1UYWL

Crystal structure of the antiflavivirus fab4g2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Crystal Structure of the Antiflavivirus Fab4G2
rcsb
total genus 52
structure length 212
sequence length 212
chains with identical sequence N
ec nomenclature
pdb deposition date 2004-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uywL01
1WFTA 5EFIB 3TA3A 4JFQB 4UDTB 1H8NA 3RWIA 4G6KH 3TO4B 1BEYL 1E27A 4JFED 5EOTB 4CMHC 3MBXL 1Z0NA 4LRIC 1BFVL 3HE7C 4F15C 2YK1L 3PDOA 1HH6B 4PBWD 5DQDH 2D03H 4G8IA 1OD7A 4GAYB 5GS1A 5T1LD 4Y4FC 3MRFB 3P11L 5TGBA 1TVBB 5HHNB 2E7MA 4W68A 2FJFB 1B88A 1J88A 4NN5C 3QFJD 3QXWA 2GK0A 5I1EH 3ALXA 3QI9D 1JN6B 1QSEA 3MLXL 1N64L 4H1LA 1BLNB 3GFUA 1S9YB 4UV4H 1F02I 3FO2B 3IKCB 2I9LA 3HRZA 3K4DA 1W0VA 4GRWE 3SY0A 1T66C 4ONHB 5HHOE 3LEVL 4WVRA 4PJIF 1A14L 3I3EA 3L3GA 1UZ8A 3PHOA 5HXMA 5C0CA 5TDPA 1KUMA 2Z4QA 1T04A 3PNWA 4ORGB 1HYSD 3GNMH 3HMXL 2KZWA 3HAEB 1D5MB 1ZANL 1FO0A 4BFBD 3LKRA 4R90L 2IAMA 2HJLB 4AM0B 5D72L 3KXFA 4RGNC 3ZKXC 3CH1B 4M4PA 1S7XB 3RVXD 3WUWB 1EAJA 5HYJE 2CRZA 3EDKA 2YD8A 1IAOA 1TQBC 2NY3D 3OB0K 2XOTA 2AW2A 3U79A 3W0WB 4DUVA 3DX6A 3MODL 4B7IA 1MQ8A 5D1ZA 2BOBB 2BY3A 1IT9H 2YEZA 3TWCH 2VDLL 2RCSL 5LCVL 3WIFA 1LMKA 2OK0H 3WN5C 3WNKA 2B39A 3AY4A 3QIWB 1UB6A 3JTSB 1WCQA 4HF5L 2K9UA 3CDGA 4G9FE 5HVHB 3EOYG 4KK6D 4L4TD 4POZD 5CZXD 3VWJB 4MX7B 1RD6A 4KZEH 4NRXB 2QHRL 5ADOL 2LTQB 1IC4H 1F4AA 3GDBA 5HYSA 5H2BA 1L9NA 5JPMB 2WZPD 4ZOBA 5C0AA 2IBZX 4Y2DB 2DQDL 3MZTA 1N4XL 5CUSL 1NLDL 1UKTA 4DAGL 3MRBB 4PGEB 3KWWA 4MAYA 4FS0A 5EU6D 4BUGA 3IJSA 3HKFA 1DQJA 4NQUA 4JQVC 2OM5A 3ULVL 2W9DL 3NACH 1ADQA 1T89A 2XRAH 2DQGL 4RISH 5F6HI 2Z8VC 3UX9B 4BZ2L 3A6BH 1P7QB 4QRUA 1F45A 2EDHA 2DM3A 2IALA 2P44B 2VZSA 1BECA 1BVZA 4NC1C 1D5ZB 4JANB 4KTYA 3WS6A 4IDJL 1ZLSH 1ACZA 4RMUA 1S5IL 3T3MF 3QUYC 1T1XA 5BXFB 4NKOB 1CFBA 1QPXA 4Y5YB 2XFXB 2IFGA 4EI6A 4X4YA 3LZFH 4K94H 2BHYA 3GSNB 3NGBB 1P4BH 3BP5B 4YBHA 3OKLB 1PFCA 2R2BB 2CIKB 5DMIH 5C08D 2H9GB 5MP6L 5KSUA 1EEUA 2N56A 3L9RA 1UB5A 2HVJA 4EDXA 2JJTA 1J0HA 1CICA 5D1XD 1DVFD 4O2FB 4L9LC 3B5TA 2FJHB 4K7FB 5CMAB 4AZ8A 1S3KH 2ZCLH 5I1JH 2QQLH 4GUPB 5ISZA 5I18H 3BKJH 4C58B 4GKZA 5F44A 4YHML 4RBPH 2NY4D 3P0YH 3I75A 1Z2KA 2A6JA 4RGOL 5GGTH 2A1WH 1MFEL 2E7HA 1DFBH 4X9IA 5IKCB 2APFA 5DJXB 1X5HA 3MLTA 1WFUA 1NPUA 1RJZB 2VWEE 2DIBA 3BRFA 2VZ3A 4G7YL 4WHYG 1F00I 2V9QA 3MCLL 1R3KA 1H8SA 1FNEB 3MA9H 1KJ2H 2JJUA 4IRSA 3HTLX 2OTUB 4LLDB 1H3PH 1DE4A 3B4NA 1HEZA 2QL1A 3L3HA 4Y5XC 5I8EA 1CS6A 3ZHLA 3MX0A 3LKOA 3OGCB 1AHWC 3QISA 5AZ2L 4JGUA 4OB5L 1AO7A 4UV7H 1N6QL 2FDBP 4KTDL 5HJ3A 1EVTC 1HXYA 1IEAB 1RUAH 3AUVA 4XBEL 1HZHL 3H3PL 2CXKA 1OAYH 5KVEL 1BBDL 4Z6AT 4ZYKA 3CLEL 3CMOL 4GW4B 3V6BR 3ESVF 3F7YB 2F5AL 3BGFB 4XHJD 3U7YL 2R56H 1FVEB 3CXDH 1U3ZA 1DBBL 3I85A 1TTUA 3CSBA 5CEYB 1H0DA 5A16A 3RNKB 4QTHB 5JW4R 1UWGH 3VFTA 3SDCD 1QG3A 5BS0A 2PR4L 2R2EB 1CGYA 4YXKL 1CK0L 5HD8D 2ADJA 2MQCA 1BQLL 2Q76A 2AK4A 4IHOA 2C1PB 3BWAA 4HIIA 2NXYB 3FQUB 1GGIL 3EAKA 3U7WL 1TZGH 3U0PA 3KGRA 2YA1A 1MEXL 1YEDB 3WN5A 2FNBA 1ZK9A 2HKHH 3ZL4H 3O8XC 2CH8A 4W4NA 4U1SA 3K7UA 3STLA 5FAAA 1CVRA 4G9DA 5GRUH 3RUGE 3FO0L 5E8EA 4QRQB 1IZKA 5I1KL 2M8XA 4UU9A 4O02L 4EI5B 3NZHL 1QR4A 4YBLB 1SYVB 5MENE 3E8UH 1OP3K 5EZOL 2J4WH 5EUOE 2CGRH 5F70A 1F3DJ 5GRYA 3BIKB 3W11C 2HWZL 4XP4H 4PGDA 5KN5A 2Z93A 4JZJC 5SWZD 3QG6B 3SGKC 3ILPB 3KPLA 3BPCA 3T4YA 4D8PB 2GJ6B 2F74B 4OD1H 2Z91B 1ZWIA 1CL7L 5CP7A 4YGAB 1BQSA 3O81A 5IHUH 5ICYB 5BV7B 3BT2L 3U2SB 3O6MH 1LK2B 1ZT7B 4HWZB 2P5WD 4OZFA 3WO4B 3HUJB 1UKSA 4N8CL 4P4RA 2W38A 4HGKC 5DMGC 2J5LB 3MJ9L 2UUDK 1NKOA 1SJHA 1SY6L 5IF0A 3DIFA 2ZUSA 3D0VA 4JFFE 2QLVB 2ZPKL 5JOEA 2WP3O 3JWDL 4ZSOB 1QBML 1R24A 3ZKNC 3OHXA 3MRMA 1K2DA 2HVKA 4NQDD 5ADPL 5L6YL 1PEZA 1SYSB 1HYRC 3PUCA 1A22B 3EDEA 5ITBL 1PBYA 3MO1B 4Z76B 1SBSH 1JZ2A 4PJDB 3TP4A 4PIRF 3SOBL 4LGSB 3KLHD 3GJEB 1MFCL 3EYQD 1JV5B 2J8UE 1F42A 1S9XA 1EIBA 4L5FH 3VD7A 3EYUL 4NQSB 4XC3H 2FHBA 3QSKB 1HI6A 1U36A 2WINA 4TTDC 2ESVD 5EU3B 3SO5A 1S7SA 4JFDE 2VJXA 1FBIH 4EVNA 1INEH 1JE6A 4S1SL 4Z78B 1FL3B 1MLBB 2XA8H 4X98B 3ARDC 4WI8A 5D7LD 5E8DL 4PPTA 4UBDC 1NUDA 5B4MD 3OKKB 3REWB 4BH7B 4Y1AB 3O4LD 4KK9D 5ESQA 3FN9A 1A6TB 3X3GH 1F2QA 4HJGA 1FFRA 3DV6A 3P30L 1R5VB 1EEYA 5JW5B 3QH3A 2R8SL 2Y4SA 4DTGL 2OJEB 3IDGB 2WUCL 4JREB 3JBG7 4FRWA 3X14A 1EBAA 5DD5H 1V3LA 1CXFA 1U93A 4DJMA 3WDHA 3IFPA 1FNSL 2GCYA 3ARXA 2HMID 2FBOJ 2CK2A 1CFNA 4WFFE 1I9RL 3VG9C 1AR2A 1UG9A 4G8FB 1X5YA 4IRZH 4NNXA 1RIVH 3MTRA 4JPIA 2VRAA 3LV3B 3HZMB 3PGCA 4PJ8A 1HINH 4G80B 4RGNE 2P8PA 5F6IC 1CLOH 3EJJX 2FBJL 4ZS6C 5TQ2L 1IBGL 1KG0B 2IPKB 5DGQA 3RTQA 4D9QE 4XXCC 4JPKL 3AAZA 5DXWA 2VLRE 5I1HH 1FFNA 1OM3L 1QYGH 5ANMA 4PJXB 3T09A 5HHXH 3WCYA 1PKOA 4QCIA 3QCTL 3LHPL 1FDLL 3L3KB 5DHVB 2P5EB 2HRLA 1LVEA 1PSKH 2VZ1A 5CGYC 3C08H 5JHLL 1MRDH 1I1AB 4L3CA 1FQ9C 4XBPB 3V5DA 1MNUL 4P4KD 3I6KA 1C7SA 1U8MB 1U3HA 3BD4A 3TPUA 1E0OB 3C6LD 4HIHB 1AC6A 3WD5H 4NZJA 3SDDA 4DKEH 1YYML 1MREH 1C12B 4P99A 3OSKA 1R5WB 1VACA 5GSVB 2FLRT 2X4RB 4WDIB 2W92A 1HSBB 4X4MA 5EBLB 3T0WA 3W9DB 5D7JB 3V4UH 