2OX5B

The soxyz complex of paracoccus pantotrophus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
SSTVDELTAAFTGGAATGEGGLTLTAPEIAENGNTVPIEVKAPGAVAIMLLAAGNPEPAVATFNFGPAAADQRAATRIRLAQTQDVIALAKMADGSVVKAQTTVKVTIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 24
structure length 110
sequence length 110
chains with identical sequence D, F, Y
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ox5B00
2OXGB 2NNFA 2OXHB 4UWQB 2OX5B 2NNCA
chains in the Genus database with same CATH superfamily
3GHBH 2VR6A 3CUPB 4MJ5A 3OLIA 4WI4A 4EI6A 3KEDA 4UV7L 5L2JB 1E2ZA 4HK3N 3CFEB 5BJTB 3GLDA 1S78D 4P3CL 5TQ0L 4G9DA 3U7AA 2DQGH 1SBSL 5BMFH 5B7FA 1RFDL 1PCXA 3RI5F 4CW1B 5C8JB 3L3GA 1BXUA 4XOEA 3G5XB 4PJGE 2KH2B 1S8DA 5GIRB 4YHLH 3G5ZA 4XP5H 3CDCA 2VLRE 1NEZG 3KVDD 4U3SB 1P5VA 1HXMA 2Q8BL 4RZKA 3ATFA 3ZZQA 3QA3B 1RK0A 4EXPX 3GNMH 1J1XL 1NMCB 4Q74A 2ZNXA 1RH8A 2IAAC 3BEWB 4HP5A 3VWJC 1AE6H 2BWDA 2G4EA 2P8MA 1OAKL 2DH2A 3KS0H 4TNFA 3VDBA 3O6KL 1TPXC 4LLDB 4ZPVA 4YN3A 4HS8H 1M1XB 2RQ8A 3NCJL 4AVHA 5AW7B 1ETZB 3CH1B 4PS4H 3NJGA 4L5FL 4RMQA 3SDDA 1UKTA 2VXUH 2XPYA 3BE1H 3UBGA 4NPKA 4WNSA 1GJUA 1CG9A 2IPTH 3ARQA 3QIBC 4JCLA 5IG7A 1EANA 1ZA3B 1IRAY 3VD9A 4TF4A 4ERSL 1IKFL 1GSKA 4GSUA 5F1IB 1Z5LA 2AAVA 2N56A 4X8XA 4YDVA 3RTQC 4GLRI 3RDTA 5LCVA 4AQ1C 1BZDA 5FAAA 4DEUA 2FRGP 3I84A 1RU9L 4PBDA 3BAEH 5I6OA 1DTUA 1KJ2B 3MOQA 4MA7L 3P9LB 2BDNL 3U36A 1EERB 5DVOA 5JPMC 5E94A 4HCFA 5EA0H 5FO7A 5IB4B 3RDJA 3KYOB 3QCUH 1WZMA 4ZAKC 3HE6A 2LE9A 1RZFL 3O81A 4ORGB 3VNYA 4KROD 2DQTL 32C2B 3EJYC 4HC1L 3AC0A 5DMIH 4N90D 4Y5VB 4R5TA 3HG1A 5D2LF 4NQTA 1ND0A 3Q05A 1EO8L 3B2VL 4LLVB 4PRPE 4AYMC 2BRRL 1F3DJ 3QE5A 2BCMA 2B5IB 2D7QA 1EV2E 3BUYA 2WVTA 2Y3AA 4N0CD 5TE4L 3WE6B 4P23B 5HPMA 1O9WA 4GAYB 5G5DA 3SBQA 4N2KA 4EBQH 2WXQA 5D7JC 4DUXA 4XPBL 4GMTL 1XF2B 1IB5A 4E0RA 1A8ZA 2YMXH 3KLHD 3DX9B 1S9YB 4KY2A 1T20A 1DJXA 1AKJA 2PCPA 3DIFA 1U8PB 3PWUA 2WGXA 4JFED 1YC7A 3QJTB 2C1OB 2DQDL 1FDLH 4OCNC 2JCCF 5TH2A 3ECWA 4NPYA 4PJEE 1HI6A 1WICA 1DQJB 4D8OA 4W9DC 4QT5A 4UQ3B 1F41A 3DYOA 4DKFH 5ID0B 1S7RB 3EJRA 4H26A 1P53A 4KDTC 4LAQH 4WTWA 4ZUUB 2VDRL 3HHMA 2UZYB 3CD4A 4TOYH 1FAKT 1L7TL 3ZDZF 2WLIA 3WDJA 4AYGA 3RDTC 1KB5L 2IBZY 1EDQA 3E2HB 4YZFF 4XNDA 3IMWA 5IFHL 5DK0B 2QDWA 3UAJC 3KLQA 2VR4A 3SEPA 3K4ZA 3HE6C 1G7IA 2OQJA 2GEQA 2BSDA 3KM1A 3WFDL 1B0RA 4AIZA 3RYMA 1IQWL 3QXAB 2WN2A 2K1MA 3BD3A 3GMOA 4WU7B 3SKMA 4HIEB 3RZCB 4ABUA 4RWYH 3WLBB 2IV8A 4NQCB 4M1GH 3H7BB 1MCPH 4ILDA 4L29A 4YPGA 6PCYA 3QYMA 2CO6A 4XT1C 3IXTB 4XRCA 3UTPD 5DFTA 3UDWC 3PGDB 3V5HB 1P7QB 5JIIA 2EDEA 1NGPL 4MJJA 3BC9A 2F5AH 1YEKH 1EUTA 1QPPA 4P5SA 5ICZB 2E9GA 2WY3B 5I17B 3UJJL 3K2UH 1U3HB 2VO5A 3T2QA 4XC3L 4P0DA 3MRCB 3HNVL 3QJRB 3L08A 4HXBH 4XO9A 5B38B 5I1IL 1JZ6A 1UXSA 3HHRB 4H1LA 4HBCL 4APXB 4IKNA 4MXQC 4L1DA 1XF4A 4FRWA 2YGPA 1P5UB 3EFDH 4WK0B 1BD2D 2H32A 2WNXA 1ZVSB 1KCSL 2X4NA 3CQPA 3IAPA 5AYQA 4RGMB 3O4LD 5DVPA 5IQOA 2VLJA 4HSCX 2G60H 2HN7A 4IMLB 3B5GA 5KTEL 4NENB 5FUZH 4DETA 2DY2A 2H1PL 2H9GB 2XVBA 3A67L 4YHKL 1XH1A 4I0PB 3W5MA 2YGNA 4L3EE 3KPOB 1MY7A 3COOA 3HG5A 3NH7H 4Z0BH 3V4VH 2I69A 1JFHA 2C3WA 3QDHA 4IEFB 3HRPA 3O2DH 1BSIA 2QVIA 4YNYB 4RAVA 3IMBA 4OLXH 5HYQA 1QI5A 2R7EA 2VITA 5AKVA 3PWPA 1YC8A 3ZHLA 4AVKA 4UT9A 2G75B 2JLPA 4W4OA 1A1NA 3DVIA 2ZCLH 1G9NL 5DSCA 4J6RH 4NFBA 2HG5A 4IRZH 1DQDL 2BOBB 5E9DE 4LPYA 2I9LB 4OQTA 3LNDA 4JDEB 3SYPA 3MXVH 1N26A 4NZUL 1A6ZB 4JFHE 1AJ7H 4WI0B 1C1EH 2IAMB 5A16B 3SDXB 4Z7UB 5F7BA 5IMOB 3U79A 3KBPA 1NIDA 3QXWA 2Y6SC 3QHFH 1RJLB 1X5JA 3SE4C 1L0XA 4P48A 4AEIL 1H6UA 5HJDA 4F33B 3D3VA 5F0JB 4J3VA 4FA8A 3IWUA 3QEHB 1QASA 3Q2NA 4FE9A 3EYOB 3GEFA 4WHYG 1CXHA 2L3BA 2XWJA 1IGJB 4GNKB 5LBSA 4KI5D 1FH5H 4BZ2H 4H44C 1PLBA 1ZTXH 3BAIA 3PWLA 5GGVY 5FLUA 1Q72L 2EE9A 3LKOA 2APXA 3QXDB 3VD5A 3QDJE 1GOFA 4OTXH 2C4FT 1UCBH 3JVGA 3R0MA 1SZNA 4NUJA 5IMLB 2XXFA 2WQVA 43C9B 4WI3A 1SUJA 3ZQXA 3QJZA 4QXTB 2G2NA 1MJ8L 3QRLA 4LHQB 1XT5A 5DQJA 2R2HB 3B9DA 3RGVB 1MF2H 4U2YA 3AWEA 1N6QH 3MRGA 1G7LA 1Y1DA 4DN3L 3ZT5A 1KACB 3LMJL 3BUBA 2QKIB 4MCYB 1Q8MA 5C0JA 4M7ZC 4U6XB 4XBPA 1BMGA 4BSWA 4IGBD 2HTKC 1U8JA 2P5PA 3FU7A 3QO1A 3H6JA 1HH9A 4XN5A 3LXUX 2C1PA 3BP5B 3T2NH 2ZUQC 4W6XB 1BCIA 2VJ8A 1YPZB 1NAMB 3WTUA 3QRFM 2QVFB 1MQKH 5T1KB 1VACA 4M93B 1QVOA 3CG8A 5GJTL 3CIAA 3NTCL 3GT6A 4NQEA 4PWEA 4XMKH 1CCZA 3DJTA 3HJEA 5ECGA 3FOLA 4F1ZA 3O9WD 4PYHA 3ZDZE 5BXFA 3JVFC 5TE7H 1PKQE 3QUHA 3H8NA 5IEHA 2ENYA 4KVCL 1XMEB 1X5IA 3U6RA 1GMIA 3PAYA 4EUPA 3M45A 2BVOB 1FV1B 3FO2A 4OZFG 5ELIA 3DDFA 1Y7VA 4XNQA 2XQ0A 2ZUYA 1M56B 4APQB 4DEWA 2Q3AA 2H3XC 2O1AA 1CXEA 1V3LA 1NUDA 3BT0A 2A1WH 1T7XA 4QOKA 5D1QB 4XPFL 5LNEA 4JNXA 4FQJL 1CFSB 2CJUH 1OD9A 2HT2C 3WJJA 5DLLA 1XTMA 4NYLB 3JVGC 4PYGA 5E4EB 1UYWH 4EZLA 3WIFB 2NUTB 4RGND 1C7TA 5EU6A 3QRGH 4AVIA 1K6QL 2IWEA 1IKOP 2R69L 4R26L 3ALXA 5AYUL 4GSXA 3EJJX 2P8LB 2VR7A 4U1MB 2DMBA 3ARDB 3Q8BA 4J1UA 2UUDH 4XI5D 1TKWB 1S7UB 4UT7H 3EG9A 5LQBH 3FZUD 1TNMA 4I0PC 2B20A 3TN0B 4ZFFB 2AQ2A 3PHQA 1FC2D 3CV5A 2GJ6B 2F53D 3QUXB 3W0WB 2QV2A 3BWUC 1RIUL 5JYMA 5ESQA 4FKKA 2DTSA 3C6SA 