2OX5B

The soxyz complex of paracoccus pantotrophus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
SSTVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
molecule keywords SoxZ protein
total genus 24
structure length 110
sequence length 110
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ox5B00
2OX5B 2NNCA 2NNFA 2OXHB 2OXGB 4UWQB
chains in the Genus database with same CATH superfamily
3UO1L 1YMMB 4GRLD 1EHLH 3KXFA 2X7LA 3LZOA 3TEWA 4IK7A 2GSIA 2HB0A 1PZ3A 2OP4H 3HUJB 5B39A 3GMNA 3GUFA 4U1MA 1LVEA 2DQHH 2EYRB 3TJEL 4Y4HC 3BWSA 1RUKH 1HH9A 4URTB 4XNDA 3IWUA 4A63A 3GF8A 1RMFH 4HWBL 3QORA 2MCAA 5CEXB 43CAA 2FTAA 1QYGL 2X3CA 5E8NA 2G5BB 4JFQA 4X0KB 5JW5A 2NDFA 3UBFA 2YGVA 4PBDA 2F0CA 1XGQB 2VLJE 3ZE1E 5C6TL 3ZE2B 2WQ8A 4NKIH 3FQXB 5I6LA 2IG2L 3T71A 1EHXA 1QRNB 1CFQB 1F3JB 12E8L 5ACZA 5ICZA 1IQDA 4NWTL 5BS0E 1G7MA 1WCQA 1CFSB 4KWUA 4NGHL 4ZD3L 3BZEB 4YHNB 1NPNA 3B1TA 3LEVL 1W72A 4MBRA 2BW4A 3PQYB 4A2DA 2OR8A 2RQ8A 1QAWA 2OULB 2DM4A 2XBDA 4LLUA 3VXNA 1FE8L 3TBVB 1P7QD 1M7DA 3TNMA 1GR7A 2A2QT 3LOWA 3NVQA 1ZHNB 2J1WA 3VU1A 2VLJD 3RZWA 3EOTL 3COOA 3BSZH 3VFNA 5E24E 3DDFA 4L37B 1F4YH 4LCVA 2DW5A 1CGUA 1UZ6F 1LLAA 5CCKL 4YHIB 4M5ZH 1LO4H 4RMRA 1GCYA 1NAMB 5IJDC 1KGWA 1OTTC 1YECH 4XP9L 1G7HB 2V7HB 2HG5B 4LARL 4F91B 4XNYL 4XBPA 1TXKA 3RWCB 3WO4B 4JPKL 1NUFA 1X7QA 3NFNB 4JO2L 3FSOA 3L1OL 4LHUG 3OKEA 4AC2A 4X9GA 5DD6B 5IFAH 4UV4L 3NIFB 1G7QA 1BXVA 3U83A 4FF9A 2XWTA 2A77H 4YDIH 2NW2B 4PV8A 5IQOA 2FNWA 2F58L 4PJGF 3BEVB 4X7FC 5DD3H 2VLKE 5ISZE 1J0ZA 3EYQC 3QWOA 4PJ9B 1HH6A 3MJ9H 5F1OB 1U4EA 3G5XA 4NUPA 3GIVB 1N4XH 3SPCA 3T77B 3WMQA 3VWJC 4WU5A 1RULL 1SN0A 5EF2A 3SDDD 1ZVSB 3T0VA 1P4BH 2WZ5A 4TSCH 3OXSB 4JQIL 3D0VB 1X9RA 3IGFA 2BJML 5BW7A 4XNBA 1J18A 1ML0A 5DJZA 1GVIA 3Q1EA 1S3RA 1BEXA 4MYWB 4L4VD 4X6EB 4NGHH 4JFFB 4LE8A 2Q87A 1J5CA 2Q8BH 2ZKHH 3GIZL 1U4FA 1MFDH 3OKOA 1MI5E 1TLMA 3QDMA 2R1XA 2QZ5A 1HHIB 4U6VL 2YJQA 4QJ4B 1GJWA 2E9BA 1EIBA 3CHOA 5FGSA 4U7SA 1FN4B 2R0ZH 4XO5A 1F86A 4AQAA 2NMSA 4OGAD 4ZUUA 3KLDA 3ME0A 2BSRB 1F97A 2X6BA 4G9FB 2NYYD 1K85A 1JN6A 2J8UF 3PGFH 3QZWB 2OMVA 3N40F 4AT6A 3Q06A 5EF1A 4XPTH 4LCWB 5C0IA 1MOEA 3IN0A 1BQHA 3OJDA 3FT1A 3BPLC 4L2LA 1BQRA 5E9DE 5CAYB 5D7LB 5KS9B 4GAAA 4ZSOA 1OE1A 1LEIA 5DR5L 3QYCA 4ZXBB 5IFHL 2CDEB 2IQ9H 2EDXA 3WS3A 5GRWA 1JERA 2VO8A 1SXBA 1I1CA 3ILEA 4AZUA 1WBZB 2I9TB 1L5GA 3D39B 5CZKA 5DO2C 3UYPA 4J3XA 2DYPB 5GGVY 4EDXB 2I07A 2UY7A 3GLDA 3QEQE 1IC0A 1UM6L 3O6KL 4JRXA 3VSUA 3IVKA 2JK5B 4RGMB 1QLFB 3W0WA 5EBWB 1QWHA 2B0SH 3HFFA 5HYIA 4ABVA 5BVPL 4MMZB 4KC3B 1OEZW 3HNVH 3VXUD 1P5VB 4Z6AT 2XPGA 3P9WB 4J8QA 4TLTA 1N5AB 3NCYP 4KHXH 5DVKA 1AOHA 1XDTT 1DVZA 2KQMA 3I6LE 3KPMA 43C9B 1N4XL 2WNKA 1BLNB 1UYWH 1OP5H 2OSWA 1AGDA 2R0LH 4MQXD 4OVUA 1VADA 3WYRA 4Q4EA 4QGYA 1BLIA 5JIKA 3IDXH 4PHXA 4XVUD 1S7XA 2OZ4A 2GB2A 3D85D 2VQ1A 4NQEE 1UOLA 1FVEA 4FG4A 1YUHB 3TBCA 1DFBH 2ZX5A 3O8XA 5LQBL 1NKOA 1RZGA 3B2UD 5TGBA 3SO5A 1IFHL 4H8VA 4KXZH 3BKMH 4ONFH 2XXFA 3ECVA 4X42A 4ZMTA 1XXFC 1Y1UA 4C4KT 4ZOBA 1CICD 1H3GA 3TFKC 1GGBH 5BOPA 3HUJA 4HETA 1OT2A 5BV7C 4GRWE 4RIRB 1KIUB 1DSYA 2BHUA 1EAOA 2JV6A 2VDNH 2W0FA 1DVUA 3CPUA 3HI6H 1UD3A 4FXKC 4XP9H 3LDBB 2H7WA 2V7NA 3ZL1A 1I3RA 3D0LA 2R9HD 3QZPA 5T5NG 4S0SD 3EBHA 3SBWC 4FQJH 4N2FA 1A3QA 4FQ1H 4G7RB 1HHGB 1L3NA 2V33A 3M6DA 3BPNC 4HXAH 5CEXA 1EZVY 3D4YA 2J73A 3RY6A 4A2FA 2NNAA 4QR7A 3KYNB 5J57B 4K8RD 4NN6C 3V0WL 3GKZA 1OF2A 5KZCD 4I48B 1ZY9A 4MAYD 4JY6A 4QNPF 2NX5E 3OR6A 4QHUA 2E27H 4JRXE 1G7MB 2FB4H 3H9SD 5T1MB 5HYEA 2AVFA 3K3QA 3TEXA 4JN2A 4CC1A 1RHFA 1S3KL 4UDUA 3B9KB 4YO0A 2X44D 2QVKA 2NY1B 1YEEL 3NCWA 2ZKMX 5HTSA 4NPYB 4PQXA 5CUSL 1FCGA 5HHOE 1Q38A 5JPNC 2YLKA 1RHHB 5EEZA 4HIJA 5JW4R 2MCG1 4K94H 4NM4H 1TJHH 1T6VN 2AXHA 4MSWB 2VDNB 4KKQA 5E8OA 1AXSA 1ITBB 3BMWA 3LKOB 3N0AA 1MUJA 2BNRE 2VABB 4I9WD 5E94A 4XXWC 1DVTA 1Q0XH 2XYCA 3CHXA 4OGXL 4ZMLA 1OV8A 4FFYL 4YHIA 3CH1A 3B2XA 4DWHA 1WICA 1ES0A 2DD8L 2FJFB 2YPVH 3H6AA 5EOCJ 5H37H 3QUZA 1NCOA 1HEZB 1OM9A 5T1KA 2Y6TE 4NQDB 2BOLA 3AT8A 4A2LA 2RMNA 5EIIA 3DJSA 2BSDA 1KCUH 3ARSA 4JDVB 1VACB 3ZYJA 1VA9A 3HRZC 4PJXB 4PJGE 1P4IH 2NY5L 4URKA 1KT2A 3BIBX 2L7JA 3EADA 2Z8VC 3OKKB 4IMKC 3FN0H 5L6YL 4UAOB 1E3XA 1FDLH 4M56A 4D9LL 2JNZA 4MB5A 5D93B 2HYMA 3ECBB 1WLHA 4RMBA 4YSOA 4IOSA 4DZ8A 2OCFD 1OSZA 4LZKA 2VUOA 3O3EA 1J8KA 1AJ7H 4OLYL 5EPMB 5F7FA 2WZ0A 3UPRA 3LKSB 2XQYG 5E2WL 3L9YA 5CJ5A 1O75A 3B7UX 5E2VL 5I0WA 2EDBA 5JR1H 3L2NA 3LZLA 4LCWA 4NHUA 3PGCA 4LSPL 1Q0YH 4HGWA 3WFEL 3WY1A 1YEKH 3IGAA 3V7MA 4TLKA 1KEML 3TM6A 2NDGA 2V9TA 4ONGH 2C4XA 2FNBA 5DS8B 3EYUH 4S1SH 4OCXL 4XNQA 5I1IL 3JUYA 2YWZA 3BRFA 5F88B 3FTWA 2ICWJ 3I84A 5TH2B 4ETQA 1GH7A 1XR8A 1Q4NX 2HRHA 3LB6D 4JPIA 1HI6B 1RUPL 2XA3A 3EFFA 4UI2A 3SKOA 5EF0A 4Y5YC 3QJFA 2VAAA 5J06A 3PQYD 1B4JL 3VH8G 3MV9D 1T1YB 1D2PA 4A55A 2UX7A 3G08A 5B8CA 2C8NA 4JFEB 4WFEE 4Q6IC 2Y6SC 3QZWA 5GSVA 1S9YA 1A6UH 1WT5A 4WHTB 2QFPA 1FZMA 1TETL 4B5ZA 3OG6B 2F5AH 1BLNA 4Z7UF 1KELL 1XQ4A 4K2UL 4GP4B 1A4JA 3UH8A 3BW9B 3WLBB 1CGXA 4UOW1 5CHNB 3GUTA 2YUXA 2WN2A 1QZNA 3SQBA 