3E3QE

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 111
sequence length 111
chains with identical sequence F, J, N, S, W, a, e
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e3qE00
1EO5A 4NFDA 1BQUA 3QUZC 4OT1H 3SE4A 5JW5A 4P2QA 4KJYA 3C5JB 2A6DB 2HRPH 1FAIL 2DQEH 2HG5B 4ETQB 2O26U 3MJ8A 4Q74A 2VSDA 3IFNH 4NKDA 3EYOA 4WHDA 3RX7A 5DZLA 3CVIH 3GIZL 3D9AL 4FQLH 4HXAL 3INUL 1HHJB 2JJSC 4OF8A 1ZLUK 3C60B 3V6OE 1LEKB 1UWGL 1ORSA 4OLUL 1AGCA 5EO9A 4M43H 1RURL 1N5YL 5IBTL 5HHOE 2UWEF 2R0ZH 4NT6A 2WBJB 4GW5B 4Z76B 4EI5D 5LAXA 1JZ3A 1QSEA 1WWWX 1XGQA 4TPRL 2V5SA 1BFOB 1SBSH 4NO5A 3VXPB 3V52L 5I8KH 3D6GA 2GK0A 3CU7A 2GQHA 4RGNC 1NGYA 3O9WB 4HK0A 1I1FB 3QA3B 4P4KA 4QRTA 3KYNA 3PP4H 1X5IA 4FMKA 5GS3A 3O8XD 4DVRL 3OGCA 4ISVB 2KQNA 5DS8A 1SMOA 2PF6A 1ES0B 1XF4A 3QCTL 4OQTA 3SKOB 2M1KA 4N5EC 5MP6H 1A6VH 2DTSA 3QXAA 2CO7B 3JV6A 4XZUA 4PB9H 4XCNB 1BIIA 4G8GA 1DQJA 5EBLB 3CMOL 1A14L 5JIPA 4ZD3L 3CVHB 5FECA 1MCWM 5CGMA 4GMTH 2ZCLL 2W0LA 1RK0B 2Z35A 4NRZA 4K7PX 4U1JB 3V7AG 3GB7A 4PJDA 5KS9A 3FONB 3S5LB 4Q9RL 3PP3H 1EGJH 4NOFA 3P4NA 2VC2H 3CXDH 4LMQI 2C26A 2VDQL 1D9KC 4X0KB 6FABH 5C0CE 2W1NA 4PRPB 4N1HB 1BOGB 4JR9L 1A02N 3IFOB 1NMCC 5CILH 2FO4B 4NCC2 1AFVH 3T8XB 3I6GA 2F74B 2VE6A 3MLRL 3ARRA 3KLAA 1MHPH 1QR4A 2Z8SA 3MV8A 2B4CL 1JNNH 2GSGA 3ARBA 3U46B 5JUEH 3WXWL 2C3HA 1P84J 3OPZL 4XCCH 2JELH 1VGEL 3TO4A 5HHVL 43CAA 4BH8B 5D5MB 1YEDA 1C5BH 2BVUA 3MMEB 4LPYA 3JTSB 4U1GB 1HKLH 4WFHD 5DQDH 1Q1JL 3JUYA 1JNLH 4JEGB 1CTOA 3VXOB 1NCTA 4P5MA 3RGVD 1HN1A 3U36A 1XH3A 5FKAB 3WS6C 3KPLB 4LP4A 5I74C 1OSPL 4I3SH 3ZT5A 4HLZH 4J3UA 5E95B 1KEGH 4MA8L 5EH1A 3KPPA 2BSRB 5C0NC 1RUML 4ZODA 4HKXA 4X9HA 3BN9D 1JPTL 3UDWC 2MMXA 4L1DA 4OM1L 4P4RB 4LASL 2UWEE 4LHUA 3ISWA 1QSFD 3QEHA 5H2BA 3FQTB 2WV3A 4G6JL 1BF2A 4ACPA 1RIVL 2R0KH 2XXMB 3HPLB 1UM4L 2IG2L 5KVEH 3PDGA 5F93C 4OF3A 1FFPA 2YKLL 1CD0A 4JY4A 4TOYL 4LSUH 4LRNL 2AQ3A 2BSTB 5T1MA 5EBWB 3NGBC 1NBVH 1MHCA 5SX4I 1OARL 3T4YA 1AQKH 2APBA 2R2EB 2X89D 1QKZL 1QQDA 2YPLA 4WCYH 4AIXA 1KLGA 4DW2H 1T1YB 2R8SH 1JFQL 3Q3GB 3VA2C 1IMHC 5DWUL 2X4UB 5GSVA 3V4PH 1G7LA 4P46A 3OAZH 3V5KA 3BZEB 1B4RA 3VXSD 1LMKA 4PJCA 4IIQA 1C5DB 4JFFA 2RB8A 2HRPL 3ZYIA 3D85D 3BH9A 2DQEL 2A9ML 5K9JL 5D2LA 4YHYC 5ID1B 3CDGB 1DE4B 3IFNL 1BVKB 4L4VE 1T0NB 3BGMA 3VXRB 3QIUD 1I85A 3V5DA 2AQ2A 3ARGC 3LS4L 2X7LA 1MRDH 3DLQR 2R4SL 1DBBL 4FQLL 2VXUL 1EMTL 1EFXB 1KTDA 1UYWL 2EIDA 3KWWB 3EYSH 2KZWA 1TZHB 2WWMD 2G60H 3FFDA 3WLBA 3FQUB 3WDJA 4MJIA 1YQ2A 2Y4SA 2YSSB 1E4XI 5I19L 2HLFD 4CADB 4Y19B 1C5CL 2V9QA 1PG7H 3PGDA 5D1ZC 5I75C 4O2EA 5A3ID 4H88L 5HDQL 4LPTA 4NN7B 4PRBB 2VZ3A 3ZT7A 1DUZA 5HVHB 1U93B 4LDEB 2PXYC 4L4TE 4XBGB 2VLKD 4RNRA 5GRZA 2IAMB 2YRZA 3PP4L 2AW2A 1BBJB 1BVLA 4JHBA 3DXAD 4Z7WB 1WV7T 3SOBH 1NUGA 5EN2A 1DBAH 3EYFB 4QXWA 1A7PH 2ADGA 2VABA 2KKQA 5MP6L 4MXWH 1MCQA 3MLXL 1MJ7H 4I18C 2DQJL 4PB9L 3BH8B 5B8CC 3SGEH 2EYSA 3MRGB 1A2YA 5CEXA 1VPOH 3DWTA 5DXWA 3VGDA 4U0QB 5DRXB 5SX4H 1CFQB 1ZHNA 2FYYA 2Z8WC 2CD0A 4P5TD 4FFZH 1NFIA 4N1CA 3Q48A 2N7AA 2AGJL 2W0KA 4Y2OA 1EGJL 2VC2L 3HKFA 4OLVL 1S7WA 4LCYA 3D18B 4PD4K 3QJFB 1U3HA 4JRXB 3UTSB 2JCCB 1JWMB 3BX7C 4C83A 1UWEH 1MQKH 4XH2A 3HCVA 2R56H 3GIVB 5EPMB 3MOQA 1AFVL 3UPCA 4O51B 4QOKA 5K9OB 3BVNA 2MNUA 5BS0B 2F54B 3G9AB 1MHPL 4KJWD 1AGDB 2ERJC 1CXFA 2B39A 3KPMB 1MHHA 2GUOA 4IOIB 4XNZB 5J3HC 3QAZB 4OZHF 4HUKB 4Z8FL 4ZO6A 1HHHB 1I3UA 4GRWB 2JELL 1T04B 1A22B 2D0GA 4WUKH 2YZ1A 4ZOEA 1N7MH 4Y4FA 1WC7B 1A4JB 3MZTA 2AJUH 2A6KB 3GSVA 5K93A 4F33A 1MCLA 1AP2B 1JNLL 3EJYC 4YNYB 4Z7VA 1FO0B 1TVHB 4Q6IB 4LF3B 5DFTA 4X6CA 1QACA 3MLZL 1U8NB 3ARZA 4ODWA 4PJ8B 2ZCHH 2EDHA 4U1LA 5HPMA 5HHXH 1WT5A 3ARUA 3RVWC 2ZUQB 3PF2A 5FO9B 1KEGL 3K1KC 4U1SA 1BJ1J 3QHZH 2IANE 5F97E 4I0PA 4YHIB 5C0EB 1CQYA 4WU5B 3OKNB 4NNXB 4XB7A 1WCBB 3ZKMD 