1MJ8L 3WFBL 1PDKA 1UEMA 3IGAA 5FYLD 2EICA 3RVWC 5CILH 3WKNA 3X11B 2CKBA 5HI5C 1B0RB 1KBGL 3FT4B 4EUPA 2AI0H 3UTPE 4F80A 3NN8A 3EOTL 1JTOA 5EBWB 5I8OH 3LMJL 1PQZB 3V0WL 3MV7D 4LGRB 2JCCA 3D85B 2RR3A 2LVEA 5C7XH 3UTTE 2H2PC 4S1RL 4TYUA 4NC1E 1CD0A 3RVUD 1GZQA 2Y9RT 4P2RA 5IM7B 4RAVB 3UJTL 1T20B 4LCUB 3ZE2E 32C2A 3OR7B 4NQXB 1LO3L 3RWJA 5AYUH 1U8QA 4P46C 4TUOA 4AT6B 3W39B 2PXYC 3QWRA 4YHPA 3RY4A 2Q7YB 3JV4B 2JTDA 1UH4A 1IVLA 4K23L 4XCEB 1LO0H 3G6JA 1AP2A 1GOFA 1ZHNB 4M48H 5IMLA 4K3GA 3SO3B 1JYXA 4LK4A 4XVJH 1JZ5A 4EN3B 5HGBB 4DQOL 3VXSD 3S37L 3NIFF 2BVTA 3T0ED 1CLYH 4A6YL 1OB1B 4XI5C 4YNYB 3S98A 2W0LA 1CE1H 5T3XH 3MYZA 3TCXA 1A3LH 2JJSA 4QWWD 4TOYL 3VFPB 2BNQB 3KPQA 4GRLB 2R23A 2D7TH 4FXLA 4XPBH 4LVOB 4P5TA 3HB3C 2JK5A 2F53A 1IGJA 3RVTD 3T2QA 1BVLB 1EX0A 1U8KB 3MGTA 3UYRH 1KCKA 2FGWH 1SEQL 4MSWA 1MAMH 1HHKB 5F7DA 3QAZC 4H1LH 3SDYH 5KS9F 1T1WA 2VDNH 3FCTB 4NFBA 5TE6H 3CC5A 1XF3B 1U8HB 4L8SA 4X7EC 1AY1L 4FMFA 2GT9B 4NN6C 2APXA 3I2CL 2YD7A 3LS4H 5LWYH 1C16B 1KCRL 2C9AA 1YMHA 5LJYH 2N4IA 2EYSA 3GI8L 1KIQA 3TT3H 2YPKB 3T8XB 2PYEB 5INDB 5MEPB 3NOIA 3BVNB 3MV8B 3R0NA 4CRPA 3MLZH 3GO1L 1OAXH 1NC2A 3U0TB 1JHKH 1HDMA 3PQYD 5TE7L 1FO0H 4JM2B 2VNCA 4XAKE 5HDBE 3REVA 4LKXB 3G6AA 3D2UA 1GJIA 1OSZA 4E9LA 3MCG1 1SMOA 1JCKA 1PVHA 3MRDA 2VUOA 4NZTH 5GGRY 4NGHL 4H26A 1KT2B 3QXDA 1IAIM 3L3JB 4QXWA 3PV7A 4PV9A 4U6HB 5IJKC 1IE5A 3W81A 4AMKH 5DA4A 4MDIB 2BXZA 4FFYL 3MUHL 4ZFOA 3HE6C 3SDAA 1QNZH 2G5BA 1II4E 4PBXA 3CPLA 5IBTH 4WUUA 4HW6A 4MLIA 1AGFB 4PRBA 3D39D 1CF8H 3E2HC 5MHSD 1NEUA 5I76B 2VDQL 1YY9C 3CFIC 5I66B 4U1MB 3BKMH 3GSOA 2YXFA 5FGBC 5SWSD 4NO0A 3Q5YA 4HAGA 2LQRA 4JKPH 1Y6KR 2EYRB 3UZVB 4HUWA 5TH2B 2HTKD 1XEDA 2NR6C 5I73B 3VXOA 3V52L 3FAXA 4PJGA 2AGJH 3KPNA 3OTTA 1NSNL 5IFHL 3D3VD 1JNLH 4PJGF 2NLJB 3IXAA 5EOQH 4JLRA 5F7KC 3P73B 5A3IC 4HJ0C 4DVBB 3W9EA 5HYQB 1HQRB 4WI6A 5T5FH 4RSVA 2BFVH 2AJSH 3L7EB 2IH3A 5FM8A 4KAQH 1ADQH 4P23D 4O58H 5MI0C 1KELH 1UZ6E 2QQKL 3L3IB 4KJPC 4LQFH 1JI2A 2HFFB 1MRFL 3LB6D 4YDLC 1NGQH 2AV1B 5B39A 1VERA 1ZT4A 5IP4A 2EECA 2X4SA 1DL7H 1QLEH 3C60D 1TITA 3DGGB 4XBGA 3KPSB 4Z7VB 2R0LL 1YNLL 3GMPA 4R8WL 3DX7A 4FQXD 4WGVB 5F9OL 4GH7B 4XCCL 1S9WB 3FKUS 4H25B 5CJBA 1AE6L 2EC8A 1BPVA 3TC9A 3HG1E 1F4YH 5A43C 1FH5H 1FVCA 3LH2L 3BHBB 2XI9A 2FCBA 5DYOB 4RMWA 4PR5B 5DT1H 1J0JA 1K6QH 1A4JA 1UFUA 1K3ZA 1NCAL 4JFPB 5E00A 2UZIL 1ZA6A 4N68A 1B0WA 5DGRA 1I8LC 4OZGF 3RGVB 4XPTH 1G9NL 3OR6B 4HH8A 1CT8B 2GTWB 5IMMA 4R4FH 3P4OA 5I1AB 5CP3H 2DBLL 2Q7NA 4I4WA 4RA3A 3UBXI 5C07A 4Z7UA 2NY1B 3RVVD 3KPPB 5IB3B 1UWXH 1AKJB 3UYPA 4JY4A 4WW2A 3WNOA 1RURH 4NQVB 4FNLL 4R2GC 3EYSH 4L4JA 4WWKD 3EBAA 5J6GB 4WW2F 5KS9E 4U7SA 5DK3A 4TUJB 4PGBA 4OCYH 4XXDA 1ORQB 2ZUYA 3MLVH 3RY5A 3UPCA 1IGMH 3DURB 1QO3B 4KKLD 1GHFH 4HG4K 4OZIA 4GAJH 4KK5C 4Z0XB 4G6JH 2YN5A 5ETUA 5IVXA 1EV2E 1KOAA 1U42A 4XPAL 3HPJB 4APQD 4FFZH 1FJ1B 1U8JB 2QADB 4ZNEA 3V7AE 3PHQB 5D2NE 1QACA 4MDJB 1IAKA 3DSFL 4QRRB 4GXVH 3PGDB 25C8H 5IK3B 2XYCA 4YDKL 5C0BE 1BJ1J 3NZ8B 4OM1L 4G5ZL 4X80H 5DD6A 3IDJA 1S7RA 3TV3H 2NX5B 4PG2C 4V1DA 2HRPL 2VZVA 2ADGA 4KPHH 3T1FA 5F9WC 2X4PA 3SQOL 5K9OA 4S0SD 2NY6B 4G43A 3LD8C 1KLUA 2GUOB 2CLZA 4WGWB 3LS5L 3QDMB 5JOFB 1UM4H 1IKNC 4YXLH 1IQWL 2Y6SD 3TA3B 1EFXA 2ZKHH 1CGSL 4DGIL 4PJ5A 1E27B 5EWIL 5FM5M 2CR6A 5BZDA 3O11B 5E4EB 4PRPD 1C7TA 1MVFA 4M7ZB 2K7PA 5EORL 4FTVD 3BQUC 2CDEA 2R4SH 4HCRH 4HS8L 1OVZA 1OTUC 5I8CA 4G8IB 1VB9A 1Q1JH 4XNZC 3QDJE 5IEKA 4U3XA 3EO9H 5CZVH 1OPGH 5C0DA 2R15A 4QOKD 5C2BL 4Q6IB 4ZAKA 2X4NB 3FHQA 2G60L 2GK0B 3S35X 5FB8A 1QSEB 4OV5A 1VEMA 4NUGH 1FCGA 4H1LB 3V79C 3V0AC 3ULUH 1FG9C 4P2QD 1DLHA 1I7RA 4WIQA 3DXAD 2I9LB 3HRZB 4MNQD 5FK9B 2IWGA 1W0VB 1ZEAH 4JFHD 1FYTA 3B6SA 4PJIB 3SY0B 1E28B 2NXZC 2E6JA 4NBYB 3PHOB 4KKBD 5C0CB 5DF0A 5TDPB 1DQLH 2FO1A 1BVKA 2Z4QB 1J10A 1RZFH 3K0WA 1T04B 3LQAH 1VFAA 1RZ7H 1FORH 4XT1C 3P4MA 5EZLB 1E4XH 2AJUH 3IFOA 3O6FC 2JE8A 1FO0B 1SVZA 2IAMB 3ARED 2X4UA 1S5HA 4HUXA 4GW5A 3WUZA 4DEPC 1CDYA 1F6LL 1R0AL 4K3DL 1WTLA 4TRPL 3BYTA 4DZ8A 3TO4D 1IAOB 2ERJC 4N1HB 2IBBA 4N0CC 5D1ZB 4Z7NE 5GHWH 1OAQL 3W82A 2HKFH 2YEZB 3V8OA 5H35A 5EO9A 3EOAA 3HMXA 3MRIA 3WIFB 1GH7A 5DJ6B 5IJVA 3QIBC 5FUOL 4QNPF 3QHZH 1F3JB 2DD8H 2D3VA 3FN0H 1FV1B 3QA3A 4OLZL 3ARBC 5GQBA 5E8OA 4HH9B 3VXNA 1BJ8A 1YY8B 2HG5A 1XH3A 3MACL 2PO6C 5J1TC 1WV7T 4I18A 5D7KE 3VMNA 1K85A 1NFDE 4HT1H 3UPAA 4B5EA 4X6DA 4LP4A 3ZT5A 5HYSB 5H2BB 1UWEH 4NQCE 2FSEA 3HR5A 3QUZC 3IDUA 4BQCA 5C0AB 3IXTA 1Q9KA 3Q6GL 2CMRH 3ZLQC 3EO0B 3K8KA 2L4OA 5FGCB 1A7QH 3L3DB 3QFJA 2HJFB 4MAYB 1NQBA 1MCIA 3IJSB 1ACYH 3BN3B 3QO0A 1HIML 1DQJB 5CFHA 3KPOB 1MCEA 3WNNA 3EYOA 1EEZA 3I6LD 3UTQA 2N7AA 4KVCH 3V4VH 3V4PH 3THMH 5E8NA 4IIQA 4JPVH 5JQHC 2IALB 5C0RH 1CGXA 3A67H 3D69A 4PRIB 4YFLF 3MUZ1 3FQTB 5AZEL 3ZE0E 1T1XB 1KTDA 4HGWA 4WJ5A 4UT9L 3RZCB 3W0WD 3OKOA 4W6YB 3EYFB 4M6OL 4EI6B 5FYKU 2ZCKH 2VDOH 1PYWA 3VXUA 3BZDA 4Q6YA 4X6BA 3DMMA 5DDHA 1ZTXL 1KC5L 3QIWD 2DQEH 1TNMA 5GGRA 1QSFE 4X5WA 2VC2H 3MRNB 3TFKC 3B3IA 5IVZA 4FQ2L 3L9RB 2UVEA 1UB5B 1L6ZA 2DIJA 2HVJB 4EDXB 3IAGC 1I1YA 5IWLA 4MZ2A 