2HAZA

Crystal structure of the first fibronectin domain of human ncam1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
SHMDTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Neural cell adhesion molecule 1
publication title A novel alpha-helix in the first fibronectin type III repeat of the neural cell adhesion molecule is critical for N-glycan polysialylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hazA00
4LLWA 2A9NL 4JFED 2GY7B 2FJGA 1HHIA 4HUWA 4RFEB 3LRSB 3D18B 3I50L 5GRJH 2N56A 5J9PB 4QOKE 3MFFB 4ZPTB 2ADFH 2OTWB 3LKRB 5GGTL 3HB3C 4W4OA 3DVFA 3PDDA 2BVUA 4ZTOL 1Z5LA 4L29B 1ADQH 4G6MH 4X6DF 2YPLB 4EI5C 6FABH 4NJ9L 5I73C 5ICYB 4NQSB 1SYVA 1IC5L 3Q0HA 5DHYB 3PGCA 9CGTA 5C0RL 1CICA 3VGFA 3HUJA 3TO4C 4WHDA 5IFHH 1R3JA 5D8JH 5FF6B 2B20A 1WK0A 3DGGB 3MLXL 5DFTA 2Z31B 5F89A 1CS6A 4JO3L 1FZJB 3TWCL 5I66A 1TJHL 5EUOE 1JVKA 3TFKC 3VRIA 1AGFA 1UH3A 4NO0B 3MCKA 4XB7A 4UAOC 1BBJB 4LSSH 3PP4L 1OM3H 2YD8A 4I0KA 3B2UD 4Z9KB 3TH3T 5BV7B 4HIXH 1OGAB 3C5ZA 4S1QL 3RPKA 4KTDH 3SQBA 1AKJA 3N1PC 5K9OA 3BGFC 4LSPL 1SJEB 2P49B 2FX7L 3MV8E 5KSUA 3WNPA 1MAML 3HI5H 5TDOA 1YMMB 4OBRA 4YFLF 4X6DA 3DV6B 3KXFE 1CWVA 4NKDB 3VGGA 2WUCH 1JF1B 4D0DB 1OGTA 1LK2B 2NY4D 2XTLA 1BFOA 1P7QA 3S9DB 5GIRB 1BVZA 2XWTB 5ADPL 3LN9A 1BQLH 2EEDA 5C0ND 4CADB 2HJFB 4P46B 2APFA 2UV3A 1NFDF 3QEQE 1DQJB 5KVMC 2H6PB 1FH5H 2ZJSH 3B9KA 3KPNA 2QKIB 5FEBA 3VH8G 4EN3A 1YEDA 3U1SH 4NQCA 3QO0A 4QRRD 2J12B 4OZ4A 2ICEA 3SN6N 2VITA 1T2JA 3GSWA 5DVNA 4UQ3B 5HI5C 4L8CB 1HIML 1CDGA 4XNZB 2HA1A 3QCVL 2BFVH 4L8SA 4MVBC 5J8OA 5IJKA 4OCWL 4HGKC 3O3AA 5IB5A 4P2QB 3B3IA 1NCWL 4YHOL 3CDGB 4G7YH 4GRLD 5GISL 5B4MC 1KXQE 1U3HA 3PGDA 1A3QA 2R0WL 5J13C 4QHNA 4KY1L 4JCMA 3BPNC 4OZFB 4YX2H 4L4TB 5D70H 5HHPA 2H45A 4HG4K 4Q74A 4RWHA 4MXVE 1UCBL 4ZFFA 3KYMB 4RAUA 4ZAKA 1CD1A 3L5WB 2IGFH 4R0LB 43CAB 5T5FL 2LU7A 2GJ6B 2CLVB 2DB8A 1M7IA 4LCWD 3EYOB 4JPVL 5E70A 1NFDA 1L9NA 1LP9B 3BDXA 3SE9L 2NY6B 4FNLH 5ALBL 3QXTA 3OB0H 3VXOA 2ED9A 5HSFA 1DFBH 4DVBA 1WCBA 4JB9L 4N1EA 4O4YH 2H9GB 5DZOA 1DQMH 5HHOB 3CZJA 4KMTL 4V1DD 5DI8B 3TA3D 1YEKL 2W0LA 3RJQB 4NO5A 5DJ0A 3V52H 4KZDH 4PJ5B 3RWCB 2J8HA 1RUKH 4ALAH 5I16A 3HAEA 4OGXL 3BZEB 4IJ3C 1E4XL 3LMJH 5ALCH 4PBVC 2BHUA 5HDBF 1N64L 2GW5A 4PJCF 4P2QE 2ICWJ 3A0OA 3T3PE 5AD0A 2G5BA 1OSPL 1I9EA 3UO1L 4L5FH 3S96B 3T4AB 1RAMA 5EO0A 4HLJA 4LL9A 2BRRH 5HTSA 4L4TE 5DWUL 4FQCL 5HYJE 1W72B 3G5YA 3UBXI 4K7FB 4AH2A 3PWUB 2Y1VA 3DX6B 2WQRA 3U4EB 3GMLB 4HD9A 4U1IA 2HT2D 1KEMH 4U0QB 3PE9A 4F58L 1JHTA 5M7QA 4EXKA 2Q86B 2WINB 5C1MB 1JZ8A 4OLWL 5E6YA 2FX8H 5ACZA 3NGBB 3L3OA 3BD3A 1ZANL 4JO2H 4TRPL 4OZIB 4MXQD 1EJOL 1HXYA 4XCYB 3VWJC 1FVEA 3SCMD 3PIQB 4MQXC 2ZOLB 1LO3L 1MFCH 2ZUYA 4WFGD 5HGHB 1IGML 3LV3B 5HHOE 5GRVK 3DHJA 4PJ8C 5GGTH 2GSIB 4K7PX 1KELL 2R23B 2VR9A 3LEVL 3MRPA 3QIWB 4NQTA 5LXGH 3ZO0A 1WFNA 3GSUA 4PJ5E 3FT2B 4WI4A 4NJ9H 3C5SB 1N4XL 1FG2A 1IM9A 4K8RL 1MLCA 4RWYL 4R7DB 5GS1B 1DCLA 4B50A 5C0RH 3VFWA 1EH9A 1D6EB 3EO0A 8FABB 3HZMB 1MI5B 1EERB 1JI1A 2V2XB 3MLXH 2ILLA 4ONGL 4JO3H 4NC0B 5B39G 2LFGA 4ZDHB 3TWCH 2AJYL 4NC1C 1TNNA 4J3UA 2R1YB 3MRMA 4DFIA 4LGSB 1EEYA 2G60H 3FOMB 3KPRD 4WHCA 3BD4A 3UJIL 1D5XA 1P84J 1JWUB 4UQ2B 5L88H 5I71B 1T80A 2BSSA 4NPYB 4U6VL 3MGTB 1A22B 5I8KL 1N0XL 1KGCD 3MNVB 3MOAL 5D7KE 3OMZA 4TUKH 4ERSH 4QCIB 5INDB 2R1XB 3FRPA 3GSRA 4MNHB 1JWSA 1A7OL 3HE7A 2FX7H 2D0GA 3PF2A 3BAEH 4H0GA 1RU9L 4YFLI 5I17B 5CLWA 1M1SA 5HPMA 1YUHB 4LNVA 1HE7A 4X9IA 4ZFOL 2GAZA 1LQSR 4FQXD 3SGDH 5FHAL 4CMMA 4NQVA 2Q7YB 5DJZA 5CD3A 4HCRA 1QFOA 3VFVB 4PLJC 2IANE 3A6BL 1HI6A 1X5IA 3MRIB 1EEUA 3BP5B 1XCTA 2DTSA 3V7AG 4HKBA 5T1KD 3NZHL 5IOPA 3S35X 5DUML 1CBVL 4G8EA 1TVHB 4M00A 4JRXD 3L3JB 3D69A 1A1OA 4KHTL 5FHBL 3LD8C 4DKFL 5L8KB 3ES6B 1HEZA 3D85D 1RIUL 2HLAB 1TDQA 3WIHL 4KK5D 2ED8A 3KS0H 3DWTA 3IYLW 1L0QA 2JB5L 3RWHB 4L3EB 4PRPD 1HIMH 3VFSB 3DV4B 3DETD 4MNQD 3VD7A 4PG2C 1U3JA 2VXSL 4CNIB 2VXQH 3RWFB 4OCWH 2CQVA 4X98B 5K9KB 1Q0XL 3OKDB 4IBLT 4OLUH 1NCWH 1ERNA 2G75B 2PUQT 4S1DC 4YHIA 3VFRB 2UYLB 2R0WH 5ICXA 3S5LA 3FO9B 4CVXB 2NW3A 3VXTB 4GQPH 4PV9A 1EV2E 3DUUB 1U8HA 2ZSWA 5C08B 5BZDB 3WS3A 5EC1A 4LSUH 4L9LA 2F54D 4MJ6B 1HHKA 3PWPB 2H32A 5CIPH 3VMPA 3CVIL 1G9MH 4JM4L 4M1DL 4CBPA 4EBQH 1W0WA 3QDJE 3DROB 3QFJE 3SE9H 5ALBH 3QUMH 4WNQA 4WTWA 4PJHF 2PW1B 4JB9H 2MHAA 3KYKL 4R97B 3UCRA 1P4LB 5ITBL 1HHGA 1FNSL 4KMTH 1G6RB 2Y7QB 4P2RB 4HGWA 3TVMB 1NC4D 4N0YL 2CO6B 3FFCB 5ITFA 4R6UA 1I1FA 5CFHA 4IDJH 3MLUL 3FN0H 3Q3GA 3DUSA 2QADC 4FXKB 1JV5B 2XKSA 1E4XH 1ZSDA 2E8YA 3D0LB 1IC4H 4KKAD 3U7WH 1U8NB 2BHZA 5FKAB 4Y4FB 1OSPH 2XWJA 3ULVC 3K46A 3UO1H 3VCLA 4D94A 2M2DA 3CNKA 5DWUH 4IIQC 4ISVB 2QSCL 4E5XA 4U3XA 3VXSD 5C08E 4XCCL 3UBXB 3V5HB 3VG0H 5JA9A 4Y5XB 3VWKB 1UWEH 3U36B 2ADJA 3O3UN 2QEJA 3PWPE 5ILTH 3TO4B 4JY6B 3FRUA 3W9EA 1MIEL 3GJEB 4JFXA 4R96A 4GUPB 5DQJB 1D9KD 4PJ7F 1ZANH 4TRPH 1WITA 5T1MB 3MZGB 1EJOH 5SWQA 5EOCH 2V5TA 3KJ6L 1S7QA 3QRGL 4WW2C 3U9PH 3FAXA 5C0JB 3CFBB 1ZGLM 1IGMH 3O3BB 4O51B 4C56B 1YNTA 1DBBL 2MTPA 3TYFB 4OGYL 1OQXA 1ZHKB 4UOJA 5ERWB 5FM8A 3FFCE 1KELH 3LEVH 1PYWB 4IRJA 4E0RA 