1F4WH

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EVQLEESGGGLVTPGGSLRLSCAASGYVFSTYDMSWVRQTPEKRLEWVAFISSGGGRTSYPDTVKGRFTISRDDAKNTLYLQMSSLQSEDTAMYYCTRHFYAVLDYWGRGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wH01
4NKOA 3W0WA 2Z35A 1MFDH 2HA1A 1FIGH 3AVEA 5D7LA 1ORSA 2DOCA 3QULB 4HWBA 3WNOA 4HG4J 3LKOA 1ZV5A 4PB0L 4O2FA 3WIHL 1BFSA 2AKRA 5IW3A 3WJJC 1QYGL 5HVHB 5IGXH 1S7SB 4OCNC 3O41B 5EOTB 3UTTE 4KMQA 3IDNB 1UA6L 4C56B 5E6YA 4H88H 4OCYH 4OKVA 3U2SA 4AMKL 4G5ZH 3ZSTA 2QQNH 1OL0A 1VHPA 5HVHC 4MLIA 3PJSA 5IW6B 1AIFA 1C1EH 2HLAA 4PRIA 5C3TA 2DIBA 4OZIB 1NDGB 2AEPL 3JV6A 2DQHH 5LGHL 5I1LA 15C8L 3NIFF 4MQXD 5GGVY 2CRMA 3D25B 1BBDH 1P4LB 1JWMA 3MRQA 4PRNB 1W2KT 3WSQH 5GS0D 5BO1L 4ZFGH 4TSAH 4QRPA 3VCLA 3KPSB 5TE4H 3U4BH 2DKMA 2VDNH 4NQED 5TGBB 3MRJB 3CCHB 5E8EB 1QBLL 2IANA 3VU2A 5FGRA 1RZ7L 5DUML 2PTTB 2HJLB 4F9LA 1TZHB 3U46B 4PJHA 1PBYA 3GMLB 3WXWL 3DURA 1YN6B 4K3DH 1R3JB 3BN9C 4LPWA 1BZ7B 5IHUH 1DQQB 3QI9D 4HKXB 4MA3B 1Q72H 1MWAL 2MCPL 3FN0H 4HZAA 1CCZA 2D7TH 1QSEB 1W0YT 3KPQA 4P46C 1YYLL 4D9LH 2AI0H 4F33A 3WIHA 3VFVA 3BD5A 5JHDB 4Y1AA 3PQYA 3O3EA 4C83B 1FL3B 3MMEB 5J0BA 4LPVA 3NBNA 4XP4H 3RBSA 2ADFH 4UB0L 4C56E 2IQ9L 3QEQA 1L6ZA 3P0VL 5EBMB 2BNUA 4I0CC 3WFEH 1D6VL 5D6CB 5D5MF 4PBXA 1K8IA 5KSAA 3CSGA 4R9HA 3CFDB 4OI8A 2NY4B 1ZTXH 3VI4E 4M7LT 4X7TB 3GSQA 2E9WA 4HK3N 3SDDA 4AL8H 4OZFH 2ZKHH 4OV5B 1MLBB 3FHQA 1SQ2N 2P43B 4O00A 5IFHL 2NY3D 2ADGB 2R39A 4UTAH 1I7ZB 1OARL 3ARGB 5GJSL 5JO5B 1BREA 1EAJA 3CFEA 2L0DA 4L3CA 4AG4H 4PGEA 5BOZG 1FFQA 4RDQG 3CFKA 3ULSA 2ADJA 4JG0H 2Q6WA 1NBVL 2NY4C 4EUPH 4IRJA 1C7TA 1IFHL 4LOUC 4NN5B 4FXLA 5IMOA 5SX5H 3KPSE 4JO3L 4U1NA 1PW3A 4QRSB 3MRLB 1QD0A 3AB0B 1JRHI 4LLVA 3LZFH 2I5YH 4LCUB 3TBYB 5TDPB 4QCIA 1F6LL 3BESR 4YGVA 3BGMB 4P4KA 4ZO9A 5SX4I 2JIXD 3QWRA 2JJSC 2FATH 4HULB 1CDBA 1WFOA 4F7MA 3ARVA 5I8OL 5BW7A 3S5LB 3ZT5A 4FQPA 4Q6IA 1QSEE 5GIRB 4ZXBD 3AB0C 3B9DA 1X5ZA 1K85A 4M02A 3ARTA 2FB4H 3BEWB 1QQDB 3BWUC 4NYLA 2FJFA 2PW2A 3VI4F 2P5WA 5TFSH 4LLMA 3WL9B 1KSRA 1YDPB 3ZDZF 4ZTPH 2VWEC 5HHNA 3PWVB 4U1IB 3ARSA 1T0PB 5DDHB 1QHPA 3TBVA 1WCQA 2ZSVA 5ERWA 3H3KA 4X6EA 1XGRA 2G5RA 2DWDA 4LPUA 3U9PL 2IQAB 3F58H 3LKNB 3QZWB 1CFNB 2YPVH 1WZLA 1LDPL 1CXKA 4MS8D 4NC2B 3VRJB 2X4QB 1NC2D 1K8DB 4Y16D 5I1CH 2VQ1B 4QXGH 2P5EB 5CSBA 3LMJH 1A1NA 3RVXD 1YMMD 1QO3A 3VE0B 3ARYA 4EXPX 3E6FB 2OTPA 3IB4A 4ORZC 5F96H 4H20H 1PY4A 5ICXA 1W72B 3DUUB 3EYVA 1NGZA 1T1YA 1U3JA 5IBUG 2X40A 5FAAA 5E8NA 5FYJL 1IC4H 3I9GH 4PRHA 1ZMYA 1IEAB 3MOAL 1KYOK 4QWWC 3V4PH 4LCWA 3QWOB 4KQ3H 2GK0B 1EEZB 3WN5B 3P73A 1GGUA 1R5IB 1YEDB 3GJFA 1Z5LB 1P9MA 2KL6A 4QRTB 4WENB 3CX5K 2QQLL 5CIPH 1WV7T 2R0LH 4F7CB 3ULUC 3OKYA 4G43A 3P4OA 3VDBA 4G8GB 3SO5A 3G08A 3RTQC 4FQXC 1QG3A 3CSPA 4DWHA 1E28B 4UV7H 3WN5C 4S1RH 4ZOAA 1VGKA 4QT5A 1AGEA 4ZAKA 5KZCB 4NWTH 1AXTH 3W9EA 1H8NA 1JYNA 2IC2A 3OKNA 3NABL 1NANH 1U8QA 1N64L 3C08L 4J6RL 4AQ1B 2VR9A 3GUTA 1ERNA 3SE4A 4IHOA 1E6OH 4YDVB 5FKPB 5F1SA 1YECH 3ZKNC 2YD6A 4XB7A 3P0GB 4K3EL 4IEFB 4OKDA 4Q9QH 4M6MH 3H6JA 1DDHB 1MEXH 4NJAH 3WD5L 3BH8A 2YRPA 3NFPB 3O4LB 3WXVL 4KMTL 3MLWH 3MXVL 4X8JA 4KDTC 5DA0B 2KZ1B 2P5EE 1T5WB 4GUPA 3RIAK 3IAGC 1WEJH 1YYMH 1N26A 2DQUL 5C07B 4PRBA 5KSBA 3SPVB 3H0TB 2O5YL 2DQJH 4R2GD 3PNWA 1Y0LA 5CP7B 1IM9D 1BVKA 2WIMA 2ICEA 3DMMD 4JFDA 1KBGH 3HC4H 4YR6B 2FCBA 3MA9L 3MLVL 4G6JH 2IH1B 5FFLA 4IDJL 3L5IA 4OZHA 3OR7B 5I16A 4PTTB 4QGTA 1IAII 4FZ8H 2BC4A 5HTSA 2F15A 4HKJB 3GGWA 2B0SH 4JG1L 4KQ4H 2CQVA 3WKMH 4F37F 4F7EB 2A9MH 4HHAA 2X4OB 3HR5B 5E94B 5C0IB 3D0VA 2PXYA 3DV4A 4POUB 4XMPL 4GXVH 2YD5A 2FL5B 2ZJSL 1FAKT 3IDIA 5CGMA 4W6XB 2NPLX 3EYSL 4X6DA 5D72H 4N68A 4X80L 2YKLL 3K8MA 2I26N 2Y25A 4Z7VB 1TJGL 3OAZH 3TA3D 1NFDA 1TTGA 3TN0B 4KKCC 2B1HH 4NKDB 1EGJH 1MJJB 3BZEB 3L5HA 1CE1H 2YBRA 5KAQG 4FQQB 5KOVC 4LF3B 1YQVL 4YE4H 1J18A 3O4LE 2WBJA 4UINH 1EHLH 3G5XA 1FRGH 4LP5A 1N5YL 3MJ6A 5IWLC 3QG6B 2VLKB 1DZBA 3VFGL 5FDYA 3TN0C 4TSBH 2EEBA 5ISZB 5E2TH 3QJHB 4RMTA 1BLNB 2FYYB 2Y1VA 2F19L 4NGHL 3BWAA 8CGTA 2DJSA 2ESVD 4WFGE 5C07E 1F8TH 4TVSa 1QNZL 3VFNB 1UKQA 4JDZB 3GMPB 3IS1X 1J5OH 4HKBB 4P2OA 3QG7H 2NY5L 1QA9A 2HFEA 4HJJL 1OGTA 2PTUA 1A6VL 2XIDA 2PCPA 1MHEA 1NGQL 1WLHA 2VABA 2W0PA 2X4UB 1WFUA 3KAAA 2CLRA 4FQHB 4O2EB 1QHOA 5FYLD 3R06A 5ITFA 1RIVL 4YHKL 1T0NA 4TNVK 1A3RL 2AXFB 4DGVH 1DBKH 4WW2F 3IJSB 3D48R 3TIDB 4AEFA 3BW9A 3PWPB 4YDIL 2HP4A 3HPJA 2XOTA 3HG1A 3MNZA 1T7ZA 4JKLA 5DC9B 2DBLL 2AQ3A 3SJVA 3GBML 5GS1B 1R3LB 3OR6A 2B7DT 3V5HA 1WCBB 3CLEL 4UV4H 2X41A 4UBDC 4HUXB 4PBVC 4EOWL 2Y6SD 1WAAE 4Z7VE 3MXWL 4PJ9D 4MVBD 3CDGB 7CGTA 2CRIA 3ELAT 4MNQB 2C3GA 2VDPL 3QQ9C 1GC1H 5GS1C 4HJGA 3MLXH 3IVKB 4LKXA 5C0DA 1X7QB 1B0GA 1KCVH 1KJ2L 3MRIA 2QL1A 2EKJA 3BT2H 4XCCL 5JW3H 2VAJA 2VLKE 4Y0GA 2X4NA 3UZQA 2IH3A 5ISZE 1JUFA 1X6LA 4DCQB 1G0XA 1IZKA 1U8MB 5DMJB 4ZFOL 1CFTB 1YUHA 3KXFD 1FG9C 2VQTA 2BNRA 1P1ZA 1G7LA 5E7FA 1M1SA 4R97B 3FOLA 2VDLH 2E5EA 2F5BH 5I8CB 2X1XR 4KI5D 4LARL 5M7QA 1KTLA 5FGCE 3TCLB 1WFTA 3C60D 1D6EB 2ZP0T 1HIMH 1JYXA 1JPSH 3MRRB 4P2RD 5EBWA 1U3YA 4S1SH 4XP1H 