3VWJD 2AQ3A 1NBQA 3G5XA 3QXAA 5B21A 2C7UA 3TZVA 1JF1A 4P9HL 2BNRE 1KN2H 2EXWD 1IAII 1FPTH 5ISZB 4W70A 2ZUVA 2DLFL 2VLMD 4F15B 5IT2L 3DETD 4YO0A 4URTB 3IS1X 5DSCB 2A6JB 3DNKA 4P3WA 3QWOA 3QUXA 5JXAL 3MLTB 1FNAA 2WWMD 4GMTH 1MFAH 4NHUA 5I74C 4P9ML 1B4JH 4NKDA 3S4SG 5D71H 1I9EA 4MJIE 1R3KB 2ARWA 1QEWA 4HC1H 5AWNH 5M7QA 2AABL 1IQDA 2Y36H 4IRSB 1G7MB 2OP4L 3FZUD 2IMNA 1DE4B 1HEZB 2VR4A 1OGAE 3EYVA 1LK3L 3L3HB 3OXRA 5I8EB 1P7QD 3LKOB 4X7CC 3QQ9D 4N0UE 5EPMA 5EUKA 2EXYC 3ZYOA 4H88H 4M61B 2OS7A 3QBTB 5HJ3B 5EU6A 5GJTL 2NY2C 5TPWL 3WNPA 2COQA 2YKLL 1CLCA 4I0PA 2A6DA 2FATH 1LO4H 2C1OA 1FFPB 3RWGB 4YK4B 4YR6A 3MXVH 4HK3J 3STZA 6FABL 5FA3A 4PGZA 2CSPA 4QRPA 1WC7A 5A16B 4QTIL 5DHXB 1J11A 4R97C 3QDGA 4RGNB 3VFTB 4G6FB 1SEBA 5BS0B 3OJDA 1YECL 1UM5H 1TQBB 4KK8D 4UQ2B 2ADJB 2Q76B 2AK4B 4IHOB 3ES6A 3VRIA 5DVNA 1ULVA 1TMCB 4ZFGH 3U0PB 4QNPE 1F58L 4MNHA 1A6VL 4WENB 3WN5B 5I6XC 4NNPH 2G75A 5DVMA 1QA9A 4U1SB 2R4RL 4UTBH 5FUCC 3STLB 4G9DB 4YH6A 5D1XA 2GK2A 5E8EB 4IMKC 2VDML 4Z7WE 1MCOH 3GIVA 15C8L 4JG0H 2C3VA 3WHXA 3GIZL 4R96A 4LDOB 5GIRB 4OJFL 4KQ3H 1GAFH 5D93C 3SE4A 3ZE1F 5DR5L 5CINH 4LCYA 2DQJL 5LVEA 2MPAH 1OQXA 3VA2C 5DWUL 3KVQA 5KTEL 4JN1H 3IRPX 4PGDB 5KN5B 2Z93B 3NCMA 1V7MH 1T22B 4RFNC 3VRJA 3BPCB 1EA9C 2GKIA 4Y16C 4X6FA 2BRQA 5HVWA 5EA0H 5CP7B 1A6WH 5JZ7D 1EJ6A 1G1YA 4H8WL 1WLHA 4MXQD 5CSGA 1OTSC 3SJVB 4MNGA 4YIQA 4X6CA 3QEUA 1FAIL 1QBBA 2OMNA 5TDNA 3IU3A 4U1NB 4OZFB 5DC4B 4X6CF 4M5YL 4OQTH 1BP3B 2QJDA 4KUCD 2FL5B 3ROOA 5HTSA 3PWPE 1SJHB 4LLQA 1S7TA 1TETL 3VXRE 1TCMA 2VAAB 3DIFB 4LCWA 2BC4B 3D0VB 2X1WL 1HK6A 2IPTL 1ZSDA 5AG8A 3DYOA 5FHBL 3Q3GA 3UAJC 2HVKB 1T0MA 3PGFL 2F9BT 5LBSH 2NXYD 4CNIA 4OFPA 4OM0H 1CGTA 3AU1B 1MUJA 4XVSL 3IJYB 1JNNH 4GG8A 2RJMA 3VFGH 4OLUL 3LEYL 1X44A 3KYKH 3ULUC 1OW0A 3SDCA 2JKXA 3MJ9A 3DJ9A 1S9XB 1EO8L 1NUFA 3FHAA 1J1OH 5DTFA 2WINB 4KXZI 1DLFL 4ODXA 3FO1A 4EI5D 3RNQA 2XNAA 4X8JB 4JHZA 3WJJA 3S3PA 1JZ6A 3GSVB 2I07A 1WEJH 4FFVC 4EVNB 4M1CC 2DJ4A 3LQAC 3AS3A 4JO4H 1G6RB 1R6VA 2F54E 5KVDL 2R29H 1MIML 2A74A 1CGWA 4BKLA 5DUMH 3WIHL 3BPLC 2GJ6D 5FYKH 4KI5C 3RI5K 4I1NB 1QRNB 1QUNA 2G2RA 4PRHE 2J88L 1Q9WA 1B2WL 4HJGB 5CZKA 3AXLB 3MLWL 3GI9H 1M05A 4ODVL 1EEYB 4XGZA 1H15B 3BKYL 1DBAL 3QH3B 4ONFH 4GOSA 3QPXH 4KUZH 5C09E 4MCZB 1AHWB 2X42A 2APBA 3O2VL 3TYFB 1N5YL 1ROWA 1ZKAA 3G5YA 1IM3A 4WO4C 1G9MH 2H1PL 1U93B 3MXWL 1LEIA 4L3AA 2HAZA 1OLZA 3VWKC 1UA6L 4NO2A 4ZDHB 3T0VA 5L7XH 3GBLA 3IFPB 2P5WA 3I02A 2GCYB 4X7TA 1RZKC 4HXBH 3OMZA 1PLGL 3S34H 4Z0BH 4M1DH 2B2XH 5IMKA 4NNXB 1WZKA 4JPIB 1OAKL 2ZJSH 1QD0A 3H9SA 5FHAH 3PGCB 5SX5K 1FGVL 1QQDA 3LN5A 1CR9L 5D5MA 5SV3A 2AJYH 4YUEL 4IS6A 3L1OH 5D5MF 1M7IB 4NQDA 2CDFA 1T7VA 1OF2B 3AAZB 4FABL 3WFEL 1FFNB 4GLRI 1BHGA 1EGJL 4HGMA 4PUBH 4X9HA 5E2UH 4QCIB 1YQVH 1J1PL 3KLAA 4XAWL 2LU4A 3IDMB 2OSLA 1U8OA 1FZOA 3P77B 3O8XB 5E1AB 1BX2B 3GBNH 4L3CB 1DQDH 4Y1AD 4LSTL 1MF2L 5HGDA 1RY7B 2XZQH 3I6KB 3GJFK 5BV7L 1KFAL 1U3HB 5TF1L 3TPUB 2J12B 1T5WB 3PP4L 1TJHL 2DTML 3O3AA 3KXFE 1MHPH 4HXAL 3D18A 4Z18A 2PTTB 3HAEG 1T2QH 2GAZB 4IOIA 4PRNA 4Y4HC 5IUSA 3R1GH 5EIQA 1H3UA 5GGUB 2FX9L 1U6AL 4CADA 1RUKL 2EYTA 4NDMA 4Z7QE 3WUWG 5CLTA 3O4LA 2AQ2A 1YNKL 4XPFH 4NT6A 2CKBB 1HWHB 4EUPB 4M3JA 3QEQA 4LP5A 3ETBF 4HPOL 3VXMB 1H3TA 3NN8B 5E8PA 1FL5B 3RX7A 1A8JH 3VI4F 1AXTL 4XHQA 3CDCA 1RMFL 1TQCB 1RIHL 3UJJH 5BMFH 2Y07L 4CMMB 1GRWA 1RZJL 1ZV5A 3FMGH 4NCDA 4Q7DA 4NUJA 4R9HA 1F3DH 1GZQB 4WHYH 4P2RB 5GJSH 4OGYH 2PF6A 32C2B 4HK0A 3QG7H 3RWJB 4XNYL 1JHTA 3S9DB 3IS0X 3WHE1 1IC7H 1U8QB 4CJ1A 4TUOB 1LP9F 4XTRD 5M94B 2AJ3A 2P5ED 1W0WA 1EAPA 3G6JB 3BXNA 1AP2B 1I1AD 5ID1A 1XGYL 1NJ9B 5FECA 5DJAA 3PP3H 3PXJA 1MCRA 5MEOB 2DQHH 1EJOL 4LRNH 2CRYA 1X5XA 2R0WL 3FQWA 2HLFC 3M1BA 3PDDA 2XTJC 2C3XA 3CFDA 4QF1A 4FHBD 1NMCC 4JVUA 2ADIA 4S11A 4FQ1H 4F58H 3QIUA 1KXQE 1I7UA 1CU4H 3CZFA 4NKMA 5D7JD 4DCQB 3ARDB 5F7FA 3B9KA 1GVIA 4ZUVB 1QHOA 4X99B 3ISWA 1IEBA 3GMQA 2F53B 4K3HA 2OR8A 4S1QH 4MJ6A 4W81A 5CLWA 1IGJB 5KOMC 1MFDH 3FQXA 5CIPA 1CDUA 3N1MC 1BEYH 1W8NA 1J8KA 3C6LA 5KS9B 1G7IB 3MBXH 4PLOB 4PRDA 5F7DB 4KI5F 4A6YA 3TCLA 1MELA 1BFVH 2O5YL 2QR0A 1T1WB 2JF1A 2CR3A 2YK1H 1F5WA 4L8SB 2WAHA 3ALWA 3D85D 3OWEA 4PV8A 3UBXA 3P11H 4YDJA 1YMHB 3WLBA 2BY0A 2EYSB 2M26A 2PCPA 3VFVB 4B41A 1KIQB 4Z77A 1KCLA 3IDXL 5IG7A 1G7LA 1OQOA 3O3DB 5MEQA 5IFAH 3MLXH 3DUSB 2R9HC 1N64H 3JWOC 3MV7A 2IADA 2PTUA 5HI3C 5T33L 1MJJA 1HDMB 2YRZA 3VG9B 3GHEH 3REVB 1NLBL 2P42B 4OCMC 3LKPB 1L4IA 4U6XA 4C56A 2ED9A 5DI8B 4CVZA 1XGQB 2ED7A 4FZEL 4Y5VA 5F6IB 3MRDB 1TJGL 4EN3D 4WI4A 3LEVH 2FX7H 3MUJA 4D3CL 3PABB 1AO7E 3ILQC 5IW3A 3I3DA 1BFSA 2CLVA 1FAKT 4MB5A 4NHCL 3QXDB 4QHUA 2YPVL 3HMXH 1UEYA 4K7PY 4PLKD 4PV9B 3RWFA 4WFED 1JNHA 2BNQD 5E2TL 1U3JA 2Z31A 4GRLD 1CZ8L 3KJ6L 2Y7QA 4ZFOB 4R90H 2G5BB 4XRCB 3GSWB 3CPLB 3GSQA 5D72H 4WUUB 3MRKA 2C4FU 2IJ0C 1A7PL 4PRBB 1V3KA 5H8DA 4R4ND 5A2KH 2H32A 2A0LC 4R0LA 4L4VA 1YN7A 4OCRL 3MODH 4ZG1A 1MCQA 1A64A 4NO0B 3OAZK 1OOAA 2DM2A 3UCRA 4QHMA 2VDLH 4HUWB 3V6ZA 5LCVH 2KL6A 2LU7A 3EDDA 3VXOB 4L1DA 4D0CA 4PJGB 3KPNB 1I8MA 4HF5H 2W59A 3IXAB 3ARGA 