4R7DA 4Y8AA 4M6NH 5EU6A 2DL9A 1S7VA 2NMSA 1CIDA 3IU4L 1UH3A 4HC1H 1CGXA 1NQBA 1G7PB 3TC9A 2W65B 1U3YA 1TLKA 3VU2A 1OTUC 3BAEH 3U1SH 4PRNB 3FN9A 5EZOH 3HAEG 4QTIL 1M71B 3C8KA 4GRLB 4UOJA 2FHCA 4QHKJ 3LMJH 1AGFA 5CUSL 1MJJB 3T2OA 5FAAA 3GM0A 1NC2B 4PJ9C 1CS6A 4XVUC 5E99H 1NBVL 4X4ME 1EHLH 4Y16B 4P2OD 3WJLA 7CGTA 3KXFD 4DFIA 1AQKL 1LD9B 2C3WA 5DMKA 2DI7A 4IEFB 4JKLA 5TFSH 2K3TA 5D7KE 1JBJA 5GZOD 3C5ZD 2Y07L 4O9HH 4JG0L 4U1HB 2CUIA 3H7BA 3PUCA 3V4PL 4MZ2A 1NCWH 4DAGH 1XGUB 3AREC 4PRHB 5TE7L 1M7DB 1FNEB 1RHFA 4X4YA 1BD2D 2A0LD 4KK6C 4M7KH 4Y2DC 5DK2B 3OXSA 5J13B 1Q0YH 3MLWH 4YGVA 4ZS6D 3W0WB 3CFCL 4ZUVA 3MLSH 4XBEL 1HQRA 5EUOA 1MRDL 1SYVB 4U6XA 3VDCA 4U6YB 3PP3K 4CVZB 3GMRA 4LLVB 3TBTB 5C0AD 2P8MB 4QLRA 5DUMH 3QG7L 2P42B 4YEEA 5HI5D 3QUXB 2BOBB 4JVPA 2H6PB 4GG6A 3ARVA 1CZ8H 1J1XH 1BJMA 1PG7L 4JVUA 1JIBA 4OUUB 4OZHE 4MAYB 4CJ0A 4R3SB 3VG9B 2JIXB 1NCAH 4Y4KD 1JMZA 2VTFA 4TVPD 5JZ7D 5K9KA 3DIFA 5BQ7B 1DVFD 4X7TA 4FFVC 4PJGA 4L3EE 1AGBA 3TWCH 2NQCA 3K46A 3ULUD 3U9PH 5MI0C 1ED3A 3GZKA 4ZPVA 2OXHA 1Q9WA 2OS7A 3T0WA 1DBAL 1HI6B 5C0FA 4JPKH 5GS2H 4MXWL 1QSVA 1MJ7L 1ZLWH 3THMH 2IPKA 2HFTA 4FFWC 4BFGA 2X9WA 4LSRH 4NSKA 3ZTJH 2W91A 3P4OA 2B5IB 1ZVYA 2W38A 2FGWL 1BECA 4FQQA 2Q3ZA 3T65B 3ULSB 2R0LH 1HIMH 4NHCH 3VFUA 5C9KA 4FFZL 2IF7A 3REVA 3C9NB 5C07B 5I30L 5F1SA 3VXRE 3EO0A 5IBUG 4M6ML 4M1GH 5I1GL 2P1YA 3CX5K 4YFLF 3BOVA 2HJKB 1NKOA 1QRNB 3PV6A 3L7EA 1TTGA 5C08A 3HE6C 1JWUA 2NY6C 1UB6B 1MQKL 4WY7H 5IVXA 4RFNC 2YOCA 2ADJB 5BVPH 3RUGA 4YX2H 5L2KB 1GZQB 3EOBA 2R1YA 1ZLSH 4MB4A 1IBGH 3G6AA 2RIKA 1T80A 2GFBB 4LVNB 5I73B 3IJSB 2X4TB 4MSWA 3H7LA 4ZAKA 3BP4A 4WUKL 1A7QL 3O3DA 1BZ7A 1N7ML 4XMLL 1J8HB 1CK0L 1FC2D 2EDOA 1CD8A 1E4XL 2BNUB 1HDMA 1D9KA 4KMQA 3X3GH 2V9TA 1CXHA 5JR1H 3X14B 3ME0A 4NQEB 4CVXB 1I9RL 4PR5A 4N8CL 1AKJD 5DVOA 1JVKA 1OCWH 1IRAY 3R06A 3CLFH 4D8PB 2CLRA 4FQ1L 4U7KA 2BNQD 4TTDD 1WFOA 4XP6H 4CNIA 3UBXG 2BMKA 4TNVK 3WS3B 2EDRA 3QHZL 4FZEH 5CKGA 4KKBD 2Q76A 2XWTB 5E6IB 2G75A 4CGTA 1FZKA 2AXHA 2DM4A 1BLNB 2XXCB 4M6NL 2GTZA 4N9GB 5TJWK 1RZKH 4PP2B 4FQJH 4HC1L 5IM7A 4NNYA 4LHQB 4JM4L 2IH1A 1N0XL 1FFOB 4JRXE 5EZOL 1PX4A 1F4HA 1ND0A 4PLJC 2VISA 3AU1B 5DD5H 2R2CA 3UZEA 3LMJL 2VQTA 1CCZA 2NXZB 3T0EB 3GGWA 1I8LC 2DLEA 5IK3B 5E99L 3O6KH 2NY2D 4HK3N 3V7AE 1EHLL 3QUKB 1PQZA 4LCCA 1KIPA 4NC1C 4OGAD 4R9HA 4LVOB 4Y4HB 1QVOB 1PW3A 4WFHE 2OSLB 4MXQD 4YBQC 2Q20A 2HT4C 4O9HL 2ZNXA 3WNNA 5J11B 1XCTB 5DJYB 4G43A 2W0FA 3BO8B 1NCWL 5TF1H 1J5OL 5ESVA 1Q9OB 2PYFA 1KLUB 3B9DA 3RIAK 4JFZH 3VE0A 3S37X 1LILA 3MX0A 4JDZB 4XNZC 3QAZC 3SKNB 1Q0YL 3HNSH 1NSNH 3MLWL 1CFBA 3I84A 4PGBA 3FKUS 2R15A 4ODTL 4IOFC 4F7PA 3GFUA 4H26A 5ERWA 2IQ9H 1YEIH 3CX2A 3ULVD 3VWJC 3RVVD 1PBYA 1H3GA 1U8JA 1BX2A 5IV2B 4PTUB 3MRFA 1OGAB 3IAQA 3LKRB 4XWOC 1T5XB 3NZHH 5GIRB 2ICES 2GHWB 4YDLC 3TYGH 2P5ED 1HCVA 1J1XL 3MUGB 4RA0C 5E8PA 3KPSD 1MH5B 3W9EB 4LLWB 3REWB 4APQB 3ZKXB 3D39A 4MD5A 4M7LL 5HGBA 4Z5RB 4UDTB 2BDNH 1KNOA 3MRQA 4OV6F 3B5TA 4D3CH 3TWCL 1UGNA 3UPRB 3TM6A 2ZSWA 1L6ZA 3KPQB 5IBLD 5E56A 2Y06L 4MHHI 1ZTXL 3GI8H 2OCFD 3DO7B 2E6JA 5I8EB 1EBPA 1U36A 3A6CL 5TH2A 3THML 5KSUB 3QDGD 2V7NB 2E8YA 1T83C 5ICYB 2C7UB 4LSRL 1FZJB 4LLUB 1CF8L 1M6OA 5SWZD 3D3VA 4J4PA 1AD0A 4JG1H 2MPAH 4HKJB 4P2CG 2HFGH 3VH8B 3B2UD 2AKRA 2PXYA 2R0LL 5B39G 2NTFB 3EGSA 4NHCL 3VWKC 3UJJL 3H9ZA 4XVJL 1CICD 3A67H 5F9JB 1KPRB 4LKXA 3W0WE 5KVGH 4PTTA 3V5HA 3B9KC 4WWKB 3BMWA 3ET9F 3TNNA 2Y72A 5BRZB 4CW1B 1F02I 5MEPA 2XOTA 1HH9A 4EN3B 1NBQA 3T2PA 4YHPB 1NCDL 2QHRL 4GW1A 3IDXH 1CLOL 4KQ4H 4I18A 3B2VH 5HGDB 3VGHA 2XFXB 4RA3A 1HNGA 4Q97A 5BVPL 4MVBD 1RJYA 4YX2L 3KNBB 5FEBA 5BCAA 1NGWA 2EC8A 1IBGL 2VZVA 2HTKC 3DXAE 5BXFA 3P9WB 2F8VA 3V6FB 1GVIA 2NLJB 1VSCA 5TPWH 4WTXA 4OI9A 4YE4H 4R97C 3F6IA 3QUXC 1U41A 5T1LD 4DKAA 2ZPKH 5D8JH 1W0WB 1A9BB 