1ETZA 4XNXL 3QQ3A 4CADB 4Y4HA 1ZE3C 5LAXB 4BH8A 5FKAB 1HQ4A 3BUTA 2V2XB 4KPHH 5EOQL 1INEL 3PWPE 3X14B 3NA9L 4MA1B 4HPYH 5ICZB 3VFRA 1YQ2A 5KSVA 3L1OH 1B2WH 2Y5TB 1WGOA 1KPRA 5E4IA 1OOAA 2VLJD 3PL6B 4WIQA 4K3JL 5T33L 3HPLA 2RCSL 4U2ZA 2ZOKA 3EGSB 4L4VD 4JR9L 1FNSL 4MA1C 2Q1EA 3MJGX 3UX9B 5TPWL 2JJUA 4MNQE 2Z31A 1ZWIB 3HAEA 3K1KC 1KJ2A 3EOYG 3UTQB 4XPHH 1I9IH 1S9VB 1X9QA 2C4XA 3VRLE 1K4CA 1A02N 1RURL 2CMRL 4NNYB 1T1XB 3UYPA 3EYUH 5FUOH 1EEYA 4JN1H 4FTVA 3T0VA 1AE6L 2Z93B 3PP4H 4ZFOA 3SN6N 2BRRH 4HGWA 35C8H 1K4DB 4M61A 3HUJF 5E2JA 5GRYA 2HTKC 5KS9F 5EFIB 1KJ3L 4YXHL 2R0ZH 4KKLD 2APTA 3LQAC 4QHNB 2NLJA 1GGBL 3QCTL 5FM8A 3VRIB 2RR3A 2VOTA 3TYFB 2XNAB 5HGGS 3O41A 4DZ8B 3V0WL 3F62A 1YEEL 3IDNA 3FRUB 1I4FB 3PHQA 4Y4KB 4C56A 4LVHB 4MXVE 3BVNB 1UKTA 4GBXB 4NT6B 2EH8H 3C87A 5HHQA 4HUWB 1I1CA 3O6KH 1J8HB 4LRIC 4NKMA 4BQBA 5BRZB 1K3ZA 1QFWI 4OZIA 3HFML 4Y4KC 3GKZA 5IJKC 4X7FC 1EEUA 3BRDA 2EDHA 4GBXC 5DRZB 5A3ID 3WO4B 3MRNB 3O3UN 3K2UL 5J9PA 4KRPB 3CJJA 1G7MB 1TLKA 3QCUH 4OLWL 5DQJA 4NZRH 3JZ7A 2QQKL 2R2EB 3O6FB 3TZVD 3MRMB 5CCKH 5J06A 4OM0L 3JWDH 1WT5A 2R29H 3HI5L 1PQZB 4K71B 1A7QL 1RJYB 5LWYH 1WJ3A 2ZG1A 4XXCA 3ARDD 3CCHA 5F9AC 1CTOA 1UZ8B 4XBEH 5MERB 3X12B 1U0QA 4O51B 5C9JB 1T7VA 4P46A 4NQVB 5IM7A 2UZXB 3RBGA 1JK8B 1UH3A 1NH6A 1TZHA 1HK6A 3U46A 1U3HC 3KJ4B 2YR3A 1XF2A 1NSNH 3GMLA 3O6FC 1OTTD 3CPLB 4YDJB 1R3JA 3B2VL 1QRNA 4J1UA 3ARWA 3GM8A 2X9XA 1DQQA 3OKKB 4K71C 5I0DA 3ZE2F 1LP9A 3VJ6A 1UJ3B 2CD0A 1RUQH 3R0MA 3KPPA 5D6DC 1KTKE 3VD3A 2CK0H 5MP6L 4M5YH 1X3DA 5TE7H 3V4VH 1F6AA 4P5TB 4Y5VC 4EI6B 3RFZC 2NMSA 4PTUB 1SY6A 5JHDA 4OD1H 4D0BB 3ALXA 3RAJL 4Z8FH 4BKLA 4OIAA 3LD8C 4M7LH 1DBJH 4QEGA 3MLRH 1B4RA 2BSSA 4XVJH 3T08A 4P57A 4HMEA 1N5AB 3TO4B 1XF1A 2LFGA 1OSZA 4EN3D 3D85D 3JTTB 5EBMA 2DQCH 4M93C 5D1XC 3MRBB 1MFCH 5D6CA 1J8HE 3T8XB 3LN4B 3MBXL 1U58B 2P8PB 4PJHF 5KTEL 2FHFA 3CFDA 1FNEA 5HYQB 5BRZE 5HGBA 1UCTA 4X7TA 1JHLH 4DQOL 1MI5A 4JFFD 4UTBH 5C7XH 4IOIA 5E7BA 5LBSL 5GPRA 4UI2A 5GGQL 2GJ6B 3C09C 1MFBL 1EV2E 1YY9D 2CDGB 4XHJC 1IAMA 1KIQB 4YO0B 2BDNH 1CU4H 4EI5B 4LU5H 4LAJH 4U6XB 4JKPH 1EAPB 2XN9A 5A2LH 2J88H 2UY7A 1JMXA 2XV6B 1E0OB 4P49A 2N4IA 2ZCHH 4D9RE 1DANT 3H9SB 3ULUL 4OCSL 1U9KA 1BOYA 4QRSA 4TVPL 4JAMB 4RWYH 3MRLA 2W92A 4EI5C 4HV8A 3TP4A 5TDOB 2VITB 4E0RB 3QIWB 1OTUD 4LCUA 5EUOB 1KN4H 4KMLB 1RFDH 3CFBB 3BGMA 1MCQA 4BK4A 3ZHKA 4OJFL 4C59B 1QSFD 4HUUB 4LLWB 3LEYL 1JNLH 2EH7H 2M2DA 3O6LH 3WFCH 5IESL 3GMOB 3QIWC 2PYFB 4JVPA 4KAQL 3BEWA 1T6WA 5F9JB 5JMRA 4NQXA 2EDXA 1T1WB 1FCCA 4OLZL 4O5LL 2K1MA 4GMTL 4WWID 3G5ZA 3QEGH 5KVFL 4RCAA 4FQ2H 2AV7B 3U30B 2W60A 3PWVA 4JO4L 1AY1H 4L8DB 3DIFB 1BD2A 4K7PY 5HJ3B 1I9EA 3N1QC 4U3CA 4UOW1 3QUZB 4JZJB 4AEEA 3D39A 2ZZUT 3MV9B 1HZHL 2IQAA 1JPTH 4MDJB 3WFZA 2DMBA 1J0YA 3JV5A 1BAFH 2UUDK 1CD1A 3U30C 5E6IB 1LE5B 3D3VB 4RMUA 2VQ1A 2GJ6E 4OCRH 3N50A 3QIUD 4OZ4A 4MHHI 5I71B 1F58H 4K8RH 4MAYA 5AYUL 4HPOH 3QUZC 3KVQA 4JZJC 5C0ND 3MBEB 5C1MB 4XMLH 5IW1A 1ZA3B 3C2SA 5EO9B 3MRDB 5SWQB 2AJZA 3H9SE 1IEAA 3RTQA 4FQXA 5I71C 4I3SL 1KCUL 4XNQA 5ETUB 3WN5A 1JZ6A 1IL1B 1Q0YH 5EUOE 2A6IB 4MXQC 3L5WB 3R8QA 1ADQL 5IJVB 4JGMA 1HYSC 4P3CH 4TRPL 1RIHH 5B3NA 1NFIA 2DLEA 1KENH 5GS2H 1C8PA 4G8GA 3HNSL 4JFEB 1TZGH 5CBAB 3TYGH 5C0GB 1R5WB 5F1IB 2QSCL 4JANB 3ZKMC 1DEEA 5EO1A 1HOCB 3CAFA 4MQSB 4KJPC 4Y5YA 3KPNB 1DVFA 2NXYB 4AM0B 4KDTA 1FNFA 4G6MH 4P5MB 5FKPA 5T3ZD 3BP7B 2X5PA 1JGDA 4Z95L 3MYJB 2PETA 4G9FA 5A40E 5H2BA 5L8KB 4FABL 3VWKD 3K8LA 4OZGB 3HMWL 3BH9A 3U7WH 5FEBA 4GRWB 4XCYB 1MQKL 5HGHA 2VNCA 2NXYC 5EPMB 3QHZL 1W8OA 3DRQB 1MLCA 4L8BA 1A6UL 5T1KD 3D3VE 1M6OB 4L8SB 1VPOL 4MD0A 1XGTB 4RA0C 4APQD 5F93C 3O8XC 1KT2B 2Q20A 3DOSA 4LSUL 3MPCA 1DE4A 4OLUH 3QDMD 3MLZL 3OJ2C 3KNBA 1CGSH 3MRFB 4ONGH 4Y5XA 4OF3A 1D5MB 2QEJA 4YWGL 5AZ2L 2WBWB 5EA0H 4FP8H 2Z8VC 4UIKH 3ZO0A 4X7SL 5EO0B 1GAFL 5EU5B 4TPRL 5C0RL 2IH1A 3WEXA 1NDMA 3BOVA 4RNRB 2XI9A 2CUMA 2EDQA 1AXIB 4ZPTB 5F7MC 4LBEA 4YEEA 1B0WA 1NKOA 1ADQA 3Q1SH 4OLXL 3SE3C 5GZND 4F7EA 4OF7A 4Y19A 1KCRH 3HR5A 2NXZB 4JFEE 3QBTB 1B0RA 5FK9A 2J5LB 5F89B 3RJQB 3LEXB 5K59E 1FBIH 3PXHA 1FZJB 4Z7QF 3WFBH 1DSFL 4QHLB 2A83B 1CN4A 5KSBF 1O7SA 2D7NA 2MSPA 2XG4A 2J6EH 1J0KA 5CJQL 1ZANH 3CC5B 5IWLA 3HRZB 5T3XD 1XCTB 4Z7VA 2NXZC 2AEWA 1BQHA 3TN0A 2LTQB 4OZHF 1MJJA 4F7TB 2H45A 5F9OH 2J5LC 1MJUL 4OZGE 1I8IA 2KH2B 1FV1A 3LEVL 3PHOB 4LF3A 4LHUA 4MSWA 1C5BH 3TT1H 2Y06H 1RVFL 2YWYA 2ADIB 4WUUA 4GRWE 1ED3B 4NO0B 3VXQB 2HLFC 3SQOH 1ITCA 3ARUA 4W70A 2VLKA 4POZC 3QFJB 4WJ5B 4OM1H 5ISZA 4EIZC 5EC2B 1AGCB 4ISVB 4KJWD 2F58H 2EECA 1ZKAA 2FYYA 4RAHA 5E5UB 2YUZA 4KK9D 3VFNA 2HFFA 4P5KB 4JDZA 4MDIB 3RVWC 4LLDB 3GMPA 4X6DF 2LABA 1Q1JL 1XGQA 5HPOA 3I2CL 4MJ4A 4R7NA 4TTGA 4PJIA 5HHOB 3IAQA 2B1AH 2OP4H 1IAOB 3GB7A 1NFDF 3QXDA 2Q3AA 2R56H 2WMPA 2AK1H 25C8L 4PFEA 3T0WA 3TJEH 1LQSR 4O2EA 3VI3E 3HZYB 4TSCL 3CMOH 3CFCL 3HC0B 1ODAA 5HI4D 4MQTB 3F7YA 5FYJU 1HH9B 2FWOA 4LSSL 2G75B 3IJSA 3BD4A 3TIDA 3LAFA 1KB5B 1FFOB 4ETYA 4KJYB 2Q8AH 4UT7H 5ADPH 1NGWA 2ATPB 4TUKH 2OR7A 3AROA 5CGYD 1AGBB 4XNUH 4CW1A 5GS1A 