1UYWL

Crystal structure of the antiflavivirus fab4g2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Crystal Structure of the Antiflavivirus Fab4G2
rcsb
molecule tags Immune system
total genus 52
structure length 212
sequence length 212
chains with identical sequence N
ec nomenclature
pdb deposition date 2004-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywL01
2EDXA 2V17L 3L6FB 3QQ4B 4MB5A 1E6OH 4R97B 5EU3B 5KAQG 2UYLA 2K1MA 2LAGB 1GZPB 1IL1A 2HJFA 3GIVB 1CL7L 2ZNXA 3DX8A 4HUWB 4WUKL 4I2XE 5DZNA 3TV3H 2ARJQ 4OI7A 1N6QL 3B2UC 5J3HD 1ONQB 3OAZH 5A40E 1M1SA 2P8MA 3QH3B 3V6ZB 4NRZA 3GMRA 1RZ8A 4FABH 4ZXBB 1Z2KA 4IOIB 2FHCA 1MWAA 4F8TA 2VDKL 4NN7C 2DOCA 1VFBB 1UH2A 5ILTL 1EFXD 4PJ9B 2IMNA 3C60A 4S2SA 1A8JH 5ICZB 1HNGA 1YMMB 4QXGL 1ADQL 1C5CL 1IGCH 5JHLH 1AE6L 3EOAB 1DR9A 5E8PA 4JM2D 4TULH 2GTWB 3VXUA 4OZFB 5EORL 3WXWL 1BPVA 1KCSL 4XXDA 1O7VA 1FHGA 3OZ9L 3RU8L 2YKLH 4OI8A 1S9XB 3AC0A 2ARWA 2VOTA 3RI5K 2FL5B 2WBKA 5TE4L 5I76B 1F3JA 3LN5A 3FL7A 3MRBB 1U9KA 4URTB 1PKQB 1WITA 2R2BA 5D7IA 1CXLA 5LKNA 3E6HA 2OK0H 1DN0B 3JWDC 1INEL 5IVXE 5TDOB 3BRDA 3EBAA 2WBWB 1T5WB 5BZWB 4K3EL 2VLKA 3GSVB 1UGNA 3BO8B 1HK6A 3FCTB 3KPRA 1OTUD 1N59B 4OF0A 4EIZC 3TFKD 2MJWA 4L9LB 2FCBA 1LO2H 3GMLA 2M26A 3QXUA 3TBWA 2GAZB 4JQIL 3TPUA 1DDHB 3IKKA 1Z9MA 4I0CC 3ULVC 4EDWL 4TSBH 3QPQD 2FLBT 4JM2F 4B53A 1Y6MR 5IGXL 5D7LB 3SGEH 4HWNA 4MNGB 1ED3B 1NKRA 2Y5EA 2RHEA 3LQAC 3MRFB 3RL1B 3HC3L 3NIFF 3HUJB 5C0RH 3H0TB 4GG8A 1A1OB 4XAKD 3B9EA 3BPCB 5DJAB 2W07A 2Z4QA 4TSCH 1N3NB 4NZRL 3VFVA 1W0VA 2P8PA 4X80H 4PS4L 2BFVL 1F90H 5KVEH 5HHQA 5AZ2L 2IJ0C 4XB7A 1ZA3A 1CT8A 4KAQL 2DD8H 3V4UH 5SV4A 3VFRA 4D9RD 1WEJH 1MHHA 4LRNH 3IAQA 4NZUH 2HFEB 3LQMA 1YPZF 2DQFB 2FX9H 4JLRB 4M43H 1ZV5A 2OXHA 1R5WB 3HTLX 2R0KH 4OT1H 2NY0B 1OP9A 5J11C 4NRXA 5EZIL 3GDBA 3HMXH 3BW9B 1J8HA 5AWNH 3U46B 5KOMC 2F5BL 1AGDA 2PETA 1G6RL 3KPLA 3WIHA 5DK3A 1WBZB 4MQSB 4OLUH 1GGCH 3OG4B 1U8LB 1LO0H 3T77A 1D5MA 4NQEB 1T1XB 4QTHB 1J0ZA 2QSCH 1BWMA 2GSIB 1AO7A 1E28A 4XNQB 1AXSB 5EOQH 4EVNA 4WW2F 4OF7A 4CN4A 1UXWA 1F3DH 3SBWC 3QDHA 4QRTB 5HI5C 3T2OA 5DEFB 4WO4B 1GGBL 2B20A 2J5LB 2WBJC 1FGVL 1KG0B 4LSPL 1CFBA 4U1KB 1I3RA 4XAKE 4KK6D 4Z8FL 3BKCL 5E8NA 1UEYA 5E1HB 1BBJA 1NGWB 5C70A 2ICCA 4QXTA 1U91B 1HH9B 1XGQB 1WBXB 2XKUA 1RY7B 4RAVA 3RGVA 1SBSH 4XNZB 3WYRA 2HJLB 2OSLA 2R1WB 2AJXL 1XAUA 4KQ3L 4P2RA 2D7QA 5C92A 2VLKD 2QBWA 3S8WA 4R96B 2VZSA 4D9RE 4JAMB 4X99A 4PGBA 3F7VB 1FRGH 5GS1C 3WHXB 2PYEA 4S1RL 4POZC 2ARJB 3HR5B 1LK2B 1ZMYA 3IVKA 1HNFA 3NVQA 5FGCB 5FYJU 3CJJA 4NOFA 5J7CC 4O51A 4GOSA 1YNKH 3R06A 4OD2B 5MHSD 1HXYA 4P2CG 4HGKC 4CVZB 2F54A 2IQAB 4JY4A 3VG0L 1ERNA 1WZ1H 4TNWF 2R23B 1V7MH 1KPRB 1OTSC 1YEJH 4NN6B 2NTSP 1J1OL 1CVRA 1I7UB 4OV5A 4LEOA 4Y8AA 1KJ2B 4P0DA 1HZHL 4YDLB 2G5BA 1CN4A 3GSNL 5FOJA 1AKJA 3FHAA 5C0DB 5DC9B 5GSVA 4RGNE 2X09A 5MENB 3UZVB 3FTGA 4I4WA 4K3DH 1NLBL 5D7IF 5JTWA 3ALPA 4LQFL 4NZDA 5IHZA 3NFPB 2MKLC 4ZFZB 4H20H 5GSRB 3GMNB 4ALAH 2WWMD 2Y9RT 1I8IA 4BM7A 2GTZB 1KLFA 4BFIB 1NUNB 1FCCA 5ACZB 4M03A 4FQLL 2CQVA 3PL6B 1DBBL 3ARDA 3RVWC 5DMKB 3QIUB 3BZDA 4JE4B 1F4HA 1KIUA 2VLKE 5GRWA 1JK8B 4GRWH 3WSQH 4FQQB 1A7QL 1N5YL 3DX6A 2HN7B 4JFYA 5B21A 5D70L 1A7RL 4KDVA 4NNPH 4YBLC 2OM5A 5DUMH 3EJJX 3DECA 5BXFB 1SJVA 1HWHB 4ONFH 4D8PA 3ARFA 3PGFH 2VMFA 5CZXC 1AO7D 5MHSE 2E5EA 4NYLA 3ZYOA 2VIRA 1SY6L 5C86A 2JCCE 5TE6L 3P9WB 2JB6A 4Z76B 4PJDB 4XP9L 2DQCL 4X98B 2XICA 3WJJA 2O61B 4M1DL 1G0YR 3S6CA 1TZGL 4PJ8A 4MJ6A 3CDGA 3FQTA 1CK0L 4ZG1A 3VWKA 2M8XA 3RGVD 5DRXA 1FSKC 4GSDL 2VISB 4LPWA 4NQVA 2BVTA 5JIHA 3UTPE 5KSAC 4AIZA 4P2RD 5GGRY 3BQUB 2Z8WC 1TLKA 3QNZA 1UT9A 2B1HH 2PYED 3EYSL 5T3XL 3SQOL 3T65B 1MFAH 1HHKA 3WFHB 4CNIA 3GI8L 2WAHA 2OQJB 3NZHH 1QFWM 3WDJA 3H2WA 3EYUH 5HDQH 3T4YA 4PS4H 3BP5A 1H0DA 1S5IH 3V6OA 5HGHA 1YC7A 4JY5L 1MCOH 1EAPB 3F58L 4JRYD 3P40A 1FQ9C 1FLRL 5HYEA 3HAEH 3RJQB 1X5GA 1OPGL 4MJ5B 4U0RC 4X6BB 1RK0A 2IH3B 2VZUA 4LFHG 2GT9B 2H9GB 1AKJD 4XVSH 3VH8A 1HOCB 1A47A 4PY8J 1YQ2A 3F7QA 4B7IA 4N8CH 2CR3A 4I5BB 1ZHLB 3QWQB 3B8SA 4AH2B 2B7DT 2DL2A 4OLYL 1QFUH 5I1HL 3MCG1 4OCRL 4MB4A 1T5XB 4O2CB 1GZPA 3MV7D 4N9GB 2IPKB 1X5IA 3GIVA 4HUWA 1OAXH 2BMKB 3OB0K 4CL7A 4YNYB 3QH3A 3V6ZA 4H0IA 4NBXB 4LSDA 2GK0B 1N7MH 1C08B 4IOIA 4P2RE 4WNQB 2BNQA 1F58H 1F6AB 4EUPG 2IG2L 4PJ9A 5C0BD 5CIPH 5E94B 5TQ0H 1ZT4B 1TETL 4OKDA 1W0WA 1YMMA 5JW4M 2FR4B 4EI5D 3LKQB 3SDCB 1U8JB 1T03L 1J0HA 2GTWA 4FP8L 3GNMH 1OAUL 3KLDA 3ARFD 3D5OF 3T0EB 4Q7DA 3KPQB 4L4TB 1JN6B 2ATPA 3RWGB 4Q9QL 5LBSL 2EDNA 3LKRB 4DKFH 2BNRD 2FL5A 3GMMB 1IC1A 4Z7VE 3MRBA 4JRYE 2DI9A 1X9QA 4Y5XC 3ZYJA 3D2UB 1MHCB 1DN0A 5DJ6B 1VKXB 5TDOA 4N0YL 3GHEL 1IM9D 1JGUH 4OCSH 1PG7W 4PJ8D 1T5WA 4P3CL 1EGJL 5BZWA 1FJ1B 1EEUA 3BO8A 4KDTA 2YWYA 3FCTA 3VWKD 5DEGB 1V7NL 1N59A 3PG2A 5BVPL 4L9LA 5I74C 3EIFA 3MO1B 3JUZA 4L4VB 2GAZA 3MV7E 3F5WA 2R4SH 1DDHA 1RIUH 3NIGE 4XMKH 3BPNB 4LLDB 3MRKA 3TIEA 1U8NA 1CR9H 3DX9B 3CFEB 4MNGA 3RVXD 2CKNA 1F11B 1ED3A 4NHUB 1REIA 3MRFA 2NY4B 5C0BE 1EUUA 2V6HA 3HUJA 3QBTB 3H0TA 3U30B 1J12A 2PO6A 1ETZB 3GRWL 3KYAA 1U42A 3BPCA 