2IWKA 3EJRA 3B2VL 3C8DA 4XNUH 3QXTA 1IAOB 4C56A 4YGVA 2I9LB 3BAEL 4MJIA 5DJAA 5IHZA 1OOAA 1YNKL 4L29B 4C83B 1C5BL 4OKVA 4XOBA 2R8SL 1QOKA 4JY4B 5E8EA 2Q6WB 2HJKB 4JFOB 4POZD 1YPZF 1AI1L 1D7FA 1BA9A 2PPCA 3C6LA 1AG0A 1M3IA 2J5LB 2CE6A 5LDUA 4JPWL 1RKRA 3B3BA 3EO9L 4N0UA 5I8EB 5CCGE 3TEZA 5ITFA 2V5YA 1A6AB 3IMVA 4L37A 4I1NB 1UJ3C 4MJID 3IDUA 1ZE3C 5KVMC 1P53A 1FVEB 2RJMA 5GGQL 5JIDA 3LIZA 5EDSA 1Y18A 4KZCA 3ULUH 2EVFA 4QWWD 1MZZA 1RZFL 3HRPA 4UIKH 3TP4A 2ARWA 1X6NA 3A6OA 3AXLA 3O45A 3QIWA 1PD1A 1GKOA 2H0FA 4NC0B 3MRGB 2GK2A 1IL1A 1U8LB 3DX0A 4XAKD 2EACA 1ZSHA 3AM8A 4U1NB 1OT1A 4GKNA 3V0FA 4R96B 4IHOB 3ZRCC 3DXAA 3MLVH 3KL3A 4QHMB 5AW1B 3PDDA 4KY1H 1TF4A 3MNVB 2HT2C 3EJZC 1TKWB 2EDHA 3S8GB 4K7FA 4BWTA 2VJ0A 4OAWB 2Y1ZA 1QFUL 3ULUC 5L4IA 3CBKB 3MOAH 2B9BA 1A22B 2G2NA 5D5MB 1BVZA 2B8OT 3DX6B 1JK8A 5KW9L 4CMHC 4J4PA 3CH1B 4TUOA 3GMRA 2IANA 1SY6L 4QKTA 1N3NA 1U6AH 3RI5F 1DDTA 1MKFA 4LSQL 1QLRA 4NSKA 3LXUX 2WNGA 1MIEH 4P23D 4YZFE 3RYMA 3PWUA 2F8IA 5IJKC 5HJBA 3D18B 1KT2B 1QI3A 2ITCA 1A2YA 5EOQL 4LRNL 3VXPB 2QKSA 4JNXA 2WLHA 5FHBL 1VKXA 5AOIA 1NINA 3HJ0A 4BE6A 3S37L 4YE4L 1A7OH 4Z3JA 3GS4A 4LF3A 4YUEH 2VXQH 1X4ZA 4JBSA 4XMPH 3SYAA 4D0CB 2VUKA 1DJGA 3C9NB 4PRNA 4W9HC 4N85A 1PNDA 5ECGA 2EH7H 4OLUH 5ABZA 5EC1B 2Z91B 4BSWB 3GXMA 3D0VA 4JQVC 4JM4H 2R56L 1PZ2A 2X4UB 4A7UA 5CKGA 1J0HA 4P46B 4YFDB 1CVRA 1ZAGA 1XF2B 4Z7WF 2ALAA 1WVZA 5FYJH 5E9DB 1BECA 3PDOA 5AVSB 4OGZA 3GSOB 1IAIL 4PJ7B 4CVZB 2YEQA 4EJ1C 1NCNA 3TXAA 2ETWA 2B1HH 2FO4A 4JRXB 4EUPA 3THMH 3FRPG 1CICB 3ECBA 1P7KB 2QLVB 2RR3A 5AZ2H 5FOBB 2A9NL 4XC3H 3BAXA 3HCVB 3SKOB 5GIRB 4UOZA 1LL1A 3VD5A 4ZBJA 3QAZC 3PXJA 5GISL 1XBRA 1URLA 2ITDA 4UT7L 2FJUB 3PV7A 4HUNB 3K7UA 4TVPE 2CDEA 3P2BA 2ED9A 4XVTL 3AG1B 1IFGA 3GDBA 1RUPH 1ZV5A 2D3JA 4N0CC 5F9OL 4EI5D 2ZUVA 1CXFA 5DS8A 1EO7A 1I9EA 2AJ3B 3AJ7A 2WWNA 3GJFK 4KDWA 1JRHL 2XETA 3X14B 5HVHC 3B2PA 2Y24A 1PZ5B 1I9JL 5IW1A 2CMRH 3ZHDA 3SCMB 4IJTA 5FA3B 4KJQC 4ZO9A 4NO0D 3Q9PA 3LNHA 1R3LB 2VAAB 4MCZB 1HTYA 2HJKA 3U9PH 5CSZB 4O2FB 4Y5YB 1CFNA 2CBMA 2W0FB 5C08E 1FNFA 1Y07A 2P5WE 3NH7L 4FCHA 1BEYL 3D1MC 1OF0A 1NGYA 3ISYA 4L4JA 5E2WH 3V52H 3P77A 2X42A 4ISVB 4XNMA 3DJTA 4ZMWA 4AW7A 5EU6A 1BQLL 3QR1A 2CCLA 3DHUA 4M8VA 4PP1C 1CQYA 1FDLL 2PMZA 2PF6A 3C5ZB 5BO1L 4NT6A 1MI5B 4UQDA 3QQDA 2BHFA 3O6FA 4TV3A 4JY6B 4NJ9L 1YZZA 4KH2A 5CP3H 1XB3A 2EDKA 5I1KH 4XNXH 1SBSH 3EH2A 1QVOB 2KZ1B 5A2CA 5T3XE 1ZDSA 4RIRA 3RHWF 5FO2A 1JGEB 3DK2A 1JGDB 2Z93B 1ZHBB 2XACC 1TJGH 5BVJB 5CBEB 4IJ3C 4AQ8A 1IBGH 3I6KB 3S36H 5BZDB 2ADFH 4G8EB 3IDJA 3VACA 4JRYA 3M45A 3VH8A 1HEJC 3JSSA 1CLYH 4MJ6A 5LJYH 5IMKB 1DBMH 3DXAB 4OCLC 3JWDH 3ULUD 4YHOH 3CX5K 4UYQA 3HTLX 4KMQA 5DQJB 5GRYA 5CIPH 1IBZA 5F3HA 4FHKA 4OD2B 4X5PA 3VXRA 1JVLA 3SOBL 1P6WA 5KSBF 3ARGD 1EO8L 1I8LA 3OHXC 1IILE 1A64A 2VDOL 3MI6A 1E8WA 4LDOB 1S78D 2W65A 1YEEH 3R18A 2JI2A 4YDMA 5IJKA 4TUOB 3WIHA 2O5NA 1D9KC 1H8LA 4LPCA 5DD5H 2VXSH 5DHMC 1RP8A 3FSVA 2FHCA 5BRZA 4GAFB 1BBJA 3QSKB 2XTJC 4QHMA 4I3SH 4UOW0 4AJVA 4Z8FH 2VDQL 4OJFH 1DTUA 4WNSA 4HXAL 5LN8A 5T1DL 1OP5K 4FABH 2XZZA 4OAWA 1ROWA 2GJ6B 4JFED 2DTSA 1KXTA 2X5PA 3JT2A 4L9DA 3HAEA 1M4KA 5IB4A 1N6QH 5AZUA 3RBSA 3GMMA 2X4TA 3OC8A 2ESVE 4P23C 2A1WH 2GITB 1NZRA 2WW8A 1ZANH 4JDVA 1JDDA 2J56A 2D9CA 2PCYA 5GXBB 4KJWD 2R2BB 3EGXA 4FI6A 5KJRL 4PM1A 4LOFA 4P5TA 4Z3GA 5J1AB 2V5MA 2VRQA 1DQVA 4LVOC 5KBPA 3F7RA 1PG7X 1XAUA 4F37F 4AMKH 4BFEA 1EFXD 4HLJA 4F3FA 4U4BA 4XOCA 1XR8B 4LLVB 4X7TA 5FWQA 3HHMA 1INQB 1EQWA 4U6TA 3IDXL 1JV2B 2QV2A 1CICA 1OIOA 4B50A 4D0CA 4ZTOL 1NC4D 3F8UB 1P0SE 3NJKA 3G08B 4PB9L 4KNSA 4ZS7H 2OMTB 4Z77A 5K9OA 4KJYB 5CINL 1UH2A 1UWYA 4M4RA 3RL2A 5HXMA 1XIWD 1JFQL 2IH9A 3HPLB 4KRPC 3PGCB 1OE3A 1LO3L 1ND0B 2JJTC 4UQ3A 4N0CD 4EI5C 2XVGA 1BZQK 1ZEAL 4M6OH 4YHPB 4NXKA 5DHVB 3DPBA 3B56A 2RGSA 5AKTA 5HGDA 1D5XA 3VM5A 5GZOA 1LE5A 1U93B 3KCPB 4PRHD 3WHXB 4BH8A 1UZGA 2N0KA 4TUJB 5F1SA 1U8JB 4AJ0A 1IAII 3QFGA 4Y16C 2QELA 3ZX1A 4FAAB 5D2NC 4L4TB 3VDAA 1WG3A 3SJVD 3FH8A 2CO7A 3T0ED 1GY2A 3L7FA 1PPIA 5E6RB 5GIRA 3RNQA 2H6PB 3JWOL 1XH3A 3S34H 2EO9A 4GAYB 5KAQG 5C0EA 4WQOA 1QTSA 4HCRA 1U8PB 2NY2D 5GS1C 3E8VA 2VDKL 4RZCB 5KSAC 5GRUL 5LCVA 1IEAB 3QNZA 5I17B 1BYNA 1J0IA 2UZIL 3BN3B 3JV6B 4Y9BA 1GL4B 4XBEL 4ZT1A 3T2NH 2GEQA 4KHTL 5GGSY 1S5IH 2QR0B 4C56B 2VDPL 1INDH 4FXGB 4UQCA 5C0JB 2NXZB 2YMTA 5DQ9A 1O9WA 3C6SB 1G6VK 3ZL4L 3NCJL 3NIFF 3CZKA 5IW3A 5IOPA 1DBBL 4Y2NA 3H56A 2PKDA 1WGVA 3K5RA 5HI5C 1X7TA 2Z93A 3FXIC 1C1EL 2LU3A 3BX7C 3FRUB 2ADJB 3MJ9L 3TBTA 1XMEB 2MOQA 3RPIA 3O3AB 5EEYA 3T4AB 1MFUA 1N8ZA 5AWNL 4PJ8D 4KK6D 2JB6A 2KLSA 1WFJA 3VQ2C 1NIEA 5DD3L 2JELL 5EO1B 1ZVNA 3JWNC 1K4DB 1JK8B 4X0KA 4ANKA 3G04B 3N2JA 2P5EA 4CSTA 1MHHA 3C5ZA 3FAXA 3V4VL 4O4YH 3ILPB 1N3NB 1RJLB 1W0VA 2HTLC 2IAMD 2XZCL 3SPVA 3VMPA 4PRID 1Z7JA 4PTUB 4PJ5E 4K8RL 1R5VB 3P0YL 2B5IC 5DMJB 5TF1L 3BAKA 5T3XL 2P44B 3ZQ9A 3QCTL 2XLLA 3UC0H 3HG1E 4IHOA 1MNNA 1SQMA 4I87A 3NOIA 1GYAA 1E2WA 5B3JE 3HI5L 2VN4A 3IFLH 1E5AA 4S2SB 1U92B 2Y06L 3AC0A 3D33A 4WLCA 4MJ6B 2JIXB 2GBTA 3JTSA 3U1PA 3U9WA 4LAQL 3UPCA 