2OX5B

The soxyz complex of paracoccus pantotrophus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
SSTVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 24
structure length 110
sequence length 110
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ox5B00
2OXGB 4UWQB 2OXHB 2OX5B 2NNCA 2NNFA
chains in the Genus database with same CATH superfamily
3LB6C 5E2WH 2QGBA 3IDJA 1A66A 5GZNC 2P5EA 2A6IA 1T22B 2WXMA 1L0YA 3WAJA 3PWNA 3V4UH 4HDIA 4XI5D 5EN2A 3S4SB 4ESKA 1JPFA 2IPKA 3KMDA 4HKJA 2J55A 4WI3A 1D5XA 5ADOH 1A4BA 4U0RB 2V37A 1TPXC 5EOCH 5LBVA 1WRFA 3HW7A 2YMTA 1MY5A 3KR3L 1RL1A 3MJWA 2E8ZA 5I18H 4NJAH 3L4UA 2F54D 1M7DB 5FV2A 3B1TA 2P26A 3C09B 1G9HA 3RPKA 3T4YB 5JPNA 4IMLB 4XX1G 3WDHA 4MJ2A 4P5MA 5B8CC 1SUHA 4KZDL 3GYRA 1XCWA 2E3VA 3SCMC 5TPWL 1FJ1B 5HYSA 3SJVB 3C60B 3APDA 4O58H 2AEWA 2AJUL 2IH3B 3WFHB 1NUNB 2XWDA 5IWLC 2PPCA 4X5PA 4KRPB 4BE6A 4NNYA 1FRGH 2WQRA 1EJOL 4XCYB 4CU8A 1VZGA 1JMXA 2Y7QA 5E4EB 4WNSA 2BPBA 2WLLA 3EH3B 1S78C 1BQUA 3MRFB 4NQEA 1OP9A 1WIOA 4O9HL 2VTFA 1ZD6A 1AKJD 3GSQA 3G3LA 4XPTL 4DPBX 7CGTA 2ZOUA 1SVCP 5ICYB 4GOSA 4GLRI 1TQWA 5IEHA 3DKHA 4XWGH 4D0DB 2XN0A 3X1EA 4LCCA 1MLCB 2PWFA 4YDJA 1UOKA 2Z7ZA 2V7HA 2XJKA 5IQ9B 1VPOL 3QJFB 3CNKA 1I3RB 4PRDA 1ODUA 1RU9L 4MXWL 2E4FA 1O6VA 4FQJH 3MV7D 4Q0XH 1N0LB 3MLRH 2UZPA 2WBJB 4NDMB 2YAMA 1CI3M 4UQ3B 3OF6A 5INDA 4UF7C 3SPIA 3FN3A 3OTTA 3A22A 4GIOA 1I7TA 2V2XB 1JGIA 4BKLA 4ATTA 5F1NA 2C7FA 2KH2B 2ZICA 3EGSB 3ZY7A 4HS6B 3O3BA 1Q72L 2G2RA 1IAIM 2VAAA 2XUWA 2NY7H 4UZUA 5IKCB 2I07A 2QSQA 4TNVF 4YHOL 3BT2H 3DTUB 1RZQA 1KDIA 4E42B 4YDKL 4K07A 3BPNB 4JL1A 2MTAA 3HOGA 4ZQKB 3MJ7A 1BVLA 1KB5B 4HPYL 4XHQA 1P4IL 2XXMB 1KJVA 4K94C 1LEGB 5T5FH 1DDHA 3UC2A 3EGXB 3LIZL 5CFHA 1Z1WA 1IBBA 1NLDH 1J9RA 4PJFF 4JDVB 4IW4C 4K71B 1KJMA 4EIGB 2VLRB 4BH8B 4I48A 4S0SD 2CLRB 4QOKE 5EWIL 4GXUN 1VADA 4A68A 2A6KB 4GW4B 4AGNA 2ODIA 2BFGA 5MENA 1JUFA 3MLSL 1PLCA 4NRZA 4XMKL 4NCC2 2F58H 4PJXE 1FZKB 3QZWB 2BP5M 2E74C 2M26A 1SXNA 2V7NA 5D6DC 4ZT1A 1KDJA 3AFLA 4XO8A 2EH7L 3IFPB 4IKIA 5D1ZB 3POCA 1LE5A 1KTBA 2VLMD 2J4WL 2WO3B 4M43H 1HVXA 5DMGC 3RFZC 1AS7A 1KG0B 5B4MD 1HDMB 1QYGL 1AMXA 3DTDA 3W0WB 4WGWB 3D3VA 2HFFB 1S7QB 1BQHA 4G6FD 1OARL 1FNSL 1NEZB 1UKQA 1KCUL 2BNUA 5IMKA 2BK8A 3QH3A 5DHMC 3ILPA 3IGLA 4PM1A 1UD4A 3JTTB 4G43B 5C3IA 1H19A 3CXFA 3HG1B 4N6QA 5F0PB 4GAGH 4LLQB 1YPZA 4XNUH 5KYUB 1R3HA 1MFEH 4PRBB 3V4VH 2OR9L 3HFMH 5GZND 4ELME 5IHWA 5KVGE 1LWRA 3WNJA 1QSFE 1INQA 3K74B 4ZUVB 2LW3A 5T1MA 2EE9A 3BQUD 3QO1B 3WIHA 3D39A 1Q1PA 2M1KA 3MA9H 1JMZA 2W9LA 5EIVA 5G5DA 1W91A 3CQQA 3F7LA 1DQQB 3L2LA 5IY5B 1LO4L 1OGTB 5JOFB 5E1QA 2XWTB 4OKDA 1S7VB 1BD2A 3VI4E 3VUAA 2F7PA 2Q6WA 3L5XL 3JV6B 4G72B 3EAKA 4WZ9A 1R3IH 4CW1A 1NM9A 4KK5C 3BMWA 3CDCA 2DZEA 3P73A 1TZGL 2X4OB 2ZSVB 4FHJA 1CUOA 4HS8H 4R6UA 3KDMB 5E1IA 2PTTA 3VU1A 3OKEB 1FH2A 3V9EA 3V5KA 2DOCA 3ZHLA 2PWGA 2WVVA 3SSGA 3O6LL 3WTUA 3V6OC 4NQCB 4NS0A 2PO6C 3AVEA 5HTSA 3HE7A 2L3BA 5EU3B 5ICXA 3BOVA 3QUKA 3IDGA 5I76A 1GGIL 3K2KA 4ODHL 5C07A 4GKZA 4HOXA 2AGJL 3PWPD 3GUTB 1HHGB 3W39B 1BIIB 3RZCB 5I0DA 1J10A 4XE5B 1WUNT 4JFQA 1J1PH 1TTRA 5D1XA 1D5ZB 1KYOK 3C6EA 1F56A 5J06A 1NCDH 3KEDA 1S78D 3ARFB 5D7IF 1HYSC 1DVUA 5JW4R 3KWTA 1LO2L 1JWUA 4JG9A 3IDNA 4XXCC 3X11A 3FQRB 5FGBA 1UFUA 5IROA 3HKFA 3U4KA 4OIIH 3CE1A 4GAFB 4OUOA 4W9HC 2IH8A 1DVZA 3SO3B 3DX8A 2OJZL 3GDBA 3MGTA 3ULUL 3T65B 5D7IA 3BAYA 5T1LD 1JZ7A 1LYQA 1TLKA 4LL9A 4KKCD 3W9DA 1B6DA 3FRPB 3ATDA 3U82B 1D3CA 1BECA 4XCFH 5FHBL 3S3CB 2AC0A 4GKNB 3WS6C 4XMWA 3HC3H 4BFGA 2YEQA 5I1EH 5BZDA 5T3ZD 4JO2L 4MLIA 5SX4H 4J3WA 3GTTA 3U4AA 3GMNB 2ZKWA 5SX4I 1WS7A 3CQFA 1CFSB 1E9OB 5H2BB 4ZMWA 2E6PA 4PTTA 5EA0L 3B9KA 3MV01 2WKOA 3EJSA 3L4ZA 2FL5B 4GG8B 4K7PX 3SGDH 4XP5H 3S98A 1MCFA 2Z93A 1NKRA 4FQXC 1NPNA 3SGDI 3FSOA 3VFMB 3IGUA 2AK1L 1A8ZA 2BHYA 1TJHL 2X4QA 1RK7A 2H2SC 3TBBA 2UY6B 4QRRA 1YUKB 1W0WA 2QPFA 3K5RA 4MD0B 5FK9A 3STLB 1JCVA 1X4ZA 2VOTA 3OQRA 2IDCA 3BAXA 2FK9A 4RGNB 3T3MB 3U4BL 1MHCB 1DE4A 4G11A 4IRZL 4R26L 4ALAC 2Z7YA 4JFHE 1TTCA 5AVRB 2CWRA 3S35X 2DQEL 1E7UA 1KCVH 4MZ2A 5GGVY 2XDHA 1NMBL 2ZKHH 4L1TA 5I1LB 4N2IA 1A3ZA 2R0KL 4ZZKA 1MEXL 3IGKA 5C09E 5I0WA 3HI6H 5DMGD 1AXSB 4Q74A 4D8PB 3P69A 3QEUB 1I8MA 3CDGB 2WY3B 5GGTH 4C56B 1U8PB 1S7WA 4DEPB 3EHBC 4DN3L 2PWHA 2FBJL 1EEZA 1LD9B 1MHEA 1X7QB 2FJGA 1ED3B 2VDNB 3EGDA 3PAZA 4QXTB 5CJBA 1ROWA 5LN8A 3ZDXF 3BMVA 4JPIA 5T33L 1J05B 4YC2C 1SYSB 4TUJA 4PS4H 5AG9A 4MWFA 3TPUA 3W3BA 1RHHA 2MWCA 2NY4B 1UXMA 3V2AR 1IM3B 1N8OE 2B16A 2VLKB 5E8DH 1BX2A 3Q05A 5DC9B 1DHKA 2OK0L 3Q0HA 4U1MA 3UZEC 4PJ5A 3DMMB 1HHKB 5CZRA 3TZVC 1SXBA 2OMVB 2UV3A 3QIWC 5TE7H 1FZOA 1J88A 1OALA 2V5RA 4TLKA 2VQ1A 1J5DA 1V8HA 3RL2B 4DK6A 1EUTA 3SQOL 2F61A 1OHQA 3ZZSA 1A7PL 3O3UN 4LEBA 1JD7A 3DYPA 1INEL 2AQPA 4KK5D 1SDYA 1KGWA 4EI6A 2WO2B 2FEDC 2DWEA 3GLAA 1CFBA 3FONB 1WE5A 1GHFH 4XO5A 3IDMA 4D8OA 1MFAH 1WAAF 4HBQA 1HNYA 1MAJA 3F12B 3EBHA 4ZD3L 2IG2H 3KPMB 2FCBA 3H9SA 2BOBB 4G9DB 5EBWB 1JL8A 1NGYA 1WBXA 1XF3A 5FDWB 2BRQA 4D3CL 4IJ3C 3EYVB 2IMMA 5KW9H 3V6FB 4PH8A 3HNVH 