L 5J89A 4PRDB 3QBTB 3ULUH 1X9QA 2P5WB 4MAUH 4LGSB 4KMQA 4HGMA 3DBXB 3T77B 5F3HA 2GQHA 2Q8AL 3Q6FA 1JHTB 3L9RA 2V6HA 1S5HB 5JW3L 3D3VD 4OFYA 4J4PC 5JORA 4H5SB 1YEIH 3QDMD 1EAPA 3T4YA 4ZYKB 3QDJE 1KEGH 4MDIA 3ALWA 2A2QT 4WW2A 2GIYA 5GIRA 2DI7A 4HUWA 3C08H 4UU9B 4FQ1L 1LDSA 1XEDA 1BHGA 1I9RL 1SBBA 3UTPD 3GIZH 1WCQA 1LDPL 3S35H 4PJDF 5EWIH 2B1HH 3FQXA 3MTRA 4XP6H 2NW3B 2R2BA 3D39D 4KKAC 3BPOB 3VWKB 2NQCA 1BAFL 4YC2B 3JWOL 4ZAKC 4G3YL 1P84J 3QO1B 3I3EA 4Z7QF 5I71B 2R2EB 3FQRB 5D96C 3VXPB 1WZLA 3MLYH 1TQBC 2A77L 3LKOB 1INEH 2BHZA 3UYRL 5E5MB 2BSTA 1Z9LA 1F02I 1UJTA 4ZXBA 1OM3L 3FTGA 1FH5H 2X4SA 4PV9A 3ZKMC 1A22B 1BP3B 1J8HE 4Z6AT 3BVNA 1V3JA 5EU6A 2D3VA 4JFDB 1RJCA 2E8YA 2G5RA 4FHBD 3DGGA 2ZSWA 1FV1B 1H5BB 2CLZA 3IU4L 3MRNB 4G8GB 2H6PB 4MA7L 1VGEL 4NZTL 2VKXA 2C1OA 3F6IA 2P8PB 5DD6B 4P5KA 1NCWL 1WK0A 3Q3GB 1LD9A 2NY6B 1NC4A 1FIEA 4JKWA 4N0YL 2BNUA 3MLUL 3L3IA 4YHOL 4XZUA 3BQUC 1NCTA 2ZG3A 1A0QL 4G9FD 2VLRA 43C9B 1BF8A 3NCYP 1J0HA 4K3GA 4X5WB 2F54A 2QQLL 3ZDXF 1HHKA 2RAMA 4I9WE 5GS0C 4JKPL 3HC3L 3RWGB 4YGAB 4LAQL 1K8IB 2I9TA 4IMKA 3VI4E 2I07B 1F2XK 2HLFD 5EC1A 3SJVD 3PV6B 5GGUB 5HY9A 1E4WL 1UXWA 1UWGH 3AREB 2VZ3A 4KMTH 4M5ZH 3CVIH 4IHOA 4HLZH 5I74B 5HI5C 4M1GH 4XCEB 1F97A 4ZXBC 1L0QA 4AQ1B 2F19H 5L2KE 3CH1A 3MGTA 2FX7H 4JFOA 5HYJA 1GAFH 5AWNL 5GISH 3EAKA 4KH2A 1MIML 3X3FL 4TUJB 1XIWD 3FRPG 5C7XL 4JR9L 3GUTB 1ZHKB 5CEYB 5EU7E 5IP4A 2NY0D 3QXAA 3KPRB 4Z77A 1C12B 5LXGL 5IUSA 1JPGB 5D72L 4RISH 5CGYD 3GSVB 2BC4A 3Q6GH 4P3CL 1RUKH 3U82B 1P7QB 3TN0A 5CP3H 1WAAF 5C0GA 4JPKL 4MXQC 1FNGA 3VFSA 3V5HB 2X4OB 2A9MH 1FNAA 1HILA 2EZ0C 3CXDL 4Y5YA 4Y4FA 1Q1JL 4JGMA 3T2NL 4F15C 4PJ9D 3O2VL 2E27H 4K8RD 4GRMA 4LLQA 4OZFB 1PX3A 5JPNA 2O26U 1JV5A 3D39B 3KR3H 5I76A 3QDJA 1U92A 4JVUA 4H8WL 1DVFA 5TF0A 1ZK9A 1RFDH 3LD8B 1I9JL 1JNHA 4XCNB 4N68A 1YEGL 5IBUB 3WNMA 1MWAA 4Z95H 4GAYA 3VXOB 5T3XD 1QFWM 1BVKA 4UT6H 4X6CB 3DO7A 2CRZA 3BW9A 4RMRA 3GMLA 1MFDL 5ANMB 4WWKD 1JYWA 4LHUB 2YEZA 5E56A 4XVTL 5HHVL 3WUWB 1FYTD 4XI5D 2VSDA 5BV7H 3LKRB 4F7PA 3T0BA 1FFOB 1KJMA 5BZWB 1J0ZA 4X6BB 3KG5A 4KHXH 3EZJB 3X13B 4FQXC 3O2DL 2Y6SD 3U0WH 3AAZA 3BP6B 1VACA 1IAII 3I2CH 3GMMB 4ENED 4G6AC 5GHWH 1ETZB 2EDDA 3PWPE 4J23A 4OCNC 3TN0C 1Z3GL 4YLQT 3FQNB 2ZUVA 4KK5D 1J8HA 3ZMRA 2XRAH 4Y5YC 2LABA 3A6CH 4Y4FC 4YHIA 4ONHA 4G9FB 4HAGA 3RZCA 4Q9QH 3LQZA 1HQ4A 3OKMB 3QIBD 1XF5B 3GO1H 3C87A 3WKML 3TA3B 1DVFC 5MP6L 4CN4A 2AS5M 1D5MA 2FJHB 2IMMA 2Z93A 3TWCL 4YUEL 2HJLA 4XBEH 2K1MA 5D5ME 2Q7NA 3BP4B 4GG8B 4TOYH 4Z0BL 3RDTA 1PEZA 3FMGH 4JRWA 1CDJA 2R4RH 3GK8L 4S2SB 1KIQA 1FFPA 4P2QE 4U1SB 5E00A 2FNBA 5CEXB 2PW1B 5GRXG 4LOUC 2ZSVA 1S3KH 2QQNH 4QLRA 3O11B 2AJYL 2ADIB 2C1PB 1U8HA 2G75A 1DLHB 1OTSC 4X9BA 3VMOA 3SDXB 2FSEA 