2I24N 4GMSH 1MSPA 3GXFA 2BHYA 2XV6B 3O4OB 2VZVA 1I1RA 2E9GA 1A4KB 4XMZA 1E5ZA 4Y9EA 4F58L 3FQUA 2YAHA 3VAEA 1MQKH 3UACA 1RIUL 3FB6A 3HZYB 3WN5A 1JK9B 1SVCP 4QXTA 1G0YR 4XH2A 2GJ6D 4JFHE 3X3FL 2J55A 1NGQH 2UZPA 1EFQA 32C2A 3PWUB 3PABB 3AQYA 3FFDA 1WWAX 1UWFA 3TO4A 2VLJA 3L13A 3D2UA 4P5TB 1F4XL 1JL8A 3ULSA 1MVFA 5D1QE 4ZUVA 2DQCL 5F9WC 3H7LA 2YXFA 4U6HA 5EO9B 3GS0A 3PJNA 1O7VA 3BE1L 3GXUB 2OX5B 4J3OD 5HI4C 1ZT4B 2Z31B 2N7AA 4GLRH 4GW1B 2JIXD 3CAFA 1D5ZB 4PUBH 1U3YA 5HDRA 3VD0A 4PRNB 5FW7A 5IVOA 2CO6B 4QRUA 4X4KA 4LSDA 3NSCA 5T3XH 3PJLA 5HDLA 4DP8X 1XCWA 5DEZA 3TJEH 3BUYA 4OZHE 5FYKD 3N1FC 5D6DA 4UQAA 2K3TA 3RDJA 3CXDL 2CRIA 4LLAA 4YWGH 5T5FL 5EUOA 4LOUD 5CN1A 5C8JA 4YHML 1UD8A 3EUUA 4LL1A 1K5NB 2BP0A 1P4LB 2UVFA 2XN1A 5GZOC 5HI3D 3S5YA 3QJZA 1E27B 3HC0A 4X5QA 1YNTA 2NYZA 3X11B 3KNBB 5HVHB 5KJ7E 1XTLA 1Z3GL 4F7MB 1ONQB 4GBXA 3T4YA 3X14A 1D6EB 4G6JL 4GSDL 1INEL 3OQRA 5HGDB 1LE5B 1QLEL 2WWMD 1HHIA 1I8UA 3VXME 4PJ8C 3BVDB 3FQNA 3V6ZA 3K6DA 3BVNA 1RCYA 5C0AB 2BSRA 2ATKA 3EBGA 3SY0B 1IGTA 1FZKB 3ARUA 5F9JA 1W91A 4BCXA 1NC2B 5ICUA 4OLXL 2RACA 2H6PA 4NNPL 1R46A 2KH2B 3NJFA 4W9ZA 3P4OB 5BQ7A 3ZT6A 2EIDA 1F8TL 4Z7OB 3IU3B 1AGCB 2DTML 5C0CD 1YN6A 3MOQA 2QPUA 4IYKA 1IGJB 3LPPA 2DQEL 2F53D 1U93A 3KCPA 4IKKA 1EBAA 3BO8B 4G8GB 1HQRB 5F7AA 1SBBA 3ZTDC 3OZ9H 4W6XB 2ZX6A 4A67A 2X53A 4BFOA 4HMCA 3PWPB 4L9LA 1HYSC 4XPGL 1X44A 4B60A 3K2UH 4N2LA 2FATH 1T80A 4JRYB 2HFGH 1ZHNA 2HVKA 1NCCH 1ZHLB 3ZZQA 3OKMB 4HCIA 5ADOH 1H9DA 3TBTB 5J11B 5EUOE 5DK2B 5I16A 3VYNA 1E30A 5GJSH 5E8PA 4EI6B 2K0RA 3TH3T 1OCRB 1C7TA 1KC5L 1KLFA 1YUHA 2P49B 4NFBA 2R4RL 1K72A 4K23L 2CBQA 2RD0A 4FFWD 1EGJL 5E23A 1OT4A 2ZUWA 1NLBH 3B9DA 1D9KB 3UJTH 5DYOB 3GJFB 4FLRA 3B9EA 3MBEC 3QISA 4GKSB 4NZJA 3SPVB 1ZHKB 4R0LB 3KVDD 1O6SB 3T0DA 2HT3C 5D7EA 2BNQB 3P4MB 4LQFL 2TSBA 4EN2A 3MGOB 1KIUA 1P9MA 3HOGA 3ALPA 2AV7A 1CL7L 1J5IA 5EULV 3AQZA 2XWEA 3T6XA 5KWYC 1KB9J 4YSQA 5DQJA 1B0WA 4Y1SA 1MFNA 3BDYH 5I8OH 1DVYA 1OOWA 4R5XA 1C5DB 2EIKB 3EOBB 4AMKL 3Q1SH 3CN3A 2EVIA 3VB9A 5EU3A 4WU5B 1BGXL 1TCRB 2D03H 4OLWH 3ATFA 2OMWA 3IMTA 4WO0A 3WFHB 1IQWH 4G6FD 1KB5L 5I24A 5C9JB 4HJ0C 2DLIA 4KXZI 3PIQA 2P3YA 2PO6D 5HPMB 4JN2B 4DCQB 4Y1AD 3NGBB 4N8CH 1ZDQA 4FABL 1FNAA 3EZJB 3N41B 3JVGA 4CL7A 1MAMH 3SDCB 1XMWA 3HLAB 4WJG3 3WY3A 4JLRA 5D9SB 2MJWA 2PWGA 2WQVA 3ZE1F 4PJHE 5L8LB 3BAYA 5SWZA 4HPOL 4DN3L 2QPSA 3KPRB 3K8KA 1FC2D 2IOOA 1ZVHA 4LAJH 1JSYA 1DJSA 4Q9RL 3LZNA 2GW5A 3D3VA 5JXED 4PGCA 4XN2A 2AAVA 3QVAA 2VLME 1F4WL 3ZGHA 5BXFA 1ZPUA 1DUZA 3DPBB 3F6LA 4C57C 5I6XC 1D3CA 5CMAA 3UYPB 3VXSB 3FU6A 4FHJA 1INQA 3SE3A 4TVUA 5FO7A 5HBBA 1HSAB 2XV0A 3APDA 2OMTA 1UUSA 2DDQH 1V8HA 1U3JA 2HRGA 1MHEA 3DWTA 3CU7A 3QJRB 4N9GA 4WIQA 3O2VL 3WKNA 5FFOA 2XPGB 3SHSA 5C0IB 1B4RA 1HXMB 1SBSL 1JGLH 3B9AA 1DVQA 3AZUA 2X89D 3L1EA 1OTUD 4HUUB 3KL0A 3IFOB 4OZFA 4DGVL 3BQUC 4PFEA 4IMLA 1FG9C 3QNFA 3EYVA 1WWBX 5HGBA 5C2UB 4M7LH 2AJXH 4HHWA 4ZFGL 3U7YH 4EZLA 3SEPA 4D94A 3D39A 3P4OA 1L5GB 1BAFL 2EE6A 4FQCH 4FZEL 2ZAGA 3QDHA 4JZJB 3TX4A 4PP1D 3NZHL 3P0VL 3BP6B 5MERB 4V1DE 3FHQA 3WMSA 4MAUL 3OAZK 4C4KO 4LSUH 4DP4X 1PGRB 2DKUA 3ORJA 4XZUB 5D55A 3BSZA 4PJBE 5JPMA 3WDHA 3FZUC 2BZDA 2Y1AA 1SOQA 2AJVL 1OAUL 4FULA 4KQ4H 1N5AA 2NTSP 3AUVA 4CN6A 3WXWL 2EUVA 2IFFL 4Y2DC 4EIGB 3IDMA 4NUGH 4WHDA 3ZO9A 4AQEA 5I73B 2APBA 4OZIE 5JOFB 4XCFH 4RGNE 1CVSC 1J9QA 4LNVA 4H13C 4GSRA 4QXUH 5HHXH 3MRRA 3ZKXB 2E4TA 3IYLW 1I75A 1TENA 2XXCB 3R06A 4OZHB 4XCCL 2EDOA 1QSFE 4LLDB 1CIUA 2WZPD 1GA2A 1T7XA 3MMEB 4JDEA 1LO2L 1O5PA 2FBJH 1ZCRA 4QTFA 5CJBA 4YFEA 4X8XA 3GZKA 1QSED 3VXSE 4MJIB 5E9AA 1N9PA 4MKTA 3T2LA 5BS0A 4PS4H 3MLSH 2D31A 1KYUA 2WLZA 3KJ4B 4N0YL 3AT9A 4FQXA 4X6CB 5GISH 3UYRL 2MCPH 5FO9B 2AJZB 1UOVA 4PRIA 2Z4QA 4N90D 5IIEA 1ZV2A 1XL6A 4LPXA 4GXFA 1A9VA 4YNYB 5AUMA 3R7QA 3GTVA 2ZCLL 5I8KL 1IIIA 4M61A 1PMYA 1WE5A 3ZTNL 3DETC 2FX7H 4AYID 5C0AE 1J8SA 5EG6C 2JJWA 3W56A 1LK3H 3W0WD 5AW8B 5IWLA 5F7BA 3A6BL 4U1IA 2WBXA 5F6HI 2AJXL 4UQEA 1FFQA 4XI5C 4JG0L 3V0EA 2BMKA 5D7SL 1MWAB 2OYMA 3FO2B 5EU3B 4V1DA 1CZ8H 2Z7UA 4PWHA 1DHKA 2OCCB 3BD4A 3MKKA 5EWIH 1FHGA 2EE0A 3NSXA 4W81A 2RALA 3QIWB 3TJPA 1JXKA 1NCWH 2YAMA 4EPSA 2IV8A 2FBRA 2FIKA 4XMPL 3R1GL 5LBSA 3RTQA 1JI1A 1U92A 2NRDA 3L5XL 4MAZA 4Z78A 3FS9A 3EYSL 1CK0L 4JG1L 3E9UA 5T33L 5CIPA 1RPUA 4PJFF 2XSKA 1IJ9A 1F3DH 1YMHB 1ZS8A 3IDGB 3P40A 4IIQA 1XAKA 4O5LL 4LRNH 2R2HA 3S8WA 3WJMB 5I0VA 5K9QI 3B83A 4P2OC 4TLUA 2HFTA 4NM8H 5E2JA 1IC5H 4V2CB 4A2HA 3ES6B 3K72A 4LSQH 4XH2B 4O00A 4XT1C 2HRPL 3MCKB 2C9SA 2O93L 1HINH 5I75C 1JBJA 2IANB 1SXZA 4G43A 1UJTA 1VB9A 4GT7A 1XD1A 3MV8E 4XN8A 1XGTB 2JWYA 3GI8L 3HG5A 5LGYA 4EIZC 2ZNWA 1XSKA 2YZ1A 1GRWA 2FECL 3TCLB 3T4YB 5SV4A 2H3KA 3VCLB 4NQCD 1GSMA 4D7BA 1XCXA 1KIPB 5CR1A 1ZT1B 1S46A 3AFLA 3NPZB 3KH3A 4L8BA 2X9WA 3CBRA 1TR7A 2Q7YB 2BY0A 3MC0A 3TZVC 4S1RL 1CMOA 4C4BA 3B9VA 3MRQA 3AU0A 5C0RH 1Y7VA 1JWUA 3DXAE 2IPTH 3S9DB 3WTWA 1S9YB 4MQ7A 4X7DC 4LVHC 2KBGA 2JXMB 4MB3A 2EC8A 2KPWA 4YLQT 1M7IA 2VDKB 3BD3A 4FNLH 4CADB 4HK3J 4XNQB 3SDXF 1NGXB 3NSFA 4P4KC 5MI0B 2IFGA 5I28A 3AUWB 