3CVHH 5FXCH 2FX9H 1R3LA 1AGFB 5L2KB 4CKVX 4YHOH 3T4AB 5JW4R 3IFLL 4LSPH 2C5DC 1N2RB 1CT8B 5DD3H 2DLGA 2FBOJ 1QKZL 5DRNB 5DSCA 2VO5A 3SKNB 4G9DB 3WFDH 1U2HA 3UJTH 5B38G 2IMNA 3CDGA 4JRXD 3NFNB 4WCYL 4JRYD 4YFEA 4MAUL 2VXTL 3IRZA 1MQ8A 3EIFA 4ZUSB 3MC0A 2QV2A 4IOFD 4XPBH 4K9EH 5E0QA 2RJMA 1SJEB 3QFJE 1EXUB 2QSVA 1OHQA 2IGFH 1NL0H 3C6LD 1A47A 4QXTA 3TC9A 4YK4C 1NGYA 4DCQA 4I0KA 1U8MA 3UAJC 1PZUB 4JCLA 1C16A 1CFTA 2R23B 3RU8H 1Q9KA 2LVCA 2DICA 3NIDE 1F4WL 3ABZA 3RVTC 3ZT7A 5TF1H 3EJYD 1TTUA 5HHOE 1J9CT 4XPAH 4DKEL 4PP2A 4DVRH 3GIZH 4PJGB 1CFQA 3HB3C 3VXRD 4HT1H 4Z7UE 4N0YL 2HG5A 1K5NA 4XZUA 3IGAB 3MRRA 3S37L 3DETC 3FAWA 2BXZA 5AWNL 5DJCB 5GS0L 2NX5B 5AUMB 4CADA 5ACLA 5LAXA 2GEEA 4AZ8A 4LEOA 5GGUA 1Q94B 2BFVL 1KPUA 4HH9B 4JREC 2VTFA 5DVOA 3X14A 5INCA 3GSNL 1NCBL 2VQUA 3ES6A 3FO1B 1KN2H 4KVCL 5K93A 3UXFA 4MQ7B 1ZLWK 3RVVD 5J1SC 1FHGA 3MROB 5SV3A 1N0XH 5L2KE 3L3JA 2DQDH 5MEPB 2ICWJ 2FJHA 3MV7A 4NQCA 5FOBA 2R8SH 4U6HA 3HNVL 2P48B 1A7BA 5KN5B 4L4JA 4X99B 3PWNA 3SE9L 4R4NC 2OK0H 2HWZH 3KYKL 1U8JB 4W68A 4GAGH 3NCFB 1TCMA 1NAKH 5CMAA 1I8MA 2YC1B 5GRVK 4PR5B 1RIUH 3AAZB 3FOMA 4I0PB 3RWCA 1X5IA 3QPQD 4HEME 5B3JF 5LCVL 1IGJB 3IXAB 3B5HA 1N8ZB 5EZOH 3V0AC 2VDML 3DYPA 2VUYA 2QLVB 4IRSB 1AXSA 5I1DB 4Z7UF 3RWDB 4BZ1L 3V8CA 4KH2A 3RKDC 5EFIA 1RZGB 5INDA 5MENA 2YPLD 5CJ5A 1WISA 4QHNA 1YN7B 4M7JH 3VRIA 3L7FA 5D9SB 4OZFB 1U8NA 2BNQD 4YFLF 4DZ8A 1KELH 4IRSC 3FRUA 4Y4KA 4PJGE 5I2IB 4JB9H 5IJKA 2A9NL 4NT6A 1E4XI 3T0DA 4URTB 5FF6B 1U93B 4JM2C 3DUHA 1FZMA 2ED7A 2NX5E 4EUPB 3P9LA 4ZUVB 4Z7NF 2Z4QB 5C70A 2PR4H 2NY2D 1EMTH 5CUSH 1AJ7L 3KLAB 4Z76B 3BIAX 3GSNA 3CXDH 4MJID 3B9KB 1A5FH 5DRZA 9CGTA 1PKOA 2GW5A 1P7HL 2YA0A 1Z9OA 3MRNA 2VLLB 4P59L 5C0AD 4L3EB 1I7RB 5JUEL 4HD9A 3QSKB 1KB9K 4LIQH 1MRDL 2A1WL 1G7MA 2MQ3A 2D0FA 5E00A 4PD4J 1U3HA 1AP2A 1FH5H 3SDAB 2WANA 3O6FA 2NZ9D 3ARPA 3T77B 1DFBH 1BMGA 4F7PB 4WUKL 1OAYH 3FQNB 3B3IA 3INUL 5IVXF 4OB5L 4Q58C 4QKXB 1FIEA 2H3NA 3LB6C 4F2MA 4E42A 1QSVA 5D6DA 3RGHA 3X12A 5CJOL 5GGVL 4UT9H 2DS4A 5HDQH 3MA7B 2OYPA 2M26A 4Y5VA 2EIZB 4BK5A 3PV6B 3RDTD 3BD3A 1I1YB 2G60H 4YDJA 1PG7L 3SGEI 5HBBA 5ALCH 2VJXA 3C5ZD 5GJTH 43C9B 2NYYD 1AGDA 4DEPB 4EQ2A 3EJJX 3WKNA 1MCJA 2NTSP 4RGND 3WUWB 4S1DC 4PJBA 4LHQB 5E2UH 2EE2A 1RZ8A 4NHCH 2H2SD 5D1XA 2ZCKL 2MTPA 2D31B 2WUCH 1NCNA 3WFHB 3FRPA 4EI6A 3MCKB 1BGXH 5F21B 4YHNB 4PTUA 4H5SA 4WV1A 4LCCB 4D0BA 4D0CB 2NY7H 2WWKT 3VMOA 5KANI 1CF8L 2AJXL 3O0RH 1IT9L 4ONFH 2XRAH 5FO7B 4CVZA 4UUJB 4J4PC 1U8LA 3QQNA 4DEPC 5CILL 3O6MH 1N5AA 3RWGB 3JTTA 2VERN 4G7VL 2NR6C 3T8XA 1A7OH 4X6BA 3OAUH 3RNQB 4LCCC 1AO7D 1FC2D 1JGLH 5HI5D 3PGFL 5F7WC 5A16B 3P0YH 2OJZL 1SEBA 5HDOA 1LP9F 3ESVF 3STZB 4L3EE 4ODBD 4XRCA 5C0BB 5T1DL 3W39A 5FA3B 4KK6C 5MEQB 1VEOA 3HE6B 3QAZB 2DD8L 1N3NA 1XIWD 3ZE0E 5CIPB 2NW3B 4JKWA 2DKUA 1G7HB 4WWKB 4ZNCD 3MNWB 4D9QD 4OLVL 1JI2A 5I1GH 4O9HH 4P4RB 4LQFL 5DK3A 4NZJA 4R4FL 4PGCB 3MRCA 4NSKA 3U6RA 4JJHA 2YXMA 4XNZB 5TDOA 3DARA 4B7IA 5DS8A 3EYQD 5IROC 3QIWA 4P2QB 5EUOA 3HE6C 1F90H 4XVUC 4XVSH 4EXKA 2X70A 1O5DT 1E4WL 1HXYB 4MD4A 4H1LA 2SEBB 4YUEH 3V7AG 4KKBD 4PJEA 4M4RA 3U0TB 3J8F7 4NO2A 1X5LA 5GRJL 4LLWA 1S5IL 3O9WD 3P9MB 4PGZA 2HT3D 4XNZC 3C2AH 4JZNA 3IKCB 3BJLA 3MREB 3IETA 3MUZ1 4YZFF 3FZUD 3QDGD 1NC2A 4YQXH 2D0HA 2NY0D 3CDFA 4L9LC 2VDKL 4GG8A 1V3LA 5TE6H 4DTGH 4X7DC 4L8DA 4QF1B 4ZFFA 1J0JA 5HGAB 4KC3B 2H32B 3UTZA 4IBLT 4UDTB 2VB5A 4HLJA 4JZJA 2P49B 3HHRB 3MV9A 3DVIA 2X4TA 4PJ8C 4BSWB 1X5FA 5L88L 2AP2A 5E8DH 1UB5B 4G42A 1UGNA 4DKFH 3VXSB 4FQCH 4G6KL 2BSRA 2N7BA 2F53A 1HWHB 4HIXL 4ORGA 5C0BE 1L0YA 3AFLA 3S35H 2AJYL 2XY1A 5C09B 2G9HB 1ZA3A 4AQOA 5J3HC 2CIKA 2GCYB 5FM5M 3FB6A 1K2DA 2ZCLH 1IC7L 1RK0B 3I75B 4YDKH 3LDBB 3UBXA 5F7FA 1EVUA 1QRKA 2XQYG 1HKLH 3SDCD 1FYTA 2CGRL 1AQKL 3SOBH 1J1XL 3PWLA 3BMWA 2R69L 3MRHB 5ETUA 5CBEB 3OKMA 1B4JL 5DRXA 4ZPVB 2AJ3B 4N0UA 4P2QE 2A6IA 4JHAH 5JTWA 1DJSA 4WI9A 2KBGA 5IJVA 4PG2A 1K6QH 1II4E 3BYYA 2UYLB 5F6HJ 1XMWA 2W0FB 5T3ZH 3LDBC 4N1CA 3EJZD 1T3FA 4JFEA 4ZDHB 1JZ3A 5DR5L 4LSQL 2F54B 5FCUH 2XKUA 1G84A 1JZ5A 1R5WA 4YHPB 5F1IA 3ARQA 2AV1B 3S36X 3TGXA 3L3DB 5IFAL 5TQ0H 2F8VA 3F5WA 5DO2C 4JPKL 4X6FB 3NIGF 1N7MH 2VXSL 1CL7H 2EDYA 4P5MA 1OCWL 3BP7A 3N85L 4DUXA 3LV3B 3FCTB 3TEUA 3VXTB 2FO1A 3O8XA 5DT1L 4I5BB 4OZGA 2DIAA 1NEZB 5DI8A 1KCKA 4FNLL 2H41A 3LRSA 4MZ3A 3S4SB 4X4ZA 4EVNB 2NW2B 5JIPA 4W6YB 1BEYH 4CMMB 4G3YH 5I1IL 4R7DA 2R1YB 3GO1H 4CN6A 1M6OA 3OV6A 3VXSE 2AABL 4QRUA 3WHE1 1KT2A 5CZVH 1XAUA 3X11A 3FO2B 5FYLL 3T3MF 4M8VA 5C09E 2NZIA 2ARJA 1I9RH 4YHLH 1XZ0A 2AEQH 2A6JB 3A67H 2OCFD 3C5SA 3SE3A 1JGVL 4MNGB 3MLUL 2YD2A 1UWGL 4AENB 4OBRA 3KLHD 1Q9OB 3E6HB 4LAQL 2F74B 4W81A 4RFOH 1H9VA 5HD8C 3DYMA 3P30L 1BPVA 3TFKD 3SDXA 4YBLB 4NNPH 3T0BA 4LK4A 5CP3H 1S7TB 3QH3B 1WUNT 4J8RB 4I8DA 5DJ8A 1MCBA 1OAXH 5KW9H 2PO6B 4DVBB 1H5BC 1MJ7L 2MCG1 3C6SA 1P2CB 2CIIA 3O45B 1Y18B 4QOKD 1DP0A 4JPVH 4DGYL 3LEXA 1FZJA 3T4YA 1RUMH 2YD7A 4FQIH 4QHLA 4ZYKB 4PJFB 3GM0A 3W0WD 5DEFA 3NACH 2Q7YB 2JB5L 5ICYB 5D7LD 3CC5A 3GI8H 1QLRA 5DC4B 1YEIL 2E8YA 2HFGL 1MFDL 1GC1C 