4OIBA 4UDTA 5DJXB 1N3NA 1INQB 3MOBH 4XCEA 3O2VL 4LSSL 4RAUB 4LSQL 2WUBH 5E4EB 3O2WL 4I18B 3GBNH 5SV3A 5BVJB 5I1IH 1A3QA 2BNRE 4BQ9A 4QXUL 4XP6L 4X7FC 5FYLH 2HFEA 5MEQA 1Y6KR 5CMAB 5H35B 5LGHH 1UJ3B 1W72H 1PLGL 4H1LB 3VGBA 4JLRA 2VLRB 4KJYB 1R5WA 4ZAKC 2Y06H 1KB5L 2Q3AA 4FQPA 4U1JB 4LVHB 1B0GB 1IQWH 4E0RA 4U4BA 3X11A 1P4IH 5A2JH 2FATH 6FABL 3PP3H 1A0QH 1NMBL 3GMPA 4KI5C 1WBZA 3P0YH 3C9NA 3GSNB 2G60H 2W9EL 4S1QL 4K71B 4HMEA 3RJDA 4Q6IB 1JPTL 4NQEA 1XF4B 4O58L 4ZXBD 1T1XA 4QTHA 5E2TL 1I9IH 3F6LA 4OQTL 4K94H 1H3UA 2ZP0T 3MLYL 4F3FA 1CF8L 1AXSA 4XNQA 1U6AL 2OTPA 1DQML 1YMMD 2EE3A 2YPKA 1CICC 5I1AB 5F44A 2QQKL 4XWGL 1TZGH 4QRTA 1H3PH 1ZANL 1Q0YH 2IBBA 4ODBD 5DEFA 4WO4A 5SWQB 3SGJC 1YC8A 1KG0A 5D93C 4U1KA 1WZKA 1ITCA 4C4KO 3V6OE 1G7JB 4GSDH 3RZWA 4ZFGL 5JXEA 3DO3A 1J87A 1RZ7L 4WCYH 1JIBA 1NGWA 3QHFH 4PREB 1QYGL 1HH9A 1XGQA 1LP9E 1WBXA 2VLLB 5JOPD 2C3WA 2ZPKH 4NWTH 4PJEE 1CGTA 2HJLA 3SDXE 4CMHB 4DGYL 1H5BB 4YIQB 1CI5A 1XCQB 4S0TD 4XAWL 2YXMA 3R1GL 4R96A 2KKQA 4JAMA 1AGFA 4GJTB 5F9OH 3AREC 4ZSOE 4PJIE 5D96B 1D6EB 2ARJA 1NLDH 4PJCB 1OD7A 3X14B 4QHLB 1JPST 3GMOB 1LK2A 1CXHA 2NXZC 2CXKA 3CXHK 3P77B 1OGAA 2DM3A 5AYUH 4LLUB 1HINH 4QWWD 3RKPA 4OD2A 2A6KB 2R2EA 4CVZA 2IQAA 1KPRA 2BY2A 3BGMB 3S35L 1L7TH 5D7LD 4XP4H 1EHNA 5IW3A 3ZDYF 3HNVL 1I7UA 2Q7NA 1KJ2A 2QJDA 1VACB 3I9GL 3WIIH 1AY1L 4PGDA 5T1MB 5IVNA 2EDJA 4QT5B 2Z92B 3H9HB 5HHVH 5C0DA 4TVPD 5MENA 4F9LA 2BX5A 3JSSA 4IRSC 3DSNA 5HPMB 4XB8A 1G9NH 5DHXB 1HDMA 4D3CH 3NFPA 5IQ7L 2A0LC 4BZ2L 4ZFZA 5GJTL 4KRPC 3V7AG 3HG1B 3KR3L 3MX0A 3GMNA 4Y4FD 5GSRA 2DDQH 1PKQE 5EZOH 2GTZA 3BZ4B 1G7LB 4BFIA 3V8CA 2NY0D 2D03H 5ACZA 4NRYB 5FM5M 3KWWB 1NUDA 4EOWL 1JYNA 4PJGB 1GGIL 3PL6A 3FQXB 2DYPB 5DMKA 3QIUA 2FH8A 5IBTH 3TO4B 3U82B 2EDWA 2D7PA 1JK8A 4FQQA 1IMHC 4ZUVB 1QKZH 3G5VB 3VMNA 1T20B 2HN7A 4YAQB 5DQDH 5LBSH 5C0EA 3MYZA 1AGEA 3WLBB 5ECJE 3ZKMC 4NNXB 1KN4L 5E8OB 1H3VA 3HUJF 3BIKB 1QFOA 4JFHD 1WIUA 1M7IA 3KYOB 4OGYL 5DYOB 1FFRA 5D7LE 4WO4D 4MNGE 4PJDA 4Z76A 2NXYB 2AI0H 3DUUB 1AD9B 1OAYH 2O61A 5DRNA 1H3GA 4CKVX 2B4CL 5J6HB 4TVPE 3OKNB 2JJSA 3VRIB 1QUNA 4U1GC 4GW1B 1KXVC 2PW1A 3T0AA 3O3UN 4R4BB 1ADQA 4K7PL 3SE3C 2VISA 1EXUA 3EO9H 4Y2DA 1RU9H 4XNYH 2OL3B 3QXDA 3ZSSA 5DJ8A 4PJBE 1KEMH 4MLSA 3BQUA 3JWDL 4M3KB 3O3DB 1I1FB 1MJ7L 4LSUL 4Y89A 4ZMAT 3AMLA 3SKNA 4ESKA 4DGVL 1SYVB 5CSBA 5DA4A 3T65A 5CS7A 1IAIL 4GLRH 4RRPG 5I1CH 3VXTB 1NPUA 2VDML 3IFNL 5I8EB 5F7MC 1RIVH 2A9NH 2HJKB 5F7FA 3ARRA 3DWTA 4FTVB 4PJ5A 3QPXL 4PRPB 4QOKA 5H37G 1M71B 4KHTH 2Z91A 4WHDA 4BUHA 1G7HB 1RUPH 5J12C 3OG6B 1A1MB 1WWAX 3FB8A 4R4FH 4D0DB 2NPLX 4RA3A 3BKML 3ULVL 2F58L 4NKIH 5L7XH 2EH8H 2YD8A 1B6DA 1CLZL 4MJ5A 5CINL 4M48L 4X6BA 4LPCA 5FUCE 4TQEL 4I0PB 3KXFE 5CEZD 2H9GA 3TC9A 3LQAL 4JFHE 5E6IC 2HRLA 1IE5A 3V6FA 2O5YH 1KTKE 3V95A 5L8JB 5GGSY 1ZHLA 4AH2A 5IESH 3FO0H 2Y36H 5C8JA 4ELKA 1KACB 3QISA 2AQ2A 1MF2H 2MKWA 1XGRB 1OAZH 1T5XA 4IRZL 4O2CA 3HI6H 3QAZB 4LHUG 4N9GA 3QCTH 5CJQH 4K2UL 2BMKA 2YD4A 3BKYH 4OAWB 2J8UE 1DQMH 1LE9B 1AFVL 2D2OA 2GK0A 3PL6D 1C08A 4G6FB 4HIJA 1KCUL 2QQKH 4C83A 4Q9BA 5DUPH 4WNQA 5J1AB 1F6AA 3IDJA 4M7JL 1C12A 1ZT4A 4HHAB 4UZGA 4KKLD 1VFAB 3LKQA 12E8L 3SDCA 3W0WB 4WEBH 1S9VB 1AP2B 2NR6D 1P7QB 2ORBH 3HN3A 1MQ8A 3M1BB 4Z7WA 4Z78A 3AB0B 5FGCE 3HKFA 2Q8AH 3T0EA 3KPQA 4RMRA 4ZUTB 3DX7B 4L4TA 1JN6A 3WMSA 1SEBB 3RWGA 4OSUH 4PUBH 3W9EA 3LKRA 3RIAK 5IEKB 5IBUB 3GMMA 1L0XA 5HHME 3HCVB 4TNVF 3S96A 4OIIH 1BQLH 5IBLD 1F4YH 4MXQC 1G6RA 4PB9L 1PD6A 3RKDC 4HF5H 2BHUA 5C08A 3TH3T 1CLYH 5DJ6A 1VKXA 3MZTA 3Q3GA 1JZ8A 1MRCL 1NBYB 5CEZE 3OKOB 1CBVL 4C54A 1J86A 4X4XB 3BGAA 5E99H 1KPVA 2YSSA 3G5ZB 3QRFM 1V5JA 3GHBH 5DEGA 3ARQA 5GRVL 4TPRH 3BIAX 4CU8A 3T2QA 3BEVB 3B5HA 2OMNA 2FNBA 3MO1A 4L4VA 5KSBB 1KIRB 2DQHH 3OJVC 5DK2B 1BP3B 1CU4H 2ZNWA 5T1LA 3OR7A 1JZ5A 1FLTX 2YWZA 3L3GB 3OXSB 1KT2A 4DZBA 1A1NB 4XMPH 1T6WA 4LLDA 3WUWG 3FQNB 1ZSDB 3OAYH 5F3HA 3DX9A 1G9MH 1T2JA 3CFEA 1F97A 5HI3D 1H3XA 4QO1A 4U1IB 4NHUA 3U0WH 3H9SA 2RJMA 1OL0A 1KGCD 2R0ZL 4PRNB 1ETZA 2ZCLH 5D6CB 3ESUF 1INQA 3IS1X 4NKDB 3AVEA 3HC4L 4NZJA 5EO0B 5BO1H 8CGTA 2DM4A 3D48R 3QDGA 1HXMB 3G6DH 5FM5O 5BOZG 4KMTL 1P1ZB 4HCRH 2FBOJ 4K3JH 1BM3H 2APTA 4P2YA 4XC1L 2BNUB 5CMAA 5DT1H 3PXJA 1AR1D 1FZKB 4PJDE 3QG7H 4IRJC 4KJYA 5ADOL 4HWEH 2GJJA 3HA0A 1R0AH 1B0GA 1FNHA 3G6JE 3KHQA 3MLWL 3UO1H 3RA7H 3FQRB 1OQOA 1NCAL 3HMWH 1NL0H 1VFUA 3EO0A 1F13A 4BJLA 4WUUB 2AV1B 5HYQB 3GSNA 3QO0B 4GXUM 4MDIB 5HHNB 3GZKA 2VXTL 1JE6A 2VDPL 3QUYB 4Q6IA 1QLEL 3NZ8B 1XF4A 3GSRB 4WENB 5IKCB 3IXTB 4HPOL 4ODSH 4YHMH 5C7XL 5F96H 1OT1A 3EZJB 1Z3GL 3HI1B 3I02A 1ES0B 3O3EB 4WWKC 3ELAT 1A5FH 3SDCD 3T0BA 1YEDB 3N1PC 1G7PB 3ZSTA 4GRLB 3K1DA 1UM4L 3S4SG 4G6ML 5IB1B 5SWQA 4L4TD 1KCLA 4BSWB 4KZDL 4I77H 3LV3B 5TQ2L 4RISL 1KGCE 1G7JA 3BAEL 2HFGL 2V5SA 3E3QC 5I8OL 5B8CA 3IJYA 1JV5B 4UT7L 2AV7B 3D3VB 4P9HC 4PREA 4XXCA 2VLLA 5CILL 3D2UD 1F4XL 1CWVA 3F7YB 1H5BA 5DJYB 2HA1A 4YIQA 3UYRH 3DUHA 3KAAA 1XCQA 3SDDA 4DWHA 3TYGL 2X4QB 5E5UB 4M8VA 2UZYB 3BRGC 4RQQB 1SY6A 1T83A 1EVUA 3JWNC 1D6EA 4HK0B 1MCCA 4PJCA 1I3GL 5IB3A 3RPIB 