1IAOA 5DEGB 4CVZA 4XCFL 5E70A 1ED3A 2VQ4A 3CXHJ 1HQRA 1DSFH 3CVBA 4EUPB 1CTNA 4JY4A 1YPZA 2GG1A 2ED7A 2D4DA 2O4EA 4P49A 5E8EB 4QCIA 1IGYA 1VLXA 2I7OA 4M7KL 4WFFD 4AOFA 3SGDH 5TQ0L 1A3LL 5SWSE 2FH8A 4H0HB 2VR3A 4FFYA 4L1LA 5ENWB 3C6LB 1SYSA 5FM4A 3STLA 3VTTA 2EADA 2YWYA 3JTBA 2I7SA 5EZIH 3A4DA 1HWGB 2OZ4L 1E4XH 3BMVA 3P11H 4JO4H 4FQQA 1A9EB 1EXGA 1AGCA 1FORL 3GPSA 3N1PC 2BCKA 3L48A 4XRCB 4EXPX 1E9PB 3F7YB 5KYNA 1RJCA 4XNZB 1WZLA 4Q9BA 3MRNA 1N59A 5A2JH 4X8GA 2MWCA 5MEPA 1VAHA 4L29A 2X4OB 2Y69B 3B9KC 1NCHA 5AD0B 2AK4D 3K2UL 4F7EA 1G6RH 3C5ZC 2A5UA 3BESR 3Q01A 5FECB 2QGCA 3IM1A 4LIQE 4QLRA 1IL1B 1U8LA 2HX8A 5F70A 3P4MA 5MHSE 4XP4L 5FHAH 1WBYB 1MFEH 2QADC 4FNSA 1SN5A 2ZSWB 1H0DB 5I16B 5HHQA 1M9WA 1EBPA 3BN9C 2MQGA 4OF3A 3R06B 5F3FA 3WNIA 1KLFB 3QJVB 3LSOB 4WO4A 1JZIA 2ZUYA 3VRIB 4E0RB 3L3IA 2VLKA 5ISZA 2J7LA 3GSRA 4MDJB 1GZQB 1Q0YL 3IGUA 1EEZB 2X9XA 1QUNB 4Q6YA 2XCMC 5B39G 2N7BA 4WWNA 4HC1H 4F9LC 1FHNA 2O5XL 4FA6A 3HEIB 1T89C 1UH3A 3ZW3A 3KM1A 5B4MD 4PJGB 4WV1B 3PXHA 2VRKA 4YNYA 1QSZA 4NCDA 5AUMB 4BCZA 4M7ZB 2XJKA 5ALCH 5JORB 3A0OA 2ODIA 4HD9A 4JRLA 5IROC 4AGMA 2BC4B 4YIQA 2EIBA 1AXIB 3P3SA 1SLXA 2VERN 3CZSA 4JDTH 4HS6A 1OZTG 2R59A 3RVWD 3TBWA 3V0GA 1DN0B 3TVMB 1BJMA 3R0MA 1B6UA 4M43H 5MP6H 2BERA 2GJJA 1QSEA 5EC1A 3GTNA 3ECQA 3IDYB 2MNUA 4BFIA 1H19A 2BSBA 4YWGL 4O2EA 4ANWA 1JPTL 1J5HA 1U8CB 4G8GE 5EBMB 1L9OA 1LO0L 4KKZA 2RH0A 3F01A 1BD2B 3HBZA 3RY4A 1RIHL 3Q1SL 4O51B 1R3KB 3GI9L 3A22A 3NIDE 4Y5XB 4A04A 2QEJA 2ITCB 3LKPB 2GHZA 3GSOA 3WEXB 2GY7B 4PJ7A 4XCEA 1ZLUK 1LMIA 2YJLA 1DSWA 4DEUA 2NY0B 4U1SA 3K5SA 2ATAA 1KIPA 2WWMC 2I5YL 5AW2B 4GG6E 4IIQB 4D9QE 1KG0B 4Z7VF 2ZOUA 1E9QB 4ELMF 4NHCL 3WU1A 1HU8A 3RZCC 2P8LA 3ROLB 2XV2A 3CLWA 1DQTA 1WWWX 2VR5A 4PGCB 5I1JL 1PZSA 3B34A 1CTOA 3HMXA 4HS3B 5IUSA 4MXVF 5IVXB 4I18B 1FG2A 3G6JA 5BXFB 2ADGB 1BXUA 3WNPA 3UZEA 4APXB 1ETZB 4KITB 1E3ZA 4WI3A 3PDOB 4XP5L 1TTBA 2WVSA 5ICXB 4AG4L 3QK0A 3ZIYA 4JZJA 3L6FA 1VERA 3PY9A 5FKAA 2QVIA 3RDTA 3NIGE 1MH5A 2GI7A 5EORL 4GQQA 3IFLL 3BUQA 3EH4B 3VX1A 3HI5H 3BGMB 5FDYA 1I7ZB 3U6XA 4YOKA 2FD6H 3LN9A 4CC4A 5LWYL 3BZ4A 3QQ4B 2VZ1A 1KCVH 4PCKA 2HWZL 4GG8B 4AQEB 1GGBL 4G6MH 3UTSB 3AM8C 3BRDA 1MHPH 5E51A 1XVSA 2KI6A 4YZFF 4Z7IA 3WLWC 1HEHC 1Q9OA 4MB4A 3HUJE 4Z76B 3RAJH 5DXWA 1DQML 4JJ5B 3M17A 1IFHH 4HIQA 3OGCB 2JF1A 2FZ3B 1VRSA 5DZAA 3UJIH 2QPFA 2CD0A 4Q9QL 3DX9B 3HS0B 1BD2E 4FTVD 1ZA6A 3GMLB 5ESQB 2DRUA 4ZPVB 1ZJAA 2PP9A 1QD0A 2DMGA 1QFPA 1GYUA 3KEDA 3M07A 1TTRA 5F9AC 1OVZA 3CFIC 1E90A 3MCLH 1HHHB 1FFNB 2Q3XA 1U8JA 3QH3A 4FXGC 1IM9B 3C87A 4HZAA 3V4VA 2X1PA 4QCIB 3RKDC 1KPRA 1RJYA 1T4WA 4L4TA 3BCDA 5JHLL 1B0RB 3FFCE 4G5ZH 4KJQD 5HJDA 5FW8A 4G59C 1SYSB 4MNQD 4F7CA 5KG9B 1ZGLM 5FX3A 1S7UA 1NKRA 4LASL 4FX5A 4YPJA 2NLJA 1KYOK 1XSJA 3JV5A 1J9TA 3QUMA 1T0PB 2WZPA 4IBSA 1WIOA 2Y3AA 4EO5A 4PCYA 4JVPA 2EDNA 1YY9C 3SDDB 1YDPB 2VZOA 2YRZA 3HVNA 4Y19E 3H3BC 3NP3A 5L2JB 1X9UA 1OHZA 1I3VA 5CEYA 3HBPA 1XH0A 3LJ3A 4NI3A 2FJSA 3L3IB 4D9RE 4U3XA 3HA0A 1NMCB 3L4CA 1IGMH 2X4NA 1JRHI 2VO5A 3S34L 2Q86B 3L54A 1D7CA 5KVFL 2KKQA 3BUPA 2EE3A 5AOJA 1G9ML 2SEBB 3Q5TA 4KVPA 2QHRL 4PWEA 4HF5H 5JIIA 4XMLH 2BOCB 5LB1A 5I8CA 4PJGA 4WV1A 1NEZB 1KMGA 5DEFB 1MCPL 5KBNC 1ETA1 4K71C 2WLYA 1LK2A 4NLAA 4DK3A 4W9FC 1BFOB 4HUVB 4EN3A 1JPST 1MFMA 3WEOA 1T83C 3FQ1A 3LKRB 4HIXL 1MWAA 1H8NA 3PGDA 2B9AA 4AC4A 3GSUA 5ISZB 3GB7A 4MNQE 3HE6D 3V0VA 5G5DB 4TSCL 1UEYA 1P4BL 3HC2A 4LVNC 4KGLA 1U8CA 4BUHA 4PB9H 4WUUA 4UNIA 4GMSL 3EO0A 1IARB 2CK2A 4XMVA 3W2DH 2Y06H 2WXFA 1WZKA 1P5UC 4F8QA 4IGBA 1U91A 2AQRA 4JY5H 2XVLA 2FECI 3EBAA 3WJMA 3LV3B 4L4TD 4YIQB 4OIBA 1JV2A 3UC0L 1KBGH 1T6WA 5HDWA 5TF1H 1UACL 3QWRA 1MN4A 5IFAL 1P1ZB 2BIQA 3G9AB 2YKLL 4XC1H 2GK0B 1J9SA 1SXNA 2WINB 3MA7A 4NO2B 2WQAA 1SYVA 2ICES 4X9FA 5AEAA 2EUXA 2E0PA 3HZYA 3WN5B 1T1XA 4KDTC 1R47A 1X5XA 1IM3B 4X4ZA 1R3JA 5BQDA 3SY6A 5J9PA 5J7CC 1MFVA 5EEWA 3VFTB 2DI9A 1N6QL 1NGXA 2JELH 2E56A 1D2OA 2VERA 3D39D 1Q1PA 1F1DA 3UZQA 4F3FB 3HS8A 2FEDC 3L3OA 5ICXA 4Z8FL 4B53A 4BFKA 1RK0B 2E7BA 4EZMA 4R5VA 1PLAA 3SDCD 1R3HA 3LMJH 4NZFA 4XPHL 5FGBA 3RZCD 4QRSA 4B3EA 2QBWA 4XNAA 4AM0A 2B20A 1D5ZA 5IHLB 1JWUB 1C9SA 1MRDH 1U95B 1I7UA 5E03A 3BZ4B 2H6UA 4IBZA 1ZRUA 2YUVA 5EN2B 4S1DD 1MPAL 1UM4H 2NYKA 1HC1A 1H6EA 2VLRD 4R7DA 4OKDA 1J87A 3MLWL 5I19L 2OZNA 4X4ME 2FGZA 1HVXA 3BIKA 3K91A 5CLWA 1UOKA 4D9QD 2FZ3A 4H8WH 4ZUSA 1FYTA 3CIQA 2QR0A 3N3EA 3MRNB 3NG5A 2A4ZA 3FUIA 5AAMA 2CRYA 1BJ1J 2DQIH 2PWHA 4DGIL 1RUKL 2VDPB 4XX1G 1NOAA 2WP3O 3TPUA 4HZ1A 4NENA 3NFSH 2CO7B 3UTOA 2OTWA 2R7EB 1MCCA 1IT9H 2DLFL 5SWZD 4G8GD 3KAAA 1EK3A 1NL0L 1KJ2H 2YAPA 2PW2A 1WC7B 3CUPB 3VFPB 5BOZG 3ASNB 3Q48A 4DK6A 3KPMB 3JWOC 5IW6B 2YN5A 2C1PA 2XBTA 1JXJA 3D0AA 5ITBH 3LDBC 1JZFA 4PREA 3W39B 3SODB 1UWXK 1EX0A 3QHZH 4BKLB 1DVFB 1E6JL 4PH8A 4OQ1A 2FWUA 5EO1A 5KSAD 4EAEA 5MEPB 2NUPB 1FPTL 5ID1A 4IRSC 3G04A 5K93A 4I1RA 1UA6H 4NKMA 2MTAA 5FKPA 2VWEC 1D5BA 1GY1A 4A2EA 2VLRE 2V3DA 1IM9A 3EKCA 3L4UA 1G9MC 2ZXCA 1T0NA 1SJMA 7CGTA 3U4BH 4YSPA 3NPSC 1SJEA 1Z5LB 1KF9B 4BIKA 1GYVA 2Z35B 3D4CA 1A7RH 