1DQQA 1MOEA 3CDYA 5KSBA 2PYED 3W9EB 3IU4L 3MV8D 4AEEA 2IH3B 2O5XL 2QHRH 3FT2A 3IDYC 4WFHD 5FGRA 3TBSA 5ADOH 3F6LA 4J7RA 1A9EA 1ORSB 4JM2D 4NCC1 1ZT4B 4RFOL 1URLA 3WS3A 5B39B 2X4SB 4NN7B 2DQDH 3TIEA 1N4XH 5CUSH 1RHHA 4DAGH 4XBGB 3MBEC 1MH5A 2XA3A 2CPCA 3FQNA 3C9NA 3GMPB 4M1GL 1WBYA 1N8ZB 3RWCB 1BIIA 3ULVH 3MPCA 2DQGH 2R1WA 3OKNB 3OPZL 1XGPA 3QQ3B 4BZ2H 1FIGL 2OL3B 1FVCB 3ULUE 1VCAA 5LGKA 5J11C 1IFHH 4IDJH 1CXEA 4KHTL 1S5IH 2NY5C 3KPRA 4XCNA 4DK3A 1BD2E 2XZCL 4K8RC 1ZGLP 4RGMB 4OZGB 3WEXA 3BISA 3FOMB 3QDHA 4XP5L 3AVEA 3QQNA 5E00B 2X41A 1ZA6B 3WHE0 1KN4L 4OLWL 1P69B 3MV01 3P4OB 4ELME 4D0BA 4I4WB 4RFEA 3JV6A 1BZQK 2I24N 5C07B 4Z7UB 4J4PC 5FDYA 4U1KB 3D39A 1TZIB 5MP6H 1NCTA 1GC1L 4JY4B 4WW2B 5GS0C 3BZEB 5JIHA 4RRPA 2Z8SA 3VGFA 5SWSA 3MLRL 3DTXA 3QAZB 4PGBB 4NZRH 1XF1A 1P84K 3CX5K 2Z8WC 5J13B 1R5IA 4X0KA 4YHMH 4RGOH 1J18A 1MFEH 3D3VA 5T1DL 4JDZB 5ETUB 4MGXA 3MNVA 3KPSD 2LFGA 4DGYL 5ACZB 5EIIA 1BBJA 4C83A 2IGFL 3MCLH 3MA7A 4HKXA 4XNQA 4PJEE 4P23A 1IAKB 2X1QA 4WHCA 5SV4A 2QEJA 3O6KL 4X4XA 1CWVA 4GMSL 3S4SA 4PY7A 1R3IL 5AZ2H 4GS7B 4OB5H 3VD3A 1S7RB 4KMTH 1N6QH 4KTDH 5BRZE 3F7VA 5IQ7L 4C4KO 3QWQB 4XBEH 3T1FB 1HZHH 3H3PH 1IMHC 5KVEH 1BBDH 1OARL 4NKIL 4H20H 2X4PB 3CLEH 3CMOH 4QGTA 5K9OB 1X6LA 4HLJA 3LKSA 5FO8A 1X5LA 2F5AH 3RGVD 1OL0A 2OJZL 3PV6A 4OGAC 4G43B 3ZHDA 1KLUB 1NBZA 4N0YL 1JPTL 2CLZB 2EH8L 5EBMA 5EBGA 3CLFL 1DBBH 3B2VL 2MJWA 2BSTA 2PKDA 2NY1D 5DQJA 1EFXB 1AKJD 4PJ7F 2PR4H 3SKMB 1K8DB 4YXKH 4HEPG 3LEXA 2CDEB 1CK0H 4OD2A 3QZWA 1PY9A 1BQLH 1AI1L 2DMKA 4FQCL 5I8CB 1P84J 1GGIH 3U7WH 5FGSA 3TBTB 1VA9A 5IEKB 4G3YL 1MEXH 1L9MA 4TSAL 3BEVA 2FEDC 3MV9A 4R26L 5B22A 4ZAKB 2ENYA 2W0PA 4E41E 2EDRA 5C0GB 1V5JA 5ANME 4HHAB 1HILA 3BMWA 5FB8B 5DQ9A 4OV5B 2E7CA 2QADD 4XPHL 4O02H 3FRUA 3ZO0A 1BZ9B 1DLHB 1FRGL 3JUYA 4QRRD 1S7UB 3NZHH 3O0RH 5MI0B 2EDEA 1OTTC 3FRPG 5EZOH 2O61B 4YDLB 2HWZH 2UYLA 2NX5D 4IRJC 4NJ9L 3LIZL 5L2KB 1LEKA 5B3NA 5ENWB 5GS3A 1SHMA 1A7BA 1BVKB 5IROA 1FCCA 1HOCB 1CL7H 1VFAB 4HULB 3P4MB 3KR3H 2AJXL 1XCQB 3IFOB 4NC2B 1XR9B 2NY6D 3TM6A 3BT2H 3DECA 3DVIA 3BO8A 4HUXB 3QDMD 1HSAB 2ICWJ 1INDL 5HGHB 2P47B 4NRYB 4N8CH 1Q9LB 4YC2C 3EHBD 3TA3D 3T3PE 4QXTA 4DZ8B 1B9ZA 1SY6H 2YRPA 1L0XA 5HY9A 2ZPKH 2FGZA 3JWDH 2JCCE 2DQTL 1QBMH 3H9HA 5H35B 5EO9B 3EOAB 5T3XD 5ADPH 5L6YH 4MCYB 1VEOA 5IIEA 4GAGL 4OUOA 4OLXL 5ITBH 1K5NA 1MCWM 3S37X 2XTJE 3QA3B 3T77A 1ZLWK 3WNMA 4OIIH 5F71A 3SOBH 5E8OB 1QHPA 5J4MA 4M6MH 2HG5B 2GSIA 1XH3B 3L95A 1JZ3A 4LPXA 3EYUH 4KV5E 5FM4A 1QSED 3BDYL 4D9RE 5JXEC 4R2GB 1VGEL 1A5FL 2FSEB 3HR5B 5JLZA 5D2LA 2I5YL 3O2DA 5LGJB 4L3EB 5D2LF 4QOKA 4S1SH 5E56A 4U7KA 5GZND 5SWQA 4O9HL 4M7LH 1J87A 2DKUA 1BQHB 1FGNL 5HHME 2JJVA 3C5ZA 4I2XA 3QO0B 4PJFA 5E8DH 2W0FB 1INQA 5C0CD 1CLZL 3QJHA 3EYOB 1EEZB 4PJFF 4FFWC 3UTQB 2BVQB 4TPRL 3DXAA 5C2UB 5E8NB 4IIQB 4U6VL 3RI5F 3HZYA 1QFHA 1GOHA 3K4ZA 2IAMD 3P30H 4HIJB 4UIMA 3WKMH 3D87B 2R8SH 1JYNA 1OP5K 3TJHC 3DRTA 4CBPA 1DZBA 4DTGH 2VLJA 5KVGL 2B5IC 4WFGE 1KTDB 2VITA 3MREA 4HGWB 4WJ5B 1S9KC 2WUCH 5E6ZA 5I2IB 5D1ZD 1PYWB 3VXUB 3DVFA 2RGSA 1KPUB 4HS3A 4X6BB 3V95A 3DMMB 4W4OC 2A73A 3QI9C 3CNKA 4B0MM 3AREA 1FNSH 5E2VH 4X5WB 3LD8B 8FABA 4ZS7L 1I9RH 4NFCA 1EUTA 3B3IB 4JFQA 4LARL 3BMVA 4UDTA 2EDNA 2ZCHL 3TO4A 4CVXA 2LU3A 4JRXB 5EOTA 1I1YB 1FNGA 4HZLA 3G5XB 2VKXA 2ARJQ 3ZMRA 3QXAB 2C7UB 3TZVB 1JF1B 1BJ1H 1CXHA 3D6GA 2DYPA 5DD1L 2FBJH 4JY5H 3ET9F 5TQ2H 1IBGH 2FZ3A 1ITBB 2M2DA 3PWVA 4LOUD 2VL5B 3IDNB 5C0AD 1OM3H 1F97A 3MRFA 5DRNA 1HYSC 4XNZB 1ZHLA 2RHEA 3CVIH 3QUXB 2ZUQC 5HHNA 3RL2A 3WDIA 3QCTH 3LHPH 2FJFA 1FDLH 3U9UA 1X6NA 1C1EL 4NKDB 2XZAL 4MAYD 4G8GA 3ARSA 1LDPL 3GHBH 4EQ3A 1ETZA 5D9SB 4FQIL 4P49A 1JN6A 3I84A 5JHLH 1QEWB 2DLHA 1MNUH 5ITFA 2NY3C 1JMXA 2VUYA 3FO2A 3OXRB 2YD9A 3WXVL 3C09C 4PRID 1YYMH 1ED3B 5EUKB 4ONHA 1YMME 2VH5L 5L9DH 1WBZA 4Y88A 2NXZB 3MCKB 3WE6A 4PJBA 3RZCD 4I0PB 2A6DB 4OKVB 1MJ8H 5SX4H 3WFBH 2C1OB 4ORGA 2YPLA 1AFVL 5DD3L 4YR6B 4PJBF 2P8MA 2W91A 3I50L 4YZFF 3HAEA 3STZB 5ERWB 5I75C 1KBGH 1RJCA 5FYKE 1P4IL 2WM0A 2ILLA 1XF2A 5FA3B 2HJLA 5F1OB 3EOTH 2DKSA 4QRPB 3LMJH 5FCUL 2O26U 5CEZE 3V0WH 2B7DT 3QDGB 4DEPB 1N2RB 3OJDB 4S1RH 1KLFA 3BJ91 3ZDXF 4EBQL 2ERJB 2D7NA 3HC4H 4KVNL 1ZVYA 3VRIB 2A9NH 5ISZD 3U36A 4UNVA 1LO3H 3ARFC 3QIWA 4X9BA 3JTSA 5EDXA 1RHFA 5J9PB 1FZKB 1L0QA 3H3KA 2G75B 1QA9B 3BUYA 4LEOB 1AR1C 5FYJD 5D1XB 3VWJA 4MX7A 1T21A 1B90A 2XICA 3MRPA 3GIVB 3U46A 4OBRA 2PO6B 2VXUL 4DK6A 4R96B 1A7RL 1JZ4A 4IRSD 1F8TL 4DQOH 1IC5L 4LCYB 3S37H 1XF4A 3MMEA 4A6YH 3UTSA 3EIFA 3LOWA 5T3ZD 5ELIA 4NOBA 3MRBA 1A7OL 5KANI 4ZPTA 4TOYH 1YJDC 5BQ7A 1T66D 4D9LL 3VGEA 1RUPH 4U1HA 4X6FB 5GGQH 4F7PB 35C8L 1HQ4B 1X5ZA 4KRLB 1MCSA 4X6CB 3QEUB 1FP5A 4FN0A 3FB7A 5TDNB 3IU3B 1SEQH 4O5LL 5E94B 5T1MA 1KCSH 5GRVK 1LNUA 1D5ZA 4HIXL 4LLQB 1S7TB 4RGND 4G6FD 2NY4C 3OJMB 5IB4A 4LCWB 5BS0D 1MWAB 5E9DA 5JW4Q 1ZSDB 4Y5YA 2XV6B 4WHDA 3RGHA 2AK4D 3U30B 1YA5A 3GI8H 1T0MB 4U1LB 4CNIB 3WO3B 4JO2L 4OZIE 1VFOA 5IVXE 1Q0XL 3BDBA 1MI5E 2OTWB 2H9GA 3GO1H 1AXIB 3JV5A 1ZS8A 2WQ8A 4ZNEE 5B8CC 5TE7H 4WEBH 1OAZL 2Z8RA 3RWEB 