1UYWL

Crystal structure of the antiflavivirus fab4g2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Crystal Structure of the Antiflavivirus Fab4G2
rcsb
molecule tags Immune system
total genus 52
structure length 212
sequence length 212
chains with identical sequence N
ec nomenclature
pdb deposition date 2004-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywL01
2CR3A 4ISVB 3MCLH 2X4QA 5SWZD 4PGJA 3C08H 3WDIA 1KPRB 4G5ZL 4G6JH 1UCTA 4MJ6A 2FJGA 4AEEA 1OAUH 4Z5RA 1J5OH 3EGSA 1T7XA 2Q20A 3TBTB 4PGCB 4PJ9B 4QY8A 1AGDA 1AD9A 2OSLB 4Y88A 1FNEA 3ARSA 1R3LA 5E9DB 1I4FA 4Y16D 2OTWB 3QQ3B 1BLNA 2VDKH 4ODHL 4K3GA 1A7BA 2ENYA 3MZGB 3MV9E 3UO1H 4BK5A 2IH1B 2X1PA 3DXAD 5E2WL 2P24A 4X6FB 4AM0A 4HZLA 5IGXH 5DO2D 4PRDA 2X40A 2E27H 4MJ5B 3MRRB 2GW5A 4D9QD 1HH6A 4YUEH 1AJ7L 2C4FU 2FNBA 3CZFB 2NY4D 1IGYA 3OF6D 5C0CA 2WQ8A 1OVZA 4MA3A 4UI2A 3RX5A 1INDL 4I5BA 5L7XL 4FZ8H 4QOKE 4LSUL 4QYOB 4AIZA 4NKDB 2KQNA 3MOAH 5K9QI 4XNMB 1TVHB 2L4OA 1HXMB 3CCHB 5B38G 1TNNA 1LK2A 3IU3A 3KLAB 1AIFB 4PREB 3WNOA 4PJCF 2PETA 1NL0H 1A7NH 4KK9C 3MREB 1U42A 2NY0B 4YC2B 1MI5D 3CVIH 4EXKA 3N1QC 3PQYE 3QA3A 3S9DB 4CADA 1MCSA 3QO1A 5ERWA 2FO1A 2NLJA 3ZDXF 1FRGL 3R06B 2DD8H 3CFDA 5TH2B 4LMQI 3PHQB 3RWHA 2VDQL 2Q8BL 3ULUE 1A8JH 4KK6C 1CWVA 5KOVC 1OAZH 5CUSH 5GJTL 1CG9B 2W65A 3U1SH 1TJHH 4LKCB 3I84A 3MBXH 1EAJA 5DJ2B 2FD6H 4CMMB 1AC0A 4LGPB 1FJ1B 1TCRB 5GGRB 5C86A 5MEQA 3VXPA 3QG7H 1I7UA 1RULL 1FL5B 4M5YH 5K33A 5KSBA 3QEGH 5CGTA 5GS0D 5DZNA 1IL1B 1KULA 2R0WL 4ACPA 1SEBB 3ULUH 4HKBA 2EDFA 1CVSC 4NO0D 1ZXQA 2VZOA 4RGMC 1EO7A 3UBXA 4OKVB 3SO3B 3D0LA 5TDPA 4U0QB 1IKFH 2ITCA 1MHPL 3DHJA 5LBSL 5MHSE 1A4KA 1CD0A 2BRRL 3PGCA 2VXQH 1I8LC 2FZ3B 3KYKH 4N90D 1L7IL 3GSUB 4XC1H 4N0UB 4Z7QE 3R1GH 1C1EL 4C83B 1EIBA 2V7NA 3JZ7A 1RZGA 3HI1B 3LKRA 3D6GA 5C07E 3S4SG 1I8KA 2YUWA 5D71L 1IAOA 3B2UD 2PO6B 4C57C 1CQKA 4F7EB 1AQDB 1B0GA 2IPUK 2R9HC 4HT1H 2I26N 4Y1AD 1A7QH 3QHTC 2X4RB 1CN4A 4PJAE 1FBIL 5MI0B 3GB7B 2WLZA 1BZ7A 1DTUA 2L7JA 1KNOA 1R6VA 2V17H 3U0TB 2HFFA 4N8CL 4XCYA 2I07B 3KHOA 3FKUS 3L5JA 1RZJC 4QXUL 1N64L 3N50A 2QBWA 4E5XA 4FFYH 1GYAA 1DBJL 1S7UB 2IAND 3O3UN 4JLRA 5E8DH 1A6WL 4I4WB 4WHTA 3RNQA 3IFLH 4UZGA 1Q0XL 1K6QL 5K93A 2D7QA 4BSJA 3JTSB 5FGRA 1RZ8B 3FFDB 1YPZA 3KYMA 2DMKA 4P2RD 4F37K 1IAIM 2QQQA 1ZHNA 4DK3A 1KIQA 4Y19B 4UINH 5F97E 1ZGLA 5I1GL 3TESA 1D5ZB 3QG6B 5EDXA 1FVEB 1KEMH 1D6VL 3IXTB 5IB4A 5A3IC 1G9MC 3BP6A 5F6IB 4NO3B 2OTPA 2QSCH 4ZOAA 3UROR 1K4DA 3HAEB 3HB3C 1DBMH 4H20H 4KK9D 5SX5H 4P5MA 3CFJB 1J87A 3OB8A 2V9RA 4YK4B 1IGFH 1FPTL 2J2ZA 1ND0A 2R0ZL 1IARB 4KWUA 4OTXL 5EIIB 5J4MA 3LIZH 4KQ4L 3RZCA 2O5YH 4H5SB 2OJZH 1RIHL 2I25N 5D7IF 1QO3B 4HWBL 3ARFB 3HNSL 2XKNB 1YC7A 5EUOF 1TTUA 4KK6D 3MRNA 4NDMB 3QUML 1FNSH 2JIXD 1VADB 2ESVD 1BAFH 5HYEA 4ORGA 4XCEB 2BCKA 3INUH 5C0GB 5HY9A 4PRIB 3GHBL 1KXTB 1N2RA 3FO9A 3N0PB 4LVNB 3VGEA 1DQLL 4URTB 4M7KH 1ZLSH 2ZNWA 4ZO7A 1DBAL 4U2ZA 4LPVA 3VD7A 4D3CL 5SX5K 5JO5A 3LHPH 1FFOB 3BD5A 1EO8H 4Y4HC 1FN4B 2IWGA 2VAAA 3WD5H 4ERSL 1H3PL 1MFCL 5EU7E 1E4WH 4QHNB 3C8KB 1WWAX 3LEXA 3RIAK 4DVBA 1DUZA 4Z18A 4UDUB 3IDYC 4NNYB 3SDDA 4EN3A 1NGYA 2ZZUT 2C3VA 4MNGB 2HJFA 1XCQB 4OZIE 3KPRB 4IRSB 1IGJB 4U1JA 2FIKB 1M1SA 3BGFB 4DGIL 3WIIL 3NABL 5I15L 4HKXB 4X8JB 3TNMA 5C09E 1S9XB 3QNZA 1J05B 3G6DL 3ZHDA 4GKOA 5GRJH 2BJMH 3PP4H 3LD8C 3OKLA 5D6CA 5FA4A 3TF7C 5IIEA 4GAJL 4JO3L 2R9HD 3LQZA 2ZPKL 4LVOC 2XTJC 4DEPB 5BV7B 3V5DA 1EFXB 5EUKA 3UBXG 3QDHA 1U2HA 4FTVD 4XBGA 3RA7H 3TZVA 2HG5A 3F6IA 4I3GA 4NQDB 2X4SB 1KPVA 3NAAL 1H3TA 3QZWA 1SY6H 3PL6C 5LGJB 3GMNA 4K07A 1YEEL 2AXGA 4HUKB 2GUOB 2AP2A 3OXSA 4OQTH 5SWSD 1Q9OB 1X5LA 2VKXA 4I9WD 4P4KC 3CD4A 1AGBA 2XA3A 1IRAY 2K3TA 4X6CB 3QXDB 2BXZA 2AK4D 4ZPVA 3E2HB 3NCMA 1NMAL 4EDXA 5L2KE 1RJZB 3RU8L 5IFHL 4MD4B 4PRPE 1CE6A 3D3VD 4YFEA 2BNUA 5HPOA 3S88L 2ZUSA 5I9QC 4Z77B 3OKNB 1RD6A 1DLHB 3VG0L 2V2TA 1CGWA 3I3EA 4PLJC 3QAZB 5A3ID 4WUUB 3GGWB 3JUYA 2D31A 5L6YL 2VL5B 3T1FA 5FYLE 4OGXL 2MTPA 1UJ3C 3KJ4B 5IB2B 5ITFA 2GSGA 5FA3A 1G7IA 1CD9B 2E8ZA 3AROA 5BRZA 1N0LA 2GI7A 4OZ4B 3DNKA 4YIQB 4OJFH 3O8XC 4YLQT 3WL9A 5CJ8A 1UCBH 2YRPA 1GZPA 2FX9H 4POYA 3VWKC 4XP4L 3MRPA 1DN2A 5KANI 5F7DA 4FXGB 1IAMA 2DB8A 3L3GA 5ALCL 5E8EB 4YHPA 2CSPA 2C1OB 1BM3L 1Q72H 5GS1C 1KB9K 4OUUA 2DIAA 4NN7C 3DV6B 4IS6B 1IJ9A 1XF3A 4LSSL 3O45A 4Z7WE 1RJYA 3LB6D 4ZXBB 4NKIH 1PLGH 4PRHD 5DJ6B 3MRLA 3ESVF 4OD1H 5EU6D 5B3NA 1EMTL 2OL3B 1L0YA 4L29A 3D69A 3SDXA 4MWFA 2ADGA 3KXFE 1QR1A 2ADFL 4LGRB 2VQ1A 5HHPB 3I6GA 5IQ9B 1PFCA 4NRYA 3E1F1 3RNKB 1UB6A 1RZKH 5I76B 1UB5B 4JR9H 3D85B 1LO2H 3RL1B 5I18H 1FAIL 4HBCL 2DI8A 1CCZA 2ZG1A 4LSDA 3BHBA 2XTJD 3PNWA 1HOCB 3MPCA 4TNVK 4R0LC 1IILE 3NIGE 2LV4A 2Z8SA 5DJAA 2DQGH 4J7RA 2VLRE 4MA8L 3U9PH 3S34H 3PL6D 4MXQC 3SBWA 1YA5A 2NX5D 4Q0XL 4G42A 1F2XK 3LN5A 4K7FA 1F4XL 1H5BB 3HZKA 3K2UH 3AGVA 2EYTA 3FRPA 3LQMA 1FVCB 4L3ED 4RA3A 4BSVA 5GS3A 1JWUB 5JDJA 5IESL 3O6FB 5F89A 4P2QE 4L8CB 1JGDB 3O4LA 5EA0L 3RWCA 3VXUB 3U9UB 2XYCA 4WO4A 2YC1A 4PJ5E 3K7UA 2NY1C 3QCUL 3KPTA 2GITA 4EI6B 1VFAA 4XPAL 3WJJA 3VE0A 3FRUA 5F96H 2O61B 