2YLHA 4YXKL 3TA4D 4XODA 4R2GD 3E80A 2Y3NA 4M56A 3PV6A 1DVFD 1XB3A 5FW8A 2APBA 3DX7A 1OAQH 2RCSH 5TDNB 4EKJA 2C7FA 4MXWH 4BZ1H 3TASA 5T5NG 4MJHA 5FW6A 2YPLB 2CDEA 4ZMOA 1TCMA 4LCCA 3GUTB 1YEHH 5DZNA 1DBKL 4V1DE 4S1SL 1LEKA 4Y4KB 4F37F 1ZIAA 2GSGB 1FZMA 5EN2B 1DZ0A 1PG7W 1CDYA 1CFTB 4X5QA 1GYWA 1BZ7A 2PW2A 5AVTB 2ATAA 4CJ1A 3EIFA 2X88A 2VN6A 4JFQB 3D34A 1OCWL 4JO2L 5D71H 3WJJC 1LJMA 3BP4A 2O6EA 2YD6A 4DN4L 1IC4H 1LO3H 5T1DH 4P05A 1T0MA 3GUFA 1MW1A 4G6FB 5KS9B 3BLBA 4GY4A 4HF5H 1PSKL 1NZRA 3IMTA 3UO8B 3FU6A 1F4YH 3VD7A 2P24A 1BM7A 3VXSE 1NCTA 1NEZB 3UTSD 3ZL4H 3H42H 4IIQB 3TBYA 1E67A 5IJDC 4NRXB 4YHOL 3PE9A 2ZXCA 1W8NA 1MFEL 1TO5A 2AJ3A 2EYTB 3MLWH 3F64A 2W0LA 3NCWA 1QZ1A 3L4YA 4XB3A 3HC4L 4LIQL 2EVIA 1ANUA 4X0KB 1JTTA 1AIFA 5JOPE 4G8FB 2WXKA 4ZFZB 4NQDA 1K3ZA 1SQMA 1KZYA 2R83A 4BQCA 4NOBA 1OKEA 3MJ9A 3QDMD 1DFBL 4DKTA 1NJ9A 1JBJA 2GJPA 3A6CH 1MPAL 4QRAA 1CE6B 4PR5B 4S1QH 4X8JB 4X8CA 2AK4A 4Y4HD 5CHNB 3RPBA 5FA3A 1JZIA 3KJ4C 3BGFB 2YMTA 1VGKB 3UPCA 2GSIB 5CJXA 2XKNA 1J87A 4P2AA 3X1FA 1UUSA 5D7IE 3KPTA 1JZ3A 1HEJC 4NNPH 3OB0H 1PAZA 5C0AA 3NZ8B 4NIKB 4F24A 4R90L 1FGVL 2HJLB 4HWBL 3PP4H 3U2SA 1CIUA 2A7BA 5IVXA 4JFXA 1OT1A 1GPOL 3HFFA 2GFBB 4OLVH 5SWZA 3QW9A 5LJYH 1L3NA 1MFCL 5F96L 5DVMA 5D2NB 1EO5A 1DQQA 4E42A 1FN4A 1KGYE 4NJ9L 3B7TA 4APQC 1A64A 3CZGA 2J1XA 1SNRA 5KVEH 5ILTH 1TOXA 1I4FA 3CU7A 1A5FL 1J7VR 2FBJL 3VFOB 3FB5B 1VCAA 4IM8A 5CINH 5C0BA 4D3CH 4CRPA 5C0RH 2OK0L 1JPGB 3QUKA 4FCAA 1NUFA 3VWJD 4EZMA 1WBXB 1YMME 2E7LA 5E4EC 4XMLH 3KR3H 4Z7WF 3DURA 2XZQH 3BGMA 3REVA 3KPLA 5HVHB 1KN4L 2ZF8A 5A6IA 5I1GL 4XPTH 4PN6A 3GEWB 3ARDC 4NC1E 4NM8L 4ZTOH 5GRYA 3KPRE 3QIBD 4DGIL 5DZJA 4Q2ZA 1CLOL 5A2AA 2L04A 5I71B 4M6ML 2BP3A 2YAMA 4X9GA 5JDSB 4LLAA 2B0SH 3QWOB 5ID1A 3HVNA 2A6KA 4OCSL 3MGOB 2OMYA 3EYUL 5GSVB 5FWRA 3RB7A 5IVZA 3OLGA 3T77B 4A6YH 5TPWH 4KKAD 2WWNA 1OD7A 3FCGA 3OF6A 3QYNA 2CXGA 4ETQB 5F89A 3FO1B 3PL6A 2XX1A 2FJFB 3FT4A 3LS5H 2AJYH 3LX9A 1YNLL 3BGAA 4YFLI 4ZAKD 3FB6A 1I1YA 2X4SB 1A6VL 3ZHFA 5DURB 3DUSB 3WIIH 5L2KB 1KT2B 3DSNA 1CBJA 3GD1C 2CMRL 4N6RB 1G9ML 3EJYD 5D8JH 5I18H 5AAPA 2CIIA 4JRYE 3GMPA 2EECA 3MV7D 2Z7YA 2R0WH 1BG1A 4UQ2A 5F3FA 5I8KH 2A4CA 4MBRA 4OZGF 3MV9D 3CQFA 4LARH 2H0EA 5DEZA 43CAB 2GCYB 2V2WA 5DJXB 4ZW3A 1O7VA 3R1GL 1HKLL 2J21A 3AS3A 1GYCA 5DUML 5ISZB 1TXKA 1A4KB 1ZDSA 3PHOB 4UCFA 1YMHA 4XPHL 5BS0E 3D1MC 4K15A 5D7JD 2YAFA 2OKMA 4JO1H 2BHZA 3TT3L 4KY1H 1WH0A 1XGQB 5IHZA 2EO1A 4JRLA 3OKKB 3TJEL 3BPCA 1PF3A 4WJ5A 4X6CE 5EBMB 3DSFH 3T08A 1JWSB 3RGHA 4L9DA 3OKDB 3OVUB 4A55A 3F58H 3CU1A 3KJ6L 4NN6B 1YYLH 3P3RA 2NW2A 3TBVB 1BZEA 3SE9L 4A2GA 3T8MA 4LOVA 2PWGA 3KYNB 4E9LA 5E1GA 3ZHKA 3U0WH 1OO2A 2YQGA 4MZ2A 1N6VA 3RDTD 2CLVB 4PIRF 5FGBA 3OAZH 3MBEB 3B34A 4IDJL 1YZZA 3ZHDA 4DKDC 3UBXA 4XAKE 5DR5H 4DVRH 2BWIA 4EE2A 3MOAH 3UAJD 1A22B 5LNDA 3ATBA 2VL5B 3QJFB 1GAFL 2HT3C 4OIIL 2EILB 3HE6D 2WINB 2UYLB 4G6KL 2FEDC 5HHOB 2QSCH 5EBWB 3S3BB 1FVDB 5FYJH 4XNUH 1PS3A 1X5FA 1NICA 3V7AE 4J23A 4P3DA 5EEZA 2IH3A 4JJ5B 2WB7A 5L88H 1FVCB 2QQLH 3HG1D 5AG8A 3BSZL 1OB0A 3T0EA 4WSGA 1F3RB 1IBGL 1MWAH 4GW5B 5DI8B 3U4BH 1OP5K 2RAMA 5CBAA 2VLKA 2ITFA 4HZAA 4Y7OC 2J4WH 2DWDB 4ZUVB 3S3CB 3INUL 4YDJA 2DJMA 2KS0A 3KH3A 1WZLA 4DK3A 3US1A 1A7NH 5F88B 1QRND 1MIMH 1IGIH 4WGWB 2XXMB 4WUUB 2BVPA 3S36H 4ZMZA 1HESA 1QLFA 5LVEA 1N68A 3EYFB 5EORH 3UTZA 1AKJD 2XT1B 2A5UA 4FQLH 3VX1A 4WWPA 4MXQD 2K9UA 3TTYA 2WMPA 3S6CA 3BH8B 2CUHA 2BVQB 4ZFQA 1ACCA 1KCUL 4UANA 4G8EA 4G80B 1UM5H 2GVYA 2AV7B 1VFBB 3LRSA 5E4OA 3E6FB 2WV3A 2W65B 2XA8H 1FZJB 1KJ2H 4L8CA 4KUZL 2RIKA 5SWSA 3GMQB 4QXUL 5E03A 1EZUA 2NTFA 5I71C 4ZPTA 4GKOA 1UADC 4QHNA 5DQ9B 4P2OA 3N1PC 4XO8A 4TXVB 4HGKC 3BJLA 3V5DA 1GXEA 2BOLA 4JM2C 5ACZA 4K2UL 4PRIA 4Z7WE 3T65B 4HJGA 4ZW5A 4JGMA 4K55A 4YHIA 2VH5H 2XZCL 3RG1C 2MHAB 4PY7B 4KO7A 3IFPA 5C09A 3AUWB 5ES4B 2ATKA 3F7YA 5IQ9B 1QEWB 2OMZA 3T0EC 1J5DA 2CU9A 2EZ0C 1FBIL 5T5FA 3C08H 6CGTA 1BFVL 5C0FB 1ZWIA 4NFCA 2FVNA 2OPCA 4U0RB 2ZPKH 4JM4L 2AQPA 2BSRA 1TF4A 2F6AA 3ARUA 4LDLB 2G3MA 2QQNL 3CLEH 2Y6SD 3STLA 4U6YA 4OGQC 4PV8A 1HHKA 1DN0A 2VUKA 3N0PB 1JXKA 4I9XA 4JFOA 1IGCL 3MRDA 4E41E 1PLCA 1MAKA 1NPUA 2EINB 1TEGA 3AG3B 3AU1B 3QQDA 3RIAK 3EDEA 1YEGL 1R5WB 2VR5A 5FDWB 1KCVL 4MDIB 2FX8L 3OTTA 1OGAB 5DJ8B 4ODHL 4BCZA 4ANWA 3ARPA 4NZRH 1GGCH 1B9ZA 1UB6B 4OZFB 4XCEA 3ZE1B 5C0CA 3G6JE 5E23A 4BSVB 1P69B 2JWYA 2ZD0A 3MJ6A 3BT2L 4MS8C 1TEYA 3EO0B 2E27L 1MFBH 3ETBF 4L3AA 1AGEA 3I9GL 3NVQA 4LPXA 2VISA 2EDQA 2E7CA 3ARWA 3BIKB 4S10A 3ZY7A 5K59F 4FQIL 4NN6C 3AXHA 3OKNB 1G7PB 3ZT7A 1WZKA 3C6LC 1XGRA 3KYMB 2YSTA 3FTGA 3F7PC 1LK3H 2VDKB 2L7JA 4FFYA 4O9HH 2E7HA 4NT6B 1G7JA 1JF1B 5LCVL 1E6OL 1ZHKB 3UYPB 3CWGA 2HTKD 6TAAA 1NCBL 4DGVL 4W68A 4YDNA 3PWPD 3MV8A 4TMPA 1ICTA 4CVZB 5F1SA 1F90H 5MEPA 4MA3A 2EDLA 1ZOXA 2FIKA 5CEYB 3AB0B 3SBPA 3RL2B 3DOSB 3RPKA 4GKSA 4KMLB 4N4YB 3N9GH 2V2XB 1DQLH 3W2DH 1IIIA 4QYAA 3FTSA 2CA3A 4XX5A 1U91A 1RUMH 4F58H 4M4RB 2XFXB 3IKCA 2NW3A 5BVPL 2O5YL 3VXPB 4AZ8A 2IQ9L 3MLTB 4UINH 1VADB 3EZ8A 4JR9L 2UY6A 4MJ6B 4DGUA 1E4XL 5M94B 4XMTA 4R96B 1CXKA 5BCAA 