1F4WH

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EVQLEESGGGLVTPGGSLRLSCAASGYVFSTYDMSWVRQTPEKRLEWVAFISSGGGRTSYPDTVKGRFTISRDDAKNTLYLQMSSLQSEDTAMYYCTRHFYAVLDYWGRGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wH01
3M17A 2D2OA 5DRWA 1RK1B 5GGUA 1NL0L 4CMHB 2GIYA 1E28A 3WLWD 5DJAB 4NUGL 5KW9L 2YEZB 2J8UB 1LK2B 4PRIE 1CL7I 4HWUA 6FABH 2PNDA 4XGZA 1BREA 1I8LA 4MD0B 3BH9A 3T2NL 4KGJA 1A6WH 2XA8L 1S9WA 1GGUA 1MWAH 2HN7B 4PV8A 3HE6B 1I8KA 4I48A 3FMGH 12E8H 1WTGT 5E2JA 4BQBA 3C09B 5D7JA 2DQUH 4RFEA 1I3RB 2VDPH 3STBA 5E8DH 1A4JA 1YNKL 3U0TA 2FLRT 4V2BA 2BVQB 3BKCL 3MO1A 4APQA 2QSVA 1RQ5A 1AY1L 5EC1B 2R0ZL 1SYVB 3CDGA 2ED8A 3VFSB 4F37F 2R2HB 4G43A 3PDOA 3TN0C 3B5HA 4XCNB 2D7QA 2HVKA 1T0PB 1WZ1L 3OKOA 1NKRA 5I1CL 4JDZB 2HJKA 1IAOB 2VQUA 3C08H 4DVRL 4Y19E 2JE8A 2IWGA 1CXLA 4X4YA 2HA1A 3BWAB 4QGTA 4H8WL 5D2NC 3AB0B 4C56E 3QEQB 4MJIE 1TTFA 3MJ7B 1MLBA 3GNMH 3BMWA 4KROC 3U9PL 5I15L 2Q86A 1DEEB 5K9KB 4KTDL 2H41A 4WEUD 4YDVB 2NY7H 1T03H 3SHSA 4ZSOE 4PJGA 1FYTB 1JNNL 2WWMD 1YDPA 5TPWH 4FRWA 1KELL 4X7SL 1L0YA 2R15A 5DJ0A 5AZEH 3AU1A 3HG1B 1Q94A 1UACH 4HF5L 4PBVC 4X0KB 5CBAA 4NIKB 3CXDL 4G9FE 2VZVA 4OBSA 5DA0B 4TVPL 4G80B 3JV0A 3V6OC 1MCLA 5FF6A 3CFJB 4K23H 3G5XA 1OTUD 1MFDH 3HFML 1A7NH 5AYUH 2F58L 2AK1H 3BZFA 4HAGA 1YUHA 4Z9KB 2FJGA 1KN4L 1SEQL 1CBVH 1UJ3A 1RIHL 5GS2D 3SKOB 4JZJC 3VXNA 5CWSA 3BP5B 3SOBH 3TT3H 4HKBB 1N4XH 4WFGE 5FCSH 3D9AH 3DUSB 1YY9D 1F3DH 5DGRA 4X80H 4MGXA 4M03A 2I25N 3T77A 1VEPA 5F3BB 4DGIL 3O3DB 3VFNA 4UT6L 3QG6A 5DURD 3DVGA 4IMKC 5DEFB 5I19L 4M62L 4PJDF 4XNQA 3FHQA 3OB0H 3NN8A 3BX7C 1I1AA 4Z0XB 5D1ZD 3JTTA 4NO0A 1DLHB 3NPZB 5I1LA 3KPRE 4K3JH 4YR6A 4HIJB 5T1KB 3G04A 2PTTB 1FL3B 1QTYT 2H3NB 1VACA 4Z7QF 3V5HB 4MYWB 3MRDA 1NMCC 1ODAA 3TPUA 1LE9A 4U0RC 4JFDD 1KJ3L 2Q7YB 1U8LB 1VSCA 4OLYL 5F7EH 2PYEE 4S11A 2AVGA 3NABL 3PL6C 3VGAB 4F33B 1OP3K 3RDTA 3I50L 1X7QA 4KI5D 5C0IB 4U31A 3WIIH 3EYSH 3QXVA 4MXQC 4NKDB 2YPLB 5EOQL 4D0DB 3OGCB 5IG7B 2IQ9L 1G7JA 2R1YB 3SGDH 3ZKND 3HHRB 2DQCL 4XNYH 5F1NB 5HHOB 2FJFB 2DQDL 4WDIB 4H5SB 4I0PB 2N7BA 5F9WC 3TO4A 4N5UA 2APXA 4QTIH 3MA9H 2ZCHL 4NN6C 1AKJA 3TBVB 1UA6H 2NQCA 4DGVH 2G75A 3MBXL 5BZWB 1B0RA 1A7QH 3RIFF 5GSRA 3NTCL 2V2TA 4XB8A 1JE6A 4FZEL 2BSSB 3KPLB 2Q8AL 3EGSB 3LB6C 4LL9A 5DDHB 1WLHA 3CFDB 2Z91B 1U93B 3V52L 4LHQB 2Y06H 1JRHI 2DQJH 4HXAH 1U2CA 3RWCB 1GOHA 5DO2C 4MMZC 4IOFC 2HTLC 2NY4D 2D0HA 1GVIA 3WN5B 4HV8A 3T2OA 3F12A 3MLXH 1AD0A 4MZ2A 4KKAC 1UB6A 3VWKB 1N0XH 3HZMA 1QLEH 1NEZA 2F9BT 3GK8H 1FGVL 2FNBA 2DWEB 1KIPA 4G9DB 1GRWA 2BNRD 4Z5RA 3GMRA 4DVBB 3RKDD 5GRWA 4ELKB 2C3GA 4K8RH 4HWEH 4GFTB 3HNTH 3BUYA 5EIVA 2DWDA 4C56A 4JN1L 4X7CC 2D7TH 3SQOL 3RZWA 4R0LC 1GJIA 3LS5L 3ZYZA 4R97C 1DVFC 3EJYC 5AD0B 2BC4B 4P3CH 1JK8A 3DURB 3EKCA 4R6UA 3P9LA 3VFVA 4DTGL 4FQJH 3M07A 1JTPA 5CSZA 4XPGH 1YNLL 3MLRH 2EZ0C 2YRZA 1OLZA 5I8EA 2IFFL 4ALAL 5BW7C 5T1MB 1AR2A 3LQZA 2C26A 3NACL 4UAOB 3MLUL 1LHZA 2ARJB 1W72L 5EOCH 3RWGA 2HTKD 3WD5L 1CGSH 5DFVC 4IHOB 2P43B 4YZFE 4B5EA 4N8PA 1OAZL 1TJIH 3M1BA 2GJ6E 1D5ZB 4LNRB 1ZVSB 5C70A 4KK8D 1MHHB 3QI9D 1E6JL 1S9VA 1EHAA 1FORH 3MLYL 1HCFX 2VLKD 5KSUB 3V79C 4OZIE 3KPTA 3C6LB 3QA3B 4X4ZA 3RZCC 1NCTA 2ADFL 4D3CH 1I8IB 3A6CH 4XAWL 4XPHL 2LAGB 4M61B 2EKSA 1KCSL 3F6IA 2R4SH 3SGKC 3DX8A 4JRYD 2HAZA 3IDGA 3OTTA 4KDWA 2AGJH 3G5VA 4M7JH 2WMPA 5HY9B 2Z92A 1N64L 1RZIB 2MFNA 3GMQB 3U0PB 1ZT7A 2NW2A 4FZ8L 2YUZA 5IB2A 1EV2E 3WEXB 1S9KC 3I9GL 1ZK9A 1MH5B 3BKYL 2F8VA 1D6VL 3FN9A 2EIBA 3FAWA 3MRMB 4HK0A 2XQYG 5EO0A 3TNNB 1YY8A 4PR5A 5F8QC 3AREA 2AJZB 5ICXB 5DUML 4G6JL 3C8DA 4QNPE 3PV6A 3VFRA 2DN7A 3D3VA 5TH2A 4QRPB 5IVOA 3S37L 5C07D 1KENH 1IGFH 4ZXBB 4YDKH 2X4TA 1CICB 5FB8B 1NMAH 5K59F 4PUBL 4X4ME 4R4FL 3DUHA 4OZHB 3G5YB 1WICA 1F3RB 3H9SE 4F7TA 1F97A 1A7RH 3BSZL 4JFPA 1IL1A 5F70A 5AUMB 1C7TA 1DLFL 3P3YA 1O0VA 5KVMC 4K3DL 4MXWH 1CDCA 4GAJL 4LCWE 4KFZC 4S1DD 3TP4A 3MCKB 3MOBH 5JW3H 4G8GB 4NN5C 1DL7H 4JO3H 3EHBD 1TVDA 2WZPD 1JZ2A 4JPVH 1RJLA 2FX7H 1YQVH 2AJSL 4X8JB 2VXUL 5D2NE 2FO1A 4P2RD 4PJ8B 4XC3H 5JMRA 1QNZL 5J13B 1U3ZA 4PJEB 4OF0A 1MCJA 4IRSD 5GZNC 2E9IA 1UYWH 5KOVC 3NH7L 2ICWA 1BFOB 2DB8A 3QHFL 2V17L 3HPLB 3TWCL 1NFDB 1S7SB 4R8WL 1FL5A 4PJAE 1BWMA 3QIWA 3TJEL 3HMWH 3AS1A 2Y36L 2PUQT 1KG0A 3DSFH 5EPMB 3GI9H 5BVPH 2GHWB 3FFDA 1G7IA 2WWKT 4Z77A 1S9XB 5B8CC 5TF1H 3KYNB 2P7TA 2VL5A 5FYKL 4NQEB 1TCRA 1NBZB 1NCWH 2IH1A 1X5ZA 4WUUB 1TJHH 1U3YA 4XP5L 2I60H 4JKPL 3V6OE 2YC1B 3TYGL 2DM2A 5I76B 5GS0L 2J5LB 4AIZB 1UXSA 5IJVA 3VDAA 2A6DB 4S1SH 5LQBL 4A2LA 1FNSH 5F7LB 1EHXA 5E2VH 4P2OA 1FIGL 1F6AA 1LDPL 2H2SD 4ZYKB 3PWLA 4P23B 5IW1B 5C0EA 1XIWD 4LLQA 4CN6A 3S3SA 3P30L 4ZFFB 1JGLH 4O58H 5BOPA 1P7KA 3NIGE 1FHGA 2I07A 2QEJA 3TH4T 4JM2C 3CVIL 4Y5YB 3T0EC 1JP5A 1L7IL 1I3VA 3QAZC 4HUUA 3BZ4B 2BY2A 5SX4H 3H0TB 4NQCD 1HWHB 4O51A 1HQ4A 3VJ6B 3UTTB 5JIHA 2AJYL 4O2CA 3U4EB 3BOVA 3PABB 3CLEL 5JQ6H 1U58B 3FB5B 1MRDH 4XMKH 1EXUA 4JJHA 1H15B 5EG6C 2EIEA 2MCG1 4YHYC 1AGDB 2KL6A 4DFIA 5LBSL 3QEHA 4NQXA 5HI5D 4AM0B 1A6UH 4DKAA 3D6GA 3JWNC 5D72L 5EZLB 2NR6D 3G6AB 1ZV5A 