1XCQB 4F7TA 3FB8B 1TENA 2YEZB 4JQIH 4XBGB 3BUYA 2ESVA 2KQNA 3PGCB 3LS5L 3PHOA 4HAFA 2AK4B 1M7IB 1HILA 3RPKA 1QZ1A 2R2CA 2F5AL 3FQWB 4RSVA 2QQQA 1FE8H 3GJEB 3N9GL 1CXIA 3O2DH 4CDGC 1QFWH 5IR1A 4ISVA 2X7LA 3G5VB 1R3HB 5I17B 2XZZA 3PWUA 3L3GB 3DGCR 2APXA 3I3DA 4PG9B 2ATKB 1UZ6F 1U8HA 3CUPA 4GS7B 5DJXB 2WM0A 5CEZH 4AJ0A 3DRTB 3B9VA 3GMNA 1IC5H 3RWFB 2FEEL 3FB5A 2DYPB 4MNGE 3W2DH 4HJ0C 4WI8A 4K94H 5BJTB 5IMLB 3MO1B 3K74B 1A9BA 5K9JH 2GY5A 4HIJA 4XC1L 1BBDL 3KYOA 3HZYA 1KJMB 4G6AC 4QRPD 3HNTH 3HC0A 4K23L 4GS7C 5JW4M 4AEIH 4MGXA 4NM4L 1ZS8B 4G8IA 4XGZB 3Q5TA 4DGIL 3T2NH 3S9DB 1I1AB 2VDNL 2ZPKH 4Z5RB 3OJMB 5I8KH 1QLFA 4RMRA 4NM8H 3QDJA 1AD9A 1LD9B 3RWEB 2IPKB 1HDMB 2W59A 2BVYA 2X4RB 4PJFE 5GISL 3QIBB 3D5OF 2EZ0C 4X98B 3GSWB 1PJ9A 4HS3A 1OAQH 1CT8A 2D9CA 4NZUL 4ODUA 4GG6F 1AC0A 4OQTL 3SKNA 1EBPA 1N6QH 2IFFL 1KFAH 3V7MA 4M62L 2IAMB 1JE6A 1I1AC 1NJ9A 1ZOXA 3NFNA 3FN0L 2VE6B 5DWUH 1OSPL 4IMKC 1PSKH 4Y1AD 5DJDA 1JHKL 3PQYD 4GRMB 4A2LA 5C8JB 2AI0L 5JOPE 3HZKB 5DURB 5DVMA 3U36B 2AK4E 3QIBC 4HFUH 7FABL 1JFQL 3QEQD 1RD6A 1SJEA 3WLWC 4HQQL 4YH6A 2IAMC 4OCXH 2HT4C 4XP4L 5KVGL 4MNHB 4F57H 1I3RA 1RZJH 3RNKB 3ZDYE 4Q2ZB 2AJVL 2DB8A 4P2RA 1ZLVH 4HF5H 3WFEL 1U8IB 2R23A 4LASH 5HYJD 4NZDA 2A77H 4ZODA 5HHMD 5J13C 2G5BB 3CK0H 5D1ZD 1KEGH 1FGNL 4ZTOL 3BE1H 1LO2H 1KIPA 2XWBB 5BV7H 3DSFL 5ESAB 5IB5B 5FHAL 4NQEB 2FECL 1EK3A 4PJGA 3LY6A 4UTAL 3FKUS 1H15B 1MPAL 3QDHA 1VFOA 3EDEA 2EDRA 3REWA 2XY2A 5C71A 4UIMB 4IRJD 1RUAL 2VDQL 3IGAA 5JNYB 3CIQA 2VLJA 4U1GC 5DJCA 1L7IL 1TVBB 2PW1A 4JG0L 5AUMA 3S3JA 5F7EH 4YBHA 1S7WB 4KRLB 1AHWC 1Q94A 1YEGL 3CGTA 3HS0B 3E2HC 2FNBA 3QUYB 1BFTA 3QA3B 4JGUA 1AD0A 1RZFL 3BKJH 3ZL4H 3WHXB 5IBLD 3VXUA 2PN5A 1S9YB 1TJHH 3HC3L 4UOW0 4P4KD 4YFLI 3QWRD 4MQ7A 3JTSA 5F44A 3LZFL 4U1HA 3LH2L 5EORH 3CZFA 1L7TL 1VFUA 2D03H 3DUSB 1JTTA 5MEPA 2YRLA 3EHBD 2EKSA 3JWDC 2I07B 4R96B 4OQTA 3QUYC 1FP5A 1RHHB 5KN5A 4M1GH 4GKNB 4EDXA 4K2UH 4PY7B 4MWFA 3L6FA 5HVWA 2P5WD 3WV0A 5CKGA 4U0RB 4LSTH 1GPOL 1YNKH 3Q6GH 4M1CC 4NP4L 4OGAD 4ZS6C 2BSTB 2YC1A 4Q9RL 5I1HH 3U82B 4XPFH 2XA3A 1BQLH 1C7SA 4ODSH 4RRPA 3EZJB 2FEDD 3IXAA 2P8LB 5JOFB 4JQVC 5IEKA 5I1KH 1N8ZA 3OZ9L 3Q0HA 2ZNWA 1YNTB 1WIOA 1F4AA 4U0RC 3J7HA 1AKJB 4L3AA 5DHYB 1TETL 4JM2A 3BP4A 4Y2DB 4JPWH 3OHXB 2WAHA 3SBWA 3BO8B 2K9UA 2EIBA 2YK1H 3AS3A 5FYKL 3GBNH 3TBWB 1W8NA 2EE6A 4NQEE 5JA9A 3UTSD 3WDIA 4EIGB 3I6KA 4V2BA 3FQTB 2XPGB 3GNMH 1MRCH 3HRPA 5GGSB 5GZOD 5I30L 4Y2DC 3MRPB 3KS0J 4EUPA 4ODVL 2JIXB 2Z4QA 1FL6A 1EO8L 2P4AB 1L0QA 3P4LA 5DJAA 3RY6C 1ZT7B 4PIRF 2A74A 2N1KA 4LCWD 3KPRD 3KLAA 4HFWA 1U6AH 2FIRT 5I75B 4QYOB 3ARDA 3RL1B 1ZHNB 4ZXBB 1T6VN 2E3VA 2E8ZA 4NKIH 2VLLA 5HHVL 4KQ3L 4MCYB 5K9KB 2VLRD 2V2WA 2HH0L 1IQDB 4RISH 1TDQA 4F7PA 5I75C 1EH9A 1BF8A 3FN9A 4ZAKD 4J3OC 3HAEG 1PYWB 3BQUC 2KUTA 1RUPL 2JJTC 1HI6B 3L3KB 1C08B 4UMGA 2XZCH 5L7XH 2EIZA 1A7PH 3PV6A 5DFVD 1I1YA 4GAJH 4Z6AT 1KUMA 1XGPA 4S2SB 43C9A 1E6OL 4J4PA 2VN4A 4GSDL 5E99H 2YD8A 1S7XA 2DM3A 4EBQL 3D2UB 1YMMB 4N90E 3OAYH 4YHZH 1JGEA 1P4BH 2DM4A 1VFBA 4ZS7H 4M6ML 5D71H 2EC9U 2DI7A 1DUZB 4JFFA 3GHEH 4LCCA 5T1LB 1F02I 2X6MA 4MS8C 1P7KB 2XQYK 2FZ3B 5FO7A 5C0CB 4HCRH 5LXGH 2FO4A 1UCBL 5FUZH 4WU5B 4FFZL 4WTXA 3LKPB 3F12A 3H8NA 1W72H 5IQ7L 1PAMA 4IM8A 3V5DB 4G6FD 5FYJD 3CDYA 3NPSB 2A0LC 4JFDD 4Z0XB 3DX8B 4K3GA 2DQJL 2Q86B 3ZE1F 2YD3A 5BXFA 4XP9H 1A6TA 1EUUA 3CD4A 5F72S 3ROLB 5F6IB 3HE7B 4PGDB 4Q0XL 1I8KB 4N0FA 4NUJA 4K8RC 1NLBH 4PJBF 2YUVA 5C0BA 5FA3A 2CLVB 4OIIH 5IROA 5IB3A 2LU7A 5B4MD 3HE6A 1ACZA 4XWGH 4RQQB 2PXYD 2VDOH 3TT3H 4FG6D 3TJHD 1QSFA 4ZFZB 2W1NA 5C6TH 4IJ3C 4OGYL 5F6IC 1GZQA 3HE7C 1WBYA 1TTFA 3OB0K 1FPTH 4H8WH 5AD0B 4KKNA 3RL2A 2AVGA 4JY4B 1G0DA 1TFHA 2JELH 5DQDL 4P2QA 3H7LA 3UZVB 4BSVB 1HEZA 4QY8B 1HXYA 1N4XH 1FZKA 2DMKA 2SEBA 1UM6L 2CKBH 5FHBH 3M45A 3U0TA 2Q76B 2CO7B 2V7HA 1YMME 4L9LA 4GKZA 3NCJH 4S10A 4HMDA 2WBJD 3P9MA 4GMSH 4EDWH 2V7NA 4ZUWA 1D5XB 3IKCA 1XGUA 1LGVA 3MV8D 3KPMB 5T5FH 4FQLH 1MJ8H 3VGGA 4R2GB 5M94B 4MX7A 4PJ8A 3MLYH 5C0CE 5I18H 1IGMH 4XAWL 2A73B 2DTSA 2Z92B 4WO4C 3B6SB 3QIUA 3JVGC 5D2LF 4GFTB 1T21B 3SKOA 5KJRH 4MLSA 2BMKB 2OSLB 2DRUA 4YPJA 4P2OD 2W9DH 1Z9SA 3TLRA 4PJDF 1UB5A 3DVGB 2W9EL 4PJEF 1HHKB 1GOHA 2R4RH 1JF5A 4GT7A 3LS4H 3Q2CA 3HLAA 2E7MA 3BSZL 4K7PL 2R9HD 4KDVA 3QEHB 5IKCB 2JCCA 3G04B 3MYZA 4WI7A 2GCYA 3MFGB 1NMAH 3HG1D 4KFZC 4N1EA 4C57C 4DGVL 5CSZB 1RK0A 1OQXA 4ZG1A 2VXVL 4GRLB 5CZXD 4PLKD 3X3FL 1W0WB 1EPFA 1HN1A 3EFDL 4OD2B 4QTHB 2I9TB 2MHAB 1KLGA 3L5JA 3MNVB 3K1DA 3WIFA 3IJHB 1NGPL 3SHSA 4QHMA 4FXGB 3UZEA 3ARFC 3R4DA 3MTRA 4GRLC 5JDSB 1RK1B 3VWKA 4ZDHA 4B41A 3QNYA 3QUXB 4WEMB 2F54A 4RAUA 1GC1L 3LQZB 2BHYA 5LQBH 1INDH 1A6WL 2AV1A 2ICWB 3BKMH 4X9GA 3MACL 3MJ8B 5JW3L 1F11B 5T1KA 2APVA 2DQGL 5F71A 5JLZA 5JOEA 4APQA 5D8JH 4NZTH 3LV3A 4LNRB 4RMWA 3QUXC 1I7TA 2H2PC 3VXTA 5J12B 5IOPA 1EVTC 4I5BA 3QDMA 4J3XA 1YNLH 4B7LA 1UXSA 1JNNH 4X7CC 3G6DH 1P4IL 5CEXA 4PGBB 4EVNA 1YEFL 1A1OB 1UWXH 1VB9A 2X4PB 2XTJD 3OPZH 4OT1L 1MHCA 3A6OA 3S96B 3V0VB 4NNXA 2UY6A 2YSSA 4Y4HD 1GZPB 5ACZB 4UQ2B 2GJZB 