3OLDA 2BK8A 4AJWA 1TJHH 4NCC1 4KJWC 3ZDYF 5EU5A 3GM0A 4PRAA 3JV4A 2X6MA 5JORB 5KVGE 3IE9A 1T04B 3BFOA 1JZGA 3U1SH 1BAGA 3SGKA 3SQBB 1NBVL 4RQQB 3MZGB 4DZ8A 1IGML 4ICWA 2EDHA 4XXDA 1X5MA 5C0IA 4G8IB 2HA1A 2VMFA 1FIGL 4RCAA 2CKBA 4OGXL 4PSRA 5HYJE 2A99A 4KZDH 2Q9OA 3IFLL 3MRBA 5GS0H 1I7TA 1PY9A 3E6HA 2E6QA 2C3XA 4F3FB 4I0PD 1BZ9B 1FNGA 1XR9B 5B39A 3CFKB 3TWCH 1QABA 5I0YA 1TTBA 2R27A 2LQRA 2LVCA 3PNRB 4JN2A 2GBVA 1R3IH 4R97C 5T3ZE 5F8QC 4IIZA 3SDAA 4NHCL 2X6CA 4QWWC 2IDSA 3DROA 3NPSB 3V6OC 1LEIA 3H7LA 2DYPB 4GXFA 3STBA 1NIEA 3DYPA 2PR4H 4MNQE 5INDB 4NQED 4RMVA 3VD0A 3V9FA 1Z3GL 3FTVA 2CIKB 4HDIA 5DA0B 3UBFA 4BWWA 4OIFA 2AANA 1N8ZB 3MKGA 2FSDA 1AD0A 3OWEA 5J6SA 1M05A 1B2WH 4WI2A 2AZUA 4GP4B 1D3CA 2E6JA 2RBLA 5IT2H 3CZNA 1UD2A 5IBTL 2ZG2A 1F4HA 2XWDA 1LMIA 3US9A 3ZK0A 1J0JA 3MCLL 4WZ9A 4GI6A 1MJJB 2IADA 2R56L 4QOKD 2CO1A 3DJRA 5SWQB 5AVVB 5AZEH 5BNXD 5E1AB 5MENB 4O02B 2GT9B 2IH9A 4FNRA 4KO9A 1IBHA 3UO1H 1O6VA 4L18A 3L95B 2DJUA 1GYAA 1U8IA 2WTPA 1JG9A 4Z7OE 5I76A 2P28B 3CSGA 2CRZA 4CN1A 1RIVL 5EU6D 3U46A 2FX9H 4OB5H 3MNDA 1OP9A 3WFBL 1T2QL 5JW3H 4AG4L 3HN3A 4JO3L 3PXHA 4LLMB 3BDYL 1NTDA 4UDTA 1H3UA 3WFCH 3S3SA 2UVEA 2YK1H 4AXWB 4HV8A 5BOJA 1YEFL 1B0WA 3FU5A 4ZG1A 3P0YL 4LASH 5I30L 1KCWA 4ZOCA 2R23B 2XPGB 3ESUF 4TLSA 3E8UH 4H88L 3TV3H 1NAMH 4XMPL 3LKQA 6FABH 3VD1A 5D93C 3RUGF 5L7XH 3ALWA 3K6OA 1B90A 1T1ZA 1E27A 3NIGB 4J8RA 3VXMA 4OFDA 2BP0B 3SDAC 4OVVA 3QDGB 4UBDC 3U0PB 4PRDB 3OKLA 1T3FA 2R1YB 4UT9L 2TSBA 2NNRA 4L4TB 3U4AA 1H15A 2ED8A 1AP2A 4DVBB 4J28A 3MCKA 5K59E 4IJ3B 3WIHL 4HUVB 3N44B 2WXJA 4OQTL 3WTVA 1KC5H 1XXDC 4IRJA 4L8SA 1Q1PA 3EH4B 2ZG1A 4NS0A 1CMOA 3IK2A 1MCRA 3ZTEA 1FFNB 5KSAB 5EOTB 2ICEB 3LKSA 3GWJA 5E8NB 3I3EA 1R17A 4JREB 2V5RA 1WF5A 1IAKB 3RE0A 1FRGH 2MNJB 4K5MA 5DXWA 3ZDXF 1M2VA 3BP7B 5A3IC 2QTVA 4APQD 4PJAE 3V6FB 2DLIA 3SD2A 3UTQB 5J57B 3ESMA 1JNJA 3O0RL 3CZJA 3F6LA 1CR9L 5EUOA 2CGRL 5LBSL 3F5WA 2WWMC 3U82B 5INCB 2VDLL 4J3OG 3L9EA 4JFZH 4PMEA 4A39A 3S2AA 4FG2A 5IFJB 4OJFL 4WIQA 4FHJA 3GQFA 1H5BB 1MCOL 4JY6B 3FSOA 1RZJH 4U3XA 4WHDA 4WI9A 5HGBB 2IBBA 5CCKH 1E5AA 4POZC 4N3UA 5KYUB 1CIDA 3NESA 4OD2A 2G9HA 3CFDB 4UIKH 3MLXL 4ADGA 1K8IA 1YDPA 3L1EA 1A7PL 3FQRA 4LOUD 4ZMQA 1PLGH 3PDGA 3L3DB 3MUGB 3ARDD 1ZDQA 3ARXA 4Z7IA 1QO3A 4HFWB 2ZUUA 1W0WB 4NERA 4QPEA 4NQDD 5FUOH 4GO6B 2OR7A 1QYGH 1ADQH 4PPTA 2OJ1A 4Q6YA 1BX2B 4TQ8A 2NY3C 3LIZH 2AK4D 4PGEB 4O00A 1U21A 1H3PH 4WTZA 2N1TE 4TUOB 4ZW8A 5CJ5A 4G7YL 4NUGL 2W07B 1G1CA 3OXSB 4GXVL 4N1CA 3BKYL 5C0AD 4BQ8A 2FYVA 3BHBB 1FYTA 1S7WB 3JWNG 4DWHA 3DUHA 3H0TA 1OPGL 2XOTA 4M7KL 4Z7VB 2Q7NA 4X5PA 1I7ZB 4Y5YA 5SWZD 1SEBB 3HUJA 2YPLD 1QZNA 3K4AA 2B1OA 1UH4A 2YLKA 3S34H 1FNEA 1M6OB 2AQSA 1EEYB 4MBOA 1HXKA 1H3WM 3ZYZA 1OT2A 1PZ5A 3X3FH 4P2CG 4UM9A 5FYLH 1EXUB 4CC4A 2DIEA 4CSPA 5C0BD 4JZJB 4MNGB 2OSLA 4TNEA 3BUPA 5H37A 2J44A 4EUPG 4M6OL 1SN5A 2AJSH 2OI9B 1OQXA 2J88H 3QQ3A 3BFQG 5CR8A 2E6PA 4XNXL 1F4WH 4XBGB 5H2BA 5E2WH 4UV4L 1M57B 4QRUA 4Z7UE 4J3WA 4UUJB 2H26A 4J39A 2CUAA 5E6RB 2W0KA 3CSBA 2Y23A 3QI9C 1PD6A 4PJ8B 1D5ZB 1T5XB 3CVIH 1S9VB 3C8KB 4O58H 3STZA 2VAAA 3RX7A 1T5WB 4DAGL 2ZQKA 4JPIA 4PI2A 4UQDA 4X6DA 1MEXL 4R3SB 4XWGH 2VDOB 1RSYA 4QHUB 1A65A 3JWDC 1SDYA 3MOBH 4ODWA 5JA8B 4MX7B 4MKTA 2HT3D 5FO8A 5FB8B 2D7NA 1NLDH 2FEDD 4PJIF 4Z18A 4X6BA 4TLUA 4N2CA 5DD1H 4OLWH 3ULSB 2YRBA 4KU1A 5LWYL 1FE8L 4U1IB 5ENWB 1P7KA 4HYTB 1XF3B 4IJ3C 4WFGD 1SJXA 2W88A 4Y5YC 4BFIA 5SX4I 4LLQA 4IOSA 3ZXAC 2BNRA 4JVPA 3B7YA 4OT1H 1RURL 1UA7A 1DP0A 2F7PA 5IMMB 3IDGA 4GSDL 4M48H 4U1LB 3VFRB 4BFNA 1RZFH 3ZE2F 4BWTA 1QSFB 4AC4A 3LEVL 4CC4C 5CU9A 3SYOA 4G7RB 4M03A 1RUPL 1BOGB 3ISRA 4JFFD 4OFYA 1QKZL 5IEKB 2J56A 4DP7X 3OJDB 2VW6A 3AAZA 4WCYH 3T09A 3T1FA 3FONB 5LXGL 1E9OA 1UJTA 1NDTA 3A3YB 5JZ7C 1C9SA 3FXIC 3H9SE 2A73B 4NAJA 1D6VH 1NWPA 5CJOH 1TFPA 3UG4A 2QPUA 2Z31A 4GINA 4QNPF 1KYAA 5J8OA 1PDKA 4N9OB 3CSYA 5AL8A 4E9YA 4KKZA 1TT6A 4FDWA 4UIMA 1KNOB 3KWTA 1HE8A 3ZDXE 1KF9B 1OLZA 4JFDD 3GYRA 3SDCB 1UD3A 1K5WA 2UWEE 3DX6B 3EGSA 1N64L 4GUQA 3KXFB 1QBAA 2CRMA 2WP3O 3HRZB 3NEEA 1P5VB 3AJ7A 4G5ZH 3BH9A 2CR6A 4KK5C 4NJAH 1LP9E 4P9HH 4PJGA 3MJ9L 1MKFA 1NCJA 4JM2D 4K23L 4GRMB 2DL9A 3GHEL 3MLZH 1F02I 2ZXAA 3P4NA 1RJCA 4MCZA 2JFCA 4HU8A 2XTJC 3MMEB 4FXGA 5J13C 3GLEA 5F7UA 3SDDB 1WCQA 4KVNL 1LWHA 3T0ED 4X4XB 3CVCA 2EZ0D 4OH2A 2SEBB 4G1MA 3G04B 4PS3A 3SGJA 1A9BA 3UOAB 5DRWB 2NDFA 2VLKD 4XP9H 4N2DA 4HCGA 2XWRA 4G7VH 5DQDH 2J25A 2PW1B 4HXAL 4G6AC 5FYKD 2WZPA 3PGFH 4LT7A 2GIMA 2GJ6E 3Q8AA 3TO4B 3VM7A 5CP7B 3Q6GL 4BZYA 5E94B 3MRQB 2JIXA 2RMNA 2V9RA 4MWFB 1ORSA 1ITCA 2OMNA 1KENH 4WY7L 1U30A 1KEML 4TS6A 5H94B 2OJZL 4XN4A 4BFGA 2VIRA 4YL9A 4IOFC 2OI9C 1PG7X 2VR8A 5BVJB 4NC2B 4BUGA 1BVOA 2Z93A 3HNSH 4TSCL 3SPHA 4X6FB 4LQFH 4MS8D 4OD1H 3CHRA 4LSVL 4ZFGH 3RWIB 5GJSH 3D39A 2YPKA 5GSRA 4AYSA 4XC3H 2RJMA 1YQ2A 2MCG1 5EF1A 3BUYB 3D0VA 3ZGHA 3C6LD 5I1KL 1WD8A 1RK1A 1DUYB 4PJ8C 1SLVA 2A9CA 3AQXA 4P2OD 4YC2C 3GS0A 1G7HA 2AXHA 2XA3A 2DV6A 3AREC 3T5WA 1QTYT 1GH7A 4JG0H 1EZSA 3N42F 3CFCL 2N7SA 5EOCJ 1GGIL 4C4UA 2PCPB 3PIQB 5KS9E 1CS6A 2VMEA 