3C5JA 3L7FB 3GSRA 4YGAB 2A6DA 5JR1L 2JJWA 3LRGA 3QFJD 2HG5A 1VFOA 2R2HA 4O58L 2EIEA 4ETQA 3KHQA 1EXUB 3DOSA 2CMRH 4JFEB 1LO4L 4QRPD 3NTCH 3MLYL 3VMPA 3CLFL 4XP6L 4J3TA 3R8BB 4KC3B 3FZUC 1LVEA 3FOLB 3C60A 4ONFL 4FQHB 5C2UB 3DGCR 1S7TA 3NA9L 1O0VA 2BRQA 2VDLH 1MRFH 3SE3A 3RHWF 4OLYL 2W07A 4PJIA 4R26L 5LKNA 1D6VH 4GW5A 4Z76A 5IB2B 2UZYB 1TZIB 1BFOA 2R9HC 2NY3D 1CD1A 1D5MB 5SX5H 5GGVY 4HUXA 1YUHB 4JAMB 3VXPA 5F89B 3D2UD 5DD5L 1INDH 1L7TL 3O9WA 4X9BA 4K7PY 3NZ8B 3ABZA 3QA3A 4M6AA 3DSFH 2D7TH 1FG9C 2JE8A 1U9KA 4P9HH 2CDEB 5C3LD 4I9WD 2Z4QA 4F2MB 4N90D 5TQ0H 1JYVA 2ARWA 3SKOA 1ES0A 4PRDB 3ULUF 2E7MA 2BK8A 1DQQB 2AI0H 4MJ5B 4JANA 5EULV 1PX3A 3I9GL 4XCNA 5F7LB 3R0MA 1EZVX 4JN2B 2QQQA 5EBLA 5TF1L 4R0LB 4F9PC 2D7NA 1T66C 1ZLWK 5C7XH 2YN5A 1B3JA 3S8WA 3CVHA 2Y5TB 4JFZL 3ELAT 5H94B 1RK0A 4U1JA 5DVLA 4FQIH 3QIWC 1RULH 4LVNC 4GOSA 4X6DF 3SKJH 4NQEE 3MBED 3FONA 1RZKC 2WMPA 2VDOH 1IAIH 4X4XB 3EDKA 4M61A 5CHNB 3OR7B 4PGCB 1X7QB 2OMNA 1H3UA 2HMIC 4X0KA 3WFHA 4XVTL 4AEIH 1QO3B 5GGUA 4BZ2H 1KGCD 3BSZH 4PRPA 4RCAA 1MCPH 1JGVH 2LU7A 1BWMA 3IFOA 5IMOB 1NUDA 3BDBA 3N1GC 2FO4A 5ACZB 2GJZB 3NZHL 4R2GC 2F74A 4H5SB 1CGYA 3AREA 4P3CH 3WUWA 4C4KO 1R5VB 5HVFB 2J8UA 3HG1B 4M48H 5EZLB 3V95A 3WIHH 3H42L 1T2QH 1LE9B 3U46A 3ARDD 4ZTOH 2BDNL 1I1AC 1CT8B 4KJPC 3BZ4B 4BH8A 5D5MA 2DYPB 1YQVH 1UG9A 2DICA 5FUOH 2BNRD 4P48A 5E6YA 1F6FB 3JTSA 4ZXBB 5C0RL 4N0YL 1DL7H 4G7YL 4WDIA 1AY1L 3VXOA 3V0AC 4U2ZA 2WWKO 5CBEB 1NCBH 3PGFL 3KPLA 2Y36H 3EO9H 4G8FB 4YXHL 4KRLB 2Y23A 2FATH 1DEDA 4WO4D 4E0RB 1J9CT 4X7EC 4MCZB 2FIRT 4JG1L 3QIBD 4AL8L 1KCUH 4F8TA 1MCCA 4P4RA 5C09A 4CU6A 2IBBA 4Y1AB 3CFJB 1YY9C 1BZ9B 4YHKH 2FBJH 4U7MA 5A16B 1MPAL 3HPLA 2VXSH 1P4IH 2HA1A 2DJSA 1TNMA 4KQ4L 2WNGA 3DECA 2M26A 3HUJB 5KSAC 4TVPE 2ARJB 1RJCA 4LLDB 3ZL4H 2DQUH 4FXGB 1X5YA 5EBWA 4BQCA 4UIMB 1PAMA 4ESKA 5I76B 4JGUA 2O5XL 3SDAB 2R2EA 4KY1H 2Q6WB 3U7AA 4ENED 1G6VK 3MODH 4PLKC 1X4YA 1F6AB 5DYOA 5TPWL 4HGKC 5DEGB 1AC0A 1T1YA 4QEGA 3Q3GA 2X4UA 1YEHH 4DOHB 5D8JL 1C5DA 3QI9C 4ZFOB 4X6DE 1NGXB 1MF2H 5CEZE 5KVFL 3HE6A 5DRNB 3ZKXC 4KK5D 4HT1L 4H1LG 1T2XA 3HE7D 3CDGA 2BVYA 1DE4A 4XC1H 2HVKB 4F7MB 1LO2L 1BVKA 4KPHL 3NTCL 1T0NA 5FF6B 3TV3H 3SDDB 4UNVA 4JFOB 2CKBB 5EO1B 5DJDB 5CGYC 1EFXA 4NO3B 1FL5B 1T5WB 4O02H 1HILA 2AAVA 1P7QD 2EZ0C 1TZHA 5HDBF 3MV9D 3S35L 3FQUA 4JO4L 4XP9L 4NCDA 5J89A 3E1F1 4LU5H 3KPOA 2YSSA 3ARYA 4CADA 4Y19A 1K5NA 3E0GA 4RGMC 5BRZE 1ZVHA 1A6UH 1TFHA 4MWFB 4PRBA 4YXKL 1IZJA 1U93A 3VFTB 4XBGA 1ZHLB 1INDL 2IAMA 3MROB 3P77A 3SQOL 1F8TH 5E2UH 1BBJA 4Z7WA 1T0PB 5J1SC 5FDWB 3UTTE 3P4MB 3EYFA 1KV3A 2AI0L 4GKNB 5SWSE 1C7SA 4YZFE 1WBXB 1YJDH 1FNGA 1HWGB 1XF1A 5EORH 3DYOA 3BH8A 4XI5C 2A9NH 1OLLA 4NQVB 3MRGA 3MTRA 3NCFB 3RDTB 1T7VA 2HT2D 2BNQE 3VFRB 5F9DC 2JB6B 5DRXA 2P44B 2M8XA 3O6FD 4B50A 4OLXH 4ZNEA 4GAFB 1T4KB 1VESA 1I8LA 2VDOL 2XN9B 3PWNA 5J4MA 4FZ8H 1KB5H 1H15B 4DN4H 4GKZB 4NQDB 3JTTB 3UTSA 2JCCA 2OJZL 1D5XB 1JWMA 3RRQA 5JIKA 3TBVB 3B6SB 4BZ2L 3BSZL 5DEZA 3RVXC 2R4RH 5KSBA 4OZGB 1JGVL 4P2RA 4AQ1B 3LS5H 4QHNB 5K9OA 4O51A 1E6OL 3FAXA 3O4LB 4P9HC 4M5YL 2F54A 4P3CL 5BS0A 4OB5H 5E9DD 1I8IB 3Q5TA 4GMSH 1AGDA 3EYQC 4RZCB 3WIHL 2VIRB 5DJCA 4R96B 4FQXD 1P7KB 3VCLB 1HHHA 4KROB 1RZGA 2NXYB 1T04A 2GSIB 4JPWH 1B6UA 5F9OL 1YQVL 1WC7A 1T3FB 3QP3A 5GS0H 5E03A 5FUOL 1B0GB 4LRIC 5GGVH 3GRWL 2RCSL 1A0QH 2VLJB 3KYOB 1AP2A 1A3LL 3M8OL 3WXVH 1C12B 4YNYA 4BSJA 5I1HH 1TVHA 5FYKE 4Q6IA 4LF3A 3DUSB 4U0RC 3RBGA 4K7PH 4HF5L 3IDYB 5IHZB 1U8NA 4PJ8A 5FDYA 2HFFB 2Y36L 3EO9L 1K3ZA 5HYFA 1BQLH 3WN5C 5FO9A 3WNKA 5HDBE 2AV1B 1YY8B 4YHIA 5C0EA 5I0ZA 3OKNA 1WCBA 3TJEL 3BEWB 4E9LA 4ZFGL 5ACMA 15C8H 4UIKH 1MCIA 4LEOB 2OJEB 4JY5H 4PG2C 4TSBH 1G7PA 1F3DJ 4KH2A 2W65A 4RMSA 3VXME 4I2XB 2VXSL 1P4IL 1PFCA 4PRNA 1DLFL 4R6UA 4YDIL 2FLBT 1I7TB 4KRPB 5CZXD 