2AEWA 4U1IA 4LP4A 3IVKA 2WP3O 1ZA6B 5FDWA 3ARFB 5DUPL 4OZIA 4RA3A 4P4KC 2Y4SA 4GSDH 2P5EB 4ODSH 1MCBA 4LPXA 1NDMB 5CAYB 1GGBL 1Z0NA 3V5KB 4XP4H 3OKDA 1NL0H 4P3DA 4JY6B 4GKSA 2FH8A 3ARSA 4XNZC 2HMIC 4E0RB 2ICWI 3DGGB 2C1PB 2PYFB 3B2UC 3BGFB 3CVHL 4ZAKD 3UTPE 1DBKH 3BN9C 1BP3B 3Q1SL 5D4QA 4D2NA 1AGBB 4QHUA 5J0BA 5D2LA 4U1GB 4Z0BH 1J0YA 3AY4C 3GHBH 1XMWA 5E5MB 4HX1B 3SDAC 2W91A 3EIFA 1R3JB 1QR1A 4MLIA 4W68A 1I9IL 1I9EA 5D1ZA 1CFNA 3GSOA 1C7SA 4Q6IB 3F6LA 1FQ9C 5IESH 1KCVL 2R9HD 2VZ3A 2ZNWA 3EFDL 4Y88A 3RUGF 1A4KA 3FN0L 1RUKH 2NY2B 3S96A 1T1XB 3D18A 2JIXD 2FHBA 4OSUL 1IQWH 2R0ZH 1G7PA 4A6YL 1CLZH 1RUPH 3FONA 2FD6L 2HRPL 4NNYA 3X12B 4O4YH 2MQ3A 4WHYG 3RWHA 1CD0A 1NLDL 1RZKH 4ELMA 1RZGA 4AJ0A 3SDDB 5MENE 3MNZB 5CEZH 4FQ1L 1VFAA 1TQBC 3WJLC 1AC6A 1YEHL 5I1DA 3VWJD 5DK0B 1BOGB 1FL6A 1AXSA 3VRLE 1PW3A 2NY0D 4F3FA 5HGGS 2NY1B 4FG6D 4Z95L 1DQQB 3L3OB 3BISA 2F19L 1ZHBB 5I18L 2HVJB 3BEWA 4KTDH 3KPOA 5ISZB 4K2UH 2EXYD 1OHQA 3V6ZB 1QRND 1OAQL 4HIEA 2F54B 5I16A 5IOPA 4WI6A 2RJMA 1RZ8B 4FFYH 5F88A 3FKUS 3RGVB 4AG4L 1TJGL 4HKXA 4NQDE 1RHHB 2MHAB 3FO2B 1W72B 3BAEH 2XKNA 2E27H 3TO2A 4DQOH 2QV2A 1RZFL 3MV8A 4M5YH 1FVEA 4L8SA 4NO3A 4PRHD 4F2MA 1KTRL 2QQNL 2APTA 1D5MB 3HFMH 3BXNB 4YXLL 1CDUA 3SY0B 1CE1L 1KFAH 3ZKXC 4OT1L 1X9QA 3CCHB 3NCMA 2X7LA 1EEYB 2YOCA 1DBBH 4YHKL 4HW6A 4P57A 2OSLA 4R3SA 3JXAA 3ILPA 3RA7L 4QYOA 4R7NA 1U8HB 2BFVL 2MQCA 1OTSC 3C5SA 2AKRB 1CDIA 4OIIH 3R0MA 3UTOA 4KU1A 1DN2A 3WFBL 4P4RB 4HFWA 3LD8B 3CC5B 2Y5EA 4PG9A 3CDCA 3WKML 1T66D 1MFAH 1DJSA 5E08L 3UYOD 4OB5L 4QRSB 4RNRA 4HS8H 4OCRH 1N0LA 4WU7B 3KYKH 3ZSSA 4PTUA 5HHNA 2EH7L 3O4LD 3TBYB 1G7HA 3H7LA 3UC0L 4G8IA 4EOWL 2F53D 1KPUB 4XXDA 4N0CC 3MGOA 1UT9A 5GISH 4PJHF 5J6HB 1BLNB 3L3KA 1P53A 4PJ5E 2BCKB 4FNLH 3MXWL 4DCQA 5KSBB 5DC0A 2N7AA 4KAQL 5ITBL 3QQNA 1OD9A 3D39A 1UWXK 2ICES 2AK4E 5F7KC 1IGCH 4HIIB 2Z8VC 4QRTA 1OTTD 4CVXB 5J1TC 4H26A 4QOKD 1CLYH 2QLVB 3VXMB 2X1WL 4XHQA 3L3IA 1EEZA 3TH2T 1YMHB 1WBZB 4OM0L 5HBBA 1I1YB 3QI9A 3ECBB 3HZVB 1E4KC 1E27A 1MJ7L 4X9BA 2W0PA 4RGND 1KULA 5D1QC 1Z9SA 1JL8A 2VLKA 1YC7A 4X6BB 2VDOH 2WUBL 2Y6SC 4GBXB 3TIEA 3T1WA 4ZG1A 2IQ9H 1R0AH 4RISH 5IB5B 2XG4A 2NCMA 4NNPH 3T4YB 4CW1A 4GS7C 1MIEH 3MJ9A 3MUZ1 2VABB 3I6GA 4L4VE 4YGVA 2R39A 1N3NA 5HYSG 5J12B 2WBJC 4S0TD 4EN3D 4LKCB 4Q58C 3O3EA 3E1F1 4OCYH 3I02B 3MBXH 1EO8L 2B5IC 2E8YA 4KZEH 3NTCH 4LSVL 1CVRA 4PJDA 1V7ML 3X14B 3QNYA 3FCTA 4HGMA 4LARL 5EWIL 3V5DB 3QBTB 4CGTA 3T3MF 1TETH 3LS4H 5EUOF 1NC2B 3FAXA 4Y1AE 3V52H 3PHSA 4UINL 3S36L 5C07A 4NUJB 1U6AL 2ESVE 5FKAB 4TRPL 1J1OH 1MJJB 2MJWA 5FO8A 1C12B 3S35H 1HIMH 4HWZB 1UWEH 4RGOL 1FFNB 4Z7VF 1GHFL 3OBAA 3FO0L 4RAUB 1UXWA 5HD8C 3P0GB 2SEBB 1LK3H 1AHWA 4K94C 1J05B 5DEZA 3RWDA 3PDDA 1VCAA 3IDJA 1FCGA 1J0HA 3P0YL 3TC9A 1BBJA 1NQBA 3C5ZC 2DKUA 2GTWA 3ZE1E 4JN1H 4XMPL 1MCSA 4GKOA 3SQOH 1HHIB 1Z3GH 3GSRA 1T6WA 3DWTA 3LZFH 5D1XB 1ZLSH 3CUPA 2BSTB 2WQ8A 3DOSA 3GSQB 3PF2A 1LNUA 4L5FH 4PGCB 3T0EE 3U7AA 4AL8L 5C0AB 3CGTA 3OKNA 5C9KA 3DX6A 3GBLA 4J3VA 4OLZL 2EIDA 4NQDA 4PBWD 4P9HL 5GGQL 3I2CH 4LVNC 3SGJC 1CDHA 4MD5A 5I8CA 1ZT4B 4WFHE 5A2LH 4YNYA 3CU7A 4EI5A 4IOSD 4TULH 3JWOL 5E6IA 5FGBC 4JPIA 3V4UL 4FQCL 3MNWB 2GK0B 4OI9A 4NFBA 3VD9A 4Z7WB 2HFEA 3PP4L 1IBGH 2PW2B 3ZO0A 3IAGC 5BOZG 4JVUA 4IOIB 2VQ1B 3MRCA 1YJDL 2ZOLA 2EDLA 4MAYB 4PJXB 5E56A 3UJTL 1KCSH 4MA7L 5TE6H 1BQHG 3LY6A 2X4PB 1Z6JT 4Y5VC 3BDBA 3VD3A 2BVPB 1U8OB 4RMWA 4EBQH 3CVHB 4JDVB 5F9JA 3B3IB 4ZFZA 4JN2B 4WHDA 4Z18A 4YFEA 4OQTL 2V6HA 2DM3A 4NQCA 3GJEA 1AH1A 3I9GH 4RDQF 2O5YL 1JVKA 1VADB 4OFPA 3U7WL 3OZ9L 4E41B 1CDJA 4JO4H 2A6JB 4LSQL 2OL3L 1M6OA 3T0WA 1MHCB 2XZQH 3BKMH 2G9HA 2P1YA 2UYLA 5IVZA 4I5BA 1L4IA 2NY6C 3FOMB 3HC0B 4F7CB 4HWBL 1KEMH 1QOKA 3K2UH 1U8IB 3BIBX 5IMKA 1LP9B 3E8UL 5D7LB 3V8CA 2G5BA 2I24N 2GW5A 5F96L 1BQHA 3ARGD 4OLEA 2FB4H 2BY1A 2PO6C 5DQJA 3L3GB 5I8OL 1S3KL 2FH6A 2OTUA 4ETQB 5L7XH 2A77L 2Z35B 5C0JB 3PIQB 5A2JH 5JORA 4TOYL 2Z31C 2XNAB 3P9WB 5DLMH 1CDGA 1QFHA 2EXWD 5E2WL 1MRCL 3IAPA 4L4VA 4TUJB 3VW3L 1KLUA 4WO4B 1ZS8A 2DQEH 3DXAD 1NCUA 3HAEA 3IS0X 2ERJC 5IMMA 1ADQA 1MF2H 1A1OA 4NZUH 1QSEE 3CSYA 3C60D 1IT9H 1P4LA 3PDGA 4Y19D 5EU6D 3MRBB 4LLMB 4NZTL 3N1QC 4J12A 5CEYA 2ZSVA 4I13B 4R8WH 1D9KD 5IT2H 1DN0A 3H3BC 2YKLL 2HFFB 1BGXL 1H3PL 3NFSL 1OP9A 1RPQA 3QPQC 5TE4L 4KJPD 4XAKE 4NZDA 2HKHL 1Q9KA 3QULB 3VFMA 2JIXA 5DJZA 4JANA 3G5ZA 2I5YH 1IC7H 3QDJE 4WJ5A 5GS0H 4DN4L 1Q72L 3CLFL 2QSQA 1CR9H 4TSBL 5I17B 1DQJA 5LQBH 4RX4D 4HJJL 3VI3F 2V5YA 4HFUL 5C0BD 5IBTL 1KSRA 1UZ8B 4CL7A 1WFTA 1OP5K 1A22B 3I6LE 2H8PA 4QHNB 2VWEC 3P30H 5DEGB 3P73A 3VWJA 2A6KB 4L8DA 2ATKA 2HG5A 1VENA 1JGDB 5T5NG 4KHTH 3MLZH 1CXHA 4P2QB 5DJYB 4YX2L 5JIKA 2D9CA 1L7IH 1QZ1A 4UMGA 2HH0L 3QIUB 2R0WH 2V5MA 4CMHC 3QPXH 4ZUTA 3C5JA 4WIQA 5MEOB 1G6RL 1Q0YL 1KCRH 4TTDD 1Q38A 7FABH 2ZUSA 2AJYH 4WFGD 2XTJC 5HGAA 3QDGE 2AW2A 3F7YA 1NGQH 4Y4KD 3VRJA 5MERA 4DKEH 5DJ6A 4F8QA 3X11B 3HE6C 5IB3A 1QR4A 3IRZA 1RY7B 4PRHA 3T09A 5A16A 1D5XA 3GMOB 3VRIA 1X3DA 3LEXA 1T4KA 4JFHD 2VB5A 1WZLA 1BIHA 1QD0A 1HHJB 2EDHA 4RRPG 1OARL 