1IM3B 2EXYC 4GOSA 2WWMC 4XB8A 2HVJB 3SKMA 2IG2H 5LVEA 2IPUG 1RHFA 2J4WL 1HHIB 3IFOB 4YPGA 5DMYA 4YXLL 4F9PC 4AENA 4XCFL 4PJ9B 4BZ2L 1FN4A 2LU4A 4PJXA 1H5BA 3BI9X 4KTEH 2B2XH 1MH5A 3CVHB 1B6DA 2XG5A 1A0QH 2BCKB 2F9BT 4YX2L 4MZ2A 1TJIH 5D7KE 4DAGH 2KDGA 4J8RA 2ZUVA 4NDMA 3RKPA 4HWBH 1S78C 2DLIA 5F3HB 4DVBA 1OB1B 1ES0B 5E8PB 1MF2H 3IDXH 1CLOL 1GGCH 5EIIA 2NY1B 5GGRB 4HG4K 4MD5B 1PLGH 5DHVA 5AZEH 5DMKB 2B5IB 2OZ4L 3G6AA 4LDEB 5ICYA 1FAIH 3R8BB 2AJUH 5TDNB 3LKQB 5HY9A 1RAMA 4OUUB 4JY6A 2B4CH 5DUPH 4G80B 3K7UA 1EX0A 1OWRM 2YEZA 35C8L 5I0ZA 1R24B 4CL7A 2C3HA 2IADB 2NY1C 3QNZB 2AGJH 3PGCA 1E4XH 3SDXF 4NPYA 4I2XB 5IBUB 2AK4A 2MOVA 5IMKB 4K9EC 5EOCJ 2UWEA 1G6RH 1DN0A 4RMSA 1ZHLB 4C56D 4YHML 1H0DA 3WNPA 4EQ3A 3LKSA 2CUIA 4JDVA 3IFNH 5DJZA 3THML 1VFAB 4TUJB 3G5VA 4JO1H 1R3HA 5I17A 5KVEL 3RZCB 5T5NF 1FNLA 5JQ6H 2BVQB 4ENEC 5I1AB 1OGAB 3DRTA 3EO1B 4L4VB 2CPCA 2QR0B 1D5BB 3GSUB 3QFDA 4KROB 5DD1L 5HGDB 4PB9H 5BJTA 1TITA 1MY5A 3MO1A 1UM5L 3RZCC 3I84A 4KGLA 5C6PB 2PYEB 3BN9D 4KHTH 4O2CA 2V9QA 5A2FA 1LO4H 3QCUL 2BY1A 4O02L 4NZRL 3VFWB 3KPSD 3MLTB 4JE4B 1QUNA 1ZS8A 2HT2C 2APBA 1X5AA 4P46D 4KROC 4PB0H 3TV3L 2ZNXA 1JPGB 1EFXB 2XWJB 1DUYB 1EEYB 4Z5RA 3WIHH 3WO3B 1QYGH 1D3CA 4IMKA 1VERA 3RWEA 4CNIB 2IPKA 3MGOA 3V9FA 2DL2A 4R4BA 3QIBA 1NSNL 4V2CB 2OZ4A 4ZD3L 4LLQB 4U1MA 3GSWA 1BQHG 3RWJA 2GTZA 3FQUB 4YXKL 4WEBL 1QSED 4CDHA 4AMKH 2IAMA 1R3KB 2G2RA 1BHGA 4LHUG 5JHDD 1X44A 1VKXA 2O5ZL 4GRMA 5TE7L 5C8JA 5IQ9B 1T5XB 1E4JA 4I2XE 4L29B 5IK3B 5T1MA 4PJAB 4BH7B 3VXPB 5LGHH 3PP3K 4OD1L 1LNUA 2VMFA 4X4ME 15C8H 4Z8FL 1S7VB 3VXRA 4MA8L 4XVJL 4W6WB 4S0TD 1HINL 2PTVA 3WS6C 5J6GB 2VH5L 1NBZA 2OMNA 2NY4D 1CQKA 5BO1H 1U8IA 2GAZB 5I15L 4LOUD 3UDWA 5JZ7C 1UWEL 3TZVB 4F3FA 1OGAE 3BDBA 2KKQA 1S7RA 1QBLH 4L4VE 1AHWA 1FZOB 1RZ7H 4NRYB 4JJ5A 5IB5A 5DUMH 5E5MA 3UMTA 4N0RA 4JFPB 3TF7C 2BRQA 1ACYL 3ZYIA 2FX8L 3TVMB 2NNAB 1FVCB 2QADB 4M1DL 2PYEE 4GQPH 2R1XB 3S34H 4JKPL 1DQDL 1MWAH 3P2TA 2MCPH 2HKFH 1SYSA 4KI5F 1S7WA 2X4SA 3T0EB 1CIUA 1IARB 1YYLH 4P0DA 1LK3L 3QA3A 1Q9LB 4TYUA 5DLML 3WHXA 5HI3C 3CDCA 3RQ3A 5GHWL 4LGPB 4M6NL 2FR4B 3TVMC 2QADC 2CLZA 5FO8A 4ZO8A 5FM5O 4UB0H 3T0XA 1E4KC 4RFNB 1FFNB 2IQ9H 2QKIB 5E56A 3C8HA 5HYEA 3P0VH 3T0EC 2JJVA 2EDWA 3GRWH 4JQVA 4GKNA 4XH2A 4JPIB 4YBQC 4EN3B 3TBTB 1JNLL 4NC1C 3OB0H 5CJBA 3BXNA 2YPLA 3CXHJ 3MJ9L 2BVOB 4PJAE 4RFNC 4RZCA 5HVFB 4OQ1A 1OARH 5GJSH 5MHSE 5JOFA 5DJ6A 2RBLA 1BD2D 4I4WA 2Y7QA 1NBVH 1IMHC 3QNXA 2CDFB 1IFHH 1Q9WA 1C5DB 4WI4A 1AKJA 1SBSL 1GSMA 4M8QA 4JFXA 1JN6B 4AIXA 3FTGB 4NIKB 2D7PA 4XPGL 1NBYB 4Y2DA 4JO3H 1ZA6B 4ZOBA 5BZDB 4KZDL 4G8EA 5CD3B 2P5ED 3TBWA 4GAFB 4QWWD 3IDMB 1FFRA 4MJIA 5D70L 2HTLC 1CDGA 5A2JH 3UJIH 2BY0A 3ECBB 1XEDA 4NN7B 1F58L 5F88B 4LIQE 3V5KB 3EYFA 5I8OH 5J1AA 5TQ2L 3ZHDA 1U95A 4KVNL 3ULUD 5SWSB 3AXLA 5ITBL 5I76B 1WBXB 5BMFL 3RTQD 4FQXD 3T0EE 1T4KA 1CLCA 1WWCA 2VRAA 1QR4A 3ALPA 1DL7L 2JTDA 1WWBX 3GSOB 1ZHNA 2W9LA 3BQUA 4OGXH 4NN7C 4ZUUA 2BVPB 2JJTA 4JM2F 4NO5A 3RP1A 1QVOB 3DTXA 1IGTA 3CSYB 3D0LA 5ID1B 3G6JB 2DLFL 4G8GD 4GQ9L 3ZKND 5BVJB 1KEMH 3FONA 4HIIB 3V95A 1CXFA 3DV6B 1ZEAL 4PRDB 1KENL 4WTZA 1PYWA 1UENA 4N1HB 5KZCD 3WHE0 4CGTA 4BFEA 3X17A 4HZLB 3KGRA 5J11B 1T04B 1LDPH 3HMXL 1C08A 1CG9A 3MJ9A 3MX0A 1G7PA 1NC4B 1OTSC 2XZAH 1BVLB 1FCGA 3L7EA 3HI6L 1T1ZB 2ICCA 2FGWL 3B2UC 2KPNA 5J11C 3IF1B 1J88A 1JF6A 1WSST 4LDOB 1PEZA 2VDRL 4N9GB 2ZUSA 3WIIL 3S3PA 2YHGA 4ZQKA 4Z78A 3MOAH 5B8CB 2UV3A 3W11C 5C0CA 1CI5A 4AT6B 5KBNC 3ULVC 3PABA 3LKPA 3QWQB 5EZJA 1TQCC 2QQLH 4WFHE 5C07D 2VZVA 3HZVB 4KHXL 1IAKB 2FSEA 4ZO6A 1MFNA 1JZ8A 5DF0A 1CGSL 5B8CC 1FDLL 3ZDXF 1G9NL 3GMMA 3P3YA 4FP8L 2YPKA 4UIKL 4WI3A 2OTWA 4ERSL 1KOAA 1MCDA 4JGJA 1WTLA 3HE7A 3NCEB 1XR8A 3NABH 5E4EB 4J6RH 2KQMA 4ODWB 5EOCL 1ZHBB 3H3BC 1MCHA 4Y19D 3WE6B 5EWIL 2H6PA 4HUVB 3G6JE 5LG1A 1F4YL 1NBQA 3KG5A 4KKCD 4K3EH 2ITDA 4OAWB 3WD5H 3O9WA 2EC8A 4RIRB 5E4EC 1PX3A 2XKNA 3WXVH 3B8SA 5FO9A 3I50H 4KMTH 3MXVH 4JY4A 3VFMA 3SE8L 1T03H 5D96C 2QBWA 1KPVA 3M8OL 1FBIL 1RU9H 3RHWK 4BSVA 2CRYA 1TQBB 4QY8A 3IDGA 1J11A 4LVEA 1J1OH 3TN0D 4QRRA 1KLUA 2J6EL 3V6ZA 1T83C 4JFYB 3SGKC 1F2QA 1A9EA 1NMCB 3CLFL 3DPBA 1A2YB 3AU1B 2HJKA 1OPGH 2OJEA 4WO4A 2FIKA 3CFJB 3JVGA 4ONHB 4WUUD 2O5YH 1ND0B 3CU7A 1D5XA 4M9PA 2IPUK 2V9TA 5JW5B 1C5BL 2VLKD 4U1JA 1TQBC 1CBVL 3MA9H 3MLVH 4L1HA 1VADB 2CK2A 5ISZD 4IDJH 2W65A 5BCAA 3F65A 3SQOL 5M95B 1NLDH 1NMCC 2A73A 2Z92A 3P77B 3IJYA 3EZ8A 3O3DB 4JZOB 4BM7A 2GSGA 2WZPD 1U8KB 1HHJA 1SM3L 4NCC2 1WF5A 1INQB 2OR9L 3LIZH 2JJWA 1YMHA 3NH7L 2YUXA 2OL3L 2V5SA 2HKHL 2P8MA 3I6GB 4XMPH 5FYKU 3MGTB 5C0EA 2OP4L 3SKJL 4PRPB 5C0FB 5I8EB 5F8RC 4UT6L 2EEDA 4L5FL 3BZFA 3EYSH 4X80H 2YKLH 3OSKA 2VZOA 3IDUA 1A6ZB 4UBDD 3H7BB 4U2YA 1TJGH 1KCSL 3Q5YA 3G04A 1N59B 3PWPD 2GTWB 2Y36L 5HPMA 5T3ZE 3KDMA 4KJQC 1YQVH 3QQ9D 4Q9BA 3ARFA 4GRLA 3BP5A 5EU7E 1W0WA 5EZLB 3C8DA 5ADPL 1T22A 4WFEE 1N5YH 4OF6A 4QTHA 1Y6NR 4H1LG 3VFGH 2I9TA 1U8OA 5F1OB 2FX9L 1CFSA 3DECA 3O2WL 2P7TB 4XNMA 4YHOL 2J6EA 3DWTA 5DD3L 1LEIA 5HYIA 4MNQD 2EDBA 2F19H 4NGHH 1ZSDA 3WFDL 3WLBB 