5CJOH 1ITCA 4OFDA 5GRUL 1XIWB 3SCMA 5LGHH 4OIIL 3UTTB 4H26B 2NY0B 1D5BB 3LEVL 2VLJA 3LDBB 2W0FB 1U8JB 2Q86A 3OPZL 1IGFL 4RGMB 2XQBL 4Y0GA 2AK1L 4OUUA 3QQ4B 4RBPK 3C60C 5L2KA 1T1WA 4HUUA 3BISA 3NZHH 4GAGL 4YHNB 1MIEH 2ADJB 3MCKB 4HMDA 1XR9B 2AJVL 5D7KD 4AT6A 3BHBB 4JFYB 4Y8DC 3P4OB 3IS1X 1FL3A 5GJSL 5IB2B 4CNIB 4M9PA 5HVFB 4PJ9B 3RPIA 5CBEA 1OW0A 2YUXA 1MQ8A 2R56L 3GSRA 4M5YH 5D93C 1W8OA 4HG4J 1MJJB 2Q76A 3ZT5A 3EZ8A 35C8H 3U7YH 3OAZK 2YXMA 3RDTC 3ZYOA 4WDIA 3N85H 1PEWA 4U2YA 3C9NA 5E8NA 2J7LA 3ARVA 3B9KD 5ALCL 4OI8A 1EXUB 5JHDB 1I1YB 4YFEA 2UZXB 5IK3A 3UBXA 2CKNA 4H1LB 1MI5D 3OSKA 4TPRL 1CR9L 3T65A 4BZ2L 1I1AD 3VD7A 5GZNC 5EOCH 5MERB 3RWIA 4R9HA 1PVHA 1BFOB 5KS9F 4Y4HD 3BWAA 3NMEA 5DC0A 3C2AL 4JFEA 4MLSA 1EO8H 3SCMC 1UM4L 4V2BA 4XWGL 3QI9B 3QFJD 5FEBA 5AUMA 5DI8A 2BDNH 2DQHH 5B38G 5I19L 1H3PH 3RU8H 3OKNB 4UNTA 2Z92A 4JDVB 5GXBB 3EUUA 4FQJL 3V2AR 4HIEA 3SKMA 2D7NA 4EZMA 4ONGH 4WUUE 1F13A 4UOW0 5AYUH 3X11A 2WWKT 5EU7C 3PABA 5H35A 2VDNL 1HSBB 2C3VA 1GIGH 1MVUA 3KPLA 4OCSH 4X4YB 1OW0C 1OSPH 1R5WB 3QIBB 2X4NA 5J8OA 3PWPA 1BX2B 5DJDA 2DL9A 5F1OB 4KRPC 1MVFA 3CMOH 3P2TA 4GLRH 4OZIB 1B0RA 5I18H 5L6YH 5IBTH 3QG6A 3V4UH 2BY1A 4HQQH 4LEXH 2XN9E 4MA3B 4YHKL 5I75C 3UXFA 3NABH 5DRNB 3MC0A 1A3LL 5ISZE 1Q72L 3GSNA 4H0GA 2G60H 2Y72A 5ITBH 2EDBA 4PJHE 3MUY1 1YEHH 5E8PA 5AG8A 3QRFM 1TTUA 2Y4SA 4Z0XB 2BMKB 2VISB 1CYGA 5HGAA 1BQUA 1T3FB 4WO4D 3WHE0 5D5MA 3RIAK 1WZ1L 3GKWH 1F58H 3GM8A 4AH2A 1K2DA 1NANH 2HKFH 3V9FA 1A7NH 1N59B 5CAYB 5LAXA 4JY6A 3BWUC 4P2QA 2FR4A 3S3PA 1KIPA 4R3SA 4K7PH 5C6TL 1KCUH 3PV7A 3V6ZB 4B41A 4DGVH 3MV9B 3BPCA 4KRMB 1JWSA 3MRCA 5C07E 2L0DA 1S5IL 4OGAD 3SO3C 3VH8G 1HEZA 3DTXB 4ZUWA 5A2JH 5CJXA 3BIKB 3BZ4B 1ZA6B 1T66D 4XPBL 4D0DA 5C0CE 3QEHA 4LCCB 3AS2A 2R15A 2EH7H 1JZ4A 3QHFH 4Z5RB 1QNZL 2PW2A 4HHAB 4O5LH 4P4KA 4CVXA 4I8DA 3VA6A 1WIUA 4B7LA 2G5BA 4NRXB 4W68A 4TQEL 5BXFB 1NJ9A 3PIQA 1CFTB 4KAQH 4Y5XB 3S88H 4NQDE 1INQA 1UM5L 4Y89A 4Y7MA 1HXMB 4ZPTA 4XNZC 1DQJA 3U2SB 5IR1A 2OTUB 3FO0H 4GMSL 1EGJL 4NQTA 4KQ3L 5LWYH 4PP2B 1ULVA 2QADD 1A6TA 1A5FH 3S37X 1P1ZB 2VDML 4L8BB 2XWBB 4BSWA 5DFVD 2D7PA 3ZTJG 2LTQB 1NCUA 3GSXA 5I17A 5HVWA 1MJ7H 1NQBA 1U3YA 1CL7L 4HKJA 3CFKA 3M1BA 2X5PA 1NGPL 1DDHB 3MGOA 5CJXC 1EH9A 5IJVB 4DCQA 1KLUA 5DUMH 3KXFE 1NCBH 5F9OL 1OF2B 4KK8D 4X8JA 5T1LD 5JXAL 5KOVC 2P8MA 4P4KC 4RFOL 4MD0B 3DVNA 2HRLA 2Z8RA 1LO2L 1J1OH 1RJZA 4ZNCD 5C0JB 5GGTL 1FRGH 4KJQD 4NQED 3T2QA 4RFEB 1ES0A 4P57A 3BMVA 2ZOLA 2YD3A 4GQPH 4WUUA 1IZJA 2AV1A 2WBKA 5B4MC 1T5WB 2EDEA 1PKQB 1JYNA 3UYPA 4GMTH 4LARH 5GSRA 3GRWH 1JJUA 4LSVH 4XP9L 5F1IB 4PJDB 5ESQB 5DJ8A 1EHNA 2A0LC 3BD4A 4W4NA 2ZCKH 5ESVB 4C55A 3LEYL 4R4NC 3WS3A 2W91A 4L1HA 4WO4B 3P3YA 2CDFA 4Y1AE 2XN9A 2V17L 4P9HL 