3P0VL 5BZDA 3TYFA 5EOTA 3QNXA 5E9DB 1FJ1B 4F80A 3MRHB 2YN5A 4U6XA 1IC4L 2OYPA 3H7BB 1NJ9B 4JFQB 3PGCA 1ONQA 5GS1A 3R0NA 3VDBA 2HFGL 4GAFB 4IMLB 1VGKA 3DGCR 5KVFH 3CVHH 1BJ8A 4K8RC 3MRRB 2Y5TB 1NGYB 1T1WA 2J3SA 3PGFH 3SCMA 2YWYA 5E8EA 3CZJA 2R8SH 3WIHL 1H3XA 3AB0C 1DANT 2EYRB 4U6YB 4AH2A 4OJFL 1TITA 2DLFH 4ERSH 4AEHL 3LKSB 4F58H 5JXEC 4F7PB 2F53A 4WNQB 4X83A 3QXAB 4LHUB 3MJGX 4JG1H 4BZ1L 4ZUWB 3L5WB 3UPRA 4Y2DC 4OAWB 1TVHB 1KCVH 3ARXA 4Y5XB 5B21A 3BP7B 4Q2ZB 2XFXA 3P11L 1LE5A 3QRGH 5E94A 4PJHE 1F8TH 4RRPA 3PJSB 1KTDA 3EO9L 1I7UB 3DVIA 4QOKA 5JDJA 3FQUB 5JOEA 4YHMH 2BVOB 3IFPA 1KJVB 2EYSB 2OTWB 4HGWA 1FFPB 4FQ1H 3QUXB 3KPNA 1HDMB 4JFED 1S7VA 4QKXB 5DJDB 2IJ0C 4XXCA 4XVUD 1NSNL 4KMTL 5TDNA 2V7HA 2QTEA 3WUWB 4JG0L 5HI3C 3FT4A 2Q1EA 2VRAA 2AJ3B 4JREC 1RUAL 2CDEA 2W38A 4J8RA 3VH8A 4G8EA 3SJVD 1MAML 3KXFD 3EJZC 1MAKA 4I3SL 4LF3A 4G6AD 5D6DA 4JM4H 4TSAL 4X4XA 4FQPA 4JFFB 4M8QB 1OAQH 1AGEA 4ONGH 3N85L 3IKCA 3BGMB 5ETUA 5HJ3A 5I71C 1JGUH 4XVSH 1N5AA 4GRLB 4Z78A 5I2IA 3W39A 3BRGC 1W0WB 1CGVA 2VISB 1F13A 3RUGA 4ZDHA 2LVCA 3RQ3A 4AEIH 4LCCA 5EUOE 1FYHB 1CGXA 5DWUL 1MCQA 5EU4A 3S34L 4PP1C 4YXLH 1TQCB 1R3IL 4FS0A 1N7ML 2CK0L 1CFQB 3PNWA 4PJBF 4D0CA 5CFHA 3STZA 5I1KH 2Z4QA 3UPCA 2VLJD 2AXJA 4K3GA 3RWFB 4X6DA 3GIVA 4RFNB 3PWVA 5C3LD 4QRRD 32C2B 1QQDA 1RZJL 3L6FB 2NXZD 4WTZG 1KCKA 1FNLA 2YMXL 4PLJC 4RSVA 5KVGH 1DBML 2H6PA 4QLRA 1T7ZA 2NXYD 1W0YT 2UV3A 2J1KA 3A6BL 4HZLA 5C0CB 5INDA 2X42A 5CBEA 2NMSA 4XP9L 4NHCH 3NZ8B 1OLLA 2CIKB 3VXSE 1FSKC 3N1GC 3UC0H 1A21A 4RAVB 4XCFL 4PJ9D 4ONOA 4I4WB 3QCUL 2DTMH 3F7VA 2OL3B 1MHEA 3ZKMC 4Q9QL 4M93B 4FQIH 4WTXA 5I66A 2CKBL 4IIQB 4DEPC 4YK4C 2N1KA 3U1SH 1EDQA 1FNEB 4K71B 5DT1H 5DMGD 5EU3A 1H3WM 4ISVB 3QRFM 3ZTJG 3TZVD 3L95A 1NUNB 1JGEA 1KJ2H 2LU4A 3QDMA 5KVEH 4JAMA 1K2DA 3DTXA 4HIXH 1FO0L 4OM0H 5I73B 1HSAB 1WIUA 4XGZB 2XN9A 4B53A 4ZNEA 5BS0D 4OFYD 3HS0A 5D1QA 3IYLW 5HVHC 2V2XB 2CLZA 4OFIA 1Q9LB 3OAUH 5K9JH 2ADGA 4JJ5B 1I8KB 2ZKHL 4OLWH 2X1OA 1ZLUK 4I48B 4N8CL 1AXTH 2BJMH 5D7JB 3ARTA 1EFXD 5C08D 1DTUA 2NNAB 1YPZE 2CLVA 1HHKB 5CINL 5KN5A 1FN4B 4OCXL 1BEYH 3U0TB 3HPJB 5KANI 3W9EB 3ZDYF 3ZDZF 1MCDA 4APQB 2WBJA 4N0UE 3CDGB 1K8DB 4AT6A 4WCYH 4LEXH 1OAXH 4Z7UF 4LSVH 4UDUB 1JF6A 1RAMA 4LKXB 2D4FA 3MV9E 4AZ8A 2FJHA 3OKOB 4XVJL 3SKNB 4XPAH 5HSFA 5BMFH 2HJKB 4MA3B 3EZ8A 4X4YB 3GSNL 5IFAH 3S36H 3FQTB 4MLSA 3MUGB 5JDSB 4UDTB 2YD7A 4PY8J 4KXZI 5CLTA 1QSFD 2VZTA 5DI8A 2P46B 2GSIA 3PQYE 4MX7B 1A7PL 4L8CB 2BXYA 2H2PC 2Q8BL 1ZT1B 3ARGA 3CMOH 3QFJB 25C8H 1NDGA 3G6DL 3LHPL 3VFWB 4M6ML 4OV6F 4PJGB 4WUKL 1L7TH 3MRNA 4ODUA 1YEKH 1CL7H 5C8JA 5IP4A 5DJ0B 1AI1L 3AU1B 3ZT7A 4XMPH 1Q94B 1QUNA 5C0FA 1NUDA 1WV7T 2VWEE 1ZLWK 4BFEA 2OZ4H 3PWPE 2ATPA 1JHTA 3DJ9A 1JZ8A 4CU8A 4DZ8A 3DXAA 5FF6B 2D31B 4M9OA 3B9VA 3OJDB 1G6RB 5DUBA 5AZ2L 3ZE0E 5TGBA 1U8JB 3F8UB 3GRWA 4OUUA 4UOJA 2J88L 4N0YL 3EO0B 4XRCA 3X3FL 2XTJE 2FJGB 4AENB 1J1XH 1D9KA 4U1NB 3FN3A 4OV5B 4P46D 5TDPA 2X9YA 4MAUL 1QHOA 1NBVH 4LU5L 3DVFA 4LPCA 3FQNA 2NYYC 5EUOA 4K7FA 2W0FB 2Q7NA 4NM8L 3SKMB 3T77B 1Q0XL 3VFNB 3I3BA 3QG6B 1ZHNB 2V9RA 3CFIC 4HSQA 2BHYA 2PXYD 1JFQH 3HNVL 4LOUC 3ZKQD 4CVZB 4Z7VA 4H88L 4MXVF 1KEGL 4J23A 1ZHLA 5EU5A 2R2BA 4PJ7F 4RAHA 5ERWB 5HI4C 3NN8B 3K0WA 5C0BA 4NO0B 1RZKC 5FIEA 4CDGC 1FP5A 1FVDA 5I1LB 4IM8A 2F8XC 2V5SA 1QA9A 5D8JH 3G04B 2B4CH 4L9LB 2YXFA 1VA9A 2G60L 3OKKA 3PL6D 5JHDE 1GPOL 5IHZA 1BZQK 4XWOD 3W5NA 4HT1H 1T5XA 1NCAH 4ODBD 3DV6A 3ROOA 3FO1A 5GPRA 3VXSA 2A73B 4G7VH 5JZ7D 4IRJC 3MBEA 5ICYB 3O2WH 2H32A 5BRZE 3I75A 2IGFL 3V9FA 3TA3C 4NSKA 2OL3H 1U92B 5FUCC 1GZQB 1NAMA 4ZFGL 4RDQG 1XF3B 4M48H 1KLGB 1SBSH 1HXMA 2BVEA 4BK4A 1FYTE 1I3GH 1BVKB 2OMNA 4PRIB 3G6JF 1J8HD 3OKLA 3SDCB 3TO4B 1AIFA 1KB5L 1FC1A 1X5FA 1KTLA 1FG2A 1RJYB 5IMOB 4LSUL 3D69B 2PO6A 3VXUD 3BD4A 4BFIA 1S3KH 3LB6D 3RVWC 5GSRB 1LO3H 2V2TB 5JR1H 3RTQC 5HPMA 2J5LC 1S7UA 2EDRA 5D7IE 5JW4M 1A6AA 3NIFE 2VXSH 4JO2L 3H9HA 4EDWH 1DZBA 4KKAD 4JO1L 4KQ4L 5E00A 4ZTPH 4UUJB 4CADA 1P5UA 2DTSA 2BY0A 3F12B 1AD0B 2R0LH 5GZOC 4LAQH 4XCEB 4PIRF 5FV2A 5IW6B 1HSBA 1L0QA 3K8KA 5F1IA 1I9JH 1S9YA 3FQRB 1KIPB 4OFDA 3WE6A 2WUCL 1MFCL 4J3WA 5GRYA 3OPZH 2YKLH 1BGXH 1H3PH 2DWDB 5DTFA 4MJIB 4C56B 1PJ9A 1M05B 1FLRL 3L5XL 3GFUA 4OF3A 3UBXA 1TZGL 5GSVA 4U1MB 2IQAA 1JK8B 3BH8A 4ZSOB 4NQTA 1EGJA 1PG7X 4HDIA 1QFUL 2GFBB 5CSZB 3U6RA 1L6XA 1T83C 4HFUH 1KBGL 1S7WB 2W65A 3BHBB 2AXFB 2YPKB 4NQSB 5I8EB 4JFEA 5CMAB 2ARWA 1TVBA 2DLHA 3KYOA 4NO5B 4G9FB 3HMXA 1WIOA 3MLSL 3EDKA 5E1AA 4QWWD 2YPLE 5KJRH 4L4TD 3NFNA 3M1BB 5LAXA 3KXFA 1TMCB 3RZCD 1Q0YH 3BGFC 1INDH 5B22A 1S9VB 1JRHH 1WUNT 4U1HA 2IPTH 3K74B 4W6WB 4ONHB 2CDFA 4RFOH 1R5VB 1JNLH 1F4YL 2H1PH 2VLLB 2D3VA 2VLME 1NFKA 3SDXE 3IDGB 5CJBA 1S5HA 2MSPA 1ZANL 1DUZA 3O6FD 1T5WB 2GJZB 2VAAA 2QADD 1U8QB 1A3LH 3ULSA 2BOBA 4CRPA 3TBWB 4MS8C 3TVMC 2WIIA 1FNHA 4PJ5D 2VDRL 4W6YB 3BE1H 3WFZA 1U95A 4QEGA 1N8ZA 1XF4A 4FN0A 3KPRB 5EBMA 1ACZA 4PJBE 1KIRA 3AREB 1DFBL 4M1DL 2E6JA 1IC4H 2YWZA 3D3VB 3EAKA 5TH2B 5BV7H 4P2YA 3OXSB 2X09A 3B9KD 5HDOA 2HFGH 1TPXC 2RCSL 3U4AA 5I75B 1F6FB 