2EDNA 5JOFB 4O02L 4XXCA 4HS3A 3ZTJG 3JSSA 4IRZL 2P5WD 4AQOA 4F2MB 5GGQH 4RGOL 5DQ9B 1N4XH 2CRIA 1YJDC 4NFCA 4RWYH 4EDWL 3EDJA 4XWOC 3U7AA 3PL6C 2X6MA 4TVPL 1P7QB 4G6KL 1LDSA 5KG9A 4FQ1L 3RVWD 1S7VB 4OD3H 3P0VL 2A38A 1I7ZB 4ONGH 5JDSB 5HBBA 3WL9A 1Q9OB 2JF1A 4M1GL 4FFYL 3BPCA 3UJIH 4BQ9A 1QA9A 3QUZA 4YXKL 2EDRA 1T5WA 1X6NA 5EORH 4XTRD 4PJ7A 2DQCL 1JYWA 2IC2A 5I8KH 1N0XH 5JHDD 4OLVL 3GMPA 3JTSB 4MAYB 4LNRA 4J3TA 2VDLH 4QF1B 1BVKA 4X4MA 5BXFB 3B9AA 1A7OH 1OPGL 4FXGA 1F6FB 1I3VA 1XCQB 5D2NB 1GGBH 5FYLE 2R0ZH 3BZDA 3BZ4A 4C56E 4LHUA 3IRPX 3I2CH 4NQDA 1CGSL 2PNDA 1CXFA 3IDXH 4TNVK 4XPAH 4ZD3L 4QXTA 1FYTD 1F45A 1CDUA 3O9WD 3I75B 3CC5B 3A6BH 4PB9L 2WZPD 1CU4H 3P9LB 2CUIA 1P69B 4LFHD 3NBNA 5CCKH 3LSOA 5DUMH 4Y5YB 4U3CA 1CBVH 1CGUA 2Y4SA 1XIWA 4GKSB 3SGEH 3K2MC 4KHTH 4DKFH 5FHBH 4K3DL 3MXWH 3MLPA 3WIHH 1UM4H 4HJGA 2KL6A 1ONQB 4JFFB 3P9MB 4OUUB 2B4CL 2PF6A 2AV1A 5I8CB 2JB5H 4MNGB 4XCEA 2X4QA 1U0QA 1JGVL 1F58L 2HFGL 1EX0A 2VIRB 1H3WM 4E41D 1U8OB 2EZ0D 5JO5A 5GZOD 4LRIA 2X2YA 3JWDL 5I74B 1VGKA 5CINL 1IC7L 1KJVA 3UPRB 4X7EC 4TNWK 1DBMH 5D2NE 3VFGL 3O0RH 5KSBA 4BSVA 3K8LA 2AERT 2VLJA 4LPXA 4NSKB 3SKMA 1UWXH 5GGUB 1MHCB 2N7BA 4JRYA 3ARFD 4FG6D 4HIEA 5T3ZE 3OJDB 1N5YL 5GSRA 3OZ9L 3SDCD 3TBYA 1DN2A 4N0FA 4ZXBA 4L4VB 1IAMA 4XNMB 1NGQL 3CVIH 4JM4H 1S7WB 2VZUA 5BS0D 3SDYL 1J8HD 4PJEF 2AJZA 5DS8B 5LGKA 3L95A 1KYOK 4D3CL 1FFPA 5I0ZA 4HPOL 2WWMC 4Q6IA 3KYKH 2X4PB 2PR4H 1FGVL 5DMJB 3GNML 5K59E 5A3IC 1GL4B 2X4SB 1FNSH 3RHWK 1I9JL 1JZ3A 4IRSD 4JFFE 4N90D 5ISZA 4HWZB 4EUPH 1IL1A 3MLUH 1UJ3C 4GW5B 4ZO8A 3S36L 2DQHL 3HFML 3VXUD 1IBGL 5IW1A 1YA5A 1HOCA 2IQ9L 5FYJH 4PJCB 3A6CL 2R4SL 2Q3AA 4K07A 3GMRB 3ZTNL 3QEUB 4J3XA 4PJ8B 1OP5H 5KS9A 5J0BA 4RDQG 1HSAA 4D2NA 4F57L 3T8XB 3BP4B 4TTDC 1BMGA 1VFBA 5I1JL 4DTGH 2RHEA 5I19L 2FECI 2R2EB 3EHBC 1SHMA 2P42B 5CD5C 5FKPA 1HN1A 4PJDA 4LVNC 5C09B 4YHYC 1S9WA 1MIEH 1UFUA 1RZ8B 5IG7A 1NAML 1OW0C 1M05B 2EO9A 4RGNC 4LLYA 3E8UL 3ZT6A 3EYVA 4WWKB 4UV7L 3KJ6H 3DOSA 4JZJA 3QRGH 1QSFB 1P9MA 1OP9A 1T1WA 2X4OA 4LKXB 4OV6F 4WI9A 3GSRB 1RJZB 3SKUD 1DTUA 3P30L 4ONFH 2FL5A 2HVKA 3ARBC 4ENED 2NY2D 2G9HB 3ARDA 4BFIA 4O02H 1WTLA 4PTUA 4LPVA 5AAWA 2W9LA 2A73A 2P7TB 5DJZB 5HDBE 4EQ3A 4XMLL 3GKWL 4PJCE 4EDWH 1P6AB 2NY3D 2WBJB 1I1AD 4HIIA 4WWID 2VABA 4TVPH 2F9BT 3P4MB 4G6KH 4FQ1H 5L2JB 4TUOB 1PVHA 4EIGB 1DEEB 4U1MA 4JPIA 4K8RD 1PW3A 3QUXD 4MCZA 4FFYH 4HS6A 2NY4C 3WKML 2EYRB 4UT6L 5GGVH 2DI9A 5JIPA 1HILA 1HWHB 3LIZL 3GSVA 1IEBA 4WTXA 1CDHA 1UYWL 4OLVH 1RQ5A 4N8CL 1CE1L 4OV5B 3LD8B 1G7LB 3KLAB 3IFLH 3WNNA 4NC1E 5BW7C 4GKZA 1S9KC 3WE6A 5GGRY 2PYFA 1QLFB 1QSFE 3BIBX 3MO1A 3C60A 4Q2ZA 3X17A 3HNTL 2HFEB 3TN0D 1T04B 1KCUL 4F3FB 4YPGB 3IXAB 3TZVA 3DI3B 1FO0L 3DMMA 3GMOA 4XNQB 3WNMA 4MS8C 1O0VA 3RWJB 4QRRA 1FFOB 3VA2C 4ZD3H 1N0LA 3W2DH 2UUDK 2OR8A 2YK1L 5DJYB 1QYGL 4PY8J 2EICA 4J12A 5K9QG 2PW2B 3WJLA 1PY9A 4MJIE 5D7JC 1BECA 4S1SL 3K8MA 2FIRT 3ZZ1A 5T5NG 5ABDE 1CVRA 4K3DH 4X5XA 1PBYA 1RULL 1DSFH 4PJFF 2NQCA 3PWVB 4GBXA 3VXRB 4F80A 3WJJA 4TSBH 3QUKB 1A0QH 2CLZB 2IJ0C 4DEPB 3CX2A 3LKOB 1JGVH 1F58H 1VFAA 4LQFH 4XBGA 1A1MA 3IKCB 1J0IA 1DJSA 4FQIH 1F6AB 2OQJA 3DRTA 4MDIB 4NZUL 2MNUA 4Z77A 3MBEA 1KJ2L 5HYSG 1J0JA 1ZLWH 3O8XB 3D39D 4HH9A 3Q3GB 5DURB 1NDGA 3IDNA 1HNFA 1X5YA 1IC7H 4JG0H 1EGJA 3STZB 5D7LA 2R1WA 4JM2C 3TA3C 1KLGB 2DLFL 3KS0J 3BD5A 4H1LA 4MJ5A 4HWBA 1K5NA 4C57C 1FZOB 2Y06L 3DURA 4MA3B 1XGPA 3W9DA 1ZS8B 5D1QD 1RUMH 4MQ7A 4V1DA 1DUYA 4ZMAT 3QXUA 4FZ8L 1N5YH 4U7SA 3OZ9H 4ONHA 2HAZA 3TJEH 1NGQH 3D3VA 1JZ2A 3SDYH 1B0GA 2WUBL 3O4LB 3V4UL 5J89A 1L7IL 4Q9CA 2K3TA 3QQ4B 4PJFA 4D3CH 4PJHB 1NMAH 3U9UB 2HYMA 4FFZH 3HC3H 1ZT4B 3BXNA 3VXRE 4HPYL 1RD6A 1JHKH 4P9HL 2ATKB 3WFEL 1OHQA 4OGAD 4WI3A 4LARL 4Q9BA 1KBGH 5A40E 2DQHH 3SGKA 1IBGH 5T1DL 1W0VB 5DJ8A 1JTOA 2ADGA 3N06B 4F7PB 1OQOA 3U46A 3OR6A 1JE6A 2ICCA 2Y6SC 5EO9B 4F57H 4LRNH 4FXLA 2VQ1B 4OM0L 3K4DA 4KQ4H 2L0DA 4WTZG 1JK8A 1NCCL 3UTSA 2ZKHL 3SJVE 5JORA 3A67L 1HQ4A 3MR9B 3QIBC 2W59A 3NAAL 3UYRL 1FFNA 3ULVE 3GJFB 3RVTD 4FTVB 2AKRA 4M1CD 2NW2A 1P4IL 1NAMH 3O4LE 3MJ8A 1T4KA 1LNUB 3U0TA 4YHML 2V7NA 4HWUA 1F2XK 1ADQA 3NFNB 4BFEA 2JJTC 3LVEA 1VHPA 2EDLA 4YDKL 5DVLA 3VXMA 5MEOB 3P30H 1PGRB 1HHHB 4B5EA 2BNRB 1B2WL 5I1HL 1OTSC 1BHGA 4X6BA 3T77A 4GOSA 3EUUA 1JGEB 4U1HA 5KVFH 2IAMD 3WLBB 4IM8A 2HFFA 4XMLH 4GKOA 1R3LA 3VFOB 1FCCA 5EOCJ 2UY6A 4LIQL 2F53B 1FNEA 3IB4A 3AU1A 3NACL 1UVQB 2P44B 5ESAA 1MFEH 2R2BA 3I6KA 5C0AD 4UBDC 4MXWL 5CSGA 3NIDF 4X7TB 1FP5A 1SQ2N 5T33L 4BZ2L 3BZFB 1DZBA 3ZE1F 3NOIA 4J6RL 1Z9LA 5IQ7H 4KAQH 3CDFA 1KIPB 3LIZH 4R4FH 3UYOD 3ULUL 1X7QB 4LLQA 2ITDA 3RTQD 5EN2A 1DBKL 5CEYA 1UXSB 4FTVE 5BRZD 2CKBL 4DN4L 2P48B 4I48B 4MCYB 4NKMB 1I7TB 3P0GB 4NHCL 1XGTB 5DDHA 2P8MA 4KK8D 3RUGF 1C16A 3E2HC 4G3YH 3HNTH 4PJAF 1MJ8L 1KCUH 3DARA 3MRDB 3H9SE 3DETC 1GC1H 4F7CB 3B2VL 2FDBP 3HRZA 3FO2B 3NN8B 5E7FA 1QACA 1U8JA 2XZAL 3OKMA 1FRGH 2YK1H 1QYGH 1BF8A 5DUBA 4KRPB 4H88H 4K7PH 3ROLB 1H3XA 4F7TB 4EI6B 2F53E 3HS0A 2XTJB 2VXVH 1HH9A 4ZXBB 1T3FA 3H2WA 1QRND 1WFUA 3CGTA 2VLKD 1CGVA 3UJJH 3E3QC 5FIEA 4I0PA 4P3DB 1Z9SA 