5ISZA 1W0WA 1HI6A 5DJAB 4XGZB 1BZ7A 3QA3B 5BRZB 5ICXA 4PJHA 2DM3A 5LJYH 3EYQC 4QXWA 1WC7B 2HRPH 1JGLL 4AIOA 3QHTC 4LSRH 5E03A 3RJQB 3IXAA 2ERJB 5D1QD 1Z2KA 4CW1A 1TVBA 2FIKA 3V52L 3WXVH 4ZTOH 3G6AA 3TO4A 1TJHH 3B2UC 3GMRB 3BDYL 3O3BB 4L3EE 5DDHB 4U1NA 3U1SH 4XNMA 2H41A 3ZHDA 2YKLH 4ETQA 4Z7VE 2GAZB 5JLZB 5C07A 2V9RA 4FZEH 4PY8I 1F4AA 3QXDA 3STLA 5FO8B 4MYWB 4NQCD 2OZ4H 3VCLA 1HCVA 3V0VA 3SE8H 3L3DA 3MODH 4DKFL 3E0GA 5C0CA 4NGHH 2IAND 3BO8A 4KKNA 1ITBB 1PQZA 3MGAA 4WU7B 5DR5H 3PDOB 1X5LA 2HVJA 3L3GB 2A6JB 3VRLF 2R1YA 1OPGL 4YZFE 4ZFFA 1NUGA 5E2WH 4OFIA 2GFBA 3WLWD 2EXWC 4QCIB 2QKIB 2GJZA 5J12B 1JFQL 1MWAH 4KKBC 3Q5OA 2EXYC 2DKSA 3VU2A 1KB5H 3ARZA 1QFWI 1JTPA 3NCYS 1ZE3C 4PRAA 1T2QL 3EGSA 4KROC 3QXUA 3DXAE 3QHZL 4MXVE 4LQFH 2F5AH 1A1MB 3CPLB 4TUKH 1FQ9C 3AUVA 4JFFB 5F9JB 4NZUL 2X4RA 3VFTA 1C16A 4PJ5D 1JZ5A 4Z78A 2ZNXA 5DRXB 5F6IC 3EOTL 5HYQA 1MCPH 3VD9A 4K7FB 1FO0A 4F57L 4LSSH 1B9ZA 2YBRA 1G0XA 1L7IL 3L5XL 1PG7W 1QKZH 2KQMA 2NPLX 1BVLB 1UM6L 3KXFA 2G2RA 2HAZA 2KZ1B 4FQLH 1JF5A 5IB3B 4E5XB 4P9ML 4HD9A 2D0HA 3HZVB 3G6JF 2QSQA 5I15H 3W82A 5L2JB 4OFPA 2J4WL 3DX7A 5C0BD 4QRSA 4Y16A 32C2B 3ARBB 1JNLH 4MNQD 4NKIL 3QWRD 5HHXH 3DPBA 4M6MH 4HFUH 2DQDH 1INDL 3VDBA 1OAQH 2GEEA 5EZIL 1F3DH 1XCQA 5EBWB 2F8XC 4MD4A 1LP9E 2V2XB 5DD3H 5FFLA 5GZOC 1F11B 3CU7A 3KPNB 3BYYA 1NBQA 3FB8A 5TQ0H 4EIZC 4FFYL 1DUZB 5FYKH 4UTAH 2EYRB 4ZUVA 5ID1B 3C2SA 3TT3H 3RGVA 1SYVB 1OTUD 1QEWB 2AJ3A 5D1QB 1O7SA 5EU3A 5IT2L 2C7UA 3D0LA 5EFIA 3T0WA 5JZ7D 4Y1AA 3LAFA 4PGBA 4E42A 5LGJB 5F7FA 1FGVL 1BBDL 3MREA 1AR1C 3MJ8B 3RL2B 3DURB 4ZOEA 2XWJA 3KYNA 3GSUA 2ZCHL 4AK1A 2H8PB 3IJYA 1NKRA 4PRPE 1T04A 4UB0H 5HHOD 4U6HA 3QAZC 2RR3A 9CGTA 2AQ1A 4JHWH 2XA8H 1A4KA 1G7HB 1XGRB 2X40A 2IPUK 2DKUA 2YK1L 1T22B 1JRHL 5DJ6B 5SWZE 2HH0H 1U3ZA 4Z7VA 4YWGH 4LRNL 3ZYIA 4Y16C 2RQ8A 2I9LB 3OR6B 4RAVB 4LK4A 2P5ED 3IDMB 1YC7A 1H3WM 4L4TA 3NN8A 2MSPA 4V2CB 5DO2D 4JO1H 2ZWLT 1T21A 2H26B 3MPCA 1T1YA 3BGMA 1YDPA 3ZHKA 4HKBA 4LVHB 3NCJH 5ALBH 3DSNA 5CUSH 5H2BB 1HCFX 3C08L 1ZS8B 1F3RB 3RWDB 5I1DA 1M71A 5DEGB 2Z31A 4PRNB 4OD1L 4MA1B 2LU4A 3DETD 3DYOA 3VRIB 2PTTB 5F9DC 4YO0B 2OR7A 5DEZA 1ZT7A 1ZVSB 4HKXA 4PREB 3BDBA 4H20H 2P5WE 3GJFA 1NFDE 1AD0B 2EH8H 5IESL 3DXAA 3HAEA 4LIQH 1G7QB 4PLKC 1NC2D 1X4ZA 1FVCA 3DI3B 4R26L 4XP1L 4K71C 2KL6A 1LO0H 2NY1D 3M17B 3REVB 1T0NB 3MLYL 1INEL 2BRQA 3I50H 4WU5B 4FQQA 4M48L 3RZWA 3SKNA 1UB5B 2W9DH 5I1CH 4KK6D 4L9LC 2PNDA 1FH5L 1A9EB 3MRFA 5E5RB 1RU9L 5C0BB 4DW2H 4RZCB 4QRQB 4UQ2B 4HV8A 2ESVE 1ZLVH 2D7QA 5JXEA 3PWVB 1AXTL 4Y5VB 1CICA 2C3GA 1CE1L 2FX9H 5J6HB 2GT9B 1DFBH 2HP4A 2GSIB 2Z31C 2YC1B 1FORH 3IAQA 1TCMA 3CVHL 4NO3A 1I85A 3KWWB 1WV7T 4JZNA 1YNTA 1E6OH 1YNLL 4LF3B 5KS9B 3HE7D 4G6ML 3CSYB 