1MVFA 4GRWB 2X4TB 3STLA 3BW9A 5ESVA 3O4OC 3HR5A 2R1XA 1YYLL 3D0LA 5CGYC 2PYEB 4QXGH 4JY4A 4Q0XL 1JHKL 3GBNL 4F7TB 1UM6L 3ZYJA 3TFKD 2IAMC 3UBXI 5CUSL 4YUEL 1K3IA 4EIZC 1T1ZA 3O6LH 3ULVH 4Y2DA 4E42A 3MV7E 1S7XB 3K4ZA 2XZAL 1NAKH 3JV4A 3RI5K 1G9MH 3VFTA 1WCBA 4KY1L 4PRDA 3QJHA 4XCCH 2LU3A 3RHWK 4YLQT 2X4UB 4UQ3B 3RGVC 2O61B 1RJLB 2QQKL 2WIMA 1WBXA 5GGVL 4GXVL 3TZVA 1DE4A 2Q6WA 1G6VK 3REVA 3B6SA 2KDGA 1KGCE 2IANE 1IGTA 3B2VH 3LMJL 4F8TA 2HKFH 3GJFB 3LH2H 4TUOB 2ICWB 4Y1AD 4JDTL 5FCUH 1QYGL 1FL5B 3QIWB 1Q1JL 1R3HA 3O2VL 4MJ5B 5I1JL 2UWEE 1CIUA 3GMMA 1BD2E 4JG0H 1JWMA 1JN6A 1RSFA 5C08A 2VL5B 4K3EH 1RUAH 2QL1A 4XPTH 1TCRB 1FLTX 1EVUA 2VDKL 4L3EE 5CZVH 5IW3A 2IH1B 2YK1H 3D25A 2APWA 1FIEA 3QO0B 4I3SH 4FXLA 1CZ8L 1JMZA 1IAKB 4PLKD 3CPLA 3JV6B 5IB4B 5DD0H 3QHZH 4JVWA 3LKPB 3MRGA 4KJQC 4P2OB 3ROLA 4Z7UE 3SE8L 1F6AB 3PWUA 4XBPA 5C0EB 5L8LB 1G7QB 5TF0A 4FQXD 5C0GB 2I9TA 2I07B 5ANMA 3KLHD 1H3GA 4M6NL 2Z8WC 3L9RA 4X7EC 1QSFA 4OD2B 1ZMYA 3TV3H 2VAJA 2Z93A 1VERA 2A1WL 3MLWL 4HQQH 5SWSD 2ORBH 5E8OB 4OGAC 4J2XA 2PR4H 2H9GB 2P24A 3WO4B 1T0NA 3W0WE 3LKNA 1IARB 3VG9C 3QH3A 2FDBP 1U41A 4ENED 3EOTH 4R9HA 3SQBA 3L1OL 5CEZE 2NTFB 4GBXC 3L5HA 3L7EA 1T1YA 2GJ6B 4PS4H 4KTYA 4U1KB 1RMFL 4TUKL 5DRNB 1U3HA 4G8GE 3EO1A 3QCTH 3VFPA 4LCYA 4U1IB 3CSPA 3GM0A 1ZGLP 4OZIB 1X5KA 3QNZA 1DP0A 1G7LB 5ESAA 3MC0A 5HYJD 3MCLL 4MQ7A 1BZ7B 1VPOH 2ZCLL 4M5ZL 4C54A 1CLOH 4Y4FD 1AR1D 4F7MB 4J3UA 3UYPA 1PYWA 4KKBD 5FOBB 3OKDB 4M1CD 2GCYA 4P46A 3RVUC 3CD4A 3BN9D 4GKSB 5FUCE 1IKNA 1NBYA 2M8XA 5DZOA 1Z5LB 2XYCA 2LABA 1A0QL 2OR7A 3LV3A 4FFWD 4JFYA 4WHTA 1RUQL 3W9DA 2FX8L 1EBAA 1IM9D 3O6ML 1KB5B 3DI3B 3WL9A 4Q74A 5DURB 4HC1A 4QHUB 3QCVL 4MD4B 1B0WA 2PXYA 3Q6GL 2FL5B 3ZDXF 4P5MA 4K9EH 4PJBA 5B39G 4WUUE 2BRRH 2ZJSL 3TCXA 3GSWA 1FCCA 1OWWA 4N8CH 4JHBA 3NAAL 3WDJA 1ZWIA 2OTPA 2VDQH 5FKPA 1A4KB 3S96B 4MJ6B 3D18B 4GRWH 4NOBA 4EVNA 5GRUH 1ES0A 1T20A 2Z0BA 3SPVA 3H9SB 4OLXL 3FONB 3MRPB 5JLZB 5H2BA 4NNYB 1SMOA 4KQ3H 4O00A 4WI8A 4UILH 3TN0B 4D9QD 1RZGB 1UCBH 4LCWB 3MREA 4I1NB 4TNWK 3ISWA 1VFAB 1J11A 5HHPB 5CEXA 5F97E 4ZD3H 4Y4HD 1EHLH 1QSED 2X4SA 5D2NB 4X5XB 5JNYB 1L0XA 3DRTB 1IAIL 2VXVL 4L3CA 4Z76A 4OZFG 2PCPA 4KROB 2DDQL 5CHNB 3FB6A 5K93A 2XKUA 1J8HA 1MY5A 5J6GA 1P2CB 2BERA 3IXAB 3VCLA 3KPOB 5CD3A 3BVNB 4PYGA 4NBYB 2B7DT 3LHPH 4RWYH 4PJAB 2IALA 3GZKA 3TEUA 4V2CB 4ZO6A 5F88B 2QQLH 1NCCL 3RAJL 2YRLA 4HKXB 3ILQC 4C83B 1MPAH 1ORSA 2HLFC 1O7SA 1L9MA 2CR6A 4FABL 4FXGA 3TIDA 2XKNB 5DC4B 4I3RL 4JFXB 3MV8B 4JKMA 1FVEB 4KI1A 1MQKH 1ZSDB 4NO3B 2D03H 4F2MB 1RIUH 2IPKA 2FIKA 4I8DA 3KJ6H 1CCZA 5AZ2H 5IVNA 5ALBL 3WYRA 1BBDH 5T3ZE 4WFED 2MCPH 4Z7UA 3X3FH 5L0QB 4GKZB 5MP6L 2X7LB 2OSLB 1WT5A 4JZJB 4FQHB 4OZFA 5JMOC 5D9SB 2AV1A 5CJOL 1LVEA 4WW1A 3KLAB 3C5SB 3MX0A 1HNGA 3RWJA 3PWNB 4YGAB 5EIQA 3BMVA 5C6TL 8FABA 3DV4A 3UTSE 4OF5A 2XZCH 4JHWL 5LCVH 4PRBB 1KB9K 1R5WA 3S37X 5CIPB 2JELH 4RNRB 5T3XD 3HNVH 3QEUA 4UU9A 2VZOA 5M95B 3C9NB 2ICEA 1G7HB 3BGAA 3OKYA 4XCYA 1DDHB 3VMNA 4NGHL 5KVDH 3BO8B 3MGOB 5C7XH 4G6MH 1FRGH 2VZUA 4EXKA 4JHZA 3GO1L 4FQLL 3D39B 2G60H 1HINH 1IC1A 1D7FA 2BMKB 4OGXH 1JWSB 3OHXB 1AXIB 4HKZA 4L4TA 3O0RH 3T4AB 1HYSD 4KTEL 3GMNA 3HNSH 3VFOA 1XGTA 5ESQA 5KTEH 5B3JE 5HHMD 1UB5A 1A2YB 2O5ZH 4ZS7H 4NNXA 1E27B 1VFOA 4ZQKA 2R4RL 3TA3A 1OAYL 1RU9L 4GUPA 5FA3A 1A47A 5GS2H 5DJ8A 1MCFA 4ODHH 2YPVH 4ZFGH 2YUWA 1QRKA 4AIOA 1C1EH 5ISZE 1WBYB 1INEH 1HKLL 1K4DA 1LO5A 3VGGA 3WDHA 3O6FA 4XNXH 5LGHH 4CW1B 5F9WB 5IM7A 4GW5A 4NN6B 2XWJB 1CT8A 4LQFH 5L2KD 2OM5A 1RI8A 1AGCB 5IJKA 1MI5E 4RMVA 1MUJB 4V1DE 5J3HC 3TT1H 4JFOA 4PJ7A 1NLBL 3WFCL 5CJXC 2HLAB 2ZG2A 4RIRA 1UENA 3LRSB 2BNUA 5GGTL 3DVNB 4HJ0C 1WAAF 4QY8B 3LRHA 1Y6KR 2IH3B 1HH9B 5FO8B 2YHGA 4PGZA 5F9OH 2ZUUA 2DQIH 2J6EA 3IJYA 3T0AA 5MENB 1UXWB 5J7CC 1AHWB 3CK0L 1DANU 3RWDB 1PZ5A 4M7KH 4YHIB 4GXUM 2A74A 1UKQA 3NGBC 4TQEH 1P7HL 4GMSL 3ZT6A 1BBJB 2DD8H 4NWTL 5E70A 1V7NH 5HYSB 4JLRB 4RZCA 5FA4A 5GGSA 4R0LB 2XQBH 1IAIM 4MDJA 3Q6FA 2YUVA 3LKOA 4R97B 1DVFB 3CUPB 2J4WL 3REWB 5TDOA 4PTTA 2AERT 1J1PH 2MOVA 3G6JA 1LNUB 4UTAH 3LN9A 5EFIA 4NC2B 4WHCA 3GMPB 5E8NA 3OKNB 5F1SA 1CU4L 4WW2F 2P5WD 1X44A 3QUZC 3IDIB 5LWYL 1Z0MA 2VH5L 3QXDB 4KHXL 4NQDB 3VXME 1JJUA 2HT2C 2GITA 1AQDB 1T2XA 3U0WH 2YD5A 3VXPA 2AJXL 3L3JA 1BX2A 4YNYB 4EI5B 2ADIB 1UEMA 1VB9A 1ZOXA 4KUCF 2CPCA 5E6IB 2EH8L 4OZGF 1EEUA 3TCLB 1MCHA 3RY5A 4ZUSB 1CN4A 5SWQA 3UZQA 2R2EA 1YEFL 1V3LA 3F65A 2HJLB 5K9OB 5HPOA 2Z8RA 4NO2A 3MRCB 3HI6L 3RJQB 3AXLB 5CCKH 4KPHL 3U7YH 1UEYA 3SKJH 5J1AB 4XPBH 2CK2A 5F7YC 3VXRA 2J7LA 1GC1H 5FUZL 5EUKB 3BWUC 4FQXA 2ZNXA 2YRPA 3GBMH 4UI2A 1J0IA 3UO1H 1KN2H 3RWEB 5F9JB 4JPKH 4ZFZB 1J5OH 4BH7B 4JHAL 4PG2A 5KZCD 3CH1B 2NY3C 5DJ2A 3X17A 2BOCA 3GJEB 5SWSA 1CGTA 3BPCA 3CX5K 4LRIC 3QJFA 1I1FB 2FX9H 5KSAD 2KZ1B 4LSTL 3V0WH 4HUVA 2MMXA 3UAJD 1SJEB 2EYTA 2AK4B 3EDDA 4UIMB 2RCSH 4R96A 2E9JA 2GAZA 1MJUL 4P5TD 3GSUA 3ZTNL 1CTNA 1NC4D 4LLWA 1RK0A 5GRJL 4G5ZH 1RHFA 2X4RA 4K7PH 5AG9A 1BQHB 2Z31D 5DQJB 1MEXH 1I4FB 5DRZB 5HYJA 1VDGA 2F74B 1AO7D 4N8VG 2UZIL 5ICZB 1BQSA 4Y4FA 