3H7BA 5EOQL 4EOWL 1YEKH 2F58H 3QZWG 2A1WL 4UOW0 4ZO6A 2NW3B 1T1YA 4BQ6A 2P8PB 2Q3AA 4OZFH 4PLJD 5TE7H 4WDIB 5KG9B 2R4RL 43C9B 4XH2A 4FQIL 3MV11 4P0DA 2P49B 4MAYA 3MMEA 1ONQB 1D5IL 1QNZH 3V52L 4XMLH 2RCSL 2AJYH 1Q9WB 4D0DA 3V4VH 1UEYA 3I75B 4JO4H 3QDJB 1MRFH 1WFTA 3SDAA 4QTHA 5A2FA 1H3XA 1K4CA 2ICWJ 5D6DA 3G5YB 5E56A 4NQUA 4ETQA 3O8XD 1NCCH 3GMRA 4HSQA 2EYSA 4FQJH 4H1LB 3S36H 1J1XL 4GKSA 3ECBA 4KKLC 4P3WA 3VWKD 4UQ3A 2EYRA 2X4NB 3GMLA 2PYEB 4GFTB 4MNHB 3DO7A 2CIKA 5CSBA 4IHOA 4YPGB 1ZWIB 1KYOJ 5GS2D 4PLKC 3T08A 5AWNL 3T2OA 1YN6A 2OLDA 3S97C 1QVOA 2H1PH 4K7PX 4PGBB 1QSEE 5GGVL 2J8OA 4ZO9A 4I18C 1B0WA 5IBTH 1C5DA 1U91A 3NH7H 2HH0L 5IP4A 3WHE0 1EZVY 2W0FA 3QXWA 1UWXH 1MQ8A 3DROA 2H32B 1FNFA 5ADPL 5C92A 25C8L 3O3BA 4RQQB 3FO2B 4DKDC 1S7VB 1FC1A 4M7LL 3VFWA 4N0CD 3GSNB 4Y5YC 1JFQL 1JNNH 4JEGB 4NWTH 3DXAB 3VXME 5IEHB 3WNNA 1QTYT 4FOMA 4WTXA 2WWMC 3G5ZA 5E00B 4PJCE 4J3TA 4RISH 2GY7B 3G5XB 4R3SB 4XWOC 2NMSA 4X9FA 5J6GB 3L5XL 2CR6A 5EO0B 1FAKT 3Q0HA 3ARGC 1JPSL 3ZDXE 1LO3L 1M6OB 5DSCB 1UWXK 4DKAA 1Q94B 1WTGT 4JPWL 1PGRB 4MXQD 1QLEH 4HIXL 1MI5B 3FMGH 3T0EE 3BGAA 4O5LL 1YY8A 5JLZA 4JQXC 4MJ2A 4OV6F 1AKJA 1X5KA 3B2VH 4XCNA 4GQ9H 4XNQB 4ISVA 2YEZA 4ZODA 4P9HC 2FEEL 4XMKH 1WIUA 3T2QA 4HGWB 1DL7H 1JVKA 3NVQA 3S96A 3MLZH 5HHOE 3MZTA 4OCWL 3A67L 2IQAB 1KIRA 2Q7YB 2FO4B 3FFCE 4K3DH 1YEHL 3R8BB 4F9LA 3IDXH 5EG6C 3QFDB 1DUYA 1YEFH 1P4IL 3KPLA 5C3TA 3E3QE 5DS8A 5EZJB 5FUOL 3S7GA 3FRPG 4MJ5A 2OZ4A 1XZ0B 5KVFH 1WK0A 5EBMA 3IT8D 4I77L 1KJVB 3QQ9C 2VXUH 1P4BH 4GBXA 4NO0B 1S9VB 4CVUA 4YGAB 1ZHBA 5I2IA 4E42A 4XNMA 3QWOA 4KHTL 4U1LA 1RJLB 2WUCH 1HXMA 4FQ1L 5C08D 2JB6B 5D2NB 4YQXL 2MNUA 1AIFA 4PREA 3IRPX 1W8OA 2KKQA 1SM3L 2FJHB 4KKLD 5E8OA 1ZAGA 4OF8A 2DQFB 2F8VA 4P57B 4LIQE 3WFEH 5D7KE 1ETZB 4TSBH 4XCFH 4K23H 4X9HA 4BH8A 3CSPA 4KAQL 1W72H 4Y1AB 2A9ML 4UNTA 5E2VH 3DI2B 1WLHA 3TYGH 1ADQH 2P5WD 3H9SE 2EDTA 3ARRA 4PG9B 3QQ4A 4OT1H 2R2CA 1YEIH 4Y5XC 4ZD3L 4ONHB 2L0DA 3VFTA 4PJGA 5J6HB 4L5FH 3E6HA 4JPVH 1QFWI 1NDMB 3WIFA 3SJVD 4FQ2L 1FJ1A 4RFOH 3JV5A 2EIEA 4OGYH 1I1AC 5CHNB 3EO0B 5HPMB 3FONB 2VXTH 3ZKQD 1CTNA 1NC2A 2A77L 3DARA 2WWMD 1OTTC 1NCDL 3SOBL 1CFBA 1GL4B 1GGUA 1ZT1A 1ZS8A 1MIEL 1P7QD 3FN3A 4P2RB 1JF1B 1LD9A 1LEIB 4XWOD 3IYLW 5DVLA 1UH4A 3P4MA 4H8WH 5C6PB 3HNVH 1HINH 3VD4A 5ITBL 3ARGD 3B9AA 3KPSE 4PBVC 5ELIA 3GSUA 3MRFB 4MNQE 4JAMB 4YHIB 1NGXB 5D7IE 4L9LC 3UPCA 3HI1A 5EUOE 1PYWB 3MLWL 4WEBL 4XBEL 4DVRL 4YDJB 5ICYB 3WFCH 1CZ8L 3W39B 1Z5LB 1AQDA 2DS4A 3ABZA 2ADIB 4Y8DC 1N7MH 1F00I 4QRQA 3GB7A 4KTEH 3MNWB 4HKJB 4JVPA 1VFBB 4AQOA 1INQB 3GK8L 3IFOB 4G6FD 1DEEA 2CKBA 3IDGA 1Z9MA 3OJVC 1I8MB 3I3BA 2H26A 4AT6B 2ID5A 1IBGH 4DZBA 2E7MA 3BESR 3VFVA 4R7DB 2BVOB 4L4TE 3W5MA 5FYKD 3N9GL 3KYOB 3ARQA 1R3IH 3KAAA 1SJVA 3MBEA 5GSVA 3EJJX 1FV1B 1RZFL 2P5EE 3RKPA 4LLWB 4X6CF 3QQ9D 2C4XA 5H37G 2Z8VC 2HWZL 4NO2B 4FQCH 3VGGA 3UPRB 4RGMB 3OHXB 4X7FC 3V6FB 4M6OL 4BFGA 2EE9A 1D5ZA 1XR9A 4LEXH 4HFWB 4XP6L 3IXTA 2BNQA 3G6JA 4NZJA 1P7HL 2DF3A 4QLRA 1CGTA 3VFRA 2E9BA 4ZUUB 3CFJA 1MAML 1TXKA 5D70L 2DBLL 1BX2B 3C60D 1ZT7A 4OM0L 3PP3H 4JFFA 4K94H 1VERA 3AREA 4JDZB 5D96C 3TV3H 3MLRL 3CXDH 3EHBC 1XMWA 4LCWE 2LU4A 1CBVL 2Z93B 5JA8B 1DSFH 4JFQB 5KVEH 2GTWA 2BVUA 3U7WL 5JW3L 2Y7QA 5CJOH 4JHZA 4WJ5A 5HGHB 4NDMA 1VADA 4WFGE 4PYGA 3RWEB 1FFNA 3OKDA 4UIMA 2WSKA 2E8YA 2WBKA 3NCFB 5E2JA 2CLVA 4OZGA 3DRTA 4BUHA 3QR2A 1KCUL 1OGTB 4HWZB 3MUJA 1I1AD 4ZS7H 2CGRH 5SWSB 1QBAA 3UXFA 5FFLA 3BKYL 4HPOH 4F7PB 3PP3K 1VPOL 2D7NA 1OTTD 5A16B 5TPWH 1G9NL 3FAWA 1CXHA 1GZQB 5DI8B 2AK4B 4CVZB 5EBWA 3EYFB 3GMOB 3HE6D 4HW6A 4KC3B 4XMPL 32C2B 3BT2L 3HMWH 3D3VB 4TRPL 3RGVC 1U8PB 1XCQA 1HYRC 5FHBH 3O9WA 4IRSA 1IGJA 5HDQH 4HGMA 3B5HA 3BD4A 3GSWA 1T0NB 4HEME 4HKXA 5I19H 1XH3B 2JJTC 5D7LA 1J05A 5EH1A 1EX0A 3MYZA 1D5BB 2NXYC 2HTLC 4RWHA 2XWBB 3KWWB 1HI6B 4WY7L 4LL9A 4Y2DC 1FL3B 3W9DA 1NPUA 1A1MB 5FCUL 4G3YL 4K9EH 1GGTA 1CD1B 1HHKB 3K3QA 4XAWH 2X4SA 2YA1A 5EIQA 3Q3GB 1RIVH 3C9NB 3LS4L 35C8H 1PSKL 5HVGB 1NAML 4ZOCA 4TUKL 4BZ2L 2YMXL 1T2QL 4F9PA 4ZTPH 4WW1B 5ICZB 3GUTB 4XGZB 1AD0B 2D0GA 4BH7A 1UA6H 5DJXB 1BD2D 5TE4H 1CGSL 4O2EA 1NH6A 2JB5L 2V2WA 4Y4HB 4RNRA 4ODUA 4P3CH 4LHUD 1E4KC 4PRHB 4AL8H 5J57B 5BVJA 2R0KL 4FXKA 5EU6B 2HFEB 4Z77A 2P7TA 1T04B 1DLHA 3IDYB 3OR6A 4NKOA 4XP9H 2EDBA 3UTTB 3VRIB 1R5VB 1RUPL 3GGWA 4JM2A 4QRRE 5IV2B 5E7FA 3QEHB 4X5LA 1MEXH 1NCBL 1L9MA 3F7PC 3P0GB 3ZE2F 4U6TA 4M6NL 5IB2A 1QACA 2VDRH 3X13B 2CXKA 2WW8A 3LD8B 2I5YL 4WTWA 3EHBD 4BFBD 4KY1H 3FO0H 4OZ4A 5FGCE 4LVOB 1E4JA 2XTJB 2C26A 2A6IA 1BQLH 4XB7A 4XAKE 4PJ7B 1T5XB 4XNUL 3OKOB 3DSNA 4ZAKA 4FXGA 1UXSA 4MQ7A 4Z7VA 3OGCA 5JW4R 3PL6B 3TJHC 4HUXB 3BGMA 4U1KB 4KGJA 5CINL 1O0VA 5DK2B 5IJKA 2NX5B 5C0AE 3D5OF 4YXHH 3DYPA 4M1GH 3FHAA 3DV6A 3BXNB 4LU5L 2PXYA 1HK6A 3O11A 1XF5B 4L3EB 2DDQH 4OCSL 4P4KB 4V2BA 1OAQL 3MXWH 4XVTH 1IEBA 4F3FB 1NLDL 4H26A 5T1LD 1FCGA 3HZMB 4NBYB 4YBHA 4YR6B 4H88L 4E41D 3SCMA 5IFAH 4MAUL 1BFOA 3IFPB 2ITDB 3O81A 5T3XD 1MJ7H 5MEND 3RGVD 2EDYA 1BMGA 1J0KA 5I9QB 5DUML 4AEHH 4LRNL 1HIML 1MNUH 2DQUH 1INEL 1NFKA 5D93C 5FXCH 