4WU5B 4XO4A 1S5HA 3BPNC 4IBYA 2Y7LA 3CZFA 4IDLA 3V4UH 3HKZA 4MB3A 1L5GB 5TF0A 2GTZA 1JWMB 3APFA 4QRPE 4UZGA 5C09D 3UGXA 3VUAA 4F2MB 4Q9CA 2X89A 3GPEA 1MLBA 3NABH 1M1SA 1ZEAL 2FO8A 4F5CE 3SGJC 2CM5A 1XB8A 2NY7H 2W38A 2K0RA 2BIOA 1T0OA 4ZQKA 1HJCA 3POHA 5KOVC 4UOQA 2WLIB 4PJ7A 5BRZA 4OCMC 3S5LA 1NOFA 2X4RA 2YKLL 5FKPB 1AOZA 3UZVA 1UKQA 3ZO0A 4HOMA 1I85A 4NO3A 1DQDH 5KAQG 1D2PA 3D09A 1LO4L 1WE5A 1XB6A 4ZW6A 1RVFH 4MD5B 2WVVB 5LNGA 2C3HA 2BIQA 4KJWD 4WHYH 3CBKB 2XTSA 2XYCA 3IDXL 4C83A 4M5SA 5C0CD 3V0GA 4H13C 1H6TA 4L5FE 5E2UL 2ADFL 4JPSA 2PPEA 3G6AA 1R33A 2VC2L 4ALAC 4AQEB 2ZOLB 3QFJE 1NFDA 4RLDA 4L29B 3TNNA 4R5XA 3NCXA 4LLUA 4NN7B 2ZP9A 5TFSH 1JUFA 3VGEA 3LH2H 1BLNA 1JHKL 3FK3A 4QTHB 4Q58C 2BNUA 2LAGB 1INQB 2P5EB 2WGNB 2WSPA 4XPGH 1OGTA 3SDCC 3NIFE 5GRUL 2YD5A 1Q38A 2ED6A 3GSNB 1OL0A 2VDPL 4HPYH 4K5LA 1S4IA 1SHSA 3JZYA 1I8MB 3D9AL 2A4ZA 3PGCA 3UYOD 1KLFA 4GMSH 3WTWA 4Z7NE 2X28A 3A6OA 4I4WA 1WS8A 4MB5A 4QNPE 3W38A 1SLXA 2FL5B 4X99A 5KW9L 4PJ6A 2VLJB 2X87A 3L5WB 4JFWA 3UPAA 5HDWA 2YAOA 1HSBB 3V0FA 2PCFB 1R46A 3KPSA 3NSYA 4MD4B 5DTFB 2EXWC 4MB4A 2EIZB 1RUAL 3U7YH 1BEYH 1MRCL 4LSRH 4WDIA 5D6CB 2WIIA 4G71B 4UTAH 4HJJH 5EH1A 4PWFA 2ZCKH 2JKRM 3VCLA 4NZTL 4OCYH 5DRZB 5FYKL 2K8QA 1UWXK 2RQEA 3CDZA 3FQXB 5IQ7L 4N0UB 4OZFH 3TLRA 3BVTA 5BV7L 3VW3L 2WLHA 4I3SL 1GMEA 2OMXA 3B6SB 3HNTH 4AEEA 2VE6A 5F2FA 1T1XB 4N25A 1OB1B 3P4LA 3QORA 3MRPB 3ABZA 5A6LA 4EQ3A 2HG5B 4KBPA 4ICXA 4LP5A 2ETWA 1KXTA 2X05A 2J8UF 4F7MA 4GRWE 3RWGB 5EZLB 4YEFA 2VZUA 2AEPL 4FQHA 2YUWA 1MH5A 3NJVA 3NUKA 5DJ0A 3RKDC 3P11H 2W9DH 4NKDB 5T1MA 4CNIB 5JNYA 1JV5B 2YOAA 2VDKH 4K4KA 3VXRB 2ESVE 1DFXA 4YGAB 3UJTH 3Q9PA 1E0OB 4L8BA 1BW8A 1CLCA 4ZD3H 2A6DB 1Q9KB 4FF9A 4LKCB 7CGTA 1GJWA 1YHPA 2NRDA 3ZKQD 5IFAH 4PJHA 1ES0B 3SPVB 3BRDA 1X7QA 4CU6A 1KEGL 3EBAA 1K6QH 2RALA 5DD6B 3IDUA 5E8EA 5BZWA 3SDAD 4K3EH 1XH3A 1IAMA 5AOKA 5GHWL 2NQCA 3WLWC 4MAZA 5K9QI 2FJUB 2XHNA 3ZIMA 3MNWA 1UOLA 3GXDA 4MYPA 5D2LA 3KYAA 4G3YH 5B1KA 3LV3A 5T5FL 3A23A 5T3XH 1QOKA 4NWUL 2XNAB 3MREA 3IS0X 1J8SA 1PG7H 2FECI 4JVUA 3QHZL 3RFZA 3ZUNC 4NKOB 4H5SB 1JK9A 5C0JB 3PPEA 4FQ2H 3EUDA 4FG6C 4S1RL 1UXWB 4MMXA 2ADYA 5EU3A 4BSWB 3DX0A 5JIPA 3O4OC 4X5RA 3QO1B 4KFZC 3VGHA 4NO2B 4GS7B 1CFBA 1VA9A 4NRZB 2BS71 5DLMH 4JAMB 3VXNA 1YAZA 2D2CC 2J6EA 3LQZB 4L0PB 5HHOE 3QORC 3IT8D 4ODTL 1C5DB 2VZOA 1Y1UA 4FL4B 5GGTH 2KI6A 2WWMD 35C8H 1RULH 4NKIL 1HNYA 3ZTCC 1A02N 5AVXB 2JCCA 2J5WA 5TK2A 3DNKA 3LPPA 4UOW0 2XZAH 3ETBJ 1IM9A 2FWOA 4K8RD 4RDQF 1J5CA 4K3DH 3D5OF 4HFUH 4POZD 3CZLA 4JRWA 5AZ2H 5C6TH 2R1WA 5FK9B 3HZYB 5E6IA 4EUPB 5IW6B 2F1AA 4JBSA 4G6JL 2QPEB 1BWMA 2WB1A 1UA6L 3S0PA 1P4LA 5I1HL 4XNMA 5IESL 4FFYL 1QD0A 3BVWA 4NNYB 1KLGA 5D4QA 5EN3A 3VXMD 4LPTA 3MFFB 2Q7AA 4CGTA 2Z6FA 1K8DA 4FZ8H 2O5XL 4HEME 5AB2A 2COVD 2BSSA 2FQGA 3MN8A 5JIHA 1DCEA 2BOCA 4I88A 5IIEB 2NY3D 4B97A 4MA8H 4KPHL 1EX0A 3H9ZA 4WV1B 4E9RA 5C0DB 1DVUA 5ADOH 4S0HA 1VJSA 1U8HB 4YQXH 4N90E 3CPLA 2NX5D 3HC4H 5E5MB 4Z77A 3VI3B 4X9FA 3KHQA 2JCWA 4PJFB 5FOBA 2Q7YB 1N3NA 3HAEG 3RFZC 2ED7A 2ZKYA 1FNAA 3QUMA 2PUQT 2WLLB 4X7TA 3SOBL 2X7LA 4YWGL 3UZQA 4A2EA 4AM0Q 3F7VB 3SKNA 4O02H 1TZOA 4L9LB 4JHAH 4TLKA 1MUJA 5I15H 1UKSA 5DMYA 3MRMB 3T3MF 5CCGE 4R0LA 4WI6A 3PJLA 5DDHA 3CCHB 2WCSA 5CBEB 3PDOB 5C08B 1WFMA 2OXHA 4H8HA 3Q3GB 2LAAA 3D18A 4GSQA 3QJSB 4A2FA 3IDIA 1GTNA 3ZRCC 1D5IL 4FP8L 5AW3B 3AG2B 3DIDA 4JFEE 4V33A 3QDAA 5FDYA 1JERA 3CFBB 2A9MH 3FCSA 1OVZA 4ZOAA 3BAXA 4QXVA 2QQKL 1HDMA 4PREA 3OKMA 2CGYA 1OPOA 1OWWA 2QVMA 1CWVA 4KV5F 4U6HB 3VWKA 4QLRA 4NJ9H 4A04A 1R3LA 4AT6A 5M95B 4FCHA 5E6IC 3INOA 2R39A 1NGXA 2HX7A 2CKBL 3DKHA 1DDTA 1A5FH 1NCOA 1ZHBA 4RNRB 2AERT 1R5IA 4HKXA 3D7PA 5E2TL 4J3OC 1FZMB 1MCIA 3MUHL 1IE5A 1E28A 2D0GA 2NZ9C 3JWDH 3QI9D 4FYRA 1NCWL 4JKLA 3WIAA 4YOKA 1U8MB 3RHWK 3BP4B 2J8UE 1OGAE 3B8SA 2PWFA 1U58A 1S7XA 1T0MB 2FAUA 3L1GA 3QDGD 4AMXA 1CFNB 4OZIE 3B5HA 4QF1A 3FRUB 3SQOL 1FFPA 5I1GH 5I6XB 2AAAA 2HMID 3LH9A 2P24B 2GUOA 3ES6B 3H6AA 5B39G 1CLOH 1FYTD 4PJBF 3SY0A 3TBYB 3UTPE 1UWGH 3D25A 3QEQB 2HP4A 5K1NA 1LK2B 4Y1AB 4XNYL 1JGLH 5CD3A 4X42A 4R0LC 1NGWB 3ZE0B 1CT8A 4B5ZA 5IF0A 4HLJA 1AGCA 4OGAC 4M61B 3P30H 4UM9D 2PXYA 1A3LH 4YIQA 5ITFA 1NJ9B 1JF5A 3MR9A 4OLEA 2FZ3A 2UZPA 5E99H 4ZMVA 3NJHA 1BD2E 5FA3B 3DECA 5CKAA 2M83A 2R59A 3V10A 5KBDA 5DJ6B 1JPST 4FL4C 1D6EB 3O4LE 3RFRA 2XKNB 4I2XB 1CYXA 2FSEA 3V6ZA 3WV0A 5JZ7D 2HX8A 2PYFA 1K2DA 2DLHA 4K7FB 2HTLC 2QADD 4OLYH 1MVUB 1YEJH 2XXGA 1HKLH 3CLFH 4U0QB 4HUWA 4K8RL 3U2SB 4JFXB 3GMRA 1YA5A 3AFLA 4PTUB 1KN2H 5LXVA 1OSYA 2BVEA 4X9HA 1PZDA 1YNTB 1GA2A 1S6NA 1PX3A 4JDTL 4AC2A 2OR9L 1EZLA 1QI3A 4O2EA 4YHPA 4DOHB 5CAYB 4N85A 1L9NA 4GUCA 1FZKA 3RWDB 1PFCA 4JLRA 4KK5D 2F8IA 4Q0XL 2Z7UA 3FQUB 3KZ8A 3NZSA 1ZA6B 3B7UX 4LSQL 3FRPG 3E0GA 1AZZC 1J0HA 1TENA 1TZAA 3FTZA 3Q7JA 1JI2A 1DQMH 3MLVL 4KHXL 2MH4A 3SE9H 3RTLA 1N12A 3LAFA 2XTJD 4DGYL 3IYLW 3K6IA 3FPYA 2P4AB 4G6ML 5BRQA 1HJBC 1DLFL 3TVMA 3KPLB 5DK3A 4IOSD 2BNRD 3VRJA 2FBOJ 1JXJA 1GZPA 4Q2ZB 4RBPH 1TQCC 3MRIA 1I31A 4OIIH 1QA9B 2PWHA 4L9LC 5DC9B 2I5YL 3LZFH 5ID1B 3CFJB 4DEPC 1OAXH 