2NY0B 3KHOA 5D4QA 3TBTB 3U83A 1Z3GL 1PZ5A 1JNLL 5D6CA 4ZPVA 1YEHL 3DX7A 4GSDL 2BNUB 3SQOL 3MSPA 4EXPX 4FQQB 3T2OA 1KJ2H 4NN7C 1CIDA 4Y2DC 2UWEF 1UGNA 3RUGA 1IE5A 5GS0C 3R8BB 5HHNB 5IUSA 1S7XB 5F96L 1YN7B 2XN9A 4HQQL 3AS2A 1OWWA 1UJ3B 4PIRF 2ZCHL 1B0RA 1ZLVK 3IU3B 1BWMA 4UMGA 4PRAA 2Y06H 3AY4A 4P4KD 5EU6D 2F5BL 1YN6A 3VJ6A 4HHAA 5GS2D 4JFEB 5FGBA 3P11L 2ZUQB 4FZ8H 4AENB 4ZO7A 3RVXD 2NMSA 1UXWA 2YRLA 1DLHA 4K2UL 4RRPA 5IV2A 3KG5A 4PJEB 2XTJE 1RPQA 4X4XB 4YDLC 1L7IH 1I8KB 1QSVA 4MZ3A 2M1KA 5E8EB 3UPAA 2OTPA 4LMQE 4YHKH 1IRAY 1BM3H 2C9AA 4H20L 2EIZA 4BM7A 4FS0A 1AGCA 3EYFB 4K23H 3DTXB 5CGTA 4PJGB 1BD2D 4P9HH 4APQD 3WFEH 3OKOA 4LARH 4NNPL 1MCDA 4W4OC 2XKUA 4GQ9L 3HR5B 3VE0B 4UTAH 3BYYA 3GSNL 3VFMB 4MQSB 2VLME 1JGDA 1JRHI 4MB3A 4HGMA 4UNVA 5B8CA 4GW1A 4OKVB 1CICC 4D0BA 3BEWB 3L3HB 2DQJL 5DD1L 3EOTH 1CLZL 1CDBA 2QQQA 4NHUB 3RGVD 4OM0H 3EZJB 4PRBB 2ZKHH 2WLZA 2OX5A 5DEGA 3RNKB 1VSCA 3CFKB 4JFEE 4Y4KD 1BQHA 1Q8MA 3QUYA 3UYRH 5CBAA 4YE4H 2AP2A 3RVWC 1P4IH 2GIYA 3ESVF 1FZMB 3QBTB 5HVWA 5GGTA 4YHMH 3RY6A 1S3KL 3C5ZC 4HK3N 5B38B 1QSZA 2VB5A 3O2VL 4KUCF 1LO0H 2NY4B 4MAUL 1B4JL 1AD9B 4QHKJ 4YDKH 1J05A 3L3IA 4PJGE 4UU9B 2XQYK 1B2WH 3HI1B 4Q7DA 5F3HB 5I1HH 3HZYA 4YK4B 1CGXA 5J56B 5FAAA 3X14A 5LAXB 1V7NH 4MB5A 2QHRL 4RFOL 1A6VL 4Z7UE 4GS7C 4CMHB 3NACH 3CH8A 3G9AB 4FABL 3MODL 2Q8BL 2DICA 5MEQA 4KXZH 1U95A 5FA3A 1T20A 2ZUWA 1Q94A 3ZSTA 2ZG1A 1VFUA 4MXWH 4DZBA 3GSOA 5T33H 3TBWB 4BZ2H 2A6KA 4EN3C 4GRLB 1AXTL 1QTYT 3RWEA 4P57B 1MCWW 5DHVB 3ULUH 5F7YC 2GCYB 2HJLA 4WI2A 3HZVA 5DJAB 4LPUA 5AYQA 2DBLH 3PUCA 3WFHB 1XFPA 4L8SC 1YYMH 3SE4A 5IJKC 3NCBB 4NHCH 5I1GL 1FCGA 4WENB 2KDGA 1JNHB 3ET9F 4JHBA 4LCWB 4XP6L 1MJ8H 1VEMA 1NMBH 1Q9LB 1HYSC 1RUQL 1ES0B 2I9TA 3B2VH 1XGYH 4UIMA 1CDCA 4EOWH 3V6FA 1A6AA 2XZAH 3BE1H 1DUZB 2LQRA 5F1NA 4CU6A 4ZAKC 1E4KA 1Y6KR 4JRWA 2IADA 3IJYA 4YBQD 3TA3B 5CUSH 1G9EA 4HXAL 3GUTB 3L1OH 2PTUA 3QDMD 3Q1SL 3BGAA 4I5BB 1NUDA 3MV9E 1MREL 4WUUD 4GKNB 2O26U 4QRSB 5F1SA 4MMXC 1EHLH 5CGYD 5HYEA 3AMKA 1RJCA 4NQXA 2FJHA 4JKWA 4PRHD 1A6TB 2DJUA 1Z3GH 4HDIA 1FNAA 1P7KB 4BUGA 2EKSA 1QBBA 1WBYA 3SQOH 3G9VA 5CJOL 1J0KA 5E8PA 5E9DE 2LVCA 3WIFB 1LO4L 3OXSB 4YNYB 3O6ML 3VXQA 4YHLH 2JCCA 4F8TA 1N59B 4G43A 5E5MB 3IDMA 4IRSC 1DVFD 5GGRB 4M61A 4HQQH 4N8VB 5CLTA 4QO1A 3RBSA 3EW3B 1NBYA 3SKNA 2VISA 5FA4A 1CL7L 2F5BH 1IGTB 2DMBA 4ZODA 5JXEA 3SCMB 4U49A 1I8MB 5C2BL 1U93A 3PP3K 3QQ9C 3QUMA 5MEPB 1IGYB 1UT9A 2NZ9D 1DANU 3TNMB 1T0NA 2AJSL 4PGDA 5IFJA 4WO4A 4R7NB 3LN5A 1IGIL 2HVJA 4CN4A 3ZYOA 1F11B 4PGEA 2D03L 5EBLB 3RL1B 5BV7L 3C8KA 4M5YH 4JVWA 5MHSE 4HV8B 2MFNA 4P5MB 3F6IA 3NFSH 5D2LE 1WEJL 5IROC 1JIBA 2NTFB 5HDLA 3LKSB 1PG7X 2C3WA 4MSWA 3U79A 3GSNH 5TDNB 5J1SC 3LKPB 2GY5A 3P4OA 2YA0A 1ZMYA 1TJIL 3HCVA 2I07A 3KPRB 1AHWA 1J1XH 3HZKB 1OSZA 1KN2L 3STLB 4C83A 2D7PA 4LEXL 2VH5L 5FOBB 3CFJA 4HZLA 5I18L 3GIVB 1J5OH 4XNYH 1MPAL 2HKFL 4HUXA 1NFIA 2EDQA 2I9LB 3PQYA 4PJIB 4DCQB 5CGMA 1FL5A 3FB5B 5DD0H 1EVUA 1JF6A 3P4LA 1X4XA 3P73B 4X0KA 1ZE3C 4BH7B 1KB5B 4ZNEE 3KPPB 1CT8B 4LP4A 2CIIA 5C0CA 4KK9C 1KB9J 3RFZC 3UTOA 2CO7B 1J0ZA 2DQUH 2LVEA 1ZKAA 4FQXB 3QEHA 1MCOL 3V0WL 1S8DA 1MAKA 2ZUSA 4P2YA 3O2WL 5F21B 1I1AA 4PB0L 3H7BA 4P9ML 3TLRA 3KYNA 4MAUH 3ESUF 1B4JH 3MRJA 4K3JL 1NEZG 4E9LA 3TT1L 5T1KB 3T0EC 1C7SA 5T3XH 1I3GL 4JY5L 2NZIA 3NIFF 1FPTL 2GUOB 3QG6B 4LHJB 5IQ9B 4JRXB 1YEEH 3C9NB 5AYUL 3D85B 4XGZA 3CPLB 5EFIA 4POZC 4XCNA 3F7YA 1T7WA 3ILQD 1Y6NR 3JWOC 2GITA 4PY7A 3E2HB 4HKXA 1JPTL 3O3EA 3W0WD 1U8KB 4PRPB 4MNQB 1U42A 5E1HB 1XR8A 2VC2H 4G9FA 4S2SA 1FV1B 2Q6WA 1T3FB 2PCPB 3U30B 4PJIE 5I76B 1ZHLB 1AXTH 2AEQH 2F19H 2X9XA 4JFQA 4LLVA 1LD9A 1BQSA 5H37G 5TDPB 5M94B 5GRZA 4UB0H 4DUXA 4Z7NF 4JJ5A 2W60B 1XR9A 3MJ6A 2PXYD 4UOW1 5DEZA 5K9JH 5GRXG 4WFED 1XMWA 43C9A 4R9HA 2W0KA 2D31B 3C6LD 2F54B 4ZFOA 5I1GH 4ZS6D 1SY6H 1OY3B 1QHOA 3EBAA 1AFVL 2WK2A 2FB4H 4PJAB 4WFHD 1K8IB 3WUWG 2AK4A 1OP3H 4I9WD 1IVLA 2VLRE 2H8PA 2IQAB 4HJJH 2DQDL 5FV2A 1A4JB 2CRYA 3VD9A 1MFDL 4YUEH 2IFFL 3WYRA 1C8PA 4PRIE 2B8OT 4L9LC 4QNPF 2V2TB 3B43A 1W72L 5FK9A 1S7UA 1U2CA 1ZVSA 4H0IA 1NC4B 1HSBA 4OLXL 2IH3B 2ZUVA 4NN6B 5FO9A 1YNLL 3WIHA 5HGGS 5JZ7D 2R15A 1LEGA 1MY5A 1TFHA 4MNQE 1UC6A 1NH6A 2J88L 5D1QC 4JZOA 7FABH 5D71L 1RZJC 4N5EC 5JOEA 2KQNA 1H15A 4DVRL 2PYEB 4GAYA 4Z7WF 4WV1B 4ZUVB 1AD0A 1I7RB 5J12B 4NZJA 4P23D 4PR5A 3UJTH 4MDJB 4CN1A 4H5SB 1QQDA 1LO4H 3G08A 2X4UB 5FM4A 2UWEB 2I27N 3G5ZB 2ESVA 4KI1A 3VXSB 3W39A 4HEPG 3BKYL 4A6YL 2DYPA 4JREB 2F54E 1Z0MA 2IPKB 1RZGA 2AEIT 4O58L 1GRWA 1D9KB 5JOPE 4ZUWA 3GGWA 3DO7B 2IBGA 1XGUB 4OCNC 2YC1B 2VXUL 1UM6L 1E0OB 1FSKC 2SEBA 3WHXA 2ZNWA 3MRLA 3OKLB 2FBJL 2GK2A 2VZVA 5IB1B 3ARGA 3BP7A 3IJHA 4Q9RL 4DAGL 4XRCB 5CHNB 3HG1D 3MRGB 3ARXA 2FGWH 3F7PC 1MHEB 4U05A 4EUPA 1IGIH 2P5WB 1BPVA 2XICA 1CE6A 5GRUL 2D03H 4NO2A 3EYQC 4Z7WA 5BV7H 4Q9QL 3T1FA 3ILPA 5DTFB 2IALB 1PX4A 3HI6L 4XMPH 4OI8A 3NCJL 2PYEE 2ENSA 2HT3C 5EIIA 1YDPB 1J05B 3V6OA 2WIIA 3FQRB 1DBAH 4IRJC 1U9KA 5EOTB 1KJMA 2UY7A 3KYOB 3UXFA 3AB0C 4XXCC 5SX4I 2OJZL 5T1LD 3VI3F 4ODWB 2YEZB 1CYGA 4ZQKB 5GXBB 4XVTL 5EO1A 2VLLA 1CXEA 