3KPSE 1M71A 4YBHA 1RHHB 4RFEB 3BKJL 5LCVH 1T83A 1MJJA 3ZL4L 2DQUL 3EFFB 1NC2A 1MAMH 4I48B 2BSSB 1SEBA 4D9QD 5IB1B 4UU9A 1UKSA 1LD9A 2J6EL 3HG1E 4KY1L 5DHVH 3O6MH 1JGDA 4K3HA 2VDRH 2PYEE 4U1HA 4F58H 4NO0D 5KN5B 1YEHL 3PJSB 3PWPD 4PRHA 1M7DA 2VITB 3KR3H 1FNEA 1IJ9A 3BIAX 3DX9B 4L3CB 5SWZE 5I1EH 5DK2A 4PRIE 4Y5YC 1X5KA 4D94A 3HB3D 4M7LT 3LKQB 2VSCA 4FHBD 3O2DL 2GJ6D 2H1PH 5HDLA 4N0FB 2V2TB 2PCPB 2YXMA 3GHEL 4ZXBC 3NABL 3IAPA 1S5HA 4RFOH 4CVZA 5JOEA 3TBTA 4HIEB 3T0AA 2P8MA 4RBPH 4K3JH 4KK9C 1AO7D 2DM2A 4PIRF 3MNVB 2WUCH 4LU5L 3QUXA 1J88A 3H3BC 2YWZA 4LSSL 3GNML 3CC5B 5GZNC 1C7TA 1KB9J 3Q1SH 4MXVF 1XGYH 4R3SA 2JIXA 5HVWA 5DD1L 3ZHLA 3ARFB 1EEYB 5MENB 2BVPB 3S3SA 3TA3B 1FPTH 2IALB 4ZFOL 5BQ7A 1DSFL 2X1QA 3QXDB 4NZDA 1F8TL 1N64L 5E2UL 3T1FB 2R1XB 2KUTA 2CKBL 3O3AB 3WIIL 2J4WL 3MXVH 5IVZB 5FM5M 1HI6A 4M93C 5DMYA 3FFCA 1MCOH 4G8IB 4N5UA 4JQIH 1R3LB 3QFJE 1DLHB 3H9HB 1Q94B 5IHLB 1S7RB 1X6NA 3PNWB 4X8JB 3HPJB 2KPNA 4QRPE 4XNUH 4KFZC 4DOHE 3DMMC 1OT2A 1EO7A 4YHLH 3SDAC 1ACZA 3ULSA 2D31B 3F5WB 1JZ8A 3RZCC 1NFDA 1INQA 1UA6L 5C07A 1D5IL 1LE5B 3PWJB 1KB5L 4DN4L 2HJKA 3B8SA 1QRNA 5J9PB 4JHWH 4F15B 2R4RL 1T21B 2IPUK 1ULVA 1QRKA 2C1OB 2ADJA 3G5VA 2B0SL 4CDHA 5L2KA 4OB5L 3AY4A 3K0WA 2MWCA 5EOCJ 1JPSL 3OJDA 1IGIL 4N90E 4HS8H 4ELKB 1FIGH 4G6FD 1TJIL 2ADFL 2X4TA 3O8XB 1I7RB 4MS8D 4KGLA 1J8HA 4FG6D 3X12A 3HN3A 3GEWB 5GS0L 1IC7H 4LSVL 4XVSH 2CR6A 5GGVL 5D7LB 3SO5A 1S78D 1CXKA 5LGKA 1ZXQA 3X14A 5I1HL 5J6GA 3JWDH 4LCWD 4CVXA 4GS7C 1TQCC 3MXWH 4AEEA 4D8PA 2YBRA 1NAKH 3WS3A 3U0WH 2VLME 2E3VA 2FNBA 2I26N 4WI7A 3V0WL 5CCKH 5E6IA 2EDWA 4OGYH 4KTEH 2ZUUA 1MFCH 15C8L 4RMUA 4UIKL 5L7XL 1CDIA 1KGCE 4HBCL 5ISZB 4N9GA 4UI2A 4PP2A 4MXVE 3GBMH 1J05B 2HT3C 2WAHA 2F53D 3CLEH 1FFOA 3IFLH 3QNXB 3RDTC 4YHNB 1K4CB 1U8HA 2R1WA 4NQDE 4F57L 4Q7DA 1RZFH 1YNTB 3AU1A 4GBXB 5BV7B 3AFLA 3VGAC 5LCVL 2OX5A 4PBXA 4P9MH 1GPOH 4JDVA 5A2FA 5IK3A 3CXHK 3NACH 4NQCD 5GS0C 1QFOA 3QUKA 2H2PC 1GHFH 3CNKA 5GRVK 2BNRE 1SEQL 1EFQA 1R3JB 4OTXH 2VDRL 3IRPX 1J11A 3V79C 1V3JA 4F58L 3BO8A 5F1IB 1Q9OA 1KCRH 1FAKT 1KJ3H 1X5GA 3H9SD 4M62H 5CZVL 5KZCB 2NW3B 1KLUA 4JDZA 4KXZI 4ZUSA 4DN3H 3SKNA 3GMPB 1A6WH 5C0BA 1JK8B 2AVGA 2G9HB 2NXYC 1G7QB 4Z7OF 3MUZ1 4OD1L 5T3XE 3K8LA 2UZIL 4KZEL 2PW2B 1II4E 1QBAA 2DQDL 4NM4L 5F9WB 5I1CH 1BP3B 5FGCE 3GSWB 1TDQA 4HWZB 3T3PF 4JM2D 5IV2A 4PTUA 1E4JA 3RTQD 5CINH 1OGAA 1IC5H 3LKRA 4H25B 1LDPL 2H32B 2C4FU 4MA1B 2R0WH 2DBJA 1T5XA 1U42A 2WUCL 2VDMH 3IDYC 5GIRA 2YUVA 5E2VL 1K4DB 4V1DB 3MYJB 3MUGA 3FRPG 3SKUD 3W9EA 1MH5A 3QI9A 1E28B 4LLWA 2CPCA 3REWA 4APQA 3PV7A 1Q0XH 3SGKC 2HRLA 4UDTA 5E94B 2J2ZA 4C58B 1I8MB 2F8XC 4OZIF 3UPRA 4KV5E 2W59A 1AHWC 1LEGB 1AXSB 5JPMB 3KPQA 3GI9H 3MXVL 1F3JA 3QDJA 5FA4B 1Q72H 2DQFB 4X5XB 4HUWB 4FXKA 5I8EA 4P5KA 4U1NB 3B5GA 4GW4A 1OAZL 1IZKA 3DETD 4AENB 1JPGB 5ICYA 4KK8C 5MEQA 1FZJA 5HYQB 4XNUL 4LLUA 1SY6H 3D85B 4PJBB 1JZ2A 4HDIA 5CJQH 4HKJA 2XG4A 4OFDA 3VH8A 2NTFA 4XCYB 4JRYA 5F9JA 1I7ZB 4LNRA 5T5NG 1R5IB 1KPRA 5GHWH 3TVMB 3DJ9A 3KPRA 2NW2B 1RZJH 5I1JH 3G6JF 3NFSL 4WEMB 4CW1A 1ZWIA 4JHWL 4URTB 4G8EB 5D93B 2QJDA 5GISL 2AJXL 4YHPA 1AR1C 3K2MC 4NQXA 3RPIB 4KXZH 2XFXA 3TZVD 3TEUA 4HLZG 1GAFH 1G6RB 3KNBA 3HA0A 4UQ2B 2GITB 3ZYJA 1PSKH 4L9LB 1S7SB 3O4OC 4XAWH 3V6FA 4E42B 4ZUWA 3HNTH 1FNHA 1ZT4B 3A6BL 5JHDA 1M1SA 4HPOL 1S7UB 1FIGL 3JV0A 3IETA 4LHJB 4ZQKA 2XY2A 5BMFL 1R3IH 5IEKB 1W0WA 3HC3L 1IC7L 2K1MA 2N1KA 3BUTA 3FQRB 3N1MC 2CJUH 1C16A 3L7FA 1IFHL 4NKMB 5GQBA 4Z7OE 1HEZB 3E2HB 5D1QD 1EXUA 3MJ9H 3C6LD 4JFEA 3OGOE 1UJTA 43C9B 1NAKL 4EVNB 1G6RH 2B8OT 3N85H 4M1CD 3L3OB 4L29B 4HV8A 5CFHA 3FOLA 4P5TB 4FQHA 5CCKL 4G42B 5A2JH 3WJJC 5ECJE 1FVCB 4KTEL 1MFCL 3SGJC 2VERN 3O6LL 2DF3A 4Q9BA 4LRIA 3CLEL 5IB4A 4WFFD 4OCRH 5IB2A 1TZIA 1EZVY 4YUEH 1D5MA 3X11B 1YUHA 4JAMA 1RZFL 2BFVH 