3GMOA 1MCWW 1TJGH 3V52L 2VL5B 2UWEE 3MV8B 3P77A 4LLUA 4NM4L 2A6KA 4JRWA 1I85A 3O6FB 5HHXH 3BDBA 1NGZB 3V5KB 3I50H 5FB8B 2NY5C 3BGMA 5AUMA 1YN7A 4X6CB 1QD0A 3LRSB 4ENEC 4Z7WF 4YFLF 4ZTPH 3MLUH 1R3JB 4FXKB 1VACA 1LNUA 3GO1H 3O81A 3QIBB 5T1MA 1F2XK 3WNPA 2HP4A 4QT5A 3DNKA 2Z92A 2E8YA 4H5SB 2R8SL 1CE1L 3QIWC 1NEZB 2AJVH 5IROC 4WY7L 2P48B 4YQXL 2VN4A 2BRRL 3HG1A 1QVOB 1AFVH 4OD3L 5D1QC 2B8OT 1BIHA 3ZKNC 5DO2D 5DLMH 3BZ4A 1G7LA 4LLQB 3EYFA 4OTXH 2VLRD 3WFEH 4DKEH 1XGUA 1FE8H 4TOYH 1LHZA 4NRYA 1VGEL 3KWWA 3LB6C 4YPGB 4PJGA 5EIVA 5ENWA 4K9EL 4UQ3B 4PLKD 2DYPA 3P30H 3TO4A 1P4LB 4OF6A 2YRZA 4HKZB 3KPNB 5DVOA 1J8KA 4H8WL 3I6LD 1BFVH 2GEEA 4ZUVA 2J7LA 1MRFH 3G5VA 1QOKA 4NGHL 5EBWB 4YAQA 2VR4A 2XKSA 2NZ9C 4MA7L 4WU7A 3V0WL 3BN9D 3QUXC 1V3KA 5HHPB 3L1OL 2XZCH 1L7IL 3IU4H 4JB9L 5D1ZC 1CS6A 4PB9H 4X9HA 4UUJA 5JDJA 5ETUA 4AEIL 3BIKA 5ELIA 3WD5H 3HC0B 5JPMB 3E6FB 2EO1A 3KYOA 4S0SD 3MA9H 5EBLB 3DUUA 2E7MA 4WIQA 4N8VB 2J4WL 3CK0H 1NGPL 3ARUA 4MCYB 4OFIA 5J3HC 3WIFB 4JVWA 3QZWG 3VJ6A 1A3LL 1EX0A 1JGVH 3LH2H 5D8JH 4ODWB 1I8MB 3OKNA 2ICWI 3VRIA 3GK8H 2F19H 4GW1A 1JF1B 2NZIA 1UWXK 4R4BA 5JQ6L 2HT4D 1T2QH 4WHCA 5BW7C 4LU5H 5HY9B 3STBA 5C3LD 2OL3A 3DROB 5L6YL 4JM2C 4JFPA 4CADA 3W9DA 3HZYB 4HUXB 4WI9A 4M1GH 4Y8DC 4G9FB 4Y5YC 4C55A 3O3DA 4R7NB 3PHQB 1MPAL 2VLRE 2EH7H 3CIQA 4YHPA 1EAJA 1SYVA 4QTIL 3LSOA 3VXTA 5I8EA 5BMFH 4GAFB 1NGQL 1J7VR 2HJKA 1NC2B 4YHKL 3P9MB 2X4SB 4FTVA 4LP5A 3I6LE 4PRPA 1MCJA 1LDPL 2B0SL 1M71A 4UV7H 3WFDL 2H1PH 2R0LH 3UBXA 2C3GA 2EIDA 1A1MA 1EGJA 2WQ8A 5D9SA 2R29L 4D0DA 5DSCB 5HD8D 4PB0L 1SHMA 3QCUL 1YMHB 1CGSH 3C08H 1YY8B 3VFSA 2PKDA 1OTUC 2JELL 1NFIB 3UTOA 5B38G 5ADOH 4I0PA 3BDYL 3TFKC 3VI3F 5IFAL 3FN3A 3SE9H 4L3CB 2QR0B 1HIMH 2ZCHH 1UH3A 5CGTA 4IBLT 5IOPB 3TBVB 2B39A 3MRJB 2AGJH 3QHTC 5JW3H 3BEWB 3FT4A 4HKXA 3QPQC 4Y16B 3HG1D 3CVIH 4QLRA 4DN3H 3DHJA 4QHKI 4K7PY 4QGYA 1VGKB 2B1AH 5FUOL 2P49B 3O6LL 2JLLA 2CH8A 4Q6YA 4XC3H 3CSPA 3GRWA 3SOBH 3IKCB 2EIBA 2XPGB 2J88L 4HFWB 4PJCF 4U31A 1LE9A 1FNGB 5D6DA 2DYPD 5DURB 5DJ0A 4RBPH 3TO4D 1YYLH 5J1AA 5K9JH 2MTPA 2HKFH 2OJZH 4HHAA 4NCC1 2B2XL 4X6DB 2ID5A 3PGDB 4ONGL 5CBEB 1A9EB 1VFAA 1TTFA 3IETB 3W0WA 3C8HA 1YNLL 3HPLA 3ABZA 4ZD3L 1S9VA 1AP2A 4KHXH 3SDYH 3M1BA 4LVEA 1JZ3A 4TNWK 3REWB 3TIDB 4PFEA 3SDAB 3FOLB 4ZUTA 3NA4A 5E1AB 2VH5H 3DX7A 3VCLA 2C7UB 1MLCA 5CILH 1KB5A 5I8KH 1QFWL 2AJYH 3GSOA 1HI6B 4GQ9L 5FKAB 5IEKA 1GIGL 3HCVA 2JK5B 3TT3H 5C07B 4PP1D 1IKNA 1J05B 1FO0L 1XF1A 4EUPH 2NXYD 1E6JL 5EOCL 5EUOB 1NBYA 4HIEB 1JF5A 2AK1L 3VFGH 3OKOA 1EBAA 1T04B 4OQTA 2X1XR 4JFED 5DR5L 3G5ZA 5L2JA 1OSZB 2VSCA 4LAQH 4FFYL 5J8OA 5KS9A 1UKTA 3HNTH 4EI6B 1JGLL 3WHE0 4PJGF 3BEVA 3T04D 1NDMA 1DEEA 3HG1E 4M6AA 5DK2A 5E9DB 1VFMA 1KLUB 1KC5L 4JQVC 1G0XA 1R3IH 2XWJB 3INUL 4G7YH 4LIQE 4JKPH 3L3GA 3OXSA 4R7DB 4PGCA 3VA2C 4PJHE 1A1NA 3SCMA 1BWWA 3FQNA 1ZSDA 4JHZA 2DBLL 2HYMA 4M7LL 4XCFH 3VGEA 4KK6C 3ULUH 4RGMB 4EXPX 3WO3B 4U1IA 3ARSA 5C6TL 3QHZH 5B3JF 4FTVD 1WJ3A 1NFDE 4PRPD 3L3OB 4TYUA 5C0ND 3TZVA 4QCIA 1VENA 4PRNA 1FL3A 2VXVL 5T3ZH 5E2UH 2W9DL 5DMIH 5GRZA 1CDCA 4ODTL 4NKDA 1IM3A 1JFQH 3IYLW 5CJ8A 1QHPA 3VXSB 2OZ4H 3KJ4C 5EO0A 2ITDA 2FO4B 1KFAL 3A6CL 4I0PD 1HXMA 1ITBB 2XRAL 3ZTNH 3L3JB 3U83A 2X10A 4IS6B 4D94A 1IT9H 1MAML 1FZKA 3HS0B 4ZFOL 1G9EA 1J9CT 3OGCB 4YHZL 2RB8A 1RUMH 3LD8C 3B9KA 4U1LA 2H2PD 1QFPA 1JRHL 3FQRA 1TQBB 1JBJA 5DS8B 4JFEE 3VG9B 1CLOL 3PGCA 4XBPB 2Q20A 3OL2A 1MCNA 5DJ2B 3S88H 5JXAH 4WUUA 4MAUL 2AV1A 4PY7A 5HYQA 1ACZA 3QO0A 4YXLH 2XFXB 5HHNA 3K81A 4LVOB 4JO1H 3ZL4H 4U6TA 1ZGLA 3NZ8A 1Q9OA 3G5YB 4HGWA 1ZLUK 3GSRA 4WEMB 3IXTA 1GPOH 3VFUA 1EEZB 2CSPA 3EGSA 1A3RH 3MUY1 4OLVH 1U8QB 3KLAA 3CFCL 5DJCB 5I15H 3HI1A 4RWYL 1FAIH 2AAVA 2BVQB 1ES0A 1HN1A 2Z0BA 3LZFH 3O3EA 3KG5A 4DK6A 3W0WD 1YEDA 2W1NA 4ODUA 1P7QD 4UNVA 4U0RB 3VDAA 2BHZA 1DBJH 5I73C 1G7PA 3DGCR 4TN9A 5JLZB 2WWMC 4GRLA 2ZOLB 3CX5K 3MOAL 3U9PH 1PSKH 3GSUB 2IGFH 3UPAA 1OSPH 2XWBB 4F8QA 4PRPE 4G80A 1BEYL 3OB0H 2G9HB 4LKCB 3LV3A 5EU6B 3UJIH 3WXVH 3LKSB 3CVHL 4RZCA 2EIEA 5FK9B 4K8RL 4V1DE 1JV5A 3TBSB 2AV7A 3ARYA 4LSVH 1LO4H 2YD3A 1PG7H 4X7SL 5K59F 5HXMA 3KPSD 4JDZA 5DJYA 4LCUB 4BZYA 1UACL 3FRUA 4KK8D 4OCMC 5F7HA 5DD5H 5TFSH 1AGCB 1QLRB 1BVZA 1FFNB 4HC1H 4HK0A 3RPIA 2VL5A 1YEEL 3NABH 1RK1A 5HTSA 3UAJD 5KBNC 5LAXB 1ORSB 5TF1H 3SKUD 1EHLL 3O6FA 4F7EA 1NGZA 5FB8A 4EBQH 3DXAB 2JIXB 4OCXH 4X6CA 1NCDL 3LS4H 3QB7C 3WV0A 3EAKA 4XPBL 1D5BB 1N4XH 3QUML 1KB9J 3RGVC 4Z7QF 5FYKL 4NC2B 1RZJL 1RZIB 1JYXA 5CP7B 4KKBD 4Y5XB 4H5SA 4J3XA 5CBAB 1IAKA 1F4WL 4XPTH 1MH5B 1DFBL 3MLTA 4E5XA 1NEZA 1SYSB 2WUCL 5DF0A 3T3PF 5ALBL 5HGBB 2A6JA 4Z7QE 3B6SB 1X4YA 4XPAL 5EU4A 1WTGT 2ADFH 4HFUH 5BZDB 5SWZB 1QVOA 1KEGL 3SGKC 1KXTB 4R90L 4E9LA 1U3HB 4KPHH 2C1OB 5DD1H 3MRHB 2CKBH 3HAEB 3CZFB 2J6EH 3VFPA 4YPGA 5KS9F 3KPSE 1I9JL 4O2FB 1WFNA 4UQ3A 5F88B 3AU1A 1VA9A 4HKZA 3KPNA 1DSFL 1L9MA 2KH2B 4KQ4L 1WTLA 3H3BC 2H32H 5C6PB 5BV7C 4WUUD 4F57H 1MLBA 4MZ3A 5HYSA 5EBWA 2HWZH 5CJOL 4M62H 3QUYD 2DTMH 1P5UA 4KDWA 1TPXB 2VDLH 5HHPA 5KSBE 1CGWA 2DLHA 3V0VA 3QQ3B 1DUZB 3QFJE 1OP3K 1GH7A 4GW5B 