4F8TA 3MGAA 2Z9TA 2FJHA 5DTFB 4ODXB 3FO1B 3RNQB 4IOFC 5IB2B 3LKNB 4L9DA 3QNZA 2F19L 4NGHH 1QFPA 4QT5B 3GUTA 4BA8A 1WZ1H 3MOBL 4MA3A 4V1DE 4Q0XH 5IKCA 4XWGL 2X7LA 2A74B 4BKLB 2XG4A 3DI3B 4YFDB 4FFYH 4AEHL 5C8JA 3MV11 5KANG 5KW9L 2G2RB 2JELL 2OTUA 1Q9WB 3BP6A 4L29B 2VDQH 3SJVD 3B2UD 1H3XA 3EOBA 3BOVA 3IVKA 1M05B 5HD8C 4XGZB 4PJ5E 2HT3D 3SE8L 1FVDA 4JDTL 1CVSC 1IEAA 3GMRB 3G5YB 4POUB 3WIHA 4PJ9A 1XCTB 3IB4A 4KKCD 2NY2B 4GW4A 1NSNH 5IFHH 2AP2A 4I0CC 5GRJL 2AK1L 4MAUL 12E8H 4TN9A 3I02B 3FFCA 4X7TB 1FVEA 4HUVB 3RZWA 4ZXBC 5IMKB 1AD0B 3KLDA 3H9SB 1IM9A 2QQKH 1QQDB 3LN5B 5CSBA 2DIAA 1MRFH 4R97B 1F6FB 5D5MB 4Y8AA 1N6VA 4X8XA 3D25A 4M6NL 2CDFB 2WLZA 2VXVL 4G8EA 3FQUA 4RMQA 2V2TA 1E4WL 4KJQD 4H1LG 1FYTE 2R0LH 4R8WH 5F9OH 4G6ML 4JHWL 4XCCH 4NP4L 5I6XB 4PJAA 3MQIA 1AE6H 4RMVA 1XMWA 1WICA 4YQXL 4JFXA 1UJ3C 4ODWA 4PJAF 4WW1B 5CJXC 3ALPA 4AG4L 5F7HA 5HGDB 4PBVC 3QXVA 3CZJA 3Q5TA 1QRND 3LH2H 3SE3A 1SYVA 1U0QA 3O3AB 1Z3GL 5LG1A 3D18B 4JZNA 4J3TA 1EGJA 1NCAH 2GI7A 2UZIH 4IOIB 4PRNB 3FFDB 4U6YA 1G9NH 3QG6A 3SGJC 1JNJA 3BP4A 4LSPL 1QSVA 4NDMB 2DBLH 2F74A 4RFNB 3D0LB 2H45A 3FL7A 4NT6B 3EYQC 4Y16B 3T2PA 3O45A 1Y0LB 5J6HB 3QEQB 4DN4L 4C55A 1ZT7A 2VQTA 4HD9A 5E8PB 2CO6B 4JFEE 4JE4B 2VLLB 3H7LA 1L6XA 2A77L 2B4CH 3NPSC 3RU8L 2R1XA 4X6DE 2X4QA 3KHOA 2XT1B 4FXKB 4ZSOA 1HHIA 4FQPA 4KRMB 5CSZB 4YJZL 2MFNA 4HK0B 1LP9B 1JHTB 4XPAH 1U41A 5B4MC 2APTA 2EDOA 4YPJA 3MO1A 3CAFA 5HYSG 3QFJE 4CVUA 4PJDA 1G6RL 1WITA 4UOW1 1FNLA 4U05A 4FXGA 1BMGA 1JV5A 3DSFH 4NBZB 4OZHE 1A4KA 1EAPB 3O8XD 3NIDE 3BXNB 5D70L 4YDKH 3RA7L 5B8CA 1RK0A 4OM1H 4G5ZH 5DS8A 5HGAA 4AL8L 5DJAB 1U3HD 2HRPH 3GKWL 2HFEB 1CDHA 3SQOH 1MLBA 2DLTA 2FJGB 3M1BB 3CFDB 5DEGA 4JN2A 4JY6A 2HMIC 3QIUB 4V2BA 1I7UB 3LS5H 3HN3A 2R39A 3B9KB 3OV6A 4Y1AA 1B0GA 5GS2D 1IEBB 2ICWA 4MJ6B 1IQWH 4X7FC 1A1OA 3FQXB 1CGSH 5CIPB 4DGIH 1O7SA 5EWIH 4BFEA 3VXMD 4A6YB 4PLJD 5EORH 4O2EA 2QR0B 4IBLT 4FA8A 2K7QA 3BE1H 1IAIH 1XF5A 4HS8H 3KS0H 4I9WD 1I3GL 4N9OB 4TQEL 2X4OB 3UBXB 4YDJB 3U9PL 4P2RD 1YPZA 5C2BH 4Z77B 1NGPH 5IG7B 3ZKND 1G7LB 3VGAB 4L4TE 1AC0A 3OF6A 4F9PC 4DZBB 1V3JA 3QWRD 3VI3E 2IADB 3GGWA 2DOCA 1MJJB 5H37G 5F7MC 3KDMA 4ZXBA 2XZZA 1X5IA 3KNBA 1WWCA 1MSPA 3RKPA 4LNVA 4RAHA 4HJJL 4U6XB 4C56B 2YS4A 4CVZB 1BJMA 2IPKA 2ZG2A 3G9VA 4TTDD 5KSAC 5A2FA 3BRGC 2VDRL 1NBYA 4ZMAT 3NIGE 5EU6E 4QHUB 5LQBL 2PNDA 5DHVA 3RWFB 1JNHB 2Z31B 2Y7QB 1MCPL 1U8PA 3ARDD 3GSQB 3VFMA 4JB9L 3MRKB 4PD4K 4WV1C 2CKBL 4I3RL 4UBDD 5BVJA 2F53D 1U8MA 1JGEA 1R0AH 2H32B 2IFFL 4TRPH 3CJJA 4L4VB 2Y5TA 4ONOA 3RVUC 1OAQH 1N5AA 1R5WA 3V6ZB 3VMOA 3P9MB 4CW1A 4W6WB 3AFLA 3W9DA 5FUOH 2ZOKA 3JUZA 1FFOA 4OLZH 5FOBA 1DJSA 3ARGB 1EHNA 1DQQB 4I77H 5C08E 3MACH 4G42A 2BOCA 4OI8A 3H7BA 1VFBA 4YWGL 1PQZA 4DOHE 3FT2B 3TBSB 3NAAH 1KCUL 4P2YA 4U1GC 2AXGB 2VLKB 4UV4L 3L7FA 3FTGA 3PWLA 3JTTB 3WFHA 3WS3B 5CD5C 5BOZG 5IM7A 1RHHB 2IMMA 5TE4L 3DX8B 3OR7A 4PLNC 1I85C 1MH5B 4ZS6D 3IFNL 2KDGA 3CSPA 3FQNB 4KU1A 3C9NB 1HIMH 4K9EC 4AT6A 4XNMB 3W39A 4YHLL 4HUNB 2WANA 1Q94B 1LEGA 4NM4L 1XGPB 5F96L 4XCEA 1WT5A 1NFIA 3CFKA 4TNWK 1B6DA 1ES0A 4MNGE 4WUUD 5CGYD 4CGTA 5AZEH 1I4FA 4WU7A 3KPRB 4XCNB 3Q0HA 1QVOB 2IPUK 4UT9H 2FYYB 4OF3A 2UWEE 5EG6C 1PKQA 1KB9K 2D0FA 4PJCE 4EXKA 4NO0D 4MZ3A 4H0IA 4OZFG 4UOW0 2BNQA 4O51B 2X40A 1JGLL 1ZTXH 2OK0L 1KC5H 4YE4L 4D0BB 4RFEB 3JV6B 1NMCB 2C4FT 2UY6A 3GRWL 2F58L 3LRHA 5JORB 1FFQA 3T2NL 4FQ2H 2IBGA 3RVWD 1U8KA 4Q2ZA 3SDXF 1FLRL 4PJHF 3DTXB 3FCTA 4JJ5A 4KXZH 3VRLF 1JRHL 1IC4L 5B3JE 1DQML 5FM5O 1R5IB 1D9KC 5IT2H 1T83A 4X0KB 2XQBL 1JWMA 1T7XA 1AJ7L 4YPGB 5JXAH 3GKZA 4YHZH 1ZOXA 2FB4H 3JSSA 1J1XL 3X13B 1XGTB 2WNGA 2YPKA 1JMZA 4K71B 1ZHKB 4C83B 3MA7B 3MV8A 4HKXB 4NO5B 1LQSR 4XNQB 2KQMA 1D5XA 2C3WA 2AABH 4YHYB 2Y06L 3TT1L 4NOFA 3HAEH 2OP4H 1IJ9A 5KJRH 1M7DA 1LK3H 4LKXA 3GSRB 5EC1A 4XPGL 1IC1A 2XN9A 4QRSB 2XQYG 1E6OL 4N5EC 5GJTH 2MMXA 5TPWH 4B50A 1IARB 3R8BB 3EKCA 1YC8A 5SWZE 1KT2A 5KSAA 1X4ZA 2YMXL 3LKSB 5K9JL 5FO8B 4XI5D 3PV6B 4RIRA 2NZ9D 2VSDA 2A2QT 4U6HA 1NBZB 3IJHB 5GZOC 2H8PA 1MVUA 1PAMA 5I0DA 1JUFA 5EBMB 1P4BL 6FABH 3ZT7A 1CYGA 5F9JA 5C07D 3PDGA 1MCWW 3OQ3B 1W72L 1AGFA 3LN4B 2P5WE 4PJ7B 4P5MB 2IC2A 5CCKH 4QTIH 5F93C 4UT7L 2GJZB 1NCCH 4PY8J 2B4CC 3AB0B 3SKJL 5KSVA 4FQQA 5I66A 1YECH 2XTLA 4U1MA 3LEXB 1T4KA 3C60C 5CBAB 3QZWB 4PYHA 1TXKA 2EYRA 5TH2A 1YNTB 2A9ML 1I8KB 5LAXA 2IANB 2Z35A 3VD4A 4FQXC 1F58H 4JVPA 4GLRH 1A6VH 4NQDE 3AMKA 3BEVB 1O0VA 2A1WL 3MV9B 1A3QA 3V6FA 1IL1A 2NLJA 4MJ4A 2R4RH 2DL2A 2V5RA 2VDMH 4DVBA 1A47A 5DJZA 15C8H 2DL9A 4CVWA 3GIZH 1WIUA 3R4DA 3FRUB 3OKMB 2L7JA 4OJFH 3OXSA 4ACPA 1FSKB 5CKGA 5DR5H 2XWJB 2OL3L 4KJWC 5HPOA 3BZ4B 2ESVE 2QSVA 3OZ9L 1YMMB 3WDJA 5HHOA 1EK3A 5KTEH 3JVGA 2UYLB 4UV7L 3DGGA 4ZFZB 1Z0MA 3KPSA 3O4OC 4F3FA 4Z7VA 1BQUA 1IGTA 4KRPC 4V2CB 4ALAH 1C08A 3G5ZA 1MCNA 5D7LE 1H9VA 4JM4H 4H25A 4H8WH 3IFLH 1IKFH 4Q9BA 3O4LE 4CN1A 5BVPL 3BO8B 1CQYA 4WWKC 3TN0C 5HYJA 5I19L 1EFXD 2SEBB 2VE6B 3H0TA 5J11B 5DYOA 4X7DC 4AIOA 3BESR 5HY9B 3MRRB 4JFPA 3VD5A 3H9HB 2IPTH 3BPNC 5FHBH 4EUPG 3RGVA 4APQC 1VADB 2DS4A 5J0BA 5JMRA 3PGFH 2NZIA 