5KOVC 1VZGA 4M62L 4PP2A 3GJEA 2IH8A 3RY5A 5HHQB 3GS7A 4F8PA 3SGEH 3E0GA 4QYAA 3ZRFC 2GTZB 3QUMB 2PCPB 3DGCR 4KV5E 4W9JC 1M7XA 5HGAB 4DVRH 4GFTB 1MJ7H 4QT5B 5HHOB 2C3WA 4D0BB 2N0MA 1UA6L 5IMLA 3BRGC 5E1AA 3MACH 4FXTA 2A74A 2I69A 4L1DA 4U3CA 4HUVA 1TEYA 3D39E 4BFIB 4PRDB 3VGDA 1QUNA 2NUTA 5EU4B 4JFDD 3N55A 4R97C 4DPRA 3W82A 1P4UA 3KS0H 2FX9H 3WGUB 5H35B 1A4BA 1SUHA 4NPYA 1JGUH 3RWJB 5GQBA 3VSVA 1GIGL 1KCRH 5AZ2L 4XXCC 1HK6A 1AO7D 1QWNA 2DQDH 2W5PA 2DLFH 4MRCA 5I71B 3LS5H 2WUBL 4E68A 3NIDB 3VWJD 4RX4D 1A0QH 2UUDK 4ZRGA 3PE9A 5E6IB 4L4TE 1LEKB 4E5XA 4HEMA 4Y16A 2R29L 3HE6A 4BKTC 4KDTA 4J8RB 1BZ9A 3L3DB 1DBAL 2VTFA 4L3EB 1EXUB 3AG3B 1OW0C 3ZT7A 3NCFB 4H8WL 1F0LA 4TF4A 3MLWH 4BZ2A 2K9FB 4FGMA 4P2QE 5JMOC 2LLLA 4ZMOA 2Y2TA 5C9JA 4WWOA 4M8QA 3T8XB 1R3JB 3MNDA 1G4MA 1HT6A 5EB9A 3X11A 2CGRH 3JWDL 4DCQA 3IPFA 3EGDB 1F56A 4M93C 1KN2L 1BZ7A 3L4TA 3O4OC 3S37H 1UFGA 3PWPD 2A6DB 3G5YA 2JKSA 3VWJB 4G3YL 4ELKB 5TE7H 5D1XE 5FOJA 3L3KA 5GRJH 5E2TH 3TZVD 2N1KA 2H9GA 5HYSB 1JYWA 3I75B 1BM7A 1PDKA 3ZOAA 4M3HA 5IESL 3VFMA 1TQCC 4G6AD 4NJ9H 4KOBA 2NT0A 4NN6B 5JUEL 3DMMD 4HGWB 3ARBC 2VR6A 3BP5A 3ESVF 3NYKA 2ZX7A 5I5RA 4MFHA 1E27A 4UT6L 4M8UA 4APQA 4N1CA 1QACA 4J6RH 3WSQL 4YXHH 4RVBA 5ALBH 3V5KB 1CB4A 1AKJD 3QUKA 2WTRA 1YYLH 2YKLH 4XC1L 4KI5F 2DQTL 5I8KH 1A6VH 1OAXH 1VENA 3I50L 1IFRA 1X5MA 2WPGA 4PJAE 1NUGA 4BZYA 1KBGL 2PPAA 4FQIH 1I7ZA 1VGKB 4L4VA 1JS4A 2APXA 1HNFA 2GTQA 2O5ZL 4JY5L 5LGHL 1WFIA 1T1YA 4YK4B 3UYRH 4N0YH 1QR1B 1IKFL 3HFML 4L8DB 4ZX6A 2L7EA 2W8CA 2IXQB 3GLAA 3HZVB 4BK5C 3FTGA 1KEGL 1EANA 5TFSH 1BVLB 2R4SL 3HG0A 2J5LC 2PR4L 3KJ6H 4HQQH 4UTCA 3GUTB 1AZUA 4O58H 3VI3A 3BEWA 1I8IB 1GZPB 1PKQA 3K4DA 1BFVH 3BC9A 1IGJA 3ZKQD 1ITCA 2GUYA 5IJVA 1L3WA 1SNRA 4FTVE 1BIIB 5BMFL 2B3RA 4XPAL 4KNQA 5E8DH 4GSQA 1M7UA 2TRHA 3MJ7B 4UT9L 4N8VA 1KPRB 4LCYB 4HS8H 3CFEA 3WJLC 1Z5HA 2B14A 4HLEA 1II4E 3DHPA 3WO4C 4OY9A 1KWKA 1AKJA 4X50A 2WD0A 1LTXA 5EU5B 5KSUA 2QQNH 1MEXL 5E6UB 5HYJB 3OKDB 5EZJB 5I6PA 3UAFA 3O81A 4F7PB 2R8SH 2NY3C 4OD3H 4MAUH 1HAWA 1ASPA 2BNUB 3EJSA 2WXRA 2NQCA 4JM2A 2PWEA 4KRLB 1BIHA 2X6CA 1FIEA 4PP2B 4XX5A 3US9A 5J6HB 2X3BA 3RB7A 3G5ZA 4OTXL 4DPAX 3AG4B 3ESUF 3L17A 2PCPA 4PIRF 5CFAA 2KHAA 4KROB 5DFVC 5IROA 3LD8B 1XF3B 2X4RA 4K2UH 5I1AA 2DL2A 2OXGB 2JKRM 3DSNB 4P99A 4OM1L 2LABA 3RWDB 1D9KA 1KY6A 5FKPB 1DE4B 3RNKA 3LEXB 1AGFA 1KJMA 5F9DC 3ATEA 2VXQL 4ZI8A 5GS2H 1BVKB 1H3UA 4HSAC 4KY2A 4ZODA 3VXSD 3QR0A 1Z5LA 4PGJA 2FHBA 2D7OA 3OLEA 4P5MB 5EFIA 3RZCB 5DEFA 3WCYA 2BP8B 4WWKA 2HCZX 4OUUA 1IGCH 5ILTL 1DDHB 3C08H 4AL8L 1M71A 2BNRB 2K4WA 3SSGA 5D5MA 1QO3B 2KERA 1JPGB 4ABUA 3CFNA 2A74B 3WFHA 4H8WC 4Q9QH 4G80B 5ABDE 2DMBA 4MZRA 4AQ8C 3UG4A 3HKZA 2ZOLB 4Z7OE 5TJWK 3QRLA 3KYOB 4X4XA 4X5LA 4F5CA 5IBLC 2BSTA 4UNUA 5DVLA 5H4ZA 3DDGA 4JE0A 3I9GL 2K45A 3VXSA 1FVCA 4X8JB 4V1DD 4WK2B 3TIDB 4CA4A 5J12B 4R4BA 2C9UA 3K74B 3CFCH 4MHHG 4EIBA 2X28A 3OHXA 2AJUH 4FQPA 2CZNA 4HWZB 5CXPA 4ODXA 3DBSA 1RVFL 3LZRA 1W0WA 4GRMB 4P59H 4XZ4A 4MD5A 4NC1C 2W9DH 4HIHB 2VDOB 3KPRA 3A4FA 5K9QG 2IDQA 1DQQA 3H3PH 1IQWL 2AW2A 3U4EA 3DMMC 3ES6A 1CFMA 3VFSA 5IROD 4XP5H 1IM3A 2AEQH 5K39B 4A7VA 1WAEA 5BUPA 1G9HA 3T0WA 2JJVA 5GGQH 3E8UH 5GS1B 3W57A 4HHAA 4PRHA 1M1XB 2OYKA 4G7QB 1SM3L 3BDYL 3V5DA 3SBPA 1BP3B 4Y89A 5CLZA 4XAWH 3A5VA 5ANME 5B1KA 5FK9A 1S7SA 2LV4A 4IMKA 1J10A 1OSEA 1BZ7B 4XZUA 4J5VA 1YEGL 4TXVB 3QFDA 2YSSB 3CHPA 5IB5A 3G5YB 2YUWA 4M1DL 1FO0H 3HCVA 3ABKB 3OMAB 5AVUB 2Y2YA 3W5NA 3CVHA 2APSA 2HLFC 5JHDD 1E4WL 2CDGA 4LKCB 1EGJH 5MHSD 4PJ9D 1H3PL 2ADIB 4OZFB 4NC2B 2DBLL 2KYIA 2BLFA 2QVMA 3BAEH 3VXQA 3QS2A 5JOFA 2OSYA 3C6LC 2IV9A 3WE6B 4GXUN 4BKLA 4WKZB 1KXVC 2VZ3A 2H41A 3OB0K 3GMOB 1S7WA 2CPCA 2NNFA 2WNXA 1AIFB 3HE7B 5E1HB 4PSPA 3CSGA 4NOFA 2BINA 3OPZH 3L3GB 4GRLB 1NBCA 3W37A 5J3HC 2QGBA 5E56A 5CZXC 2HX7A 1FGVL 1IC1A 3LHAA 2V37A 3WD5H 5B38B 5IB3A 4HFUH 1ED3B 4JZOB 3N06B 4NENB 4U1JB 2ID5A 4LO9A 3S48A 2ZE0A 1B4TA 2OJEB 3SQOH 5FFLA 2PW2B 3OZ9L 3VFPA 4POZC 4N1EA 4DZBA 3OAZH 2VW7A 4A7QA 5GS3A 5HY9A 5DMKB 1MG2C 2F7IA 2YPLA 3V9EA 4PJ5A 2NPLX 5DFWH 5A2IH 4XE5B 3APFA 2IIJA 2HKHL 1DJHA 3KPLB 2O30A 4OQTH 1MRCH 5CCHE 4W93A 2DWDB 2QQKH 4D0BA 4FQQB 4NZUH 3PL6C 3VXOA 3EO1A 2IAND 4GQPH 4Y1TA 2NZ1A 2RBLA 3FN3A 5F1KC 5SX5H 1RZIB 2LGNA 4ODTH 3S97C 4KTEH 3HC3H 2D31B 2OXGA 3DSNA 2EIZB 4Y2DB 2AANA 5DYFA 1T0NB 4GP5B 1RP9A 3QWQB 4F7EB 5F6IB 1LO5A 1I1AA 4LDCA 3DIDA 4DKAA 2F19H 1U36A 1QBLH 2XRAH 3HRZB 5DJDA 3DXAD 2WM0A 1UXSB 3T0EB 4LCCA 5G4OA 3K2MC 3OZLA 2K6ZA 3KE0A 4FZ8L 1UM6H 2BNUA 4IDLA 4WENB 4YDKL 1Z3GH 4XTRD 1N64H 1YMHA 2GUOA 4U6YA 1J0JA 1FGVH 1VDGA 5CSBA 2FIRT 2XXGA 2APVA 1MFBH 4CJ0A 3I3DA 5A3IC 2DMCA 3LN4B 3QNXA 2ARJB 1EXUA 3VRIA 3SE9L 1EAPB 1JPGA 4H20L 3TVMC 4QOKA 1E9OA 1F6LL 3EYFB 3NSYA 4O9HH 4X6DE 3IGLA 1KTCA 1ACYL 5E7BA 1HQ4A 1UT2A 3BXNA 5ANMA 1G4RA 3FT2A 1MWAH 1U8IA 2V2WB 3NEXA 2WLIB 3TTYA 2XQBH 3HJEA 3WGVB 1MLBA 4HCFA 5EZIL 5TE6L 3RA7H 3R4RA 3FQTB 1NMBL 3F7PC 3L45A 5FYKL 1QBML 5C08B 3QRGH 2R1YA 4HGKC 2YC1A 4U6VH 1FVCB 4OU3A 3C6LD 5JQHC 3MUY1 4LP5A 1F4XH 2HLEB 4GB9A 1NOLA 