3ROLB 2I7SA 1WA1X 2FGWL 3O8XA 4GBXB 2ILLA 3UP1A 5JYLA 2OJ1A 1WJ3A 1RIHH 2W94A 2H1XA 3QE5A 1MI5B 4YGAB 5K9OB 3P77B 5CBEA 3IDYB 3C5JB 4G7QB 5CCHE 2V0AA 3BP5A 4A2MA 3OQ3B 1COBA 1YQ2A 2NT1A 3TBYB 3KYNA 1UXWA 2Y07L 4HEPA 4JRYB 3KXFE 4RGOH 1JZ2A 2FSEA 3E8UL 4MB1A 3HZ3A 1EDQA 2A73A 3ARGC 1J9QA 3V0EA 1T4KA 2KDGA 3IVKA 4KI5C 2DM3A 1OV8A 3N43F 2ADFH 1F2QA 3UPRA 2NZ9C 4LBAA 4F8PA 1YNTF 1VCBC 3D4CA 1ZIAA 4G8GE 2NY6B 2F5BH 25C8H 1M05B 1OAYH 3TA3B 4WI4A 4F2MB 3OMAB 4JQXC 4ZMQA 2YD0A 1CG9A 3BO8B 2X4NA 2ICEA 2W0FA 1SHMA 2VUYA 1V55B 5JW3L 5FEBA 1HKLH 1U4EA 4X4YA 3TVMC 1UACH 5T1DL 1JZJA 3OXRA 1MCPL 4HZLA 3SDAA 4Z9KB 1H3VA 5I1KL 3MZGB 4OD2A 1UVQB 3U0WH 2QBWA 3ATEA 3II1A 4FQXD 3CXHK 5AAMC 9PCYA 1GCYA 4HIXL 1AZBA 5J13C 3O6FC 3GZKA 5LKNA 3N1PC 2MCPL 1KB5H 1UOLA 2H2SD 4KAQL 1KXTA 3VD5A 3ARWA 3HPJB 5E2UL 1URLA 1IGIH 4U1LB 1NKOA 2QADC 2NNAA 4R8WL 3QULA 1H15A 3MXWH 4W9DC 5JHLH 3RRQA 2R2HB 3OG6B 1WBYB 1E6OH 2CIKB 5AYTA 3V0FA 5F89B 1NSNH 5CGBA 2WB7A 3PHQA 4WW2C 2VH5H 3PJNA 4NUJA 5DJDA 4KXCA 1ORSA 4W4OC 5ES4B 1CBJA 4P05A 1VGKB 5IM7A 5DZPA 4JM2B 2XV6B 4HIEB 2CXKA 4OUUB 2YGOA 1WHOA 1PLAA 2Y2TA 1OF2A 3G5XB 1RVFH 1U8CB 3O2DH 3P9LB 4MMZC 3W9EA 3P3YA 5E5MB 3RTLA 5BV7B 5EIIA 3QDJD 2ZCLH 4OCSL 3KGUA 1KYAA 5IESL 1T21A 5D1ZI 1KLUB 3UTTD 2AJXL 5D7JB 5T1KD 1QQDA 5KSVB 4AXWB 1PTZA 5DK0A 4E9LA 4XMPL 2VO8A 4BZ2H 4JQIH 4MA7L 1DBML 4WUUE 4Y19E 4WLCA 4AC2A 2CA3A 1W6LA 3HHRB 3EOAB 2XSKA 1MCHA 1ONQB 1CLZH 1Z5HA 1BVNT 4X7SH 1PY4A 4OV6F 2YC1B 4MAYA 1SOSA 2QFRA 3TZVD 3CH1A 4HK3J 1PD1A 3G04A 2E59A 3AWFA 3BD4A 4HCRH 4JANA 1E3FA 4LPWA 4WY7H 5C08B 3QIWD 1SMDA 2VZTA 5BW7C 1B90A 4NO0A 5BJTB 1SOQA 4X6DE 2ADGA 4PRHE 4FGMA 3BZFA 3T2OA 5GS2H 3DO7B 1D9KA 4MMXC 5HI3C 1BBJB 1JF6A 4PSPA 4CRPA 1BDYA 1SF5A 3DJZA 5AWNL 5HGBA 4U6YB 4RQQA 3WE6A 3ZUCA 2FEDD 4H1LA 3W2DH 1O7DE 4JJ5A 2JIXD 4R4FL 5FO8A 3HZVA 1FLRH 1MJUL 1LO5B 3DHJA 1YC8A 5DUML 2ZT9C 2ZUXA 1JGVL 3D51A 3RY4A 1KNOB 1KELL 1X5AA 4FHKA 5AKRA 3UJIH 3MBEA 4U3SA 3EKCA 4PRIB 1J8HD 4WO0A 5HVFB 1M4KA 3RGVC 1BYNA 1LNUA 4HFUH 4KHXL 2VUOA 5I1IL 3LMJL 4LF3B 5E6IC 1MUJB 4FA7B 3NUKA 4Z7WB 4LP4A 2CO3A 5F1SA 4C4BA 3QZNA 3HRZA 3VW3H 3HJEA 5E6ZA 5SWQA 3L3HB 5E2WL 2EDMA 5CJQH 3S9DB 3A21A 4E41B 4B9PA 3RNKB 3V4UL 4P2RD 3ARGD 1E30A 3U6RA 4AQ8A 3UYPB 3IAPA 1NUDA 1B4TA 2AEQL 3VXNA 2A74C 3JYBA 1UYWH 1N3NA 3FUEA 1G7HB 3HC4H 1FE8H 1LQSR 2E4TA 2OLDA 5F6IB 2BS9A 4FFYA 4FE9A 1A1MA 2NZ9D 1UJ3C 3FH8A 1HILB 1DVFA 3BSHA 2CCWA 4Y1AB 4KVCL 4N2FA 3TT3H 5K9KA 3QWOA 2KC0A 2QTEA 3J07A 4M6NH 4WFED 4OF0A 4Y2DA 3R1GH 4ORGB 1ND0A 1N5AA 1CDBA 1IEAA 1A6VH 3OKMA 3WTSA 2F54B 2NY5L 3ZZLA 1EAOA 1PG7L 1W9XA 4U1GC 4ZFZA 3X14A 1EZSA 2WXGA 2EZ0C 5JNYA 3BP7B 1ZVSB 3QA3A 2EE0A 4ZJ9A 3CFQA 1C16A 2P9RA 4XP6H 5L2KE 2IXQA 5HPOA 1I1AA 4RA0C 3WDJA 2DYPB 4ZXBA 4QTFA 2HKFL 4NN6C 4FKEA 4JY5H 5A1AA 1QWNA 2APSA 4Z7NE 4NPYB 4NQTA 5GRZA 5IB4B 4RGMC 4EI5D 1NC4B 4LIQL 3JZYA 4H2CA 3T6XA 4KTEL 4NKIH 4LQFL 5IBLC 2YAQA 1ZS8B 2P43B 4MNQA 4RAUB 1J5OH 1IQWH 35C8H 5ECGA 4H0LC 3CXDH 3GSOB 4U1KB 1I3GH 3MRKB 3TH3T 2X12A 4L29A 3WIHL 4G42A 4BFBD 1AKJB 1MOEA 1R5WB 4TOYH 1T2XA 3IE4A 2XPGB 3VFVB 3I6GB 4LE8A 1ZLWK 2VERA 4M4RA 4MJ4A 3DVGB 1E4KA 2C3WA 5HDBF 2JJTA 4B97A 2YKKA 3REVA 3OG4B 3Q6GL 4X6BA 3MLRL 4RIRB 3RY5A 1LGVA 2PWDA 4YFLI 3MV7B 2FH8A 2A9NH 3ZRSA 1MCEA 3WMQA 1CGYA 2X6UA 1NLBL 3QEQA 2XQYG 3O0RL 1NL0L 1IGMH 4LQ1A 1RZ8B 3RGHA 4CJ0A 3NAAH 4XNAA 2FLMA 1MW3A 3LNGA 1NFIB 2YD4A 2YZ1A 3F7VB 4EOWH 4LCUB 1RP8A 2C3HA 5J11C 3BT2L 3EOBB 1ZT1B 4S11A 3WN5A 1H3XA 2VDNH 1M7UA 2Z8SA 4I85A 4R7NB 2ATKB 1JGDA 3TJHD 3HZKB 3WTTA 4N4YB 4QRPE 1KBBA 4YE4L 5H35A 2IADB 4OM0L 3RWJB 4AY0A 1XEDA 4X8JA 3JTSA 1TKWB 3LNEA 4P5TD 4X6EA 3M17B 4JL2A 4W1TA 1JNNH 3QQ3B 4F8NA 2YFNA 3B7UX 4YHML 5FM5M 5HI3D 2W0PA 2D3LA 3GLZA 3M46A 2YOCA 4IBYA 1J87A 5KVDL 2VXTH 1EXGA 2DQCH 4N2DA 3RX5A 2FEJA 3HBPA 3HG2A 2XQBL 2WYHA 5HPMA 2YWYA 2QKSA 3RUGE 2GJPA 4NZRH 3CUPB 3GIVB 4F7EA 1UXLA 1UXSA 5IB3B 1XSJA 4U6VL 5E99H 4LKCA 2AJVL 2APXA 4QJ3B 1WFTA 3C5XA 3QHTC 2CHZA 2ZAHA 3FU7A 3OXSB 3UL4A 4M43L 2QVMA 1P9MC 1U8OB 4OFVA 1MKFA 1P6AB 3KW8A 4U1NA 4I3GA 1QPXA 3OWRA 4LCIL 3RGVD 5IFAL 4KUCD 3EO1B 2GJ6D 2Z6FA 5BUAA 4Z7VF 3KWWA 5E6ID 1B2WL 2VISB 3ZTCC 1CCZA 2K9FB 4G6FB 1FDLH 1OAKH 3H2PA 1FZMB 4LLWB 5EN3A 1TCRB 2AXGB 1XMEB 3GMRA 3HAEB 3JVGC 1JHKL 5AOJA 3UJJL 1N2RA 1KXQA 3ULUE 2J5LC 1U2CA 4HU2A 4PWIA 5H8DA 3WENA 4X0NA 1KZYA 4M7KH 4PP1C 1S7SB 5CXPA 3TCXA 1B0GA 2Y5TA 3KLDA 4N2EA 4ERSH 4J28A 1TVHA 3VYPA 5IB1B 4PI2A 1JXKA 1E4XL 4XPBL 3X17A 1F86A 3BQUB 1TJGL 3STZB 3C5ZC 1BM3L 2WCGA 2DIJA 1NUGA 2E6JA 1N18A 3GMOA 3V5HB 3CHSA 3UMNA 3KLKA 4JRXE 4V1DB 3HTLX 4OCRL 1KULA 1YMMB 4G9FD 4I2XE 3DVNA 4XODA 1S7TB 2JJSC 4LLYB 4HS8L 6PAZA 1XZ0B 3MLUH 2O5YH 5D2NC 2O93L 4N2HA 4P4KB 3WKNA 1OQOA 2VN6A 5F9OH 4Y4FA 1QHPA 2NQDA 1X4YA 1EDHA 4EQ2A 2ZKYA 4P06A 2JCCB 1QLRA 3EO0B 4HCGA 5DD1L 4HUUB 1FSKC 5ALCH 5M7QA 5HJ3A 1GXEA 4OGQC 4L4TB 1NC2B 5FYKL 1SJEA 4AC4A 3KYAA 3PWPB 3LV3B 2WXHA 3SPVA 1N5YL 2WXNA 1C1EL 2X2IA 3NGBC 5D5ME 4WFFE 1T03L 1IBZA 3BZ4B 3DDGA 4B96A 5DD5L 3EO9L 4H7VA 2CQVA 1BVNP 