4G9FA 2DQCL 4XVSH 4OLUH 3T77B 3LEYH 4JKMA 5IB3A 1AKJA 1BM3L 4ZAKD 5CHNB 3L95B 3KJ4C 1EO8H 5D7IE 4NQVA 3T08A 3V7MA 4PJHE 3EFFA 1A6PA 3NH7L 1UT9A 4HJ0D 3VGHA 1DLFH 2DMCA 4TUJA 5JLZB 4BM7A 5D2LB 1YEJL 5F89B 4HUUA 3P0GB 4ONGH 3V6OE 4AEIL 4BUHA 4KJPD 4PB9L 5C71A 5HDLA 3H9ZA 3U0WL 2YUXA 4OLEA 4XP4L 2O93L 3OAZH 5F7UA 1MIMH 3C5ZB 1FJ1A 5L2KD 4PJFB 3WIHH 1INQB 3QJHB 2Y6SC 3N1GC 3PHQA 4OD1L 3BH8B 1RQ5A 4MDJA 3L5WB 1FHGA 4QRRA 2E8YA 2YD3A 2J88H 1B2WH 5IK3A 3MLWH 3HZYB 4UIMB 2Q8BH 3BKYH 1DBAH 1RU9L 2YC1A 5JIIA 5DZLA 3DRTB 2VLJB 4HPYL 2VITB 3MREB 3O2VH 4LCCC 1N5YH 3ZDYE 4HS3B 5F1KC 3LRSA 2H1PH 4I3GA 3MXWH 3IRZA 1UA6H 5FYLE 4Y8DC 2A73B 3T1WA 2GUOA 3MZGB 3QDMA 4Q9RL 8FABB 1VFUA 1PLGH 3HLAA 1SBSL 4UUJA 4Z7OE 1OAKH 4CVXB 2MSPA 4K2UL 4N90D 5IW6A 4NWUL 1FNGB 3O11A 4HZLB 1FGVH 1CR9H 3MV7E 4L5FL 3NCJL 4Y7MA 4XC3L 3V5HB 1RUML 2YBRA 2DYPB 4YUEH 5HBBA 4R2GD 2AQ1A 4DFHA 2YD5A 2FZ3B 3PWVB 5F7EL 4P57A 3FB8B 3RFZC 1L0YA 3TJEL 4GAFB 4FABH 3WFEH 2A6IA 1EGJH 5DRNB 1ZHLB 4L3ED 3RL2B 5C9JA 1J1PH 3U9UB 1UM6L 4Q6IA 4XAWH 2X4NA 4G8GB 4KK5D 1ETZB 2H26A 1XGRA 5ITFB 1S9VA 4LSTH 1MF2H 5BV7H 3GJFB 5TF1H 4J12A 3HC3L 2GYSA 3PP4H 3X3GL 3DVNA 4M4RA 2DTMH 3UO1L 4F9LC 4WI2A 1NANH 4F8QA 5FK9A 4HXAH 2P24B 1JJUA 3VXSE 5LGHL 4PJIA 4OI9A 1E28A 3T0EE 4JRWA 5ALBL 1WBZB 2EIEA 4J8RA 2BX5A 3SBWA 4IRJB 5D96C 3WE6B 4PJBB 2FX9H 1U6AH 1RUKH 3PJSA 3B9DA 2YPLB 3ULVD 2P8MB 3VXUD 5EZLA 3U7AA 2V5MA 3DMMD 1T7ZA 5EOCL 1XF2B 4HPOH 2GY5A 3DRQA 5AD0B 1AXTH 3EZ8A 3TN0A 1ZVHA 1UVQB 1RMFH 2J6EH 1RIHH 3BW9A 4JRXD 4YC2B 2OLDA 2Y07H 3K2MC 4LSVL 1RZJH 1HINL 2KH2B 3TZVD 1HCFX 3MRQA 2ENSA 1CLOL 2P46B 3U36B 5DJ6A 4J3SA 5J56B 2IG2L 4XNYH 1KV3A 1F3JA 3T4AA 1FV1A 1Y6MR 3QUXD 3RUGA 3BUYB 4HH9A 1S78C 5B39G 1YY8A 5JA8B 2WBJC 2AAVA 1T21B 3RUGF 1PSKL 3GK8H 4NSKB 3MRPB 4GQPH 3U46B 5D1QC 2ZOLB 3PQYE 4XP6L 1XGYH 1JFQL 5MENA 1PJ9A 4MJ5B 1HHHA 5EUOA 5BCAA 4ZOCA 1EJOH 1XF4B 3MMEB 2D9QB 4RBPK 5DD0L 5EUOF 3UTSB 2R0WH 4JGJA 3EO0A 1MREL 3LKQB 3L3DA 4ZPTB 2HJFA 2WQRA 5BQ7B 5CJQL 3VXTB 4U1HB 5E6IC 2NXZD 3OB8A 5GGVL 1NFKA 2HFTA 3KPOA 4I0PD 3SKNB 5HVHC 3UXFA 2ATKA 4ZD3H 4RMSA 3FB7B 2EDJA 1AGBB 3D39E 5T1MB 4DWHA 4HLZG 3O3EB 1J0YA 4PRIA 5MHSE 1LNUB 2EXWC 3FQTA 1X9QA 2O5YH 4QRPD 2EE6A 3QUKA 5EO0B 3DETC 3QDGD 4JFFA 2CLRB 1F3RB 5IB4B 5SWSE 4JO1L 3RZCA 4Y2DC 5E9DB 1BZ7A 3EYFA 2YHGA 3RHWK 3BH9B 1DN0A 1KJMA 1A2YB 3IDXH 3D3VE 5DHYA 3MRNA 5DHVH 3LRGA 3FZUC 5GRWA 2OZ4H 1ZS8B 5FXCH 2J8UF 3ARBD 3HC0B 4WY7H 3QQ9C 3SCMC 1LO0L 2PO6D 4LRIA 4JFDA 2IQAB 5I1DB 4LLYA 4FZEH 1H5BC 1TJGH 3HE7A 3QNZB 5JNYA 5DSCA 4D3CH 3QUZD 3GUTB 4QHNA 1M71A 4MA3B 1DUYB 4NHCH 2B8OT 4Y4FA 2X7LB 4WI3A 1DANU 2YPVH 5CJOH 1OLLA 4JRYB 1EERB 5E70A 1DBKL 3KJ6H 3C2AL 5C8JB 4XPBL 2E3VA 2VIRA 1A7PH 1G7MA 4BK5A 3BP6B 5ACMA 3EOBB 3IVKB 1TTGA 4MVBD 4KK8C 4NQEB 4OCRH 1MAML 3SKUD 5JPNA 2EO1A 3UTZA 1BGXL 1FVDB 4M61A 5L8KB 1M4KA 5C0EB 3OG4B 4CJ0A 3O2WH 4LCWD 4PJ9B 4TULL 2BSRA 3LS4L 2X10A 1FFPA 3RWGA 3FB5A 1BIHA 3PWNA 5A40E 3FFCB 3IU4H 2XKUA 2O5XH 1L7TL 2HP4A 1IM9B 3TFKD 3MLSH 3SGEH 4OV6F 3VE0B 2P48B 2NY0B 4RFOH 1X5AA 4UQ2A 2E6QA 3D25B 2VLRA 1I9JL 2VDPL 3ZDZE 4G8EB 2V2TB 2D7PA 3GMMA 1K9TA 4NZTL 2AEQL 5JZ7C 3ARFB 1O5DT 4M1GH 4CN6A 2XY1A 4XCYB 4MXQC 2YSSA 4PJAB 2X1XR 2QQQA 3TNMB 4RAUB 4ZO8A 4JFXB 4ODWB 1WTGT 5KVFL 3RIAK 3IDIA 1FIGH 1NEZB 2DMBA 5GIRA 4GG6E 2BVOB 4YFLI 5BW7C 5ID0B 4TNWF 3L5JA 4XC1L 4OI7A 4Z5RA 4E0RB 3DHJA 4PFEA 1CG9B 2OR9L 4JZNB 5KAQG 2W0KA 1A6UL 1DDHA 4P2OC 4XP5H 1B3JA 3LDBC 2MQ3A 4U6YB 1T22A 2NXYC 3BP4B 1WISA 4OLWH 1MWAL 2BSED 3PG2A 3MROA 1CDBA 4HSQA 2NY2D 3PHSA 4JQVA 3MLUL 3O45B 3SJVA 1GC1H 5DO2D 4OGXL 4U1NA 4E42B 4TVPD 1YEHL 2G5RA 5T5FL 2FL5A 3MLRH 3UTTA 4PRPE 5IEHB 5TF0A 1DP0A 2BNUB 4YBLC 3H9SD 4FTVE 3RDTC 2VAAA 4HMEA 2R1XB 4LHUA 2BC4A 2X4QB 1KJVB 3QUYA 1HHIB 5ACLA 2P7TB 2NCMA 2DQUH 4XP9L 5T1DH 4AENB 1PW3A 3OJ2C 4OZ4A 3VFOB 3ZE2F 5A1AA 4Y19B 4QOKE 4DGYH 3AU1A 3CMGA 2YD2A 3IJYA 2IGFH 2ZSVA 4FXGB 4I2XE 5J3HC 1R3LB 4XMLL 4JPWL 5C92A 4JFZL 1A4KB 3O6KH 2DWDB 3WO4C 3QHFL 3AM8C 2GY7B 4P2QE 3RJQB 5B8CB 3DUHA 1BQHG 1RK0B 2D0GA 5DS8B 5HGAB 3DXAE 4L9LA 1XZ0B 3SCMA 1A02N 4MNQE 2V5TA 1KPRA 4X8JA 1WBXB 1RZ8B 4ODSL 3GSVA 4JFHE 5IQ7H 4XVUC 1DQTA 3BEWA 3RL1A 1OARH 4NKIH 4WTWA 1G6RA 5DEGB 4JN2B 1YN6B 4JY6B 4N0YH 3BSZL 2EH8H 1B0GB 2ICWB 2XKSA 5I1LA 2VYRE 4Y2OA 4Y16D 1A1OB 1E4KC 1QRNA 5DVOA 4IM8A 1YEFL 3QCUL 3S5LA 4DFIA 4DKDC 3PWUB 1SM3L 5L0QC 3AXLA 4YHKL 4TVPL 4UNUA 3QEQD 3BYYA 1H15A 1CXLA 1JGUL 1WCBA 4O2EB 1UQSA 4ERSL 2H6PB 4Y5XA 4XMKL 4MCZA 4FQJL 1AHWA 1XF5B 1AI1H 3NABL 4FQCH 4GRWH 1CFTB 1OWWA 2NY7H 5IBUB 3TYFA 2HLAA 1AGCA 3MLVL 4M00A 1RPQA 4G3YH 1I1RA 4TSAH 1ZGLB 1YPZB 5D2NC 5K9QI 5GPRA 1LHZA 4R26H 3PXHA 1RI8A 2JJWA 4ZDHA 1VHPA 4P3DA 4BH8B 2YUWA 5EOCJ 4HKJA 1GGBL 1GYAA 2Q8AH 3X12A 3GGWB 4KGJA 3KDMB 4ZXBB 2AV7A 3ARVA 2BHZA 1FRGH 3KNBB 2Q87A 4GXVL 1YYLH 1MRCL 5HDBF 4RMTA 3TNNA 1ZLUH 1F90L 4HMCA 4X80L 1M7IA 4HQQL 1TZHA 1EMTL 3FAWA 4KDTC 3TV3L 1D6EA 3LIZH 4NJ9H 1JL8A 1OF2A 5IB5A 2VDKL 3GEWB 1WUNT 1NBYB 4FFVD 5F9DC 3CCHA 2AXFB 3NTCL 4M1CD 1YEGL 4OGZA 3IDMA 4WHTB 4EKXA 