2VABA 3T2NL 1JPFA 3HC0A 4WDIB 5JPMA 5GISL 3E6FA 4GRLD 5K9QI 4UIKH 1DJSA 3K1KC 5EBLA 5KN5A 1CGXA 1JMZA 4L29B 4N8VA 3MUHL 1HHJA 3T1WA 4MCYA 3WIFA 3TNMB 4FFYH 1JZ7A 2DTSA 5CIPB 3LIZH 2AXGB 1QBBA 3O3BA 4N5ED 4LAJH 1MJJB 4ODWA 1I8MA 4GG6B 4ZAKB 5I1KH 3D3VD 3NFSL 4DGIH 4OZIF 4WW1B 4LCYB 2YA1A 4OZ4B 2OR7A 3QNXB 4JHBA 2DMCA 5IIEB 5HY9A 4EI5C 2HTKD 3K4AA 3DROA 5D2LE 2CGRL 4M4RA 3PWLB 4U49A 5EZJB 3ZT7A 3HZYA 4HUXA 3NBNA 1I4FB 3ARFC 4G9FA 3P11H 1Z9SA 5C6TH 5AZEL 5I1DB 4UDUB 5HDLA 4R7NA 2W60B 3PHQA 2DLGA 4BFGA 4MNQB 3X3FL 1I7ZB 2QSTA 4JN1H 4LASL 5F9JB 1E4KC 3MV8D 1FO0B 3SJVB 1K3IA 2I9TB 1T2XA 5KJRL 1NC2A 3P9MA 2P47B 2X4SA 2YD7A 3SBWA 3FZUD 4OM0L 4WUUE 5FFLA 3O6FD 2ZUWA 1Q1JH 3WJJC 4GMSH 4N1CA 2WBJA 4Q58C 2XNAB 4YC2C 4PJ8C 3NIDE 4OCWL 1MCPL 1YMHA 4PLJD 3GBML 4O4YH 3HR6A 1RUAL 1S7QB 1YY8A 2EXYD 3VWKC 3MNVB 1IBGL 3QIBD 3LY6A 1XR9B 4NZTL 4FQHA 3MROB 2QR0A 5CD3A 4P23B 4J8RB 1LGVA 5FKPB 1ZT1B 2XZAL 4BKLB 1QSFB 4LMQI 1OARH 5E8EA 3O4OC 1DQLH 5IOPA 3I2CL 5JR1L 2X9YA 3BEWA 3RAJH 3SY0B 5FOBA 3RNQB 4Y16A 4U1NB 2X4PA 4GMTH 4OZHB 4DN4L 5GS1A 5CP3H 5L8LB 3IDNB 4EQ2A 4NO5B 1EHAA 4NQCA 3RVXC 3U7WH 2DQGH 3D3VE 4JHWL 5C0FB 5E8DH 3V6OC 1FYHB 1J5OH 3CLEH 3P4NB 3IKCA 2XPGA 5HVWA 3EYVB 1TZIB 2AJZA 1KELL 1DQDH 4QRRA 2UZIL 3FB5A 3A0OA 4KMLB 3CCHB 2KPNA 4AL8L 2RAMA 3U7YL 4X6DA 2VDRH 3PGDA 3NAAH 2R1XB 5CBEA 1A9EA 1BOGA 25C8L 3TO2B 1OD9A 2NYYD 3IETA 3S34H 3UJJH 3REWA 3TIDA 2FBJL 4Y5VC 3MV8E 5DI8A 3SDAA 2X4TB 3BZFA 2A9ML 1HI6A 3UDWA 5FKAA 1G1CA 5C2UB 4G9DB 4R97C 2JK5A 4X6CE 2BSTB 2A83B 2DIBA 1J05A 2OTUB 3MV9A 5EUOA 1MFDH 2X1QA 3A67H 4NJ9L 5CGMA 4ZPTB 4HIEA 1L0YA 4FQXB 4UB0H 1SVZA 1NUFA 1ZEAL 1T04A 4ZXBC 2APBA 4O02H 4X8JB 1OSZA 1S3KH 2PUQT 5F1IB 1HHIB 3MRLB 4LCWA 1KENL 3WFBH 1N2RB 2ZCKH 2ZWLT 4HLZG 3VXNB 3PWJA 5E2WL 4P9HL 4OBSA 1WIPA 3OJDB 2H41A 4HIIB 5E9DA 3ULVF 1KLUA 4G9FD 1P84J 5E6ZA 2VZ3A 4R7DA 4UT9H 1J0KA 1U2CA 4WFFE 3IT8D 4MD5B 4X7TB 5DD6A 3CVHB 1LILA 3UMTA 4EDXB 4HX1B 1S7VB 2VLJB 1MNUH 5K9OB 2H6PA 3TBYB 3L3OA 1BZ7B 4NC0B 1E0OB 4HPYL 3WKML 3UTZB 4PR5B 4PTUA 4L5FH 1KCKA 4HDIA 4M6OL 1BF8A 3Q6GH 1WCBB 3VXSA 5GS0L 1RIHH 4KDTC 1I3UA 1JNLH 4YPJA 1NBVH 2NY5L 5GRJH 4Z0BH 2J1KA 4JO3H 2NW2A 4L9LC 1FNEB 3L3JA 1HWGB 3B83A 3U2SA 5DWUL 5GGQH 2HMID 8FABB 3UYOD 4QWWC 5KSAA 2VZVA 5FM8A 1K3ZA 4U6HB 3GIZL 1CGYA 1NKOA 3K4ZA 3OGCA 4JPIB 4AEHL 1A6TA 2VSDA 4DTGL 4Q97A 1DBAH 3BDXA 1Y0LB 4XBPA 4TUOA 2C3VB 2EDLA 5DJ2A 1FCGA 2XFXA 3G04B 3T2NH 2OMBA 4WHTB 5C0JB 3R0MA 2XIDA 1JZ6A 1OOAA 5DURD 1ZTXL 1BFSA 4MA3B 5ALCL 3V4PH 1EEZA 1TIUA 4G9FE 1Q9WB 2O5ZL 3ORJA 5L9DL 3N9GL 1U8QA 5DJCA 5CKGA 4GS7C 2BVQA 3MXVH 4MS8D 3BIBX 3DTXB 2W0LA 1KCVH 1ZLSL 1UENA 3IDGB 3GM8A 2QQNL 5JLZA 1RZKC 3MYJB 3SDAD 1FGNH 3GSUA 2ZG1A 5IHUH 4LLVA 1DQJB 1L0QA 2XWBA 5IW6B 5E6IB 5ESAB 3RWCB 4NJAL 5EU6A 2NY0C 4LKCA 1VPOL 3LKSA 5TGBA 2X42A 5C07D 2R4RL 3TBSA 3EFDL 3L3IB 2N1KA 1O5DT 2BJMH 3WEXA 1E27B 3FB6B 4YR6B 4LCUA 3ESVF 2O5XL 2QEJA 4XVTH 1XIWB 1WWCA 1BECA 1AGCA 1QLRA 1UB5A 1ZLVH 3BWAB 2JJVA 3RWEB 3X3GH 5FUCC 1GHFL 4OM0H 1IGML 2C4XA 2Q1EA 3O0RH 3GSWB 4J3UA 1IQDA 5E9DD 2YUZA 1ZT7B 4WO4C 5CFHA 2BDNH 2J5LC 2C3XA 2FHFA 5LAXA 1ORSA 5I19H 1LK3H 4X6DF 3DXAA 2JIXA 3QA3B 3IU3B 1LEIB 1BGXL 4HS3B 3BE1H 4K7FB 1IC7L 1N0XH 2DQDH 3IFLL 1FPTH 2A6DB 5ICYB 4JRXE 1SEQL 3MLSH 1D5BA 2CO6B 2CR6A 2HKHL 3TJHD 1GYAA 4XNZC 2IBZY 1RZIA 2AK4B 4UNTA 3VDBA 4Y5XA 4NPYB 5CBAA 3NPZB 4AEFA 3RX8A 1MH5A 2OP4H 2IFFL 4S11A 4TNVK 1SYSA 4L3EB 4NO0B 3U48A 1M7DA 3FHQA 4R8WH 2ATKB 5EUOF 5HGBA 1RJLB 1KOAA 4ZNEE 4LPXA 4Z6AT 4MJIA 2FD6H 2D31B 2XZQL 4PV9B 3CH8A 5CUSH 4OD1H 3UTQB 4Y19B 5C07E 1U3HA 1QHOA 2C1OA 3MRHA 1X5ZA 1JTOA 3JV0A 4QRUB 3HAEA 4EEEA 4DVBB 5F88A 4NN6C 1PG7X 5ID0B 3DI3B 1OAKL 4JKLA 1H15B 3ECBB 4MAYB 4U7KA 4PGEA 3J8F7 4GO6B 4QHUA 1YDPA 4XVJH 1IAMA 5HGDB 5FXCH 4YDLC 5E2VL 3BP7B 2JB5H 1F3RB 3QQ3A 1U58B 5E9DE 3D25B 4F9LC 3T3ME 3IDYB 4JFDB 3EDFA 3CX5J 4GW5A 4BSVB 1FYTD 4Z0XB 4UTAL 3U6RA 1UM5H 2V9QA 2LAAA 3VXPB 2E27L 1ULVA 5HDBF 2RCSL 1K6QH 4WDIA 2H3NB 4P5KB 3QRGL 3UROR 4KRLB 1IGFH 2VO5A 1TQCB 2Z8RA 3MUZ1 2Z93A 4MQTB 3DVIA 4P57B 2FB4L 3DBXB 3TNMA 3TGXA 2H26B 4DAGL 5EU6D 5CIPA 2AXGA 1A64A 2CMRH 2CO7B 3PL6C 2COQA 1MJJA 5DC4B 2Q6WB 2K9UA 3QIUC 4GG6A 1YN6B 3ME0A 4ZAKA 3S37L 1QA9B 2L0DA 2PTTB 4WW1A 1JNNH 4LCYA 5E00B 3QNXA 1XMWA 5IIEA 2WK2A 4KKLC 4Z77B 2DWDA 1R24A 3VWJB 3JV5A 1UA6L 3PWLA 5EZJA 4XP5L 2NR6C 2XTJE 4AM0B 5SWSB 1I4FA 4XNXL 5I1DA 4UDUA 3EJYD 2W60A 2NY7L 4MNQA 3NA9H 1I7ZA 5E5RB 1QLFB 2BSRB 5FHAH 3PUCA 4X9FA 3TJEH 5F9JA 3O6KL 7FABL 2PN5A 1R3LB 1FO0A 5IBLC 2I9TA 4XPFH 1CICA 1J1XH 2YPLB 5FO8B 3L7EB 2XOTA 1MFBH 1C7SA 1CQYA 4YX2H 4OLEA 4TRPH 4QGTA 3DXAD 2JIXD 3HRPA 3D87B 1TCMA 2XNAA 3SGJA 4ZS7L 2EYSA 3ARVA 1T66D 2NY3D 2D7OA 3V5HB 1S7QA 1RULH 3BKJH 2YK1H 3MNVA 1FYTE 3GIZH 1XR9A 4R2GD 3MROA 4P23A 4J4PA 4N0RA 4J8RA 1ZT1A 4D0BB 3BQUC 1QSFA 1LMKA 4HBCL 5IVOA 2YZ1A 4UINH 3RUGA 4X4YB 1F00I 3MR9B 1UWEH 3SY0A 4GRWE 5EU6E 3DRQB 2Z8VC 3RNQA 3KYMB 4U1NA 4OZHA 5SWZD 1KCRH 5HI3C 5FHBL 3RVUD 4RGOH 5J56B 2P1YA 3I75A 5EH1A 2P8LA 3U4AA 4NO5A 3STZB 3BT2H 3TNNA 