3RNKA 1HSBB 2IG2L 4QRUB 3VXRE 3EO9L 2NXYD 2HTLD 1LO0H 5IROC 3D85A 2YA0A 2VQUA 1AI1L 1D5MB 1FO0B 4HXBH 4Y2DD 1UJ3B 1VA9A 4MA7L 2ZKHL 5C2UB 4PJHB 3BP4B 3ESUF 2Y4SA 3OTTA 4N8VB 1HOCA 5I6XC 2BOCB 3FQXA 1WISA 5SV4A 2UY6A 2ZJSH 2VZ1A 3IDNA 3O8XB 2OZ4H 4XP1H 3W5NA 2Z91B 2XKSA 4YHNA 3VWKB 3X11B 1LHZA 2A6JB 4NRZA 2I9LB 4NSKB 1PBYA 3GKWH 4NOBA 5ECJE 1KYOK 5GS1B 1FVCA 4PB9H 4M3JA 2QV2A 4F7CA 4HG4J 1T2JA 4NN7B 3O6FA 1YECL 2PCPB 4G6KL 4YHLH 4LLVA 4KJQC 3CVHB 4P2OA 3HPJA 1NCWL 3PV7A 4YGVB 4BSWB 1GOGA 1ACZA 3EDJA 1WBZA 4OF5A 2O61A 4JFEE 4ONFL 4O9HH 3KPQB 4XWGL 2IFFL 4WI8A 1YYML 5GZOC 1J9CT 2BNRA 3OWEA 4JFDD 4MD0A 2NW3A 4N1EA 2P8PA 3NA9L 5IT2L 3VFNA 1LO5B 5IM7B 4ZFZB 5A2IH 3U0WL 1J8HA 5JMRA 1NUFA 3MV01 2JELH 3SGKA 2DQHH 3BWAA 1FGNH 4K8RC 4OSUH 4QHKI 4WGWB 4YHKL 5SWQA 1OQXA 3AS3A 4HJGA 5E5RB 4NFDA 1I3RB 5DJDB 1Q9WA 4KRMB 3QDJA 3BI9X 1FORL 1F3JA 4N0UE 5DMGD 3KJ6L 3P73B 5JIKA 3WLBB 3BMWA 2EH7L 5E08L 5B39A 1NANI 4R0LB 1HQ4B 1C5BL 2HKFH 2PYFB 4Z6AT 1KFAH 3MO1A 4MNHA 5F1IB 2OI9C 3BUYA 1JGUL 3MRMB 1JHKH 1NC4D 1ZMYA 4HZAA 4YPGA 5E94B 5HGDB 4MMZC 3TJHD 1ZWIA 5C71A 2CPCA 5H94B 2HKHH 4QXGL 4DN4H 3MYJB 3QUYC 4HFUH 2MPAH 2J8UB 4JO2H 2R2HB 4Z7UE 1EHXA 3IJYA 4QHMB 1RI8A 4CU7A 3TVMC 3QH3B 2AQ2A 2ZWLT 1C5CL 1MREL 2NY1B 2YD9A 4HCRL 3PWPA 4NO5B 5GPRA 4GG8A 4OLZH 1KJ2L 2DLIA 2B2XL 2D9QB 3AU1A 4P9MH 3SN6N 1I1YB 3DXAA 5T5NG 1AR1C 5BO1H 3QFJD 3VFGH 4HHAA 5KJRH 2CKBH 4FNLH 4Y19E 2X7LA 3I3DA 1I8IB 1CXLA 2RAMA 1JHTA 4A6YA 3G5XA 3WE6B 3M17B 3BKMH 2XZQH 5J6GA 1O5DT 4NYLA 3HMXA 1KGCE 5DYOA 4Z7OF 4B7IA 5DSCA 1DQJB 4KV5F 4AEIL 3V6BR 5TF1H 3O4OC 2B1HL 5F9JB 1EGJL 1NBVH 4ODVH 3GIVB 1DEDA 3F7YB 1HHJA 1XGYH 2O5ZL 3MA7B 4JQVA 3NACH 3GDBA 2W9DH 3UTSD 4MCZB 4RFNC 4IMLB 3WEXB 5ILTL 4NQEA 1NQBA 4D0BB 2KBGA 1J0HA 4TPRL 3O41A 1M4KA 4I18B 4KJQD 5AYUL 3FL7A 1AGCB 4O2FA 4MQXC 4KMQA 2P5WB 4PRIE 4R26H 3BW9A 1TVDA 1OTUC 3TYFB 1KCLA 1VDGA 2I60L 4PJ8A 2DQCH 2Z8WC 1U41A 4HIHA 4X4YB 3M1BB 1OAKH 4P48A 1XGQB 3STZA 5GZOD 3ZDZF 4TULL 2J6EL 3MRBA 3QFDA 4LEOB 3SJVB 1FH5H 3HG1A 3V7MA 1G0XA 4HUWB 4UOJA 3O2VL 1CFVH 3DX6B 1FLRH 1A1OB 4UT7H 1A3LH 4K8RD 4Y5YB 3HLAB 3IFNH 4XBPA 2ZCKH 4O4YH 1WQVT 3REWA 1BF2A 3V0VB 1KJVA 2BDNH 3VXSE 4MNGE 5BQ7B 3KPRE 3OKKA 3WUWA 2AQ3A 4JN1L 3L3IA 2ORBH 4P23C 1OW0C 3TO2B 3HS0A 5DGRA 2BFVH 2WUBL 1U3JA 1GIGL 3ARGB 3L3OA 3IB4A 2FJHA 2BVQA 1NCAL 1HILA 5T1MA 2X09A 5BZWA 2A6DB 2H8PB 4JFPB 2PW2A 4DOHB 5CMAA 5ACMA 2ATKA 2EXWC 1KLUA 2FYYA 2J88L 4NQDE 1CDYA 3QUYD 3I50L 4XPGL 5HYSB 3QCVH 3GNML 3U4BH 3LEYH 1KXQE 3TVMD 5DD3L 1F4HA 4IOSD 1BVZA 5DEFB 5CFHA 4D9RE 1JGLH 4G6FB 5B39G 5J6HA 2EDNA 3K80A 2DQEL 1BWWA 3VU2A 4J8RB 4QHKJ 4R4FL 2VWEE 1YMMA 4X6CE 4YAQB 3HE7A 5BV7H 1UVQA 5JOFB 3B5TA 5GGTA 3QJHA 5I1CH 2ZUYA 2XWJA 3EO0A 3U83A 2NW2A 4ELME 5I1KL 3FONA 4LLYB 2VKWA 4HWEL 4BQ9A 3OXRA 4ETYA 3VH8G 4DKEL 5GGUB 2EE6A 4Z0XA 2F19L 1G9ML 4HJJH 2HRPH 2G9HB 1B88A 4RAVA 4WUUE 5DD6B 3VFUA 1MQKL 1U8MA 3MRFA 2Q87A 2DQJL 3S35H 1NGXA 3QI9A 5ENWA 1NEZB 1U9KA 4DW2L 5IW1A 5F9OL 4JPKL 3UTPD 1PYWA 4AJ0A 2YPVL 3QHZL 2G75A 3MJGX 3NMEA 3W39A 2GJ6D 1Z5LA 4R4BB 3BZ4B 3BYTA 5INDA 3LCYA 3GRWH 2YPLB 4UILH 1ED3B 4WNQB 3P0VH 3PHSA 5DD5L 1G6VK 1CXFA 3MNWA 4OD2B 4Y5VA 4NCC1 1NKRA 3JV0A 4LKXA 4G8FB 1RV6X 4YBQC 4MQXD 4K2UL 1YN7A 3IFOA 1OTUD 1GGBH 1AP2B 5C2BH 3VD5A 2SEBA 4Y5XB 4N5EC 1BJMA 2DLGA 5I30L 6FABH 4G7VL 3O6LL 2EE2A 4FQLL 5EC2B 5ESQB 1YQ2A 5F7EL 4PJFF 3OKMB 4LLUB 3WNPA 5I1HH 4NUJB 1IEAB 3DVNB 1I1AB 3OG4B 2YXMA 4JY5L 1WBYB 2B0SH 1FV1A 1G7QA 1QFWH 4LLWA 4UB0H 4G7YL 3L3JB 1NSNL 4YJZL 2OTUB 4X4XA 3UPRA 5D1XB 3OHXA 5FK9B 2BVYA 5B3JF 4U1HB 3NTCL 1I9JL 1BQHB 4YHZL 2YS4A 1S7TB 3WFZA 5LGHL 1FE8L 4MXVF 4N0FB 1FNAA 1TTFA 5I1DB 1FZOB 3BN9C 5I71C 5JHLH 2FWOA 3LZFL 4RIRB 2IC2A 4NC1C 4C54A 2HRLA 1PX3A 1A9BB 1BX2A 4Q9RL 4L9LB 4HXAL 4L1DA 3SE9L 1GJIA 5BVPH 3JWOL 4JDZA 1MCEA 1E6JH 4TSAL 2EXWD 5JZ7C 3QUMA 5TDOA 4R6UA 2AAVA 3SKMB 4DGVH 4JFQA 1CLOH 2HT3C 1MY5A 1I3UA 1T80A 1B90A 4Z95H 2EH8L 5CJ5A 3WUWG 4P49A 1TENA 1B4JH 1MWAA 1CE1L 4HF5L 2CDFA 4PJ7F 5E8PA 4PP2A 2AI0L 5ACZB 2B1AL 5K59F 3RUGB 2IPTH 3VXUE 4WFFD 4HWZA 4WUKL 3LPWA 4M62L 4JFHE 3VG9C 4NQCB 5E6ZA 5A16A 3QUXA 3QEQD 1BD2B 4NM4H 1KB5A 2XN9A 4CVZA 3IETB 2AV7A 1RHHB 4KDTA 1IFHH 3MRCA 4LHUB 2OYPA 5C8JB 1IM9D 5EOTA 2MFNA 4YHOH 5EU4B 2BY2A 32C2A 3ZE2E 3ME0A 4NC2B 4OFKA 4TTGA 2QR0A 5EBLB 4PJXA 5T3ZE 4LSPL 1E6OH 2OR8A 3RIFF 1ULVA 1M7IA 5DR5L 2VABA 4R96A 1FNGB 2NYYC 5GGQH 2P45B 3IKCB 1J1OH 1WWWX 1YEGH 2P44B 1DANT 1FL3A 2K7QA 5D96B 3EOBA 4RGOH 1A6AA 1T4KA 3TH4T 5JORB 2PYEE 5A1AA 5EU5B 2WANA 2QKIA 4PJHF 1KSRA 3SO5A 1S5HB 1FZJA 2W0PA 1WF5A 5T3ZH 3W0WA 2G2RB 2KL6A 4JKPL 4N5ED 1JV5B 2XIDA 3FB5A 2AK1L 4KQ3L 1W0YT 1KELH 1S7QA 4I48B 2GFBB 5SWZE 2XZAH 5IBUG 5I1AB 4R90L 4X7EC 1EHAA 4LSVH 2YWZA 2ZCHL 2QEJA 1AD0A 4QKXB 2RR3A 4UT6H 5DJXA 1IC7L 2Y6SC 4NKMB 5C0CD 4XXCC 5ACLA 4Y4HA 4JDTH 5I8EA 3WFDH 3ROLA 2IGFL 1T5WB 3NFSH 4UTAL 5I1EL 5C3LD 2F53A 4YFDB 1LP9F 4BZ1L 3RWGB 5IVXB 5C6TH 1JRHH 2D7PA 4E41B 4JANB 3MJ8A 2X6MA 3UTTA 5MENB 4PJEF 5I0ZA 3RGVB 4I3SL 3LS5H 4I3RL 1F58L 1U58B 3KNBB 5ADOL 1MAJA 