1QA9A 2VH5H 3U0PA 2DIEA 1TQVA 2UX6A 1G0XA 3ARQA 1CS6A 4FG0A 4Y2OB 4XMUA 1RIUH 2GITA 2PR4H 1NANI 2ZYRA 4DO4A 2Y0SA 4K94C 5I2IB 4FNLL 2LR4A 2YAFA 4N8VG 3CSPA 3KPSD 5IBTL 2YN3A 2D3LA 2NCMA 1Q0EA 2ZYSA 4HEPG 5ECJE 1YJDH 2ICEC 1FJ1B 3AY2A 4MS8C 4I89A 5IB2B 5DEGA 2F58H 3A24A 3GLZA 1KNOA 5I15L 3K2IA 3VGEA 4LHUD 2J12B 3CFCL 3N42B 4IBTA 5DA4A 5ERWB 3W0WE 4HKJA 3NACL 3X12B 1YPZB 3ZDXF 3ARGC 1TZGL 3QFDB 2X89A 5AALA 1LWJA 4YMPA 1AIZA 3GT6A 4HKBB 4JAMB 4OFQA 4P46C 3V79C 4J3VA 4J3OC 4YSAA 4P0DA 1DEEA 3INUL 4BFFA 1BZ8A 1NPUA 4QUOA 1KXVA 2A38A 1SHXA 4UM8B 4XNYH 5DEJA 2FR4B 4HJJH 1WIPA 2YBRA 4DKDC 4FG2A 1YECL 4JFUA 1FG2B 1V10A 4OFPA 2WTRB 4PJDB 4M5ZL 5AAPA 1QSEE 1GZPA 1PKQB 1M05A 5IESH 4FD0A 2R15A 1AD0A 1ZLSH 2BPBA 3D69B 3OAYK 3BSZL 4YX2H 1U58B 4F7TB 4H1LH 1QSFD 4NM8L 2CR3A 4Z9KB 3L3GA 3U2SB 4XP1H 5LVEA 5IB5B 3H4HA 1ZTXE 4I4WB 1SFDA 1KYFA 1TQWA 3NCJH 3ZUCA 3CVHB 2Y23A 3R1GH 4PWJA 2PYEE 2GJ6E 1A3RH 2GJPA 2IBBA 4IDJH 2F9BT 4OZIA 5F21B 2W9EH 1MCHA 3O6KH 4P4RA 3CPLB 3FCTA 5FXCH 1SLWA 1P1VA 4HUXA 2AABH 3T2NL 4OM1H 4Y0GA 5F44A 5J6HA 5C6TH 1AQKH 1EAQA 4XXDB 4HWEH 4QJ5B 2OK0H 1NLDL 3TU6A 2XWBB 2ZOOA 3SKMB 5C0JA 5I1CH 2ZYIA 2H4EA 5F7DA 1DFXA 4KUZH 4JO1H 5D2LB 4AE1A 1JWSA 2P45B 3L3HB 4N6RB 3F00A 4MAYB 3LPFA 2BFGA 2YIHA 4CILA 2FLRT 5SWQB 3HG1D 3QBTB 3KBEA 5D7IE 1Q94B 3A6CL 3WNLA 1NFIB 2ATPB 1ZS2A 3L5WB 4PJ5D 2L04A 2ZG2A 2ZCLH 3OKDA 3U0WH 2O61B 1QKZL 1S7QB 3K8MA 1GIGH 3ZDZF 2WNWA 5A2FA 3GEWB 4PJBF 4NKDB 3BN9D 2V0AA 3MBEB 4PLNC 5T1JA 4Z23A 2HFEA 2UY6A 3C12A 1KGJA 3WENA 1SEQH 3GIZH 2F8VA 2FJGA 3CXFA 4N9OB 6PAZA 2XWDA 4KDVA 5HHPB 2F1EA 4G9DA 4Q8BA 2ALWA 1D7DA 4Y7OC 1BFVL 2VLKB 3EO1B 1QSEB 4RDQF 4HISA 4FHBD 3ARZA 2XU9A 2K4AA 1A7NH 1N2RB 1VPOL 4WEEA 1RJLA 4QAMB 3RNKB 1A1MA 1KEGH 1DJZA 2DJ4A 1BZEA 5FCSH 1ZIBA 2AQNA 4NQEB 1JNNL 4WI0B 5FYKU 3MCG1 4WRLA 3T1FB 4IGBD 2P8PA 3P3YA 3U4BL 3WEXA 2IFFH 4TNVF 5LGHH 5C3IA 2BP5M 2BP8A 2NQDA 4WWKB 1RZ8B 2WN3A 4WUUD 3TL5A 4I8DA 4HD5A 3D9AH 5D1QB 3RDTD 1OAXL 2AQSA 4Z7QB 3SYCA 1NDMB 2KLTA 3ZHNA 3UZVB 3GBNH 4UB0H 1YYLL 3L1OH 3NZHH 3DJ9A 2G2RB 3P0VH 1MCEA 4IKNA 1XBDA 3HZ3A 2EDYA 4Y1AE 4W9DC 2K6YA 4HMDA 3VWKC 3V55A 1VFMA 4WI9A 4FTVB 4N5UA 4KK5D 3RGVC 1TNMA 1KB5A 2VM3A 1E28A 1T2XA 4XCNA 4DGVH 2X0WA 1WBXB 1U0QA 4NO3B 4F8NA 1NBVL 4CAGA 2IAMA 4KFZC 3WUZA 5CJ8A 1EPFA 1CD1A 3OJVC 5FKAB 3WUWG 3L1GA 4AIZB 3OWEA 3BDXA 3TNNA 1FE8H 1U91B 4ACTA 4DGIH 2FHFA 4ZJ9A 5KSVB 1KIRB 2WV3A 5DURB 1F1AA 4PGDB 5TK2A 3KLAB 2F1AA 2VQTA 1A14H 3QXAA 5CILH 5D71H 3PWNB 4ZD3H 2XT1B 3FH5A 1T03L 4XODA 4YBQD 3WHE0 4G6AC 4HS3A 2VDOH 5K9KB 1MCRA 2W1NA 4JFYB 4WJ5B 3MGTA 5DRWA 2Y7SA 3WXVH 4BK5A 2BP3A 3TTSA 4LIQH 1GZHA 3VGFA 4MS8D 2TAAA 3LRSA 4F7MA 1DBML 3L3JB 1M6OA 4MNQA 2R29H 1NEUA 1EZSA 1J1XH 2QSQA 1MH5B 1AD0B 2XN2A 2W60A 1XL4A 1W8NA 2CLVA 4GSXA 5FCUH 2Y7QB 5CLXA 5D70H 2YAOA 3HUJF 1R3HB 1A65A 3LMJL 4ANVA 1HXYA 1C16A 2WUBH 4AENA 4FQHB 4DESA 1UURA 1XGRA 2J4WL 4OF5A 3SE8H 1ZV9A 1JPSL 3O9WC 2F8OA 3F65A 3LQAL 1IGTB 5L4FA 3VD9A 3U0TB 5H8DA 3FT4A 1DEEB 1E50A 1CFSA 3GJFH 2OW6A 4YHZH 1DQLH 2GSGB 3IDYC 2R1WA 3BI9X 5DMGD 7PCYA 3F7LA 4NBXB 5H37A 4LK4A 3MR9A 3MRPB 1RUMH 4RGMC 3BIKB 3T2OA 4G82A 3O0LA 3FSWA 2J6EA 1AY1L 3BKCH 5C0CE 2JCWA 1RZIA 4ELME 4TNVK 1L9NA 2W94A 3QIUB 2NY0C 1OGPA 1FSKB 3SGKA 2SEBA 1T3FB 5A6LA 4LQFH 1CCZA 2DLEA 3VVWA 5D6CA 5E0QA 2H0JA 1GS7A 5H4YA 3DETD 4P4RB 4A68A 5I8CB 5JHDA 4GUCA 2HVJA 1CJYA 4WW2F 3IKKA 3QZBA 1GYCA 3PS6A 1WAAF 3VFVA 1U9KA 5GJTL 5L2JA 4HIXH 3QGVA 2ARJA 3UMNA 2ZKYA 3L9RA 3BUDA 5JPNB 1TG8A 1EAPA 3GB7B 3V0VB 1T4KB 5ITBL 4MAYA 3GJFA 3RURA 3CFTA 1N7ML 1HQ4B 3FT0A 1YUKB 4YDVA 3BT0A 4EKXA 1A6WH 1K6QH 3EJCA 4KPHL 4HXBL 4NQTA 5A2KH 2VL5A 3VD3A 3U0WL 1JXGA 3GSVB 4P5TD 5C3LD 4LHQB 3DLQR 2NY6C 3NJMA 1WEJL 1MDTA 3WKML 2CLZA 3INOA 1NEZA 3CQPA 1KGCD 4OVVA 5HVWA 4ORGB 1VZIA 3FCUB 3RDTC 4Y88A 3II3A 3PNWB 3KPOB 5AYUH 3TA3A 3QJOA 3BPOB 4YXLH 5FB8B 5I1CL 2MRYA 2R1XB 4CDHA 3CX2A 2C26A 4GP8B 4LDLB 2ZIDA 5IMLB 5E5MB 4P5SA 4A39A 3H55A 2WJ7A 5D1QD 4RRPA 4KXAA 2J8OA 4QNPE 5FDWA 1YEDA 2YD9A 3AU1B 3IJEB 3BXNB 4PRDA 1BM3L 3M1OA 3DMMA 1MREL 1OLZA 2EIMB 3PFUA 2AXGB 4TVPH 3FQTA 4XVJL 1L4IA 3W81A 3L3OB 2ZXWB 3HNSH 3L08A 2A7BA 2VKWA 3S37X 2EDTA 3TZVA 4GQ9L 1R3IH 4IW4C 3TN0D 2BZCA 4NX0A 4XPHH 4M93B 3BPCB 3EYQD 1L6PA 3TA3D 2ZICA 5A2LH 5GZNC 5SWZB 2R2EA 2MPVA 1U8OA 2DS4A 2AJSH 3EUDA 5DSCB 2JK5A 1ID2A 1P6FA 4F15B 1QLFA 3FOLB 3W0WB 4B9PA 3BHBA 5KVGH 1DBJH 1HKLH 3RVXC 2X6AA 3V5HA 4FQLH 4UM8A 4HJJL 5J9PB 2IPKA 4FN0A 1QHPA 4LEOA 2A6KA 4TNFA 3OR7B 4YHMH 4Q2ZB 3IGKA 2I26N 3R0NA 1FH2A 4PYHA 2J6EH 3POCA 2DMKA 5GZOD 3MBWA 4G6ML 1DO5A 2O5YH 1KCVL 6TAAA 4H0GA 5C6PB 2OXHB 3GBDA 3BT2L 3QCVL 2BNQE 1AS6A 4DO6A 3T2QA 2ITEA 4E42B 1J9CT 2IBZX 1HHKB 4P3DB 4G71B 3VWJA 1XGYH 1FLRH 2Z4TA 2ZWLT 3CFKB 2XTJB 4JKKA 4YGAB 5B1BB 3QDGB 2Z8WC 1CI3M 1DLFH 2H8PB 2OTWB 2R7EA 4HJUA 2WIIB 4OF0A 4PJHF 1FL5B 2ICWI 1MCWW 3K80A 2PN5A 1WFMA 3P69A 1ZWIB 3AS3A 2PTTA 4GOSA 4HUUA 2FR4A 4U0QB 5IW6A 3FTZA 1BF5A 2NCEA 5DMGC 4JFYA 3NRQA 4KKLC 3DRQA 5KS9F 3PP3H 5K9JL 1OAKL 1T20B 3MRBA 3CV5A 4B95C 4CVWA 