4P5TD 2VSCA 3TJEH 3BRGC 3BN3B 5E4EC 5M7QA 5TGBB 2JELL 2MNUA 4QY8A 3VXRB 4N8CL 4OCRH 1CLYH 2XG5A 3UEZA 4G8GE 1KLFA 4GXUN 3HE6A 3BUYB 1U41A 3SKOB 3KNBA 3KPQA 3PQYE 4HXBH 4KMTL 1CE6B 4YK4C 2M1KA 5DJCB 3S34L 1JUFB 5JQ6H 4JM2B 4KI1A 3VE0B 1G9MH 4Z7OF 5LCVH 2NY4B 2F19L 4OF5A 1XR8B 1IQDA 3WFDH 4PRPA 5GISL 3MYJB 2A74A 5KSBE 4ACPA 2AK4B 5EPMA 1A14L 2B2XH 3HPJB 5BZDB 3ZT7A 4QRTB 4N5ED 5KW9H 5JXEC 1DQQB 3O3AA 3WFEH 1CICC 3RRQA 4OCYL 1UVQB 1XGQA 3SDCB 5SWZA 5CD3B 4L5FH 4XCYA 3WN5A 2BY3A 4IBLT 4YPGB 3RNKA 3TVMD 3VFPA 4I5BB 4YAQB 5LBSH 1FNEB 3VG9B 1RZKH 4QEGA 5J9PA 3NFNA 5MHSD 5FM4A 4GKSB 2JIXD 5EZJA 2BVEA 4NPYA 1ADQH 5KSAA 2Y07L 1N3NA 1RI8A 4HCRA 3WS6A 1ND0A 1ZKAA 5J57B 4PJ8D 1FPTH 1U8NA 3RX5A 4WI4A 1RFDL 4KI5F 3KPRE 1UJ3B 1S7SA 5EZLA 2CIKA 3DLQR 3V8OA 4DKEH 1HKFA 1ODAA 3A6OA 3HE6C 4GW1B 5ACMA 4HJGA 1GGIH 1ROWA 2EDHA 1PGRB 3GNMH 2ICWA 3MJ9H 1V3MA 1NFDA 2CJUL 3T77A 3NCBB 4QGYA 2APBA 4UT9L 1JHTA 1KJ3L 4OFVA 1S5HA 1F8TH 3QNYB 4EOWL 4QOKB 4ZYKA 1LEKB 4KHXL 3U6RB 4YEEA 1NCAH 3S9DB 1DSFH 3L5WB 5KZCD 4CAGA 1I8MB 1EERB 1MF2H 4UU9A 3V6FB 1VESA 3I2CL 1LE9B 5GHWL 4DVRH 1RJYA 3VFUA 5F44A 1BD2D 4QRPD 4OF7A 5HHPB 2IH1A 1PBYA 1GOHA 1AQDB 1BIIA 3HCVA 4U05A 2EC9T 1O7VA 4ZFGH 2XTJC 3WN5C 3JBG7 1KJ2A 3KPSE 3MLTB 5D1ZB 2V9QA 1YQ2A 4X9GA 3A6CL 2ESVA 4K9EL 3FB7B 2NY2C 4Y2DB 4LVEA 3HE7B 1T7XA 4YGVB 2R2EA 3GO1L 3I6LD 4U6VH 1U91B 5I8EB 5KSAC 3WS6C 2X4TB 4U1IA 3SDAD 4DEPC 3BEVA 1X7QA 2WINB 3W81A 3MR9A 4KV5E 1IGYB 5CILH 3VXPA 2BXZA 4HAFA 2BCKA 4XBEL 3LKOA 1FGNH 5E5MA 4FNLH 4HUXB 1EEQA 4PGEA 5IHUL 3BPNC 4MCYB 5HHQA 4NSKB 2Y1VA 4PFEA 1X4YA 2P24B 1V7ML 5L7XH 1JBJA 3CX2A 4TNVK 4OLUH 4YXHL 5EUOF 1A3RL 4U6YA 5DD0H 3D85B 5EO1B 1YY9C 1MHEB 4ZS7L 3SY0B 1MHPL 3EYUL 2QQNL 3UJJL 4F7CB 3HUJF 5IG7A 1FV1A 1IM9A 1T7YA 4GRLD 4LGRB 2XY1A 2N7AA 5DUBB 5A3ID 4G8GA 1NAKH 4C56B 2VQTA 3NPZB 3HNSH 5CJOL 3STZA 5K59E 1UCTA 4OCXH 1A7BA 3PQYA 1OGAE 3Q3GA 1RMFL 5C9KA 4EIGB 3DRTB 1KCVL 3RVWC 1RZ7H 1S78C 3BKJL 4OZGE 4RGNE 1MCJA 4AQOA 3T1FA 1LO5B 43C9A 4BQBA 5F6HJ 4YIQA 3BPOC 1PFCA 5KSBA 1WVZA 3BEWA 3O0RH 5ENWB 1K8IA 1N2RA 4KTYA 1JNNH 5I71C 4XCCL 3V95A 2A6KA 2I07A 4OQ1A 4K3EH 2R69H 2VKWA 2QQKL 1WF5A 1QFPA 4RSVA 5J06A 3ME0A 5I30L 3SGEH 2BHYA 1G6RA 1I7UB 3UTTE 2EC8A 3U7YL 1S7UB 2A6IA 3V4VH 3KGRA 1JF1B 5TDPB 4XCEA 5KVGL 4WNQB 5B38B 2AEQH 3N85L 2FBOJ 3EDDA 4WIQA 2ADGB 4OAWB 1IGJB 2HMID 2QEJA 1B90A 4NOBA 1FO0H 1ZMYA 1J8KA 5H8DA 2WBJD 1QFHA 3LQAH 3WNOA 5EOCL 5CLWA 4N0FB 2ZOKB 3KPRA 3VXSB 1C12A 2SEBB 1D5IH 1JPGA 4JO3H 2B7DT 1WBZB 2FWOB 2W0PA 2FB4H 4UBDC 2W1NA 3GSVA 1EO8L 1IBGH 3T3ME 1P7QA 1EVUA 3TESA 5KN5B 2V7NA 4ZOAA 3O3UN 3V5HA 3CMGA 2X4OA 4HJJL 4F3FB 1F6FB 1U58B 2DLFH 3RU8L 3INUH 3KPMB 1KENL 1JE6A 4DUWA 4R4FH 1EZVY 4OZFA 5JHDE 