4N1EA 4OZIE 5F89A 3ROLB 4PRAB 4X6BB 2BRRH 4WW2B 2P47B 4FS0A 4P9ML 1IGCL 3TT1L 3NZ8A 4G9FB 4FP8L 1KC5H 1U3JA 4OZ4A 1BJ1H 3NACL 4TSAH 1I3GH 1TVBB 3N9GH 2L4OA 1H3PH 1AH1A 4F2MA 5T1KB 2QSCL 1TQBB 4NIKB 3PGCB 1TZGL 4RWYH 4PRDA 3O3EB 3JWDC 3LQMA 4F15C 2GT9A 5DC4B 4EXPX 2I5YH 4EI5C 2GJJA 1S3KL 4JN2A 5E2TH 4RAHA 4ALAH 2PN5A 3WIHA 3TYFB 3CZFB 2Y5TA 1R0AH 3SHSA 5IMKB 4I8DA 3WCYA 1TENA 3PWLA 4OFVA 4JZJB 5BV7L 4IRJB 3G6JE 3U0PB 4X4XA 2BVQB 3BPLC 3S88L 5CHNA 1XZ0B 3OR7A 4YAQA 2LTQB 1DTUA 2WP3T 3GRWA 4PGCA 1X7QA 2ITCB 5JXED 4UV4H 5I1CL 2E6PA 2XA8L 1QO3A 1BM3L 3S34L 5D70H 5CINL 4RMWA 1OP9A 4XMPH 1YEFH 3MRKB 2QSTA 3WIFB 1H9VA 5DFWH 5ACZA 4OSUH 4XNMB 1T7ZA 2GJZA 3LDBB 3U82B 1VA9A 2XNAB 2X42A 3MRHB 1RUAL 1R5VA 2MKLC 5EZLA 1NAMB 4PY8J 3QEQA 3IJHA 1LE9A 2EICA 4Y5YA 1Q0XL 1A1MB 2BP3A 1U2CA 1IC4L 4U6HB 1CT8A 2A77L 3BZ4A 5ALBH 1OM3H 3QXVA 2DYPA 4FMFA 1HYSD 4M6OH 1D3CA 4ZXBA 1FIEA 1KT2B 1I1RA 3GI9L 3PWPE 4OKVA 5I0DA 3U83A 2IFGA 2AJYH 4ODSH 3S37H 2OK0L 1F4AA 4XX1E 1KLFA 2BCKB 3BFOA 1R3KB 4PJ5D 5CSBA 5JIHA 3IFPB 1BD2B 2ZKHH 4WUUA 3SGDI 4E0RA 2J6EA 2VAAA 4MCZA 5GS1B 2DQTL 1K2DB 2DQGH 1A6ZB 3VD3A 4BH7B 2AK4B 2GY7B 4UINH 1P84K 4Y1AA 5GHWL 3CFJA 1BZ9A 1EAPA 5L6YL 5ADOL 1ZA6B 5JMOC 5I1JL 5A16A 3WFEL 5C0AB 4LLAA 4PG9A 3RGVC 2ZUTA 2FEDD 1BGXH 3HUJA 1DDHA 2VR4A 2ARJA 4G3YH 1TPXC 4FXGA 3O2DA 3CFEA 3I85A 4UIMA 1T0MA 5I76A 2ZJSH 4KVNH 4WIQA 3G5XA 3SDAA 1DVFB 1X5AA 4Q9CA 5L2JB 3HAEH 1DBKL 3KPNB 4X6FB 1BHGA 3HNTL 3NCCB 3WLWD 1F6AA 4UNTA 3RZCA 4X7DC 5DEGA 2EYRB 8FABB 1UJ3C 3O2VH 3EYVB 5IQ7H 2AJSH 4P2QD 5DJXB 2I9LB 2CJUL 2CKNA 2YK1L 4X9IA 3O41B 4GKSB 3OB0H 3WFDH 2OZ4H 4ZFOA 3LN9A 1YMHB 5GGTH 2WQ8A 1NGXA 4L8DB 4NZRL 2F19H 3MJ9L 3KJ6L 2MKWA 3N1FC 2HVKA 4F7MA 3EJJX 1JI2A 5FF6A 1E4KC 1RZJC 3SDDA 4AIZB 3U0TB 4FFYH 4JFOA 5ANMB 2CKBA 5EO1A 1VERA 5DJDA 2YD4A 1G6RL 3OKOA 3MACH 4NO3A 2LV4A 1FL5A 4TVPH 4Y7MA 1T5WA 3PWUB 1NEUA 4HJJH 1YEJH 2BHYA 4PJ7B 1TJHH 3BDYL 5BW7C 1C1EH 4WU7B 3ULUH 4MCYA 2NY5H 1QSED 3C2AL 4JM2F 2PKDA 2JLLA 3TH3T 1OQOA 4P57B 3P9MB 4YUEL 1U58B 4KJQC 3SCMB 4HS3A 4MWFA 1U8IB 3HR5B 1CYGA 2BFVL 3QUMH 3VFTA 1OTSD 4QY8B 3P30H 1ZHLA 3DVGB 4JZOB 3QIUC 5E8OB 1YPZB 4AJ0A 2VRAA 4OCWH 3AMKA 4YQXL 1A7NH 5CEZH 3LKNA 3KS0H 4TSAL 1CDHA 1I3GL 3N9GL 5FDWA 2XTJD 4LNVA 3QRFM 1ADQH 3P4MA 1FFRA 2D4DA 2WWMC 2AXFB 4RWYL 1A21A 4U49A 5EUKB 1WSST 4X99B 4TRPH 4GKNA 2D0FA 1WBXA 2HLFC 2X2YA 4LCWE 5IBUB 3TFKD 3UBXI 4ALAL 4NQVA 3RDTA 5A3IC 2QL1A 1CU4H 4L9LC 2CIKB 1ZAGA 1AKJB 3F6LA 5I1KL 5INCB 1JPST 2X70B 3AS2A 4MA3B 5C6TL 1T4KA 3CDCA 1MCHA 2WUBL 3K8MA 2XN9A 1MIEH 4DK3A 3ZKND 2Y6SD 1H15A 4G6ML 3JTTA 4UV4L 1MHEB 4UAOB 1D5XA 1FFQA 1A8JH 1ITBB 3GDBA 4EDWH 4JJHA 2DI8A 3TBVA 1DFBH 3B6SA 1UADC 4OZGA 1NMAH 2N7BA 1TXKA 2EH8L 2VOTA 4QHNA 4OSUL 1N3NB 1S8DB 2BY0A 3O4LA 4XCEB 4ZOAA 3UROR 1OW0A 1WCQA 4M1DH 4P23B 1I8IA 4Z78B 1OY3B 2HKFL 4RZCA 3B9KD 2VIRA 3J8F7 4P5TC 1P7KA 1DP0A 4JFDB 3VCLA 5JXAH 4BSWB 4YLQT 4HIIB 5IFHH 1HCFX 1UZ6F 2NY2B 1B90A 4FABL 2GSIA 1OM3L 3MRDB 3H2WA 4KU1A 4QRSB 5CP3A 4M6OL 4MNHB 4G9FE 4D2NA 3UBXB 4D9RD 2RGSA 5I71C 1JTPA 2YD9A 1HYRC 2VLJA 3OKMB 4I3RH 3KYOA 1ZT1B 2AJYL 1WZ1H 1C12A 4C56B 3L3DB 4C57C 2I9TA 3DUSA 5T5NF 1AIFA 1ODAA 5GS2D 5IHZA 2FX8H 2HFFA 1FZOA 1V3MA 4QRRB 4KJWC 4HWBH 4KDTC 2ZKHL 2AV1A 5FYJL 1M05A 1YY8A 3UYRH 3LD8C 3BDXA 2FIKA 4PJEB 3SGKA 3FO0H 3K74B 3WD5H 3BEWA 1DQML 4UT9L 5C6WH 4UINL 2I27N 2OJEA 1NGQL 2MCG1 5KW9L 1AHWA 5KJRL 4HG4J 2MTPA 4I2XA 3BEVB 1UM5H 3ZYZA 12E8H 1UM6L 2EO1A 5I16B 1G7MB 1I7TA 2OTPA 3D48R 1YZZA 2FX9L 3H3KA 4PJAB 5EZJA 1J0IA 4XPAH 1BGXL 3SO3C 1RHHA 4RFEA 5FV1L 2XI9A 3KHOA 3LV3A 3EFFA 4OBRA 4MX7B 3OZ9L 4PJ7F 4LKCB 3MFFB 4I48A 2BSSA 2UY7A 3U7YH 5JW5B 4KVNL 4PYGA 2LTQC 1NKRA 3DRQB 3FAWA 5IB1A 3BT2H 4R4FH 4MNQD 3ZKMC 2YPLD 4HWEH 2E5EA 2H26B 2FHBA 5F7EL 4P46D 3TJHD 