4ZUSB 1FYTB 4OJYA 3ZPDA 1XH2A 2JKWA 3LIZH 3CC1A 3V6OA 4L5FL 4QRQA 4IRZA 4JPWH 4WHYG 2W60B 3SJVA 4K9EL 1A9BB 2NNAB 2XVBA 4ORZC 1JV5A 4JG9A 4OV5B 4E9QA 4BE5A 4S10A 4WDIA 1QI4A 4OZHF 2OS7A 3QP3A 1OPOA 4HJ1A 4X6FA 3G6DH 1J1OH 5IMOB 3E80A 4Z7NE 2LU4A 4YAQB 2CU9A 3WIHL 5I6MA 3KPPA 2IWFA 3ARRA 5IEHB 1I1FB 3L4YA 2BVOA 1MWOA 3FT4B 3QUML 3UPAA 4CW1B 4MQXC 4O9HL 1ZTMA 3MROB 3S3DB 2JTYA 1OQOA 1BVOA 4OD1H 3OWRA 1DP0A 4LCCC 2NY3B 1UZ6E 3WUWB 1OD9A 4ZX3A 5IK3B 1MVUB 4IU3B 4KOCA 1G5AA 1Z2KA 1CLCA 1A1OB 1V3MA 4F9LA 1ZXKA 2X41A 3T0BA 1ZOXA 4X99A 5K5YA 1TZHB 2MQ3A 4RMUA 4QRTA 1ES0B 2FJFA 1QBLL 2XRAL 1S7QA 4OF8A 4YDLC 3GSQB 1PAZA 5FWRA 2Z35A 5BO0D 3D06A 3EF7A 2H47C 5EIIB 5I76B 2H0PA 4FXKB 3EF4A 2HPOA 4HC1L 3WS6C 1YEFH 4H44C 4UU9B 4PJFA 4F7PA 2IPUG 1PU0A 1VFBB 3GHEL 2ZZUT 2BIHA 5ACLA 4ORGA 3MCLL 4RGOL 4LLQA 5C0BA 3WELA 1P7QA 3ULVF 4W4NA 1IGFL 2OMNA 3P0GB 4LSPH 3V6FA 2W0KA 3VFGH 4X7EC 4R0LC 4WW2C 1T7YA 3OAUL 3KLHD 1PY4A 4J4PC 4B9YA 2GHWB 2DB8A 2VC2L 3ECUA 3ZZSA 3ASOB 1THAA 5CD3A 1KV3A 4FFVC 2EO1A 2DQJL 1NTDA 4OLZL 2RCSH 2VDKH 4WKXA 5IGXH 1HDMB 2VL5B 4HIEA 2O6EA 2QMJA 4N8UA 3ATAA 1DEDA 4GKZA 3H2WA 3NAAL 2Y6SD 1OM3H 5AAMC 3J27A 4AK1A 2A6DA 1VZHA 1WS7A 4XB7A 1C8QA 3QZMA 3UJJL 2PPDA 4FLOA 5EFIB 5I1LA 3RZCA 3F6IA 5FGCE 5KSVA 2HXAA 3BAWA 5I74B 3B1UA 5DZ9A 4A2MA 1BZ9B 1KCUL 3L3DA 1JE6A 5D7JA 4NC1E 3L5IA 3PWNA 3ARGA 3K72B 1KWGA 1UH4A 4KO5A 2WB7A 3IE9A 2OSLA 5I66B 4NO0A 5D72L 3BHBB 5EH1A 1ZEAH 5TTRA 4BD4A 1WHOA 1XSIA 4ZFOL 3RVVC 1TO4A 3MV9E 1U3HD 3ISRA 1Z1WA 5FPIA 5KVDH 4W9IC 2AQ1A 1MDAA 3G6AB 2IAMB 5AOLA 1NICA 2C9AA 4HIPA 3HB3D 2DYRB 4NHCH 4PB0L 4KV5F 3UAJC 2OXHA 4ZTOH 1QFWM 1MFAH 4JW3A 4FC3E 4OZGF 1DSFL 1XSOA 3BUTA 2B1AL 4G72B 4OGQC 4PJFE 3ZTJG 4PG9A 5CEZL 3ULUE 1S3KH 1UT1A 4TL4A 5I1GH 1W0WB 1HESA 2E27L 1I9RH 1EXHA 3VFMB 2CKBH 2IO5A 2JCCA 3ZTJH 3GGWA 3N85H 1TMQA 4U1HA 2ENSA 2JXMA 4UBDD 3LKNA 3BWZA 4AYFA 4LNRB 2PXYD 3N43F 3MRLB 3H53A 4X6DA 4Z7WE 2O6PA 4F93B 3U4KA 4PRHB 5AKSA 1M6OB 2IPTL 1JZ6A 1AZNA 1W0YT 2DPKA 1LP9A 4LBEB 2YXVA 3MJGX 2ESVB 4N5ED 4RWYH 4S1QL 2NXZD 5K33A 5LBSL 3WJJA 3TEUA 1A8ZA 5JIMA 4GG6F 2XN9B 4X80L 3SJVB 4RFOL 1S7VB 1W80A 3UTQA 5C2BL 2DWEB 1WK0A 4L8DA 2EXWC 3LQAC 2COVD 5IMOA 4Q74A 2P5WD 5IR1A 3D6GA 5DD1H 2FRGP 4JM2B 1NDGB 1CUOA 4LSVL 5DD5L 5LQBH 5EA0H 4CW1A 4H88L 1R1CA 3ZHLA 4JHBA 1WTLA 2YAEA 4I9WE 5CGBA 4XRCA 1G9EA 1FV1A 2F1BA 3C8KA 1QSFA 1T22A 3U9UA 3P9LB 1UCTA 5JOPD 1UYWL 3I2CL 3OPUA 3O2WH 5EZOL 5B7EA 4YK4C 1HILA 1A9BA 4YHOL 1IUZA 4I7ZC 3ZMEA 5KN5A 2VLRA 3DGGB 1J8HE 1EJ8A 1MFEL 1L6ZA 2PPFA 4L8SC 4YHKL 2WLNA 4GINA 4XHJC 4LLMA 4OI9A 3CD4A 4BFJA 1U8QB 3DUSB 1ADWA 3NMEA 2GC7C 3N41F 2BVPB 4PRBB 5F7UA 5DD0H 1CG9A 2JCCE 4GRWH 1O6VA 3PNWA 1CZ8L 3RVVD 3TA3B 1V7MH 4Y4HA 3VFVB 4WNJA 4OUUB 4LOVA 3HZMA 4RGNC 3H1ZA 2B2XH 3UJJH 1O9ZA 2Y36H 1S4IA 3ENEA 3VFOB 5JPNA 2YOAA 2WO2B 4HK3N 5E5MA 1JNLL 1LD9A 3NCMA 4LDEB 4AH2A 3RWDA 1L0YA 4U6XB 1FNSH 1ZSDA 2ZKXA 4WCYH 1YY9D 2YA2A 4O02L 3KZ8A 4I3RH 4YS4A 1AGFB 4XPBL 1PKOA 4LMQE 2ENQA 2K78A 3ZE2E 2JJTA 1P5UA 4IOIA 1MEXH 5DHEA 5IVXF 2WLMA 3TONA 2VC2H 4MCYA 2R0ZL 5ADPL 1M42A 3QUZC 5BNXD 4XVSL 1I7RA 3U9PL 3ZDXB 5JORA 2VL4A 5EF3A 4ZNEA 3GPEA 3LNDA 4MZ2A 3IMBA 1MHCB 3BLBA 2ICWB 3IEAA 1YEJL 2WKGA 2WXJA 1KIQA 4AGQA 4DSYA 4MJJA 2CKBA 2PXYA 3ILQC 4J4PD 1WA2X 3TCTA 1FRGL 2EEDA 3S3JA 1GSKA 1X4XA 5MENB 1OB0A 3V6FB 1GOGA 4HQQL 2CXGA 3I6LD 4PJHB 2A9ML 3V5HB 4O2EB 5F9OH 1DYZA 5TFSL 5A7BA 1XCTB 1N67A 2JKXA 3MU3A 3LVTA 4KI5C 3BVVA 4P9HH 4UT9A 1KFGA 3Q9QA 2WUCL 4QYOA 4UZSA 3MV8B 3NZ8B 1Z5YD 5F1NB 3BQUB 4NEHB 1IU1A 2F6AA 3IJSA 4IOFD 4JR9L 1SDDB 1ULVA 1PQZA 2Z31D 4KQ4L 3O3DA 1T83A 3MUJA 2G9HA 2KS0A 2C1OA 1WAPA 3VXUA 5DHXB 3B6SB 1VIWA 3HR5A 3UBXG 4H25B 4OGAC 1ID5I 4CRPA 2FGWL 2VUYA 1KDJA 4YVUA 5HD8D 5DHYB 5AW9B 4K7PH 4YBQC 3PP4L 5CKAA 5JDSB 4UT6H 5KTEL 3KXFB 4XAKE 5F72S 3HBGA 5K39A 2BVTA 2OR7A 2EIJB 3NJIA 3VXQB 2AEOA 4CSPA 4NN7C 4L23A 5J4MA 2VWEE 5DI8B 2WXPA 1ETZA 4MNGA 4BGDA 1R6VA 4G6FB 3OKYA 4JFPA 4MASA 1OP3H 1YEWA 2X9ZA 4OZGE 4RSVA 3ULUF 5FYJU 1FQ9C 3P1VA 5BV7L 1G9NC 1PY9A 1FL6B 1P7HL 2IQAB 1S6NA 2BVEA 1C8PA 4EUPH 3BH9B 3MLXH 2YSSA 5TE7L 5CZVH 4UTAH 5IB3B 2CHNA 1BCIA 4OV5A 5DURD 4JFQB 4WV1C 5D93C 5CEZD 1DCLA 3NABL 4W9EC 1SMOA 4JG1H 4PLKC 4OFVA 1MLCB 3AAZB 2ZP0T 3K6OA 4MXQD 3U36B 4DQOH 4JQVA 1G43A 1M2VA 3ZDZB 3FF8A 3KPPB 1MJUL 3F85A 4X83A 1EJOL 4D8OA 5DA0B 1CYWA 3BVXA 5F7EL 4PJIF 4S0HA 1DVSA 5DRXB 2RHEA 1T20A 3H7BB 5EIIG 1K3IA 4JHAL 4M7JL 1XGYL 5CBEA 5LO7A 4IRSA 1I3GH 4A7GA 5ISZD 1AQDB 3GMLA 4XVUC 3TO2A 1BHGA 2BRRL 2WWKT 4DN3H 3ARFD 3MJ9A 3V9FA 4ODSL 1PYWA 2B4CH 2WBJB 4IBQA 4L8SA 1A0QL 1QFUH 4NZTH 4ALAH 4OIIH 3FB7B 3SDYH 4HUWA 5J12C 5HGGS 4YSSA 3DC0A 5T8IA 3GSQA 2ZUSA 3P30L 2CG9X 5CO1A 2IDCA 3CN0A 4LLMB 1BV8A 4Q6IB 4M6AA 4X6CE 3GQFA 2WQRA 3CFQA 4LLYB 5AB2A 4PJFB 5JQ6L 3VFWB 3KGRA 3KPLA 2DKSA 4KKAD 4MMXA 3PQYE 1FUNA 1EDHA 3UP6A 2W91A 4ZZKA 2W92A 2A74C 1LO2H 1H8SA 2XWTB 1AFVH 2R69A 1OPGH 3NCYS 4UTBA 3ETBF 3O0RL 1TSRA 3C8KB 3EYOA 1KDIA 1T6BX 4XPFL 3PPSA 1FAIH 1QMUA 1S5HB 3GWJA 1BF2A 5C07B 4RAUB 3NJHA 1JIBA 2Q1EA 