3BT2H 4NQVB 4ONGL 2WQ8A 1CS6A 2WIMA 5AYUL 1B4RA 3QCTL 1KBGH 1OQXA 1IQWH 4HWBH 3C8HA 5FB8B 2WLZA 1JZ3A 3P0VH 4QKXB 4YNYA 1GIGL 2FZ3A 1D6VH 1OSPL 1KTDB 1TMCB 3VFOB 4XCNA 3SDAB 1U6AH 4R97B 3CMOL 4NQSB 5DS8A 4LLDB 1J86A 3KPSA 5DVLA 5GRYA 4LHUA 4OCWH 4JAMB 2BVPA 3NABL 2P4AB 3ZE2E 2BFVL 3K1KC 3WUWA 5L9DL 6CGTA 5ITBL 3VD5A 1FFOA 3QJFA 3QDGD 4X6BA 5C6WH 1UA6H 2ZP0T 4IIQB 2VTFA 5E2UH 4BFGA 1HNFA 1WISA 3BP6A 3OF6D 1HOCA 4JANB 3KAAA 3GKWL 4M4RA 1F58L 1ETZA 2HKFL 3PL6A 1BEYH 4PJCE 4HZAA 4KUZH 3W0WA 2E3VA 4FXGB 1I8LA 1CL7I 3PGCB 4HIIB 3FQNA 5EIQA 5EO0A 4MSWB 1NCCH 2IQAA 1CGSH 3VJ6B 1OTTC 1KJVB 1DQDL 2XG4A 3MNZB 3TGXA 1MFEL 3RNQB 1P4IH 1JHKL 1DN0B 2JE8A 1YEEL 4OZHF 5C9JB 2DQJH 4HJ0C 5ADOH 3W39B 1EFQA 3ARUA 2WP3O 4WI3A 3TA3A 2FJHA 1OGAA 2EH7L 3QHFL 3UBXG 4G5ZL 1IL1A 5IMLB 3BP4A 3O4LD 2ARJQ 4OZGA 1KYOJ 4F37F 2VC2L 3DMMA 4S2SA 3GHBH 3K7UA 4F7EA 4L8SB 1LGVA 2OR9L 2PW1A 4KAQL 2P7TA 4LMQE 3BKMH 3MV9E 2EE2A 4OGYL 4ZNEE 1AQKH 2ZKHH 2ADIA 3OB0H 2C1PA 2GI7A 4PJGE 4WHYH 4UAOC 5GS0L 1ZWIA 4BH8B 3QDAA 2DLGA 5EORL 5HGHB 5IB1B 1QR1B 2J8OA 3RBSA 4BQ9A 4BZ1H 2J3SA 3UTTA 3GMPB 1A5FL 1D5BA 4QHMB 4UZGA 5EU5B 5HDQH 5CHNA 1U8JA 3PL6C 1HHHB 1I8LC 4JQXA 3D69B 2IEPA 3QQ4A 2OQJB 3MV7B 2HT2C 3K0WA 4MAYA 2BY2A 2ADJA 1KPVA 1QG3A 1XR9A 5E99H 4JFYA 3P4OA 2VQ1B 3DIFB 3NOIA 3EJZC 3NFSH 4M7ZB 1FL5A 1RJLB 5E6IB 5DUML 1NCBL 3LKPB 4LSTH 5KVFH 1K3ZA 1RD6A 2R39A 3TA3C 5I1KH 1QYGH 4NN6C 1AGBB 4JHAL 4Y19D 1MJJA 4BSJA 4KGLA 4M93C 4LSDA 4LHQB 1J1OL 1NMBH 1C7TA 2WUCL 4RGNC 1HKLH 1FZJB 3PNWB 2X9XA 5LKNA 1FRGL 2XACC 2J8HA 3DMMC 5KAQG 3G5XA 3HZYB 5T1MB 2OI9C 1QBML 5JHDA 3W9EB 3QFDB 1LO3H 4H1LA 4YDKL 3KPPA 3D25B 5MERA 4LSVL 1BFOA 2DIBA 1TJIH 3T0AA 2ZCKL 3VFMA 2K7PA 1NBYB 4MJID 3MRRA 2GTZA 3QI9A 3VGHA 4X80H 4KI5D 3LDBC 4IRSB 4W6WB 2ENYA 1HK6A 1OAKL 4JQXC 8FABB 4BFIA 5FUCE 5E8DH 4NDMB 3OKNA 4JDVA 1QRNB 3QISA 3K8LA 4MAYC 4XPGH 1OB1A 3ZDYE 1S7TB 2C4FT 3LN5B 2HRPL 5DT1H 3VRJB 1PKQE 4XP4H 4LSRL 5FYJL 5I1LB 2ITDB 2BVOB 1MJUL 4M3JA 1NGYB 3TFKC 4PJDE 1R5WA 2XA3A 4UILH 4PJCA 4IRZH 2EKSA 3PUCA 5BS0B 1TJHL 1X5JA 1U8PA 2MJWA 1DLFH 1D6EB 1R6VA 5GRVK 3RHWF 3ZTNH 1I9IH 3RY4A 4MA3A 2AKRA 4GG6A 3VI4F 1QTYT 4YFLF 5DRNA 2OZ4L 4JHBA 5BRZE 2P47B 1RZJH 5HHME 1NMCC 5BV7B 1NSNH 5L0QB 1U8OB 4NGHL 4MGXA 1I1FB 4Z0XA 5BW7C 1P6AB 4P2CG 2PO6D 1LMKA 2VISA 1T3FA 1J5OH 1DCLA 2ZG2A 4P5MB 2Z35B 1M05B 2GW5A 5T5NG 5DR5L 5DJXB 4OGXL 4ZUTB 3VXUD 2PTUA 4JRXD 4KY1L 4XWOD 1MWAL 3HB3C 4QRRE 4PRBA 3MV9A 2HWZH 3BJLA 4OLYH 1NFIB 4PJGA 2GJJA 3MACH 1KB5L 3DO3A 4A6YA 1I9EA 3E8UH 4J4PD 2JTDA 3B4NA 3QEQB 3BIKA 1QSFD 5LQBH 2X4PA 3EOBA 2F5AL 3MJ7A 4LCCA 4TUKL 4Z5RA 1FIGH 1AY1L 2OK0H 3UPRB 4HX1B 1CD8A 5JUEH 4P23B 3M45A 1EO7A 4UINL 2JJTA 3VFRB 3IS0X 4S1RH 1Q9KB 