3P77A 3O8XA 5E1AA 1BX2A 2HN7A 3I6LE 3SHSA 3QIUD 1U8PB 2YZ8A 2YD6A 4YXHL 3VFMB 1UM4L 3B9KD 4M7KL 4X5XB 1INDH 4KY1L 4Q9QH 5BVJB 5TFSL 1JGEB 4HMDA 1T5WA 4KI5D 2Y5TB 2XY2A 3RRQA 5BW7A 2PTTA 3WFCL 2DQTH 2CRMA 1N5AB 4K94C 2GAZA 5FUZL 5C0NC 2EE9A 2R4SL 3W0WE 4CW1B 4FG6C 4JZJA 3N06B 3QEGL 5GGUA 4OLXH 3SGKA 4KC3B 4XTRC 2ZOKB 1CL7I 1FFOB 4HWBL 3DGCR 5FOBB 3MYJA 1AD9B 2GTZA 1WWAX 3UZEA 5C0IA 1I1AC 2WV3A 2BOCB 4G42B 3H7BB 3B43A 2QKIB 2CXGA 4LIQL 3VXMA 5AAWA 1LILA 1JBJA 1FL5A 1VFBB 4GXUN 4MQSB 3BDYH 5K9QG 2YUVA 1VGEH 3A6CH 1A5FH 3M07A 3ULUL 1UZ6F 2NPLX 3L7FB 3FTGB 4CMMA 3PWLB 4BSWB 3WFHB 2WSKA 2I5YH 3RDTA 4UAOB 3NPSB 2VLME 1ZEAL 4C56D 3BKCL 1RJYA 4O9HH 5FYJU 3ULSA 3P9WB 1CN4A 5ICXA 1FGNH 5D7JC 1TNNA 2N7BA 2ZWLT 1CLZH 4H5SB 1P7KB 4TUKL 4IJ3C 1RZFL 3LQAL 1RJLA 1UYWH 5HYEA 2MKLC 4OLYL 4UI2A 1J8HB 1RZ7L 2BMKA 1LEGB 4TPRH 5CGMA 4Z8FL 1TLKA 1PG7X 2Z31D 1Z9SA 1NFIB 1X7QB 2IQ9H 1BF2A 5CWSB 3CFKB 4HDIA 1ES0B 1T7YA 1NJ9A 1I4FB 4UT6L 4WU7B 2ITDA 2V2WA 3OG6B 5KVGH 4K3JH 5MEOA 3HUJF 4JHAL 3MFFB 4L4VD 4HWUA 2NYYD 3BP7B 1AGDB 3TO2B 1PKQB 5BZWA 4LVEA 2HKFL 1A0QH 2NNAB 4J1UA 2F15A 4DCQA 1TDQA 3ARDA 4ZUVA 5JOPD 2PW1B 2D4FA 4X99A 4ZS7H 2GFBB 4LARH 3SDXB 5JHDB 2ZCHH 3ARGD 4PJHB 5KS9A 4Q2ZB 1G7IA 3M17A 2NTFB 5C6PB 2JIXB 1RZKL 2JLLA 2MWCA 4HT1L 4JJ5B 4EN3C 5MERA 5DD1H 4P3CL 2ZNWA 1NCWL 2XKNA 3WSQL 2VLKD 1YQ2A 1JWMB 4HKBA 5CBEA 2CMRL 4PLKC 3VFVA 3GRWA 2DI9A 1C1EH 4GRLC 3O3DA 1LDPH 3FB6A 3VA6A 4FQIH 2E7LC 3LN9A 2BRRH 3DUSA 1D5XB 2ICES 2AEPL 2CK0L 4PGJA 5ILTL 5DJCA 5C0BA 3KYOB 1N0XH 3FO9B 3IT8D 1M7DB 3BIBX 5IVOA 3V4PL 5GGVY 3LKPA 1G7QB 3WXVH 1XIWC 5EC1B 3A67L 4LVHB 2XN9B 5DI8A 1XGQA 3RQ3A 3O41A 2VH5H 1IGCL 3KPRD 1I3UA 3ARUA 1CCZA 3PABA 4QO1A 1UC6A 4XXCA 5KSAB 5FFLA 3HS0B 5DD3H 4RIRB 2VDOL 3I50H 5J7CC 7FABL 4Z95L 2H8PB 1MVUB 4YDVA 1JUFB 1P4IH 3MR9A 4XRCA 3GSWA 1NCDL 5F9JB 1P9MC 4W6XB 2EIDA 5E6YA 5FCUH 4F7MB 2EE3A 4JM2C 3STBA 5KSVB 4FQQB 1QFOA 2ITCA 4KKAC 5IV2A 1T03L 1WK0A 4EBQH 4JCLA 1QFWM 1T4KB 5EN2A 4L8BA 3K81A 4KVNH 1KN2L 1MCBA 5LAXB 2Z35B 5SX4I 4M8QA 3K8MA 2ARJB 1XGUB 3V6FB 1IL1B 1W72A 3RKDD 1UWXK 4GMTL 3F58L 1NAKL 1DSFL 5DJZB 2EZ0C 4ZUSA 1SMAA 4M6AA 2VXUH 4GSDL 4HC1L 3OXSB 3V5KB 3C8KB 2R9HD 1F8TH 3PL6C 1ORSA 4GRWB 4HBCL 1IC5H 5HI3D 5ESVA 1AIFB 2B1HL 4U1GB 4GRMB 2B0SL 5DURB 5HHOB 1J0IA 4BZYA 3Q1SL 4FQHB 1CDJA 1EZVY 1A7OH 4F3FB 1IGTB 5I73C 5I1IH 4HZAA 1C08B 3G5ZB 1N8ZA 3RWCA 1F4XL 4P46A 3QNXB 4UIKL 3WJLC 3ILQD 1ZAGA 3OAYH 4AIXA 35C8H 2PXYA 4LU5L 2GJ6E 3OKEA 1JF5A 3OKNA 2A38A 3QQ3A 2F8VA 3MJ7B 3CGTA 2OL3A 4O5LH 5HYJB 4LLUA 1X5GA 1IRAY 1A3RL 2HTLC 4HIXH 3S97C 3U48A 2P8LB 3H0TB 3HUJE 3UEZA 3ORJA 3EJYC 5DC9B 2AJVL 4OT1L 4OZGA 3S3JA 4PYGA 3FOMA 1HNFA 4Z7NF 1WAAE 4LSSH 1PG7H 1BFOA 4ZSOE 1C5BL 5H37H 5CAYB 4JO2H 4G9FB 2IAND 4ZFGL 1SJVA 5BJTB 3RHWF 1YEKL 1V8HA 3K80A 3EGSA 1Q0XH 2RIKA 4U1KA 3MV9D 1TZIA 2V9TA 5FYJH 3BZEA 4ETQA 4AH2A 1J5OL 4PJDE 3EFDL 2DLGA 1TPXC 3UDWC 1NFDF 4NQCA 1I7TA 3EFFB 3OJVC 3JWOL 4U2YA 4HUUB 5CINL 5T3ZH 1D9KB 1YMMD 3MOBH 4JDZA 1I3RA 3O6LL 4XWGH 4NO3A 3WFZA 4KQ4H 2YD1A 5T5NF 4OAWA 5ACZA 4M9OA 4AEHH 2NY1C 1PZ5B 1RSFA 4ISVB 2JELH 3GMOB 1CGVA 1ODAA 2APVA 1RFDH 4Y1AE 3ARPA 3GM0A 2YC1B 2CUHA 4OQTL 1KACB 4JDTH 4OD3L 1JWUA 2FEEL 3ZE0F 4E5XB 1DBJL 1YUHB 2VTFA 3AGVA 1MY5A 1LD9B 2GSGA 5DK0A 2R0ZL 3P3YA 3LRSB 5LKNA 2CD0A 1YEEL 1QSFA 5GRJH 5DJ8B 1TTFA 2QADC 2QQNH 5IJKA 3HLAB 1JNNL 5K59F 4UUJB 4I13B 3MRJA 3HE6A 1VGKB 4XX1G 4DUXA 5IW6B 1LGVA 4J4PD 3UBXG 1FLTX 2IH1A 2PW2B 4MD5A 4LASL 2FX8L 3SKMA 1K8DA 2BNRA 3X3FH 3GBML 5GS0D 3E6HB 4M93C 2YBRB 4BZ1H 4FZ8L 3QXTA 4JM2F 4QXUL 5FGBA 5F72S 4FOMA 5L8LB 2VXVH 4P57B 4M8VA 3TBTA 2A6IB 3K2UH 1DCLA 3ELAT 5C9JB 4HG4J 3P4LA 4G6MH 4JHWH 4JO4L 1R3JB 4NP4H 5C0GA 4MJIA 4LQ1A 4PJXE 4HHAA 3C5ZD 3BRDA 4YQXH 3SKOA 2H26B 1QFWL 1U8NB 1XGRB 2P5EE 4AG4H 3EHBC 5DJ0A 3TA3C 1S9VB 2X6MA 4F33A 2R69H 1T6WA 2AXJA 4DGVL 3RIAF 1BZ9A 2BK8A 1S7UA 3DVNB 4F57L 1RAMA 5J1AA 1MHCB 4CDHA 4M7ZC 1Z3GH 4OZFH 5CEZL 2O61A 4KDWA 2I26N 4JQXC 4NIKB 5GS1C 2VLJD 5L2KA 3U4AA 4J8RB 5ENWA 4LSPH 2NY5L 1KULA 3O4OB 4K8RL 1HOCA 4KRPB 3PJSB 1HE7A 3CUPB 4ENEC 1XCQA 1Q72L 4GQ9L 4OSUL 1XR9A 1FIEA 4DN4H 5L7XL 1CI5A 1YZZA 2Q3ZA 1HSAA 4OGAD 3DRQB 3INUL 3MLPA 4HXBL 5HGHA 2IEPA 4NRYA 3W5NA 1Q9LA 3TN0B 4J6RL 2XACC 1DUZA 3EJZD 4Y4KC 3BW9B 5FHAL 3P9LB 4YHNB 2A77H 3RU8H 5GS0L 3F7PC 3MRQB 4LMQI 2DYPD 4TSCL 1DEEB 3BPNB 5ECJE 4MCYA 1I8LA 1VPOL 1KIRB 3O2DL 4M62L 3TLRA 5FKPA 1I3VA 4M7JL 3T4AB 2V7HB 1G6RH 3RUGB 4ZOEA 2E9BA 1P5UA 1PY4A 4P2CG 2FEDD 1KENL 2LE9A 3O9WC 4G8GD 4P48A 1KIPB 4MD4B 2W07A 4Z7WF 5D70H 4XCFL 4GW1A 3KJ4B 1KEMH 4GKSB 1FNHA 4AL8H 1DQDL 5MENB 2XZQL 1HHHB 3L6FB 5EUOB 4ZUWA 4BSVA 1KTLA 3UROR 5D1ZC 5LGJA 4L3EA 3GKWH 3WBDA 2H2SD 1OTTD 1T2QL 1BQHA 1NL0L 5EC2A 3C6SA 3AY4C 1N3NA 2XG5A 2W0FA 4IRJD 3H2WA 2GIYA 1KXTB 4WFEE 2BNQE 2FIKB 2YPLD 5CS7A 3TBYA 4A2LA 2BVQA 1XAUA 2ATKB 2F8OA 1BWWA 1JI1A 5EZIL 3HFMH 2BSSA 4HIJA 3PWPA 5I8KL 1QKZL 3VXRA 1AGEA 3QUKB 4JFFB 2FEEI 4LOUC 1QLRB 2OMBA 1G84A 5BMFL 4PG2A 2E9JA 1I3GH 3I9GL 4TQEH 1BZ7B 2WUBL 5I2IA 4WCYL 5DJ2A 4LCCB 2EE2A 