4LK4A 3BN9D 1QFUH 1KENL 5EN2A 3RZCC 5IWLA 3O3DA 5FUCC 1MHHA 2NXYB 2A74B 2VDLL 1H8OA 4OF6A 5JZ7D 4XX1E 3QYCA 5JUEL 1A7RL 5E5UB 1JTOA 4Y2DB 1OARH 2HT3D 3REVB 4NT6B 3MGOA 2ZG3A 5DF0A 4LLQB 1MI5E 1SEQL 1T0PB 3BP5B 2Y9RT 1ITCA 4HQQL 4MSWB 3MRDA 4A6YH 4G80B 1RUKH 2R4SH 3ZKSD 4X99A 3ULVL 1DQDL 3H9YA 4U1KA 1OP9A 2MHAB 3PWLB 5CIPB 3BE1L 1F4WL 4ENEC 2WMPA 3BXNA 1AFVL 2AJSH 1GVIA 3KDMA 4P4KA 3SDCC 2R1WB 4LAQL 1XEDA 2ZG2A 5E2TL 1RIUL 3RGHA 1TQBC 1SJEA 4LCIH 1KN4H 2J8UF 4LSQH 3SKJH 2GK2A 1DLFH 5FYJL 4G5ZH 3SDDC 4EN3C 1Y0LA 4X6DA 3L7FB 4NJ9H 5DQ9B 4MDJA 4F58L 1MVUB 1JHLH 3BX7C 3T4YA 3VXOB 3K0WA 1S3KL 4JFDB 2CO7B 1RMFH 2PKDA 1PZ5B 4OV5A 5DEGB 3V4UH 4ZFGH 5C9KA 1EH9A 1IGTB 4ZPTA 2NYYD 3RZWA 5CP7B 4FS0A 4XNYL 5E1HB 3I2CH 1FO0A 4U3HA 5D2NE 1YEJH 3DV4A 4PTUB 5F7HA 4PJHA 1RK1B 3BP4A 4N90E 3CJJA 1AJ7H 3TZVC 1UXWB 3WXVL 5CEXB 3DO3A 2ED9A 3QIBA 4MB5A 5GS0H 4XPBL 1CYGA 3O8XA 3KYNB 1S5IL 1VSCA 1UT9A 3MCG1 1U6AL 1IC5L 1P4LA 3RBSA 3GFUA 5EBGA 4TTDC 3EFFA 4Y1AE 4TUJA 4H8WC 1BJ8A 1NC4B 5IJVB 1ZLUH 2ZCLL 4NBXB 4QF1B 3BSZH 1K8DB 2F9BT 5AYQA 1IGCH 4HX1B 2E5EA 2F54A 2Y6SD 3FB7B 1U93A 4X5WB 1DBBL 3DVFA 2F5AL 5IMOB 2IANE 2VITB 5E6YA 2VDQH 1U8QA 3BMVA 4YDLC 3HFML 3IDIB 4Z78B 5J9PA 3V6OC 3L6FB 4KTDL 5GJTH 2XACC 3R0NA 1X4YA 2DQTH 2R15A 5IK3B 4PUBL 2ATPB 4JKWA 2DKUA 3X12A 4ZFZA 4C59B 4UIKL 5FB8A 1P2CA 4AYFA 4X9GA 1NGZA 4P2RE 3NA4A 1WAAF 1A5FH 5D93B 2CMRL 5ALBL 4Z7OE 3QFJB 1I3RA 3RZCD 3QHFL 4KV5E 2OK0H 2FL5A 4L4VA 4G9DB 1I1FA 4X5XB 1MFBL 5GGTH 3WLBA 2QLVB 1MCBA 4FMKA 2OQJA 4D9QE 2N4IA 4KKNA 3VFMA 1HHHA 5I6XB 1Q0YL 2PYFA 3HKFA 1JNLH 1MIMH 1RZIA 4LARL 5KBNC 3P11H 1GAFH 3MRMA 4LLDA 4P9HL 5E94A 1DCLA 4IIQA 4IRZL 1OM3H 4JFEA 4KK8C 4DAGH 4D8PB 3UTSB 1F6LL 2CDEA 3ZDZE 1MJUH 4OFYA 3H3BC 2ESVE 5KSVA 5FKAA 5CSZB 4F80A 1SBBA 1KT2B 4K94C 3LKPB 2DWEB 4PJDB 2Y07H 3SDDD 3LQAL 5FYKL 4EN3D 3BDYH 1MLCA 4FRWA 1WC7B 2D03L 5ID0A 4EXPX 1N64H 1J86A 3WNMA 3MJ6A 1DBJH 3ZYZA 4D9LL 4L8DA 4WRLA 4ZFOB 4KVNL 3Q5YA 4HK0A 1QFOA 2NTFB 2FBJL 2VH5L 5FO8A 3EUUA 1MELA 3CUPB 3X17A 3VWJA 2YSSB 4GAFB 5DK0B 4ELKA 2CKNA 1OGAA 3UZVB 5EOCJ 3MRQA 3H3PL 5GSRA 3TZVD 1RUML 2NZ9C 3SHSA 3RL2A 1MF2L 3EOYG 3FQWA 1OOAA 1VEMA 4JVUA 1HQRB 1YY9D 1PKQA 2MKWA 3NZ8B 3LRSB 3SBWC 2LABA 1JZ3A 1F4YH 5F9JA 5FOBB 5KN5B 2V9QA 1ZA6B 3U4EB 2HLAB 3GIVA 4QGYA 1D6VH 3ELAT 4ZQKA 1KUMA 3BEVA 3WKML 2OI9B 4UTBL 1X4ZA 4FTVE 1NANH 5JR1L 4IMLA 2XOTA 3P4OA 2DLFL 3CH8A 1XGPB 4WO4C 3QXUA 4Y4FA 3QUYB 2LVCA 4YX2L 4KQ4H 3Q1SH 3BH8A 3RJDA 1K2DB 3HC0A 1AXSA 3PXHA 1EEUA 1SYSB 3WJJC 1XF2A 2GCYB 3TVMB 1YQVH 1MVFA 1FNHA 3VXTB 3CC5A 1M7DB 2A9NL 5LJYH 5SWSE 4GO6B 3QUMH 4I9WE 3FB8B 4U1IB 4LEOA 1CFTB 1BJ1J 4F33B 2AGJH 4HUWA 2FDBP 2FLRT 5IQ7H 5J1AA 3DX6A 2UZYB 1MWAH 2AK4E 4Y5YA 2HFGL 5F7KC 3HLAA 5KSAA 2QQKH 5F1OB 4MD5B 4L8SC 3X3FL 3OV6A 3O6MH 4NP4L 3D3VE 4C4KT 43CAB 3MXVH 5HHNB 2NY6C 5BRZD 1EBPA 5D6DC 1SJXA 2VLKE 1KIUA 3QWRA 4LCCC 1MFCH 2DM3A 3LMJH 4G8GA 4EVNA 2FSEB 3ZKXC 1S7XA 4K7PL 5LG1A 5D5MA 4ODSH 3RFZC 3B9DA 1ZHKB 4ZS6C 4PG2C 1MLBA 2HTKC 4FQHB 1KB5H 4Q9BA 3ULSB 1HXYA 5JPMB 3DSFL 2DWDB 2WINA 4WI3A 3O4OB 3WIIH 4JB9H 3SGJA 1IM3A 1ZANL 1MCOH 4X6BA 3OKEB 4FP8H 2GJ6B 3E6FB 4UT9L 1S7RA 4KK8D 2AV1A 5ANMB 3I9GL 1JN6B 1A1NA 4RFNB 4WGVB 2R56L 1M71B 1WBXA 1CDGA 4PGEA 2DLTA 3UTQB 4PJFE 3STBA 2DLHA 1WUNT 1VKXA 1AE6H 5FCSH 3UZQA 1U8KA 1QFHA 4JHWH 5B38B 1CFSA 2PR4L 4JREC 1DQMH 4O51A 5IR1A 3DOSA 5DQJA 3CH1A 4KTYA 1TJIL 1OD9A 4Z7NF 4JFXB 5E2UL 4NN5C 3RUGF 1JZ5A 3MRGB 4PRHE 1JPFA 1WWBX 5B3JE 3EOAB 3VD3A 5EU6E 1IAII 1J7VR 4MXVE 2W9LA 1UZ8B 5GGUA 3PIQB 5KS9E 3VA6A 3HC4L 2EDLA 3ROOA 5IHUL 1B3JA 5I66A 2VQTA 5IB1B 2NZ9D 2R29L 1CLZH 3BIKA 5IFHH 4P23B 5T5FL 2YPKB 4S1QH 3QULA 3VG0H 1SBSL 3C5SB 2XPGB 2R23B 3VD9A 2XTJE 2MCPL 4EKXA 1JYWA 4MDIA 5DJCB 1J12A 4TNWF 5JDSB 4PJ7E 2DQIH 3BZ4A 3CLEL 1I9IL 4YDIH 3QCTL 4R97C 1KCRH 2YPLA 3GIZL 3O4LD 1JUFB 1Y18A 4WNQA 5K59E 4KRPC 3J7HA 3MJ9L 4WO4D 1LVEA 4OD2A 3WN5C 5IKCB 5JHDA 2VR5A 5T33L 5DRXB 2NX5E 4CVWA 4ODBD 3K8KA 2HLFD 5FGSA 4F9LC 4LLMA 5HBBA 4L3EE 4K3EH 4L9DA 4POUB 4OLUL 3MFFA 3TNNB 1T03L 5EC2A 1R3HB 4HUUB 3OKMA 1MHEB 4NUJA 4MAYD 3DVNA 3S4SB 3O0RH 1NAKH 4NKQB 2RIKA 3OZ9L 3WFHA 3BEWB 1DJSA 1TIUA 1PQZA 3IDUA 4JY4B 3CFCH 5C0DA 1B2WH 4GBXC 4DTGL 2JCCA 2VRAA 5IMKA 4LSSH 5A2KH 3KPPA 3SDAD 3QEQB 4CJ1A 3T2PA 3P9LB 2NY6D 5D1XA 3CSBA 1A47A 4OAWA 3GSVB 3RDTC 1IM9B 4Z0BL 1KN2H 5FDWA 2VLJB 5DMKA 5IVXF 1BQHA 1MH5A 1NMBL 4U05A 4MLSA 3CU7A 4J3XA 1WEJL 5I1DA 1N8ZB 1G6RB 4RIRA 3V9FA 2HTKD 1CK0L 2ZUWA 2Z4QA 1KPUB 4R7NA 3HAEG 5I73C 3GBLA 1G7MB 2XWTB 5EO1B 3U7AA 3VJ6B 3LEVL 4ORZC 2X4QB 3QT2A 2L7UA 1BEYH 4MJ6B 2FJGB 5CCKL 4Z5RB 5F3HA 3EGSB 4EQ2A 2XZCH 4QY8B 1AGDB 2E3VA 1AD9B 4W6XB 4G43A 1RFDL 4FZEL 5D9SA 1HHIA 1LEGA 4G6MH 1R3LB 3LH2L 2ZOLB 1I4FB 3FZUD 1RUQH 1U8IA 3BJ91 1FO0H 5L2JA 1BLNB 5ACZA 5DD0H 5CWSB 4Y0GA 1LP9E 1MFDH 3OJDA 4WFED 4AM0B 3IVKA 4LDOB 4HZLB 4J1UA 5GRUL 5C0RL 3VFOA 4NQCA 4L4JA 4YWGH 3C08L 4PJEE 4G6JL 5C0CB 5ESAA 4MA3B 1OAUL 4MLIA 5FF6A 1J5OL 4I5BB 5C7XH 1IC4H 3JV4A 4AIZB 1EHNA 5C8JA 4AG4H 3ZZ1A 1KC5L 1EUUA 3RRQA 5IVNA 1ORQB 