4ELME 1U3HD 4R26H 3HPJB 1CFVH 5TF0A 4BZ1L 5C0FA 1CCZA 3CC5B 3D69B 4F58H 3EYVA 1TZIA 2FX7L 3AM8C 1JYVA 1FG2B 4GAYB 4F7TB 4A6YH 1EDQA 1QFHA 3QFDB 5IV2B 3CCHA 4OGXH 2R1XA 4BK4A 3UPRB 4I2XB 1KXQE 4JO4L 4GBXD 3TO2A 2FJFB 4L8SC 3U7AA 5IB2B 3MUJA 3B9DA 3C5JB 2MQ0A 4ZFOA 4HH8A 4JJ5B 1AR1C 1YZZA 5C9JB 1CDGA 1OP5H 7CGTA 4QF1B 2Y25A 4YHLL 1YEHL 3MLZH 4NHCL 1ZWIB 4IRSA 1P9MC 2IC2A 3QIWB 3TA3B 2DQIL 1F8TL 4G9DA 2AVGA 1UCTA 3ZE1E 2OTUA 3TT1L 2R9HD 5F8RC 3IDMB 4G5ZL 1GHFH 1D3CA 3GKZA 3S3JA 3JUYA 4AG4L 3W2DH 2YN3A 3VRLE 5HJ3B 1I7RB 4X8JA 3O9WB 3K7UA 5T5FL 1NCTA 2EKJA 3EDDA 4PJXF 1HHIA 5F1IA 3MRLA 4DVRH 3NCCB 4D9LL 3FMGH 4OLZH 3MODL 1UADC 1N2RA 2XA8H 5F7DB 1QO3B 3VXNA 5ITFB 3SDCC 2E9IA 2QKIB 5GJSH 5SWZE 3OJDA 4HIIA 2W0PA 1CL7I 2P7TB 3VDCA 3T0EC 1CXKA 2PF6A 4HEPG 5BRZA 3OV6A 3QUKB 3SE4C 3I3DA 2BY0A 2CRYA 4X7TA 4MNQD 4DEPB 3CVHA 4YDJB 3D0VB 4HX1A 1S7VA 2VLJA 3OR6B 5K9OA 3SJVD 4NNYB 2YUWA 4RFOH 4LP4A 4U6VL 1ACYL 3B2VL 3TBYA 3VU2A 2FX8H 2BOCB 3UTZA 4PR5A 4XH2A 4CJ1A 4ZDHB 1UWXH 3BMVA 5D71H 4F7MB 3MLPA 3VFWA 2H8PA 3JTTB 4ONOA 4TUKH 5ITBH 4XBEH 1C1EL 3CXDL 4YXHH 3RWJA 1CVSC 3H9YA 5M95B 5IJKC 3F8UB 1BJ8A 1DLFH 2CK0H 1J0JA 2WV3A 4JVUA 1S9KC 2FJGB 3P0VL 4P23D 4J4PD 8FABA 3SE3A 5GZND 4GG6F 2NMSA 1QSFD 3CU1A 4LSRL 4U6HA 2YXFA 2HLFD 4FG6D 3BZEB 5JNYB 3BPNC 4JPIA 5JO5A 5CZVH 1IJ9A 1GRWA 1FVEB 2CLVB 4KI5F 4C56B 4WTZG 5CCKL 3K0WA 1RUQH 1DBKH 3SKJH 1Y0LA 3QUMA 2NY4C 2HT2D 2VC2L 2A38A 3U30C 3G04A 4LLYB 5F7KC 4G3YH 4XCCL 1CFNB 4J6RL 5C0JA 2DKMA 2XY1A 5KANG 5LQBL 2GCYB 2UUDK 3C2AL 4LCCB 3MJ9L 4MA3A 1Q9WA 3N85L 4G6KL 2JE8A 4OF3A 5E4EC 5FYLD 2NX5E 3NN8B 4NC1E 4I18C 3UTTB 4MNQE 5J1SC 3DTXA 3NACL 1TMCB 3WNNA 3L5IA 1EO8H 4Q9RH 4GRMB 2JJWA 1ORQB 3SJVE 1FFQA 1OLLA 3DUSA 1UJ3C 5F21B 4H25B 5DO2C 1DQJA 1AIFB 5D2NB 5E6IA 5ESAA 4LARH 3QI9B 1RVFH 4JKMA 3H3KA 1II4E 4U1HB 2FGZA 4MA1B 5FF6B 4I0KA 4LVHC 1Q0XL 2FWOB 4YH6A 4OLXH 1BREA 2YBRB 3L3IA 1IC4L 2I5YH 2YMXH 5C0GB 2VTFA 4RDQF 3RUGF 1E27A 3FB6A 1AD0B 1MQKH 2IPTH 4FQXD 1MWAH 4Q6IC 1JWMA 3BN9C 5GXBB 4YDVB 1Q9KB 4JR9L 3MBXL 4ZTOL 5IFHH 3TWCL 2GIYA 1RMFL 4YFLI 2V7HB 3GM0A 1QSFE 2MCPL 3BWAA 3RWEA 4PTTB 2ZG2A 5LVEA 4LOUD 1MCIA 3S97C 4NKQB 2ICEB 4Z7NE 3EZ8A 3GSWA 4OZHE 4M5ZH 1OM3L 4UQ2A 1ZT7A 1QQDB 5IW1B 5GGVH 1OLZA 1UZ8A 4MQXD 1OCWL 2PR4L 2YD5A 3QA3A 4K8RD 1LEIA 1KPUB 2AXHA 3X12B 3QWRD 4K7FA 5J9PB 1SJHB 3NCJH 2MQ3A 2A6DA 5ICYA 1K4CB 3KYNA 3KPOB 4YHNB 1BBDH 1EPFA 3FFCB 4EZMA 1K4DB 2HT4C 5FYLE 2CIIB 4CMHC 5IMKB 2LABA 4P4RB 1JNHB 1H5BC 1LWRA 4KVNL 4NPYA 4G8GD 2YRLA 3QDJB 1IC5H 1MFCL 2CJUL 3DOSA 4NO0A 2R56H 5CGYD 2ATKA 4NDMB 5D96C 1DL7H 1YEGH 2D31A 4KV5E 4PV9A 4OGAD 3UTQA 4Y19A 4M7KH 5T1DH 3H7BA 2HT3D 4UMGA 3ZE0E 4GAJL 4KVCH 4QKXB 5GGTA 5JA9A 3BP4A 2AJ3A 3DURA 4I48B 4RGNB 4QRUA 2FIRT 4PRIB 5KTEL 1RFDH 4DVBA 1D6VH 5ID0A 3PNWB 4MAYA 5HD8C 5A1AA 5GHWL 5LXGL 4ZUSB 5FV2A 5HGDA 1YJDL 1Y18A 4MA8L 1KJ3L 3UTSB 4BA8A 4KK5D 3DO7B 4GXVH 1DVFD 2C3HA 1A6VH 3AAZA 4G8EA 4IM8A 3KPPB 1FZJA 1U58A 2NW3B 4YDKH 3IJHA 4JFDA 4WWID 5E6YA 3QO1B 4BSVA 4Z0XA 4M9OA 3PHSA 3K2UL 3VXPA 1S78D 4P5KA 5MP6H 5FCSH 3FJTA 4AENB 3CSYB 5FCUL 4P57A 1T7YA 3CD4A 3DBXA 4RIRB 3NPSB 4H26B 2H26A 3O3AB 1MRDH 4D9LH 4X9GA 1EZVX 1MJ8L 4FXLA 3MRNB 4G8GE 3TO4C 3WIHH 5CD5D 1YN6A 4UI2A 2GJ6E 5F7EH 2JCCB 1ZLUH 2PTTA 1UJTA 5E00A 2EDFA 1ZKAA 1KNOB 3VWJA 5LCVL 1Q9LB 4U1SA 1UCBH 4AM0A 3FN9A 2R69L 1GZQB 1XIWD 3T09A 3TEUA 2GY5A 1JUFB 4ZPVA 1XGTA 3MRQB 4EUPB 4HWZA 1YQVL 1UQSA 5KVDH 4HT1H 5IUSA 1QLFA 2BSRA 3WO4B 2R39A 5D72L 1TVBB 4IDJL 5L0QB 1MIML 4PP1C 3SGDI 1T4KA 1CG9B 2NXYC 5FO8A 1E4WH 1F3DJ 1QBLH 3L7EA 3PDGA 4QRPD 4HW6A 1H8NA 2MOVA 4DQOL 1FNSH 4CMMA 1NC4A 3H7LA 4DUVA 1CDYA 3V5HA 4RX4A 1AXTH 3OAUH 2LU3A 1T3FB 1I9EA 3RY4A 4YHOH 4JDVB 4J3VA 2V9RA 3S98A 2AJUH 3TVMB 2AK4D 2VAAA 4OF8A 2X40A 5EO1B 3HFML 5ANMB 4D0BA 3TPKA 4L3ED 4LCIL 1PX3A 4NO0D 5IMMA 5E0QA 4X4YA 3DETD 1C5BL 3MR9A 4IDLA 1A6UL 2Y07H 3KYMA 4NWUH 5LQBH 4Y19D 1X7QB 2ZKHH 3MRIB 4YZFF 4ORZC 4LK4A 5SX4I 3STZA 5E5MB 3F7PC 5A2FA 1T0NB 3HPJA 5CEXB 3WS3B 1KIPB 2AEPL 2V5TA 5C0NC 3CC5A 3D69A 4G7VL 5DC0A 5J06A 1FG2A 4F7TA 4MAYD 3FN0H 1QZ1A 5BV7H 5BQ7B 3DPBA 3QFDA 2V9TA 5IV2A 3N1QC 2DICA 4HK3N 3UPRA 3V4VH 4I2XA 4LEXH 3TCXA 4I0PC 3QDMB 2Y7QB 2VN7A 4FQ1L 4OLWH 1MCHA 3UEZA 5IB2A 4LVNB 1J1PH 3C5JA 1HCFX 3IRPX 1F42A 4F2MB 5C9JA 4QRPE 1FZMB 4TVPL 3SQBA 1ZWIA 2Q8BL 3PWUB 3QIWA 3TA3A 5JZ7D 2H2PC 3BUYB 5DUBB 2EDQA 3QAZC 1EV2E 3MRDB 4CW1B 3ZE2F 1UKQA 1CZ8H 1P53A 5C6WH 2HVJB 3SE8L 5CJBA 1N26A 3IDMA 4IHOB 1A7NL 2VDQL 3BSZL 3P4MB 3HI5H 5FA3B 1NANH 1RZKL 2AK4E 5IK3B 4HXAH 5HJ3A 1I7RA 4XZUA 3W5NA 3RIFF 1S5HB 3C5SB 4H88L 4L3EE 1OP3H 1BVLB 4P2OB 4JRYB 1JPSH 5C0CB 4ERSH 4M4PA 2YPVL 1FNAA 1OF2B 3VWJD 5F7DA 1QO3A 1P2CA 1WISA 5ITFA 1MAKA 1DP0A 2QKIA 3QJHB 1IILE 5I1EL 5SWSD 4HD9A 3AB0C 5IVXA 4Y19E 2V5YA 2EC9U 4YGVB 3QUKA 4WJ5B 2ADJA 3OKMA 5J6GA 5D1ZA 5GGUB 4TSAL 2A2QT 3GB7A 2NLJB 3D0VA 1KBGL 3VW3L 3OR6A 1JHTB 1JJUA 4MQ7B 4YE4H 2VXQL 3MCLH 4HG4J 1TJIH 4NNYA 2YPLD 1UZ6F 3E2HB 5TE7H 5B39G 5JW4R 3SO5A 2BOCA 4P46B 1HH6A 1AGBB 3MGAA 5D5MF 3K74B 4ZDHA 5DJDB 3FT3B 