2DQFB 4YHNB 1AE6L 5I18H 1G7PA 4Y88A 3EGSA 3DX9A 1WAAF 1G7MA 3FQTA 1MPAH 5D9SA 1GGCH 2HKFH 3JXAA 5JHDB 2FH6A 3QQ3A 3BRDA 2JJSA 1H0DB 1FBIH 1F4XL 2VJXA 5DJ6A 4GG8A 4DZBB 5DRWB 3QUZC 1U8IA 3DVNB 3UC0L 1QSEA 2P8PA 3RVVD 2P47B 4YHPB 4HT1L 3QO1B 3OKNB 1OB1B 1G7IA 1KV3A 3N0PB 3LEXB 2JELH 3WXVL 1IAIH 1Q38A 4PGCB 3QXDB 3V0WH 4YFEA 4OFPA 5KSVB 4M4PA 3O2WH 1FYTB 1BFVH 2P5WE 2J8UA 3N1QC 5C2UB 3P0YL 3O9WB 4PB0H 4HG4J 1A7QH 2AXFA 2XFXB 4K3JH 5JW4Q 3MNWB 1NANH 1R3KA 1U8PA 2H3NB 1WZKA 2DD8L 3WO3B 3TT1H 3RZCA 4GRWF 3T3ME 1H3TA 1BZQK 5E5RB 1TPXC 5E0QA 5JLZA 3VFPA 3X3FL 2O5YL 4G7VL 3NFPB 1KFAL 2AW2A 1QR4A 3WKNA 4OZFH 1UZ8A 1RIHL 4PJ9C 3MGOA 4PV8A 5HDQH 4G9DA 4MQTB 1INQB 1MJ7L 3RIFK 3RTQA 1PDKA 1JPTH 1R5VA 5BRZA 2E7LA 3M17A 2BC4A 4FHBD 2Z92B 1PSKL 2X4NA 3BVNB 4E41B 2HTKC 4LLMB 2YPKB 1XIWC 3IF1B 3W5NA 3VRJB 1CN4A 4OCLC 1BVLB 4NRZB 4XC1L 1WZ1L 3IDYC 3UTPD 1A1NA 3B8YA 3VG9B 2EXWD 2MCPH 5ANMA 5ESQB 1FVDA 2R9HC 3OV6A 4FMFA 3CMOL 4K94L 5JUEL 5C0FB 2FJHB 1T5XB 1G6RL 4P59L 5D7SL 2DIJA 3ARFB 4LRIC 2YRZA 1R24B 1Z0NA 4HW6A 5E6IA 4G8GA 1F3DH 4NQCE 5F9OH 3SDCB 5ELIA 1U8MB 2BVTA 1MJUH 1AJ7H 1BZ7A 1TCRA 5BS0B 1J8HB 1EAPA 4J3SA 5DD6A 2QV2A 3IFOB 1LO5B 4POUB 3MJ7B 5FUZH 1ZA6B 1DP0A 1OCWL 3WNKA 3MRKB 1DBJL 3CVHL 4N0UA 5CP3A 1FIGL 3BW9B 3E6FA 3G04B 3G5VB 2M8XA 1W72H 1RK1A 4IRSB 3GBML 4OLXH 1YNLH 1P1ZB 4JFDA 4LCYB 4UDTB 3OKKB 1YEFL 4ACPA 3VXUB 3REVB 1BQUA 1CF8H 4E41E 2J88H 1L7TL 2VNCA 1K4DA 2J6EL 3GHBL 4HK0B 4Q6IC 1JHLH 5D71H 4NQEA 1TZHA 4DVRH 1AQDB 3PHOB 4MWFB 4XZUB 1NGXB 3QWOA 5IR1B 1KACB 2X7LA 1MCPL 3IRZA 4P4KA 3IDIB 5DO2C 5FYLL 1EO8H 3R06B 1CFNB 1WIUA 1T89A 3QFDA 5E94B 3MV8D 5DFWH 2XV6B 3L3DB 1YYLH 1TQCB 1LE9A 4ZFZA 5TE6H 2Y72A 3KXFD 3RY4A 1V3KA 4O58H 3L6FA 2AV7A 2H2PC 3WXWL 5BS0E 1N2RA 1J8HE 1BREA 4JKPL 3O6FA 4YGAB 1KEGL 4MD5B 3ULSA 3MYZA 2VXUH 1UM6H 2CGRH 3EOBB 1ZOXA 4JAMA 2AEPL 4JDVA 5F9JB 2A6IB 4QHLA 5EU7C 4Q9RH 4DAGH 4F7EB 3GMQA 4KI5D 1A9EA 4JZNA 3QEQD 3ARQA 2NY2B 4S1RL 4XBPA 5ETUA 2ARJB 4ZFGL 1LEIB 5ACMA 2OM5A 1P2CB 4M7KL 2CDEA 4O2FB 4Q9QH 5F7DB 4YR6B 1P9MC 2NY3B 3VFNB 3NCJH 1A4KB 5E2VL 4CUCA 1QFWM 2E7BA 1CXHA 4QHUB 4QTHA 1MCJA 3QI9D 2OJZH 1F4AA 3EO1A 3QUXB 2D3VA 3MYJB 2RAMA 3DVGA 4BH8B 2O93L 4XVTH 4G6AD 3RU8L 1AGDA 3DX8A 5T3ZL 4PLKC 3BIAX 1EEZA 2RCSL 1U8LA 1T0PB 2F5AL 3EYUL 4WRLA 5E4EC 4XP5H 2E27L 4KKCC 4NIKB 5F97E 2BMKB 5EBWB 2V9RA 3R1GL 3G6JA 3O41A 1F4XH 4I18A 3B4NA 3BESR 3LEYL 1FN4A 1NAMA 2X4RA 3L3KA 4AM0B 2HLFD 2W65A 4IMLB 4KROD 5IMLA 3G5XA 3UC0H 3QNXA 3TN0B 5IW6A 5DRZB 3VGAC 3CCHB 3QWRD 2Y5TA 3KPOB 1MFBL 3AXLB 3P0YH 4Z7QE 5IB4B 2Z91B 4OCRH 3T65A 5DEFB 4HH8A 3KLHD 2VDNH 3V9FA 2DD8H 4JY4A 3VGDA 1BOGB 5AZ2L 1ZAGA 3C60C 3JTTA 2KUTA 2D0HA 1KCRH 2Z8WC 3X3FH 4G7VH 1AQKH 3DRQB 5KOVC 4PG9B 1N8ZA 4LSVL 2GJJA 3Q6FB 5I1KH 1KFAH 4YXHL 3TZVC 3DMMC 1S9XA 1S78D 3EFFB 2VAAB 5DC9B 3FTGB 4QRTA 4P5KB 3RWIB 4XP4L 4U6YA 4NNYB 5D5MA 4OIAA 1INDH 3V4PL 3WJLC 3ZE0F 3T0EE 1FZKA 2OZ4L 4FN0A 5HYJD 1EXUB 2C5DC 3F58L 5DRNB 4F33B 2X44D 3D39B 1LEKA 3TIDB 2AGJL 5EIVA 2CK2A 1ZGLA 1NBZB 3IJSB 3H42L 3PGFL 5A16B 4J3VA 4GBXC 1MHPL 1OT2A 2ICWI 3VI4F 3GHEH 4ZO6A 3CMOH 1EA9C 4K94H 2F74A 2W0PA 1YZZA 1NMCB 4Y1AA 2XPGA 2MQ3A 1EMTH 4YGVB 4P59H 2VQTA 3MBEC 5D7SH 1J1PL 5D1QB 4OCSH 2DLEA 4KQ3H 3BQUA 1RZKH 2BVQA 5FB8B 2GSGA 3QDMA 4BZYA 4CW1B 2R69L 1F90L 5CSZA 1U3ZA 3MOBH 4WUUA 1GCFA 2R56L 1CG9A 1BP3B 3SDAA 1J18A 4J4PA 1NUFA 2CMRL 1DBJH 3IFNL 3UEZA 4IS6A 1FIGH 2VE6A 3OXRB 3F6LA 5AUMB 1EFXD 1ZA3B 4IOIB 1UZ6E 3FZUD 4MYWB 2GK0B 4QWWC 3WHXB 32C2A 4NWTL 4N0CD 3U2SA 1EZVX 3JV6A 2A6JB 3CZFA 4KVCH 3H9HB 3K4ZA 2Q87A 2XY1A 3JV0A 4KMQA 5ICZB 2J6EH 3GHBH 4MHHG 3RWDA 5BQ7B 1VGEH 2HFTA 5E8OA 1KJ2A 3LQMA 5FDWA 3H7LA 4FFWD 4L3CA 4MMZC 4XMKL 1CLYH 4WI8A 1ED3B 2HMIC 3TH4T 4KJWD 3SGKC 2ZZUT 2EDTA 4BKLB 1FQ9C 3CH1B 2BERA 2E6PA 1U2HA 5IVOA 3F5WA 1J1OL 1XH3A 1KLUA 5F9WB 4RMRA 5C0BA 3OB0K 1MRDL 2NX5D 4JKPH 5IBUB 2IMNA 5SX5H 2LV4A 4PJXF 1G7JB 3CAFA 2IH1A 2IAND 2YSSB 3V6ZB 2KH2B 4J3OC 3B5TA 4YDVB 3BO8A 1BJMA 4S1RH 3GB7B 2FIKA 1YEIL 4BJLA 1AC6A 2DN7A 4J7RA 1L6ZA 4LAJH 5TGBA 2IAMB 4LDOB 5EU3A 2CJUL 4JPWH 4AIOA 1JPFB 4GAJL 5FO8B 2Z4QB 4P4RB 2W0FA 1I1YA 3PWLA 1KIRA 4X99A 5GJTL 3FB6A 1I9IL 2FEDC 3G6AA 3AREA 3FFDA 5C0AB 2Z35A 4UILL 1S5HA 1ORSB 4XX1E 2A0LC 1AIFB 1AO7D 5L9DH 5CJBA 4GW4A 1KIQB 2C3GA 2F58H 2RFXB 3QG7L 2RCSH 2F5AH 2FSEB 1IAOA 2JIXD 2QL1A 4KRNA 3F65A 1ZHBB 4PJXA 5CBEA 3AGVA 1WZLA 1LE5A 3R1GH 1GPOL 3N1GC 4JPKL 5C0IB 4WHTA 1S7SA 3NH7L 2CXKA 4KTYA 1U36A 2MQ0A 4PJ9B 2FYYA 5HVGB 1WBZA 3J7HA 5BOZG 3ULUF 3K3QA 4DOHB 3QJFB 5C0EA 1S7TB 5HD8C 3QDJD 5AZEL 1S9VB 3AAZA 2X70A 3QFJD 1BIIB 1NGYB 2EE6A 1PEWA 2XZCL 2QQNL 1AY1L 5GRYA 2YRPA 1DQDH 2GTWB 2ADIB 1T83A 4QLRA 5I1IL 3LKQB 3QNYA 4GRWB 5AZ2H 5LKNA 2ED7A 1LVEA 5GGSY 4O2CB 4JFYA 1GZPA 5JW4R 5HYQA 1QRNB 1K4CB 3PG2A 4LSVH 2VLKB 2XZQL 1H5BA 4YXHH 4ESKA 5C0AE 1JZ6A 1RURH 2HTLD 3IXTA 1KCSH 4Z78B 4ONOA 3BPLC 1IILE 5GRVL 5HI4C 4NYLB 4LSRL 3V4PH 4RMVA 1QR1A 1WAAE 5FV1L 5A2LH 2O5ZL 3ULVL 3C6LA 1X5LA 1ULVA 1XAUA 1QVOA 4GMTL 4ELMF 4DKEH 3B5GA 4Y16A 2CKBA 3IFPA 4I0PC 5IMKA 2FWOA 3UTTD 