4MB4A 3GSOA 3VRJA 2VDKL 3IU3B 4EOWH 1IQWH 3MUGA 4KZEL 4N8PA 1F90H 3UO1L 7CGTA 1OPGH 4PS4H 5I71B 15C8H 3D2UA 1AKJD 3S5LA 4CADB 5IGXL 3IKCA 3P3YA 3QO1B 2E27L 5ERWB 2NLJB 3CFDB 3EYSH 2FCBA 4YUEL 5FDYA 1U2CA 3GJEA 3V52H 1T20A 3NCJH 3T8XB 1H3UA 3RWHB 5JORA 4FZ8L 4KRPD 1NAMA 1PJ9A 5IW6B 3K4AA 1DVFC 2W65B 4OCXH 5IOPA 5E8NA 1Z2KA 1KCKA 1JV5A 1NL0L 2ZOKA 1JPTH 2EDXA 1J1XH 2GFBA 2J8UE 5MEQB 3CVIL 3VXPB 5I1AA 1I7UB 2LTQC 3D1MC 3CXHK 3EO1A 3MBEC 1CFQA 2DD8L 2X1XR 4NZTH 1F42A 2XG5A 2Y06H 3FJTA 4HKBB 3VG9B 1U95B 4GBXD 4JN2A 2YRZA 2AEWA 3VXQA 4JM4H 1OAZL 5CUSL 3UBXB 4M5ZH 3D0LB 3U1SL 1TJHL 5TDPB 4NQSA 1A4KB 3MBXL 3PGCB 4I2XA 4FG6C 2F5BH 4UMGA 5D2LA 5KVGH 1N6QH 2NY0D 3FT2B 3TH2T 3C5ZA 1EAPA 2FECI 1UKQA 2V7NB 2VR9A 4M5YL 3ES6B 3AREC 5HJ3B 3LN4B 3QEGL 2WIIA 4UUJA 1I8KB 1OB1B 1JFQH 1MFAH 3RX7A 5DUBA 2A74A 3WJLA 3ULUL 4EZMA 1FZKA 1B0GB 2BSRB 3PE9A 5C08E 3ZDYF 1UG9A 3N85H 3REVA 1BZ7B 3PXJA 1NJ9A 1IKFL 1QD0A 2VE6B 3BP5A 1V3JA 2VXQL 4M48H 4NNPH 4MSWA 3KYKL 3DIFA 1EJOH 4XC1L 4MZ2A 4JLRB 3QIUC 1U8JA 3R1GL 4WHTB 1KCVH 3BPCA 2MHAA 4JVWA 4JKMA 4P4RA 3PF2A 4BA8A 4M6ML 1S9KC 1XGUA 2EDWA 2P5WE 3F7RA 4C55A 1NC2D 1WVZA 1YPZB 4BKLA 4RGNC 3KYMB 1F13A 3VDBA 1A14H 5HGGS 3SJVE 4ZFOL 1QYGH 1WAAE 2NY3C 3V5HA 5DQ9A 4PJDF 3O9WC 3BGFC 1MVUA 3QDGA 1V7NH 4FFYL 4OCWH 4V1DE 5FM5O 4F37F 3MOQA 1JGVH 1YEHH 2R69H 3IFLL 5DTFA 1DQQA 2YD2A 2VC2H 4F8QA 1JZ4A 4P5MB 3FQNA 4XPHH 2B39A 1ND0B 4NN6C 5E6IA 3F12A 3HI6H 3PABA 1HSAB 5E5MA 3RZCB 4NOFA 1ZVYA 4YFLF 3WDJA 3PDOA 1U8OA 1MRCH 3ARBA 1EXUA 5CEXA 4UINL 3MRNB 1SJHA 4DOHE 4HUMB 3NOIA 2EICA 1KEML 2BCKB 2ZUTA 1U8LA 4CAGA 1VENA 2QSCL 4JZNA 1DBML 5HY9B 1GRWA 3EIFA 1N2RB 1IGFL 2XXCB 4OLWH 3S5LG 1P69B 3MRHA 3LIZL 3MBED 5EOCH 2APBA 1OT1A 4WCYH 2VAAB 2BHYA 2OJZL 5CBAA 4JFZH 1WCQA 3SDCB 4RMVA 4WIQA 3LEXB 3S3SA 2A9MH 1TQBB 3VXNB 5JMOC 3TBSA 4DVBB 3IDIA 4JZJA 1DUZB 4GMTH 1FNSL 2YOCA 3LOWA 1PX4A 3SDDB 1GC1L 1BAFL 4EN3B 2IFGA 5FYKE 5IK3A 2C3VB 2HJFB 2VDMH 2BNQD 4FG6D 3INUL 4JM2C 5I17B 1UFUA 2QHRH 3RIAF 1FHGA 1MFEH 1A2YA 1JWSA 3OL2A 3FOLA 4M7KL 3TNMB 4JFFD 1ZLSL 2J7LA 3ARED 1KBGH 4PRBA 1JK8A 3LHPL 1EO8L 3RKDC 5DA0B 3OKLB 2YXFA 5JA9A 2E6QA 4GXVH 4R8WL 5FA4B 3WD5L 5IIEB 2DYPA 4CN4A 2F8OA 4X5XA 3BDBA 4WW2A 5EUKB 4XBGB 2FIRT 3TZVB 1RZ7L 2HG5B 4HGKC 1BJ1H 3CU1A 4ZAKC 3RVUC 4YNYA 3K8MA 1D6EA 1KPVB 2D7TH 2YRLA 1TETH 3QZWB 4H1LG 5ITBH 4TUOA 4M8QB 4HWNA 3BQUA 2AXGB 2PXYC 1SHMA 4X4ME 3OXSB 4D2NA 5GRJL 1ZTXH 2BJML 2JTDA 3IDJA 4WWID 1AGBB 3V8OA 3HCVA 4X7CC 4U3CA 3OQ3B 4HPYH 4KKCC 4RGND 4ZPVB 3LKPA 1KJ2A 4EDXB 3SCMC 5FECB 3RA7L 4KUZH 3MLXH 2NZIA 1NGQH 3NCCB 1CE6B 1BFTA 4TOYH 5GGSA 4YDLB 2BNUB 2NY3D 1N3NA 1WC7A 3UX9B 2VXSH 3GK8H 3O9WD 3K81A 1UQSA 1UENA 5JXAH 2V2TB 5F8RC 3UC0H 5MP6H 2CRZA 5D7LD 2D31B 3BZFB 4LOUC 3D18A 2JJWA 3T1FB 1F11A 2YSSA 5FO9A 3DYMA 3OGOE 5ITFB 5FA3B 1G7IB 1IGMH 4PJBA 1T66C 4OZHA 1FZMA 5BRZB 4XT1C 4JCMA 2H9GA 2PW1A 1EGJA 2HWZH 1QSFA 3WL9B 1QUNA 5JOPD 2AQ1A 1GZPB 2UWEA 5EULV 1ZT4A 3MRPB 3ARZA 1D3CA 5BW7C 1L7TH 5F7DB 4G9FE 4XX1G 2APXA 1ZA6A 3L3GB 3S98A 4YHPB 2Z31C 5LKNA 4OUUB 1LK3H 4ZSOA 5IEKA 2EDOA 2F15A 1XF3B 4P2OC 3O45B 4JKKA 1RJYB 4C56E 2IJ0C 4Z7NE 1Q38A 1Y6MR 2X89A 5DQDH 3RUGE 2J6EA 4DKFH 3U7WH 5JW5A 2AXFB 4OJFL 3U46B 1UCBL 3VXTA 2FX9L 4N9OB 4QRPE 4X7SH 1QHPA 2X4TA 1NLBH 4RAHA 4L29B 3D69B 4MWFB 2FH6A 3MFGB 2ADGB 1BD2E 4JM2D 1QR1B 3DYOA 3QO0A 5EZLA 2VQ1B 3P0YH 3I6GB 3G9AB 4EDWH 1UB6B 4AH2A 1K85A 1KCUH 2HT2C 4PP1C 1HYSC 1F97A 3BO8A 3RKDD 1EVUA 4NKIL 5LAXA 1PLGL 4S1DD 3BHBB 3UBXI 3PNWB 5DURD 1A6ZA 3Q48A 3JWDL 4S11A 2M26A 4KDVA 1QHOA 5KSUA 4G8IA 2UV3A 1AR2A 1I85A 3T77A 3CGTA 5DJAB 4ZAKD 3RVUD 1ZHKA 3A6BH 1OHQA 2EDKA 1IZKA 1W0WA 3D48R 4TNVF 4G42B 1KB9J 3OMZA 5HYJB 2PXYD 1RZKL 2HP4A 1TVBB 3U4AA 2EYTB 1K9TA 3E6FA 4BSVB 2Y23A 4JR9L 1LDSA 3IJSA 5F7NC 2IALB 2WK2A 1U92B 1JN6A 1UH2A 5F89B 3TPUA 5EFIA 5I18L 4EUPA 3O4LB 3RWCB 2HFTA 2GAZA 1M71A 4KKCD 4WO4B 2YC1B 1VFMA 1X5FA 3U79A 5IFJB 5AAMA 3SCMD 2CUHA 3QJFB 2GITB 1VFAB 1DDHB 5FYLD 3VE0B 3FRUB 3H7BB 3QNXA 5B38A 4DQOH 1BBDL 3NFNA 4UAOC 3U9PL 1ZVSA 3S34L 1QKZH 2WBJA 4JFXA 1CGUA 3GMMA 1NAMH 4HUNB 3WHXA 1MFNA 3E8UH 5DFWH 2WQRA 5F7LB 1N59A 2AJZB 3SGEI 4XH2B 2FBOJ 1RY7B 3CFIC 5IVXE 4LOUD 4ODXA 3GBMH 3MMEB 1P84J 1GHFH 1JPGB 4HS6A 4XVSH 2C1PB 3D85D 4KROC 4E41E 4MCYB 4L8SB 4D0DB 4WVRA 4NUGH 3GHEL 5T3XE 3D39A 5MENE 3EYVA 3ZT6A 1T66D 4MVBD 2X70A 5H2BB 5JW4Q 3U7YH 1K4CB 4UV7H 5IB1A 3V0WH 4ONGH 5DJ0A 4ETQB 4LCCB 3MOBH 3DUUA 5BMFH 5F96L 3SPVB 3GMRB 3TA3C 2EYSB 1YEKL 4P23A 1MJ8H 2F58L 4QRSA 5F1NB 5ISZA 3ZKXB 4GKSB 2AXHA 3DX8B 1HH9A 3ECBB 3MV7A 4S2SB 2W38A 2EYRB 1X5GA 3GMLB 3PGFH 1D5XA 5TE7L 3A6CH 2XPGA 5F44A 2CIKB 4IHOB 4JQVC 4OIIH 3I02B 4HK3N 1QNZL 1YN6B 1BQUA 4XMLL 1QVOB 2AJYL 4J4PA 5AZ2H 3O6FD 3UZEA 5T3XH 3V4VL 3T3MF 4P2OD 2P8MA 4JO4L 5IHZB 1U91B 4UNUA 3KPOA 4PJ8C 5IKCA 5C0BA 1ITBB 1NCCL 5F1KC 2BNRD 4FQJL 3S36L 3O3BB 1OLLA 4LCUA 3VFWB 1Q9LB 4LBEA 1J8HD 4JREB 4HLZG 1MHEA 3GSQA 3S4SA 5LWYH 3U0PA 3LV3B 4NN5B 1U3YA 2H1PL 3G5ZB 4M8VA 1BBJB 5DC4B 5E0QA 2HT2D 2VLRD 4PP1D 5IBTL 5TFSH 1HYSD 5KZCD 1MCWW 4JFDE 