4F7MA 4KK8C 1DANT 3JTTA 4XCNB 5DD0H 3JZ7A 3ARGB 4KTYA 3K80A 5ID1B 5CSZB 4HQQH 4PRHB 3UBXG 1GC1H 2AABH 2FJGA 1EFXA 3JV6A 4YK4B 5BW7A 3QR2A 5C09B 4EI5B 1NMAH 3UAJC 4GW4B 4LGRB 4IMKC 5JNYA 5ABDE 4M5YL 3C87A 1B0RB 1UXSB 1B90A 5KZCB 5F9AC 1FVEA 4UT6L 1RURH 1BQUA 4JG0L 2I60H 2VUYA 1FBIH 2PNDA 2BNRB 3WLWC 1HHHA 1NCCL 4NFDA 1LO3L 3SO3B 5I71B 1CFNA 2GCYA 4KKBC 4GKSB 4YXKL 1UWGL 2A74A 4JREB 5SWSE 5D7SH 4LCCA 3UCRA 3HRZB 4DCQB 5CHNB 3TF7C 4JZOA 1NAKL 4XP1H 5IFJB 3EOBB 4OZGB 3B5GA 4YC2B 2DQJL 5I8CB 4J1UB 4AJ0A 3NN8A 4RMSA 3UTTA 4HS8L 4LRIA 3QCVH 2HTLD 2Y23A 5DQJA 4GRMA 1ORQA 1WT5C 3ZDXE 3VD5A 1KYOK 3WDIA 2YPLE 4H25A 1AIFA 2ESVE 5CEZL 1U0QA 2J8OA 4Z95H 1YECL 1WAAE 4U1HA 3TA3D 4LSTL 5FF6A 2FWOA 3FO1A 2F53B 4JPWH 1CD8A 2IAMB 2FGWL 1NAML 3RQ3A 4Q0XH 1AD0A 4YO0B 4HAGA 3QUYC 1R6VA 2D7TL 1HKFA 4YDVA 4HLJA 5D72H 2AEQL 3O9WD 1FN4B 2VXSL 5IHBA 4FQJL 5I6XC 1PGRB 2ZUQB 4X7DC 2P5EB 4L8CB 1A7OL 3MCKA 3G9VA 4JDTL 4N0UE 3IB4A 1LP9B 1UEMA 2ICEA 2D4DA 1ZGLP 4MXWL 1BQHG 1RZFH 3QEQB 3SDXB 4GRLC 4PJFF 5IW1A 4YGAB 3X13B 1G84A 4YDIL 3IFPB 3KDMB 4N5EC 4MCZB 2GITA 4ZSOB 4PJIB 3X12A 5J9PA 1SJHA 2VDOH 2QQLL 5FYJD 1K4CA 1NCWL 1FG9C 1EJ6A 2DJSA 1K4DA 2CIIA 2Q87A 2YC1B 5M7QA 1JNHA 3Q2CA 2APXA 2A77L 5FDYA 3QDJA 2VRAA 1BAFL 4NO3B 3LKNB 4PBXA 5EB9A 2VITB 3O4LB 2BOBB 1X5FA 1MEXL 4UTBH 5FUZL 4OCYL 5MI0B 3KYKL 3C6LB 1XGYL 4EKXA 1N8ZB 1B2WH 5FAAA 3U36A 3LDBB 3UC0L 3FZUC 2VDNH 3B9VA 4I48A 3VI4E 1A14L 4JQVA 3O6FC 1URLA 4JFXB 4KUCD 5C1MB 1OW0C 5JQHC 1B0WA 2VKWA 2B4CC 5DFTA 1W0YT 4UV4L 3PNWA 4C56D 3W5MA 1MI5B 3BOVA 5GRUH 5IVXF 1CTOA 4PLJC 3WNKA 4ZUSA 2EXYC 3P4LA 2QLVB 1FDLH 4PGZA 3UTSA 4U05A 5JA8B 3QIBC 1FVCB 3KPPA 2BERA 4FZ8L 1FORH 2NW3A 4HZAA 1D5IH 4JG1L 1IFHL 5EOTB 3LMJH 3UTTD 1G7MB 2ZOKB 2EXWD 2MPAH 4PPTA 32C2B 4GAGH 4B7LA 3CSYA 3PWVA 2IPUK 3PV6B 4A2LA 5FYJE 4JFZL 4RIRA 2XQBL 3MXWL 4H26A 5I1JH 2VXUH 4MHHI 3QI9D 3VFOB 3PABB 1FNLA 3MLRL 4XMLL 4APQD 4KTDL 3MRNA 4POUB 5KSVB 3GKWH 5KVGH 4LHUB 1AJ7H 2JCCA 2A6IA 5I1GH 4FXGB 5ACMA 1KNOA 4HWUA 1QBAA 5FO9A 5LWYL 1NJ9B 2NYYC 4FNLH 1KBGH 5SX5K 1HILB 5F6IC 2ENSA 5L8KB 1T80A 3S36H 1BZ9A 4I1NB 1JUFA 4J3TA 1GAFL 3FO2B 4EUPA 4U6YA 1MVUB 3B3IA 5DHVA 2DLFL 1B4JL 3NTCH 1TVBA 3CLFH 5ESVB 3GFUA 4OM1H 4X5WA 4GS7B 1IGYB 4C56E 2EIZB 3LKPB 3MV01 4M8QA 3ILQD 4P59H 4Y4FB 5CWSB 1K9TA 4PJBB 1WBYA 4KWUA 4ONHB 5B22A 4P48A 4XHQA 4CU6A 1UYWL 2OCFD 3GSQB 3KJ6L 1T3FA 4UAOB 3DJ9A 2IQ9H 4JPKL 3FKUS 2V7NB 4MSWA 3FFCD 3ZDZE 1PKOA 4HXBL 4JDVA 3UTTE 1ZHNB 4WI2A 3MACL 3TVMA 2BSSB 3PP4L 5GRVK 1VSCA 5IMOB 3B8YA 1Z9LA 3QDJD 4OGZA 2BY3A 1N64H 5DDHB 3RX7A 3UP1A 5D2NE 2DKUA 3DMMD 1SM3L 2I07A 3RVVD 1INDH 2L7JA 3MLXH 4LL9A 3RWFA 1X7QA 1FVDA 3MRIA 4JQXC 4AT6B 3KXFB 2EEAA 1NBQA 1T0NA 1MHPH 4RGND 3KPMA 1KIPA 3WS3A 3M07A 2CLZB 4PRID 1OAQL 4CN6A 1RHFA 4GKNA 3WUWB 4OB5H 2AJSL 3MZGB 1KJ2H 5BQ7A 3ARXA 2CDFB 1Z6JT 3UTSD 1BF2A 3BXNB 1F4AA 3A6BL 1MFEH 2J8HA 1IAII 2J8UB 5KVFL 1FP5A 2HMIC 3LN9A 1AC0A 4F2MA 1E4XL 1GOFA 3H3PL 5HYSG 1FZMA 3GJEA 1R3KB 3PWUA 1GOHA 1FZOB 3C09B 3BUYA 2EDKA 4KXZI 4LFHD 4Y16C 1MJUL 3DVFA 5DUBA 1IGIL 3OPZL 4MYWB 3MRDA 1A4KB 4CW1A 3QQNA 1OVZA 2HH0H 3WFZA 3DVGA 4DUWA 4IHOA 1JTTA 4NBYB 3SGKA 3FFCE 4OCLC 3P4MA 2IPUG 1PEWA 2I9LB 1U8IB 1JHLH 3MJ9A 2QHRL 3QDJE 2XN9D 4HIXL 3U4BL 2VERN 5HHMB 3C5SA 4Z7VA 3FQWA 4JRYA 2F5AL 3NH7H 4NM8H 5C0CA 4MS8C 3OGOE 2XTLA 1TJHL 3QJHA 3UYPA 3CFDA 3RNKB 5D7KD 1YA5A 3MLVH 5TPWH 5I66B 4RBPK 4GT7A 1EMTL 4YGVA 3SDAC 2V17H 1E4JA 2R2HB 1BX2A 3N0PB 3QQ9D 2OR9L 4I3SL 2HG5B 5GGUA 3UDWC 43C9A 2F8VA 1CL7H 4PRIE 4WUKH 3VXRD 5CJXA 4MQ7A 1N6QH 5D7JB 1NAMB 1NMCB 3UTPD 3AROA 2QV2A 1VERA 4R3SB 3ARBB 3S4SB 1AGBA 3MV7A 4HWBL 3SKMB 3UTSE 1OB1B 3EOTL 2VDKH 1KN2L 1YEIL 2BCKA 5F71A 5ILTH 4HC1A 1DTUA 4XCNA 3WKNA 4POYA 4QXGH 1ADQH 1C5CH 3ARGA 5ID1A 1CD1B 1AE6H 1VESA 5BS0D 5CSZA 3VXMD 4ZQKB 2FSEB 4PRHA 4M02A 4NP4L 1J10A 5EORH 3TVMD 3WXWH 5C0BA 1CDUA 1KCSH 4J23A 3VFTB 1EK3A 3QEGL 3MJ8B 4HUUA 5C09A 4Z7UB 5EUKB 3CMOL 3OZ9H 3RU8H 4EI5A 2QL1A 1RUKL 3ULUD 4GW4A 5JIPA 1TTUA 2JCCF 5TE4H 5IB5B 1S7WB 1B0RA 1UXSA 2EDBA 2BVUA 1YYML 3FT2B 1BHGA 4RGMC 2DN7A 5T3ZD 1YY9D 1CXEA 2DQTL 2DQEL 5INCB 3OKKB 2DWEB 1INEH 2XN9E 2BNRA 4OFVA 1E4KA 5F7UA 3TJHC 3PV7A 1A7PL 2HFFA 1QRND 4K3EH 1NH6A 3T4AA 1CQKA 4PYHA 5ESQB 4GKSA 4N1EA 5EBGA 4DCQA 3HRZA 5D7KE 5CHNA 5C3TA 2Q86B 5IFJA 1IM9A 3G6JB 5I8CA 3RHWF 4J1UA 5L88L 4FQ2L 1HKLL 5F8QC 4JQIH 3QDMD 3ES6B 3VXRE 3ISWA 4G43B 4G8FB 4HUKB 1DN2A 3TP4A 4HUVB 4KY1L 4EDWH 2R0WL 1NSNL 4QRQA 5IGXH 4XVUC 4HH9A 4WI3A 4FFZL 3HC3H 1TQBC 5IT2L 2ZUYA 3CFKB 2IAMA 3IAGC 3I6GA 3VG9C 4LLWB 4P5TB 1DQQB 1CDHA 3QG6B 3BD5A 5JMRA 5BS0E 4HZLB 3LEYL 3VXME 1AI1L 4NZRH 4LVOC 4YO0A 4LIQL 1FL6A 2NTFA 5BOPA 2BFVH 5ANME 1FN4A 2XXCB 1JWSB 5AZ2H 1J88A 3ULUE 1NDGA 2P5EA 4P2OD 4L8CA 4KAQH 5C0CD 3GEWB 1CE6A 3L3HB 1LP9A 3O6ML 1S8DB 4LPUA 1I1CA 3EDEA 4M6NL 4PJEA 3SDXA 1VADB 2N4IA 4JFOB 5T3ZE 3X13A 1A6WL 4L8SB 5EZIH 3DSFL 1BQSA 3FRPG 4Y5VA 2IBGA 3IFPA 4MX7B 2F5BH 1LD9B 4K9EC 5H94A 1QRNE 4XPHL 4MCZA 1G6RH 4O5LL 4ZSOA 4PJIA 1HQRB 2ICWB 3LPWA 3P73B 4H8WC 4PRBB 3L6FA 3QQ4A 