2FECI 2ADJA 5D71H 1A8JH 1ECZA 4JFFE 4BZ1H 5JA8B 4LDOB 4UYQA 5HYQB 3WSQH 4F3FB 1AJ7H 2R83A 4DGVH 3QFGA 3MBWB 5LWYH 2QLVB 4RMQA 4LLUA 5JHMA 4EMZA 4U3HA 1A47A 2EXSA 4RWYH 2BY1A 4E9YA 2R1XA 1AY1L 2IWFA 2NUPB 5HVHB 2LE9A 3V0AC 4ZMNA 1G9MC 1FPTL 2B5IB 5DQDH 5T1LB 4WV1A 1BMZA 4I3SH 5FOBA 5DD0H 3WUWB 5AALA 3OKOA 3ZZ1A 4XGZA 3D69B 3KVDD 2A6DB 3GD1C 1BIHA 5SV4A 1T6BX 1B4JL 5A2JH 3FN0H 1DQDL 5D7LD 2YAFA 3FTXA 3DHPA 3VG0L 5BV7H 2CBQA 1EEYB 2EVHA 3IKKA 2XPYA 5C0JB 3GMPA 2X5PA 3O0LA 4ANUA 4L5FE 5KUKA 2VN7A 2FR4B 4QRTA 4LCYA 1U8MA 4LPVA 3U9UB 3GK8H 4M6MH 4AL8C 3IMWA 3MUHL 1MFMA 2EDNA 2FX8L 1XO8A 3GBMH 5LNEA 3QNXA 2Z1PA 2XJLA 2Y24A 3NSYA 3MLPA 3GHEH 2WLYA 1S5HA 4R7VA 4UT9A 2MQGA 4BCZA 4LMQI 1ZLWH 1J0YA 4KRLB 3EYUH 3SY0A 3FAXA 3VSQA 4G80A 4A55A 2A9AA 1FL6B 2PYEA 4PV9A 2F53B 1OCWH 1Q94A 3QW9A 4PJDB 4GQ9H 4UU9B 5B1KA 2JWYA 4UB0L 1ACCA 2QHLA 3HI6L 3GSUA 2NXYD 1E2ZA 2ZSWA 3VFNB 4DP5X 3VWKB 5ID0B 2OM5A 2V2WA 5AVTB 4OFIA 3CFMA 4X5WB 3ZK0A 4Q9CA 4KJQD 4PQXA 3OAYK 4YZFE 4PIRF 4U7SA 1UM4H 3WXWH 1DLFL 3ROOA 4ETQB 4M8QA 4WEBL 2H3KA 1UADC 1AGBA 4LL4A 3O4LA 2DPKA 2QQKL 1HEZA 2FNBA 4Z23A 4OVUA 1MIEL 3T1WA 4GG6B 4GUOA 4PP1D 3KNBA 4RBPK 4PRAB 5EU4B 4M6OH 2LU3A 1T04B 2APVA 5HD8D 3AQDA 4NHUB 5CEYA 1OXYA 4WKZA 1BWWA 4DKEH 1E28A 3C5ZD 4XN2A 1J12A 2Q7YA 1JCKA 1U0QA 1CFNB 3GMLB 3H8NA 4OSUL 4YNYA 1SVZA 3FRUB 5D2LE 3RNQA 3LXBA 4LCWA 5IB5B 4GRMA 3MMEA 4OB5H 1E67A 2D7OA 3E3QC 2AXJA 3T4AC 1OVZA 1CWVA 4TUUA 3WE1A 3ALWA 3PQYB 2XNAB 4K5MA 4UT6H 4P48A 3WD5L 1MFAL 5C0CA 1FC1A 4ZPTB 4CDGC 3R19A 2I32A 1QKZH 4RDQG 1RK1A 4FEMA 4KGJA 4RFNC 3QUGA 2PW2A 5HHXH 1U3YA 4JQVA 2XFXB 4LASH 2P5EE 3NIFB 5D7KD 2XIBA 5GRXG 1CF8L 4Q9RH 3QHFH 4FQCL 3WBDA 2F2HA 2RJMA 1BAWA 4Z76A 2Y6SD 2XICA 1FYTD 1IFHH 4KKPA 5FLUA 5JOPE 3CBRA 1B0RA 1CXEA 5FM8A 2GSGB 4U4BA 4PBVC 1SHSA 3F01A 2XA8L 2Q8BH 5L4JA 2X4RB 1ETZA 2ZCHL 3MA7B 4XCCL 4CMHB 2F9BT 1O6TA 2XKUA 4KKQA 4ODWA 1MZZA 1NCHA 3LKSA 2R23A 3VFSA 2BNRA 5D93C 1DL7H 5TH2B 2DF3A 2BY0A 3T6VA 3NSXA 1BGXL 1QRKA 1YDPB 2VZ3A 4FQQA 2D03H 2HJFA 2N01B 4QRQB 1H6EA 2IPTH 4WI2A 3HN8A 4QJ5B 5BCAA 3LN5A 3ZE1E 4U1IB 3BH8A 1HNFA 3LKRA 3PE9A 3T77B 1CD0A 3AJ7A 3DVIA 3ES6B 2ZXWB 3N1QC 4C83A 1OCRB 5EEXA 1NMAL 4J6IA 4NQEE 5IG7A 4S1RL 4A7TA 2JELL 5K93A 2AV7B 3UBXG 4NWUL 3B2UC 3L3OC 4MJJA 4GSRA 2K7PA 1ASPA 2K7QA 5CO1A 2DMKA 3VXUA 1GL4B 2ED7A 4F7KA 4OZGA 1MRCL 2VDLL 4MD4A 4K2UH 1IBYA 1JPTL 4ISVA 4OLUL 4P5RA 4LRIC 5TD4A 4Y5YA 3INUH 3ZDZF 5IB2A 3JWNE 1IGIL 5ISZA 3PYCA 3KE0A 4QHMB 2X28A 3ARDD 1CICC 1CBVL 3M86A 4NKDB 1NFDF 2GHWB 2J8OA 1JGLH 3FB6A 4O2EA 1RUKH 3AS2A 1TLMA 2JNZA 2Q86A 3J8F7 1AI1H 3UEZA 1YEJL 1F00I 4FFYL 2I26N 1VSCA 4JHWL 1CD1B 3IPFA 1SHXA 3K0WA 3A47A 1IU1A 3R8QA 2V3EA 4DTGL 2GJZB 2JK5B 3SD2A 2C9AA 3G7TA 4FNQA 3D4GA 1USQA 1MNNA 3VNZA 2H3NB 4WTXA 5B1JC 5T3XL 1CD9B 4PJGB 4ICXA 3DROB 1GOHA 3OKNB 1U8KB 1IZJA 1HQ4A 2CO7A 2WLIB 1ZGLM 3AMKA 3T0EA 2UZXB 3QDJB 4LLMB 1XF5B 4U1JB 2ZWYA 1A6AB 4BZ2L 1UZ6F 3MQIA 1IC4H 2F5AL 3HS0A 4JQIL 4K7FB 5DRXA 3G5VB 3U1QA 3NIDB 2VLJA 5MENE 3DX9A 4A2LA 4AUUA 2ORBL 4OLZL 1CLZL 4ZX5A 1ZTXL 3ULVL 3H3PL 4M1GH 5E8EB 3HAEH 4ZS7H 1BEYH 4XNMA 4KOCA 3OKYA 3QNYB 1WCBB 2AABL 4LVNB 3JWDC 5CCKH 3IFOA 4UV4L 4JRFA 4Y5XC 4K3EH 3VSUA 4B27A 5ENWA 5HHVH 1T83C 3FL7A 3PDOA 4OF8A 4OI9A 3QXTA 1EZVY 3HPLA 3MLXL 2DQHH 3HVDA 3OZLA 2AXFB 5JZ7C 2CA4A 1Z2KA 5IVZB 3TEUA 3BX7C 5GQBA 2VDMB 2LFEA 1QPPA 3BW9A 3T0DA 5LQBL 1NICA 5CCJA 4E5XB 4AM0B 5JIIA 1JSYA 1YYLL 4LIQE 3R0MA 4QPEA 1BVZA 1E9QB 1YPZE 5LB1A 3QCTH 2Y7NA 2Z91A 5C0NC 1OPGL 3UJIL 4UDUA 3QAQA 3FO1A 3W57A 1VFBA 3F04A 1ZHLB 3OJMB 2G5BB 5CLXA 5E9DB 2YGNA 2RACA 3OAYH 1PLGL 2YMXH 4MXQD 2XZZA 1J8HB 1E90A 3KDPB 4HJGB 4IMKC 1YN6A 3D39E 1TTAA 3UBGA 2YAPA 2B4CC 1RZKL 4LOVA 3VX0A 2H9GA 1LJMA 2Z92A 3VW3L 1A4KA 1QZ1A 2Q87A 1JWMA 5I66A 5GS1A 1BD2E 3JV4A 5CJQL 2AV1B 3MLTA 4RBPH 4D9QE 1SRDA 4Y9GA 4F7PA 4N22A 2EYTA 3FC8A 2Y72A 3JSSA 3WY2A 1S3KL 2WVUA 4M7LH 2GJJA 4P2RB 1S9WB 4L8DB 1K72A 1W72A 1N6QL 1N0XL 4CA4A 7PCYA 3ZR6A 4X98B 4FQ2L 2RHEA 1WS8A 5E8PA 2BVTA 1F90L 1MJJA 3RVWC 2JKTM 1LHZA 2VIRA 4M6NL 5C07E 2MCMA 1N6UA 5KEZA 2OTUB 3JBG7 4XNYH 1QASA 4NWTH 2R69A 1RZGA 2KQNA 1W16A 3GRBA 5F88A 5CJ5A 3LDBC 4G2AA 5EBLB 5D1XE 1XGQA 2V6HA 3OX8A 3IFLL 3DUSB 4F80A 4Z1PA 4QOKD 3L3IB 3N1MC 4UM9A 4ZK8A 1VFAB 3GS4A 1NMCB 1DVXA 1K2DA 1NANI 2R0ZH 4LPUA 5AAWA 1P1VA 1QFWI 1IT9H 4TSBH 2G4EA 2PF6A 1MCOL 1DBJL 2APWA 2WIIA 4ZUWA 4GXVL 2Y5QA 2Y2WA 3UZQB 5B3SB 1T6VN 3O6KL 5KVDE 5T3ZH 1OP5K 2EDKA 4ZFFB 5GSVB 4EI5B 4WWKC 4JREB 1IQWL 2ADIB 2C7UA 3L81A 5D7IE 3VXPA 2CGZA 2J8UA 1F3JB 4FXTA 2NY1C 3C75A 4FXGA 3WIFA 1NDMA 4CJ1A 2LLLA 3O41A 3N40F 3MBXH 1CICD 1WFUA 4WHYG 3VE0A 4MZ3A 4ZNCD 3BESR 1P7QA 3HR6A 2LU4A 5FHAL 4HIQA 4L2YA 3RWDB 4DVBA 1ZHNA 3QZOA 4NBYB 1EO8H 3T8XB 5H94B 4PCKA 2GKIA 5BOPA 3UTPD 2COVD 1BFSA 3FAWA 2X6MA 3EZJB 5C6TH 2QZQA 5A6IA 1JTPA 1R5IB 1ORQA 4EI0A 5HJDA 5CD5C 3R0NA 1JZFA 2IANA 5AFAA 2XKNA 1JBJA 3EFOB 4O5LH 4S1QL 3CZSA 5FYLH 3FB8B 2C3GA 4HPOH 1J86A 3E1F1 2RAMA 1BBDH 4QUOA 2Q76B 3NAAL 2NYZA 1KXHA 1HX0A 2J7LA 1OM3H 1LO0H 1E65A 