3WLWC 2P8LA 3TPKA 3HUJA 5DVKA 2VLJA 2BXYA 3SY0B 1KCSL 1IAIH 1MSPA 1QRNA 4NC0B 4PTTA 2X4OA 4MAUH 4X7DC 3F5WA 4TQEL 1A6PA 4PJ5D 3IGAA 3T04D 5EWIH 1JNNL 1O7SA 1KPUA 4NWTL 1A64A 1INEH 3KS0J 4QCIA 1G7MA 1KTLB 1AKJB 2Z35B 4XCNB 2AABH 3CNKA 3T2NH 3EO9H 2YEZB 4GXUM 4JRXA 4RISL 1MCCA 2IQ9H 2IBBA 3OR7A 4R97B 5I8KH 3E3QC 4KRPB 3S96B 4FQQA 4MA7H 1S78C 3WN5B 5DVNA 3PWPD 1LILA 2HMIC 4ZNEA 3QP3A 1KIRB 2XRAH 2ZOLA 2OS7A 2WV3A 3HE7C 2VDPH 5CWSA 1NGPH 5MERB 1DUYB 2JLLA 1J0ZA 1QLEL 3KPLB 3GI9H 5DS8B 3B2VL 1CDIA 3ZHLA 4GQ9L 1HZHH 2HAZA 5TJWK 4KROD 5EBMB 1YPZF 3UDWA 4XRCA 4EUPG 4GBXB 4XMKL 4WTZA 1AQKH 1DL7L 1PDKA 3MLZL 3DUHA 3RY6A 1KOAA 1ZHBB 2AJXL 1LGVA 2EECA 5I2IB 4E42B 3LDBC 3QWOB 3WDHA 4U1LB 1ORQA 3RDTB 3UJTH 4K3DL 4F7TA 2BERA 2GQHA 2B7DT 3QI9C 3QFJE 4M43H 4P46C 4BFIA 3CFEB 3U36A 3IDXL 2IFFH 1T21A 4I8DA 1YEFL 5DDHB 5E8OB 5D8JH 1MJJA 4YPJA 1HN1A 1QBMH 3NA9H 4WI9A 5IT2H 2DI7A 3OKYA 1X7QA 4GMSH 2JK5A 3PHOA 5I73B 2RB8A 1VCAA 4BH8B 4NQED 1FDLH 1G7HA 2D7MA 4UU9A 4Y5VC 3T8XA 2VXUL 1P4BL 1MCQA 4ALAH 1X5AA 1T6VN 3TH3T 5IW6A 4PJ8D 1ERNA 3QQ4B 3HTLX 3NIFF 2A6KA 4J6RL 3VFTB 4PJGB 5AG9A 5CGMA 2IH3A 2XKUA 3E6HB 3TBWB 5DLMH 5LXGH 3WIFB 3UTSE 4X0KA 1A7OH 3HG1D 1UACH 3TT3H 1IZJA 3F6LA 3WFEL 5DRZA 1AGFB 1JL8A 4TSBL 4XCFL 5DMYA 2IPKA 4PJDE 1BFVH 1NC2B 1OLZA 1NBQA 2IMNA 1U95A 1W72L 3LN9A 1FG2A 2CK0H 1ZT1B 4GKNA 1XCTA 5E2VL 1ZA3A 1ZS8B 1T0MB 3G04B 1ADQL 5EZOH 3TYGL 3H7LA 3WLWD 1LD9B 1MCRA 3P4MB 4H25A 1YEIL 4YEFA 4G8EB 4L5FL 1V8HA 4JPVL 2OBGA 3AUVA 4GSDH 2XI9A 2EIDA 3FT2A 2EEAA 4LIQL 3ALXA 3ES6A 5ICXB 1T1WA 4OGYL 5HJ3A 4OB5H 3LN4A 1OB1A 2IBZY 2VXTL 1BGXH 3VMPA 3SKUD 4MYWB 1AXIB 4KK5C 2X44D 1LE9A 3HI5H 1KXVC 1JTPA 2BSRA 3AS0A 1ODAA 2YWYA 1XGRB 5I1IH 4QRQB 4WHYH 3F62A 5FEBA 2VE6A 4H8WL 1PAMA 2Y36L 3HNVL 4K8RH 1HINL 1DEEB 2CKBB 1DVFB 3IDGB 2KZWA 1QG3A 1LE5B 1YMMD 3KLSA 2H26B 3RP1A 3HE7D 1FQ9C 4YDKH 4DZBB 3P77B 1K8IA 1YYLH 3LKSB 1X5JA 3VFVB 1PG7H 4GRWH 3WFCL 4MX7A 3SE4A 3V4PH 3QDMA 1E27A 2LTQB 3QUXC 3MBEB 5GSVB 2LU3A 3NCBB 1CVRA 1N7ML 4KDTC 3W9EA 3THMH 4NHUA 4KTEL 4XXCA 5EPMA 4UOW1 1X6NA 4TPRH 4IBLT 4WFHE 2V7HA 2GT9B 4I13B 4NZRL 1TQCC 3RI5K 1XR9B 1I9RH 3QI9D 3NPZB 2BNQB 1IBGL 2R39A 3G6JB 3RWDA 3VFRB 2XA8H 4PJAB 2J6EH 3F8UB 3GO1H 1P7KA 1ZT7B 2X10A 4NIKB 4JFFB 1N5AB 3AREB 1R3IL 1IQDB 1HSAA 4RMUA 3RY5A 3W11C 1UWGH 5KVDH 5E1AB 4P5TC 4OD3H 4PY8I 2GTWB 4WTZG 2Y7QB 1F2QA 4FQCL 3O6KH 5BZDA 4GRLA 4WJ5B 3V0AC 1JP5A 5FV2A 3OX8A 2MWCA 4LEXL 3VCLB 2GJ6E 1FFNB 5EB9A 3OKDB 4UIMB 5ANME 1URLA 2CLVB 3WXWH 2H2PC 4OZGB 1J0YA 3DRTB 3MODH 1OTSC 3QIUB 4E0RA 1Z3GH 2X1QA 3F7VA 1HWGB 2RFXA 3WHE1 3RVWC 3D25B 2NQCA 3TT1H 3TV3L 3VW3H 1YZZA 3CMOH 1EDQA 3CXDL 1PY4A 5KVEL 1DSFL 3QEUB 3RWIA 3DX7A 3SDCA 3DRQA 1NFDA 5CJOL 4RGNB 4M03A 4X7TA 5EBWB 3VXNA 4XPGH 4DCQA 2OM5A 1ZV5A 4AY0A 5BXFA 2W0KA 5KOMC 1ZEAH 3MNZB 2MQ3A 4L8BA 2NY3B 2ARJA 3CIQA 3O9WB 5I17A 3ZYJA 5T1KA 2ERJC 3SDXF 3GSWB 1OAYH 4W68A 5D7LB 3WKNA 5IWLC 4ZS7L 2CGRL 1T3FB 3P2TA 1D9KA 1YUHA 3C2AL 4NN6B 4HPOL 4HWEH 4KK5D 3W9DB 4KH2A 5TPWL 3NBNA 5BS0A 4GG6A 5EORH 4ZMAT 3ZLQC 3BFOA 4ESKA 4HV8B 2D2OA 3HMWL 1SVZA 4X9IA 1MPAL 1VGEH 1KEGH 5CP3A 4CMHC 3EYUH 3MLUH 2BVPA 1KACB 1TZHA 4L1HA 4M8QA 1WSST 2BHUA 5I19L 3KGRA 4WU5A 5IB3B 5EZIH 4Q6IA 5CS7A 2YPVH 3QHZH 1BFSA 2X4PA 4BH7B 3QUXD 2X41A 4O2EB 1BPVA 4OZIB 2V2WB 2XN9D 4KU1A 1Q1JL 4RNRB 4ODUB 4K9EL 4U6HA 5FECA 1Q9KA 2W60A 3MV8E 4WFFE 1DE4A 4XAWL 5BVJB 4FXKB 2X2YA 1FSKC 4JFYA 1JGEB 35C8L 2P7TB 3V6OA 3OR6B 4NKOB 2Q6WA 5IBLC 4CDHA 3A6OA 3QEQE 4JM2B 3HB3D 4U33A 3BZFA 4ZTPL 4XPTH 2DM7A 4NWUL 4OGAC 1RU9H 1UA6L 5J8OA 5TE4L 2CQVA 4M7LT 3W11D 3PDDA 2DMBA 2BSED 3DX9B 4P5TD 4YXLH 4G7YH 1PEZA 3U6RB 1F3RB 3QIBC 3U30C 2A6IB 5DURB 1OAXH 3IU4H 3W0WD 3STLB 3MJ7A 4HUVA 3D9AH 4XP9L 1G1CA 4C4KO 4Z9KB 2DKSA 4ZAKB 1I9JH 1UXSB 4MQ7B 1LWRA 4Z7VB 5FUZH 3OGCB 2VZTA 4BK4A 3BGMB 2IF7A 3H6JA 4HDIB 2H2PD 4GJTB 5L2KB 2WBWB 4PJIA 1OTSD 3TBVB 1JPST 1E28B 2PXYB 4HXAH 3FCTA 5HHQA 3O11B 3JWOH 4PGZA 2N7AA 4Y4HD 2W91A 4LPXA 1G6RH 1IEBB 4KY1L 4H26B 2F53D 3MROB 2AEPH 4ZDHB 4MJIA 2AXFA 1BQLL 1MY7A 4N9GA 3U46A 3SCMB 2R1XB 4BUGA 1BFOB 4PLOB 1CE1H 3UTTD 2Q7NA 5INCA 4ZUTB 5IVZB 3QISA 5F71A 5B4MC 5HGAA 1OWWA 5C0CE 2XQBL 3VGDA 4YXHL 4PY8J 4XC3L 3T4AB 1AXTH 1P84K 4WUKH 1H0DB 3NZHH 2IBZX 3C6LA 2AKRA 2DDQL 1QRKA 3MXWL 4XVTL 1NEUA 5F9AC 5T1DH 4P5KA 1RUAH 4U4BA 5I16A 2EIZB 3T0AA 5IFAL 4CL7A 3FQXB 4NC1E 5FM5M 4TN9A 5C0EA 3IDNB 1MJ7L 1X6LA 2BSTB 2R0LH 1U8NA 2BP3A 2BC4B 4YHNB 2QHLA 2YN5A 2GSIA 4IIQC 4NRZB 1F8TH 3UAJC 5DUPH 3D0VA 12E8H 5HYJA 1MCIA 1TVBA 2Z31B 3RTQA 1N0XH 4YHMH 4W4NA 4F7CB 2EZ0C 4P4KD 4YZFE 4QRPA 2IALA 3RVVC 1U92A 4PGDA 4LLVB 2KH2B 4P2OB 3HPJB 3FTGA 5DJZA 5GRWA 3BPNC 5HYSG 5IFJA 1KV3A 2W92A 3ZL4H 1WBZB 5AD0A 3QJFA 1DDHA 3VFPA 3MNVA 2ZJSL 5KSBE 4W81A 2D9CA 1U3HA 2OZ4L 1NCTA 4XP1L 2BNRB 4JZOA 5GRVK 4MD0B 4NHCH 3KS0H 3VFNB 4FABH 3BKJL 1J8HB 4TVPH 2DMCA 4KQ3H 5DC9B 1FL6A 2AJZA 3GKWL 3BWAB 4PYHA 2X9WA 1DZBA 3ARDC 3VWJC 1JPGA 4PB9L 5SWQB 4XPFL 5C9JA 2C1PA 5L88L 1DN0A 3CZJA 5K9JL 4HJGB 4MCYA 4L8SA 2ZCHH 4OGAD 4YHLL 5CD5C 3BISA 2VLRB 