3LY6A 3W5NA 1Q0XL 2NYKA 3M1BB 4KI5E 1KTDB 1A6AA 4LPVA 1OM3H 3ZOAA 5HHPA 4PLKC 4PJDF 4OFYD 3PL6B 5F89B 4B9IA 3PUUA 4XAWH 1KXHA 5BRPA 1IBGH 2NPLX 3ARVA 5DHYB 4HJTA 4PJXA 3RKPA 4X4MA 4IOFD 1MJ7H 1F42A 5ETUA 5GGUA 4LESA 4CMHB 2Z31D 1T0PB 1YYMH 4PRBA 3GMPB 2ZJSL 3R4DA 5D7LB 2HKAA 1BJ1H 1I8UA 4FQCH 4G7QB 4LIQE 4UQ2B 4X5WB 2KZWA 1WAPA 1CFQA 3T3ME 1HKFA 5EDXA 1HE7A 2BY0A 4QRRA 2VN3A 3X13B 3HC0A 3D06A 3JWOC 2I60H 5F21B 4N8CL 1YEDB 2VDOH 3H53A 5H4YA 4F7CB 4O51A 4WGVB 2Y07H 1YMHB 1JWUA 3GJEA 2Y7OA 3QIUB 4ZDHB 3ARED 1FUNA 4KK9D 4I1PA 4HIHA 2NZ1A 5EC1A 5HD8C 3TEZA 3EBIA 5DS2A 1XGTB 3AT8A 1H0DA 2Z91B 1HAUA 4QY8A 1MI5A 1Z6JT 2DDQL 1AG6A 5L9DL 2FEEL 4XP4H 3LXBA 3OZ9H 2ARWA 5F7YC 1FL3B 2CQVA 3FU8A 3SOTA 3RI5K 4HZLA 1GL4B 3GMLB 1USZA 2OSYA 2IPUK 1IC5L 2DQUL 4GH7B 4L8DB 1ZLVK 2IOOA 1AR1C 5KJ7E 3NA9L 4R4NC 1X5YA 4UDUA 3CN1A 2WZPD 4PRNA 3V0VB 5HHQB 1KJVA 2LV4A 4ZFOA 3NRQA 3QNXA 4JHWL 5IV2B 5IUCA 1IAOB 5MEQA 4FGMA 4PUBL 2F54B 5BQ7A 4FABH 4ALAH 3PREA 1NGQL 5J12B 3DX2A 4R6UA 4QCIB 2LU4A 3C5JB 4HKZA 5DT1L 4PJBE 3KWVA 4RGNE 5AQ0A 1H9DA 5CLZA 4AYDC 3QZNA 5CM1A 5HHVH 3NFPB 3AMLA 4G8GA 3CVHA 4XP1L 3SJVA 1SPDA 3IRPX 2MKWA 4PMFA 1JHLH 1LL1A 2IEPA 2XUWA 5DO2C 1IGCH 1WCBB 3Q2WA 1QLRB 5KBPA 2K8MA 3D39D 1UT1A 3CH8A 2HPOA 3L4TA 5CBAB 3MX0A 4XX1E 1A6WH 1TYJA 5D4HA 3OB8A 4YDKH 3GGWB 1KBGL 4OLZH 4P2QB 4HG4J 2F53E 3R7RA 3UX9B 3F6JA 4HD5A 5E1IA 3UTTB 4XH2B 2Z34A 4FQXA 1RUQL 2BVPB 4OKVA 2CBMA 3QS3A 2VWEE 1P4BL 3HZKB 3LQAC 3BT2H 4B7IA 1U36A 5DK2A 3BKCL 4GBXA 5GGSA 4DKEH 4ONOA 4MASA 2OZ4A 5IBUG 1HIML 2O5ZL 1HT6A 3VI4B 1BQLH 4XVJL 3Q06A 3RNKA 2YPVH 1CGTA 1DSFL 4FC3E 2X89D 2ZOTA 3TOPA 2WSDA 3CN2A 5DEGB 5TDOA 3SYAA 1G87A 2ZG3A 4X6EA 2Y06L 4Z3GA 1ZHLA 2GK2A 2FQDA 1ONQA 2FNWA 3Q8EA 2IANB 5J56B 4UAOC 2EXWD 3N43F 3HLAA 5DS8B 5JPNA 3AU0A 2CDGA 5BRZD 2MNWA 4AEFA 3FJTA 5BZDB 5L6YH 5E00A 2YXVA 1MHEA 1N0LB 4BFOA 1P6WA 2N7BA 3NCFB 4BK4A 3FU9A 4KH9A 3W56A 4DO6A 2B4CL 4YHMH 2J12B 1MRDL 3CAFA 1KYOJ 5MP6L 4N0FB 2BXZA 4PRIB 2AJUL 3VJ6B 2WO4A 1W0YT 2BNQB 3ARYA 4YGVA 1E7UA 1U95B 1X7SA 3GSVA 3NN8A 3IMUA 2G5BA 4WW2C 1UJ3A 3GSWA 4P5MA 3UTSE 3MODL 2OMZB 3UXFA 2UXTA 2ERJB 4EDXB 2E8YA 3QULA 1ZWIB 3RKDD 5B3NA 1SMDA 4JR9H 4NBYB 4F7TA 2YSSB 4IU2B 2DWTA 4OZHE 1IGFH 2MSPA 2W60A 5B8CA 2BSRB 2OTUB 4ZO8A 1DBBL 2YQBA 3M46A 1LQSR 5J9PA 1DN0B 1M7IA 3BUIA 2DQHL 4PJDE 3TT1L 1KIQB 4U1GB 3CC5A 5C0GB 2PF6A 4IK7A 2VDML 5FGCE 1IGMH 4MJIA 2CHXA 3VG9C 4PGDB 5I66B 4YLCA 4S2SA 2NDGA 1QUPA 1KY7A 1A3RH 3C5XA 3BFWA 3N0AA 4FHBD 2JJSC 3DMMA 4KH2A 2AJXL 1KPVA 1MFAH 4K9EH 4NO0B 2DOCA 4AQ8C 2GIXA 1T22A 3M17A 3F6IA 3EYSH 3WHE0 3FCUB 2V7NB 2JB5H 3GM8A 3KPSD 3VXUA 2P7TB 4HGMA 3T71A 4GUOA 3O8XA 2WSKA 5E56A 4B6ZA 4L1BA 1DUZB 4OZGA 3D2UA 3QUZA 4MNHA 3FQNB 3H3PL 4EN3B 3O6FA 2JB6B 3BLKA 3DDGA 2PR9A 4RAHA 1DE4B 4Z78B 5KVFH 1DEEB 5DYOA 2VQTA 3WS3A 1P9MC 1TZIB 5DMKB 1VEOA 4TSAH 3HAEB 3TBWB 4LMQE 1IC7L 1WBZB 4M43H 1GW0A 5J12C 5SX5H 1ILSA 2Q3ZA 3OGCA 3QORD 1OCRB 1UJ3C 4AGNA 3VD4A 4LNRB 2QSQA 1YJDC 5CIPA 4ONGL 3SZ6A 1EFXB 1PLAA 1ZCRA 2YN5A 4JZNB 3AY4A 3GSQB 4QEGA 4KX9A 4KXDA 2ICES 4KQ3H 3PG2A 2E8ZA 1FLRL 3KM2A 3KHOA 1V3KA 4CJ0A 4EZKA 5J6GA 4WFHD 4DERA 4MD0B 1HC1A 3GSNH 4GAJL 4E9QA 1WJ3A 3TESA 1AC0A 4G70B 1I8KB 3GXNA 5DEFA 3O2VL 1NBZA 1AYRA 5E8PB 3WTXA 1FVEB 4UQAA 4F7PA 3IXAB 3BVNA 2QSVA 4G43B 5GXBB 5D7KE 4ONFH 5MI0C 3BLPX 3IEAA 2V3EA 1E43A 3WFBH 2JK5A 1RZKC 3C2AL 5I8EA 3BMVA 4PGBA 4P2RB 3DMMC 1U6AL 2W92A 3BDYH 1MXGA 2ORBL 1GGBL 4PJ5D 1UFUA 3IAQA 3VD3A 4DZ8B 5CUSL 4XXDB 2WM0A 5LDSA 3GK8L 5C0IB 4O5LL 2X4UB 4GT7A 4O4YH 5HGGS 1S3KH 1S9XA 2I07B 1JTOA 4LXFA 5CJQH 3BP6A 1W15A 2O72A 5CSZA 5IJKA 3GZKA 1FAIH 3I3BA 3K0YA 3MRBB 4LCWD 3CVBA 2WTRB 3WXVL 1LE9A 1AKPA 2ADGA 4KO5A 4OGZA 2UX6A 2Z92A 3IU4L 5EZJB 1FNGB 1N59A 5F9WB 3A6BH 2CO7B 3ZMEA 1AMXA 5F0MB 5B39B 3BSHA 4FD0A 4I48A 4HUXB 1GZQB 4JN2B 4XCCH 1TU2A 4N8UA 4ZX3A 4Y2DA 4QTFA 4PTTA 4OQTH 4TVUA 4YSEA 4DUVA 3HBZA 4TQHA 1A3QA 3AY4C 2ZKHL 4AGPA 1IJ9A 1F4AA 2XG4A 4OY9A 3OC8A 4AI7A 4J3OH 1A4CA 4JVWA 5DO8A 4AV5A 2VW4A 1IM9D 4A2LA 5D1XA 3T1WA 2QBWA 3KYKL 2ERJC 3IU3A 4N8VB 2C9VA 1QSEB 1JL8A 1CD1B 1TMCB 2R0ZL 3D69B 5E6ID 3QIWC 4HGWA 1AO7D 3F12A 1I8IA 5AAMA 3VE0A 2P5WB 2AK1L 2QMKA 4JPWH 3WEXA 1CN4A 2IADB 5TE6L 3C60A 4BQ9A 2NZ9D 1Q0EA 2YAPA 4OJFH 1MFNA 1CB4A 2VDQB 3FO9B 1NCUA 4JY5H 3VU1A 2VB5A 3MDJA 1UM4H 4U6TA 1G4RA 4YBQD 4ZYKB 4UQCA 1W0VA 3EHBB 3GTNA 4LPCA 4FYSA 4KJQC 2DLTA 1YYCA 2YS4A 4HUUB 1ULVA 4J8QA 2A74B 3U46B 3ZO9A 2B59B 2OS7A 3DJZA 5D7SH 4ZX4A 3HG1E 1JDAA 2YD8A 4RFOL 5DRNB 3VXTB 1LO5A 2NQ3A 4ATWA 5IREA 1HFUA 1WT5A 1VGEH 1CGWA 1QP1A 5IWLA 4KOBA 3BUTA 3L7FB 3MRHA 4I89A 2JKLA 3CXDL 5DRXA 3FRPB 3WTYA 3JWNH 1GS6X 1NCNA 4LPWA 1IUZA 2K6ZA 2YEVB 3RL1A 4DH2A 3L3HA 2J3SA 2GSMB 1AD9A 4H20H 1S9WB 3L9YA 1NFKA 1AZCA 1QRNE 4QHMA 3O41A 1MXDA 3ERXA 4OGAD 1NSNL 2I7OA 1T1ZB 2XWTA 4JY4A 4N5EC 2AGJL 1HU8A 2V5TA 3F00A 4XCNA 3ULVC 3BKYH 5F7MC 4EVNA 4ELMA 1T3FB 1WGVA 3R8BB 3R19A 2X0VA 4ZTPH 2CCVA 3DC0A 4IQHA 4ZSOE 4OGYH 2HVBA 2G2RB 5D1XC 4B3EA 4ISVB 4EUPH 2B14A 1AZBA 1G9EA 3VWKD 2HTLD 3CHQA 4PCKA 1HHIA 2RD0A 