4ZTPH 1KACB 4KKAD 1OT1A 2H9GB 4LHJB 5FYLH 3LOWA 1A7RH 2VZOA 1CFTA 4WFGE 1VFMA 1P2CB 4AYFA 1D5ZB 4ZAKD 3TIEB 1YY8A 4TSAH 1QKZL 2OSLB 1H0DB 2IGFH 2HJFA 1HXMA 1KPUB 1D7FA 3RKDC 1R3IH 4A2MA 2BVYA 5CSGA 3HR6A 4XBGB 5FYLD 3U2SA 1CBVH 2R1WA 4BSVB 1E4XL 3CC5B 5EDXA 3PP4H 4UV4H 1X3DA 5H94B 3VXNA 3SGDH 4YBQC 4ODVL 1OAYH 1AKJB 4PP2A 5DHVH 3EDJA 4HKZA 4JFFE 1QOKA 1P1ZA 4PJEE 4KU1A 4L8BA 2Z8SA 3IDGB 2R29H 3ROOA 1B3JA 4U49A 3VXME 1A6AB 4OQTH 4U6TA 4NN7C 1JNLL 4O2CB 4RWYL 2ZCLL 2IAMB 5CMAB 2IH3A 4NNYB 5HHXL 4D9LH 4M6ML 1RPQA 4HFUL 2EE3A 2X2YA 3H0TB 3BZEB 1MCRA 2A1WH 2DQDL 1ZTXH 2VJXA 3NIGF 4AENB 5HHNB 3V79C 1SEBB 3O8XA 1WAAE 3QNXB 4ZQKB 3P40A 1TZGL 3CLEH 2FEDC 5FYKL 4UTAL 4LCCC 4JFXB 4HH9A 3TT3L 1ZEAL 5DRZB 4XPHL 2DYPA 2X1OA 2WK2A 3G6DH 4XB8A 3IDJA 2VNCA 5DEFA 1Z5LA 2CD0A 2JJTC 1OAZH 3TEUA 1MCWM 4O58L 5D1XB 4M6NH 3WL9B 1TNMA 5IOPA 1ZLUH 1F4HA 3V5DB 1O0VA 2Y9RT 1PKQA 5D5MF 5EIIA 1FAIH 3GDBA 3ISWA 1JWMB 4RFNB 2CIIA 4JJHA 1TVHB 3IF1A 4CRPA 5KAQF 3CZFB 2FBJL 5F1IA 1HH6B 4OD2B 1HHGA 4PJDA 2QSTA 4AG4H 1DJSA 2XA8L 3LB6C 1F90H 5B8CB 5ESVA 4O51A 2PO6B 3PHOB 5EC2A 1W72H 5HI5D 3DX6B 5E2JA 3NCEB 4YHYC 2HH0L 5CP7B 3Q2CA 4F58H 4XC3L 1G6RH 1UZ6F 4IEFB 3WO4B 1IEHA 1CLOH 3MOQA 4JGJA 4RNRB 5EU6D 4MJ4A 5DJAA 1AO7B 3VFGL 5CIPH 4XGZA 1QSVA 3QA3A 5BRZA 4PLOB 3MXVH 4XMLH 5HDBE 3HI1A 3UTSB 5JOPE 3VW3H 4LBEB 2MCPL 1ORSB 2V2WB 5CJQH 2NZIA 3H9ZA 3F7VA 5FA4B 5ILTL 3O8XC 3VA2C 5EUOB 1K6QL 3GKZA 3LEXB 3B3IB 4DZ8B 4G6JH 1CIUA 4UDTA 3HUJB 5F1NB 5DDHA 3OB0K 4HZLB 4U1MB 4PRHE 5TJWK 2EZ0D 4QRRA 2VWEE 4JCMA 3F12A 5C6PB 5JLZA 2VLRD 1T0MB 5FUCC 3O2WH 1K9TA 1UQSB 1MCWW 4H20L 4YQXH 1J05B 5FO8A 2F54D 2GYSA 1UXSB 5DHXB 4U31A 4LIQL 2FYYA 4DGIL 1ONQB 5T3ZE 3IDIA 5MEOB 1LO0L 5C08E 4O02H 2E7CA 1GZQB 1KTRL 3P73B 2PYFB 5C0EB 2A6JA 3I50L 5D96B 5BVJB 4HDIB 5E94A 1TQBB 1X5AA 1XZ0A 4KJPC 4HS6B 4QCIA 5TDNB 5CEZE 1R3LA 2QKIA 3HN3A 3O6LH 3RVVC 4K2UH 1UWXH 1EJOH 2VO5A 5T5NF 4ELMB 4J1UB 3OTTA 1G6VK 2RBLA 5HGBB 4DW2L 3TP4A 5D7JA 2RJMA 5HYJD 4X4XB 5FM5M 1HINL 5FYJD 3FONA 4N8PA 4Y4KA 3GSNL 2VH5H 4Q9BA 1H3GA 4K3DH 3Q6FB 1A1MA 4CMHC 1DQMH 3L9RB 3CPLA 3NCMA 2ERJC 2D31B 4G6AD 4JFFA 4PJEA 3MROA 2DQGL 3TN0D 5E4IA 1JGVH 1XGUB 4OBRA 3VXMA 1FORL 3MJ6A 4HUWB 1FN4B 1EA9C 5EBLA 1E6OL 4WW1A 3BQUB 3VDAA 1P4BH 5HYSA 2H45A 1T7ZA 4HW6A 3RL1B 2R2CA 4S1QL 4IOFC 1BVLA 2LAGB 3K80A 3QDJD 4XNQA 4UT7H 2FIRT 3LY6A 1M7XA 1DVFD 2W0KA 3AXLA 4OCRL 4LLVA 3WFHB 4TULH 5E5UB 3U0TA 5KVMC 4E5XA 4HGKC 2X70B 1MCHA 4F9PA 5C70A 1OCWL 2FO1A 5GJTH 1G7MB 2YZ1A 1IJ9A 4KVCH 4HIHB 4JQIL 3RY5A 1G1CA 2ZJSH 32C2A 1KLGB 3ARBA 2BSTB 4L3CB 3FFDA 4LOUD 4RWHA 3WDIA 2X09A 4ZXBB 3FTGB 3TLRA 5D7JC 2HT4C 4PV9B 3ZHLA 1OTSD 4N0RA 3BVNB 5EBWA 4KHTH 1EHAA 2B2XL 2V2XA 5IMMB 1KIUA 1MLCA 