5KZCB 1F3JB 4NBZB 5H2BA 4RDQF 3MLYL 5C0AD 1MAKA 2OXGA 1IGIH 1I1CA 3QIBD 4LCCA 3VGAC 1VACA 1W8NA 4O9HL 3SPVA 5C0JA 5B39B 3FHQA 1SMAA 5F1NA 3DX8A 3MO1B 4S2SA 3CDYA 2CRMA 3RWFA 3BUYB 4PG2A 6CGTA 1NEZG 2JELL 2CUIA 4I3SH 2DQHL 2ZSVA 1FGNL 2D3VA 4I3RH 4OSUL 1F58H 4PJ5B 3I02A 4JJ5B 1QA9A 4Y4FC 3X3GH 5DK3A 3VH8B 4HS3B 4EJ1C 2F54D 4PV8A 4NZUL 1A3QA 5IHZA 3S6CA 4OBSA 1NBZA 3IJYB 1WT5A 1QLRA 1I3GH 5JUEH 1HDMB 5GQBA 1N5YH 3VXRD 3PWPB 4PB0L 2HKFL 1KFAL 1H8NA 4GG8B 5LQBH 4PJGF 1YPZE 1MUJA 1Q9LA 4UAOB 3CX5K 1JHKL 3F65A 2QADC 5B4MD 5KSAC 3AU1B 5CD3B 3ULVH 5I0DA 3LV3A 5A2JH 1DBKH 3RHWK 2FX8H 3MCKB 2HKHL 4HHAB 4DN4L 5BJTB 4OBRA 1BBJA 3ISWA 4HFUL 2MPAL 3V5KA 2X7LB 3DECA 4WU7B 3CSYA 4JHAL 4LP5A 4DUXA 4L4VD 4JY6A 4JO2L 4KROB 1JHTB 4A6YB 3ILPB 5HSFA 4LAQH 2B4CH 5E2TH 1CL7I 1IAKA 4TVSa 3IKKA 5E4EC 5GGSY 4LPUA 5F9WC 4NYLB 3SGEH 1KLFA 3RQ3A 3SY0A 5DYOB 1S9YA 3M8OH 4OLZL 2GJJA 3AMLA 1AY1H 1QSEB 2NY5H 1AO7A 5J3HC 3TA3B 3OG6B 5FUCE 3SDYH 4KRLB 3SGJC 2G60H 4P9ML 1A9EB 4OCRH 1P6FA 1HHJB 3UAJD 4LCYA 5IW3A 1KTLA 3NIFE 5BO1L 4U1NA 2Z35A 5KJRL 4FNLL 4JFED 1UWEH 1MCPH 4QO1A 4OFYD 3VFSB 1GGCH 2EZ0D 4NQEB 5J1TC 3RVVD 3O41B 1RURH 3BKML 2XZQL 4X8XA 4O2FB 4WHCA 2NY2C 2NY1D 3WN5A 3BW9B 4PJ8B 5I8OH 4HIHB 4I1NB 3LKQA 2B8OT 5A40E 2EDEA 3STZB 5TF1L 4JG0H 2DLEA 1C16B 3MRBB 5MERA 2XFXB 1LMKA 1ZVHA 4MHHG 4ODVL 3HG1B 1IC5H 3QUKB 4KJPC 2N7BA 4ZOEA 1S7SA 2GJZA 3NACL 4XBPB 3VWJD 2W9DL 4M6AA 1B4RA 1WV7T 2BMKB 3REWB 1OGAD 5CBEA 1FYTA 5CD5D 1UYWH 3OKKB 3WUWB 5F7WC 1CLYH 4JRYA 4R26L 2DQCL 1IMHC 4OUOA 1RAMA 2H3NA 3L3IB 2UVEA 4LHUG 3RDTA 5IF0B 1OAKL 2DI9A 3HS0B 5B22A 3CFEA 3BP7A 3L3OB 2XQYG 5CGYC 4EBQH 1CIUA 2BVQB 1FH5L 5DDHA 1HILB 5T1MB 3G6JF 3DMMA 1F4AA 1CFVL 5BZWB 1UM4H 1FLRL 4GQPH 2X4UA 2PW2B 4UT7L 1T6WA 5CMAB 3IFNL 1NDGB 2ATKB 2ZCKL 4PLKD 4O4YL 1AHWA 1KLUB 1Z6JT 2A73A 2FYYB 5LCVH 2VWEC 3FFCB 4Y4FD 2BDNL 4U2YA 3WO4C 4OCYH 1EO5A 1N6VA 3MV9A 3EDEA 3DVGA 5DVOA 1V3MA 2LAGB 1CDHA 3JUZA 1A21A 3SE8H 2ORBL 3ZTNH 1CT8A 3V6ZB 4N68A 2DTSA 1NBYA 5J89A 1F02I 3O2WH 2BFVL 3TBWA 2RQ8A 2KZ1B 1F6AA 2CH8A 5C0IB 1YMMB 2IEPA 2FJFA 2VZUA 1UJTA 3HE7B 4YE4L 1UVQB 4QOKA 2PTVA 3QJHB 2QADD 4KDWA 2XWJB 4OZGF 1AGFA 2NW2B 5CLTA 3JTTA 5KSAD 3OXRB 2J4WH 3M45A 3QUZA 5DJYB 2D7OA 3IAQA 1TZGH 3GSRA 3UJJH 2X1OA 3QCVL 5D1XC 1T0MA 3G04A 1EFQA 3QWRD 4UV4H 4Z0XB 4PRNA 3PGDA 4U6XA 3U4BL 3LEYL 4KZDH 3BZEB 3PQYA 4RAVB 4G8GD 2C3GA 4IRJA 4G8EA 3ZTJG 4DN3H 1JGLL 3VFUB 4KPHH 3LDBB 3M07A 3TIDA 1U8MB 1JBJA 4LMQE 3QI9B 5ENWB 4P46B 4S1RH 5J3HD 5IW1B 5BV7L 5JQ6H 1A6UH 5ICXA 5IBUB 5I1CL 2IAMB 3B3IB 5BRZE 3P30H 4X80H 5HYFA 3W2DH 1CXIA 2G75B 5HYQA 4NFCA 2YD8A 1ACYH 5INDB 3W82A 3KPMA 1XGRA 5IB5A 4HJJL 4Y5VB 2HRPL 2IMMA 4LKXB 4HC1A 2NY2D 2NY7L 1YN7B 5CJXA 2P1YA 1X9QA 2WAHA 5CKAA 1DVFA 3RWJA 1LE5A 4L3AA 1LNUA 1VHPA 2SEBB 3S35L 3VI3F 1G9NC 1UEMA 4R4NC 3P77A 3L3HB 3LKSA 4TSCH 5CJBA 3UMTA 4KJPD 2E9JA 4PV9A 4UTBH 3G5VB 3BAEH 3DLQR 4FFZH 1G7QB 4APQA 3GRWL 3P0VL 3SDXE 4OZIF 5K9OA 4NRXA 3B9KA 3CDCA 3TO4A 4HULB 4X4XB 5C1MB 4J3VA 4A2MA 4B7LA 1T7WA 2GT9A 4JE4B 4PD4K 5C07A 2EDHA 2FGWH 3CLFH 1GGBL 5AUMA 2X05A 5C2BL 4N0YL 3MA9L 1FFPA 1BVLA 5L9DH 2HJLA 2JJVA 6FABL 2G5BA 4P59H 3OAYH 5CGYD 4PJAA 2FWOB 5B8CA 4U7KA 4JM2F 1N5AA 5DMIH 4WWKA 2YZ1A 1IQDA 1AGEB 1YNKH 4OFPA 1OCWH 1QFWL 2PTTA 2YPLD 3QUMB 5TDOB 4UB0L 1L6ZA 2MMXA 5E1AA 5F72S 2UZXB 2AJUH 5FYJU 5DRNA 4S0SD 5JHDD 1MWAB 3QWQB 2FEDC 1EZVX 4PRAB 1XIWC 3GMPA 5DHYA 2QQLL 4AK1A 5HGBA 2CDFB 3VCLA 1WTLA 5E8PB 4PP2B 4K7PH 1VESA 2P5EB 1X5ZA 5JHLL 2V5MA 3O4LE 3QIUA 5CEZH 4Z7VF 4QTIH 4RWYH 1X4XA 5BVPL 1JRHI 3D25A 1CXEA 3OAYK 1E6JL 5T5NF 2OL3L 1EHLH 4DGVL 3QEUA 3QUXB 1KB5B 4Z95L 2XN9B 3K1KC 4XNXH 1NMCC 5D1XD 2AV7B 1KJMB 1B4JL 3CFBA 1YMHA 3FOMA 3DGCR 3HR5B 3MRCB 5D1QA 1H15B 5EOTB 3K2MC 3AY4A 1G7LA 3MNZA 3EJZC 2XZZA 1CICA 3GJFA 2CUMA 2QR0B 4PJXB 3C5ZC 1TQCB 4PPTA 1M7IB 2IPTL 3QPXH 1R3JA 2PR4H 2VABB 1ZHLA 3PJSA 2N56A 4R96B 1ORSA 1QOKA 5E2UH 1YNTA 3WJLC 1T3FA 5D72H 3ARWA 1RQ5A 1WITA 1I7TA 1C08A 4NM4L 2IADA 3T0VA 3EOBB 1A6AB 1T4KB 3L3KA 5DZOA 1IFHL 4LNVA 2XY2A 4P5TB 4YHYC 2QKIB 4HV8A 3NFPA 4YHOL 1FZJB 4NQVA 4XCCH 4KI5C 3SEPA 1DANU 2IPUG 3W0WB 5M95B 1E6OL 4Y16C 4IM8A 1YDPB 5DD1H 2K7PA 3FB5B 4WEUD 2D4DA 5HVWA 1S7QB 3MLVH 1WZ1H 2P47B 5GGQL 4Q2ZA 5IB3A 1SBSH 1J1OL 4GRMA 4NQCD 3OPZH 5HHXH 4ZOBA 5DO2C 3CFKB 1YEGL 3RAJH 2E7LA 4OZIA 3UYRH 5TGBA 4RGOL 1TZIB 2NY4C 5I8EB 3ROLB 4BM7A 2XG4A 2YK1L 2F53B 2XQYK 3TN0A 5C09A 5I1LB 4LSTH 4WFEE 5T3ZL 1JGEA 4GLRI 4WV1C 3HPLB 3MJ8B 3GI8L 1QSVA 3VMNA 5J1SC 1KELL 2VXVL 5HDOA 5JPNA 2XZAL 4NM8H 1SVCP 3D2UD 2ERJB 5E6IC 5EN2B 4XXDA 4UT6L 3O3DB 1MHHB 4OCLC 4JDTL 5DFVC 3ARBC 3U48A 3WFDL 3DX9A 3NFSL 3BRGC 3U6RA 3MQIA 3C6SB 3QRGH 4U1MB 3QQNA 3MGOB 4ODWA 1HNFA 5C6TL 5I8CA 3STLA 2FEDD 1HKLH 1J11A 3UJIH 4ZTOL 1XIWD 1R0AL 2NXZC 4Z0BH 3CPLA 2CRYA 4POZC 5LVEA 3CK0H 2DBJA 3MRDB 3LS5L 5FGBC 4JFOB 4CMHB 4X99B 3I6LE 5FHAH 3C09C 3Q6FB 5L2KA 4HDIA 1QFUL 5JIPA 2DQDL 2EDRA 5FOJA 3TBVA 4PRPA 4XZUA 3EOTH 1BZ9A 1E28A 3HZVB 3UYPA 3IRZA 1VEOA 5E9DE 1I7RA 3KDMB 2VLLB 3MLSH 1JI1A 3GSNL 1OARL 1SJEB 