3ZHFA 1TU2B 3LVTA 4EVNA 3S36H 3AABA 4QRRE 2EDFA 2K45A 2YSSA 2BVQB 4FP8L 4NGHH 5B8CA 3KS0H 5DSCB 2JKSA 4OZIB 3FQXB 3SCMA 4JHBA 4LEOA 3ZKSD 2FGZA 4M5YH 1X6NA 3NK4A 4G7VH 2XBDA 3DX7A 3ZE0F 5IWLA 1NDGB 3CFIC 1P7HL 3CLFH 1LTXA 3BRFA 1VHPA 4GW1B 2VW7A 1NH6A 3K46A 4NKMA 2EXWC 2SEBB 3KYMB 4K3GA 4JGUA 1U91B 2QPSA 3EJCA 3FZUD 1EK3A 4P5TB 3PIQA 4IKKA 2WAHA 4A66A 2Q3XA 1VESA 1KGCE 1X44A 2DQCL 5EO1B 2EP6A 4IU3A 1AZRA 5GRVL 5F7NC 5KVFH 3DX0A 3H9ZA 5I5IA 3D85A 1TNNA 2Z31B 5HYSG 5DS1A 2YJQA 1VB9A 1GJUA 4MBRA 5F9JA 1G0XA 4MA1C 5E6RB 4ZAKB 3UTQB 5I28A 4DP2X 1KCWA 5FYKE 5L9DL 1AVAA 5GHWL 4F2FA 1YEHL 5HJGA 1FN4A 1SOKA 5C0ND 4Y9BA 2NT0A 4GI6A 2R8SH 1MVYA 4PGCA 3QFDA 4EUPB 2FJUB 3HG0A 4L8CB 3EYOA 4JPQA 3DX6B 2AEPH 2ZYHA 3CFBB 4YGVA 5BRPA 4PJ5E 3D9AL 5KBDA 1HCYA 3CG8A 4C57C 4OZFA 3EFFA 4ZSOA 3VXQB 3QORC 1TQBB 1IKFH 1OAKL 1V3JA 2OP4L 3VTTA 3V4PB 4PJ7A 4ONHA 4BQ9A 5DRWB 5AB1A 1SXSA 3DO4A 4F7TB 3I6SA 3S2AA 4E9SA 5B3JF 3FQUA 2GFBB 4GFTB 2QV4A 1GTFA 1KUMA 2BP0A 1IEBA 3NABH 2IO5A 3U1SL 4HBCH 3LS5L 1G6RB 2DQIL 1TEGA 5AW9B 3FSZA 4HQQL 3DV6B 4MNHA 3P30H 4GMSH 1PQZB 2A83B 4B0MB 5B38B 5I1JH 3H9HA 3PABB 4L3EB 2C9RA 3H9SE 2Y22A 1W0VB 2UWEF 4NRXA 2ZUVA 3RWHB 4UILH 5F7UA 1AQHA 2BSED 4L1SA 5I9QB 3C9NB 4YX2H 5I6LA 1P7KB 2L7JA 1DVSA 5KUMA 4AQAA 1CGSL 3QBTB 4WWPA 5DR5L 4E9WA 4ZMVA 1AGDB 4IRJC 2XVGA 4KI1A 1FAIH 4BXVA 1XGTA 2KLTA 2MHAB 2WLKA 3U7YL 5HHOA 4NIKB 5D6DA 5LBSH 2XWJB 1FFTB 3RFZA 1X9UA 4JFHD 5EUOF 1HU8A 1O6SB 2XC8A 3GBDA 3U30C 1AE6H 2IWEA 2IGLA 1GS8A 2J2ZA 1QSEA 3HLAB 4GS7B 4PW9A 1W2KT 5GGRB 4UIKH 3TCLB 5CR1A 4ODVH 3BWUF 5DJ6A 3KD4A 1IEHA 2W80C 5C09D 4Z7IA 5KS9A 4WWKD 2FECL 2GCYA 1VKXB 4XAWH 5EC2A 4UAHA 1SJVA 3MAWA 2VL4A 3HBZA 3ZE2F 3QUYC 4B50A 5KSAB 1OAQL 3C5SB 3IDXL 5KYYA 3M8OL 3QFJA 1VA9A 5DWUH 4NQXA 3X12A 4N6RA 5MP6L 4LSVH 4FYSA 3RJOA 1VZIA 3RI5K 4I0CC 1X9LA 3UAEA 3FSVA 2UXVA 5A7BA 5JDJA 4HC1A 1HESA 3NMEA 4YSOA 4Z7QE 3DGCR 4OIBA 2XWZA 4KX9A 3TO4C 5CD5D 5DU7A 1EJ6A 4X8CA 4Y1TA 3KPOB 3BYYA 1R34A 5I5RA 1JTOA 3KWVA 5F2FA 4JY6B 4I3SL 3VSVA 4S1SH 1U42A 2YXFA 3P0GB 4Q52A 3NK3A 5I0VA 4UV7L 2Y06H 4MA3A 4CVXB 3FCBA 1T1YB 1W0YT 5I2IB 1ZXKA 4P57A 3MNZA 1L9NA 4DPAX 3FN0L 4KTDL 2AQ3A 3V6OA 2NLJB 3TN0D 4FRWA 2PO6A 4YDZA 1K5WA 3OZ9L 5D7LB 3CFCL 2A0LC 1SOXA 1OP5H 1T1WA 4BSVB 3P9MA 2WQSA 1GVIA 3T0BA 4YDVB 2DMGA 3VFTA 3C8KB 2CRZA 4YR6A 4X8GA 4U6XB 3A67H 3NFPB 4JFEB 1I4FB 2HAZA 2P4AB 1NJ9B 5BVPH 1CE6A 1PGRB 4OD1L 3UADA 5IOPA 2VDQL 5EU7E 4XZUB 2OMUA 4ODTL 5CU5A 4JHAL 2HT3D 4XMVA 3GNMH 4OCXH 4XXCA 4F9LC 2HFEB 2V2TA 3V0GA 2J88H 1OEZW 4I18B 4XNXL 4ZI8A 3EYUL 4G8FA 2B2XL 2VB5A 3EUDA 4MQ7B 3SQBA 2BIIA 3MNMA 1YNKH 3V8OA 3MO1A 4E2OA 2WJ5A 1AGCB 3K5SA 3EYFA 5BNXD 4WGKA 1B88A 1U8IA 4DESA 4QWWD 1YY9D 3N42B 4HCFA 1A9BA 1NPJA 2VDMH 3GMMB 4UCFA 4B9ZA 2WLZA 3VTMA 4QY8B 2WQXA 3FH5A 3DNKA 1ILUA 2NXYB 1C5CL 2QSCL 4G6JL 4JZJC 3I3BA 5CP7B 1AZCA 3WS6A 4A7VA 5A6MA 2ITCA 5LGKA 5J9PA 4J23A 3MUGA 4UBDD 4FQ1L 3O2VH 3WXWL 1ZHKB 1YQVL 3LZPA 4LPTA 1MCKA 4PGJA 4YHKL 3K6IA 2WCPA 3QNZB 3F5WA 4A1RA 5DDHB 1E2WA 2JTYA 5F6HJ 2XN9A 2L7UA 4OD3L 2C4XA 3IXTB 3IKCB 1RK0A 3NIGF 3CDYA 4DSYA 1SBSL 4YSDA 4FQXA 3F6IA 4OCWH 4XNZB 1MCWW 8CGTA 5IEKA 5CGTA 2L7QA 4FNLH 1BF2A 5HYFA 1GJWA 4DAGH 2ARJA 4BCXA 2IAMC 3UJTH 4HH8A 3U36A 3S96B 5JO5A 3HNSH 4ZUSB 3LKNB 2YRBA 4LSSH 3SDXA 3CZGA 1KB3A 1KPUA 3WLBA 1M1XB 2PTVA 5IVNA 1P4BL 2VR8A 2O5XL 2H3XC 4I0PC 1X5FA 4I77H 1ZEAL 5ADPH 5D96B 3BP6B 3RL1B 2PETA 4X6CF 5DRNA 5IVXF 5SX5K 5LXGL 1FIGL 3FFCA 4LASL 3N9GL 1XSIA 2BP8A 2FZ3B 1KV7A 3QT2A 1AGEA 3SY6A 3B9EA 4UTBH 3C6LB 3SGKC 5F9WC 2YUWA 3SE8H 4PB0L 4LPYA 4FTVD 4HUMB 1WISA 1IFHL 3GXFA 4CVZB 1G43A 4TUKH 3UTTA 2F19H 5T1KA 4NZJA 1RJZB 1RQ5A 2DH3A 3DGGA 3FCSB 2TRHA 3MLWH 4O2CB 4Q6IB 4PJIB 2NQ3A 3QUYD 1YEWA 5IVXA 4PGBA 2Q8BL 5GZOD 1TQVA 4P2CG 4DGUA 4MX7B 5IJVA 2R9HD 3S3JA 3ZYOA 4PJ9C 2EUZA 2UYLA 4HWEL 4ELKA 3UZEA 3AUVA 5KYWB 1CXFA 5T3XE 1HOCB 1BFTA 3AXIA 2CDEB 3DPBB 1JV5B 3TZVA 3RJQB 4FQHA 4WUUD 4HOWA 3ECBA 3QIWA 3KH3A 4XVUD 4Y19D 4XP4H 5FUOL 4ONGH 2B59B 5C8JB 3MV9D 2XTJB 3TO4D 3MRNB 3UDWC 1QBLH 1XSOA 1GZQB 4WTZG 3D0AA 3G6AA 1A9VA 2JMRA 4JFZH 4KNQA 5DYOA 5HHNA 1CFQA 2VJ8A 2YPLD 1JPSH 3MJ9A 5L8LB 3Q2NA 4X9YA 1ZTXE 3TC9A 4R0LB 4Y9CA 2JIXA 3BKJL 3ULVE 2AQTA 1NCWH 4PRHD 5KYNA 1XGPA 1HI6B 1IC7L 1NKGA 1OTUD 3HUJF 1TR7A 3QIUD 1JWSA 3OR6A 5K5YA 4AOFA 3ALXA 3LHAA 1A7QH 3PGCA 2OL3B 4O51A 3VQ2C 2HLEB 2MRYA 4XPGL 4EQ3A 3LH8A 2VDPL 4M56A 2B9AA 3ZQ9A 2WBXA 3FPYA 3PWJB 5JORA 1TEYA 4IGBD 1L9PA 1HT6A 2X88A 1IGTB 3INUL 1VGEL 4L0ZA 5IW3A 3ELQA 1OT1A 1PZBA 1RURH 1TXKA 3CHRA 1W72L 3ARDB 3QEQE 4OGAC 3PL6B 1HZLA 3BKMH 4J3BA 3ARGA 3HR5B 4M62L 3WG7B 1AI1L 3CC5B 3K72B 1S9YA 3H7BA 15C8H 4AT6B 1XGUB 3K4DA 1DJWA 4CC1A 4UQBA 4K15A 5LXVA 4QO1A 2GYSA 1E27B 4WU7A 5AYUH 3W81A 5IHUL 4ABWA 2R69L 1PFCA 2OSWA 3IJHB 4F7CA 3KJ4B 5HHME 3V7MA 4CNIB 1J0HA 3WKML 3RZWA 4N8VA 4JQXA 4RRPA 1T2JA 3RWCA 3MRBB 1KEGL 1C08A 1IKNC 3SKJH 3GMQB 4EUPH 4S2SA 2LAGB 5IFJB 2OI9B 3MRLA 3TVMA 5AD0A 1FFPA 1B3JA 5E1AB 4KH2A 2IBZX 3AU0A 3X3FH 5DJ0A 4XWOC 2PUQT 5EC1B 1OM9A 5CBAA 