3VH8B 3MV11 3QZWG 4M5ZL 2ICWB 4UNTA 1UB5B 4HUUA 1F3RB 3O45A 5JHLL 2I26N 5EG6C 1P5UA 5ESVB 3QEGL 2XA3A 2X7LB 4XPBL 4G6JL 2UVFA 4IOFD 1RJYA 5EU6B 2FX9L 4XI5C 1FFQA 5SWSD 5D93C 4U2ZA 1CLOH 1GJIA 4M8VA 4PYGA 4OSUH 2R69H 1F90H 4KTEH 2E7HA 4PRDB 2C7UB 4M62L 4GRWE 2R56H 5KSAD 2LU4A 4GXUM 4NZTH 4X6CA 4AMKH 1NGWB 1VADB 3DXAA 4JG1L 4P2CG 1QRNE 3AY4C 3UTQA 2VLKE 5DSCA 1RI8A 5FECA 5FGBC 4U1LA 3TC9A 4POYA 4M43L 3S4SG 1TZIB 4PP1C 2VMFA 2FECL 5GZND 5DJCA 1AXSB 1BD2B 4APQB 1NC2D 1YJDL 3HB3D 5IB3B 1F3DJ 1D5IL 1I1RA 3KJ4B 2NY5L 2EC9U 4LAQL 3MRQB 3TBVB 4EI5D 2MPAH 4KGLA 5J6HA 3NA9H 4JRYE 3WN5A 3UTZB 3FB8B 1MSPA 1M71B 4Y8DC 2VKXA 3KPLB 1KCVL 2GEEA 2VL5B 4XMKH 5TF1L 2EE9A 3TO4D 3JV4A 2EYSB 2VUYA 3RGVB 2OJEA 1JMXA 2M26A 3OX8B 1KOAA 4O5LH 5A2IH 4DK3A 3TFKD 4Y4KB 4XBEL 5F1IB 1AP2B 2CDGA 5FYLD 2H1PH 5B8CC 1SJXA 1J1OH 5ISZE 5DK2B 4HCRH 4J1UB 4RDQF 1MRDH 1A7BA 5CWSB 5F88B 1BJ1H 1JWMB 3V95A 1FL3B 3TBSA 1A9BB 3WSQH 4I2XA 1SM3L 1Q9KB 3QUYC 1XGRB 2VYRE 1S9YB 4NKIL 3L7EB 1XF3A 5SWZA 2NLJA 1BD2E 1BZ9B 4GG6F 5KS9E 3B6SA 4L8BB 3ZDXF 3GI9H 3A6OA 3ARZA 1IEAB 1YEIH 3KPQB 4ODUB 3EOAA 3SDDA 1U8QB 4X80L 4Y89A 1EUUA 3WLWC 2W1NA 2CJUH 3HNVL 2R2HB 3GSNA 2BNQD 5CKAA 2WAHA 5EU7E 4RAHA 4NUGL 5GJTH 3RVVC 1ITBB 2FO4B 3TT3H 2PO6D 1UKQA 4PREB 3NCYP 4PTTB 5E8NB 1CGYA 2D7TL 3AROA 4NO3B 1R0AL 2B1AH 2F8OA 4N9GB 5BVPL 4ETYA 1UQSA 4JHWL 4AEHH 5LVEA 5CSBA 5D96B 3U7YL 5D7IF 3OF6D 3QG7H 5GSVB 1CFTB 1M6OA 4JHZA 2YMXL 5HI5D 4PUBL 4OCMC 5L2KA 1AXIB 3BGMA 4HLZH 1UB6A 4MVBD 4JPKH 2EYTB 2ARJQ 3HE6A 1J88A 4OF0A 3QXWA 5T3ZD 1G7HA 5FO7B 2OTUA 4WVRA 3REWA 3ZKXC 5B39B 4M93C 3GK8L 5B4MD 4GG6A 5C6TH 4U1NB 3FQWA 4NJAL 4HX1B 5AZEH 2K7PA 5DC0A 1IGCH 3ECBA 3K4AA 1G84A 4WDIA 5F7NC 2QR0A 4UINL 2F74B 4AYFA 1MVUA 2XZCH 1OAQH 3T08A 1HWGB 3SE4C 3V79C 3FQNB 1AY1H 4YQXL 1JZ7A 4ZUSB 4NT6A 5L7XH 4R26L 2GJZA 4P2OA 3CSYA 4U6XB 4ELKA 5LCVL 3T04D 1MRCH 1FO0B 1K2DB 3QDMB 4OCYL 3HPJB 1I3RA 3ZDZE 1ZWIA 1N5AA 5EPMB 5DQDL 3O6KL 3MUY1 5EUOF 1JCKA 3JWNC 3CFDB 3VGBA 5BJTB 3OR7B 1E4KC 4PRHB 1TENA 1AGBB 1VEOA 4FQHA 4O9HL 4OAWB 35C8L 5EC2B 2O61A 3VXNA 32C2B 2MKLC 5HYFA 4M9PA 1QFUL 2K9UA 4M7ZC 5IEKB 4QOKA 3FONB 1NDMA 3F12A 4GMTH 1TZGL 1IGJB 5T5NF 1A2YB 1MNUL 5DJDA 1DE4A 1M7DA 1XF4B 5JNYA 3TIEA 1DDHB 4GT7A 4YO0A 1DVFB 3H9YA 2XWBB 1KTLA 2APTA 3SOBL 2MJWA 1SY6A 5IM7B 5F7WC 1QLRA 3QEGH 2P5EA 3T0AA 4UT9H 4HFWB 4XPBH 4G6JH 4GH7B 5BCAA 1NL0H 1A6UL 2FX9H 3D1MC 25C8L 1H8SA 3AVEA 3AUVA 2F15A 3M07A 3MA7A 2DWDB 4LVOB 2C3HA 1N6QL 1UA6L 2LAAA 4M62H 2DKUA 3IETB 5D1ZA 1N26A 3BH9B 3VU2A 5C8JB 2VDPL 5E56A 1TTFA 3D2UB 3D48R 1G9MC 4L1HA 3VWJD 5EZJA 1WZMA 4HUNB 4MQXD 2LTQC 5JXEC 3MXVL 5IKCB 1YECL 3HPLB 4LKCB 4PJ8D 3MRFA 5HVFB 4F7MB 3IDJA 3I02A 1D5IH 1T1YB 3TH2T 4QRPD 4BA8A 2IF7A 3V7AE 5DD3H 1IM3B 2CK0L 2NY5H 3QISA 4WO4C 3GJFH 4RFEA 3V7MA 3LRSA 5DZLA 3D18A 4WIQA 2OSLB 5J9PA 3MFFA 4ZPTA 3P40A 2OTWA 3LKRA 2ORBH 2APBA 2YUXA 2Z9TA 5IBTH 3KR3L 1I7UB 3MUJA 1I1CA 1KCVH 2LABA 4L29A 5TF1H 2YPLA 2R4RL 3D3VE 1UWXK 4L3AA 5C07D 1WICA 2VTFA 4MXVF 5ICYA 4NQSA 1YQVL 5ECJE 4JFHE 5DHYA 3IS1X 1RK0B 3UYPA 4XBEH 4KGJA 1AHWC 1FNGB 4U1SB 5FF6A 3OBAA 4WEUD 3DGGA 2Z31A 2AK1L 1KN4H 1FZJA 4F9LA 3WEXB 5JQ6L 4RMUA 4Y4HD 4HS8H 4OFYD 2DWEB 4M6OL 2DL2A 3GBNL 1CGWA 4Q0XL 4NO0A 3FL7A 1BBJA 1SM3H 4ODVL 1KPUB 2WV3A 4MJID 5F1KC 1NEUA 1GOGA 1MH5B 1OGAA 4GAGL 5F3BB 4HBQA 5EU5B 5DVOA 4QEGA 4GO6B 5IT2L 1SJEA 2ZPKH 3UTSE 4X80H 4PLJD 1YMMA 1IT9L 1YMHB 1FFRA 2V5SA 1OP5K 3OQ3B 1K3ZA 2CKNA 3DV6A 4NKDA 4PY8I 4MGXA 4W6XB 5JIHA 4NUGH 3W0WB 2BRQA 1JF1A 3HAEG 4D0DA 5BMFH 1PKQB 1LK2A 2D7TH 2YD3A 5C9KA 1R0AH 2KPNA 1I9RL 5GIRA 3U48A 3OHXB 1QP1A 2XWTA 3QPQC 4UIKL 4JHWH 3U7YH 4CADA 2HJFA 4Z76B 4P46A 4LOUC 3KLHC 2YMXH 4OIBA 4Y5VB 4WI5A 1U58B 4PUBH 1DQJA 3VXME 4XH2B 2H6PA 4U7MA 1JNNL 2PXYB 2QKIA 5DMIL 3TYGL 3VDAA 2BJMH 2ID5A 1G0XA 5JMOC 4S1DD 4UQ3A 3GK8H 1UG9A 4L8CA 4NJAH 2OK0L 1N3NB 3MTRA 4MJ2A 2EDBA 4K9EL 2Q3ZA 1T21B 2Y23A 3BWUC 4UINH 4YDJB 4P2QA 4OFIA 2A77L 3CDGA 2AS5M 1RSFA 1SMAA 4M6AA 3CSBA 2MWCA 4FQJL 4R26H 1EHXA 4OCXL 4OZFA 4L4TA 4XPGL 5EDXA 1JMZA 4OCYH 5ENWB 3KYMA 4NWUH 3O6LL 1PKQE 3L5WA 3QULB 4R0LA 3O6KH 5DURD 43CAA 3PJSA 3MFGB 2GJ6A 2XQYG 2CLVA 5JXAL 2C4FU 3EYOA 3WFZA 1X3DA 1JJUA 2OP4H 2GT9B 1KG0B 1SEBB 1LP9A 2VAJA 4X7SL 5K9QI 5B3JE 3QCUH 3QHZL 4P23B 1MELA 3WS6A 2QADD 4YDIL 5LQBL 3SJVD 2H9GA 3DSFL 2WBWB 4JN2B 1Z9MA 3S88L 5HHOA 1CQKA 4ELMB 4WFEE 5DI8A 1MNUH 5J6GB 1D5MB 3ULVD 5AWNL 4PJ5A 3RWCA 5DK0B 3V0AC 2IG2H 3O4LD 3RDTC 5C7XL 3FAWA 2PTTB 2DQIL 4LLUB 4U4BA 1YY9C 1EFXA 3FRPG 5DMKB 3ZHKA 4X5WA 25C8H 1NLDL 4M9OA 1FYHB 3S96A 3T4AA 1N6QH 1UA6H 1CL7I 5BVJB 3WHE0 3T2PA 1JRHL 3HC4L 1W72A 1EO5A 3HG1B 4K7FA 3PWUA 3PDGA 3U4EA 3GMLA 5GGSB 2B2XH 1JP5A 1OT1A 2Q86A 2WINA 3ETBF 2IBZX 3HMWL 3MXVH 1YECH 5DMGC 1FG9C 3TCLB 4MD4B 3ARGC 3OAZH 1UWGL 5GGVY 1KB5L 4KDTA 1F3JB 2FO1A 3SDXB 1MHHB 5GJSL 2XN9E 1KT2B 2CK0H 4XCYA 1ZLWK 5IB2B 3PIQA 2ZOLA 5T1LB 1MLBB 5EWIL 5HGHA 4UV4H 3LV3A 1QNZL 2UZIH 2GSIA 4XWOD 4BSWB 2R23A 3PL6D 1WQVT 3KR3H 3QIWA 5I6XC 3R0NA 2CR3A 3FT2A 3FCTB 3CX5K 4ODXB 3C5SA 2A2QT 4FMKA 3V6OC 3VMOA 4QY8B 