4MZ3A 3MROA 1H8SA 4JZJC 4ZDHA 5HHVH 5DMJB 2XV6B 2R1XA 1Y0LB 5K9KA 4X6DB 1Z0MA 3EJZD 2CJUL 4MDJB 4J3OC 4F2MA 5IVZA 4ZUTA 3T4YB 1FSKB 4A6YL 1RUKL 3C5ZD 5GRYA 5F7YC 5H37H 5JQHC 4OV5B 3DURB 3S37H 3CDGA 4X6EA 4RMRA 4ZPTB 1AC6A 2ICES 3O2DA 1KJ3L 1CF8H 3T4AA 1H0DA 2WLYA 2AJSL 1H9VA 1HKFA 4CJ0A 3QB7C 1R24A 4JJHA 5F8QC 1UADC 3DV4B 3C5JA 4LCIL 1KN4L 2Y5TA 4KRNA 4WW2C 4LSQL 2EO9A 3SKJL 2GHWB 1A0QL 1TFHA 1DLFL 2EIZA 2V2XA 4QXTB 1IT9H 5C0AB 2YD4A 3QIBB 3U30B 1KC5H 3FQTA 4NJ9L 2ICEA 4KI5D 2BSTA 2EDJA 1CGYA 1JHLL 1M05B 4XP5H 4Z7WA 2X5PA 2BC4A 5F3BA 3TWCH 3BQUC 1RMFL 1P4LB 5BW7A 2FR4A 3V4UL 4HWUA 1XFPA 4ZFGL 3EFFB 4TUJB 4KZEH 4U6YA 1J1PH 1W0VA 3WIHA 2Z31A 1K5NA 5EO9B 1YJDH 3H2WA 4GW5A 3I2CL 4PJGE 4XB8A 1YEJL 2F54B 4FFVC 1U93B 1OT2A 3KXFA 4LPWA 7FABH 1U8QB 1SMOA 3SGDI 2VOTA 2VDOH 5GS0L 4F7MA 3VXRB 5J9PB 4QHUA 3QDGD 4WEMB 4NQXA 3AAZA 3VA2C 3AXLA 1KTDA 4YBLC 4QGTA 1UM5L 4GAYA 5CJQH 3X12B 5FB8B 2HVJA 1R3KA 1P2CB 2R1YA 1NGZB 4JO1H 5MEOA 5GIRB 1BQSA 3BSZL 5GISH 5E6ID 1IGCL 2VLRA 2FL5B 4L4VB 3NPSC 5DFVD 1I1FB 1TLKA 3ARBD 4LQ1A 3DUSA 1ES0A 2OQJB 4OZFA 1JCKA 4MS8C 2Q76A 3VFMB 2VDNH 1A7PH 1HHHB 4YXKH 5IMLA 1YNLH 2DQTL 5M7QA 2NXZD 3KVQA 2GTZA 2WP3O 3VDCA 1RZIB 2YBRA 4OQ1A 4P2QA 4PY7A 4POZD 2BY1A 4LLDB 4FQXA 4PJ5A 2NNAA 4AMKH 1A5FL 1K3ZA 4IDJL 4JJ5A 4IIQB 1T7YA 1PG7W 3V2AR 3MACH 4JFEB 3VH8A 4HS3A 2MKLC 3PWNA 2OK0L 3LY6A 4MJ4A 2CDEB 3IF1A 5KSVB 4AQ1B 5FKAB 1I9EA 2IBGA 2YUVA 4Y4KA 2AEQH 1HDMA 5GGTL 4OLXH 4ZFFA 2YHGA 4HEPG 3G6AA 3BPNB 4IOFC 5DT1L 1MLCB 1JNLL 1KF9B 1CU4H 5ID0B 1MIML 2GEEA 3P11L 4K55A 1FFRA 1HWHB 3WS3A 1KG0A 1GAFL 1FGVH 5L0QC 5CD3A 4L8DB 4HC1H 4RRPA 4ZNCD 4QXWA 4GS7C 4HK0B 2DTMH 3MCKA 1OM3L 5FO8B 5BJTA 4KMTL 3H0TA 4CNIB 4M6MH 4DAGL 4WU7A 4ZYKA 3ARDB 3VWJB 1JTTA 1MJUL 5DJ8A 1F6FB 2DYPD 1A3RH 3BOVA 4ELKB 3ILPA 1OGAB 4U6VL 2BNQE 1CQYA 3G6JE 2APVA 3MRQB 5GSRB 3UTZA 5GZNC 4HIEB 1I85C 5I1JL 2Y07L 3RL2B 3MLPA 2I9TA 3BDYL 4JFFE 3FQWB 4KJYA 3IXAA 3ZE0F 1QSEA 3VGAB 4Z8FL 4Q9CA 3TA3A 1PKQB 1XGTB 4Z7UB 3BQUD 1A9EA 4ZQKB 3BEVB 2XICA 1GPOH 1P1ZA 2Q86A 3VFSA 4OLVH 1QLFA 3P4OB 1T89A 4Y4FB 3BH8B 4FFVD 3HC0B 4ZUWA 1AXSB 4OZGE 4X98A 8CGTA 5TDNA 1XF2B 3VXMA 3SQOH 3CC5B 3EFDL 3QBTB 2WBJC 4Q7DA 1XF4A 2AJ3A 4JG1H 2ENSA 4PJCA 3I6KA 1C16A 1F4YL 2XFXA 2VISA 2BOBB 3QUKA 4S1SH 1A6TB 5J1AB 4RGNE 3IJHA 3ZO0A 2E7BA 2QADB 5KSAB 1S7WA 1G84A 3LSOA 4PFEA 2BMKA 3S36X 1DFBH 1FVDA 1JI2A 1KTKE 3Q1SL 3B9VA 4DFIA 3OAUH 3JXAA 3T0EA 1QSFD 5DA4A 3B43A 4G8GB 5D7LE 1CDCA 1YQVL 2CLRA 4EVNB 5IF0A 1S7XB 4MS8D 5E4EB 5F9WB 2P42B 5D5MB 1V7MH 5A43C 3DTXB 2GKIA 1JIBA 2O5XL 1GC1H 2G5RA 2AGJL 1MLBB 1HXYB 5IQ7L 2WINB 1CL7H 1MWAL 5HHOA 4MA1C 1NDGA 1YC8A 4J4PC 2QQKL 1IM3B 1P53A 3GJFH 4X6BB 3O6ML 2VLME 3GSXA 5TQ2H 3FFCA 4K7PY 3MXVL 5JOPE 1RZJL 1ZK9A 2RHEA 1S7RB 1T83C 3BPLC 1EBAA 2AV1B 3VI3E 3LB6C 1A1NB 4XVJH 3TCXA 2X89D 5KTEH 1R5IA 4R8WH 1V05A 1WBXB 4PGEB 4CVXB 3LMJL 4WI5A 4CU8A 1WZMA 4I0PA 1OF2A 4HAGA 4OZFG 1VKXB 1J88A 4M7JH 3V6ZA 5KW9H 2C7UA 4DZ8A 2NY2B 5JW4N 4IOFD 5C0FA 1RZ7H 1U8KB 9CGTA 4LFHD 4ODSL 3P4NA 1JE6A 2EEBA 2ILLA 1CFSB 1JNHA 5C0IA 1P5VA 5IR1B 4O51B 5CZVH 2B5IC 5DQJB 1KB5L 3VXSB 3CH1B 2UVFA 3KPNA 2DIJA 4LQFH 1W72A 3L5WA 3T65A 5IMMB 1TMCB 5AZEH 4JB9L 4DGYL 1PZUB 2MOVA 2VR4A 2Z92A 1ADQA 1FIGH 1G0DA 1JPFB 1MCOL 1AR1D 5TQ0H 4FP8L 4ZUVA 5DJYA 3QXAA 2Z9TA 2B20A 3GJFK 3MRJA 1B0RA 3WSQH 3BZEA 3ROOB 1MRDL 5I66B 2YR3A 5GZND 1AE6L 3T3PF 3JWOC 3BIKB 4JHWL 4I0KA 1IE5A 1DQML 2YUXA 4PJXF 4P46A 5E99L 4B41A 1G1YA 5EC1A 2ICWI 3QULB 2IAMA 3B3IA 5GHWH 4NPYA 3H9SA 1A02N 3EYOA 4RRPG 1Z9OA 2OP4L 2UZIL 2WZPD 4MDIB 1CD8A 1GGIH 1RVFH 3Q6GH 3FO1A 4NGHL 2BSSA 1Y18B 1BHGA 5HDLA 4M1DH 4Z7VE 1M7XA 3T0BA 3WO4B 5JHDB 5E70A 4ELMB 1CLZL 5HI3C 1JJUA 2X1WL 5D7SH 4LVHC 4LLMB 2QQNH 2WBJD 4S1QL 2EDDA 3FQRA 3MFFB 3L3HA 4XHJC 2VLKD 3LKOB 4KVCH 3HZYA 2OR7A 3TC9A 5EU3A 3AM8C 5HTSA 1EV2E 3C8DA 3WFHB 4N0RA 2DQIL 3G5VA 3UDWC 1PQZB 4YDIL 5C0DB 3KPSA 3WFBL 2JCCB 1KCRL 2HVKA 3MLTA 3D39D 4MNQA 1VGKB 1ZSDA 2FHFA 3HNTH 5IMKB 3NCYS 4Q9QL 3KPPB 5D7IA 3RY6C 3B8YA 4HS8H 2APTA 4RMSA 1U8HA 5EUOA 4OAWB 5HI5C 3FT4B 5FDWB 3X14A 4O2CA 1OQOA 5DMKB 4P23D 1CTOA 5ISZD 1MH5B 4RA0C 3MV7D 5ESVA 3WV0A 3ZSTA 1NGWA 4K3EL 3P9WB 2H45A 4X4ZA 4NNXB 4XVUC 1B6UA 1WCBA 4IOIA 2Z4QB 4HIJB 4KMLB 4R7NB 3O0RL 1NAKL 4HWBA 3PWJA 3L1OH 3ZYOA 1AGEA 4J4PD 5FYLH 5D1ZA 2FX7H 3CFCL 5DGQA 3TCLA 1B2WL 2E7HA 5BCAA 3HC3L 1L4IA 4U7SA 3BKCH 5F3HB 5MEPA 1EEZA 2VB5A 3H42L 5C0BD 4M02A 4PRAA 4L4TA 1OSPL 3O2DH 3VGBA 1KN2L 4G43B 1WFOA 5D9SB 1HHIB 5F88B 1LEGB 3JV6B 3JWDH 2LQRA 1U8IB 2P5EA 5L2JB 1OD7A 2ADJB 4UDTA 4IMKC 4N0CC 1T7VA 5DWUH 3OJDB 1OP5H 3BRFA 5F21B 1N4XL 3KLHC 3IVKB 4J1UB 1X5YA 4LASL 4U1SA 3VFOB 3PV6A 1BVKA 3UPAA 2BNRE 1BEYL 5ESAB 5FF6B 1KJMA 2XZCL 3JV4B 3HR5A 1H15A 1J8HE 3WIHH 2VLJD 3L95B 5TE6H 1DR9A 1QRND 4G6ML 4Y8AA 4MMXC 4X6DF 1RUQL 1FO0L 3GSOB 3VRJB 4K3JH 4LPYA 5DD0L 1QPPA 2OR9H 4LCWA 3MUGB 1BBDH 1EVTC 1DP0A 3QDJE 4NJAH 1MFDL 3D2UB 4B53A 2EO1A 2E9IA 3GBNH 3S5LB 3BVNA 1P6AB 1OP5K 4JQIH 4JRXD 5JNYA 4YWGL 3EKCA 3GJEB 4LSRL 3WS6A 1T20B 1J18A 5CILL 2M2DA 5C70A 4AENA