4E41E 2WVUA 3O2DH 3B8YA 2X40A 3B7TA 4N0UE 5CJXA 2G75B 4PY7A 5E4EC 2CIIB 3PV6A 2V5RA 4PG2A 3K6IA 4U1LA 4GKZB 3WHE1 2FT6A 4K3GA 5EU7C 2D73A 1JD7A 5I1LB 4QTIH 3WTXA 2FO1A 2X4QA 3KYMA 2DQFA 1PX3A 2M26A 2XHNA 3GSNB 5AYUL 2AK1H 4WI4A 5LGKA 1BQSA 1LWRA 3FPYA 1KC5H 1E40A 4G9DB 3RVWC 3BFQG 5D1XA 1LD9B 2Q2EB 4M7LL 4ZFGH 1HAUA 4HG4K 4GRLC 1T2QH 5EBGA 3R19A 1YNTF 1LDPH 1F13A 4KJWC 2V2WA 2JB5L 3BYYA 3G5VA 4B9ZA 1MLBB 4ES9A 3WFZA 3OXSA 1MRFH 3EO0B 3ATBA 5DUBB 2EIEA 3O2VH 3TCLA 3ZHKA 4AYBA 4KGJA 4QTHB 2N56A 1NIFA 4MMYA 3CZLA 5TDNB 3AROA 2C9VA 1JF6A 4JFFA 1H3VA 2BNRD 3WS3B 1MHCA 3D08A 2ICWA 2GCYB 1KIQB 2AHIA 2C9XA 3FO1B 3LPWA 3KGTA 3VXRD 2NR6C 2BOBB 3ALXA 1RUQH 2P5ED 4H25A 5I0XA 5BRZE 4IBWA 5HHOD 5I73C 3ARDB 1F8TH 4S1SL 1A47A 3WTSA 1X5GA 3CQQA 1UM4L 2TSAA 2Y7OA 3L4VA 4JQXA 2IMNA 4LXFA 2EYRA 4AV4A 3EH5B 3H9SE 4JRXD 1MCSA 2XKSA 2DQUL 1CDHA 3IPBA 4FE9A 1KB5B 2WXLA 2QGDA 4HDIA 4NS0A 4LCWE 5F1NA 3UBXI 1MY5A 2XZAL 5F89A 2FAUA 4ERSL 3GFUA 1MCLA 2VM4A 1NCAL 4HULB 2MQCA 3U2SA 2X1XR 5AB1A 3QXWA 3QC6X 1GW0A 2VN3A 3TT3L 3TF7C 3RVTC 3OBAA 4M1GL 5JIQA 4AGLA 1GC1C 4MTMA 2UXGA 2JVUA 1M2VB 2VGLM 1I1AC 4K4KA 5E99L 1XCQB 4NRZB 2VJXA 3P30H 4J23A 3FCTB 2AI0H 3TBVA 4L3AA 5A2BA 5HHMD 4R83A 1I85C 3KR3L 3U7WH 5B7FA 4YC2C 5HYFA 4RH4A 3H9HB 2XTSA 2IGFH 3FRUA 4JFPB 2V6HA 4PGZA 1UWGH 1SEBB 4FOMA 5C0NC 3AQDA 2VDRH 4QEGA 4XXCA 1BWWA 2DWXA 5HDQL 4NQED 2HT4C 3RJOA 1C08B 5DJ2B 1S9XA 4KTGA 2Y7QA 2YD7A 4GLRI 3W2DL 2HG5A 3AAZA 3UDWA 1SDYA 4NM4L 4MXVE 1KGUA 1RJZB 1VGEH 5IR1B 3N50A 4EI5A 2YK1L 1ESOA 1TYRA 2CM5A 4AK2A 1OW0A 1UA3A 5CILL 5D71L 3VXUE 2K7PA 4GAJL 4DQOL 2MTPA 3FYEB 2F54A 3OSKA 3M1BB 5FIEA 5DJCB 2QKIC 5JW4M 3NABH 1YO4A 3PJSB 4X9HA 5INDB 1Z9OA 3EZ8A 3SPIA 1A6TB 1J05B 2BWIA 4F58H 1NUDA 2UWEA 1GGIL 3R4DA 4HK0B 1JCKA 4XB8A 2IGLA 1FL3A 1ZSDB 2CNYA 4KNUA 2JB5H 2VE6B 2NY4C 5IQLA 5E7FA 3VFRA 4R4NC 1GW6A 2QHRH 4RAUA 4DGYH 4I48A 1OGSA 1V3LA 2LVCA 3QUZB 1W72L 1RUAL 4KKBD 1OAZH 5KSBB 2QPDB 4NZ8A 5F0PB 2NX5B 5HI5D 4TSBL 2ZOTA 3UIYA 1P9MC 4YO0B 2P1YA 4U31A 5C6WH 4PVNA 4P9HC 3NDYE 3VFWA 2A0LC 2OQJB 1WQVT 3QO0B 4GUPB 4I1PA 4ZUVB 1OHQA 3KG5A 3MRHA 3V4VH 4WNQA 5IJCC 1KLUB 2NY3D 4UOJA 2ORBL 4PEEA 5JQIB 3SPGA 1MI5D 2YA0A 5DVNA 4JN1L 5F0JB 2YPVA 4FERA 4DZ8B 3L9RB 1CFTB 2LLNA 5EPMA 1JN6B 5JHAA 2J8UE 4FFVD 4H8PA 4TTDC 4YSEA 3MV8A 4OLXH 4EBQH 2GT9B 1S2EA 2A73A 4OCYH 5I75B 1HZLA 2P8PB 5JHLH 5H2BA 2XKNB 3AMKA 1A7NL 5EUOB 5BRZD 1OGAB 5C8JB 4UINL 4ZPTB 2YARA 1LEIB 1I7RB 3H42L 2APFA 2VZTA 3S4SG 2MPAH 2MKLC 3Q8AA 4C8XA 4DTGH 5KYWA 3ULVD 5BVPH 4PJXE 1WBZA 2C1OB 3VXUB 4ZX4A 2VNCA 4OCRH 2CKBB 3L3OC 4Y16B 3QHFH 1BG1A 3R8BB 5JZ7C 2NZIA 2XG5A 2GCYA 2JKNA 4N2BA 2MHAB 2HN7A 1IB5A 2ZCHH 4XO4A 4LLWA 1JHKH 4JB9L 2YD0A 1OSZB 4NNYA 5B21A 1JI2A 1T5WB 1RSFA 4AVKA 3WMPA 2XUWA 5K9KA 2EKSB 3RAJL 3PG2A 3V7AE 4F15C 4JQIA 5FDWB 5B8CB 4NQUA 3NZ8A 2PPEA 3E1ZA 5I71C 5BRQA 3AY4A 3D25B 2DI8A 4HUKB 3FDWA 1Q8MA 4TUKL 4XPTL 1UOWA 4KRMB 1BOYA 3GZPA 4JO1L 4KKNA 4J3UA 3FAWA 3ZO0A 1KTKE 4AIZA 2PP7A 4X7SL 1H9VA 3QG6A 3WFDH 2FEDD 3DUHA 5C86A 4CGUB 4RMSA 1JFHA 4BZ1H 4JHAH 4M7JH 4ESKA 3ZYZA 2Y3NA 1HXYB 2ITFA 4ETQB 1J12A 4MD0B 1P2CB 1CT8B 2ZKHL 2CBTA 2W9EL 3PHQB 4ONHB 4NAJA 2H1PH 2C7FA 3OLGA 5EU6D 3LH9A 4YHKH 2V7NB 3VMOA 4EZJA 2ARJQ 4Z7OF 3QORD 5BS0D 2R0WL 2WXKA 2ZUQC 2J8UB 2A6KB 3MXVL 3O6ML 4O2CA 3QJHB 4DNLA 1ECYA 2BVQB 4U3SB 4D8PB 2LE9A 4OT1H 3QCUL 3DOHA 3VB8A 3UBXA 1NCUA 2FWOA 1G9NL 5J56B 2WBJA 4L8SB 1JYVA 2FSEB 4TRPH 5HYQB 5KSAA 1EEYB 1H15A 1FO0A 1FBIL 2A0LD 3E7JA 4EI6A 1C08A 1DQJB 2J88H 3ZKXC 2UZYB 3OF6A 5IHZB 4RFEA 2WXOA 3U0TA 4X5WA 1T3FA 3KYAA 1S7RB 1RIHH 2UXTA 4LLYA 3INUH 3O3BA 2JKJA 3O45B 4N2IA 5I6NA 3AW5A 3WN5C 2P5WA 1CL7I 3FFCB 4S1DC 2EINB 4BINA 1SLUA 1CWVA 1T21B 4P2AA 2YSTA 2CA3A 4FEMA 5JW3H 1CXHA 1ET5A 1PG7H 1CGWA 3H9HA 1YNLH 3ZTCC 3JUZA 4NP9A 4PD4J 4NWUH 5HVFB 1A6AA 5G55A 1KPUB 2ZXAA 5I1HL 1S5HA 1R19A 3H54A 3MLUH 1BAWA 5C09E 5D7JD 3SCMD 4TL5A 4BA8A 3T09A 3ZE0E 1W6LA 4N8VB 4PR5B 4W6WB 5JIHA 3UTPD 4O02B 3KH4A 3CZGA 4G42A 4AM0Q 2RAMA 1WP6A 1XX9C 4YAQA 3B37A 1X5AA 1BQ5A 1I9RL 5HPMA 2Y4SA 1YJDC 4DP6X 4LSRH 5LBGA 2BSSA 4MLSA 3AREA 1YEJH 5CEZE 2DQFB 5DJCA 12E8H 4WAFA 4C56D 2AXJA 2J2ZA 1NBQA 1UJ3B 1S5IL 1CLVA 3WTUA 3Q6FA 3NA9L 4N8PA 3FL7A 3K6FA 1FZOA 2F68X 3UPRB 1T4KA 1I1YB 4GBXC 4WHYH 1JMXA 4R26H 1FFRA 5KVDL 3GHBH 4KI5D 1R5WB 1CI5A 4PRPD 5M95B 1FNSL 5T5FA 4IBYA 4AW4A 1HHJB 1BVKA 1U3HA 4AYSA 1GZHC 2DQHL 2EYSA 2XKUA 2NTFA 3LRMA 3V9CA 3V4LA 4BZ1A 3JZYA 3ILDA 5D7IF 4ZFZA 1N6VA 4KROC 4BH7B 3ZE1B 2XA8L 3MYJA 4KO7A 3S36X 5TH2A 4ZW5A 3VD4A 2BWQA 2EXTA 3NK4A 3SQRA 1QO3A 4AV0A 4Z3FA 2HKFH 3AGWA 4WWID 5FM5M 4B0MM 1B2YA 2GI0A 1MCJA 3EFOA 3W5MA 1E4HA 4JO4L 2E74C 1BQLH 4OR1A 1JF1B 1E4XL 4EE2A 1RAMA 4NPKA 1CLZH 2M2DA 3WFCH 3DMMB 4I3GA 1T5XA 2YPKA 1LO3H 1JZ3A 3G6JE 5GGVH 3SGJA 3HC4H 2AXGA 5L2KB 3QEUA 2C3VB 2BSTB 3MBWB 5CINH 1J8HA 1ETB1 1KJ2B 4YDJB 4M7KH 3TBYB 3CZNA 3BPOC 2VXVH 3BH4A 3TA4D 1S7TB 3AABA 2N01B 3DJZA 2VDQB 3QDME 4ODXB 1V3JA 5J6GA 1MJ8H 4HBQA 2FO4B 4AYGA 4FNTA 4K5OA 4AUUA 1JRHH 3IMWA 2MHAA 4X0NA 5JPMB 1QBBA