1Q90A 1HJCA 2CO6A 4ZS7L 2FB4H 4JG0H 1M2VA 1P69B 4QF1B 3OGCB 5CHNA 5TJWK 5AAMA 3E8VA 1EDYA 2DJUA 3O6FA 5L2KD 4AE1A 5FR3A 4KROD 3PGFH 1QZNA 1WFOA 3EW3B 2DQHL 1RLBA 2IAMD 1G6RH 1F13A 3QYCA 3HMWH 1YEEL 1HXKA 5D1QC 2IALA 3SKOB 3QEGH 3AXHA 1TETH 3GTVA 3I6LE 5BZZA 4PBWD 1GYUA 3QWNA 5G4OA 5JA9A 1L7IH 4JLRA 5KTEL 1ZMYA 3WFEH 3HZYB 1M7IA 4I0PD 3THMH 1XF4A 4FQIH 3QJSB 4WW2A 2UY7A 2FUQA 4CSSA 3ZMEA 3TASA 1QUPA 2EEXA 3OB0K 5DHYA 2HX9A 4W4OA 4OF5A 1KXQE 4UM8A 3AACA 4M93B 4S1DC 1EPFA 1A3LH 5DZ9A 3TA4D 5DQJB 4MMZA 4X8XA 1M53A 3GLDA 3B9AA 5FO7B 3VFRB 5AKVA 1MJ7L 3UTSA 1IKOP 1MDAA 2BINA 3QUZD 5CR8A 4A04A 2BJML 2XIDA 4PRNA 3RBGA 5AW5B 3CFJA 2CLZA 2L7EA 2UXFA 3WY1A 1NWOA 3CMOH 2YARA 4RNRA 2A4CA 4JO4L 2NY0C 1BSIA 4PJ9D 4QCIB 4FA8A 1IGYA 1Q9WA 1DSFH 1O7SA 3QYNA 1J1OL 2D2CC 3MU3A 4LOUD 1JZ3A 3FMGL 1V7NH 4CDHA 1NBZB 4N68A 1F45A 4LVEA 1WBZA 2G0KA 1CZ8H 2VN3A 4HEMA 5BW7A 3QQDA 1QVOB 1KIQA 1YHPA 2FTAA 3ETBJ 3DTXB 4IJTA 4YXHL 1UM6H 2QV2A 4ZTPH 1LM8V 3Q13A 2AEOA 3LRMA 2DLFL 4MMXA 4CSZA 5DMKB 1KIRB 3IWVA 3CFKB 5LGYA 5IV2B 3GJFB 3DRQA 3KLLA 4P9HH 5CD3B 2VRQA 2QL1A 1J1XH 4MTMA 1J48A 4H26A 5IQNA 3QISA 5SX5H 4MDIB 1QFWL 4NAQA 3PJSA 4XVTH 2DWSA 3ESVF 4LEXL 3EGSA 3FOLB 4QOKB 2R0ZL 4IKNA 4PCSA 1I1YB 5TDNB 3GSNA 2OZNA 3VGDA 1DQJA 3I74A 3MRCB 4FMFA 4KFMA 2ZPKH 3OKLA 3RA7H 3RGVA 4YVUA 1UZ8A 3PJLA 3L13A 4EN3D 3DECA 2WJ7A 3MJ8B 1R6VA 2A77H 3IGAB 3MGOA 4F15C 1NOLA 3VWJC 2H26B 4CBPA 3CZLA 5AZEL 4QXUH 4AIEA 1WQVT 5JHAA 4K94L 1HC1A 3AXLB 1NBYB 4YSPA 2HN7A 4YHNB 4R90L 4PVNA 1K4CB 3V79C 5ACZB 2CLRA 2WSDA 4JFWA 4Y9FA 2EDBA 5JQIB 2VXUH 4JUTA 2IH1B 3HRPA 4ZX3A 5CKGA 2ZKMX 2B39A 2A74A 5DZNA 5EOQH 5IW1A 2NX5D 3DETC 4JY4B 2X38A 3S5LB 5GGVH 1F3DH 2R2BA 4N2OA 4Z7UA 4ELMB 1UJ3A 1QSFB 2GK0B 1YLBB 4UZSA 3EJTA 1BFOA 1QD0A 5JLZB 1S8DB 3LQAH 1TITA 5JXED 2E9GA 3VH8G 3FB7A 3U0TA 4D0BB 4CBZA 1T5XA 1IC5L 4HUNB 1QR4A 2D4FA 5A3IC 1RAMA 5FW7A 4IOSA 3VI4B 4H88H 5FO2A 4FFZH 2NR6C 3QYMA 2Y1ZA 3O9WC 2CBTA 2MEJB 2AMGA 4NPKA 4XWOD 5DD3L 4AENA 2MNUA 2CUAA 3UC0L 4AYDC 3LN4A 4APQD 3IJEA 3RTQC 5I1HH 5FPIA 3PHSA 2PYEE 2R1YB 4F57H 4GEJA 1U3HD 1ZT4A 4N9GA 3UZVA 4YPGA 4NM8L 2ZWSA 3RWIB 1CYXA 5CGYD 3NP3A 4KMTH 2EC9U 2GTQA 4BINA 1KB9K 4Y4KD 3X1FA 3MN8A 5CF3A 4YBHA 5D1QD 4GW5B 3NQIA 1K6QH 5L4FA 4HC1L 1J9SA 4F58L 3LRHA 2IBBA 3LKQA 2CALA 4WFFD 3SDCC 4MCYB 2WQ8A 5I15H 3DX3A 3VXOA 4TUOB 1I1FB 5HGDB 5C70A 3O4LE 1S9VB 4LSTH 2J71A 4S1DD 4XOBA 1AD9B 4IDLA 1T2QH 1Z5LB 5E5RB 1CXIA 1CL7L 5E6SB 3GJFK 3QRGH 2ZWKA 3M1CA 4BFOA 2NW3A 4TRPL 4BDVA 4EZJA 4GAJL 3OJDB 1AGFB 3OLGA 2D9QB 4PR5B 1MHPH 3MCG1 5I26A 5FIEA 3WFCL 4F9PC 1Q9LB 1OE1A 2N7AA 4DHLA 3FYIB 2VDKB 4Q9QH 3GB7B 5FGSA 4C8XA 3T6ZA 1W15A 2FVNA 3QJOA 2P48B 5DHVB 5FCUL 4HLEA 3TBTB 3HHSA 2WINB 5E0FA 4ZBJA 4G7RB 4V2CB 1KIPB 1T3FB 2APTA 4LCWE 4DK5A 4YHIA 1ITCA 4AV5A 4D0CB 4R3SA 4LSQL 4QTIL 3W37A 4KVPA 4YWGL 3E1ZA 5DMJB 1KTDA 4KRMB 3RX8A 2VITB 3EYQD 3KPSB 5C0CE 3H3BC 4YSCA 4JFYA 2IGFH 2WZ0A 4H40A 2CGRH 2BIQA 3TT1L 3VGAB 3KYKH 3U6XA 5BVJA 2B15A 3DPDA 4PV8A 1EO5A 4NIYE 2OYKA 1Z9PA 4IU2A 3C2SA 1JN6A 5F3HB 5DJYA 2DL9A 5JHDA 4X6FA 1UH4A 4KX7A 3CLWA 4X5XB 1CFTA 4M7ZC 3LZOA 5DK3A 3OB0H 4Q4IA 5HGGS 1UWEH 1MJ8L 3KPLB 2AJYL 3QQXA 1QEWB 2CSPA 1NGZA 5ETUB 3MNVA 1YEIL 1P9MA 1DQMH 1MF2H 5DJCB 3O6MH 5JHBA 1LVEA 3ARBC 3BVUA 1AE6L 4LMQE 1SNRA 5JQ6L 1JRHL 1H5BB 1KF9B 3AGWA 4OZHA 5J6HB 3O2WL 4JZOB 1S7UB 2BNRE 3T3MF 3AROA 3B2VH 2EVIA 2V8MA 3MRMA 3VWJD 1FNEB 4FZEH 4J1UB 1MWAB 4OJEH 2OL3H 1HAUA 1NGXB 3JVGA 5C09B 3WKPA 1DBAL 1HSBB 2X89A 2IPUK 2ZX8A 4F5CE 3D18B 4F1SA 2K6WA 1RUPL 3KG5A 2ICES 5DS2A 1D7FA 4C4KO 1BJ1H 1TQSA 4JR9H 3EG9A 3SE4C 3VB8A 3FHQA 4W9FC 3H42L 3BGMA 2XZCH 4DFHA 1T66C 2I60H 1LK2B 3DETD 4RETB 4RWHA 5L6YH 3QG7H 2AANA 5HY9B 2ZUUA 3VYNA 1A9EA 4M61A 4XP1L 4ALAL 5M95B 3F7YB 2BXZA 3SDYL 4S1SL 3VXUE 4PJ8C 2ALAA 2ITDA 3CFEB 3LS4H 5DZLA 4OZGE 2NMSA 1OGAD 2JJSA 4ZUTA 1F4WL 2ARWA 2Z65C 4D8PA 2O1AA 3I9IA 1FG2A 1AMYA 5D2NA 3PFQA 3C2AL 4JG1H 3ZRCC 5KSBB 1H9DA 1G7QB 1GW6A 2ZP0T 2X44D 3GRWH 2Q20A 2FYYB 1YMHB 1LD9A 3KWXA 4FLRA 1X7QA 2BY3A 5FX3A 4R83A 3X13A 5ISZE 2NR6D 1AD0B 2BS8A 3O9WD 4GUCA 4HSAC 1MQKH 4MHHI 4P2QA 3TN0B 2OMNA 3FOMB 4NUGL 5EZJA 1FHGA 5AW0B 3S36X 1Q4NX 3WOVA 1PDKA 4JUSA 1S6NA 3QJVB 2QKIC 2GTZA 1D7CA 4KQ3H 1I3UA 4HVBA 4N2BA 4J4PC 2P5ED 1F58H 3WTWA 3GKWL 5A2BA 3DMMA 4R4BB 2X4SB 3ZDZE 4AYBA 3KPRD 1UD8A 2XZQH 1XCQA 4L8SB 4YDLB 2OMTB 2CD0A 5DCCA 4NNXB 2OMVA 5F7BA 3UAFA 4KQ4H 1K85A 5HYIA 3MRGA 3BZEB 1YNKL 5GGSB 3T0EE 3SDCD 5JOPD 2QSVA 1ACXA 4JHUA 3VX1A 1T20A 1NCTA 4PEEA 2HPTA 3QUMA 2WM0A 3EBGA 2P8LB 1IFRA 3VXMD 1Q0YH 1YEGH 4JDZA 5CIPB 1ZLUK 3L7FB 4WHTB 3ZT6A 2VLJE 5JDSA 4GEIA 3MJ9L 1E8YA 3KXFB 3K2UH 2VZVA 3SPGA 1R24A 4JHZA 1F8TL 1CDHA 2BOBA 2NUTB 3BDYL 2ZCKH 4ZFOB 2Z7WA 3N41B 4PJAA 5EZLA 5LNGA 5ABZA 1DFBH 2DQDL 2FRGP 3ARZA 1NCBL 1RFDH 1WV7T 5C0EB 4AH2A 5I16A 3G6DH 1OKEA 3ZBMA 3HJ0A 4GBXA 3PNWA 4HETA 3CSYA 4G8GB 4AGLA 1GPOH 4GNKB 3KCWA 4F8QA 3D50A 4JN2B 4LARH 1RZJC 4J6RL 3UFIA 1TO4A 4KWUA 4ANKA 1KLGB 1G7JA 4HV8B 4AEEA 5EDSA 4UOZA 3FO0L 1G9NC 2X4UA 3QJHB 3M6DA 5KBMA 