3MOAH 3KPNA 4Y4KC 2YUWA 3DGGB 4AEHH 3WFEL 4H25B 4P2OA 2VDPH 2APXA 3HAEG 1NL0L 5JIKA 5AZEH 5FOJA 1SYVA 3PDGA 5DJZB 4OIBA 1N5YL 2C1OB 1D9KA 4L5FL 4AEEA 2GUOA 4P5KB 3HMWL 2P43B 1J8HD 1ZHLA 1NC4B 4NBZB 1P69B 4NM8H 5LBSL 4GAJH 4LNRA 3RL2A 4LLWA 3L3IB 4XZUB 2H8PA 3NIFF 3D9AL 4A2LA 5GGSB 3BX7C 3RZCD 2VLRB 5D71H 1ADQL 4F15B 2GITA 4X9FA 2AK4E 5IJKA 2F54B 5HD8C 1FPTL 3MRJA 4W6YB 4EJ1C 3RX8A 2QSVA 1XGRA 2X41A 3QEGH 4JFHE 5B21A 1QA9B 3KYKL 4I48A 4F9PC 4PRHA 5EC1B 4DKEL 4XBPA 1T22A 4OZHB 1U0QA 4U0RB 1GGIL 4DTGL 5HY9B 4EQ2A 1QO3A 1UXWB 4I3SL 1DBJH 3GNML 2I9LA 3ARBC 3MFGB 3NTCL 3IKKA 1AH1A 4IHOB 2XV6B 4WI6A 1KEML 4M02A 4N9OB 3OQ3B 1NAMA 1T5XA 1MCOH 4I9WD 1QACA 5FIEA 1F8TL 4IRJB 3CH1B 4JFOB 5HYJB 1Z6JT 4TSCH 5C08A 5IFHH 1NCAL 3GSQB 4PJBE 5DZNA 2WLYA 4PUBH 3SCMD 1KGCE 3H42L 3O9WC 1MPAH 1ZS8A 3RWCA 1C5BL 4P2OC 5TQ2H 5K33A 4FQXB 3PWUA 2EYSA 3QXAB 4Z77B 1AFVH 3GB7A 5JR1L 3PWJA 3S7GA 1D9KC 1CDGA 4YO0A 3ARDC 5L2KD 2XNAA 2QV2A 3LS5L 4ZFOA 3MLVH 1KPRB 2PYED 3VFSB 4FABH 3QQ3B 5J7CC 5I1AA 3F58H 1HILB 4L29B 4XPFH 2YPVL 3RA7H 4Y5YB 3OAYH 1MCNA 4Y4FB 5HJ3B 1G7QA 5F9WC 2D0GA 3VFWA 3M17A 4GRMB 4LLQB 4QOKE 5JPNB 5BO1L 5IJKC 3FL7A 3REVA 4APQA 2BERA 5BMFH 5HSFA 4RMSA 3O3DA 4XHQA 3BGAA 2VRAA 4JG1H 1CFVH 5IWLA 2VXSH 4EDXA 4FNLL 4HPOH 5DMYA 1KC5H 1JNHB 2VWEC 2OJEA 4KKLC 1F4WH 1KT2B 3SE3A 5L7XL 2FHFA 1MWAB 3OX8A 5DD0L 4GAYB 5FGRA 2HA1A 4CKVX 1KOAA 5EN2B 3ZKXB 2CDGB 4RZCA 1BVKB 5FUOL 1V7NL 4UQ2A 3BW9B 3P9WB 1KB5B 4FQCH 1FFRA 5H37H 3U48A 4WY7L 4U1JA 2YEZB 4XTRD 1FHGA 2M26A 4FFZL 1RY7B 2IMNA 2RCSH 2OR8A 1UC6A 4KPHH 4NCC2 3UZEA 2AV7B 1CU4L 1XF3B 2GT9A 4JO4H 4OCXL 5JOEA 1SJEA 2GK0A 4OLXL 1KJMB 5I2IB 5F7EL 3ZT6A 2YZ8A 1RZ7L 2VZ1A 2YC1A 2ZNWA 3AAZB 3KWWA 3GMNB 4LF3A 4Q58C 2EE9A 1QSEE 4XB7A 2HJKB 1NPUA 4OV6F 1KB9K 3C60B 5T33H 1RIUH 1AJ7H 2HVKA 1FDLH 1WTGT 4RMQA 1JNNL 4RAUB 5I8CB 3X3GH 4ONHB 4JB9L 4MZ2A 4C56E 4K3EL 4JO2H 4Z7VF 1HQ4B 4ZO8A 1FZMB 1UH4A 2DBLL 4APQC 1MCIA 3BUYA 3PWPD 3SKOA 1A7QL 1UCBH 2Z93B 5IWLC 5D93B 3BGFC 5DJCA 4XAWH 1HHIB 4JM2A 4XMKH 3UTZB 1HXYA 3HKFA 2AEQL 3SE3C 4UIKH 3RDTB 1XR8A 3ZLQC 3OR7B 2UUDH 1FFPB 5TPWH 2AABH 1FO0L 3OJDB 1WLHA 2AK4A 1T6WA 3HPJA 5BZDA 2ARWA 5C86A 5HPMB 1L6XA 5ITFA 4LSPL 1B2WH 4JO3L 1U8HB 2G75B 2FB4L 4HF5H 5D7LB 1IBGL 2EIEA 4S1DC 4WFHD 5EO9B 3SDCA 1IGIH 2ED7A 2ZPKL 5CD3A 4WGWB 3SCMB 3W9DA 4R96A 4UUJA 2OP4H 2MTPA 4P2QD 4DN4L 4QT5A 1DBMH 4M7LL 4I5BA 2MQ0A 1FNEA 5D8JH 1DBAH 2VLJB 1MAML 1OP9A 3UJIH 4R7NA 2Q86B 1SY6A 4JREC 4GKSA 5DMIH 4OUUB 5C2BH 4R4FL 3P0GB 4PY8J 4DN3H 3BT2L 5L2KB 4HUUB 1MELA 5I1HL 4WEBH 7CGTA 1KBGL 4PJBA 3BI9X 2DQCL 4AIXA 4AT6B 3QUXD 4W70A 2DLIA 3LHPH 1FL3B 1UWXK 1D3CA 3ILPB 3BOVA 4P4KD 1I7TA 3UZVB 4FG6C 1LHZA 1U6AL 2VE6B 3WMSA 5JPMA 5F7YC 