4R7DA 4FRWA 5GS1A 1JGLL 1T7XA 1F13A 1D6EA 1QEWB 8FABA 3HZMA 1MI5A 3S5LG 2V2XA 2OCFD 2NXZC 1ORQB 4P3CL 2WMPA 4HXBH 3H9SD 3PDOB 2JK5B 4RCAA 4ZDHA 1FGNL 2R1YA 3HG1E 4M6OH 2JJSC 4WU7B 3FOMA 5KZCD 4HLZG 2FATL 3GBNH 1JWUA 1ZV5A 4UQ2A 4NPYA 4Z7VB 3MGTA 4PGZA 1K85A 2XYCA 3MNVA 5MI0C 15C8L 2OR9H 4NBXB 4QGTA 2CUMA 4GAGH 4NRYB 4QCIA 5INDA 4AQ1B 3SDXE 5DHVH 1TQBB 2R1XA 4OZGB 4MB4A 3RVUC 4PBXA 5TQ2H 4MNHA 5FCSH 4KJQC 5IT2H 1IT9H 5I17A 5HY9B 1YUHA 4QXUL 1BJ1J 1UCTA 1MY7A 3RZCC 2Q7YA 3EZ8A 5H94B 4JO1H 2BOBB 1XZ0B 5E99H 3VFVA 1L4IA 2ATPB 1I9RH 3MRIA 3BP5A 4U6HB 4UIKH 2NR6C 1U91B 5D7IB 3W81A 3TV3L 3OAYH 1VB9A 1TVHA 2EDWA 3R0MA 4O2EB 3L3JA 3ZT5A 3ES6A 5DMYA 2HLAA 4A2MA 1BEYH 3LDBC 5DMIH 5IEHB 4LSQL 5J57B 3BKCH 4NZRL 2CXGA 4NZDA 5JQHC 4LCUB 5IBLC 3RWHA 4L3EA 4Z7VE 2AJXL 3DV4A 3VFSA 2OK0H 2Q8AL 2IPUK 4CNIA 4K9EH 4U0RC 3RWFA 3K74B 4XX1G 4X98A 5K9KA 5BZWB 3OKDA 1FE8L 4OD1L 2X89A 4M7ZB 2DBJA 1C12B 4OZGE 4ZOCA 2QHLA 4N68A 3VFRA 2UYLA 3ZKMC 3FMGL 4OB5L 3TNNB 4LF3B 5E6IC 2V7HB 4OCXH 2E8ZA 3FO9A 4MJ4A 4CVXA 3VXTA 3MROB 4XT1C 2ZCKL 3KPSD 2N4IA 3QCTL 3DUUA 5BZDA 5C08A 1EUTA 1A6ZB 3O6LH 4RX4D 2VDKL 2DTMH 4MJ6A 3K2UH 2HWZL 2WWMD 5M95B 5EUOB 3LQAL 3PWPA 2OL3B 5E00B 1NGZB 5A3ID 5IMOB 5D1XD 1ZLSL 3UTPE 3DROA 2OS7A 1G0YR 2VDOH 2FHCA 2B7DT 4CVWA 2PW1A 3DNKA 1O5DT 3H3PH 5IVXB 4Y19D 5CIPB 5I1DB 4RFNC 4YDIH 4BELD 1P4LA 4M03A 3K8KA 1G6RA 2A74B 1NLBL 2Y7QA 4HMCA 4P2RA 2K1MA 3MV8B 3TVMA 3X12B 3FFCA 4R8WL 2HH0H 5GZNC 2ZUUA 5AWNH 3PXHA 3KXFB 3P77B 1KIUA 1MJJB 4FXKA 3WUZA 1JV5A 5F7LB 1UENA 3D0LA 4HF5L 4FA8A 5C7XH 1KPRB 1WIPA 4F9PA 4TTDD 1RHHB 1U8NA 3WDHA 5FKAA 1U41A 1FLRH 3EHBD 5HYSB 4Y4FA 4WU5B 1T89C 4I3GA 4X4YB 5CD5D 4Z8FL 3MJ9H 5IESL 2GFBB 2YD5A 4LHUG 4P0DA 3WD5H 3PWNB 1IZJA 1JRHH 4ISVA 3QEQB 4YC2B 3V5HA 5DYOB 3UBXA 4CVZB 4Y5XA 4RGND 3VWKA 3TPUB 3O6FC 1KJ3L 3U36A 5ACLA 4CJ1A 2NXYC 4OLZH 3GM0A 3CLEH 2AAVA 1WC7B 3O11B 3TO4A 4JY6A 2JCCE 3HMWH 3GJEA 2L7UA 4GUPA 4JHAL 3LS5H 5DQJA 5MEND 5LGHL 1UWGH 2J6EA 4Z5RB 4QHKI 1KB5H 2CRMA 3ARBD 5T1MA 5HJ3B 2BVPB 5IVXE 1MCBA 3QI9B 5C0JA 2FD6L 3CFBA 3DYPA 1QNZH 2DL9A 3O3BA 4BUHA 4O51A 4C56A 3FJTA 4YHZH 3TJHC 3TYFA 1ZHKA 5ERWA 3RAJL 1G9NH 1PYWA 3EYSL 5JOFA 5J3HD 4KV5E 1ROWA 4F2MA 1YEGL 3G6DL 4LVHB 3EJJX 4R3SB 5DQ9A 4I77L 1RZIB 2NPLX 1JGLH 2ZOKB 1E6OL 4KUZL 5L0QC 1MIMH 1YY8B 4KROB 1S7VA 3NCYS 4K7PY 1I7ZA 5E2TL 3RIAF 5JDSA 1UACH 2PO6C 4PFEA 2Q20A 4KI5E 1Q9OA 4QRUB 5I9QB 1E6JL 2VDQH 4I18C 2X1QA 1I4FB 5K59F 2I60H 2DLIA 4XNUL 4DW2L 3RZWA 5E1AB 2EH7L 4R4BB 15C8H 4XHJC 3JTSA 3X3GL 3MV9D 4MAYA 4QF1A 2J5LC 3VXPB 5BXFA 4MS8D 1H8NA 3BKML 1XCQA 3PQYE 5D2NA 3V5KB 2DQGL 5HGDB 4BK4A 2XRAL 3CIQA 1PKOA 2EDFA 3QIUC 5C0CE 5D7JD 2EDKA 1TJGL 5F6IB 5E9DD 5HYJB 2YWYA 3I75A 3CC5A 5HDOA 3P9LA 1TXKA 1ND0B 1F97A 3PJSB 1J0YA 2Y5EA 4Y5YA 5HI3C 3GIZL 5JR1L 2BSRB 1H3PL 3BN9C 4GKSA 3ARWA 4HC1H 2ZWLT 4DGYL 2WIMA 2CH8A 4KHXL 3C8HA 5I30L 3FQUB 1E27A 4G8IB 4KDWA 1ONQA 2NYYC 12E8L 3TESA 4JFFA 2YN3A 3P9MA 5F9AC 2GHWB 4OUUA 4OJFL 3AS3A 5I8CA 2DJ4A 4MNGA 3BMWA 2VIRA 2AJXH 4JM2D 4MA8L 1U8OA 2R0KL 3SKOB 1J12A 1CFQB 4IOSD 1FL6B 3NZ8B 1QKZL 3BSZL 4W81A 4JQXA 3ZL4L 4PGBB 5IHLB 3UPRA 3FMGH 5MHSD 1EFXB 3E6HB 3TP4A 4OB5H 4RA0C 5CZVL 4UDUB 5C6WH 1GC1C 4X5WB 5TE7L 4NSKA 4LSTH 2ZCKH 3E0GA 5GGUA 1MHCA 3RDTB 4GXVH 1V05A 3SDAC 5DRXB 2VZTA 2VDKH 1VFOA 1NJ9B 3OJDA 3PHSA 3LQAH 2OZ4A 3WBDA 1QPPA 4L4VA 4XNMA 3ALWA 1S7WA 4OFVA 4PJBF 3DIFB 5EU4B 5DS8A 3T4YB 4JJHA 1FJ1B 1W8OA 1F8TL 2D7MA 1CD9B 2YD6A 5DUPH 2X4PA 3ZHLA 1NCAL 2A9NH 2OBGA 2FJFB 4WY7L 2X4SA 4K3EL 3T0WA 3MRNB 3QSKB 4HWZA 4R8WH 3I50H 3QQNA 5TQ0L 2FRGP 4YJZL 4DN3L 3P4NB 4GW5A 5KN5B 2Y6SD 5DC4B 2OR7A 5FUCE 4ZTOH 3GMNB 4BQ8A 2NX5B 1T1ZB 3FO0L 2XA8L 4PJCA 3VGHA 4A6YB 5F6HJ 1Y0LB 5I8EB 1IARB 3GMRA 2IANB 5H35B 3SE3A 3QEUA 4V2CB 1IC5H 4PJ8A 2BK8A 2PETA 4XB8A 3QIBD 4MLIA 3BPOB 5GQBA 1MQKL 4X9FA 3T8XA 3BP4A 4LPTA 3QAZC 1R5WB 3HNSL 1I8IB 3BN3B 2R2EA 4WEBL 4WJ5B 4GMSL 1TJHH 1S5IL 3MLYL 5C09A 3WO4B 1H3UA 2HG5B 1AI1L 4WUKL 3RL2B 4JHAH 2D7OA 1RZ8A 2VN7A 2CDFB 5LGHH 1M05A 3PP4H 4I8DA 3JWOL 4UUJB 1OTSD 4WWKA 1OAKL 1D5ZB 1FAIL 2E9IA 4Y4HC 1QLEL 4P9HC 3CK0L 4S1QH 1QSFA 1QBLL 4EIZC 5GPRA 4LKXA 1AO7B 1RJZA 4LSPH 4OUOA 2Y9RT 3L9RB 1MAMH 1O7SA 2G9HA 2XXCB 3EYSH 2JIXB 4NCDA 1YEGH 2P7TA 1VPOL 2VZSA 3AREC 4R4NC 4UBDD 3N9GL 2NX5E 3MACL 3BP6B 1DLFL 3LB6C 4I77H 2WBJA 3MNZB 4KUZH 4JKLA 3P4MA 5JTWA 1GH7A 1WGOA 5L2JA 5ADPH 4TUOA 4H1LG 1UKSA 2XT1B 3QDJB 2VLRD 1JGUL 4ZOBA 5E2TH 2WNGA 1DEEA 3QFJB 5F72S 1N7ML 5FYJE 4F15C 1ZTXL 2C3VB 4FQ2L 5E2JA 1C7TA 4JLRB 4PRID 2EYRA 5CJXA 3AFLA 3WV0A 4XNUH 1MRFL 3NPSC 2A83B 2EH7H 4AIXA 5LGJB 3X3GH 4OV5A 4LCCB 1G7LA 3O4OB 3QCVH 3KLAA 3FT3B 2RIKA 1IKFL 1QLFA 2DQGH 3PHQB 4NDMB 4U31A 4YHOH 4HUKB 2HFEA 1AO7E 5GISH 1T04A 2KZ1B 2XRAH 4F3FA 1RZJL 1T83C 3ZKNC 1QUNA 1WISA 4YPGA 4KY1H 3IXAA 4XNQA 1TJGH 3RWJA 1FFOA 1CTOA 4EDXB 5EZLB 5DJYA 1II4E 1UCBH 4KPHL 1H5BC 1B0WA 2PW2A 3EDFA 2DRUA 3UTTB 5T5FH 4JANB 3GIZH 3ULVF 3GBLA 4JPVH 5JR1H 1T2QL 5JOPD 1H3PH 4P5TD 5I15L 4KHXH 1HXMB 3PWVA 4Y2DD 3VXRA 3ULUC 4WFFE 5JW4M 3QUKA 3PV7A 2CLZA 4KC3B 5GS0D 4BZ1L 