2F74B 5ADPL 2EDTA 1TNMA 5EU3A 4P46D 2UWEB 3QJFB 1QSED 1DBML 3D0LB 3QDME 3QZWB 1ONQA 4NO3A 5DD3L 3LKNA 2VITA 2BOBA 3ARGD 1K85A 3CUPB 2AKRB 1BD2D 4KUZL 3EJYC 1QNZL 4ZXBA 2WW8A 2DI8A 4PRHD 1SQ2N 1VFBA 1I1RA 1GGBH 2VUOA 5ICZA 1FGVH 3R8BB 4LSPH 5C09D 2SEBB 3EOAA 4BQ8A 2X44D 3IDXL 4Z7VF 2OL3L 4OZFA 4Z8FH 3BKCH 4XNUL 1A9BB 4JFXA 4JCMA 4LBEB 4WI8A 5KZCD 2YEZB 2XYCA 4RRPA 1T66C 3V0AC 2NY3C 1S9XA 1ZXQA 2VQ1B 2AJXH 4FQIL 4YUEL 2IANB 2X89A 3S3SA 4JZJB 4KQ3H 5I76A 5F6HJ 4PP2B 5C0CE 1PKQA 2W59A 4Y4HB 2VNCA 2E6PA 4R2GC 4FZEL 4S1RH 4NQTA 3BISA 5TDPB 5EWIL 1KYOJ 3JWOL 3RBGA 4TVSa 3GSVA 1G7MA 2DMKA 3RZCB 1P7HL 5B38B 4Y1AD 32C2A 5DA0B 4EJ1C 4TTGA 3NIGF 3RVUC 1G6VK 3VG0H 1AR2A 1U3HC 4O9HL 2NY6B 2E9WA 3VFOA 1J1OH 3VMOA 2VB5A 4UOJA 1QSEE 4JO2L 5I2IB 5T33L 2F53D 1HZHH 5KSVA 2IAMD 4ODHL 2O26U 2UUDH 3GSNH 5FM4A 4FQCL 3EHBD 3LEVL 4UOW1 5JIKA 1BD2E 5D7LA 1IAOB 2F9BT 5JOFB 4PRHE 5E08L 4ODVL 5F1NB 2EYRB 2VR5A 1NUGA 4GBXC 3RL1A 5BJTB 1TPXC 1NLBH 4KRMB 4LQFH 5EA0L 1A1OA 5C09E 4J3SA 4BYHA 3DYPA 5DJAA 3FO2A 2P5ED 3Q6FB 3IDUA 1A6ZB 1MVUA 3SKOB 4NOBA 4KZEL 5IB4B 2X4OB 5ESVA 3P9LB 4DJMA 5CSGA 1IGYA 3QEQD 3VGAB 1A2YB 1TVHB 3LKPA 2R9HC 4FQLH 5CWSA 4Y4FA 3T8XB 4PJBA 1DBBH 1EJOL 4ONHA 3SGDH 2DQFA 3ALWA 4Y4KB 2DF3A 3GSQA 1A7QH 1N5YH 5D70H 5F70A 3BW9A 1T1ZB 1A7RH 4XTRD 5I0ZA 6CGTA 4OZGE 2E7LC 4PJAE 4X0KB 3MREB 3U46A 2J12B 3T1FB 3U4EB 1YEFL 4LDOB 4YWGL 4Y1AE 3T2PA 3KNBB 1RV6X 3U1SL 1U8LA 1JPGB 3SEPA 3O4LD 1SY6H 5DDHA 2EE2A 3OX8B 3RPKA 3ARZA 5TE6H 4NC1C 1JHKL 5HYJB 3LHPL 4PRDB 2GSIA 1U2HA 4XP9H 3MTRA 3ZO0A 4HJJL 2DQCH 3C6LD 3N1GC 2F53E 1MHEB 4ZO9A 3KXFA 4JFFE 3V7AE 5IQ9B 1NFKA 1YPZB 4M1DH 4NQSB 2Z31B 1CK0H 5SX4H 5EU5B 1LP9F 3I84A 1S7SB 3WDHA 1XR8B 4JPVL 3WFCL 1MI5D 4PJEF 3SDXF 2D0GA 3LEXB 2GYSA 2CDFA 4XPGL 2MWCA 2X89D 3S36X 4NUGL 1S9YB 2P5EE 1U8OB 1U91A 2J8UA 1TXKA 2W9LA 4P23C 1EO7A 4J4PC 4PJIF 4UILL 3QEQE 5GZNC 2R1WA 3BESR 4KMQA 3EYSH 3O8XB 4OJFL 5T3XH 3SQOH 3B9AA 2HLFC 4FG6C 3GI8H 1NGXB 4WW2B 3VMPA 1R3KA 4XGZB 1LO5B 1FZOA 3F7VA 2GI7A 2GUOB 2QADB 3WHXA 1A21A 1A4KA 3HR5A 3QULB 2HT2C 4JY5H 1Z9OA 4P9ML 3F58H 3M8OL 4RFEB 4K23L 1FLRH 4HUNB 4RMQA 1OPGH 2C1PB 3WS6C 2AERT 3E1F1 2R23A 4FS0A 4LHUD 3O4LE 4OI9A 5EFIB 4H0HB 1U8PB 2ZJSL 3LOWA 3RNKA 5I66A 1IL1B 1TVDA 3LQZB 4OLYH 5I1HH 1P4BL 4OCRH 5F9WC 4F7CB 4ETYA 2WLYA 3E8UL 2C5DC 1SJEB 2P8MB 1DEDA 4NRZB 3CFJB 5D7JA 1UG9A 2OR8A 1NAMA 4QNPE 1MI5E 2D0HA 4R3SA 4DK3A 5F3BB 1ZS8B 3C60B 3ARTA 3ARBA 4S2SB 3S4SA 4HS6B 3SKMA 4K94C 3ZTJG 1OB1A 1YEKL 4YBQD 4FQXC 5E8PB 2IG2H 4PJHB 3VXUB 1TETH 2KQNA 1ROWA 1CD1A 4E41D 1T03H 4ZQKA 2FSEA 1QFWI 4FP8H 3VFMB 1FIGL 1OAUH 4LOUC 2E7CA 1NFDB 3VFTA 3I3BA 4Z7OE 1X6LA 3MJ8A 1FH5L 4N5UA 4Z7UA 4Q9QH 4B5EA 4GKOA 5D7IB 3HE7B 5BXFA 5IB5A 1DUYB 3GJFB 4MQXC 1S7WA 4RNRB 5I30L 4K8RC 2P44B 3TESA 4ZOBA 1SBBA 2AXFB 3KXFD 5INCA 2DWEA 1F2QA 4N0YH 3GHEH 1A4JB 4AQOA 3D9AL 3KPRB 35C8L 1N0LA 3BGFB 4P3CH 1EGJH 4WHYH 1X5XA 4AMKL 4AQ1B 1XCTB 3GMLB 5ESQA 1V7NH 3TBWB 4JHAL 2IADB 4X98A 2O93L 5BVPH 3PE9A 1L4IA 2Q86A 4MJ4A 3BP6B 3PIQB 1D7FA 2JF1A 3G6JA 4M6ML 5CGYC 5AAMA 3N1MC 4PJBF 4JEGB 4JFEB 3UJTL 1MIEL 4MXVE 3ROOB 3ES6A 1K5NB 1EVTC 1PQZB 3WNMA 1KLGB 3VXQB 4OGAC 4G43A 1WZMA 4HUVA 2HT3C 3U0TB 1IKFL 5KW9L 4GG8B 5E7BA 5GRXG 1MFNA 4KJPD 1OTTC 3CFKA 5B3NA 3VFVB 1W0VB 2P8PB 3L5WB 1BFOB 1ODAA 3O2DL 1DQQA 3QG6A 3GSXB 3GRWH 4IOFD 4JM4L 4KJWD 4E41E 5JUEL 4HZLA 3WFHA 1RZJC 2OQJA 4LHJB 4KK5C 1M4KA 3O2VH 3CDFA 4LSSH 4LLAA 4O00A 1DVFC 4LSQH 1CT8B 3O2WH 1MHHB 1JWSA 1TCRB 3L5XL 5HHMD 3AM8A 3SPVB 4RMUA 3VD9A 1EAPA 4QXUH 4V1DB 1Q72L 4XP6H 4KTEL 2G5RA 4NRXB 1S78C 3L3HA 1PLGH 1JRHI 1V8HA 2RQ8A 1S8DA 3C6SB 2IH3A 1VADA 4JFOA 2GT9A 2MHAB 5JIIA 2J3SA 1KB5H 4L8SA 3KPLB 1HOCA 4UBDD 1F6LL 2D9QB 5F7LB 4MX7A 1LD9A 1T0MB 4E42B 5EN2B 6FABH 4I5BA 1NMBH 2J8UF 1D5MB 1HQRA 5D7JD 3T77B 2DKSA 3TV3L 5CD5C 3LAFA 2F74A 1P9MA 2W9EH 4S1QH 1RJYB 5DTFB 1I1AB 4YBHA 1JPTH 1E28B 2UWEA 3ARBD 3NCYS 4O58H 2DIAA 2IPKA 1R3HB 5E2TH 1JHKH 1P7KB 3D0LA 1J0IA 3WBDA 5DJZB 3RWIB 3THML 2VZ1A 3QZWA 4OQTH 4FABL 2JJUA 2WWKT 3MLYH 1UXWB 3TCLB 1CF8H 1U6AH 1XIWC 4YNYA 3BX7C 2AKRA 4YJZL 3B43A 4XWGH 5AAWA 2P45B 1IGCL 5JHLL 2XY2A 4CN1A 1ZANH 3OKLB 4TULL 5E94A 1I3RB 4F80A 2GKIA 1BBJB 2FR4A 1F5WA 1VEPA 3EW3B 5J13B 1U8JA 4ZFGH 1B6UA 4RFNB 2YKLL 1ZLVK 1EEYB 3RIFK 1A9BA 1RZ7H 4LBEA 1FFPB 1QYGH 3SE4A 1WFUA 3UXFA 4XI5D 3S5LG 3N06B 3F65A 4DGYH 4PGBB 2OK0L 2DJ4A 1T21B 4YHIB 4XAWH 1GSMA 4PP2A 3R1GH 2X9WA 4W6WB 3D2UA 1MHCA 1JWUB 1RJZB 3RBSA 3KPSB 2W91A 3R06B 5TDPA 2FEEL 2WP3T 4LQ1A 1WICA 1FJ1A 3DETC 2F54B 2ENYA 4JY4B 3QXWA 4C59B 5IJKA 1LO2L 5B38A 5DFVD 1VB9A 4L9DA 5HVHC 3S35H 5DK0B 3IJSB 3QFJB 2EDYA 1QR4A 4TSBL 3HNVH 2XXMB 4HV8B 4EN3B 4NO2B 5I2IA 5GSVB 4MAYC 3I9GH 4YFEA 1AY1H 4CGTA 4P5TD 5IEHB 4PYGA 5C0RL 1U8HB 3RDTD 5JOFA 5F1NA 5IHZB 4FFWD 1F11A 5BJTA 2V5RA 3WUZA 2CRZA 4TSCL 2F8OA 4PG2C 3V79C 1U3JA 4X80L 4Z7UE 4W4OC 1I8IB 3IDYC 5IQ7H 1XGPB 4BZ2H 1F90L 2VWEC 5GJTH 4GUPB 5KVEL 3Q6FA 3KR3H 5DJXA 1A6ZA 1BJMA 3QDAA 1XZ0B 4RAUA 3SKOA 1A6AB 1U8KB 4PJDF 5IB4A 1X4XA 2X4OA 5JZ7C 4RCAA 2DD8L 3V4UL 