1YYMH 3O2VL 2IQAB 3TLRA 2A83B 2YA1A 3SKMB 1YPZF 1K9TA 1RIUL 2VITA 4JJ5B 3WFDL 5GGTL 1WK0A 3DX9A 4IRZH 4L3CA 5E8DL 1MY5A 1AGCB 2AV7B 1E6JH 1GJIA 1FYTA 4P49A 3O81A 3LKQA 3T2QA 4KTDH 4P2OC 2F58L 5LAXB 4HH9B 4ZS7H 2OL3H 3MACL 1XGQB 4JO2L 4MAUL 2PCPA 4N0FA 2QKIB 2IWGA 5GZOC 3C5ZC 4NO5B 5DEFA 1FE8H 2FECI 3C08H 5HJ3B 3QQ9D 4S0TD 2GK0B 4N0UE 3MNVA 3ULUL 4P4KB 4QRTB 2P24A 4XPTL 3CC5A 1BFVH 3BQUD 3MRLB 1WWBX 2A0LC 4LPCA 3OGCB 4OZFG 3LQAH 3MV7E 5J0BA 3ARFA 2J5LB 1EEYA 5MENA 5JW4Q 2BVPA 3TA3A 2IALA 1UZ6E 2NY7L 3BJLA 4ZS6C 3QXDA 4UT7L 4KI5D 4ELMB 3ARSA 3RY5A 5E5RB 5HYJA 4S1QL 3T1FA 1BIIB 4JB9L 4G8GB 4OD2B 4Y0GA 2R1XA 5T5FL 5AG9A 1MJ8H 2NY0D 4EUPB 1KCVH 4KAQH 3WJJA 4NPYB 2Z35B 2FCBA 5B39B 3QR2A 4NRZB 1N0LA 5FYLD 1FZMB 3SGJA 3GB7B 5HI5C 4G8IA 5T1LB 1DLHA 3H9HA 1I1AD 1Q94A 1S7RA 4X8JA 3P4NB 3HPJA 4MGXA 2EIBA 4Y4KC 5JZ7C 4JFYB 3OJVC 1DVFC 4M9PA 4OUOA 3WHE0 4XPHH 3RIAF 1GIGH 5AD0A 3MCG1 3F5WA 1BAFL 1QBML 3ULUC 1OAQH 2NY5C 5FOBB 3QCUH 1MIEL 4EKXA 5FV2A 1U3HD 1LE5A 3PWJA 2VLRD 4L8SC 5JA9A 3SJVD 5J9PA 1L7IH 3HNVH 4I1NB 4WFFE 2WBWB 2XPGB 1T21A 5E8EB 5EU5B 1NMAL 4PJ7E 4QOKD 2C1OA 1HOCB 1MREL 1KENH 1IE5A 1VEPA 1YDPB 2QADD 3KGRA 5D6DA 5CLTA 3D2UB 2FX7L 2NY4D 3QDME 4ELKA 3W39B 5IFHL 3O8XA 3UMTA 3P9LB 1YPZE 3OSKA 5KSAD 1RUPL 4Y4FD 1G7JA 2CK0H 3CSPA 3QULB 1S9VA 2AJVH 2FJFB 3BE1L 3QNZB 5D7LA 4I3RL 1QBBA 5DURD 1CE1H 1IM9B 4R7NB 2AJZB 3OB0K 1HZHH 1IAOA 2FX8L 4K07A 4HKZB 2CXGA 2A1WL 3MLUL 5L0QC 3UYRL 5HHME 1KIRB 2E9WA 5DMJB 2ZOLB 5ALCL 4ZDHA 1EUTA 1EJOH 4WI9A 5ISZA 1PZ5B 1R3HB 1JZ4A 3WSQL 5JOFB 4HH8A 1WISA 3SY0B 5CD5D 3B9VA 4NZTL 1UM5L 3DX7B 3QNXA 4YHNA 1K4CA 3DROB 5LBSH 3QB7C 4JDTH 4YDKH 2ORBH 3AM8C 4Q58C 4XPAL 1YNTA 5DC0A 4GBXA 5C3TA 5HI3D 3K81A 1JHLH 4N0CD 4TTDC 3CD4A 5IHUH 3U7YL 3MFGB 4KKBC 4OQ1A 4UAOC 4NC2B 5IB5A 1YEGH 3S6CA 4JFDE 1R3JA 3E3QE 1PVHA 2VDKL 3UO1L 3ULVL 1KTRL 4M5ZL 4GUPA 3BKCL 2NW3A 2O5ZH 2XZZA 2CDGB 1KTDB 3RGVA 4C56E 3FN0L 4IMKC 7FABH 3GMPA 4TUKL 5CIPB 1JK8A 3WLBB 1BQSA 2G9HA 1E6JL 1G7QA 2NY2C 4JFQA 2FJGB 4OFPA 2XY1A 2PW2A 4PJDF 5KS9F 2FJHB 3PGDB 3QISA 4OM0H 3GSWA 1CXEA 4MXQC 1QSFA 1J0ZA 2VXTH 4Y5XC 2ENYA 3C08L 4H25A 3VXUE 2H32A 3ALXA 4EDXB 4RNRB 5B38B 2ESVD 1Z3GL 1K4DA 3FB6A 2VH5H 4V1DA 3MYJA 2BC4A 1WZMA 3B83A 5EN2B 1PY4A 5CJ8A 1XIWB 5JQ6H 1FVDB 3RWIB 5A2LH 3RVXD 1I8MA 1DQLH 5C0JA 5AYUL 1FCGA 3ULVC 1WGOA 1A2YB 1LEGA 1AXSA 1P6FA 3VGBA 1HXMB 5FA4A 5HYSG 5LQBH 3VD7A 4KAQL 2DQFA 4P2QE 3N1QC 4HUWA 1P6AB 2FYYB 4HIHA 4QCIA 4DCQB 3E8UH 1EK3A 1MVUB 5BW7A 4UTAH 4U1NA 5I6XB 3QQ3B 1URLA 3VXSA 2DJ4A 4AENA 1JPGA 5CWSB 4BKLA 1H5BC 4TUOA 5HYQA 3S36X 3DVFA 3D85A 4PJBA 1W8NA 3ZE0F 5GGRB 3HE7B 1RAMA 2KDGA 4C83B 1U8LB 4XCYA 2VB5A 2VDNL 3QHTC 1CVRA 1R5IA 2H3NB 1OAQL 3QCUL 2NW2A 3BVNB 1T22B 3MRCA 5IBLC 1QSEE 1BBDH 3MV9B 3MYZA 2W9DL 4WRLA 3NN8B 4G8EA 3NH7L 1CXLA 3SN6N 2C3XA 3U4EB 1L7IL 5L88H 3I6KB 3RNQB 1EHXA 2CLZA 3CK0H 5JMRA 5F6IC 1IKFH 1CFNB 4CU7A 3G08B 1TJGL 3IJYB 5F6HJ 1G6RA 1KENL 4S1RH 5JLZB 1MFBH 4UQ2A 4L9LA 1NL0H 3B2UC 2OM5A 4PJFB 1ZLVH 1A3RH 4F33B 2VLKA 1F4YL 4E42A 4HW6A 1YYLH 2J88H 1ZT4A 4Z7VB 1CICC 4H1LB 4P3DB 5AAMA 1HHKB 4ZAKD 1AR2A 4X6CB 1OD7A 2FECL 3TF7C 2WW8A 4OJFL 3DPBA 1A7RH 5IEKA 5AWNL 4G8GE 3LSOB 3ROOB 1OAYL 2IPUG 3FQRA 1JNHB 3W5NA 1N4XH 3TN0B 4PJHB 1NANI 2J5LC 3KG5A 4NKMA 1CE1L 4PJCF 3I3EA 1HEZA 4R7DB 4S1DC 5E24E 4L5FH 4MVBC 2BSED 4PJDE 5KS9E 5D2LF 3GSNH 1JMXA 43C9A 4EVNA 3O6FB 3L3OA 5C0CD 1AXTL 4L29A 4P5TA 4PJXB 4WI6A 5LWYH 3ZLQC 3C8KB 1FVCA 4NZUH 3V4VH 5HGGS 3W2DH 2X1XR 4CAGA 4LL9A 5CJOH 4UT6L 2FH6A 5F6HI 1BQHG 3TH4T 4MB3A 2Q8AH 3MV8E 3MJGX 5LBSL 5J1AA 4KHTH 3X11A 1U92B 4R4BA 3ROLA 4PRAA 2VL5B 4WW2A 2VWEE 1S5IH 3JV4A 3SDCB 1P4LB 1CG9B 5AAWA 4L8BB 2GCYB 4OI7A 4KDTA 3QSKB 1I9JL 4OCXH 1NLDH 4FQXB 5T1KA 2IMMA 3PGCA 4D9RE 1B88A 2APTA 4NKQB 3O3EA 1YEGL 