1J0KA 5FYJU 4NN5B 4LLUB 3V95A 3WXWH 5F89A 3PP3K 2R56L 4L4VB 2QQKH 4KVNH 3GKWH 3ARBC 1EAPB 3QIBD 3MJ9H 3NIDF 4Y8DC 1VEMA 3MV9D 1IM9A 2BNQD 2NLJB 1KACB 4XNUH 5IEKB 1MIMH 3ORJA 4QXUL 5IQ7L 1CF8H 5DVMA 2EECA 4I0CC 3O8XD 5CEYB 2VDLL 2ZSVB 1QYGH 4YJZL 1T21B 2HT4C 1TQCC 1JHLL 1H8NA 1DN0B 4HJGA 1T04B 1TTUA 3CZFA 1SY6A 4TSCH 1AGFB 2AI0H 3PQYD 2W9LA 2BSRA 3BKJH 5EZIH 5K9QG 2ESVB 5D71H 2J2ZA 5B8CB 4P2CG 3CFKB 4JKWA 4OCSL 5EC2A 1V3MA 4WWKC 4XPFL 1QO3B 3WHXA 3CSBA 4RFNC 2OJEA 3MUHL 5IHLB 1S7QB 2VZ1A 3G5ZB 4I77L 4KVCH 1FE8L 4KK5C 2B4CC 2AQ1A 4HCRL 2BP3A 5CGMA 2V7NA 2XXCB 3O9WC 1FAIL 4K94L 4PJFF 3RL1A 2B0SL 1YN6B 4U1JA 1JGVH 3PWPD 1NH6A 3LEYL 3FJTA 3SE8H 4TNVF 43CAA 4DFHA 5FFLA 3O45B 4Y4HA 4L8DB 5C92A 4OKVA 3ULUF 4BM7A 3OKMA 5CD5D 4WFFD 3C2AH 4E41E 4HG4J 1KPVA 2R29H 3QAZB 5DQ9B 4M93C 3EYOA 4UB0H 2VIRA 5E4EC 3C5JB 2WBKA 5AYQA 4K71C 2VMFA 1I75A 1XEDA 3MLWH 5D6CA 1YEEL 1XCQB 5CP3A 1FG9C 5HGAB 5F6HJ 2ADJA 6FABL 3INUH 3HE6D 1I8LC 2V5RA 2FIRT 1P1ZA 2OR8A 2YN3A 1A6WL 5F1OB 5TJWK 3VRJB 3N1FC 2CXKA 4U33A 5C2BL 5J11C 3L1OH 1MWAL 5MEPB 5FK9A 5TE7L 4LVEA 5CZXC 12E8L 3OAZH 4TUKH 1JIBA 2DQUL 4YDLB 1LMKA 5E8DL 5D5ME 1T4KB 3BZEA 3WJJA 3HI1A 4URTB 3JWDH 4P4KB 3MLPA 3NFPB 4APQC 5MEQB 3WHE0 1UWGH 5JA8B 5BVJA 5EOTB 1F11A 3IFOB 4ORGB 3QNXB 3N50A 4BSWA 4Q6YA 4O2FB 1Y18B 1ZVHA 3DX9A 5DA4A 1ONQB 3OR6B 4XNZB 3OAYK 3SGEI 1VGKB 3QEQD 2XIDA 4N5ED 3ULUC 3C08L 2DYPB 4OQ1A 5IR1A 3SE3A 3SCMB 5E8EB 3S36X 2O93L 1II4E 4HK3N 1MFNA 3GNML 1GGTA 43C9A 4EJ1C 3SDAB 1GGYA 4EIGB 4NKOA 4X6CE 1FYTD 3K81A 4BA8A 2NY7L 1CYGA 1T03L 5H94A 4EI6A 3UPRB 3HG1D 2B39A 4MCYA 5TPWL 5FV1L 1HI6A 4OCWH 1YMME 1HK6A 4WI3A 3BP4A 5GJSH 1UACL 1U42A 1MSPA 4BKLA 5C09E 3ZHDA 3FT3A 1TTGA 3NPSC 4HHAA 4P2QE 5I1AB 1IEBA 5KAQF 4LCIH 1QEWA 4GG8A 4K23L 4HGWB 1OGAA 1MFDL 1TQBB 2ZP0T 5JW4N 4CAGA 3MRLA 1ETZA 2W60A 2GSGB 2XA3A 2V7HB 3ZL4H 3FT4B 2GT9A 1CBVL 1UJ3C 1CS6A 2FR4B 1VFBB 1LDSA 5I30H 2CDEB 1DR9A 1MRFL 3SOBL 3TT3L 2GTZB 5F7UA 1N4XL 2ZUYA 3HAEH 4PBXA 3D9AL 4N9OB 1ADQH 1G7MA 5JOFA 5L2KA 4U7SA 4LF3B 4X80L 1YECH 1SJHB 4KZDL 3IKCB 1PSKH 5IEHA 4JE4B 3JUYA 4CVUA 5JW5A 2DQFB 5DD5H 3MROB 3T2QA 4MVBC 5I2IB 5T1KD 2WV3A 1SMAA 1QFWI 1I1AC 2APFA 5DR5L 5HVWA 5E9DE 2Q76B 5B3NA 3QDJB 3MRIB 4K3JL 3WSQH 5ALCH 5BV7C 5JPMA 2UY7A 1Y6MR 1WAAE 4DZBB 1MVUB 3FO9A 5AG8A 1Z9MA 5BJTB 1CI5A 1JPFB 3PNWB 3P4OB 4D0CB 3STZB 1G9EA 1VKXB 2Z4QB 3ZE2F 5F7EL 4PLJD 1G1CA 4MDIA 2YPLD 4KRPC 5I0ZA 3I3EA 3RDTC 1QQDB 4MNGA 3WIIL 3K80A 1B90A 2CUHA 1OB1A 5HHOD 2H6PB 3ULVC 3D48R 4I0PD 4XP1H 1G9MC 2XXMB 1EJ6A 4X6EA 4GW1B 2VSCA 4HZLB 4PRPE 5I9QB 4XNYL 5DF0A 3U79A 5E2UH 1IILE 3DETC 3BI9X 1N2RB 2P5WA 3QDGB 4HS6A 4QTIL 1EZVY 3MA9L 2EDKA 4QXTA 1NFDF 2OR9L 1U36A 3PHOB 3KPQB 2OQJA 4DGVL 5KS9A 1C8PA 2FGWL 1ORQA 5H35A 2FHFA 1A7QL 2X05A 4AEFA 3TJHC 5A3ID 2VITA 4P49A 4FQLH 4MNQE 4LVHC 4WI7A 2A6IA 1CXEA 3ZT5A 4POZC 1JGEB 1D6EA 4LBEA 2JJWA 3QDMB 5LGJA 5FYLD 2Y06L 2F5AH 2DQJL 3VWKD 4Y2OA 4OZGE 4HXAL 4HULB 2XN9B 3S5LG 3HS0B 3VD5A 5D1QB 2R4RH 4H25A 3MLXL 1OAYH 4L8BA 1JZ3A 1U0QA 2CQVA 1K6QH 5E8PA 4PGDA 1KXTB 1QLEL 1JYXA 3GK8L 3LN5A 3HR6A 1WFNA 3KDMB 2CLVB 5KN5B 4HWEL 4GS7B 4K8RL 3B5TA 3HNTL 3NZHH 2YD3A 4OCNC 1C5DA 2WBJB 3VXOA 2D7TL 1FZMB 2B5IB 4YHLH 4HPOH 3HC4H 1WIPA 4P3CL 4YAQA 5B4MD 3QZWG 1JV5A 2FJHB 4N1HB 4FQJL 3WIFB 4LLYA 5DQDL 4XPGL 2D4DA 1MLCA 3MLRL 4PJHB 3MRJA 4J3SA 4X7TB 3DSNA 3S5LA 4G42B 4O2EA 5DS8A 1F90L 3CXHK 5SWZE 4P5TA 2GSIB 4I9WD 3IJHA 5EOCL 3CFBA 1CGSL 2JB6A 3O3BA 4NM4H 1AJ7H 3AAZA 1TJIL 2EIZB 4D8PA 5JHLH 4ZTOH 1T89C 3C6LD 5C0CE 2LTQC 1AO7A 4GMSH 4ODUB 3C5ZB 4DOHB 3QUKA 1FORL 5C8JB 1A1MB 1P6AB 5J9PB 3V6FB 4HGKC 2AV7A 1X4ZA 1XZ0A 3OR7A 4HMCA 5IBLD 5C0FB 4LSDA 4MQXD 4D3CL 4RGMC 3A6CL 4FP8H 5JOPD 2R4SL 3QIBA 4DZ8B 2AGJL 4WY7L 5FM8A 3U2SB 4M7JL 2BNQA 1MY7A 4XWGH 3NIDE 2VUOA 5LWYH 5DMJB 4ODXB 4RBPH 2ITCA 3L3DB 4YDJA 2HT3C 4KHXH 2JB5L 3O8XA 2RFXB 1JPTH 1Q9WB 2AJXH 2OK0H 3W82A 4K9EC 4QRPD 5TDPB 1BJ1H 2QSCL 1HOCB 3OX8B 1MWAB 1TZHA 4HS3B 1BIIA 4ZXBD 5EUOB 4K7FB 4U6TA 4LOUD 4GW4A 1F3JA 4U1LA 1CICD 3IGAA 1KIQA 1WAAA 4F15C 4GT7A 2B2XH 1BAFH 5HI4D 4DW2H 1IGFL 4YDKL 5I75C 3T8XA 4BSVB 4P59H 3T3PF 1ZHLB 1T3FA 1NMAL 4KXZH 5CEZD 1YNTA 4QRQA 1D5IH 2YD1A 3RPKA 5JIIA 4PREB 4ZPVA 1A7RL 3FRUB 4HKJA 4NQUA 1IFHH 4YQXH 4G8GD 3N0PB 4Y5VB 5FUZH 1QA9B 1RK1A 4DUWA 4MXWL 2BSED 2AXGA 5GS3A 3MOBL 5JW3L 5DJCA 3OKKB 4PJ8D 3ULUE 1DL7L 4JO3L 2YEZA 2J8UA 3DV6B 3KYMB 3FO1B 3LKRB 1LK2A 4JPVL 3VXSB 2FX7L 1YQVL 3WLWC 2R69L 1JZ6A 4JGJA 4XC3L 3MBEB 3MODH 4WW2A 2H32B 2EDEA 3I75B 5J06A 1UYWL 3FZUD 4Y16A 2HN7A 4NSKB 3EW3B 1D3CA 4KKCC 4P9MH 1E4XI 3HMWL 3K8LA 3QIWC 4NQED 3VA2C 3DSFL 4WUUD 2BVQA 3GI9L 4OZGA 3B8YA 5BVPL 1AIFB 4JVPA 3BPOC 5AWNH 2V2WB 1A3QA 5EC1A 5GRJH 1SYVA 5TF1L 3NBNA 1FG2B 4KJYB 2PO6B 1YEJL 3OXRB 1NCWL 2DL9A 3VFSA 1TJHL 2R2HA 4ODTH 2ZSWB 1WISA 2I60L 3MGAA 5FHBH 1YYMH 3J8F7 5IV2B 1QKZL 1CD1B 1FV1B 5E1HB 4P23D 4WI9A 2VQTA 4JDZA 3MRKA 5A2FA 3KHOA 4M4PA 1FNSL 4R7DB 5E2VL 1RULH 4RCAA 4P2OC 2R56H 2F15A 5H37G 5GZOD 2ID5A 5C3TA 2O5XH 2DIJA 3QEQA 4N0UB 2Q20A 2ERJB 