3ARDB 4I18A 1WEJL 4LRNL 1R5VB 4NZUL 1TQCC 5BVJA 1A2YA 5D2LB 4EOWH 1GGIH 2FX9L 3G6JF 4M43L 3VXOB 2R0KL 4OT1L 1KJMB 2FYYB 1CD9B 3L3DB 5H35A 2I27N 1UJ3A 3HMXL 3ZHDA 4H1LA 3KLHD 3ET9F 5AWNL 4NIKB 2VLRA 1LE5B 1PJ9A 4F15B 4U1JA 3QXVA 2ZZUT 4OLUL 4X0KA 3MREA 4NYLB 1GGCL 4U3XA 3VWJC 1W2KT 1DANU 1LO0L 2LU4A 1M05B 1KN4H 1X5JA 5A2IH 2QSCL 1IGTB 1JPGA 4W68A 5FGBC 3OX8A 4F7PB 5EOQL 5EBMB 4AZ8A 3AY4A 4OGYH 5I6XB 4NBZB 1Y6NR 1MHEA 3OF6D 5I1AA 4NQSA 4HWBA 2L4OA 2Z31A 3UX9B 2B4CH 4P5MB 4NQVB 1AQKL 2D0FA 4Z18A 4O2EB 4AIZB 1XR8A 4A2MA 4ISVB 4K7PH 2X70B 3LEXA 2IAND 3LPGA 1SBSL 1S9YA 3QUZB 2BC4B 3HZKB 3C2SA 4Y4HD 3FOMB 1U8OA 3JWDH 1MJ7H 4LSUH 5HVFB 1G9MC 4DGVH 3O8XA 4NN5C 1FRGL 3FAWA 3T4YB 1IAIH 1PFCA 2VDMH 2UWEF 3IFNH 3RZCD 1NGXA 5HGHB 4HKBB 1LO5A 2GUOA 5A3ID 3MJGX 3QPXH 2QQQA 1AHWC 1YNKL 3X14A 1WGOA 4QHLA 2NY6D 2CXGA 4CDGC 1WZ1L 2JTDA 4LDLB 4X8XA 4RFEA 1GOGA 1V7ML 3BKMH 3ULVH 1YEJL 1CXFA 2F58H 2OI9B 4NQXB 1CLZH 2C1PA 4PJ7E 5CINH 4M48H 4WRLA 5GS0C 3D18B 4TQEH 3HE6D 2C4FU 1WIOA 5EFIA 3LQAH 2BVYA 3R0NA 1DLHB 5H2BB 3H42L 4X5XB 2HTLC 4OFDA 1U8PA 1T6VN 5EO9B 3LQZA 4K3DL 4M93B 2P24B 3H9HA 4F7CA 4ORGB 2Z9TA 4IRZH 2C26A 3DV4B 1SJEA 5HPMA 5IHLB 4H20L 4K2UH 3TA3C 3THMH 3WNOA 5EOCJ 3CFJA 3H6JA 4ALAL 2BNQB 3WCYA 3KPTA 5F3BA 2IANE 1ZS8A 3ZHLA 4HS6A 1W0WB 1KCUH 4PY8I 1OP5K 4ZOCA 4M7JH 4Y4KD 4PJHA 1S7XB 3BYTA 4Y0GA 4OQ1A 3O9WC 5SX5H 3WSQL 1SMAA 2NQCA 12E8H 1ZE3C 3FQXA 4W81A 3VGDA 2ATPB 5I18H 3VFMA 3LRHA 4AIOA 4NNPL 2UZXB 1FFOB 5DUML 2RR3A 1NFDA 4HIHB 5D4QA 5MEOB 4ONFL 1T20A 3PGFL 3BHBB 3QNYB 3HE7A 4WFGD 4DZ8B 5F6IB 2XG5A 1DUYA 4DEPC 3GJFA 5HYJD 5KG9B 2ZSVB 3WLBA 4RNRA 5CEYB 4NNXA 5E8OA 4X6FB 4WI7A 1D5XB 2AXFA 2EKSB 1I8LA 3W11D 1A4JA 1MRCH 3BYYA 4QYOB 2Z31D 5DYOA 1CBVH 1AD9A 1XCTA 4KGJA 1WSST 2IADA 5ERWB 3F5WB 3BP6A 3PIQA 3V6BR 5LG1A 1HYRC 5J6HA 5F6HI 4JFEA 3TBTB 2MFNA 5D1XB 2EECA 3MRKB 3TIEB 1U8NB 3ROOA 1X4ZA 1K5NA 1PQZA 3H9ZA 3HB3D 1KLGA 3VXQA 1B3JA 1MY7A 4R0LC 2B1HL 3O8XD 5CLTA 5E95B 3U0TA 4C57C 4GKZB 1OWRM 2OTWB 3CXHJ 2PO6B 1MFAL 1BVKB 1I1FA 4YHYB 2QADD 4UDTB 2FEDD 3NZHL 4XCEB 3L5WA 1BFOA 2DM2A 2R0ZH 3EYUL 5HDQL 3GSXA 3NIFE 1EERB 4NQDB 4C58B 1S5IL 3W39B 4G6AD 1MCOL 2YRPA 3HC4H 4N8PA 4LCCC 1G7HA 1TCRA 5MEQB 2RIKA 3ARWA 3SPVA 4KMTH 4WFGE 3MQIA 4V1DA 3EYQD 4HAFA 5HYJE 4LRIC 4XC1H 4XVSL 3E0GA 2EXWC 4E0RB 2DQUL 3C6SA 43CAB 2MHAA 3X11B 4N8CL 1U92B 3BMWA 5D2NC 1YPZE 3GMPB 3MLWH 4WGVB 2W38A 3C9NB 3QI9C 1NCAH 1QFUL 1T0MA 1UVQB 4E42A 4MA1C 5EN2A 4APQC 3AFLA 2XG4A 3BH8B 1OAXL 3JV4B 2VXTH 2VDPH 1RJYA 5DTFA 1I1AA 2ERJB 4F3FB 3C60D 1QLEH 1XGRA 1R3HA 1P7KA 2YPKB 5DJZA 3RWIA 4OAWA 4HPOH 1N7ML 4LPYA 3TCLA 3VXUD 5C7XH 4U3CA 3RTQB 1F58L 1Z3GH 3V8OA 2CPCA 2CUMA 3BH9B 2XT1B 5TQ0L 5GGRB 3RWDB 4JRXB 3REVB 5IG7B 3OKLA 1UM4H 3VRJB 1AQKH 4G6MH 3GNML 5DMGD 9CGTA 4KZDH 5TQ2H 4RISH 3HE7D 3BAEH 3V9FA 1P7QA 1NCNA 3ILQC 2HFGH 1EEYA 5I8OH 2WIIB 4ZNCD 2AQ3A 4DKFL 4UT7H 1FFPA 4BQBA 1SEBA 1F4XH 1WK0A 1AGFB 1T21A 3KPRD 4YHIA 3MOQA 3TYGH 3DARA 1JGUL 4OCSL 1JWUA 1RJZA 1OGAB 3KPSA 3D6GA 1I3GH 5J0BA 2R2EB 3V52H 4U0QB 3DMMC 4X4XA 2AS5M 3RVVC 4NM4H 5EIIB 4KH2A 4PJHF 2R4SL 4RMWA 2AW2A 1RIUL 2LQRA 4KFZC 1KIRA 4XMKL 5KSBA 4RGNC 5DK0A 3IJSA 3QFJA 1CR9L 5DXWA 4PGDB 1BZQK 1CGVA 4NT6B 4IMKA 1NFDF 3AXLB 3H42H 4HV8A 4NO2A 4EN3A 1IRAY 5AEAA 3CDYA 3VXUE 2HLAB 1MCDA 1NCUA 5IEHA 4XHJD 1U8HA 1HDMB 2R8SH 1X6NA 1CE1H 3MOBL 5HGAB 2VZOA 4MVBD 3NGBB 4WY7H 2HFTA 3EDKA 2WUBL 5D6CA 1XGPA 4YQXH 1JTPA 3MC0A 5D7IE 5DFWH 4GUPA 2BRRH 3MGOB 4V1DD 4OD3H 3GBNL 1ZVSB 1XZ0A 4J3OC 1A6AA 3EDJA 5I1IL 1U8KA 3PWPB 1J8HD 4X7EC 5JW4N 1R5VA 5FYLL 5LGHL 1W72L 1VGEH 5D2LA 4XCYB 1P1ZA 2XTJB 1Z5LB 1A02N 3NPSC 4K9EH 3VXOA 1HYSD 3KPRE 1YUHB 1WT5A 1KJMA 2FYYA 2Y06L 3L3DA 2BNUA 3RHWK 5C0EB 4NKMB 5HGGS 5TH2B 3P2TA 4H8WH 1IQWL 1BJ1H 1AGEB 4NGHH 1LE5A 1P4IL 4EIGB 2FATL 1A0QL 1I1AD 2OS7A 4ZS6D 4MA7H 3P0YL 3V0WH 2G60L 2V2TB 3L1OH 1L7IH 4JB9H 3Q5YA 2XQYK 1M05A 1M7IB 1I9IL 1IGTA 4MDIA 5CLWA 5IF0B 4AEIH 5AYQA 4K94L 3QUYA 4F7PA 1QR1B 5EBMA 5IKCA 3QQ9C 2AP2A 3S35X 3WO4C 5DRNB 5L0QC 1FYTB 1H3PL 2J4WH 1Q0YL 1NGPH 4R9HA 1A3LH 2PW1B 4B41A 4JANB 3RX5A 4P5MA 3TN0B 1EXUB 4OBRA 3FO9B 4Y2DB 4BUGA 5IB1A 1J18A 4O2EA 3QXDB 4BFEA 2PTUA 2WLZA 3W82A 4WCYL 5JQ6H 4BSWA 4GRWB 5DJ8B 3QHFL 4ISVA 2X70A 5L6YH 2R1YB 3QUZA 2ZPKL 2BC4A 4NWTL 5DGQA 3SKNB 3HZKA 3D3VA 4ELMB 3FOMA 3TVMC 2LTQC 5EDXA 4WV1B 1J8HE 4MMXC 1MPAH 3F7YA 3ULUC 5F9OL 2P42B 4QTIH 4DKDC 4PJ5B 2X4QA 4QOKB 2F54D 3DRTB 1NLDL 2Z91B 5FGSA 4HKBA 1NGQH 4RQQA 5JW4Q 3FB8B 4YHKH 3V7MA 4U2YA 5AYUL 3HZVB 1HINL 1LDPH 2B0SH 3WFDH 1YY9C 1JZ4A 1EEQA 1AO7E 2R29H 3QFJD 3MV8A 4PB0H 3QCUH 1L7TL 4NQXA 4EN3D 4XP4L 2JELH 3ZYZA 2DQUH 3V6FB 3D18A 3V5KA 4GQPH 1OW0A 3BDYH 5IFAH 4OUUB 3SHSA 3WIIL 3LRSA 1T89A 1DLHA 2NY3B 2P46B 3PXHA 3WL9B 1R3JA 2X5PA 5H2BA 5I9QB 4X5XA 4ELKB 5C8JB 4FXKA 5HHVL 4UU9B 4LVNC 5EO9A 1CGUA 3QIBA 5E24E 2P24A 1GXEA 1OHQA 1OY3B 4R2GB 1G9NL 4ORGA 2YS4A 1XF5B 4DW2L 4D3CL 3DV4A 5F1OB 3BPLB 1KF9B 4HIJB 3ARDD 3O6LH 2DDQL 5FUOH 4C83B 3O2DA 1I1YB 5GRYA 4JN2B 3BVNB 5EZOL 3IDJB 2J88H 1C12B 1LEGB 2D03L 4K7PX 1ZHBB