2CXGA 3GSRB 3IDNB 1F5WA 4KRPB 4AL8L 2Q76B 4JM2C 2F8OA 4OV5A 1IGCL 2X1QA 1X5YA 5CZXC 4WDIB 5F8QC 5MEQB 3C9NB 5E8NB 5AAMA 2VYRE 3R0NA 3QNYA 3VRLE 5KVEL 4ERSH 4EN3A 3B8SA 4QOKA 1T20B 2BRRL 4HK0A 5I73B 5IK3B 2A0LD 2DI8A 3L5WA 1XH3A 4PBWD 2HT3C 3HMXH 3V6FA 5BVPH 1VFBA 5JOFB 1GGCL 1BVZA 3C6LD 3PE9A 1BEYL 4DGYH 3SDCC 5HHPA 1AQDA 4NKDA 4FTVA 4JFEB 3E2HC 1FNSL 1VEPA 2HG5A 3P30H 1NCCL 1WEJL 1CGSL 3FT3B 5D1ZA 1SQ2N 4PJXE 5SX4I 5DI8B 3QIWA 3FB7A 3ULUE 3EYQD 3TZVA 5JMRA 3MRGA 2Z92B 4PBVC 4I0PA 1U91A 3SO3B 3O81A 2WINA 4Q9CA 3BH8A 1WSST 3CDGB 1FBIH 3RWFA 2I27N 3X11B 3MLXH 4XC1L 2YA1A 3B2UD 3PABB 5H35B 2AJXH 4J12A 5MEPA 2C3VB 3KPLB 3K74B 5I66B 2FX8H 3AROA 1SHMA 2P24A 2X4NB 5DJDB 1QSEA 43CAA 4RDQG 3HNVL 2NXZC 4XPAH 4IDJL 4WUUD 3QG6B 4R90H 1YECL 1AQKL 1JPSL 1FG9C 5GPRA 3TCLA 1Z9SA 2AEPH 2XFXA 3OAUH 5AZ2H 1A1OB 4C56A 1C1EH 4EN3C 5C1MB 1BJ8A 4OZFG 4HK3J 4XNZB 2APVA 1SBSL 3F8UB 2EDYA 3CAFA 4BZ1L 5GGQH 1G9EA 3DRTA 4ODXA 5HDQL 1S9WA 1G7LA 4KKBD 2XN9D 1NUNB 4EDWH 3P0YH 4XHJD 3OKOB 7FABL 2ILLA 5LAXB 5ISZD 4V1DE 4RX4A 4JY6B 4NO2A 5DLMH 5IMKB 2FR4B 5D1ZC 4CDGC 3LIZL 2C26A 3IDXL 5E99L 5ENWA 3QIWC 1X5KA 1YYMH 3BPCB 1CG9A 3NFSL 4I0CC 2CR6A 4KTDH 1JWSB 3TZVC 4LHUG 3MRCB 4QWWC 3FZUD 2CR3A 3ARWA 4NIKB 3VFNB 4C58B 4I0PC 4JGUA 4LSTL 1HEZB 4ZUWB 3WUWG 4K7PY 1FLRH 5I1KL 1QYGL 5HVGB 3BDXA 4CVWA 3WCYA 3LRGA 4BFBD 3TO4D 4NHUB 1TNNA 3QEHB 3WO3B 3KLHD 3R8QA 1YUHA 1NFDF 1TZHB 1NMBL 4G7VH 4URTB 4NN5C 1JPTH 2XZZA 3TYGL 2D2OA 2BVQA 2G5BB 3IU3A 4OAWA 3P77B 1FP5A 1IGJA 3ESVF 2J8UA 1LO3L 3G04A 1NJ9B 3PIQB 2WWMC 3MNWB 4X0KA 4F2MA 1EFXA 3MO1A 3W2DH 2HN7A 1INQB 1A6PA 1GGUA 2SEBA 3TBYA 5J1SC 2FWOA 1EEYB 5KSUB 1YNKL 3OGOE 1DQJB 3QUZB 1R0AL 4CL7A 4MLIA 2GSGA 3JTSB 4X80L 1WJ3A 1F2QA 3OAYK 4XT1C 1A6TB 4LLYA 4KRLB 1U58A 4LU5L 1RIVH 4J3XA 5HDLA 3KPOB 4BSWB 4NQDD 2VXQL 3KPMA 1K3IA 3GSXB 2WV3A 5I17B 4IDLA 4XPGL 4NQVA 2D9CA 3UTQB 2JLLA 4HKJB 3CFKB 5FB8A 2H32H 3QZWA 5BCAA 1YJDH 1Y6KR 1T83A 2PXYA 3MGOB 3IAGC 3B9EA 4DCQB 3LV3A 4NQSA 2BJML 3OHXB 2XI9A 4X8JB 4YHMH 3MV01 3PG2A 1YEFH 4LLDA 3FT4A 1AE6H 1CXEA 1AR1D 4U1GC 2N56A 1I9IL 3DVNB 4PJXA 4S1SH 5C0RL 1FL6A 1RJZB 2F58H 4JAMA 2B0SL 4K94H 2W9EH 2VR9A 2DTML 1E4XI 1QRNE 1ES0B 4BUHA 5CSZB 2ZOLB 1OP3K 3NAAL 3KXFD 1ZHBA 1NSNL 2OTWA 4WUUB 2AV1B 2DLEA 5DVNA 4IS6A 4HCRL 1J5OL 2CKBH 5GSRB 1H3VA 1ZLSL 2YD5A 4G43A 1TFHA 1FE8H 1IT9H 1RIHH 5FDWB 5IV2B 3WIIH 5KJRH 5DJ8B 5GGSY 5BS0E 4OD3L 4ALAL 4FXGA 1TCRA 3PGCA 2Q7YB 4Y16D 5KSBF 4ODTL 3IFOA 4MSWA 3UYOD 3LZFL 1H8SA 4PS4H 4EBQH 2DQIL 1CGTA 1Q0YL 3EO9H 3MNZA 5DMGD 3MACL 2XN9B 5TFSH 1DN0A 2YR3A 3E8UL 1ZGLP 4YFLI 5LQBL 1HI6B 4YXKH 1BZ7B 3U9PH 5ICXB 5ESAA 1CD0A 1VFAA 4KROB 3IFLH 2OK0L 2Q20A 4H1LG 1T83C 1WGOA 1T0PB 3RGVD 2PXYC 3IXAB 5JUEL