3EHBC 3S7GA 2FBOJ 5MHSD 3DTXB 5DFVD 1BMGA 2QQLH 1EEUA 2YRPA 2XZCH 3ZE0E 1HQRB 2NY3C 5F72S 3TYFA 2ZCKH 2O5ZL 3CZFA 3LQZA 5DJ8A 5IQ9B 1NCCH 1MI5B 3GMRB 5JW4N 5IMKA 4FQCL 1IT9H 7FABL 4YBLC 3VG0L 3GBNH 3AB0C 4JZJA 4X83A 4CDGC 4ERSH 5T3ZL 2CDFB 3U0PA 2BVQA 4Y8DC 1VACB 1XZ0A 4GG6B 3QUZB 3OHXB 2X6MA 4W68A 2ITCA 4Z0XA 1IGFH 1J1PL 1WAAA 1TMCB 5FFLA 4GSDH 5K9KB 3DIFB 1J7VR 3MRKA 1G9NH 2R69L 4X7TB 3I2CH 2FZ3B 3WIFA 5FIEA 4XNMA 1F42A 3O3UN 4OD3L 3MRHA 1ED3B 2F5BH 3RL2B 3QRGH 2DTMH 1NAMA 3D39D 3EJZD 4FOMA 5LXGH 2EKSB 5C0FB 5D7SL 1A1MA 3MBEC 1YN6B 5DD0L 2EDBA 5HTSA 4U6HA 2YPLE 1SYSB 25C8L 4M3JA 3UTOA 4DGVH 3KXFA 1BVZA 1OLZA 4J7RA 1ZHKB 4XWGH 3JBG7 3ZDXF 1KT2A 4PJCE 2PO6D 3N1PC 3C5ZA 4JO3L 4JFFE 1CBVH 5JIIA 1ZEAH 3OKYA 3JXAA 4L4VD 4RGNB 2E7CA 5D2LE 5E8NB 2BCKA 1R3KA 1K8DB 5FM5O 1GGIH 1BD2A 2EDFA 1Q9KA 1H0DB 3ESUF 1GGCH 4LCIH 2VXQH 5GS1A 3HAEA 4NN5B 3ARDC 3PV6B 1K2DA 5IGXH 2FR4B 1A6ZA 1KBGH 1SVCP 4NRXB 2AK4A 3QEGL 3QJHB 2GJ6B 4E41B 4MJIE 5D7JD 1MELA 1F58H 4KKNA 1ZA6A 1OAKH 1MEXH 1N2RB 4FQ2H 1XT5A 4KWUA 2R1YB 3KYKH 5GGTA 5C0AA 1BBDL 3DI2B 5GRUL 3BZFB 3NMEA 4ODVL 4L4TD 1AO7B 4NJ9H 3R1GH 4KKAD 4S0SD 5GGSY 4DEPC 3GJFH 4ODBD 4WO4C 4S1RL 5D2NC 4LFHG 4Y4KA 3OX8B 2A6JB 5E4IA 2XKNA 3QIBC 2HT3D 4NC0B 4X6EB 1D9KB 1DVFA 3KPNA 1YYLL 1V7NH 2EYRA 1NMCB 8FABA 3B3IB 1SM3H 4G80B 1A7RL 4M7ZC 3EYVA 1B0RB 5JQHC 2I9LA 3P73B 3O41A 4GKSA 1VFUA 5HHQB 2W9LA 4NP4H 4D9LL 2Q76B 2W92A 2E7LC 4L8DA 2QV2A 4U1IB 2GTZB 4XP5H 3PG2A 4AIZA 3U0TA 5ANMA 4W4OC 2EXYC 2FHFA 4NRYB 4ZTPH 5HGHB 3C60D 4RDQF 4LFHD 4ENEC 4JHZA 3TIDB 3PWUA 3RI5F 3VD5A 5EUOF 4C4KT 2NX5B 3VMOA 2VISB 4QRQA 4GXUN 1CGVA 4RGOL 4OBSA 1PKQA 1ZVSB 2WBJD 5CJOL 4WU7A 1CLYH 4QOKE 3HC0B 1KJ2B 1H3WM 2DMBA 1RFDH 4P57A 1QYGH 5I1AB 1PQZB 2YZ8A 4KK5C 3SCMA 1KIPB 3S5LG 5EBGA 3HE7C 3UTQB 1U8IA 1RZ7L 4J2XA 4QY8A 3O9WD 3DVGA 4JZOA 4QYOB 5E8OA 2XV6B 4X7CC 2A6IB 1MY7A 4IBLT 3ZDXE 5HBBA 4OCXL 4OIIH 2WWKT 3P4LA 2MCPL 3OB8A 4PJGF 1UACL 2MFNA 4W6WB 1H8OA 1RIHH 3F58H 3C2SA 3RU8L 1NJ9B 1E4WH 2D7OA 4O2CA 3MBXL 4X6CE 3O2WH 3MNZB 4PGBB 3NGBB 3IVKB 1P2CB 4H26B 4I13B 5ERWB 3BRGC 1KJ2H 2ZCKL 4U6VH 5FHAH 1NCCL 4HIJB 1I1YB 1RU9L 4XMKL 2CIKA 1WZKA 1AKJA 3RX8A 4ODUB 5INCA 5ILTH 1IT9L 3MRFB 4MA3A 2Q7YB 4KUZH 1Z9LA 2ZUYA 4Y88A 5EU6E 1JF6A 4POZD 5BO1H 1CFVH 1NGPH 2QQNL 4KK8D 1X6LA 5CZKA 5E8PB 2HWZL 3EDEA 1FNSH 4Z7NF 5HDOA 2F9BT 2WIIB 1ZSDA 5H35B 4YHYB 4UDUA 5FUCE 3UXFA 1EJ6A 1QPXA 2G2RB 3I2CL 1A1OB 2F53B 3ARGB 1N3NA 1S8DA 4XCEA 3QPQD 5ELIA 2BXZA 4XCFL 4OCNC 4P23A 2HT2C 2F5AH 4Z78A 5IVXF 4GFTB 2DTML 1T7YA 5EU4A 2H8PB 3RUGF 3QQ4B 1OAXH 2EC9T 2X40A 4BSWA 4LIQE 4HIIA 2FD6H 5TH2B 3AUVA 1WBZB 3MRDA 1EUUA 4QRSA 3OR6B 4MNHA 5BOPA 1T1XA 3WFCH 3UBXA 4M9OA 5D1ZB 1XFPA 5I75B 1H3VA 1AD0B 3OF6A 3OKMA 4DWHA 1TITA 1Q9LA 1ZT1A 4DVBB 2ZG3A 3L3DA 4OGXL 3BUYB 3SDXB 3EGSB 3NVQA 1QLEH 2B1HH 2EDLA 2YA0A 1A6PA 3H9SB 4QRRA 1GGIL 1N6VA 4IRSD 3V5HB 3TNNB 4R8WL 5EUOE 1FLTX 2VXQL 4NQTA 5GRXG 4FQXC 4M4PA 4PJEA 2E27H 2WSKA 5IGXL 1AD9B 4PV9B 4W4NA 3RA7H 1G9NC 3FT2A 1KBGL 1GOGA 2QR0A 4YHOH 2EXWD 2WP3O 5T33H 1BEYL 1QA9B 2PETA 3KPTA 4YHML 1MFEL 4YWGH 1F58L 5B8CB 4L9DA 1OAKL 1Z9SA 1MEXL 4FQ2L 3BEVA 1YNKL 1DJSA 5I16A 3K2UH 1G7MA 1OT1A 3VFPB 5M7QA 3ZDZF 4PJAA 4L3ED 5FA3B 1MRCL 3O0RH 3DARA 4G7VH 5F1NA 1LK2B 2P5EA 4JQVC 4PJGE 1A6AA 4MX7A 3DURA 5HI4D 4LKCA 3MFFA 1T89C 4LARH 3DRQA 4Q0XL 3GSRB 1RD6A 5CP7A 4OKDA 1V7NL 1VDGA 2R2HB 2H26A 1QD0A 4HJ0D 5IW6B 4ZNCD 2RFXB 3T77B 2IQAA 3ZZ1A 3M1BA 2A83A 3SKMA 4RMTA 5CZXC 2ERJB 2CR3A 2Q8BL 4JJ5A 4NM8H 1Z6JT 5IFAL 3KLDA 3FRUB 4IS6B 2VZTA 1S7TB 1P5VA 1FDLH 3QDGA 4F7TB 1NMBH 2AV7A 3G04B 3VXRD 1MFAH 3KLHC 3FMGL 4PJIB 2APFA 5DK3A 4RISL 1JGLL 1HXYB 5FUZH 5H37G 2XKSA 4Z7NE 4HH9A 1EEZB 1YMMB 2QKIA 1CD1B 1I9IH 4HUXB 3DBXB 1UT9A 5HJ3A 2WZPD 5C08E 5AYQA 2XWJB 3CDFA 