5K9QG 1EH9A 1UUSA 2LVEA 3QIBB 3M45A 5I8OH 1G0YR 1FL3B 1IRAY 4L4VA 3L5WA 3Q1SH 5FUCE 1L7TL 2EKSA 4LZKA 4OFPA 3T2NL 3P40A 4BV1A 1JK9A 4PLOB 1QA9A 1NAMA 3LNIA 5MI0B 1JYXA 5GGUB 2IV8A 3JWOC 3RPBA 3MJGX 4FL4B 5ADPL 5DI8A 4Y4HC 4BRJA 2P8PA 5GRJH 2AKRB 3VRJB 3FHAA 1WAEA 3GJFH 4DJMA 2FX9L 2GT9A 2ROXA 1GW0A 3NRPA 3TYFA 5F7AA 3Q5YA 1UWGH 2OQJB 3ARBD 3E6HA 4CN1A 4PHXA 1NBVH 1OLLA 3FHEA 3P02A 3MV8E 4V33A 3EJRA 2Y3NA 1NOFA 4R97B 2CLVB 3K0YA 4XPHH 4ZPVA 5I74C 3F8UB 1LDPH 2F19L 3JXAA 2HT4D 1J8RA 5JW4Q 2ZP8A 3MLWL 2DMCA 4FN0A 5ILTL 4HJUA 4F33B 4KVNH 1CK0L 2WXPA 3RVTD 3QEHA 1QX1A 1IAII 5MHSD 4JM2F 1M71B 1FGVH 3B5TA 1LILA 3G5YA 5TQ2L 8FABA 1XGYL 3BZ5A 1T66D 4EN2A 3L3KB 2R2HA 1PKQA 1JZIA 2CAKA 1T7YA 4D9LL 5MEND 2WMPB 2EEBA 2VLME 3CN1A 1OOAA 1V7MH 4Y19B 3JUYA 1LEIA 3WIAA 2VMJA 5I19H 1MCLA 4FFVC 4XO9A 4JFZL 4PJ8D 1R0AH 2FWOB 1EGJA 4E9XA 3Q3GA 3UGXA 5I75C 2JTDA 1MY7A 1OAUL 3GQFA 3VO0A 3T4AA 1XZWA 4TVSa 2DDQH 5KVGH 3S3SA 4X6DB 1L3NA 4XMLL 1SDDB 2J8UE 2YOAA 2BCKB 3BAWA 3DUHA 2F08A 3LZFH 4BK4A 4P04A 1E7VA 1KPVA 1HKFA 3FUHA 4PRHB 3WMPA 1JVKA 1JZDC 1G7IB 3Q6FB 3QG6B 1EMTH 3QIUB 1C9SA 1A7QL 1R46A 3NFNA 5DK2A 1AACA 2B3IA 3SDDC 3B83A 2CHNA 4NXSA 3IJYB 1JXDA 3VG9B 4IBTA 4BUHA 1ONQA 4HK0B 3UCQA 1D2OA 2R1WB 2R2EB 3US0A 2DEXX 4BCYA 3K8LA 1PG7W 4IGBB 1HZHL 2ATPB 2IANE 4HUXB 4NYLB 3QCVH 3D39D 5DLLA 1ZLDA 3UYRH 2JVUA 3BGFC 3REWA 3MYJB 3SEPA 1OB0A 2XXGA 1CPUA 4DT2A 3U4EB 4YZWA 1KENH 2QSTA 3O45B 4UYPA 1W8OA 3RP1A 4D9QD 1KN4L 3N04A 1OCOB 1M7XA 1E9PA 1R3KB 4Z7WF 4ODSL 1S3RA 2ZX5A 3HC0A 1AOHA 5DLML 4EO5A 1D5MB 3GGWA 4PGEA 4YPJA 4JCWA 1F11A 1G7MB 2KBGA 3IT8D 1WWBX 3MI6A 5C0FA 3HE7D 4XBMA 5DA4A 3GSNL 2LLGA 3LSOB 5AB2A 2BFVL 2FO8A 5I1AB 3T6QC 1E8WA 2EDOA 1SJHA 4I3RL 3MRRA 2CUMA 3TO2A 3NG5A 4K3DH 3GI8L 3FKUS 3L3OA 1QTYT 1HL9A 1S7XB 2VDKH 1Q9KB 4ETYA 1BCIA 1BYPA 2A9ML 4PN6A 5H37H 2B4CH 2FB4L 3T1FB 3ZVVA 4N0YH 5JIQA 5DHVH 1K4DA 1LLAA 3BFWA 2CXGA 4YBLB 1CLYH 5A6LA 2CIIB 2C9PA 1ZE3C 2ENPA 2OX5B 2D3NA 3CVDA 3PGFL 4LRIA 3TONA 4ANVA 3CSGA 4RMVA 5L2KB 3BRGC 4KROB 2R59A 2EICA 1FH5H 4OLWL 4LAQH 1CLVA 4GP5B 1CICA 1FFQA 4Z7NB 2JJUA 5TGBB 3IU4L 4ZSOE 3EOTL 1X7TA 2YPVA 4KXBA 4UQ9A 3RBSA 1EAPB 4Y1AA 1WC7B 4IS6A 4N2AA 4PJ7E 2E27L 1ZLUH 3E6FA 1GJIA 3BP4A 1AFVH 3QAZB 2YPKA 3G5ZB 1MRDL 3VXRD 2OXHB 4Q8BA 1WZKA 5EZOL 4L3FA 5HGAA 4I5BB 5B1JA 5ITBH 4YAQB 5BZWA 3IRZA 4TQEH 1HHHB 4H4NA 4OI7A 2DBLL 3D07A 1RJLA 4K7PY 2CRYA 4YXKH 5T8IA 4PB9L 2AXWA 3QUZB 1Q1JH 4XRCA 2EKJA 1A7RH 3DRTB 3B9KD 1ZA3A 3P3SA 2B1AH 4BHUI 4YSTA 1IGFH 4HSQA 1D6EA 2HLAB 1DSFL 3E80A 1GAFH 3EH4B 3IAGC 4TNFA 4ONOA 2E86A 4FQLH 1MWAH 5GIRB 2Q8AL 5AVUB 2D31A 4QRRD 4PLKC 2ZONA 2P80A 2V3DA 4G7SB 5HHOE 3AM8A 4BWWA 1CZ8L 3FFDA 2XG5A 4FD0A 4Y5XA 2KZ1B 4G83A 1AHWC 4ZUUA 1T83A 2EC8A 4ZTPL 4JKNA 2Y36H 4PGZA 2YLKA 5C0IA 2V17L 1R5VB 3B3BA 4XPFH 3SKMA 1VACA 2OCJA 5ECJE 1QSEE 4QRPB 4X99B 2ZF8A 3WHXA 5I73C 1X5IA 3MX0A 4HJ0C 4LLVB 3WU1A 5GJTL 2D2OA 4XHJD 2D7PA 2GJRA 3B3IA 5EU7C 5KS9E 4HJJH 3RDTC 4Z7OE 5I8EB 4AWJC 5I1CH 5J6GA 1GGTA 4PJHA 1KGCD 1F4HA 3QFJE 1J5HA 4P07A 1EBPA 5DS8B 4N26A 3F7VA 4GRWB 3IF1B 3NSFA 2ZOLA 4KO7A 3RUGB 1JGUH 3SDDD 4AQ1C 4IIQB 2CRMA 2DQUL 4IMKA 1JNHA 5I8CA 2WLHA 3ISRA 4PJEA 4GT7A 4EN3B 2J73A 1IM9B 1JZ6A 1MZYA 4PW3A 3MOBL 3N85H 3ZE2E 1KBWA 1SY6A 3AZUA 2O26U 2CHWA 4PJ5D 4YL9A 1TKWA 1FI8C 3BLKA 2I9LB 3NCFB 3Q7JA 1TFHA 1YAZA 2BW4A 4HKXA 5C0BA 4M8RA 5I1DA 1PMYA 2FQEA 1J18A 5EFIB 3VA6A 4P3DA 2HJLA 1N64H 1U3ZA 5EOQL 1NCJA 2NXZC 3MRQA 1D9KC 4QMEA 3ZKXC 4FKHA 2WXQA 4FERA 5G4MA 3SZ6A 3QHZH 3U25A 1OTTD 3KPNB 4BFKA 5KN5A 4FABH 3GHBL 3MHZA 2R56H 1TOXA 1KC5L 3ULSA 1AQKH 4C58B 2E76C 5LAPA 2BSEA 2DW5A 4A6YA 1UD2A 3VFUA 2G3NA 1SM3L 2GTWB 1H6FA 4CU7A 3EJQA 2CKBA 5CIPH 1A7NH 1MSPA 4N2MA 1U6AH 2CJSA 1GMEA 4DN4H 1L5GB 2FLRT 4HAFA 2FD6H 1TQCC 2G9KA 1DUZA 4FFZL 4JRXB 4BHUA 3HI1B 5EORH 3WJJA 4I2XB 2B20A 1FGNL 4NEHB 3ISWA 3VRLE 3O8XD 4OFKA 1ZHBB 4NN5C 3SGJC 2BIMA 2LTQC 2VXQH 4APQB 4LSUH 3CC1A 2APFA 2K78A 1Z6JT 3QCUH 4XC3L 2Y9RT 3H55A 1DBBH 1CGTA 5ELIA 1JXFA 1U3HB 3CZUB 3P2DA 1GGCH 3LHPH 4APXB 1U8HA 3HE6B 5J89A 1FQ9C 1A7OH 3QC5X 3NN8B 4LSPH 4EBQH 32C2B 3CDZA 1DQIA 2JQZA 1RIUH 4HUKB 4Y4KB 5CEZL 4XP9L 1MCCA 4MCZA 5IIEB 4JM0A 2JCCF 3I9GL 4RMWA 1XT5A 2P3YA 5I15L 1SN2A 2VMEA 3TIDB 5D5MB 3RPIA 2CCVA 1RV6X 4UI2A 2OXGB 3WKQA 1CGXA 2VMDA 4JFFB 4Y2DC 4XBEL 2FBRA 1ZIBA 1C5BH 3P2TA 5TFSH 1T2QL 2VSCA 3IJ9A 4FI6A 4MNGA 2XN9E 3BWZA 3PV7A 4JKPL 3S48A 1T7XA 2CR3A 4XMXA 5D72L 4POZC 5LJYH 1O9WA 3UACA 1ACYH 3H56A 5AVQB 1ZLSH 1Z3RA 3ZN6A 4AZ8B 2WWKT 2FATL 1AO7A 2HXAA 5DJ2A 2QZ5A 3PWVA 4Y5VC 1HWHB 3ECUA 4K5NA 4MASA 4QR7A 5TQ0H 2EIEA 1BXVA 2P7TB 2XN1A 5GGQL 4NNPH 4AEIH 4HXAH 2HX7A 3SDXE 4P49A 3X1NA 1U92A 4R2GC 1EHNA 2JB5L 2XT1B 3AU1A 2NDGA 3ARQA 3KLAA 5I1GH 4PLKD 1JHLL 4XVOA 5IHZB 4UOW0 1S7RB 1RP9A 2XQYA 5MEQB 4G8IB 5DEFA 2Y1YA 3FFCE 3UTZA 5EU5B 3IJ7A 3GRGA 3OMIB 4XH2A 4PY8I 3Q9PA 4PWJA 3DI3B 3OV6A 1T0MA 5F7FA 5MEOB 3ALPA 1XH3B 4P46C 4PREB 3KL5A 4NSKA 4HJ0D 3QPQD 1AZUA 3TF4A 3VQMA 1WFJA 1KLFB 3JV0A 3QUML 1KYUA 2X4TA 3F7RA 5HYJD 5FYKU 1KEML 