3DX9B 1KPUA 1U91B 3U9PH 4RRPG 2L0DA 1DN0B 5GISL 1KJMB 5CEXA 2VISA 4CDGC 2J8UB 5K59E 5DHYB 2X70B 1T89C 3ARYA 1Z9OA 1IKNA 2PYEE 1B4RA 1NGYB 4JRXA 3MV8E 4Z9KB 4HWNA 1FE8L 1I75A 4CMHB 2NMSA 4U0QB 3WS6C 1NMBH 4JFDB 3B9EA 4LLYB 3BQUA 1IGYB 3HE7B 5JNYB 4GXUM 1YEIH 2VL5A 3IDNA 2F54A 4QHNB 1J7VR 1M71B 3UTSD 1PZUB 5HHQA 3ABZA 4AIZA 4Y4FB 5IB1B 5LQBH 4TNVK 1N59A 3BI9X 4ESKA 3GMLA 4S1DC 4NN5B 3VFUB 5D9SA 3UPRB 3WFDH 5HYFA 1MCPH 1QFWI 5GS2H 3QULA 4PRHA 2VIRB 1NDGA 4KHXL 3CFBA 4JB9H 4MQXC 1SVCP 2CKBH 4I3RH 4S1QL 2JJTC 1CICC 1FNFA 4EUPH 1MFDL 2IFFH 4LBEA 3VFRA 4FFWD 5DEFA 5C09A 3RBSA 5JPNB 4OQ1A 2QTEA 4TSBH 3UTZB 1ED3A 43C9A 4DKFL 2YN3A 3S35H 5I17B 5FDWA 2V7NA 9CGTA 4JQXA 4KGLA 3TJHD 3MCKA 1NCBL 2BSRB 4OKVA 5E9DD 2LVCA 3FB5B 5D96B 5F7LB 3S36L 2RFXB 2P1YA 2BVPA 3PWNB 3NFPA 5ERWA 1KB5B 1OSPL 1IGFH 3QZWG 1NC4A 2ID5A 3O6FA 5IFAL 5HYIA 4EDWH 4IRSC 4YWGH 1UGNA 5E08H 4AY0A 5JW4N 5F3BB 3ZKXB 4UINH 1KCUH 1N2RA 3U1SH 1UH2A 4K07A 5HPMA 1T1ZB 4Y4KA 3GHEL 4XP1L 1KEGL 2EH7L 1MAJA 2VLRB 5TE4H 3GMMB 5C0FA 3ZSTA 2FX7L 3IFNH 3MLYL 3QIBA 5J9PA 1FZKA 4YK4C 3IETA 3KPSE 4YHLH 5JTWA 4Z7VE 2YSSB 4LEOA 2KBGA 2Y23A 4JRYD 4WTXA 3ARBA 1MHHB 4NM4H 3NCEB 5B38A 3IDIB 5F96H 1P1ZA 2WBJB 3O9WA 1QOKA 2PO6A 4ZO6A 4JR9L 2XPGB 1RZIA 4MXVE 5D1QB 2BVEA 2OR7A 3KG5A 4Z5RB 3QUZA 3DYMA 1OCWL 4NQED 1DDHB 1DANT 1A7NL 4UB0L 3BFOA 3TIDB 3D1MC 1JGLH 1CQKA 4MMZC 4YE4H 3MROB 4NM8H 4Z7QF 4PJ9D 5GSRB 5FO7B 3OKYA 4ODHL 4CU6A 5DVLA 4F7PA 5E6IB 2CRIA 5CJ8A 4ZTPL 3GRWH 2F58H 1HQ4A 1WVZA 1G0XA 1U8IB 5DRXA 1JGVL 3T2NH 4JQIL 1KF9B 3FFCD 3RX5A 5E94A 4OFVA 1FLRH 3UTTB 1DTUA 2DTSA 5D7SL 3ZYJA 1JRHH 1IM9D 4EQ2A 4YHOL 1DQMH 4LHUB 1CBVL 1FG2B 3HI5L 1MWAA 3QUYB 3GSUA 1X4YA 1F4WL 2XQBH 2NY0D 1AJ7H 1HNGA 3HCVA 4OZ4B 4ZODA 4U1LA 1J1XH 1M6OA 2EDFA 5K33A 2UY7A 1RULH 1NBVL 3TF7C 1FZMA 3K4AA 4UQ3B 4PS4L 3OAUL 4MHHI 4LPYA 3ARFD 4NNYA 2ZSVB 2OTWA 1RIUL 2MHAB 4MB3A 3B2UC 2Y06H 3TT1H 3RWEA 3HI1B 1AR1D 2HT3C 4QRRE 2LV4A 3LPGA 1ZGLM 2V9RA 3EO1A 4WEMB 4L9LB 4XPGH 3SCMB 1KPRB 1H3WM 3LKNA 5FF6A 1IFHL 5IB2A 1E6OH 3LCYA 1H5BB 3OB0H 4QT5A 2Q6WB 4KKCC 2X89A 3BEWB 4RA0C 1CIDA 2NX5E 3RL1B 5HHVL 3SGDI 2QSCL 2YMXH 4TVSa 3VG0L 5K9JH 4A2MA 3VH8B 3FT3A 3SN6N 1LO5A 3KPMB 1JK8B 1ZHBA 4IOSD 3L3OA 3CU7A 5I1LB 43CAA 1W72H 3IAPA 3S5LB 1MCDA 3QDME 1GOGA 5IMOB 4HKZB 4L29A 4UT7H 2ZZUT 3QO1B 3SKJH 1WCBB 4F7TB 1UQSB 4Y5XB 3HNTL 1NDMB 4LPVA 4KJQC 4YAQB 5EULV 4NZRL 2HLAB 1AGCB 2A9MH 5GXBB 3GMRA 1SJEB 5T3XE 1XCTA 2Z92B 4RNRA 5CP3A 4PP1D 5INCB 2ZG3A 3NA9L 1KCVL 4IMLA 1X5JA 3NCYP 1PEWA 1EHXA 4PTTA 4P3DB 4QRTA 4Y19D 2Q86B 4HUVA 4HKJB 2EDLA 3AC0A 3QUMB 4JDVA 3X12B 1LE9A 1AD0A 1GCFA 1WWBX 4D0DA 2AV7B 5DJYB 4ZPVB 1QSEE 2W60A 1HXMB 3LQMA 4CAGA 3RX8A 2OL3H 4MHHG 1AQKH 1MCLA 3TNNB 2BJMH 3OZ9H 2X9WA 1FL6B 4P5KA 3PIQA 1CE6A 4RX4A 2DQFA 1TZHB 1LO2L 4TTGA 4KMTL 1D6EB 5IB5B 5E7FA 2C3GA 3GZKA 4PJIE 4IOFD 3SE9L 5JW3L 1QP1A 4HLZH 4MA8H 5I15L 4H20L 3CCHB 5FV2A 5C0CE 5CD3A 4N8VA 3TBWA 5D6CA 4PP2A 2HN7B 5BVPH 4WW1A 1YJDL 5JQ6H 5A2JH 4QHLB 4IMKA 4U3CA 3AS2A 2I9TA 5I19H 1VEPA 4R7NA 5DLML 3PP3K 4PJ8C 5GGSA 3ZTNL 4GJTB 2ZSWA 2Y5EA 3CVHL 3VDAA 3G08B 3FFDA 2H41A 3RTQC 2E9IA 1NAMB 4P2OB 3U6RA 1X5KA 3S96A 3LDBB 4JZJB 2DQCH 3D0LA 5IQ9A 4L8CB 2P45B 4XH2B 2X5PA 4Y16A 3CFEB 3MYJB 4S2SA 1BM3H 5T1KA 2HFGL 2GTZB 5ICZB 1Y0LA 5J6HA 2LAGB 1Z6JT 1Z9MA 5TDOA 4MJ2A 1MCJA 5C0IB 5DFWH 5CGTA 5ESAB 4JFYA 3OF6D 3VDCA 2VLLA 1U3HC 3NH7H 1UXSA 4XNUL 3ZHKA 1Q0YL 4ZXBD 5IBLD 4HCRA 1YEJH 3F5WB 3O0RL 3SDDC 4AEIH 3MUGB 4FXKA 3RDTB 4PB9H 3MGOA 2DDQL 5CSZA 1RK1A 1T2XA 2RAMA 1RJYB 3G6DL 3J7HA 3U0WH 5C0AE 4HWBA 3ULSB 1LP9A 3G5VA 5ICXB 1CXIA 5J89A 1C5DB 1AQDA 3P4NB 2HH0L 5FGCE 4F7CB 1RJLB 1SBBA 3HG1B 4LL9A 2BMKB 3KR3L 3A0OA 5F1IA 4KTEL 4PLJC 2D4DA 5F6HJ 5I9QC 2ADFL 3ULUF 3HNSL 4HDIB 1LE5A 1RU9H 5F3HB 2XXMB 1NMAL 1BD2A 1TQCC 1KNOB 2ITDB 2V2WB 3V9FA 5F88B 4OIBA 5JR1L 4HPYH 4LPUA 4PRIE 3T3ME 4OCXL 5DUPL 4LDEB 1QBAA 2HFEA 4K55A 5BZWB 2FJGA 3NA4A 4ELMA 5EU4B 4J1UB 4EIZC 5AUMA 2ORBH 4ELMF 1BAFL 4PB0L 4Q9RH 4MS8C 4NYLA 4LSRL 3NCBB 1BFTA 2C3HA 4OIIL 4K2UH 4HUKB 1I1FA 4NWUH 4M6ML 2D9CA 4YLQT 4BQ6A 3M17B 3ZKMD 3NCJH 5JIPA 3UYOD 5L0QB 1RUMH 5MERB 1JYVA 3TYGL 2XKNB 4NZUL 3QPQC 3QCVL 5F7EH 2OQJB 4GT7A 1GPOL 3TJEH 1OP3H 2X4OA 1EZVX 4HKBB 1V3MA 5ISZE 2VXTL 5CBEB 5IFJA 4DKAA 2JJSC 2EDTA 1UM6H 2P49B 4WO4A 4M7LL 1G7PA 5D2NB 2W1NA 3U4BL 3VWKA 3FB6B 4JGMA 2OXGA 4P5TC 4PJEA 3S6CA 4C59B 3WLWD 4DZBA 5FYJE 2BXYA 4PJEF 1J8HD 4LPCA 1QBLL 5DJCB 5C0BB 1FN4B 3HC3H 1EO7A 3UO1H 3F7QA 4CKVX 3WKML 5BRZA 1EHLL 5IOPB 5LGHH 3BIAX 4L8SC 2VB5A 3TVMC 3O41B 5ALBH 2UUDH 5T3ZE 4ZFFB 1A14H 3RP1A 1XR8A 4EEEA 4HFWA 1TENA 2X05A 5E7BA 1JPSL 3FOLB 3VJ6B 4MA7L 1ZANH 3N1QC 2FRGP 4YDVB 3MR9B 3N85L 5EOCH 4R4BB 5E2WL 1U8LA 5E2VL 4NZDA 4LEXL 4B53A 5JHDD 2AKRA 1NANI 2ITCB 5IV2B 1IEHA 4LSVH 3KAAA 2JIXD 4LVNC 1EXUA 1KGCD 1RZGB 5EN2B 4L8BB 1UCBL 5BS0E 2K3TA 3RWHA 3QDJB 2RCSH 3P9MA 4JY5L 4X6EB 2IG2H 4Y4HA 4XZUB 1WFOA 2BY1A 2MCPL 2AK4E 4OLVL 3NFSL 4M8QB 4E41A 3DI2B 1TVHA 3CVIL 1W72B 3VCLB 3HPLA 1KXVC 4LDLB 3SDAC 3GHBL 2Q20A 4ZUSB 2DKMA 4XP6H