1GSMA 5SWSB 4Y16C 3LKOA 3IKCA 1YEKH 4MA8H 2E7MA 3LH2L 5LJYH 3GMMB 3GRWL 1F6AA 4MDIA 3HTLX 2R0KH 4OT1L 3OL2A 5KSAB 3O8XA 4JFZL 5HVHC 4F37K 4OGXH 2GYSA 3BSZH 4TOYL 3ZL4H 3STZA 1N64H 3MJGX 4WW2F 1FVCB 2W9DL 1BWWA 1KLGA 2AEWA 2BVYA 5J11C 2PYED 1NC2B 5F8RC 5ANME 1D7FA 3CVHB 2BOCB 3BUYB 1FZOA 4MA3A 2CUHA 2F8VA 2QLVB 1ZS8A 1DN0B 2EE2A 4FQCH 4EI5B 5I73B 4HBCL 1E28B 1G1CA 4PPTA 4F58H 1QO3B 4R90L 3O4LA 3UTTE 1HNGA 5KANG 1GGUA 4OLWH 1ZLUH 3QQ4A 3T2NL 1F8TH 4PJHA 5HGBB 5D6DA 3U9UA 1NCAH 4WY7H 4N0UE 1ZT4A 3MZTA 4K3EH 4X6EB 2E3VA 3WN5C 2I24N 1R5IB 2NTSP 1LO3H 2ATKA 4LEOB 1IC1A 3GKZA 3EJYC 3O81A 2A6DB 4M6ML 5SWSE 4DN3H 1CICD 1OP3K 3DO3A 4UAOB 5IJVB 4XXDB 1W0VA 1MEXL 1A64A 4JFDE 4K3HA 5J1AB 1X5ZA 4F7PA 3BGFB 4PD4J 5F7EL 4K8RH 5SX4H 4M6NL 5EO9A 2V17L 2P24B 5IWLC 4RAVA 1MQKH 2VQ1A 4FQLL 3HNSH 2EC8A 3VW3L 1V8HA 3MRBB 1T7YA 3LS4L 4WEBH 4GMSH 3C5ZD 2AJYH 3MR9A 1S5IH 3MLYH 1AKJD 2R29L 3PL6A 3T0DA 1AI1H 3GJFA 4FTVA 2BNQB 4U6VH 4H25B 2XOTA 1LNUA 2PO6B 3EJZC 5JIIA 5IF0B 5JPNB 1PX3A 3MOAH 1OAKH 3Q5TA 4YLQT 1OAXL 3CK0H 3NFNA 3SO3C 4QKXB 3SEPA 1QBLH 3ZDYE 1CGTA 4JQVA 4FZEL 3SDDC 2LE9A 3RRQA 5MEOA 4X4ZA 3W82A 1HHHA 2BNRA 1RU9H 5HHQB 2MSPA 3D87B 1JGEA 5FHAH 3WLBA 1VPOH 4QHMB 5I2IB 4NRXB 3N9GH 1ACYL 3B9KD 3VFOA 2Q76B 1DLFH 2F53A 4EN3D 4R2GC 4DGIL 4NQCD 5A2KH 1UVQA 2CD0A 1L9MA 5EOQL 1CDYA 2Z8RA 3NZHH 3QIUB 5J13B 1JGUH 1BLNB 4NUJB 3BPNB 4X7TA 2Z8VC 4HIJB 4PGJA 3BZFA 1MF2L 3HE6C 4DZ8B 3AC0A 4ODHL 3CUPB 4M48L 3QXVA 1RIUH 4MD0B 4MX7B 1E27B 2E6QA 3H0TB 1KIPA 2VN4A 1X7QA 4RRPG 1U3HD 1UXSA 5C0DB 2BNQE 4I48A 4MCYA 1F4WL 4NKMA 1I7TA 3AMLA 1GVIA 1HYSD 3C6SB 5L8LB 2VXSH 1QFWI 2D0FA 4U1JB 2BDNL 5CJQL 3G6JE 1XGTA 1Q0XH 5GS3A 3QDGB 4ZAKD 2EE3A 3H6JA 2EO1A 1T6WA 1SEQL 4TPRL 3MRDA 4P2OC 3UZEA 5F70A 1Y18B 1NEZB 4F7CA 2V2WB 3FO2A 3NN8A 3ZMRA 1WSST 3F7VB 5K93A 1D5BB 3K80A 5LBSL 1IMHC 3HC0B 4IJ3B 4J8RB 3RA7L 4KPHH 4Q58C 2J2ZA 5FGRA 5IIEB 3ROLA 3CLFL 3WIIL 4EI6A 4F7TA 1RVFL 4RBPH 2C1OB 5A1AA 4M1DH 3MBXL 1T2QH 1PEZA 4WCYL 5I15H 1A7PL 4LK4A 5ID1B 3RI5K 4P3DA 1R6VA 3PWJB 1VA9A 3N1FC 4N1HB 1BQHG 3TBTA 5ITBH 4RMWA 3IDGB 5D1XC 1CD0A 3MCLL 4PJGF 2BNUA 3LH2H 1UH4A 3PV6B 3GRWH 4N0YH 1HQRB 4FQQA 4OT1H 3HLAB 1JN6B 4JFZH 4I4WB 1KTDB 1B90A 4TOYH 5E08L 5FM5M 2JJWA 3VWJB 3LPFA 5DZNA 5HHNA 1S7XA 5DT1L 2W9DH 3QQ9D 1CFSB 1YN7A 3QDGE 4Z7UF 5IVZB 3MMEB 1UJ3A 3IU3A 4AL8L 4QRPB 2JJVA 3MUGB 3WUWB 5D1ZC 1A5FL 4JFEA 3VD4A 3FB7B 4URTB 4AENA 2QSCH 4HBCH 4XCCH 4PJEA 1O7VA 2NNAB 2AJ3B 4PJBB 1V7ML 4TNVF 1XF5B 4X4XA 1I8KA 4NGHL 3T2NH 5E8EA 5C07B 4LU5L 3EYFA 4C4KO 1P4BL 2C3XA 3DTXA 4PJGA 1X5KA 1IM9D 5KVEL 4M6MH 4C55A 4X9BA 5SV4A 1XGQB 1DBBH 1NAKL 4OGYH 3HR5A 1C1EL 3VE0A 1MCLA 3VFMA 1MEXH 4Y4HB 4U1GC 4IRZH 2ITCB 3C2AL 4MA1C 4RGOH 3S7GA 5HPOA 2ZUXA 4OKVA 5F7EH 3BEWA 3L3HA 4M6NH 1T2XA 1J9CT 2V17H 4KK9D 4MJIB 4NHUA 4FQLH 5J3HC 4OM1L 2Z31C 3VW3H 4PRBA 4QRPE 4F9LC 5CAYB 3P0VH 3LS4H 3RNKA 3CFKA 3X13B 2BY1A 1QBML 4ZS7L 4NC2B 4PS4L 4TNWF 4XC3L 2R29H 4M1GH 3I9GL 5F44A 1IKNA 4YXKH 5F8QC 1YC7A 3GI8L 3C5JB 2YZ1A 3T0ED 2DQCH 4PJBE 3S3JA 1FZMA 5BV7C 3DHMA 5B38A 3LHPL 4FQPA 1RFDL 3ARRA 4IEFB 5DJXB 5C07E 1CQYA 1OAXH 5JMRA 1AD9A 1IJ9A 4JDZB 4POZD 5E03A 3NPSB 2VR5A 1OPGH 3RKDC 4RNRB 4UU9A 5F3HA 3HI1A 3OPZL 3T2QA 2I5YL 3TO2B 2DM2A 1CGSH 2AQ1A 2DJSA 1P6FA 4GRWH 3L3GB 5LAXA 1Q9WB 3CFEB 3RHWF 4QT5B 4RIRB 4DGIH 1BGXL 2DLGA 1INEL 3BKJL 4PB9H 3ABZA 5EOQH 3EDEA 4P46C 1QG3A 4XNXL 5IMMB 5CP3H 4EVNB 4P3WA 3EO9L 5H2BB 3QA3B 4TUJB 3TBWA 4LMQI 3OSKA 4GRLA 4XPTL 3SPVB 4P57A 5DHVA 2GCYA 5D2LF 2B4CH 5DJAA 4M02A 4XNZC 1OD9A 2HFGH 3WFHA 1F4WH 2XXMB 3SY0B 3N85L 2YD4A 2BDNH 3D0VB 1NGPL 5CJQH 3NABL 3CFCL 3JWDH 1JNHA 4LCWA 2FEEI 1XF1A 5CINH 3V5DB 1Q9LA 5GS2H 3VFGH 3U0PB 1C5CL 1ES0A 2YR3A 1JPGB 2BXYA 4YWGL 2QADB 1DUZA 5LBSH 4BFBD 3SJVB 1V3LA 1TITA 2VZ1A 4R0LC 1IQWL 1HH6B 4N5ED 3TA3A 3CLFH 4OD2B 1RVFH 4X5LA 3GUTA 4RQQB 3DVIA 3C09C 4I5BA 3KPMB 3MBXH 4JFPB 2NY6C 4GKNA 4QRSA 4WCYH 1A7PH 2YBRB 3PABB 3VFTB 3WS6C 3LAFA 4IIQB 4BK5A 1K8DA 1LO2L 4HPOH 1KPVB 1A6TA 2BVOB 1FGVH 3OG6B 3GNMH 4XCFL 4E42B 1P7KA 3FQXA 1I9JH 3MCLH 5IVNA 3BT2L 4B7IA 3RQ3A 3WIFA 2GI7A 3OXSA 3S36H 4YNYA 3TM6A 3HFMH 1N59A 1E4WL 2CSPA 5E08H 2IQ9H 5E5MA 1QZ1A 1GZQB 2R4SH 3A6CH 4WW2B 5DT1H 4RZCB 5GGRA 4KK6C 4N8VA 5HHMD 5FGCB 3KAAA 3ZTNH 5CKGA 4ODBD 3RJDA 2DM7A 4AL8H 1ADQL 3ROOB 1GAFL 2P4AB 4RAVB 4CAGA 6FABL 3ZKQD 1A5FH 1IGTA 1I8MA 5C9JB 3SCMA 4PJIF 5I1JH 2BXZA 5I19H 5HGAB 5MEPA 3EYQD 4PLNC 1IGYA 3TNMA 3X11B 3PL6B 5D8JL 1B6DA 3NGBC 4ZUUB 3S37L 1EO7A 2HT3D 4NGHH 4R7NA 4KDTC 3RWGB 3BIKB 4IRJD 1R3HB 1F11A 4RISL 5EBLA 3RL1A 4X6CE 3E8UH 4HV8A 3DXAE 4OFKA 4P5MA 5INCB 1NQBA 4UV7H 1NCDL 4MHHI 5KVEH 4LSSL 1OM3L 2NTFA 1TVDA 1IGFL 1NAKH 3OJ2C 3LKSA 1C1EH 1OF2B 2RGSA 3H9SB 4HIXL 4L8DA 5MERB 5TDNA 3LKPA 3MJ9A 2ZSVB 2JJTA 3KPRA 5KZCB 3HZKA 1EBPA 3STLA 3BDYL 3I6GB 5FOBA 5GS1C 3GIVA 3HI5L 4U33A 3GKWH 4D0CB 3QUZD 4G42B 5FGCE 3PNWB 3QXAB 2DI7A 2VR4A 4OM1H 2I9LA 4PJIA 4DCQA 1DQQB 3FB5A 2EDXA 3D25B 5JIKA 3P73A 1AGEB 1HDMB 4BH7A 4PS4H 1KB5A 3M8OL 3KPPA 3MCG1 2DDQL 5DA0B 1CT8A 4XC3H 5I71C 1G6VK 3WKMH 4G80B 