3UJTL 4P2CG 3EOBB 3GSVB 5FDWB 1RK1A 1QNZH 1CDUA 2HVKB 1ONQB 3QUXA 2NY5H 3TNNB 4HJJH 2PKDA 1KC5L 2EE9A 1A6VH 2JCCF 1HSBA 1NGQH 1SJHB 4K9EL 5JXAL 5GSVB 4U1LB 2OMBA 3SCMC 3DVNB 2BVUA 4YHKH 3RU8L 4YNYB 4P23B 3QO0A 3AREB 1P7QB 5DRWB 3DI2B 1A1OA 4YDIH 1OP9A 3ARBC 3IXTB 3PP3H 5FUCC 2DBLH 3GBMH 5EU3A 4F9PA 5D5MB 4PRPE 5I66B 3N1FC 3DX9B 1V3MA 3V0VA 4A6YH 3RY5A 1F13A 4HT1L 2EYRB 4EOWH 5ACZA 1CXLA 3U1SL 5BVPL 4P23C 5ENWA 4M7ZC 3AREC 3MXWH 1V7ML 3FB7A 1IM3A 1CLZL 1JRHL 4IMLB 2BOCB 3UBXG 3T2QA 2V2TA 3NIFE 1G9ML 5T3XE 6FABL 1HHIA 3IFOA 2VDPH 4K94C 1JI1A 5GSRA 2E27H 4JRXB 3HAEH 3SKUD 4JRYB 4QOKA 1YZZA 2IALB 3HA0A 2GUOA 1FFPA 1KN2L 3QEUA 5E1AA 4P3DB 4NQCD 3GSRB 1CDHA 1CFVL 3X13A 1YPZA 2X1OA 1RMFL 1YEKL 1BIHA 2EC9T 3R1GL 4M9OA 4CAGA 2W0LA 3HCVB 1DR9A 2HTKD 4WY7L 5DA4A 1NPUA 1V3JA 2GITB 1LEGB 3BZ4B 4NQUA 1EZVY 3WCYA 2MJWA 4LARH 4MD5A 2FD6L 4JFQA 1S7QA 5DJYB 5EN2B 1RIUL 3T1FB 2DKSA 2C7UB 1GGTA 5E03A 2ICWI 5FUCE 3CH1A 2ITCB 5DJ2B 4XNXH 3F8UB 5IMMB 5MEND 4PJXF 2EEAA 3GMQA 4X4YB 2FX7H 3O3BB 2IADA 3MR9B 4N8VA 3KJ6L 2EXWC 2HRPL 1QR1B 1NUDA 5IMKA 5EOQH 3GI9H 5CEZE 1ZT1A 2NQCA 3NA9H 4Y4KD 1GJIA 4GBXD 5BV7B 3BRFA 5D5ME 1RZJC 1FORL 1J8HD 4JB9L 5DVNA 4K3JH 5T33H 1QBMH 4TUJA 5F7NC 4LEXH 2Z8RA 3RZCA 4MXWL 2UZIL 4JO2L 2BVQA 2IBBA 4NRXA 4JR9H 5B39G 1FNSH 5I1AA 2PR4L 5TPWH 1OGAA 5BV7C 5D7JB 3U83A 2BVTA 5CHNA 1JWSA 5DVKA 2QR0A 4JRXE 5JR1L 2H26B 4JRYE 2WK2A 1RURH 2LAGB 4E41A 1U3HD 2CMRH 1PKQA 4CBPA 3O6FD 3LKRA 5JPMA 1NAML 5EU4A 3IU4L 2UWEF 1AE6H 3TH4T 1XF4B 4D9RD 5D7JC 2D9QB 3EOAB 3SGDI 2VXQL 1CD0A 1KJ3H 3VGBA 4YXHH 1OAYL 1JGUL 3PIQA 4U6YB 1KNOB 1WC7B 5T5NG 3VFSB 5IB4B 1GGBH 3QCTH 4HDIB 4UT9L 4CNIA 4FXKB 32C2B 4XCEB 5BZWB 3V0WH 1YEEH 3ROOA 2OXGA 3RX7A 2MPAL 2JE8A 3RX8A 5BS0B 3L5XH 2BNQB 2Q3ZA 1CIDA 5CD5C 4ELKB 5CWSA 1WTGT 4WHTA 5D1XD 3E3QE 1FJ1B 3VWJB 1Z3GL 3WS6A 4PJ7A 5HYJA 1P6FA 4C55A 1X6NA 4NHCL 3C8KB 1PG7W 3ZDZE 4WU7B 1U8PB 1XF5B 5IK3A 1ZVSA 5D1ZA 1P69B 1C12B 4AEHH 1AI1L 5JMOC 1UVQB 1I7UB 4XHJD 4XP6L 3QHFH 3VWJC 4OLWH 4WHCA 3O6ML 1CZ8H 2QQKH 5J6GA 5C0AB 3ZHLA 1I3VA 3ISWA 4LMQE 4OM0H 2GAZA 1CGVA 3HI5H 3VXMB 1A7QH 3LSOB 2NY6B 3ARGC 3WNNA 1IAIL 3IKKA 2GJ6D 3ILQC 1L9NA 1OAUL 4KV5F 1FZOA 1OLZA 3P0YL 4NRYA 4XWOC 4ZSOA 1MIEL 4EI5D 2D3VA 1IILE 1S8DB 4BFBD 4NN5C 1MCKA 5D1QB 3B2VH 1FVCA 1NAMA 1FL5B 2E6QA 1LO3H 3GEWB 2NY6C 5JIKA 3UJJL 3RWHB 3H9SD 4NWUH 3C5ZB 4LGSB 5MP6H 3BP6B 3T0EA 4PJCE 3RA7L 1LE9A 3AY4C 4WDIA 3MOBL 4M4PA 4O9HL 3QIWD 4RGNB 3PGDB 5D1QC 5D7IA 1IGYA 3RAJH 1WBZB 5ESVA 3VW3L 4JEGB 5FECB 5BS0E 2QKIA 4RFEB 5ID0A 1Z6JT 1URLA 1CS6A 2BNQE 5LGJB 3O2VL 1X5JA 5KTEH 2EICA 1DCLA 1V7NL 4QNPF 4Y89A 4DQOH 3C2AL 1H3XA 5DYOA 3TO2B 1ZT4B 4K7FA 1AO7B 2BVOA 5LBSH 1D7FA 1F00I 1K9TA 3PHSA 1A1MB 3UTSA 4RGOL 5AAWA 3ULVL 5C0AE 3QUZD 3SO3B 2CDFA 4JFZL 4DTGL 3MV9D 4CVXA 3Q3GB 2BOBB 4KK8C 1JN6A 4LLUB 3PG2A 2JB6A 3O11A 2OS7A 1XIWB 3VXME 5BZDA 3D3VD 1HSAB 4OCSH 4P9HH 4TVPH 3RUGE 3KPRA 4M7KH 4PJCF 2F53D 5IF0B 1RUKL 4FQ1L 1KGCD 2V6HA 5JPNA 1JV5B 1DQJA 1MCPL 5MEOB 3DGGB 3ARRA 4AY0A 4OUOA 1N0LA 4FQCL 3SO3C 1TVHB 2VISB 4MXQD 4K55A 1OF2A 3Q6FA 5F88A 4ALAL 4NQDA 2VLRA 4OJFH 3T65B 2LVEA 1FLRL 4ETQA 1HYSD 3LEYH 5SWSA 3P11L 2C1PB 5I76A 5L6YH 1FYTD 1UQSB 3K8KA 5B38B 2ZCLL 1BIIA 4KAQH 4YDKL 4D0DA 4RGNE 2O93L 4OLZH 3ZKMD 4O5LH 2WLZA 4OV6F 1CVRA 4PV8B 5H8DA 4KJPD 3RPIA 3RVUC 4GMTH 2J8UA 1S9XB 5KVFH 1BZ9B 3QDAA 1HQRB 5F1NA 4WW2B 4WNQA 2DLTA 2DTMH 3RGVB 4DW2L 3G6JA 2CKBB 3KPOB 4JFED 3GHBL 3BIKA 4Y7MA 4HIIA 1M71B 1YEHL 3DV6A 4H8WC 4ODTL 3KR3H 2WUBL 1S5HB 2V17L 3DHJA 3NOIA 4QRQA 5DC0A 4KZEH 1HZHH 5AEAA 3RIAF 2DQFB 3U0PB 4LCYA 4LSRL 1D5ZB 1WFNA 1BFOB 2E9IA 1LEKB 1A6PA 2NXYD 1LO0H 4LPYA 4RRPG 1AO7E 1KACB 1I3GL 2XQBL 4X4XB 2M1KA 4XMKL 3RGVC 4IOSD 3ZTNL 1UC6A 5BQ7A 1NC4A 3RUGF 4S1QL 4IS6B 1PG7X 5AYUH 1CR9H 3O8XD 2H32H 5F6HI 1KULA 1QBBA 1A7NL 1C5CL 4BQ9A 2HN7B 3B43A 1SHMA 3X3GL 4XXDB 1XR9B 3NCBB 4D8PA 3QO1A 1I75A 4Y88A 2AQ2A 5B8CA 5IB2B 4I3SH 1NGXB 1KCUH 4D9QE 4HGMA 1REIA 3SDCB 4FFVC 1YY8B 4NCDA 1NCCL 4AH2A 4N8CL 2P45B 4U33A 1EA9C 4I48B 1VFMA 4ODXA 3HZVA 1ADQH 2I9LA 1IAKA 1CK0H 2EDJA 4HBCL 1QPPA 2IWGA 4TRPH 3HI1A 3OKEA 2ZOLB 5IHBA 3HNSH 4YHLL 1MRFL 3FFCA 4ELMA 2P24B 2QSCH 4HKZB 2WIIA 5IG7A 3VD9A 4OBSA 3U0WL 3U4EA 1ZHBA 3TH3T 2ZUWA 4R0LB 4Z95H 1U92A 4V1DA 4PBWD 2NXZD 1EO5A 5F3BB 2H8PA 4OD3L 5EC1B 5DJ0A 1T83A 1FVDB 3SGKA 3HMWH 2GIYA 4MJ2A 4LSVL 4HUKB 2UVEA 1MQKH 1MIML 3MV8A 1CQYA 3QHZH 4HIEB 1R5VB 2HLFD 1A6UH 1RUML 1VSCA 4POZD 3SY0A 1VPOH 2R4SL 3L3HA 3NACL 2R2HA 3I85A 4F15B 3EOTL 1UM4L 3QXUA 4JFYA 5C08B 3GIVB 3BDYL 3MLZH 3MSPA 5H94B 4DN4L 1F97A 4ONHA 5AZ2H 3FO9A 4JQIL 5I9QB 3RVWD 4PRAB 5LKNA 4X7SH 1Z0NA 1GAFH 4GKOA 2HJFB 3QFJD 4R90L 5FGCB 4TPRH 5C0RH 5K9OB 4X6CA 1LDSA 2DWEA 3BKYL 4F15C 5GRVL 2EYTB 1RJLB 4JFOA 4TNVF 4XNYL 5FGBC 3HUJB 2XWTA 5KS9B 1FE8L 3MUHL 5EBLB 5IVZA 3O3DA 4Z7WB 2ILLA 4M00A 3QUML 1QFWL 2ENYA 2BX5A 3K2MC 5I9QC 4MCZB 2IEPA 3BEVB 4OLXH 1U36A 3P4MB 3PWJB 4N9OB 1TXKA 5HHOD 3UO1L 1LK2B 3D69A 1IC5L 4WFFD 3DROB 3PUCA 4X5LA 5DMGC 3AM8C 4PRPA 1G7JA 1DSFH 3JUZA 