1UH4A 1JGLL 1JI1A 1CE6A 1S8DA 4QXUH 5K9KA 5LKNA 3UTTD 5L9DH 4YDVA 1HSBB 4LLDA 5DK2A 1JHLH 3WE6B 2EKJA 3ZTJH 1HXYB 4FFZL 2FGZA 4YHNA 4NPYB 4M4RA 5JQ6L 2JK5A 3QO1B 3HG1A 3WO4C 4OCSH 5KSBF 1I7ZA 4WWKA 1MRDL 4XMKL 4XPFH 2WWMC 3QG7H 5LVEA 1V3JA 1K85A 3Q5YA 5I1IH 4G80A 4I77H 1FE8H 2RB8A 3MA7B 3O9WA 1JMXA 3ARFD 3BH8B 4K94H 1A6UL 4MA1C 4O5LL 4Z7NE 4JPWH 2P5ED 2W0KA 2W65B 4ELMF 1OTUC 3LEYH 4KK9D 4M3JA 1EZVX 1E0OB 3SKOA 1WVZA 4KI5F 3KPPA 3P4MB 1GL4B 4GSDL 4ODSL 3HUJF 4ZS6D 3S7GA 4XP4L 5MHSE 5E1AB 3ULVE 5F3BA 3NFNB 3GI8H 3I85A 1UH2A 4CN1A 3KR3H 1TCMA 3GRWH 1YEEH 5C0NC 3N06B 4FHBD 2XTJB 4GAYB 1DBKL 1NCBH 3DO7A 2BVTA 4S0SD 4UT7H 1NKOA 5ADPH 4Z0BL 4M1GH 4Z0XA 2CO7B 1MFBL 3GHBL 1DLHA 5FYJE 2A9NH 5IUSA 4WWID 1U9KA 4N90D 5C2BH 3CFCL 4HIJA 5TFSH 2R23B 1K8IB 3AGVA 5TE7H 2NY2D 2PTTA 4P3WA 1FL3A 5D1ZC 3V5HA 2YA2A 5EORL 5IESL 5JXAL 4FFVD 4I2XA 4N0RA 4ZO9A 3ULSB 2AJVL 1BF2A 1CK0H 1RUKL 4NRZA 2Q7YA 2WIIB 3LPGA 2UVFA 4CU6A 3EOBB 3K46A 3SBWA 1DQTA 1IQWL 3SDDD 4X98B 3NCJH 4PJFA 1BM3H 1CLZL 1RUPL 5DMYA 1P7QA 3MYJB 3FFCD 5C0IA 4O4YL 1KIRB 4NKDA 1RZKL 1BQUA 4KC3B 5CEZL 5IG7A 2IFGA 5ENWB 2IPUK 5JHDB 3I6KA 4NBXB 2R1YA 2NY1D 2DJ4A 2WW8A 2FJFA 4JRXE 5HHOA 3X3GH 4WDIA 4H5SA 4I0PA 1ZTXH 3BW9B 3H3PH 5F7WC 1A1NA 3D0LB 5F6IC 5F8RC 4ZFOA 4M9PA 3ZKNC 2WAHA 5BRZB 4F9LA 1XGYL 3MV11 5ISZD 5BZWA 2H32H 2F54D 1PD6A 4YXHH 3RGVD 4Y2DB 4E42B 3KPLA 4ZO7A 4K2UL 3EGSA 4LFHD 4ZPTB 5DDHA 3VFTB 1UZ6E 4JKLA 1WCBB 4FFYL 2Z91A 5ABDE 4ESKA 3SN6N 3RWCA 1WBXB 2VUYA 1U91A 1F02I 1DE4B 3BAEL 4DKFH 3JBG7 5FM5M 2PTVA 3REVB 3WN5A 2E27L 5DK3A 5GGVY 4Z7WF 4R90H 1RZ7H 3P77B 4DQOL 3MRQB 4M5YL 3TESA 2CIIB 1W2KT 4L8SC 3GSXB 3LSOB 3N9GH 2C7UB 1UFUA 2C1OB 2NY4C 3VDCA 4D0BA 5D7IB 2DWEA 4OCLC 4PJXF 1I7RA 1AD9B 1IEAA 4DVBA 1KFAL 1R3HB 4NKMA 2BY3A 3VGEA 4OD1L 5L0QC 3O3AB 4JREB 5BQ7B 1JN6B 1DBBL 5KAQG 3MUY1 3UZEA 3RKDC 5C6WH 4YE4L 1MRFH 1J12A 2ITDB 4PFEA 3TH3T 3LKQB 3D25B 1GC1C 4OIIL 3SEPA 2C4FT 5EZOH 4WGWB 5FDYA 3DURA 4KJQD 1OM3H 4X9GA 5TQ0L 3BFOA 3SE9H 2Y7QA 1MFAL 4GXUN 4KZDH 4YHPA 3K1KC 4HS8L 4OCRL 5GHWH 5I71B 3KYKL 2Y1VA 4NCDA 4NC1C 1UADC 2GUOB 4NOFA 2CR3A 3C8KA 2P8LB 3EYFA 5DR5H 2I9TB 1F00I 3ARQA 3EBAA 5GISL 5FGRA 4IHOA 2V5TA 3L9RB 4FNLL 2CJUH 4O9HH 1LP9F 3D3VE 3VXMD 3LDBC 2KQNA 1VFUA 4LNRA 1D5ZA 1ZVSA 4KDVA 4LGPB 2HTKC 4KMLB 1MHHA 1QLFB 1IGCL 3H42H 5DVNA 1EGJH 4GRWE 1CLYL 5F72S 2P24B 4B7LA 5KSUA 1T0NB 4HH9B 1DBJL 2VXTH 4KK8C 3DUUA 4GBXD 3QH3B 3QI9C 3SE4A 1I8IA 1TXKA 5A2IH 4MA8L 3HMXH 1DBAL 2VDOL 2JKXA 1TZIB 1P4BH 5HY9A 4DUXA 3GMQA 3U0PA 1R0AL 1NEZG 5SX5H 4RISL 3LN4B 1U3HB 3EO1B 1UKSA 3VFPB 5T3ZL 3UTZB 4RMUA 2CDGB 4EQ3A 4NNPL 2BDNL 4HK3J 1MIEL 3TLRA 1FSKB 4Z7OE 3WEXA 3QNZB 5ESAB 1MH5A 5JPNB 2OR9H 1FZJB 3NCYP 2ZUTA 2B1AH 3K3QA 1CGYA 3MRMA 4OCYL 3TNNA 2FGWH 2E7MA 3SDXB 4KZEL 2PN5A 3DLQR 4QRPA 4DEPB 1NC2D 4YK4B 1NBYB 3IRPX 3S9DB 3IFNH 4BZYA 5IWLA 5FYKD 3LV3B 4ZXBA 4JFYB 3D2UB 2RAMA 5DD1H 4XNMB 1C08B 1CICA 5FB8A 1TETL 3LS4L 3WL9B 2WK2A 3RY6A 3IDMB 5GS0D 5DHYB 4OZHA 1J1OL 1F2XK 2FECI 4JQXC 4NP4L 1P84J 4J6RL 5HVHB 2CRYA 1HIML 4PJBB 3S35L 1UWEL 1LO0H 5AUMA 3GSWB 3T1FB 1LK3L 3LIZL 1AHWC 5FM4A 2RHEA 1OY3B 4JRXA 3ZSTA 2DQHH 2ZZUT 4X8XA 4S1DC 5D1XD 4PJ8A 5KBNC 1ES0B 3E3QC 1T20B 3K7UA 1A9BB 4PJEA 1Z3GL 3EHBC 1A6PA 5C0AD 3MR9B 3LZFL 3AFLA 1ZLSL 1Z2KA 3D85A 4L5FL 1BFOA 3RNQB 3MREB 2FSEB 4N68A 3MV7B 2A9MH 5LGKA 1NFDA 1S7SA 4PJIF 4IRSC 5DQDH 4KWUA 1ZLUH 5CEXB 1AFVH 5EPMA 2X4SB 2VKWA 3I2CL 1PFCA 1F90H 3KYNA 5FO7A 4AMKH 4NQEA 4PYHA 5B39B 1NBZA 2PCPB 3FB6B 4HG4K 2IANB 2D7NA 4G6FB 4M6OH 4EI5C 5GGSY 2Y23A 4I0KA 4TULL 3WNLA 3GIZH 2QHRH 5E6IC 2ICWJ 1JF1B 4AIZA 3NCCB 2IALB 4DAGL 1DQLH 5EBLB 1T89A 2UWEB 3ALXA 1URLA 5I8KH 1LEIB 4MAYD 1BD2B 1IBGL 1XF5A 4P23A 5IW1A 3ET9F 1XGQB 3JWDC 4ZFFA 4L3EB 3HLAA 2XWBB 2H2SC 2X4NA 4KJWC 4KRMB 3GHEL 5TE6L 1DUYB 1FH5H 3BQUD 4S2SA 3BJLA 2IPKB 1OD7A 4WY7H 2FIKB 1BOYA 3BZ4A 1QLRA 1SYSB 3H0TA 4EBQL 1H3UA 4GAGH 3VJ6A 3UTTA 3HE7A 2W9EL 4Z7UB 2JB5H 3F7QA 3U4EA 1U8MB 1JPST 4LPWA 3FB5A 2AEPH 2DI9A 3H3KA 2FZ3A 4OZFB 4XH2A 5D2LE 2QSCH 4L1HA 3VMPA 1PLGL 5HVFB 4BELD 3RWJB 4CJ1A 4JO4L 1IAMA 4BFGA 3E6HB 3DV4B 3MFFA 1O5DT 1MREL 4AM0A 2XZQL 3BKML 1R5WB 4R26H 5EZLA 3T04D 5D7LD 2DJUA 4U7MA 1ZA6A 1KEML 1OAUH 3A0OA 3ARFA 3W0WB 1NFIA 3K2UL 3QEUB 5HI5C 2ICEB 1PQZB 4XCYB 4F7EB 2NR6C 2P5EA 4JFDE 3MNVB 1T22B 2FB4L 4IRZH 2ZOKB 3RX7A 4BH8B 3MLTA 5A40E 3IDNA 4ELME 1H8OA 4JY6A 4EEEA 5L7XL 2ZCKH 1TENA 2JJTA 1G9NH 3DGGA 4Y89A 4E0RA 2C1PA 4WO4D 3RKPA 2Y07H 5DLML 1HEZB 1NGXA 1J18A 1M1SA 1AGBA 2R69H 1NANI 3AMKA 2NX5D 4IRJB 3VFOB 1XGTB 3QISA 1SM3H 5F21B 1UB5B 2DQEL 4NYLA 4ZAKC 5IMLB 1MF2L 3WHE1 4HX1A 1REIA 4NZUL 3TA3B 5ITFB 1IT9L 1R3JA 3E0GA 4GUPB 3UEZA 1X5GA 3HB3D 4Q6IA 1E6OL 5IT2L 5JUEH 2IEPA 1B9ZA 2DLIA 3KLDA 4LDOB 3M8OH 4QHLA 4PLNC 4GW5B 5IK3B 1IGMH 1CT8B 2R9HC 3SO3C 1YEGH 4KDTA 4HC1H 3WS3A 2DL2A 4J1UA 2R0KL 3HCVB 1YEJH 3X12A 2XI9A 1SVZA 1QSVA 4M7ZC 3MV8E 3KWWB 5C2UB 2I5YL 1IC7L 4OZ4A 3MNZA 3RTQB 3QT2A 1QKZH 2VZSA 3DMMD 1NPUA 2GY7B 3FFCA 1C16A 1CR9L 5ELIA 2YXMA 3JVGA 3WS6A 4YFDB 4P2QD 