1BQLL 4UT6H 3LPGA 4QRQB 3GFUA 4FQXA 1KSRA 4LHUD 2VWEC 4X8JB 4L1DA 5I1LB 1UYWH 3MUZ1 1FH5L 5L8JB 2ZJSL 4N8CH 1CE1H 2WWKO 4JVUA 3MRHB 3U1SL 5HYIA 4PJ9D 5T1KA 2FLRT 2Y07L 1SJHB 4OF5A 1HYRC 2GUOA 2OLDA 1A7RL 3QG6A 5IQ9A 3DBXB 1NPUA 2I5YH 4JRXA 2BFVL 3C9NA 5SWZE 5SX5K 2Z93B 4NP4L 2ICES 3D85A 3RNQB 2C1PB 4YFDB 2HTKD 1OLLA 1FO0H 1XIWD 3CPLA 2BCKB 3FOLB 1IFHL 2HT4C 1XF2B 1U8KA 4GRMB 4PRPA 2R9HD 4MNQA 4YX2L 1BX2B 4YBLC 1VACB 4EEEA 4S1SH 1FV1A 2PCPA 3NCFB 3QH3B 5IFAL 5I76A 1ZHLA 1V3MA 3E1F1 1V3JA 3NCMA 1U92B 4XPTH 5TE4L 2FHBA 1RULH 5TDPA 5FDYA 3OKEB 2ZNXA 3KLSA 2W60A 2E9WA 1C08B 1S7RB 3KPSB 1LHZA 1X6LA 4FNLL 3LPWA 4P5TC 1DFBL 3SKJL 3N85H 4EUPG 4NZUH 2D31A 5E24E 3FT4B 5L2KE 2F54A 4JRYD 4O4YL 3NABH 1DQML 5EIQA 4PJAA 4HKZB 1K8IA 5D1XB 2E6JA 3KLDA 1WF5A 3VD3A 5AAMA 5JPMB 2IQAA 4KZDL 1LDPL 2DLFH 4ALAL 4LDEB 1A4JA 3BDBA 3CXHJ 3GSXB 4ETQB 3LMJL 5ALCL 3RIAK 4Y19B 3ARUA 2V2TA 3KYAA 4HC1A 4S10A 5T3XE 1NC4A 2IH3A 4L5FL 1K3IA 5ISZD 5F71A 2D2OA 2WUBH 3V4UH 1NCTA 5DO2D 4AT6B 3GSQB 4R97C 4K94C 2JLLA 1LO2H 5IHZB 4ORGB 2PYEA 4WV1A 3KDMB 5LG1A 3TVMC 4ZUVA 2H2SD 1EK3A 4HPYH 4WW1B 2FX8L 2G2RB 3MV7B 4LVNB 1I7RA 3T3MF 4YHYB 2XZZA 2P46B 4MDJA 3BT2H 3CSPA 4H5SA 2H2PD 5EBMB 5EZIL 2X4UA 3KPSE 2UWEA 3G5ZA 2GTZB 1OTTC 1RZKC 3VXSA 3NIGE 4F9PC 4RGNB 1HHJB 1E4WH 1OARL 3IAPA 1MFCL 5T1DH 4LQ1A 5FYKU 2IPKA 4Y4FC 2NY7L 1J8KA 4Z7UB 4BQ6A 4Z0XB 1MCHA 1D9KA 5MENB 5LXGL 1GAFH 3ARBB 3DO7A 1VENA 1XGUA 3OTTA 2YC1A 4PP2B 4U1GB 1IAKB 4H26A 4MA1B 4NOFA 4Y5XC 3VWKC 1NCCH 4Y19E 3M45A 3OKLA 4ZUTB 2P5EE 4J2XA 5IB1A 3A67H 2YA1A 4JGMA 5DFVC 1RJLB 1JTTA 4XRCA 5CHNA 3FN9A 3MC0A 3NAAH 3MRGA 3S37H 1MHEA 4LASL 2DLTA 2CPCA 2P5WA 2WP3O 4U1KB 3ARDD 5E6ZA 4RISH 3MLTB 5DJ2B 1MWAB 2G60L 4YAQB 5DTFA 2WQ8A 1UEYA 1NCDH 2IALA 5L88L 2QSQA 3Q48A 5C0GB 4PLKD 5CZKA 1YDPA 1IGFH 1SYSB 4KKCD 2FGZA 3MREB 3FQRA 3MV7E 5EOTA 3O3DB 3KYOA 4TUKL 3WMSA 4TULL 4ERSL 1WWBX 4ODWA 3VGEA 4G6FD 2YEZA 3BHBB 4ZQKA 2X5PA 3M1BB 4RGNE 3BDYH 2DQFA 4YHNA 5TF0A 3TCXA 3BAEL 4IHOB 2Z0BA 3H9ZA 4LIQH 5I1AA 3ZTJH 5JHDA 3KHQA 5MENE 1H0DA 3IGAB 5CEZD 1PQZB 3MV9B 2YPLE 4LLDB 2UVEA 3P3YA 5DRWA 3M8OH 4X9GA 2DDQH 3B9KC 3DVNA 2J4WL 4J6RH 4NFBA 3DGCR 4YHPA 4XPHL 4U3HA 4HUVB 3QO1A 3C60D 1CDJA 2X4TB 3OKNA 1OB1A 4ODTL 5D7JB 3LEXA 1DBKH 4PGCA 5KSVA 3HA0A 3QXDA 4MAYC 5E9DB 3VA6A 1FYTA 2CKBH 4DN4H 5SV3A 3TZVD 3DMMD 3O9WA 1GYAA 1HINL 1WBXB 2XFXA 3MNWA 5D2NC 2H3NA 3QPXL 2Y07H 1SMOA 2N7AA 3IVKB 3U6RB 1A7RH 1U3HC 3MRCB 3NFPA 2VXQL 4NP4H 1OGAE 3ME0A 3V0VB 4OLUL 4ZO9A 2CLRB 1INQA 1IFHH 3B8SA 4GBXD 1RUPL 2VZOA 2H26B 1YMME 1T66C 4JM2B 3BH8B 2OL3L 4Y5YC 2Z92A 3BVNA 4E41A 4Q97A 4LLMA 2YPKA 1Z6JT 4G8FB 5IFAH 2JE8A 3IF1A 3UDWA 3VRJA 1GGTA 3MBED 4LSUL 1BVLA 4NRZA 5CP7B 5TE4H 3QNZB 5ESQA 2YD2A 5E8DL 1G9ML 1K8DB 5C0FA 4EBQL 4HKJB 5D2LB 5HXMA 3DYMA 1T5XA 3C09B 2D7NA 5D7LD 5C6PB 1JNLH 4WI6A 3FQXB 3QUML 4D9QE 1YEHH 3ARFA 4GSDH 3W5MA 3SKJH 1R24A 5I74C 3SDCA 2HJKB 4JQXC 1U8MA 5FYKD 1X5GA 4OZHB 1KCLA 5BS0A 1J8HA 4KJPD 2FNBA 2XKNB 4QWWD 3IFOA 1LO5A 4IDJL 4LBEB 1OOAA 2RJMA 3MJ7A 4YBHA 1ZA6A 1LDPH 3FN0L 2C26A 3D3VD 3BEVB 5F96H 3MRKA 1WFOA 4XVUC 2ZCHH 4Z6AT 1IC4L 3BW9A 4JFHD 3U7WL 3G04A 3G5VA 3MX0A 3OGOE 3P11H 1VKXB 4IRSA 1NCNA 1P1ZA 1OAYL 4K2UH 4LCYA 4UDTA 3OKKA 4NKOB 3ARSA 2YUVA 3VXUA 3REVA 2HMID 1PJ9A 4ZSOB 4HK0A 3VG0L 3D2UD 1UWEL 3RX5A 4KH2A 4OLYL 3WCYA 1AQDA 3PHOA 4MWFA 4Z7QF 4H20H 4XZUA 3CX5J 1CLCA 1NGXA 5ILTL 2GJ6E 3QIBB 5IR1A 2W9EL 2D7QA 1CI5A 3IDIA 3QZWB 1LP9E 5EZIH 4NNPH 4X6FB 3R06A 1CFNA 4GQ9H 4OF7A 3VFUB 5EOCL 3CMGA 2IPUG 5E94A 4L8DB 3UTSD 1OARH 3U9PL 3L3DA 3SE3C 5IROA 2NY7H 2X42A 4OTXL 1GGYA 4OZHE 2EEBA 4HJ0D 3H3BC 2DQJH 5DD1H 2IEPA 5ID0B 4I0CC 1CLZH 4MD5A 5GGQL 3FKUS 3EOBA 5F9JA 1HK6A 2A6IA 2K7QA 3L7FB 4YIQB 4F7EA 4QYOB 3UPCA 5JW5B 4JO4L 3S4SB 3VXMD 4AIZB 4OD3L 2ARJA 4LASH 2FEDD 4S0TD 2JB6B 1LEIA 1A3LL 1WFTA 1P2CA 4WWKC 4HAFA 4ZSOE 5I1CL 4O2FA 2X05A 5F7DA 1S3KH 4M8QB 2A0LD 4YR6A 4KJYB 3O2VH 1BAFL 1ZK9A 1T0MB 1C5DB 5EORL 3VFNA 2FLBT 1A4KA 2AXGB 3HE7C 3F7RA 2XNAB 4HIHB 4QHUA 1YPZB 2VLRB 4TULH 3OAUL 3QUXA 1T22B 3MYJA 2VDLL 2GQHA 4BFGA 3HKFA 4OZIE 3RKPA 3OJVC 4BH8A 4PRIB 5C3LD 1GGBL 1UZ6F 3FO1B 5L6YL 2WBJC 2QHRH 2X10A 4RFOH 3T0EA 2R0ZL 1A6VH 3I2CL 3RBGA 2IWGA 5HD8D 3T0BA 3LKNB 2BMKA 5EBWA 3IDXL 4FABH 4XPAL 4Z0BL 3MODH 2Q8BH 3GZKA 4RMQA 3GJFK 1QD0A 4BQCA 3K0WA 1MUJB 4AM0A 1G7QB 4FFVD 1CU4L 4IMLA 5CJXC 2J4WH 3TN0A 5CCKL 1A3RL 1FC1A 4XPHH 3UROR 1TIUA 5DRZA 1IQDB 1JUFB 1MI5E 4YBLB 4ODTH 3CCHA 1JYNA 2DQTL 3KPOA 1T1XA 3MXWL 3AXLA 1UM4L 3CJJA 2HN7B 1HINH 4B7LA 5IB4A 2Z91A 1PZUB 5DEFA 3QPXH 5FUOL 1BOGA 1F2QA 2HRPL 5HI4D 3MRRB 5F1OB 3DRQA 4XP6H 4PG9A 3Q6FA 1YPZE 4P5TB 2VWEE 4C59B 3EFFA 1RUQH 2FR4B 2VAAA 2YXFA 4NN7B 3FTGA 4P5KA 4Y2DB 3LN4B 3RWIA 4NNYA 3UAJC 1DBML 4I0PD 4Y7MA 1RHFA 1RUPH 3O0RL 3LQZB 2OL3H 4HXAH 1EXUA 3OWEA 3WDIA 3KNBB 5DRNA 1TVBA 4F33A 3D39A 3Q1SH 1ETZB 3TIDA 4D8PB 1MREH 3RPIB 4OFDA 1XT5A 1NBZA 3IJSA 5A16A 1ZT7B 1CFVL 4XI5D 1M4KA 4PRNB 5E8DH 4DEPC 2CIKB 3BWAB 3HMXL 1PFCA 5EUKB 3ZLQC 2P8LB 2OXGA 1ZXQA 5IW3A 4YGVA 2XN9D 2UZXB 4I1NB 4NN5C 5CJOH 3O8XC 4YDLB