3VFUB 2C4FU 2MMXA 3TESA 4WW1B 1LHZA 5GGTL 5F7UA 3BRGC 3VA2C 5CJQH 5DMIL 1GYAA 3H7BA 4NKOB 4PYGA 4R3SB 2J12B 5GRWA 3W0WB 3LHPL 3QB7C 5CP3A 1FLTX 1KJVB 3VXNA 5D7LB 1GIGL 1MJUH 3QDJD 3L3OA 1ORSB 4R26L 3LKOB 3LEVH 4PJ5A 1RVFH 2R0KL 3TIEA 4F58L 2AKRB 5L2KD 4NM8L 5EZLA 3DXAA 3V6FA 1QSZA 2GY7B 4JFHE 2EDDA 1UG9A 1OAQL 3MQIA 5C08E 1NCAL 1VGEL 1DBML 3UAJD 3WLBA 3SCMA 3OJDA 3EOBA 4TN9A 4MJ6A 1CL7I 1PSKL 1ONQA 1AIFB 2FBJH 2HLAB 2AS5M 4PRIB 3RVTD 3UTTA 3RWIB 2L7UA 5C92A 1G6RB 5HYSA 3JV6B 3H42H 4K3HA 5I1LB 1YC7A 5GSVA 3HB3D 3ARBA 3OWEA 25C8H 4U1LA 3HUJE 2B4CC 5KS9E 5DD6A 1JWMB 4OCXL 4I77H 3O2DA 4Z7WE 3GMRA 3QUMA 2FJGA 4R97C 5D7SL 2OQJB 3DETD 3UYOD 3CFCH 1RZJL 2AQ1A 3JBG7 3JUYA 3Q48A 4YNYA 4LSSH 4EEEA 4QRPB 4P23A 3VCLB 5JORB 2X1QA 1A4KA 3EUUA 2HMIC 3JWNC 1P7QA 4HX1B 3QRGH 4OSUH 1SJVA 1XH3A 1ZGLA 2IANB 1GOFA 2VZSA 3KPLA 3BE1L 1LO2L 1H3UA 2O61A 4U1KB 4RAVB 3HTLX 4U7SA 5DXWA 1UEYA 4PJHB 5GGTA 3DURB 3AC0A 5J6HA 2M8XA 2EYRA 1OAKL 1QKZH 3NFSL 4XPTL 5IBTL 1M7DA 5J1TC 3W0WE 4G8FA 5F7EL 4WCYH 1RZKC 2CJUH 5D7LE 4MAUH 3VXUD 2VXTH 4R4ND 4NO3B 3KPQB 1KV3A 5A43C 4FFYL 4J3VA 1A6AB 3PL6C 5E9DB 4F33B 2RFXB 3VFVB 3BKJL 4NCC1 4Y1AB 2IALA 3PQYB 4UQ3A 3WJJA 1TJHL 3O3EB 4RA3A 3GSRA 1CDJA 1A3LL 1HCVA 1JWUB 1L0XA 2BNUB 1ZLSL 3QULA 4Z0BL 4RBPH 3RKDD 4Z7WF 1K8IB 5KSAB 3I02B 4PP1C 1CGYA 1CICB 1F4WH 1SY6L 2VZUA 4FFWC 6CGTA 2GITA 1S7SA 3RZWA 3SDDB 4PRIE 5EOTA 1YNKL 4DKEH 5DD5H 5HHMB 2ZUQB 3ZE2E 1S9KC 4IRSD 4N0YH 2C7UA 3CFEB 3NMEA 4L3CB 4DFHA 3S37H 4PGEB 2MNUA 3N1PC 5AWNH 5KSAC 2X89A 4P99A 4JM2D 5GS0H 1DBAH 1CICC 2Q6WB 5IW6A 3SDDC 3O3BA 2QHLA 5IMOB 4QRPE 4DKAA 2BFVH 2OI9B 3LRHA 1NDGA 1QR1A 4LVHC 4XP5L 2K7QA 4U1NB 5C2UB 1YPZF 4IRZL 2IANE 1NCBH 2GKIA 1WQVT 3D25A 3GBNL 4KVCH 1P4LA 4LLVB 1GGYA 4PRNA 3QCVL 4PJHE 4QCIB 1KXQE 4P4KB 3RIFF 2X05A 3W82A 3UTPD 4G7YH 1MWAB 3WYRA 1JPFB 3HNVH 3KPSA 5TGBA 3SE9H 3MRJA 3WO4C 4XT1C 5E8EA 3V7AE 4PD4K 3KYKH 5D7JA 3LB6D 3H9ZA 4KRPC 4L3ED 5E9DE 2PTTA 2HJLA 1WZ1L 4NYLB 1YN6A 2FJFB 2PW2B 4Y1AE 3PQYE 4U7MA 4Y4FB 1A64A 2P5WB 3H3PH 3VG0L 1BZ7A 3BAEH 5LCVH 4PUBL 4HKXA 4MA3A 5BW7C 3OKLB 4I3RL 3ETBF 1IE5A 2VDMH 1XF4A 3K0WA 4BZ1H 4NJ9L 5EG6C 1QSEA 3BPCB 5EB9A 1MFEH 3TBVB 4S1DD 2EDKA 5KVDH 2GI7A 3KJ4C 1KNOA 1DEDA 1WC7A 5ERWB 1IQWH 1XGRB 4Y4FC 2DWDB 3WNMA 3I6LE 4C83A 1ULVA 1FL3A 3MMEA 4FZEL 5HHME 1UJ3C 4J4PD 1FNGB 2A9NH 1A1NB 1QO3B 4P5TC 3M1BB 2NR6D 2C9AA 4OFDA 3VWJA 1T1YB 4LFHD 1DN2A 4JHWL 5FYKD 1AJ7H 2WBKA 1MLBA 1U8PA 4WU7A 4OV5A 4PRHB 2ADGA 3TO4C 1I7ZA 4IIQB 3GK8L 3ARGA 5JO5A 3OMZA 2FHCA 4P59H 3SQBA 5JUEH 5TH2B 1MRDH 3CX2A 1RJCA 4LQ1A 4HWEH 1W72L 4KK6D 4ESKA 2JJSA 1MFAL 4N0CC 4OFIA 4G43B 1TZIB 1UEMA 3INUH 4IIQC 4MA7H 3LSOA 4OB5H 3G08B 4LMQI 1MAMH 5CJOH 5GGVH 1VGKB 5GRXG 4QT5B 1AGEB 3S36L 1P9MC 3TBYA 3AY4A 5C0BD 5TDPA 3OKNB 3MCG1 3NCMA 1U8QB 5CINL 4PJ7F 2P5WE 3HE6D 4XVUD 1PG7H 5D1QA 4MMXC 1JIBA 4XI5C 1FL5A 3GUTB 2XYCA 5EUKB 4BZYA 4IHOB 1JHTB 3S5LA 3MRGB 3DX7B 2VDOL 5GIRA 4WI2A 3SDYL 2ZCKH 3WMSA 4DFIA 1QQDA 5JIIA 5SWZB 1JF1B 3BH8B 4P2QD 5ILTL 4DN3L 4Y8AA 5ABDE 2JKXA 1QOKA 3WL9A 1CF8H 1SEQL 2R0WL 3A0OA 1YDPA 1IT9H 1T20B 3SE4C 4KDWA 2AAVA 4U1IA 5CILH 2IPTL 5JHLL 4HWUA 5DDHA 3MV11 4G7VH 3UC0H 4PRBB 5KSBB 3QZWA 3LKNA 3NCJL 1E6JL 1CFNA 3PGFH 1Q8MA 3PNWB 1T66C 5MI0B 3VRJA 4PJ8D 2ICEB 2X4QA 1HH6B 1IGFL 4PRHE 1K8DA 2OJZH 2P5EA 4L4TB 4S11A 3VE0A 4OZHB 4LCWE 2QHRL 3E6FA 4JVUA 5I16B 3L95B 5T1DH 1W72A 2BC4B 5CLWA 3DUUA 4CJ0A 3GGWB 1EHNA 1XFPA 5D7IF 4YJZL 5KJRL 1CXHA 5MI0C 5E6IC 5J3HD 3EKCA 3KLSA 4HHAB 1V3KA 4OLVH 3D0VB 2DQIL 1HSAA 3DV4B 1WITA 4ODHL 1U91B 3BKCL 1FGVH 2VSDA 3QWOA 1NCWL 2GK0A 1EEZA 3LQMA 1R5IA 3MBEC 1YEDA 3DGGA 1Z5LA 3IDIB 4QRTA 3TBSB 3MLSL 5GXBB 4X6DB 4F7CA 2HAZA 3T65A 2EDOA 1NFDB 3Q5OA 5GRJH 3MRKB 3N1GC 3IS0X 1S5IH 1E28A 2C1PA 2XFXB 1BQSA 3HZMB 1UQSA 2YBRB 4BQ8A 2XZQL 4XVTL 1WVZA 5SWZE 2YS4A 2I60L 2WBJB 2W07A 2DBJA 2O5XL 3G5XB 3JWOH 3O3AB 3RI5F 3P4NB 1S9XA 4YDVA 5DO2D 3VFPB 2VDKH 1NQBA 3KPOA 4KTYA 3ZTJG 2J8HA 1BFVL 1M71A 2F54D 1DDHA 4Z7QE 1FG2B 3BWAB 4TQEL 1XGYL 1S5HA 3NFPA 3SGJC 3O4LA 5KSBE 3NAAL 5FYJE 2DQFA 4ONOA 4LRNL 5L88H 4HK3J 5DD0L 1MVFA 4JFDE 1QA9B 5LQBL 2CXKA 2YD4A 2Q8BL 2R1WB 2PCPB 1IKFL 1MHEB 4OF0A 1BBJB 4L4TE 1T5WA 4G6KH 1R3IL 4OZHE 4IS6A 4HIXH 3V79C 2CLRB 3NTCH 3IT8D 1OT2A 4FQJL 5C07A 2AJYH 3E8UL 5ITFB 1HYRC 3SPVA 3H0TA 1G9EA 1T0NB 5CP7A 5JXEC 1EFQA 2J8UF 4KI1A 4L8SC 1JNNL 1NUGA 1UXWB 3G6DL 4YR6A 1P84J 3BW9B 5GQBA 4H25B 3OBAA 1AQKH 5IB2A 3OR7A 3OPZL 2R69H 4PTTA 5HD8D 1B4JH 1X5YA 3SJVB 1CYGA 1OW0C 3V52L 3QRFM 1MCOL 1MHHB 4HKJA 3OR6B 3V5HB 4I48A 4X6DE 4JHZA 3STLB 1X5GA 4U6VH 3OGCB 2X4OA 2VR5A 5E94A 1CLYL 5C0IA 1NFDE 1WWWX 2H1PL 1F5WA 1T7YA 2IG2L 4LGRB 5DR5H 4LSQH 3GZKA 2FL5A 4HKZA 4LKXB 3ULVF 1B0GB 3MRIB 2VXUL 3UP1A 3VD7A 1HHGB 4S0SD 1GRWA 2VXSH 1WAAA 2MQCA 1CD8A 1OCWH 2X4NB 3N85H 1QLEL 2IH3B 4NKDA 1JUFB 3S35X 4XX1G 5F3BA 2YA1A 2PUQT 5E95B 3BZEA 1RY7B 3CH8A 4HS8L 4WTZG 4FQQA 5DT1H 1FVDA 1YUHB 1IZJA 2BNRB 1P1ZB 1G7LB 2E7CA 4FNLH 3IDXL 3KHOA 4O58L 3MLPA 1OVZA 1BM3L 3FOLB 3QG6A 4BUHA 3FT3B 4HIEA 5I1IH 2Y72A 