2X4OB 1M7DA 3R8QA 2BNRE 1DQQA 3Q5OA 3QIUD 5E99H 3L3OA 3UZVB 3VWJC 2VDNH 1SBBA 5CJQH 2LU7A 5I6XC 1ZHBA 5M94B 4KHTL 3BT2L 1CFTA 3MLZL 1MCOH 5ID0A 3IJYB 2NY0C 3O2DA 1X5HA 5L6YH 4FG6C 2R0WL 4WTWA 3QPXL 3V6ZA 2F54A 2XPGB 4EDXA 1S5IH 2A74B 1KCRL 1RZ8A 3MOAH 2JCCF 4FFZH 4M02A 7FABL 4MSWB 5C9JB 5FAAA 2P8MA 2W92A 4NC1E 2EXYC 3B83A 1XR8A 1W72A 2ZPKH 4MDJB 5CP7B 2AQ3A 2FEEL 2RBLA 3Q6FB 1NGQL 3LKOB 2YSSB 4PTTB 3G6JB 5JO5B 4DKEL 3IU4H 1D5MA 4NBZB 1OW0A 1EEQA 3BXNA 2UVEA 4O5LH 3D39E 4YDLC 4DK3A 2V9QA 3L3HA 1KUMA 3UJJH 1YEIH 1YJDC 3U9UB 4HIHB 1T0MA 3F5WA 1P6FA 1U8HA 4C58B 2AKRA 15C8L 4MCZA 4ACPA 5C0RH 2VLKE 1WITA 1N6QH 4GMTH 5HGDA 3B9AA 5GS1C 2GJJA 3X13A 3PWJB 4Z8FH 5KVFL 2R2EB 4YEEA 3PGFL 4A2MA 3EFFB 3SCMC 1T66C 2R8SL 1HHHB 3MQIA 4QXWA 3WFHB 1KPUA 1RVFH 4LHUD 1MFBH 4OZFH 5F3HB 4P99A 3S6CA 4XTRD 2DLFL 4ERSL 2MWCA 3CFCH 5J6HA 4F58L 2BCKA 3VXRB 3FB8B 4HXBH 2GY5A 3UTSB 5KSBA 4JG1L 5EIIB 3RVTD 4PJDE 1GSMA 4QRUB 1RUMH 4X6FA 5EORH 1PZUB 5E5RB 3V6BR 4HIIA 5JXAH 2AJVH 4CVXA 3TVMB 1NGZA 1PEWA 3QRGL 4MJ4A 1LD9B 1XCTB 1F8TL 3OJVC 1YMHA 1WBZA 5C07E 1I1YA 3EYVB 5SWSB 1E4WH 4JFDA 2QR0B 1OTTC 3QUXD 4Z7QE 3BPCB 1J0ZA 5DFWH 1CXIA 3QJFB 4YHML 3ZYIA 1MCIA 4X6BA 4HUVB 5E6YA 1Z9OA 1CWVA 3EDJA 3BP6B 2KKQA 2EYTB 4X6DF 1A5FH 4JCMA 4RGNC 1TPXB 4YO0B 1QSZA 3HZYB 4R96B 5IB5A 1QPPA 3HUJA 1GYAA 5EA0H 4OKDA 3VE0A 1W8NA 4XXCC 3O4OB 1PAMA 2ENYA 4UT9H 4ZOEA 3E3QE 4N1CA 1RK0B 5DC9B 4U6VH 2W59A 2IG2L 1G0XA 1QFWM 1XGYH 3I02A 3PUCA 4JFFD 3KPSD 2X4QB 2IAMB 4PGBA 4C57C 2X40A 1BMGA 4D9LH 4N0FB 5F7MC 4JM4L 5D6DC 3X14A 3LQAH 1XGPB 4HEPG 1J8KA 5T1DH 4ONGL 3V5DA 2X89D 4GRLD 4HUWB 4B41A 5EDXA 2IC2A 1JGUL 2VR9A 1W8OA 4XVSL 3QQ9D 4NUJA 4CVWA 1XT5A 4GQ9H 1VESA 4WI5A 1MI5B 2HT4D 3IETB 1FFNA 5DRXB 4V1DB 5T5FH 4AEIL 4RAUA 4Y0GA 4LCCC 1N59A 2SEBA 1X6NA 5GGRB 3PGDA 3KS0H 3HC3H 4HJGB 2BSRB 2X5PA 5I1KL 4OD1H 2ARJQ 4YBQD 2BNRA 5DSCB 1EHNA 2FEDD 4YE4H 4PD4J 5MI0C 5LG1A 4U0QB 3ARZA 5D1XA 5ACZB 4FTVD 2BSTA 5C0CD 4N8VB 1KT2B 5KVGL 3G9AB 2ZG3A 5TQ0H 3WLBB 1VHPA 2V7NB 1WSST 1NCNA 1VGEH 1NUGA 1DQMH 1MJ8H 1MQ8A 1AE6H 5I9QC 2OP4H 2DRUA 4U1JB 2FYYB 4PV9A 4NHCL 4HPYL 43CAB 4PRNB 5DD3H 1ACYH 4NQCE 1CDYA 1ZT4A 1RV6X 4PJIE 2CRMA 1KXVC 4PJCF 4QHKJ 3OKMB 2DTML 35C8H 2Z9TA 4XP6L 1WC7B 3FHAA 1UJTA 1HILA 4FQIL 2IBZY 3RNKB 3FQWB 3U1SL 3C6SA 2GK0A 5DT1L 2W1NA 4Z7WA 1OCWL 5GIRB 4O02H 1KJ2L 3RVXD 5KVEL 1J10A 1DBJH 4HIXL 3VG9B 4OTXH 2VQ1A 2ADJB 2J8OA 4MAYA 4PJXA 3VXTB 2YR3A 1A64A 5D7JD 3KNBB 3OAUL 4MA8H 6CGTA 1DBAH 2X4PA 4OF7A 5K9JL 4G7YL 3BD5A 2BVPA 4OLWL 1SEBB 1YN7B 4NKQB 1AXTL 1U8OA 2C3XA 2DOCA 2YZ1A 2BJML 2HJFA 4JRYA 1E4JA 3B3IA 4APQD 3BQUA 4JN2A 1S78D 5EB9A 5T3ZH 2P48B 4GLRI 1V5JA 5BXFB 1BEYL 2BDNH 3BZEB 3CH8A 1A6ZB 2FATH 5GQBA 3WV0A 3HI1B 3S4SG 4WCYL 4YBLC 4CMMA 4LEXL 1OAXL 3N1MC 2A6JA 5E7BA 1BFVH 4RMQA 3NVQA 3BDYL 2P45B 1XF2B 4F9PA 1YEDA 3S88H 4XPAL 5BMFL 1BPVA 1XFPA 2OXGA 4PB9L 4F7CA 5IR1B 2DM7A 2VC2L 4LASH 5IFAL 2LAAA 4A6YA 1LP9A 5D7LA 4JQXA 1JPSH 3TBTB 2RIKA 4NP4H 3DX7B 4J6RH 2DKMA 3QFJD 1OOAA 3L3GA 1IJ9A 1K4CB 4ETQA 2Z35A 5C0JA 1X4XA 3DNKA 3PIQA 4ZOBA 3CMOL 1XR9A 25C8L 3ARGC 5K59E 3LIZH 5H94B 4U2ZA 2XNAA 1MCRA 4S10A 4LSRH 1L7TL 1R5IB 4UQ2B 1ZA3A 1HQRB 1YEKL 4KH2A 2H45A 1CL7L 1HI6B 3FQXA 3S4SA 5DZLA 4LDLB 4WO4A 3BP4B 4XBGA 2EXWC 2OZ4L 4WV1A 4XVTH 5F6HI 2RGSA 2NX5A 2E8ZA 4P2RA 5EBWB 4HHAB 4IS6A 1Q8MA 2XRAH 1MCPH 3U30B 1QEWB 2P8PB 3MRBA 3DIFA 2EO9A 1OGAB 4IRSA 1U8PB 3ZLQC 2VLRD 4DN3H 1EJOH 2A0LC 1ZAGA 2WINB 2JJSA 5AAWA 1J1XL 1D9KC 3FTGB 3TBSB 1OF2B 3QULA 3VFUB 2Q3ZA 1NBVL 1G7MB 4KJPC 3Q3GA 1FFQA 4UBDC 4C59B 3SGEH 1CFSB 1M71B 4DAGH 5FEBA 1AP2B 1ND0B 5HDBF 1GCFA 2PF6A 4PRHE 3JTSB 1B0GB 3U4BL 1HYRC 5CLWA 5IEHB 1FNGB 1JFQL 4NO0D 3DMMA 1SY6H 3FT2A 1UZ8A 1PDKA 4GG6F 2VTFA 3OWEA 4QHNA 5DEGA 2DI8A 2A6KA 2F5BH 4OI7A 1UVQA 1JGDA 4LMQI 3GSVA 4QT5B 3GHEH 1XIWA 2QKIB 3QIUA 5D8JL 1JF5A 5JPMB 5ID1A 2B4CL 3WXVH 3DARA 3HRZB 2W9EH 3RL2A 4HT1L 1NCAL 5DYOA 4LVOC 3ARDD 4FQ2L 4HMDA 4G7VL 5MHSD 3OSKA 3MOQA 4AY0A 1I7TA 2NY5C 2B1HH 4PJIA 1RIVH 4TTDC 3MBEC 5DFTA 1A8JH 2IMMA 3O2WL 1PLGH 4KK6D 3HAEG 2DQGH 2X70B 1H9VA 3O4LE 4K07A 1LGVA 3DBXB 2IADB 3RJDA 1R3LB 2F53E 1MREH 4PRID 4LQ1A 3SDCD 3TO4D 1SHMA 4M48L 3GMOA 1SBSL 1I3GL 1LILA 4DJMA 3NCFB 5CP3H 1KLFA 1HHJA 3TJHD 3FOLB 5IF0A 3BD3A 2VR5A 5IHBA 3A67H 4L1DA 3KYAA 5IROA 4CNIA 1FJ1A 4WVRA 4QOKE 3L5JA 2OQJB 1ORQB 5H35B 5FUOH 1LO3L 1OAKH 1CFBA 4JFQA 1CGWA 5JR1L 1BFTA 3QUMA 4RGNE 1P4IL 4NRYB 1MAJA 2A6IB 3MRRA 5D5MB 3UMTA 2VXSL 2Y5TA 1NGYA 1QFOA 1T2JA 1D6EB 4KUZH 4PY7A 4NWUL 4EDWL 2IBBA 5F71A 1OT1A 4BUGA 1QFWH 2EYRA 1NGWA 4ZTPL 4ZAKA 4B7IA 4DGYL 4H25B 2R0LL 4F7PA 4LAQL 3QXAA 4LHUA 4PGDB 3L5WA 4R2GB 1TNNA 1E6OH 1I9JL 1LEKA 4Y5XA 4C56D 5HHXH 4MJID 5JTWA 3BP7A 1CD9B 3OPZL 3ULUL 3VI4F 4P5KB 1CTOA 1C5DB 1R24A 5B38G 4PRAA 3DHMA 3Q0HA 3FQUA 2R0KH 5T3XH 4X6CB 2EYSA 3RUGE 2OTWA 3CDFA 1A9EB 1IKFH 1IMHC 3UTQA 4YAQB 1FFPA 1BFSA 1BZ9B 4YPGB 1JV5B 3QUXA 2FBJH 1AC0A 1MFEH 4DKDC 1HDMA 2DI7A 4LLYB 4ODVH 5DJDA 1UM4H 3PV7A 4G9FD 1YMMB 4YZFF 1IGYA 1X4YA 2AJ3A 4O2EB 5DS8B 2OXHA 3UDWA 