4DOHB 3CSBA 4LRNL 3UTTE 1HE8A 2VABB 1JDAA 5EEWA 3H4HA 1G9ML 4UINL 3DIFA 3WFBH 1JZGA 3V5DB 4RFEB 5IVXE 1KFGA 3KR3H 1YSOA 5IMOB 3D69A 1G1CA 3DA0A 1BLNA 2WW8A 1JXGA 1EEUA 2AEIT 2CK0L 2ROYA 2CM6A 3F84A 3AT8A 3QORA 4PMEA 4P4RA 2JXMA 5TPWH 2XOTA 2AJUH 3WY3A 3FDWA 5BQDA 4QKXB 5EBMB 1A2YB 3ZLQC 4PJDF 4KZEL 2EACA 5F7MC 1EJOH 1HXYB 4PJBA 4JR9L 4AL8L 4NO0D 4U7MA 2AF2A 4ZQTA 4DP9X 5B39G 2OSXA 3ZR5A 2DICA 3OGOE 4QXGL 3PRZA 4O9HH 3MCKA 1P4LA 2I60L 2NXZD 1D9KD 4NQVB 3GWJA 1FVDA 4XCEA 4XPTH 2C1PA 5MI0C 1NAML 1KWKA 4RZCA 4UU9A 4KV5E 3LS4L 2WKLA 4IOIB 1I85C 3VFOB 5IHBA 2BERA 1VPOH 3VFNA 4PY7A 2J72A 4E0RB 4IRJA 2XYBA 1HHIA 3FTGB 3L3JB 3KL0A 4JG1L 4GG6F 4MXWH 1Y0LA 5ID0A 4GAAA 1WLHA 4NC2B 3T0WA 5BS0B 3E2HC 1O75A 4HGWB 1SN5A 1TFPA 3F7QA 4AYMC 3LPGA 2GAZA 1EVTC 4G70B 4NUMA 1Q72H 2M83A 1CR9L 3G5WA 1A4JB 3KM1A 4KQ3L 3DOIA 4FTVA 4YHOH 5I71C 1QR1A 5DUJA 1N4XL 1XGRA 5EU4A 4KI5E 5IFHL 5KSUB 4KNTA 2EDJA 5AVXB 1T04A 3IDJB 1SLWA 2P5EB 1I9IL 3QUYA 1T80A 2A6IB 4HPYH 1P4IH 1Y7VA 1CDGA 2EO7A 3PWNB 3K6OA 3ZYZA 4DUXA 4WFEE 3LIZH 3KPQB 4MXVF 1CFNA 1DZBA 4HDIB 4B9JA 3GMLA 4HMCA 2LV4A 1XHHA 3NIFF 2YD3A 1R75A 5EN2B 2EEAA 1JPFB 3R06A 4A2EA 4X7TA 2IPKB 1HL5A 4UIMA 4HKJB 2YHGA 4Z78A 5JW4M 2O61A 4FXKC 4G1MB 2PPAA 3MV9A 3TO4A 1EGJL 4Y2DD 1YNLL 3MLSH 2XNAA 4BK5C 2BHUA 3MOAL 4XMKH 4FAAB 1GC1C 5T3XD 4LNVA 2WZAA 2ZOWA 5AUMB 4IBSA 2J5WA 4POZD 4NQSA 1B9ZA 4QYOA 4M5ZL 5JPNB 2YPLA 4KBPA 1F41A 3B6SA 2EH7H 5EH1A 4AMXA 4P5MB 1TCMA 4TQHA 2J4WH 4W6YB 2CGYA 1QYGH 4N2KA 5EZIH 3ZE1B 4DCQA 4YXLL 1HOEA 1QEXA 4W9EC 1SGKA 3N91A 1CTMA 1MFDL 1OTSD 3EJJX 1OARH 1FNSH 1YRKA 4UQEA 5CILL 4J8QA 1KCUH 4GMTL 4NNYB 3ULVD 3U9PL 2WNGA 3IM1A 1E5AA 4R2GD 3TJPA 2WLLB 4NQEB 5JR1L 3W11C 1DJSA 1BEXA 2PN5A 2EYSA 2J1WA 1JI1A 2OR9H 3GSQB 4WI0A 3ZDYE 2F7RA 3BLBA 2K9UA 4F9LA 4CGUB 3MREA 5IEHB 1A14L 3NCCB 3IJSA 1EJ8A 1HE7A 4L8BA 4LCCB 4EDXA 3EJPA 4YDJB 1I9JH 1QW8A 3UTSE 1Y6NR 3UG3A 2V7HB 2ENJA 2NY3D 2FIKA 1LO4H 4PRDB 3V7AG 5T5NF 2HRPL 3T77A 5GRJL 3ES6A 2C9VA 1K5NA 3L5XH 4G6AD 3PP3K 1JOIA 4KJPC 5INDB 4JGNA 3D87B 4N25A 2BY2A 3ARPA 4MS8C 4QGTA 1TZGH 1FNAA 4GRLC 4HIHA 4OCNC 2P5WA 4Z5RA 4BKLB 3NTCL 4JZJA 4N0FA 5F1NB 1KN2L 4J2XA 3O3BB 2G2RB 2DYSB 4ENZA 3A6CL 4L4JA 3PPEA 4JBSA 3O6LH 4KKLC 1KTLA 2I07B 4HEME 4LHUG 1T0NA 3OZKA 1RULL 2ZXBA 4WNQA 1F02I 2EDLA 1A4CA 4HZAA 4M1CD 4NRYA 4TSCH 5HHMD 1IAIL 1N26A 1BVLB 4ODHH 5BPPA 3GFUA 5FLVA 2AGJH 2WPGA 4JPKL 4QNPF 4HALA 5CSZA 1KJVB 2UZYB 4XC1L 1IC0A 3K91A 5J5EA 1JK8A 2HH0L 2WSPA 3GSRA 4PJGF 5DO2C 2QVFB 1LO2H 1KJMB 4KTYA 4QHKJ 1I8KA 4I48B 4L48A 3GS0A 5DJAB 3Q2LA 4F93B 3ASWA 1VADB 2WKGA 2HTKD 1WWCA 3EBIA 2X4PA 1EQWA 4OLXL 1JUFB 1XCXA 2YPVL 3T3PB 1CD1A 1AAJA 2IAMA 4NRZB 2R27A 3L4WA 4HPHA 5F3BB 2WWNA 3VDBA 3NIDF 1P1ZA 2H4EA 2V7NB 4UANA 3ULUH 5KVGL 1LE5B 4I0PA 4HULB 4B7IA 1YUHA 4KDVA 3BSZA 3Q48A 5FHBH 4H8WC 1K9TA 4HX1A 2A38A 2UZXA 3D3VB 3F62A 4JDEA 1BQHB 1UHVA 5I17A 3QWQB 1RZFL 2MKLC 3T5WA 4HWBA 2BNUB 4U6HB 2FJFA 1Y18A 1LP9A 3H2QA 5DUBB 3G5VA 2A1WL 3ILPB 3SGKA 5IMKB 4JO2H 3B2DC 2PXYC 4K5LA 4KXDA 3FO9B 4NI3A 1UZGA 1YPZB 1R3HB 1BAGA 4Z7UE 1D7BA 5EA0H 1WCBA 4M8UA 1INQB 4W9IC 2DTSA 4UTAA 3QCVL 4PJ9A 1UM5L 2W60A 5T1MB 4KPHH 3JWDL 5D8JL 3B1UA 5F1IA 4H5SB 4B3EA 1SZNA 3D39B 3I9PA 4N0CD 2AK1H 5MERA 4L18A 1ID2A 1TJHH 1XL4A 4LVOC 5G5DB 2DTMH 1BQRA 5EEUA 1KENL 1SXCA 5KJ7E 1L9QA 3TV3L 3M1BA 1BD2B 2NNRA 1UT1A 3NCYP 3U4BH 3UDWA 4K8RC 3B8SA 3OHXC 2I5YL 4IRZH 5FUZL 3QQ4A 2Q6WB 4R26H 5EF2A 4S0HA 4LP8A 1Z9OA 3ZO9A 1OT4A 3P73B 2DQEH 1ET7A 3QPKA 1NMBH 1TTUA 4Y4FD 3FUJA 4PWHA 2PTTB 3V5KB 2GI0A 3ARSA 2G30A 3BEVA 2WVVB 1MEXH 1SQMA 1IE4A 2OMZA 2WOYA 1SLVA 2VE6A 3HE7B 4XX1E 5ICXB 1BREA 2KS0A 3QUKB 1FVCA 2Q2LA 3IDGB 5DA0B 5DUPH 1JV2A 4DN3H 2BXYA 2RFXA 1NA8A 2FBJH 4RAVA 2G60H 4GKZB 5C07B 1PY9A 5B22A 2GUOA 3UMTA 5C3LD 2B4CL 3CVIL 3T0AA 4N0YL 3IRPX 1KZQA 2EDXA 4PGDA 3LEVL 2QHRH 3BZDA 3FB5A 3LKPA 4JFQB 5D1XB 4Z8FL 1GMIA 5KJ4A 5T33H 5DQ9A 3ATBA 1SY6L 5F1KC 3W11D 1KXVC 3MCYA 3G6JA 4BWTA 1JWUB 2B9BA 4YLBA 3IDNB 3LPWA 1LK3L 3NDYE 3X11B 3FT2A 3PLYA 4YE0A 2ZAGA 4QRUA 3MODL 3SKNA 1FH5L 2CR0A 3GEWB 1P5VA 5IQ7L 2WSKA 3UBXA 4X9BA 1OP4A 3DX8B 3CX5J 2EEFA 3MGTB 2OTWA 1PNCA 2H6PA 2CM5A 1Z32X 1R3LA 4FZ8L 4L5FH 2NQCA 4KNSA 2NX5A 4DO4A 5MEPB 5GPRA 4FS0A 1A7PH 3W9DB 4KJPD 4A6YL 1UB6B 4J2QA 1ZAGA 1INEH 3BUQA 2CKBL 4KXZI 2FO4A 2LLNA 1QLEL 4MAUL 1JYVA 5LAXA 2JQAA 3CFDA 5TF1L 2O6CA 5BZDB 1NGQL 4KKLD 2AITA 4ZD3H 1IKNA 1RUAL 3MKKA 2OBGA 5DFVD 1A7RL 1S46A 3WEXA 4U6TA 4BM7A 4D3CH 7FABL 3CZNA 5GRWA 2D7NA 3B9KB 4U1HA 3D0LA 3QUXC 1GAFL 4Z3JA 2BNQA 4AMKL 4P5KA 2Z93B 2F8VA 5JHDE 3T2QA 3TNNA 4NO3A 3SN6N 5GS0C 2AVGA 5CN1A 2ZUQB 4ZFGL 2X4QB 2FSDA 4NM4L 4QRRB 3SE6A 3X1GA 1CFMA 4JFXA 5FK9B 5F7HA 1ZVHA 3LEYL 4YS4A 2VMFA 3E8UH 1TIUA 1DE4B 1FCCA 3UP6A 2PYED 5D1QA 2R29A 4ZFQA 4NUPA 1RHFA 1R5IA 3NCWA 4OZIF 1AP2B 4NP9A 4KK9C 4HJJL 3ET9F 4GUQA 3LZQA 3PP3H 5I1CL 2YAOA 4KKRA 5CWSA 5E00A 2GEEA 3SOTA 2Q76A 5G2NA 1I8MB 1VIWA 4AUJA 1OPOA 2HTLC 4QKTA 3RI5F 1S7WB 3CVCA 4Y1SA 4HJSA 2FHCA 1MHEB 1HHJB 2FJGB 2V8LA 3LVEA 4CGTA 3EGDB 5JW3H 