1DTUA 2GJJA 2LTQC 5DFTA 1KTLB 2AABH 1PLGL 2XTJB 5C2BH 4TUOB 5CSGA 4GH7B 3QJHA 3VGDA 4ELMF 1BLNA 5C08A 1FAIL 2AJUL 5FYLH 3GIVA 4KRNA 5EBWB 1ETZB 3QQ3B 1F45A 5AG8A 5H94A 2AK4D 2NY5C 4BH8B 4HKBA 4CMHB 3T2OA 5CEYB 2AGJL 1E4XL 2UVFA 3ARXA 3MLUH 1F3JB 4HJ0D 4M6AA 1A14H 4Z7UB 3HG1E 1TPXB 2EYTA 5KSVB 2X4UA 4JLRB 1L4IA 1LMKA 3P30H 4FQHA 3HUJA 4GXUM 3SJVE 3CVIH 1KPRB 1SMAA 4A6YB 3IFNL 3OXSB 4G6AD 3HPLB 4OFYD 3T09A 2P46B 4CMHC 2FDBP 3FQRB 3QT2A 2AXFA 4PLJC 3EDKA 2DYPD 3IFPB 3AUVA 3PWPA 2EDLA 1TPXC 1MJ7H 1YJDC 4PY8J 1LK2A 2MWCA 1EEQA 4KK5C 2Z31B 3DROA 1RZKL 4DGYH 3HAEB 1KJ2B 1QFPA 1M7XA 3SGDH 2PNDA 1WCBA 4GLRH 5I1JL 4HUXA 5I19L 2CDEB 2IBZX 2EZ0D 5IP4A 2JB5H 1D9KB 4NUGL 1AFVL 3WNLA 4K7PX 1YEIH 4R3SA 1LO4L 4FTVB 4X6CF 2HFGH 1S3KH 1I9JL 4ZFOB 1B90A 1I1AD 1KJVA 4MNQA 4HGWB 2Z31C 4RGMB 1ZLUK 2Z0BA 4M61B 3IVKA 1B88A 1X7QA 2P44B 2BNRE 3LS5H 1KTRL 5AYQA 2FLRT 2NLJB 3QIBD 3LQAL 1D9KC 2F5AH 1V05A 1IKNC 1PDKA 3WLWD 3PHQB 3N9GH 2XTJE 3T0AA 5IVXB 2IAMD 2HT4D 4JM4L 4RGMC 5HHQB 3EO9L 1HWGB 5GGSY 2XICA 5DURD 2OX5A 4NKMB 5B3JE 4TOYL 5HDBF 2BJML 5I8CA 5EZIL 4J3WA 1DQML 3RWIA 3TCLA 1G6RA 1BOGB 3FT2B 1D6EA 1X5KA 4XC1H 5J9PB 2V5TA 2OQJA 5DQJB 4K23H 5FKAA 1TMCB 4NM4H 4CU6A 2V2XA 4E5XB 5JORA 2XA8L 4DGIH 4HX1A 2Y4SA 4M03A 5ICZA 2Y5TA 5IM7B 4P46B 4HWNA 4U1KA 4RAVA 3PL6A 5GISH 1XF2B 4Z7NE 3VH8G 4NZUH 1DBBL 1QRNB 4FRWA 4J1UB 1WT5C 4OF5A 4XCNB 4OQTH 1LILA 3EGSA 2IFFH 4M62H 4XTRC 3S34L 4FTVE 1LP9B 3QUYD 1JVKA 3VJ6B 1ORQB 2HKFL 4XXCC 3KPPB 3P9WB 1OSPH 5F8QC 4NO3A 1JHKH 1ZWIA 1F6AB 1A6AA 3UTQA 1S9VA 5E9DA 2RFXA 5ADOL 4M1CD 4ZS6D 4PS4L 2UZYB 1JFQH 1T1XA 4NNYA 1BVZA 4BKLB 7FABH 5E08H 4WGVB 3V4UL 2EIDA 4HQQH 5KVGH 4H26B 1ZXQA 1EBAA 2BSSB 3FO0L 5IVXE 2Z93A 4P57B 1UKSA 1JWUA 1OSZB 2D4FA 2DDQL 2AJVH 1K4DA 2D2OA 4DK6A 4GW1B 3GRWL 3I02A 4I0PC 1NFKA 4LRIA 1CICA 1FNEB 4U4BA 5HGBB 3TYFA 2APWA 3KYNB 1MI5B 2XNAA 1FGNH 4GKSB 2ARWA 3BYTA 4LVNB 5L9DL 4ZTOH 1GHFH 4IOIB 1IBGL 4TTDC 4OZIE 3DSFH 5FHAH 1I4FA 2YMXL 4R8WL 3BVNA 1MPAH 4GBXA 5DTFB 4O4YL 5TJWK 4HUWA 1RUAH 4N90D 2VDQH 1E27B 1J8HA 1TNNA 3NZHH 4HBQA 1AKJD 1IEHA 3CSBA 1L7IH 2XN9B 1B3JA 4Y2DD 5ECJE 5BRZA 4LVNC 1YEGH 4X5WB 5FA4B 2OR8A 1RZFH 4X0KB 4DOHB 3HC3H 5HHPB 4HV8B 5KG9B 3BHBB 3B4NA 3MV01 3LH2H 1L7TH 2R2EA 3UJIL 3MRMA 1QRNE 3ZYOA 4OLYL 1MWAA 1PQZA 1JPFA 1LP9E 1RJYA 3B9KC 4UNUA 3JXAA 2XXMB 1G0YR 2Z8SA 4L1DA 5MERA 1UZ8A 3EDDA 3BQUD 4O51A 4YAQB 5C9JA 4NQVA 1GPOH 1JK8A 3UYRL 3OX8B 4NP4H 4NQXB 5JHDE 3SDAC 4Q9RH 3CPLA 4OGXL 3GSXB 4Y4FA 2BHUA 2V9RA 3OKKA 1IC1A 4OZIF 3V6BR 1GH7A 3G5ZB 3OKLA 2W60B 3OZ9H 1UJ3A 3TWCL 1ZLVK 5I1EL 3OF6A 3BPCA 1PEWA 1KEML 1BD2B 4P5TA 4KKAC 5AAMA 1TETH 3GRWA 2X44D 3GKWL 1N6VA 3D39B 3CZJA 3W9DB 1HNGA 1MI5E 5D2NB 5FYKH 1CD1B 4H0GA 3OL2A 3TO4A 1FNGA 4B5EA 3D2UD 2XZAL 4OZ4B 3MRBA 3K4DA 4MAYB 3M1BA 4U49A 4U1SB 4HXAL 3LN4A 4KTDH 3DBXB 1YEJL 1U58A 2E6PA 12E8L 2P8PA 1MHPL 4KUZL 5I30H 2XN9E 1F4XL 4YZFE 4N8VG 5C9KA 5HYQA 5IW1B 1JCKA 2A0LD 4ODVH 5IHLB 2B20A 1EO8H 3U7YL 5D2NC 5T1LD 2NTFB 4K07A 1EJOH 3V2AR 4LCIL 3V8OA 4U7KA 5C0CD 2C4FT 2AJZB 3F7QA 2GJ6A 4DOHE 4IIQA 2CDGA 2ZG3A 4JN2B 1BWMA 3RTQB 4FQXB 1KIQA 2X1WL 4YO0A 4MAYC 3QHTC 5HHVH 4XNQB 4K8RD 4EI5A 1CTNA 2W0KA 4U6XA 4YHIB 5TH2A 2J1KA 1EAPA 4HS6B 1G7IB 1JTPA 3KPTA 2HH0H 5FGSA 4UILH 4NC0B 4I3GA 4P3WA 2VWEE 4P9HC 3H9SA 1TZIA 1NFIB 3HE7D 4JAMA 1RUPH 4XC3L 2VITA 4E0RA 3QAZC 3VMNA 4LPCA 1DEEB 5EO1B 1IGIL 4Y5YB 3CFBA 1KF9B 1DVFB 4WWKC 4M6OL 1K3IA 5EUKA 1JHTA 4GSDH 3OQ3B 4HUUA 1T7XA 1JGDB 3MRGA 4EBQH 3DX7A 5GS2D 4G9FB 5H2BB 2DQEL 4U31A 1BD2E 3GMOA 3QYCA 3WUZA 2PYFA 3BH9B 5F9JA 1HXMB 5SWZA 1T1WA 1JF1A 4OTXL 1CDYA 4Y5YC 3D39E 2DQTH 3OJVC 1DVFC 5C3LD 3I50L 4KY1L 5HGHB 1T03L 4QRRD 5D2NE 1T20A 5JW4N 1RU9L 2AV7A 1MLCB 3OGOE 1Y6MR 4L8BB 1UCBH 4FFZH 3MUJA 4MD0B 2AXGB 3O81A 1J1OL 5IQ7H 1J1PL 2XACC 2CSPA 4JDTL 4WO4D 3TNMB 3DIFA 5HJ3A 1D5IL 1DE4B 3FMGL 3QUZA 4ZOEA 3KNBB 1OPGL 1CE6B 4Y5XB 2VKWA 3ORJA 4MDJA 1EUTA 3NIGE 2L4OA 5E6IA 1LE5A 2BERA 1HH6A 3D3VA 3ULUE 1O0VA 4Q0XH 4TVPE 1NDMB 3WEXB 4L4TA 1AR1C 1JP5A 4PV9B 3VA6A 2A38A 1NLDL 1SBBA 3L95A 3MBEA 4Y5XC 1OAZH 4LBEB 3CU1A 1A7RL 1FSKB 4ZNEE 5EO9A 3MRDA 3QPXL 3LIZL 5SWQA 4Y19B 3DHMA 4OGYH 3H2WA 4F80A 3O4OB 4G8GE 1U91A 4F37K 4QTIL 1B0RB 5FK9B 1IL1A 3BGAA 3MCLL 3A6CL 5DQDH 5GGRY 4HW6A 3T3ME 2BP3A 3FT4B 3TBSA 1FSKC 3L5WA 1LWRA 1MVUB 1UM6H 3LPWA 4TULL 1R6VA 3O4OC 3OAYK 1BQHB 2AJSL 4G9FE 3MRKA 3ARFD 1NCDL 4GRLD 2XFXA 5CBAA 1JYWA 3HZMA 5C0GA 1I8IB 4YC2B 4JANA 3OKDB 1FV1B 2GQHA 4LHUB 4MSWB 4X8XA 1PFCA 3U4AA 1HOCA 4Z77B 4WUUB 3WJLC 3KPNA 3BPOB 3SGJA 4QHKJ 3NZ8B 4HK0B 5D7KD 4AM0A 3O3AA 4XAWH 3WDHA 5DFWH 3P4NA 3ULUF 1T2XA 3CNKA 3MYJA 5DZOA 3VFPA 1DQLH 2O26U 1X5HA 3KYMB 4YC2C 3QUXD 2H2PD 2C26A 1FG2A 1ZLUH 3BPOC 2HFFB 4XCYA 4BFGA 5EPMA 1XGQB 4R7NB 3DRQA 2W9EH 4GG6B 5JXEA 4PJIB 2R1WA 1ZAGA 4L8SA 3GB7B 1XGTA 3QXDB 1BBJA 2WV3A 5ELIA 4FS0A 1UH2A 3WBDA 3BSZH 4K7PH 4GAYB 1OW0A 3MRFA 2EIEA 1CGXA 1MNUL 1D5MA 2EXYD 4HWZB 2WWMD 5CJXC 3VD5A 3F7YB 2FWOB 4Y19E 3GBLA 5EO0A 1UXWA 3KLDA 5EU5A 2VXVH 4RNRA 4H25A 3X3FH 2WP3O 1RULL