4HK0A 4L8SB 5E6YA 4HIXH 1RY7B 1G0YR 2P43B 3JYBA 1N5YL 2FJGA 5AVYB 4N0YL 4MQTB 4U1JB 1E8ZA 1BIHA 2E9BA 3JTSA 1B6UA 2A9AA 5F7DA 4OF8A 1M2VB 4RSVA 3SDXF 4Y19B 1JPSH 2XV0A 3V9CA 5FFLA 1CO1A 5JXAL 1QFPA 1U92B 4ZQTA 3PHAA 1NKGA 5KG9A 5DJAB 1JZ2A 3N55A 4IBZA 3U25A 1F97A 3GI9L 5C07B 1F8TL 1BA9A 4HWZB 3HMWH 3EJZC 4MMYB 5JIMA 5EO0B 3RIAF 2VSMB 2VXQH 4PB0H 3IFOB 4TQEH 1WT5C 1J1PH 3DX4A 4Y7MA 5F6IC 1JHTA 2X4QA 4HHAB 5IWLC 4F37K 4OVUA 1WAEA 1J8HA 5D5MB 1L6PA 2ZWLT 2IBZX 3QG6A 1KIPB 5CO1A 2ZWNA 5EFIB 5KSUA 3QFDB 3LKRA 3BO8A 3WY1A 3NJJA 3ZT6A 4FA6A 4GEJA 3GLZA 1MCDA 1ADWA 2LABA 5K39A 5JW4M 2X6VA 2ZXGA 1SYVB 1KJ3L 3VDAA 1KMGA 3L6FA 2OTWA 5F9WC 1TLKA 5D96B 4YXHL 4NKQB 3D4CA 4J2QA 4HPOH 2PXYD 3EFFB 3FFDB 3QNYA 4RFNC 1AACA 1K4DB 1QQDA 2EDTA 2HVKB 4MVBC 5IW1A 2J6EL 2J8HA 1P2CB 2OMVB 4FMKA 2IV9A 4EQ2A 3BEVA 2I9TA 3WGUB 4DZBB 4KNSA 5C0EB 3Q1EA 4WKZA 1NIBA 1F00I 3ILQC 1RURH 3JWOH 5MHSD 4DQOL 1YPZF 3I6LD 3KPMA 4HBQA 1A6UL 1J5OL 3NFSH 3U9PH 1YEEH 5T33L 2NLJB 4OV5B 3I85A 4I5BA 4YSPA 3SE6A 4LKXB 4FTDA 3HMXH 2UY7B 3HOGA 1E9QB 1G6RA 1K5NB 1VAHA 1D5BA 2EDXA 3P9WB 4FMVA 4R4BB 2QPSA 2VDNL 5KSBA 3FOMB 2XBDA 2J20A 4MQ7A 3MJGX 3PWPE 5GRVK 3RVTD 1BQHG 4R4FL 3FCTB 2ZX9A 3RU8H 2DRUA 2PCXA 3D0AA 3KMDA 4E36A 5HD8D 1JI1A 4JANB 4GRLA 4L4VA 3BDXA 4L2YA 2W94A 2PYEB 4NHUA 1ET7A 1Y0LB 4EEEA 1OY3B 2V8LA 4PRHB 4HCRH 2XETA 2NY5L 2MOGA 2YGOA 5DZLA 3TVMD 3FYEB 5T1LA 2C7UB 4PCTA 1AHWB 5HYSG 3QUML 5IBUB 1JV2A 2D03H 2R4RL 1OHQA 4DHLA 5LGJA 3D3VE 4NOFA 1AR1D 4GUPB 2I24N 4R4ND 2HRHA 3AADB 1AY1L 2OMUB 3RZCA 1CGVA 2AJZB 5E08L 2XIBA 5JO5A 2XWXA 1GS8A 2WYHA 3HI5L 1BXXA 4K0OA 4BA0A 4AEHL 1PVHA 4ZUWA 1UXMA 4AKQA 1V7ML 3G9VA 1UQSA 4JKPL 2F08A 2HFGL 1KWKA 1AXSB 2QQQA 5GRJL 3O11A 1T66D 5E2VH 4HS6A 1LNUB 4BH8A 1S7TB 4OLUL 3SGDI 4R7VA 3FTUA 2W80C 4QO1B 3X11A 5CXPA 1L0PA 3E1ZA 3K5RA 3O3AA 3B7SA 2DQ6A 5DO2D 3DXAA 3QG7L 4QRRD 3LQAH 1I3GH 1BDYA 5IVXF 4PJCB 4Z7AA 4NQVA 3PHSA 4LSSL 3EXJA 3WSQH 4WO4A 1HH6B 5HDQH 3AXLA 3BAWA 3RUGA 3B9KB 1D5RA 3MBWA 2UX7A 1T03H 1EDHA 4B60A 3VQMA 2OMWB 2WAHA 1YQVH 2RFXA 3NG5A 5DWUH 2PKDA 2APFA 2X9WA 4NQEE 4YR6B 3NDZE 4CVXA 1RUKL 1MI5D 1T6VN 1XTLA 3DX8A 1SM3L 1NC4B 1HHHB 1R3KB 1X5LA 1YN6A 2ZX7A 4XXCC 3BZEA 4LL9A 3LN9A 2A6JA 1XXFC 2APWA 3PQYA 5FV2A 1R75A 2Y36H 3LIUA 2HVJB 2WNWA 3IETB 1IFHH 2UZIL 4MHHI 1N10A 4HX1A 2DTMH 2YA0A 4CL7A 3OPUA 4QOKE 3EGSB 3IGAA 1E9PB 1GGIH 3V52H 2NY6C 2WAQA 3NCYS 5JQ6L 1SOSA 4H8UA 3VXOB 3MPCA 1HHJB 3GIVB 4M1CC 2DQJH 3TA3B 3WY3A 1RZ7L 3WFEH 2D0HA 2IALB 4LNVA 4PJGB 1VKXB 3HR5A 5HGHA 2F8XC 1ZEAH 2R2EB 2PP7A 2DQFA 2VLRB 3NSJA 2EJ1A 4XBEH 5EU6E 3KWWA 2GK0A 1BFOA 4MCZB 4PW3A 4G8GD 1WZ1L 3RWFA 3UJIL 2Q76B 3SJVD 2W5PA 4DPBX 5AOJA 5DC0A 4X4YB 4RETB 3H4HA 1NC2A 5C3TA 4AGMA 5IB2A 3W9EB 5K93A 1FORL 1TTRA 4KTDH 1AYOA 3FQWB 2EABA 1CL7L 4NAMA 3BQUA 3D33A 3ZLQC 1Q0YL 4J7RA 4NO5B 1WEJH 1WLHA 3QJVB 2MPAL 3J2PA 2AKRA 3R0NA 1XZ0B 4XCYB 4ZS6C 3WN5B 4B50A 3HBGA 3TCLB 4ENEC 3SKOA 1A9EB 3TEXA 4AKOA 2BJMH 2X3BA 4LHUD 2CAKA 1VFAB 2JIXB 2O61A 5CEZD 3MRRB 4GBXD 1SY6H 2VXVL 1H3XA 3W37A 3RY5A 1FFQA 4F8TA 3WTSA 1C5BL 5LGYA 1JHKH 3OZLA 3C8DA 1EGJA 1B3IA 1NBCA 4NGHL 4Z3JA 3TZVB 4MYWB 3ULUC 2WJ7A 3WELA 2XZZA 1OHZA 3GINA 3V0WL 2WXNA 2ZOKB 3WKYA 3L48A 4UU9A 1SOKA 1I3UA 2WQAA 2A9DA 4YSSA 4HHGA 1AHWC 1G43A 4FFZA 4G9FA 3ZKXB 1IKNC 2R2BB 4CC1A 4JRXA 5JHDA 1RK1B 3TIEA 2VABA 3TX4A 4P2YA 3BKJL 4PRPB 3A4FA 1F5WA 4HW6A 5JHBA 1P6AB 4RZCA 3FSWA 5BO0D 2WZ5A 2X3CA 1KELL 2DL2A 3NZHL 1DLHA 4M6NL 3ZVVA 2XG5B 5L4IA 4NNXA 2EEBA 3CZFB 4Q56A 4RH4A 4AJ0A 1D9KA 1MRCH 3PNWB 4XVTL 4JM2F 5EWIL 1JMXA 5IB3A 2WBKA 4TLTA 3TCXA 1KCRL 1CZ8H 4IS6A 3RBGA 5ANMA 2ENJA 3SB3A 4OCXL 4B0MM 2HLFC 3IWVA 4PJEB 1HNFA 3BAKA 3K72B 2X4TB 3LPOA 4HKJA 5JOEA 3K0WA 3RVVC 1FH2A 3DV6A 4FEIA 5AW2B 2XJLA 2WBJA 4XNBA 5DCCA 4XZUB 3RPIA 5GS1A 4NQDE 3LRKA 1YECL 1Z0MA 4C54A 3MHZA 5DJYA 2GUYA 2JTYA 2GAZA 3G5YB 4NO3B 5A40E 1DANU 2D9CA 1ED3A 2FGWL 4MJID 4P4KB 5I74C 5DUBA 2Q10A 5CZRA 2AK4E 5DJDA 1JRHH 4ZT1A 5C70A 3B9KC 3LDBC 1PY4A 2Z9TA 3UTTD 1M71A 4QYOB 3DMMD 3FPXA 4PJIA 3G08A 1LO0L 1AQMA 5C0AE 2YXMA 4TSBL 1E5YA 5EOQH 1IGYA 3HCVA 4TTDC 1J12A 2IPKA 4GW4A 3TH3T 1EJOH 1JOIA 2CUMA 1OAYL 1V27A 5DHMC 5IVXE 3TNNB 3VXUD 4DIXA 3OM3B 1E4JA 5SWZE 2XBZA 3O8XD 5A7EA 1DJSA 3D2TA 5CN2A 1KIUB 1CLVA 1YLBB 3D2UD 5ALBH 3WKML 4IKLA 4BKLB 5J0BA 5DFVC 5F44A 3QPQC 1TCRA 5KVDL 2HLEB 1ACXA 4G1EB 2NXYB 5A2BA 1T4KB 2PTTA 1WFIA 1EAOA 2DIBA 2QPFA 3TA3C 2ISDA 5C0BE 3FT2A 5HSFA 1EHXA 1BF8A 3PGCB 1OCOB 3E8VA 4M8VA 2A0LC 5C2UB 1NFIA 4ES8A 1I9IL 1D9KC 2GI7A 1TQSA 2VMDA 3POCA 4NP4L 1OF2A 3ENEA 4LLWB 2ZKWA 3AROA 5GGVH 4X99B 5IVOA 4ANVA 5JLZB 5ICYB 5H8DA 1JZDC 2WVSA 3S35L 5JIDA 4YHYB 2V4LA 3AITA 3CVHL 4XB7A 3TF4A 3OSKA 1F3DH 1RHHB 4GP5B 1S7VA 4HEPG 4B0MB 2WNGA 1Z32X 1KGCD 2LTQC 2QV4A 3RX8A 1JD9A 4AYID 2D31A 3QIWD 1KG0B 2DEXX 1BM3L 4MDRA 4ZX5A 2DLGA 2NUPA 4ODTH 2HWZL 4ONHA 3HJ0A 4NZJA 3IMSA 4L3EB 4P46A 1R3JA 4M7JL 3RWHB 2EYRB 3QXUA 4BXSV 4LCUA 4DSYA 1KJMB 3EW3B 2V5SA 3V7AG 3SZKC 3UC0L 3QZWA 3DVFA 1OTUC 3TFKC 4URTB 2R29H 5CEZL 5FEBA 1CUOA 4Q9RL 4LRNL 5EF2A 2OZ4L 