3VFGH 4JFZH 5C09B 1T7YA 4X6DE 4XVUC 1JNHB 4P5TB 1ZLVH 1FPTH 3D1MC 3M45A 3U83A 3BT2H 5HHVH 1HHGA 3CFBB 2IBZX 3O3BB 3ES6B 4XT1C 2YBRB 3RX8A 4JFFA 3KPSA 5KJRL 4M8QA 3AAZB 4DUVA 5HYFA 2PW1B 3NGBB 3V4PH 4G8FB 3BGMA 1INDL 1QBMH 4G6AC 1JRHL 3F58H 5B38A 2IPTL 1QRNA 2AV7B 4G6KH 3GB7A 4GRLA 2ZWLT 4RFOL 1JNLL 2H1PL 4IDJH 4W4OA 4ODWA 2R2CA 4HBCH 1FBIH 3QZWB 5EN2B 1MCCA 1CG9B 1MHPH 2EDYA 1U8KA 5CILH 3QUZB 4J4PD 5IBUG 1A3LL 1CFQA 1KJ2B 4LPVA 2MPAH 2ITCB 4QNPF 4YDJB 2R1WB 5FM5O 3IXTB 3KPRD 3QDME 2C3VA 3ARED 3RWFA 3MGTB 2EE9A 2OLDA 3D3VD 4MWFA 1JUFB 2XN9E 4ZNEE 3BE1L 1NCDL 4U6HB 2X44D 15C8H 3L6FA 2NW3B 1H3VA 5E7FA 1A6VL 4NT6B 1F3JB 5BV7L 2JJUA 2QJDA 2RR3A 4EQ2A 1A7OH 1KIQB 4JQIL 4ZUVB 1A6TB 2PYED 4FTVA 4PP2B 4OQTA 5C86A 4EUPG 3T8XB 1KB9J 4KKLD 1IGIL 2C4FU 5LXGL 2CIKA 2NXYC 1T3FB 4QXGL 2EE3A 1P84K 3QUYD 4RAVA 1QHPA 1XAUA 3O4LA 5HHQA 2EDTA 2JCCA 4OLUH 3VH8G 4C55A 1H3TA 4PJ9C 3WFDH 1WZMA 3O6LL 4IIQA 4LAJH 3T65A 3ULVL 1FNEA 2AXGB 1IQDB 4PRPB 5DJCB 4HWBA 1NAKL 1G9ML 4ISVA 3MTRA 2I26N 5EO9B 5D96C 5KANG 1U8NB 4PJCE 4XCCL 2NY3B 2LFGA 3BUTA 2UZXB 1WK0A 3AC0A 3DROB 2VXQH 1HSAA 2KUTA 3IF1A 4KKCD 5DMGC 4PJAF 5BCAA 5I1GH 3TZVC 4WW2B 5HTSA 3O41B 4IBLT 3OGOE 3UXFA 4DWHA 2V2XA 4MB5A 4TPRH 5KOMC 1Q9LA 5FYJL 3B2VL 4Y16B 2HKFL 3QIWD 1W0VB 3LH2L 4JJ5A 3QFDB 3D0VA 1GOGA 5FCUL 1SVCP 4D94A 4MNQB 4ONFH 3EOAA 3HI5H 4EUPA 5CGTA 2NNAA 1HKFA 1HHKA 1LEGA 1FN4A 1IM3B 4D9RE 4NZJA 3HPJA 4DOHE 3GMLB 5JA9A 4OZGB 3W9EA 3RBSA 2XQYK 3ARPA 1K8DA 4K3EL 2IG2H 4XPTL 3MZTA 1UM5H 3UYRH 5CZVL 3GJFK 1J0JA 2YK1L 4W70A 4UDUA 1B2WH 3KVQA 1ZHKA 4LKXA 3WBDA 4NQVA 4EN3A 3DXAE 4P2OD 3VXQA 3RVVD 3NIGF 1ZGLA 3SKNA 5FO9B 3MRKB 5DD0L 3QHZL 2VO5A 1XGRB 4MA3A 5E03A 4NKIH 5EU6E 1A02N 4JQVA 3U36B 1OGTB 1F4WH 3FQTA 3T2PA 3ARBB 3MUGA 5JDSA 4UDTA 4UV7H 5AEAA 4U1SB 4MX7A 2VKXA 4UOW0 1K5NB 1BQLH 2C4XA 3KGRA 4YH6A 3O11B 4L8CA 3V2AR 1CE6B 1RFDH 1S8DB 1JYVA 3T3ME 1ZT1A 3MV01 2E6QA 1CIDA 1V05A 3ESUF 3QFJA 3NCYS 3TV3L 3UJIH 3VFWA 4LLDB 5DK2B 1HH6A 2BRQA 4M43H 4HQQL 1IGJB 1F4XH 1FGNL 2ORBL 4PGEB 3LRGA 4Z7VE 4YHNB 2PR4L 5T1LB 2JK5B 3QQ3B 2FO4B 1I7ZB 4WWKB 3PP3H 5SWZB 1C5CH 2NZ9D 1I9RL 2EC8A 5C0BE 2GJ6D 3EOTL 4YBHA 2D31A 1E4XH 3OJDA 4N9GB 1G6RA 3O9WB 3BN3B 1G9NC 4OLVL 4PS4L 1U8JA 4UIKH 2VE6B 1U3HC 3QCTL 1J87A 3EO0A 1MCKA 4HPYH 1H0DB 4AENA 2VLRA 4CKVX 4LPUA 4U1NA 4OV5A 3KPPB 4YXKL 5I1EL 1NUFA 1VPOL 1CLOL 4WEBL 1FDLH 4XP6H 2W0FA 5GJTL 3M17B 5DRWB 5C0ND 3B4NA 5GGUB 3SKMA 2XKSA 4P46C 1E28B 1IKNC 5E4EB 5EU7C 4NDMA 2DLEA 1ZHNA 1OCWH 3DRQA 4CVZA 1BF8A 3P2TA 3DO7B 1EERB 1MCEA 2CO6B 5ERWA 3BH9B 2PXYC 4JFHE 4K9EL 5HDBE 5J11B 1S9WB 2GEEA 4JB9H 2BRRL 4ZOCA 4G7YH 2FWOA 4PV8B 1M7XA 4L9LA 4GG6E 3AM8A 2DIBA 3O6KH 4RFEB 3PHQA 1PX3A 4I2XB 1EMTH 2VDQL 3H9SD 4HMEA 1A4JB 3WIHA 4NRZB 4U4BA 5L88H 2A73A 5DZNA 3TN0D 3MO1B 5GRUL 4LCWD 4XWOC 5ICYA 4PJFB 3ARDA 4QTHA 4JRWA 1P7QB 4KQ3L 3C87A 4UILL 3VRLF 5JZ7C 4NJAL 3CX5J 4G43B 3PDOB 1UCBL 2HVKB 1U92A 4IDLA 4E9LA 1GZQA 4LRNH 3BDYH 3QWQB 1XF3A 3I6KB 1KLGA 4YFLF 1BVKA 4PJCA 4G3YH 4PB9H 4ZD3L 4KROD 2VC2H 1A1NB 4PRIA 3SDCA 1EHLL 5FHAH 3IFLH 4ZFOB 1MLBB 3V4VH 5IMOA 1RJYA 3D69A 1KTKE 2Q86B 4Q7DA 4HUXA 3NA4A 1GAFL 4TN9A 5HGHA 4RWYL 1YDPB 3OAYH 2QQLL 3QEGL 5IFHH 3MV8D 1MPAL 3J7HA 4JFEE 4GKNA 2UUDH 4UUJA 1U91B 3NPSB 4OM1H 5CBAB 1MQKL 2D03L 1RIUL 4XCEA 5IW6A 4UV4H 3G5XB 5D70H 2AABH 3KJ6L 4D0BB 3FQRA 3SJVE 3C60A 1BBDL 3MLVH 4Y19A 1I7RB 3KXFE 1P9MA 3EUUA 1IEAB 3BZFB 5EU6A 2MCPL 1YUHB 4NKMB 3ETBF 2M1KA 1X5AA 4MJIA 1UJ3B 5DVLA 1M05A 1WT5C 3VXNB 1D5BA 2G2RA 5CWSB 3OF6D 2YUXA 1QBLH 4U1MA 1F3DJ 4X99A 2K7PA 3VI4E 2XZCL 2I9LA 5LCVL 3O2DL 2Y7QB 4ZSOA 4YHPB 2JELL 4F37K 2GFBA 3DVGB 3U4BH 5A1AA 1S7WA 3BHBA 2AXFA 2FRGP 2YPKA 4NQSA 5CMAA 3EYUL 4XNQB 2FHCA 1PVHA 4RX4A 3C8KB 1I1AB 3EYFB 5KVDL 4NO5A 3JTTB 4G9FA 3RI5F 2COQA 3D39D 2VLJE 3VI3E 3DYOA 5BV7B 5C7XL 4G6ML 1FRGL 4YR6B 3RHWF 1I85A 3IDXH 3O3UN 4BQCA 1CVSC 4QRRE 1VACB 3F7RA 4POYA 3MRDB 4UTBL 4LHJB 1HINL 3TPUB 1LE9B 4OGXL 2XY2A 4QWWC 1OWRM 4FQ2H 3O0RL 5H37H 1OSZA 4MXQD 5HDQL 3HNSL 5KTEL 4ONHA 3DUUB 5E2TH 1R5VA 4KRPB 2BX5A 2O5ZL 2VYRE 4ZS7L 2VLLA 3RDTB 3W5MA 1T7WA 1X7QB 2CLRA 1KOAA 1YZZA 5D7KE 5ACLA 2CKBA 3D5OF 1NGPH 3UTPD 3LQAC 1T5WA 2GJZA 1JWUA 4ODHL 2YPVL 2YA1A 4Y4KA 4PB0H 4OI8A 3H9ZA 4MZ3A 1U8QA 1C1EL 1G7JB 1INEL 3QP3A 1IC5H 3TBWA 3MCG1 4XNXL 2Q3AA 1CFVL 1FO0A 3O6FC 5LGHL 5IHUH 2QADC 2AEQH 2GKIA 4J4PA 2HYMA 1TIUA 5FGSA 4LQFL 1AKJB 1UC6A 3QSKB 3H8NA 2P44B 4BSJA 2G75B 2P42B 3KPRA 3UBXG 5IJKC 1B0RB 4XBEH 3TT1L 3THMH 1Q9OA 4M8VA 4GG6A 1JYWA 3OXSA 4LVHB 5BS0E 1P4IH 3ZKSD 5DO2D 1FZKA 4IOFD 2HTLD 2QQQA 4NWUH 1PY9A 2PYEA 3B9KC 2WWKO 5MEND 4L3AA 2DBLH 5C08E 4LLVA 1O7VA 2E3VA 1GGCH 4HV8B 4DGYH 5F9OL 2DQIL 1UB6B 3QUYA 3ZE1F 3HZMB 3TF7C 4CN4A 4YHZL 1NEZB 4XZUA 5ILTH 3WDIA 1S7XA 4M7KL 1LO2H 2EDOA 3TFKC 3K4DA 4JRXB 5F93C 3WO3B 3GMRB 3GSNA 2M2DA 4Z5RB 4JM2F 4TQEL 3ULUH 4JGUA 2X4UA 4UQ3A 2O61A 2DD8L 3VG0H 1DVFD 3BUYB 1V7NL 3EJYD 4PD4K 2LVEA 1NBQA 2XQBL 4YEFA 3ZZ1A 1WEJH 4P0DA 5ANME 3GJFA 3D85B 3IU3A 4TUOA 1J1PL 2EZ0D 4UTAL 3DECA 3KLSA 1QSFE