1RZIA 1MCNA 4I88A 4RGNE 3S4SG 5CEZE 4JPIB 4NJ9L 3QO0A 4TUJB 2PXYD 5T1DH 1S2EA 4MWFB 3TPUB 4JKMA 2PP8A 1RHHB 4PJCA 4UDTA 5HDWA 1MCPH 2ZZUT 4L1HA 5J3HC 3PV6A 4HT1L 1BX2B 2R39A 3TFKC 3TU6A 5I1KH 4U1MB 1DZ0A 1E6JL 4YHPA 3AADB 1IGJA 5FKPA 1HSAA 5TE6L 2J43A 3OPZL 4HS3A 3WTXA 2WXOA 1ZKAA 2MCPH 4GKSA 2ZXCA 1PX3A 5D2NE 1FZOB 3HB3B 4KAQH 5E2UH 2VQ1B 2QEJA 1R1CA 4YH6A 3BUDA 5AB0A 2X2JA 1AS8A 4LCWD 3QHZL 3TEXA 4JPWH 4AGOA 3LD8C 4K8RD 3S37X 3WELA 3OLDA 2VXSL 2YAEA 2G5RA 4GKLA 4GP4B 4P2QE 3WEMA 5A2AA 3T6WA 2ODHA 4Q97A 5J4MA 3B7SA 2OMYA 5GISL 1NIBA 2DWEB 5C0CD 1PW3A 3ABLB 1AIZA 4BA8A 3IDMB 3DJ9A 1A7NL 2OJEA 5DD6A 1TT6A 4RMRA 3H9SB 3ESNA 1M6OB 1WBXB 1NGYB 5FUCC 1XF3B 1DSWA 1OAJA 1LQBC 3NPSB 5J12B 1YN7B 3ARYA 3OSVA 5ERWA 3F7KA 2OS7A 4I9WE 4OCSH 4U3CA 3V4PA 3TF7C 5IESH 1HIML 2QQQA 3CTTA 5CN2A 2AJXH 3OC8A 3O8XB 5CNHA 4XMPH 2W9DH 2Z8RA 4HF5L 3V0HA 4MA7H 1DBMH 5CBEB 3VWJA 5C86A 3BP5B 1U41A 2IAAC 5E94A 2BIPA 3DGDA 3KYNB 1UXWB 4Y16C 4OAWA 3RE0A 3UAAA 4OFQA 2FSEB 3Q06A 2A73B 1AC6A 3FBQA 3L08A 1AHMA 2VDOL 1ZWIA 1FWXA 2MOGA 3HCVA 2NY2C 1KTCA 2N3JA 1T4KB 2JLLA 4PJAE 1U8QB 2BOCA 5IT2L 4KY2A 3ERXA 1GYAA 3UPRB 1BVKA 4B60A 5AWNH 4YL4A 3WKYA 1A64A 3W82A 3NEOA 1VFUA 1FO0A 1QO3B 1RZ7H 2QVIA 3Q2WA 1J9TA 3VI3A 4E9VA 1CG9B 2X4NB 2ICEB 2W0FB 3JWNH 1MJUH 4H25A 1OGAA 1NGWB 2CMRL 4X4YB 3LIUA 4OTXL 4Z7QB 2OW6A 1JGVH 1YECL 4XBPA 3RKDD 1KELH 4JO3L 4ZO8A 5AVZB 3VXUD 2C3VA 3TCLA 4HZLB 5AEAA 1IAMA 3SDAB 1S5IL 5KG9A 1F6FB 1K8IA 2F74A 2NR6A 2Q9OA 3O9WA 3QUXD 4L4VE 4M9OA 4TV3A 4WI9A 4OD2B 4KHXH 1NCNA 4W9JC 5I1IH 1IV8A 3LMJH 3QZWG 3RTQA 4FXLA 2DV6A 3RAJL 5GS0D 5HXMA 1NPUA 2Z34A 1B4LA 2GBAA 3FU0A 5DJXB 5ISZD 1XV8A 1KXTB 3DURA 4BSWA 1IVLA 2NNAB 1OK0A 3QULB 1H15B 3KPRA 1ACZA 2K70A 1T0PB 1F6LL 1E5BA 4U3XA 3CLEL 5F8RC 3B34A 2OCFD 1NEZG 5SWSA 2AEQH 3PHQB 3BD3A 4KK9D 1QG3A 3SDCA 5F70A 4NUJB 5DJDB 1U9KA 2P28B 1JZ8A 2XFGB 1ORSB 1MFCL 5DT1L 3PY9A 1H3UA 4M7JH 3WFBL 5B1AB 5IM7B 1J0JA 4KVCH 3VXMA 3FS9A 5D4QA 3W9EB 1OF2B 1XIWB 2HTLD 4TL5A 1EEQA 3T0ED 4YIQA 5EIIB 2NY5H 4OT1L 4F8LA 1PG7H 2KERA 2CCLA 3KPPA 1QQDB 3RILA 1OD9A 2ESVA 4F9PA 2CPCA 1PKQE 2VLJD 1DVQA 5CSGA 4ODUB 5J3HD 1RSFA 2DLHA 1P7BA 4A63A 2HKFH 3OAZK 3TFKD 2C4FU 2HRGA 1XD0A 5EO0A 1WIUA 1HINL 4JJOA 1TF4A 3N42F 4LESA 5I6XB 4LIQH 3AREC 4MAYB 5FKAA 4XZUA 3E3QE 3CH1B 2VC2L 2AJSL 1TQTA 1JERA 3G04B 2R0WL 4JANB 4KTEH 4LQFH 3WJLC 1RMFH 2X70A 4NO0B 2WXJA 2A2QT 2DL2A 3K4AA 4IEFA 4GLRH 4WO4C 2ADGB 4GFXA 4TVUA 3ABGA 3BWSA 1BG1A 4WK0B 1OQXA 3BZFB 3WNNA 3WIHH 4TN9A 3SBQA 5FB8A 1NDTA 1OGPA 1XR9A 3NEEA 1IQDA 5HGBB 4RQQB 1JGEA 3WE6B 4JVUA 1LO3L 1WWWX 4MVBD 2XIIA 1X5LA 4FNUA 4H1LB 2IOOA 1MFBH 5FO8B 4X80L 3HZVB 3IPBA 4XVJL 4MMYA 4PWFA 3Q6GH 2RB8A 1RPQA 3IRCA 4MB3A 3S3BB 3BUBA 1U95B 1G5AA 1X5XA 4UNIA 5BMFL 3ZKND 3MBEB 4HU8A 4U3SB 4M5TA 4A37A 2YS4A 5K1VA 1NLBH 1I8AA 1ZHKA 5HBBA 1HNGA 4QAMB 5AAPA 5D55A 4ENEC 5LGJA 4JGMA 3O0RH 1LNUB 1NL0H 3ARBA 2YRPA 3BVVA 1U3JA 1FLTX 3CDFA 1H8NA 3QNZA 1T7VA 4QRAA 1YC7A 3AITA 3HRZB 2VDLB 5KBLA 6PCYA 5ID1A 2IWKA 3FQTA 5SWQB 1PZ5A 2EH8L 1JZEA 4F92B 3DWTA 3FRPG 4BK8A 4UUJA 3MV8D 3O4OC 4YE4H 3FQWB 1D6VL 5F7KC 4OM0H 4J3OD 1ZDQA 5ESVB 1PY0A 3U6RB 3QXDA 2ZP9A 4U4IA 2NY2D 1AZZC 4LPXA 3VXNB 3SE4A 1D5IL 1N3NB 4ONFL 2H1LM 3H4FA 2Y7MA 4OQTA 3J7HA 4YHMH 3CAFA 1A1MB 5E2TL 2AK4D 4D7PA 2V9UA 5IMLA 5KVDH 1NGPL 1DVFB 3PNRB 1FCGA 3RIFK 5K9KB 3QWOB 2XQBH 5LUMA 1OZTG 4HA1A 2VGLM 3NJJA 1N5AB 4PJ8A 1IEAB 5FM4A 4PJIF 3OKMB 3LXCA 4UM9D 4U6VH 3I3EA 3US9A 2AJVH 4PJFA 2WTOA 4ZFZB 3X14B 3BSZL 4HWNA 2E47A 2MOQA 2IFGA 5JNYB 4WENB 3QA3B 3C6LA 4TQPA 1C16B 5EZIL 2CU9A 4ZNEA 2IXQB 4MQSB 1I1AB 1SVBA 5GS3A 1WTLA 4HWBL 4ZXBB 2ZWLT 3LJ3A 3RIAK 4LCIH 5IFAH 1ZGLA 1RUML 1I8UA 4L9LC 4OJDH 4AM0Q 2YEZA 4W9CC 1B2WH 3BPLB 5M94B 4Z3EA 4PJIA 5E8OA 5J1TC 4EDWH 2VR4A 4Y1AE 5FWQA 4ES9A 3VQ1C 4MNQB 2QKIA 2VM3A 1JHKH 2N7SA 3OPUA 3LB6D 3QI9C 3UJJH 3UTPE 1A6UL 5IQOA 4UTAL 4J4PA 1JS4A 2V3FA 1KYFA 2ZJSL 1P7QD 1I31A 4L29B 3L5IA 4G42B 4GO9A 4IHOA 2BMKB 3JYCA 4IBZA 4YUEL 2Z3FA 1M3JA 4P59L 5DVKA 2B59A 3BWUC 1XSKA 2D7TL 3HA0A 1E4XH 4XPBH 4YHZH 1I9JL 2IQ9L 2FJHA 3HS8A 3CFNA 3IDUA 1TJGH 4M4RB 1BM3H 3L1OL 3PWUA 1MAKA 3OKKA 1E4XI 1IIIA 3REVB 1QFHA 2IAND 1IBGL 2VR6A 4C4UA 3UIZA 5CMAA 2DQTL 2NY3B 3FW6A 5HHPA 4OCRH 1T1XA 4TNWK 4N87A 2DQJL 5K59E 2YAHA 4FFTA 1PKOA 1E3XA 3BPOC 1WDAA 3QEQB 3X3GL 4TVPL 3QVAA 2V9QA 4NLHA 5SWZB 4R7DA 4H0GA 1UG9A 2R7EA 1KFAL 3SCMD 3AS0A 2AAAA 5BZXA 3WN5B 1NUFA 2ZCZA 5CZVL 4LNRB 2MQCA 3KHOA 4TSCL 2AI0L 4MJ6A 4YSSA 2XVBA 5DD1H 1JGDB 1Z9SA 1ADQA 2BVPA 5HHMB 3S97C 5FYKH 4FNPA 5H35B 2GQHA 3ARED 3Q8FA 4HKBB 4NKOA 1PX8A 4NZTL 1A6PA 4X8JB 1F5WA 1N5YH 5KVEL 1C1EH 3VXSA 3JTSB 1T03H 3FTSA 1O5DT 1GZPA 2E56A 4Y89A 1UCBL 4X6EB 3EO9H 5DD5H 4E36A 4G7YH 4N8UA 4PJHE 3PL6A 4HLZH 4NFBA 4IBUA 5FWRA 2H32H 3D85D 5L88L 3HI5L 4MYWB 4ZO6A 3B43A 1ZLEA 4GAYA 4PBDA 5HPMB 4G5AA 4JKKA 4F7EB 3MROA 1UXSB 3RWGB 3S88L 4LKCB 4MSWA 4PJEE 4JK0D 1AY1H 2ZX9A 4GH7B 5DEGA 5EB9A 2FQGA 3BWAA 2ZWNA 3FU7B 4Y4HA 1FPTH 1D5BA 2X2UA 1G94A 4FQPA 3VXRA 4U1NB 3ARVA 4PG9A 4NQDD 2KKQA 5C0BE