4KJQD 4X5XA 1PZ3A 4BIKA 4IRSA 4YXLH 3ATDA 4NUQA 4WFGE 2EIBA 4HMCA 1QNZL 5BOPA 2VZSA 5JOFA 3IMVA 1OZUA 3IF1A 5E9DB 2YA2A 1Q94A 3MAWA 5BW7A 1NGZA 4KKPA 4GIPD 3S97C 2B3IA 5CWSA 1EEZB 2ZTBA 3ULVH 5E6SB 3GBML 3HAEH 2VAJA 4HS3A 3MLSL 3ZKXC 3LEYL 1AMYA 2CLZA 3L3KB 3JT0A 4KO6A 4WHTA 1F4XH 3HLKA 2E7DA 2VKWA 5FA4B 5F0PB 4WTXA 4FI7A 3BX7C 4PGZA 4L3CA 1U8QB 4JFFE 4N5ED 3ZPDA 1I53A 1UZGA 2H2SD 4GG8A 2BSBA 4OFPA 2IO5A 3P54A 1XIWA 5FPIA 2FATH 5EU4A 4B7LA 2CH8A 1H19A 1AXTH 4ZOBA 4PU2A 4OD3H 4LU5H 1HZHH 1KCKA 4MAUL 4UQEA 4C8XA 4LCYA 4IJTA 1YJDL 1MHHA 5D1XD 1E4WL 3ZQ9A 4HSAC 5DZPA 1BP3B 3QDJB 4JFDE 3WL9B 3FUMA 3QYCA 4PJ9B 3TU6A 3CDGB 4KNUA 4PW9A 4QRTA 2BSTB 1I3RA 3L5XH 2GC7C 3C60D 4P46C 4R7DA 1MIEL 2JI1A 3RZWA 4DTGH 2EVGA 2AQNA 2DLEA 1N8OE 1JPFA 3B83A 5ERWA 4P4KC 3NQKA 2GTWA 3GJFA 4OCLC 2ZT9C 3ECUA 3B3IA 3AS0A 1RZKL 4IRSC 4QXGL 3S37L 3HW7A 4FAAB 3EJZD 2EYSA 4OBRA 1IAIH 1PL3A 4K5PA 4N0RA 4NWTL 3T0EE 1VEMA 1G4MA 2FWOB 2EE0A 1T1YA 3MA7B 2CNZA 1C16A 1BQHB 1J05A 2IDUA 3ISYA 3B8YA 4FN0A 2VLKE 4KK8D 2R8SL 4JFTA 4LF3A 1MHPL 3REWB 3HPJB 4AENA 4CSSA 3ZDZB 3E7JA 4MGXA 4MMZB 5FYKE 1PKQB 1IM3A 4YAQB 1IT9L 3DV4A 2GY7B 1X5KA 4P04A 2YRLA 1HHGA 1B4JH 4WW1A 2MQCA 1ID2A 5FYJU 5I9QB 1BBJB 3X1GA 5I1LA 2MPVA 1XBDA 1U4EA 3VFNA 2BOCB 5HYSB 2OP4H 3K81A 4BV1A 2G30A 5CJBA 1HSAB 4MVBD 3W9DB 3WNMA 3AACA 1Z9SB 2ICWA 4Y16B 1FL6B 1TETH 3MUY1 3U4EA 2VLLA 2E59A 1XCXA 4MZRA 4EJ1C 2J1YA 4YHYC 2BMKB 4LMQI 3K80A 3VVVA 4Z8FH 2A83B 1QATA 4CVWA 4M02A 3P3TA 3VQLA 2VDQH 2J8OA 3ILPB 5I1CL 5SWSE 1DBAH 2JXMA 2MTAA 1A21A 2JJUA 3IGKA 1TTUA 2DWEB 5JHMA 4PVLA 1GGUA 3BMWA 4ZS7H 4I7ZC 4CDHA 2X42A 4J3XA 4HIIA 3NAAL 1BV8A 3GKWH 4KTEH 4IMKA 2EEFA 3GSXA 1T7ZA 3AS1A 1NCAL 4XMXA 2AI0L 3IDIB 3L16A 2VN7A 2Z35B 4W4NA 3EO9L 5C09E 1JF6A 1XGUB 3KPPA 3RA7L 4C56A 5G4MA 1O6SA 1J5IA 4AT6B 4JDTH 2OR9H 1J8HD 1C12A 5J11B 2Y2WA 4K73A 3X1EA 1T4WA 1XL4A 2VCOA 4HD9A 2UXFA 2XFGB 4GFXA 12E8L 1DQIA 2W9EH 4XCFH 3HPLA 2YD0A 4AW7A 2HFEA 1XGYL 4N8PA 2KERA 4GAAA 5F9JB 1OTTC 3S96B 4YS4A 3MLYH 4V1DB 4W9HC 3L2MA 1U8NB 1IEBB 3RVUC 1PGRB 4JL2A 5LG6A 5LGHH 4XGZB 1FCGA 2ENQA 4Y2OA 1SBBA 2NQDA 4OSUL 1HINL 1TVHB 1U58B 2X9YA 3NRFA 4FERA 4IYKA 4ZW7A 5C0CE 4N1HB 3U9UA 1NQBA 4H7VA 4D9QD 5KSVB 4RIRA 4OM0H 4LVNB 5CSGA 1W2KT 1FG2B 3UTOA 5ADPH 4ODUA 3OKEB 3MGTA 1NMBH 2Y5TB 3EBGA 1BYNA 1F11A 5FCUH 3HHSB 4BH7A 4K7PL 3MRNA 1MHCB 2IG2H 4E9SA 2JKNA 3VXSB 1Q0XH 3G6DH 2DM2A 3E1F1 5H35B 1KYUA 4CN6A 3WG7B 1IEAA 5E0FA 1BXVA 1ZE3C 3S8FB 2K9FB 3BW9B 5CEXB 5IF0B 3JSSA 3VFMB 3K6SA 4LBEB 2JNZA 4H0LC 3ARBB 2WO3B 4ZTEA 5TTRA 2XRAL 4ZZKA 3MV8E 1IVTA 4KRMB 3OX8A 4GQPH 5CILH 3DPBA 2JI2A 2R4SH 1WZAA 3MXWH 1ZS8A 2ZJSH 2FH6A 4MSWA 2FGZA 4GRLD 1MCBA 3QQ4A 3TIDA 5K9KA 3PAVA 4L4VD 1O6TA 3NP4A 4LAJH 4Q6IA 4KQ4L 3LD8B 4YX2L 1KBPA 4KKRA 1MCQA 4H0IA 5T1LD 1N18A 4GQQA 1EAJA 3GMRB 1PZ2A 4PHXA 5D7IB 5EBGA 1CLYL 3JT2A 2X41A 1OSZA 4X7DC 1HWHB 3TO2B 3UGUA 3VGFA 1ACYL 2Z4QB 4O2EB 2CNYA 2IQAA 4J6IA 3L1OL 1S7QA 2NY6D 1NEPA 4M29A 4M7LL 2V2TA 4Y9FA 3K2IA 4M1CD 3F7LA 5I9QC 1JN6B 2IH8A 4DW2L 2FJHA 5FFGA 3GRWH 2XICA 1ZT1A 4GO8A 1E4XI 4YE4H 3MRKB 5FM5O 2VXSL 1IL1B 2DI7A 2ZYHA 3L5IA 3QPXL 1NIAA 3QCTH 4LSPL 5IOPB 2BP8A 5JMRA 3JTTA 1JXFA 4FS0A 4Y16C 3V4VA 1EEQA 4U1SA 5I6KA 1BLIA 5KYWA 7PCYA 4RMBA 5KYXB 3HKFA 1QLEB 1R4XA 3O2DA 4JG1L 4D0BB 1YMMB 3QJQB 5F7KC 5AKRA 3FO0L 2VZTA 1Z9OA 5JUEL 5HDLA 3FU0A 2N0KA 3DXAD 3SYCA 3VG0L 3O3DA 3NSDA 4PUBH 3VRJB 3NK4A 4GQ9L 1GZPB 1NGQH 4YLBA 3N44F 15C8L 1B0GA 3HUJF 3VFVA 4ZS6D 4IRZA 5GPRA 1NDMB 1ZLUK 2Q8AL 1K85A 4ENED 3KPRB 4JS7A 2MOQA 2HRPH 5DJZB 1RPUA 1CGSL 1LD9A 2A9NH 2Z7ZA 1J9TA 2WXHA 3CN0A 5AD0B 3L2LA 2C34A 1ZSDB 3GI8H 1SJEA 2OW6A 5I1EL 4RRPM 3FT3B 1G7MA 3GMMB 1A1MB 4LCIL 3CK0L 2DQEL 4RMWA 4JKNA 3UC2A 2OV0A 1JJUA 2D7TL 3LNGA 4NKMB 3WFHA 5GS2H 2BW5A 1IGTA 2FO4B 5FW7A 4J5VA 1BAFL 4Y4FB 1F58L 3FB8B 5KZCB 1U8OA 1RQ5A 1WHPA 1I7RA 3PQYD 1K4CA 3ULUD 2FT8A 3L9RB 3WNIA 4Z5RA 3S3PA 3R06A 3K46A 1FJ1A 3C6EA 2YD2A 4Z3HA 2Y1VA 4JRYB 1N5AA 1LMKA 1AQKH 4LFHD 1NKRA 2HT4C 4P06A 4XMVA 1YY8A 3RRQA 2BW4A 1S5IH 3B1UA 3LN5A 3VGAB 4HJEA 5EC1B 4X6DF 1GKOA 2D3JA 4BFJA 5BS0B 2CPCA 3O3BA 4LVNC 5EUKA 3VB8A 1ACZA 4KJYA 4X80L 4D0CB 4S1DD 4WUKL 1EFQA 1A9VA 1QSVA 4PG2A 4ZRGA 3U30B 3WUWG 3DO7A 1MCKA 4E5XG 1SVCP 5FS5A 4X6CB 3O9WA 3GXIA 3MUJA 5E8DH 2HLFD 3BQUD 2A6IB 3GBNL 2WKOF 4UDUB 3RVVD 3ME0A 4XVOA 1COBA 2QZ5A 1KJVB 3HE7B 4HIJA 4ZFOB 1CE1L 4EIUA 1G6RL 3VXME 3HB3D 4N9GB 1JYWA 1A7OL 4JPKL 3F85A 5K9OB 1AQDB 2BCKA 2W0FB 5I8OL 4L0ZA 4IBQA 1KYFA 5J1SC 3OXRA 3MYJA 1OV8A 1E5CA 4Z0XB 5F1KC 1BBDL 1N7MH 1DVSA 1TZGL 3KLDA 3LD8C 2XWBA 3V4PB 4AIXA 1R9FA 3FUFA 1A7QH 5GISL 1YG9A 2YGQA 3OMNB 3ARTA 1WWCA 3CSFA 3WOVA 4DFIA 4FI6A 3P77B 2H6PB 1CF8L 1CPUA 3CXFA 4QRQA 4AK1A 4G9FD 3N04A 5FGSA 3BUQA 2Q6WA 1TR7A 4JRXD 5DFVD 4ZODA 5JHDD 1HILA 3QPQD 5CLTA 2KQNA 1YUHB 5D1ZA 5EUOE 3I2CH 3WENA 5DU7A 4HQQH 3TA3D 1DBJL 3ESVF 2QLVB 1VPOL 2A0LD 2ADJA 4UQBA 3D8MA 3WNOA 1D9KD 3MRFA 4FKHA 5DD3H 1ZTMA 2Q20A 1U8LB 3NACH 3RHWF 1OAZL 1W72B 4MRCA 1ZY9A 4KXZH 3UG5A 5TDOB 2YOCA 4QJ4B 1CU4H 1DVFA 5ALCL 2R1XA 3MRJA 5I19H 4TV3A 2JSFA 3IDYC 5IBLD 2R0KH 5GGRY 3TYFA 4JG5A 4CBZA 1TSHA 4FZEL 5JPNB 2J1WA 4AM0A 5FO9A 4HWEL 1FL5A 2WBJD 4XZ4A 2EE3A 4ZMWA 4F9PA 2BFVH 4ACTA 5IJVA 1NAKL 4U2ZA 3VFWB 4GW1B 4IHOA 4AH2A 4ONGH 5DD5L 3OMIB 2V9QA 4BZ1A 1OE3A 2L7UA 2F7QA 2QPDB 1ILUA 2F74A 2CRIA 4GI9A 2ZXBA 5I1JH 3TFKD 1S7SB 1ZK5A 2H3NB 4AL8H 5E1QA 1P84K 4BQ6A 3PS6A 2FR4A 4P5MB 3CMOH 1PAMA 2C9AA 1FYTE 1M7XA 3AZUA 4RRPA 4Z7WB 3B1TA 2LU5A 4BFBD 3MROB 1EHLL 3KWXA 4UTBA 2OL3B 4Y4FC 4TVPD 3HUJE 4G8AC 2IGFH 1QFWL 5AKSA 4ZUTA 3RWJB 2V7HA 4Q9QL 3ULUL 3D4GA 2AQRA 1SFDA 1X6NA 2NYYC 5DD0H 2HJKA 3CDFA 5JDJA 5ITBL 2J2ZB 3HI6L 1X5ZA 2RHEA 3A21A 3TWYA 3QXTA 3MJ7B 3P4OA 4I77L 3V5KB 1AGDB 4I8DA 1JGEA 2QVTA 5IB5B 3KLAB 1N4XL 1MG2C 1MREH 5I8CB 1BXAA 5AWNL 1Z0NA 3QNFA 1QFHA 4E41B 2FO1A 1OGSA 3QDMA 2Y7QB 4KMTL 3VGAC 3X14A 1JVKA 3Q6FA 4RA3A 4K9JA 4M62L 2GI0A 2ZZUT 2OYMA 3DVGA 3HZ3A 1HOCA 3VFUA 4A6YB 5EIIG 4Z3FA 3G6JB 3K2MC 4KAQH 5AUMB 4A7GA 3U30C 3ROLB 1N2RA 4YBHA 2TRYA 2AJVH 1T1WB 3LKPB 3HG3A 4R8WL 2YIHA 3LSOB 3O6FB 1QTPA 1DBML 3I50L 3CGTA 3L3JB 4ANUA 1CI5A 3QEUB 4PJ7F 1E7VA 3HE7C 4X6DE 4P46D 4FFWC 5D55A 4Q89A 5TD4A 3KCPA 1NMAL 1SDDA 3FFCA 2VXTL 1ZLDA 3FHAA 2O26U 3I9IA 1EMTL 1QR4A 1YUKB 3O45A 2H1XA 1I9JH 3TBSA 1PYWA 1I1AB 4IRSD 4F57L 4P9ML 4GIOA 3I75B 4OCWL 1UWFA 2KLRA 1D5XB 2F8OA 1EGJL 5F1NA 1UHVA 3W11C 2GJZA 1NFDF 3GSRA 4NLAA 2BNRE 2YHGA 5DZVA 3SCMB 2F58H 5EO1B 1UACH 1A25A 3IJHA 3IMRA 3OKOB 2E76C 1QHQA 5HI4D 3OPZH 5IR1B 1Q4NX 1QBML 4FFZL 4XO3A 1AI1L 1C08A 3ZTNL 4ECNA 1N0XL 4G72B 2LLGA 3IJSA 4KXBA 4OUUA 4EDWL 2CK0H 1FFOB 5E4AA 4EI5C 1LDSA 2JK5B 5I8EB 1CICA 2Q2LA 4IU3B 4P5TA 1RZGB 3RTQA 4FXKB 3W82A 8FABB 1U8CB 2Y72A 4GO9A 4AMKL 1XIWD 3J27A 1I9RH 4YO0B 4GPVA 3AGVA 4WNQA 3CXDH 1QUNA 3FUJA 1YAIA 2NXZD 2PETA 1ZHNA 2B1HL 4L05A 4ZAKA 2DKUA 3S2CA 5EBLB 4KZEH 3X12B 4K71B 2X70A 2WQUA 4ODXB 2EIJB 2WBWB 3UFIA 2MQ3A 1NSNH 5K5YA 2EH7H 2DQCH 2WK2A 4LEOB 2AGJH 3G5VB 2ADGB 3MV7A 5I75B 1J8KA 2Z92B 5AOMA 3KNBA 5HYJB 1USQA 2YBRA 1AANA 1MFMA 3C5ZC 3LKNB 3FDWA 2IXQB 3MV9A 3KPNA 1R0AH 4ZXBA 3BKML 2ITCB 2B2XL 1MWAB 2X4PA 2F19L 3PYCA 4PTTB 4WF7A 5J3HC 1RI8A 1ORQA 1SXSA 3O6MH 2XKUA 2KZBA 5D7JA 2VJXA 4BCYA 2A77L 2DICA 4I3RH 1UB5A 2KMWA 2XACC 5HDBE 4DT2A 4NQXB 5DJ2A 1N5YH 2DBLH 5CZVL 1IBBA 1JNNH 3EGDB 2ILLA 4I1RA 4MNQB 3BDBA 2VQ1A 3NIDF 1VB9A 2H1LM 4OI9A 2AABL 4UMSA 4XNZB 4HGWB 4TVPL 2C4XA 3QNZA 1I8AA 2LVEA 2BHUA 1IM3D 1F6AA 3EOYG 4ELKB 1EBPA 4KDTA 4M8QA 3JV6B 2F1EA 4BDVA 5JHLA 2ENPA 1YNKL 1OTTD 3TBCA 1CQYA 4FADA 2DD8H 2DQIL 3OMAB 1CICC 4XOBA 4P5TC 5FWQA 4C59B 4UNUA 3CIQA 5FYKU 1KB9K 1RZ8A 1W0VB 3OAUH 5L8KB 4PJHF 1TQBB 4HH8A 4UM8A 4TPRL 3UAJA 3F7KA 1SXAA 3ECBB 3GZQA 5GGQH 5DUPH 3THML 5KN5B 3MLUH 1NL0H 3QO0B 2G9KA 1FPTL 2G4GA 2NSQA 1ZE3H 2YFOA 3HS0B 4JPVL 2JLLA 2J72A 1KPRB 3CN4A 4F9LA 5J6HB 4Z7OB 3ARGC 3D39E 3DBXA 3QUYB 1VRSA 5FHAL 3EZJB 4O2FA 4X4KA 1B9KA 5KJRL 4UT6H 1A0QH 1KFAL 4H8PA 1A2YB 4CGUB 3CUPA 3RL1B 2X4OB 1MQ8A 4QKXB 4ZXBC 5K1JA 2WXFA 1FO0B 4JQIH 1UGKA 3UDWA 4CKVX 5L2JA 1GS7A 3Q1SL 5EIQA 3CFEA 3O41B 5BJTA 2XWTB 2YC1B 5I6PA 2IFFL 1FNSH 1Q9OA 4TUKL 4CW1A 5C8JA 4EVNB 1E5UI 3QC5X 3G5XA 1QRNA 2JKXA 5GIRA 4KRPD 4MXVF 3UH8A 4LEEA 5E5RB 2YXFA 2WQ8A 4U3SA 2M1KA 5TQ2L 2HH0L 4JQVC 3EJSA 3QA3A 4C56D 4F2EA 1U8KB 4LDEB 4W6WB 2EACA 1XX9C 2XN0A 4MLSA 4ZSOA 4FKEA 4LLDA 1TTFA 4G83A 1M1XA 1UWEH 1ZGLB 4PJ7E 5BRZE 3KL5A 4E2OA 1ETZA 3CH1A 3I6KB 2FJGB 3TURA 4PCSA 5EPMB 5E5UB 3D85B 4JCMA 5EZIL 1BHGA 2X1OA 1MNUL 3H3KA 3BCFA 3E9UA 1X9LA 2DIJA 4A68A 2V5YA 4OZ4B 3MJ8B 1P4UA 4J3OF 4LGPB 2R0LH 3MLRL 5F1IA 4D9LH 1JFQH 4PJAB 4FXKC 3C5SB 3ZMRA 2V33A 4FEMA 3P2DA 1NFDE 4F9LC 1KJ2A 2P47B 3R18A 3P9LA 2QDVA 3C9NB 4U6VL 5AB0A 1RMFL 1X7TA 2X4QB 2XVKA 4TULH 5IB4A 3ZN6A 4BGLA 1IEHA 2EDFA 3FT9A 5EU7C 2YRZA 3HG4A 4ORGA 3QG6B 4K71C 3P0VH 2UXVA 4LEBA 4ODSH 1G0XA 3GXFA 1RIHL 4Y5VA 4M5ZH 1LDPH 1T21B 5I75C 4OI7A 3V0EA 4XPAL 4LLVA 5IQNA 3U2IA 3SE4A 1JGUH 2CALA 3WUWB 3GHBL 4E5XB 2B1AH 2XQYG 1QQDB 4OLUH 3WE6A 2W81C 3AABA 5SX4H 1DVZA 4MCMA 3T0DA 5HVFB 4GAYA 2EUXA 1RJYB 3UBXI 1HNGA 2DQGL 3MC0A 5BMFL 1YEIH 1NMCC 4WKZB 4YVNA 2D3NA 3AWFA 1KYDA 4Z3TA 3KPSE 3DX9A 4U1KB 1S9YA 2D3LA 4I87A 1QMUA 5I6NA 1G94A 1X9UA 4YHLL 3NA4A 5C9KA 4XP5L 1O7DC 4D9RD 3TBTA 1JNLH 4FXLA 5I0ZA 2XN9D 2C1OA 3GLAA 3RWCB 2P8PB 1HZLA 5AW9B 3GNML 1DQJA 1FZOB 4UQ3A 1F1DA 2AMGA 5CLYA 1L9MA 5ID0A 1VERA 5F7EH 3PWNB 1A7BA 1TJIH 2NNCA 4HS8L 4ZUUA 3TTSA 4AE1A 3L3OB 2ALAA 1RUKH 2E4FA 3IS1X 3BI9X 3MRLB 2UUDK 3N85L 2HKFH 4MQ7B 3UP6A 3VFPB 4CMMB 3C12A 4PS4L 4XP6H 5FIEA 1OK8A 2HT4D 5F97E 2VXUL 1L9SA 1FWXA 2EH8H 5J06A 2EDRA 2NY4B 1MN4A 1OAUL 3BE1L 3P02A 2R9HC 1IARB 5DK0A 3Q5TA 2IPTL 3NIDE 4J3UA 2FD6H 4KX7A 2WD0A 3DOIA 3L5HA 1AQHA 5AOLA 1HOEA 4A67A 5FKAB 3HS0C 4WFHE 3WIHA 3DHUA 3WD5H 2EUVA 1EAPB 1OE2A 3X1BA 2Z65C 1NBYA 1JRHI 1RZ7H 3BAEL 3QXAA 4Y5VC 1GW6A 1JV2B 3PY9A 4WU7A 1VLXA 4HIEA 2FWSA 1UA3A 1TQUA 1I7UB 3JTBA 4WKXA 5EA0L 5CGBA 3VI3F 3WLBA 4NQCA 3QCUL 5LGJB 3H7BA 3HZVB 2YD1A 4PJHE 2FUTA 4ENZA 3ZZ1A 3IXTA 4NM4H 4PB9H 4RVBA 1GKEA 2N59A 3DETD 3IJYB 2JF1A 2PTVA 3WKNA 3VFSB 3O3UN 2B5IC 3V5HA