5IVXE 3LEXB 3MRLA 2AJ3B 3RUGE 4DGYH 1U8PB 3QUYC 1QYGL 2Z4QB 4MDJA 2AK1L 1ZGLP 4KDWA 2N56A 4NN5C 1Z9OA 1KEML 4A6YH 3HB3C 4UUJB 4QXUH 5CD3B 1BZQK 4JANB 4ELMA 5JTWA 4F3FB 5DC9B 3VXNB 4OD2A 1AJ7H 4HFUH 3D69B 3X3FL 3D25B 4EUPA 4NKIH 3DRTA 3HS0B 5JDSB 4NPYA 5B39A 2D9QB 1FZMA 1JYWA 1E4WL 5T1LA 3O2WL 4PJ9B 4H0IA 3EFDL 5M94B 4M61B 5JHLL 3PXJA 1CLCA 1KJ2L 4JFYA 2O5YH 2DJUA 2DQIL 2FSEA 3WFHB 1KB9K 2HH0H 3RY4A 5GGUB 4BSVB 5I1IL 3QNYA 3FT3B 3VDAA 2D7QA 4KUZL 5C71A 1F97A 5FOBA 1NGPL 1U8OB 3X13A 4JRXD 3AREB 3WUWB 1D5BA 3ZDZE 3C5SB 2PR4L 5ADPL 2J8UB 2V17L 1FNSL 4Y2DB 1FG2B 2RHEA 2XPGA 5E8EA 3MGTA 5EU5A 5IWLA 1HOCA 5ITBH 1S9XB 5BS0D 3C87A 4U1MB 2P5WB 3LRSB 5IFJB 1ONQB 1YDPA 2DQHL 3HZYB 3GJFK 3D2UA 1MAKA 1JZ5A 4R4ND 4WDIB 1INEH 3W39A 3P9LA 3PDDA 3S96A 5DK0B 1WZLA 4YEFA 5MHSE 5JORB 1XMWA 3QULA 2B1AH 1N6UA 3QNZA 2FJFA 2XZAL 5I17B 5EOTA 1EERB 2MQ3A 3CJJA 1IM9A 3QDHA 2QSVA 4R7NA 5CJXC 4PJ8D 5C09B 3S98A 2AJZA 2B1HL 3T4AA 1CGSL 1O7SA 4HKZA 2IGFL 3LZFH 1IILE 5MI0B 4HPYH 4UNUA 1IQWH 2NY1D 1KIRA 3MBEA 1GZPB 1FLRL 2ZOLA 1JN6B 2GW5A 4YHOL 3V6ZB 1PZ5A 4J6RH 4MS8C 1R3HA 5T33L 4FG6C 3SGEI 4YWGL 5JOFA 3BWUC 3CDYA 3SY0A 3WO4C 4J23A 1DUYB 4FA8A 1S78C 3DX7A 1MCDA 3DROA 4PJIF 3VI4F 3U30C 2OP4H 1FGVH 4GRLD 2AEQH 4EI6B 3D39E 3O0RL 4G7VL 3WHE1 1PLGH 5DYOB 4M7JH 4PYHA 5D9SB 5I1LB 4YK4C 3KAAA 4FRWA 4Y16D 4LARL 4J1UA 2OR9H 4OT1L 4QHUB 4UOW0 3UAJD 4KDVA 3HE6B 2NY6B 4KJQD 4ZSOB 4RFNB 4XXCC 3SPVA 4CMHB 2CRMA 4PRHD 3CVIL 1IEHA 2VZUA 4GJTB 4NM8L 2CDGA 3D3VE 5DDHA 3L3JB 1HILB 4ZMAT 5CIPA 4QT5B 3W0WD 3QO0B 4M43L 1MWAH 2FJGA 5D2NA 2R0ZL 3KPOB 1K5NB 2FJHA 5D72H 4NWTH 4OLWH 1YN7B 2AABH 1SBSL 1I9IL 5EOQH 3BKYH 3FJTA 3F8UB 4PREB 4DGIH 3QXUA 5I8KL 4EDXA 5B38A 5E5UB 3P77B 2C4XA 4MAYD 4DGYL 5F21B 4KVCH 1EA9C 4Z95H 5KANG 5EWIH 2E7LA 4A6YL 1XIWA 1I3RB 5IJKC 1FVDA 1A6VL 2J8UF 3RWIA 5DR5H 5JW3H 1LQSR 4W4OA 1P1ZA 1FNGB 5I9QB 1M7XA 1ZE3C 1AJ7L 4HFUL 4ZUTB 2BJMH 4JM2C 1HXMA 1X5JA 2EYTB 1LK3H 2ZNWA 3RTQC 1A4KB 3O3BA 5D5MF 4GMTL 4W6YB 3NAAH 4KQ3H 4DFHA 3MA9H 2BVTA 2GI7A 4DCQA 1ZHBA 1MVUA 4MJ6B 5DGRA 2P46B 3QQ3A 5CWSA 4AEHH 3PWNB 3CXDL 1FQ9C 1GC1H 3QXTA 5GGRA 3HE7A 2ILLA 6FABL 1NDMB 3JV5A 1MIMH 4Z0BH 4G6AD 1U8LA 5KSBB 4HIXH 4P2RB 5DQJB 5E2WH 3ZSTA 3HZVB 2H3NA 5CILL 4PJIE 3VI4E 1T22A 1QRND 2DOCA 1UC6A 3MV9A 1JNNL 3TT3H 3NN8A 3U4EA 3B9AA 3BD3A 1RMFH 1OVZA 4JPIB 3I6KA 5JUEL 5DJCB 3RNQA 5D1XD 1QLRB 4XCCL 1RZGB 3DETC 1CFNA 3G08A 3IJYA 1TNNA 5ITBL 5L2KD 3ZT6A 2NNAB 5JLZA 1C5BL 3MOAH 3VWJB 1UQSB 5JO5A 1RK1A 1HKLL 4PJFA 1T7WA 5DQDL 4GQPH 4NWUH 2X05A 3V2AR 4H1LA 4P3DA 1VGKB 32C2A 1HHKA 5LGHH 4NBXB 1JNJA 4BQ9A 3NIFF 3SE9H 4YDLB 1J8HD 2XTJB 4IOSD 4I3SL 2H45A 1J1OH 3LSOA 3ROOA 2B1AL 3VW3H 1MVFA 3PE9A 1JNHA 3L95B 1W72H 5DLMH 4PJHA 3TN0A 4NQED 4E5XA 2BX5A 4EOWH 3TZVC 4X8XA 4XPFH 4XNXH 2R0KL 3O6FA 5KVEL 1IQWL 5E6ID 2MHAB 5EDXA 4PJXA 5A2KH 5CJBA 3QPXH 3ZYOA 2I07A 4PRPE 5E6ZA 1TETH 5EB9A 4LSUL 4J6RL 2LAAA 3CGTA 2GEEA 4LAQH 5F3HA 3ZSSA 1SEBB 4WJ5B 2OP4L 4UU9B 1FGVL 2J8UE 1ZGLM 3OAYH 4I3GA 5D1QC 3MLTB 1U92A 3IGAB 1JGDB 4Y5VC 3C6LC 3VWKB 3ZMRA 1UH4A 2VL5A 1MJUH 2WK2A 4WCYL 3T0ED 1DBJH 3SDCA 5E9DA 4DW2L 1P4LA 1CG9A 2R8SL 4L8BA 2GCYA 3HLAB 4YO0B 3FB5A 4M1CC 3B9KB 5D5ME 1G9MH 3QWRD 2OR9L 4CMMA 4FQXA 2YC1B 4Y4HD 4ONGH 5IG7A 4M00A 3OTTA 4Z7WF 4EQ2A 1EO8H 1AGEB 1D5ZA 2XQYK 4OCYH 5B4MD 1RJLB 2YA2A 3DTXA 3KVQA 5DUBB 3OJMB 1CFSB 2DD8H 4UTBH 3T0DA 4PS4H 2ATPB 5IQ9A 1MI5A 1ROWA 1AXIB 1S5HB 3EYSL 1A3QA 4P59H 3MRJB 4WTZA 2H41A 2G60L 5HPOA 4KMTH 5TE4H 4JQVA 3FQWB 3FL7A 2VQUA 4NO2A 4R97B 2CDFA 2P7TA 3EOTH 5DUPH 1VACA 4GXVH 3QUZA 5EFIA 4ONHA 3OHXA 3V6BR 4HMCA 4Q2ZA 1CDUA 2PTUA 3H3PH 3FB7B 3CSBA 5EOQL 3G5YB 4DGIL 2JCCF 4FTVB 2FZ3A 1V8HA 3SBWC 6CGTA 2XRAH 1K3IA 4DKDC 5CLWA 1OD9A 3SOBL 2JJSA 4KVCL 4NN6C 3RL2A 2VZ1A 5JDJA 2EKSA 4JE4B 1A7PL 1KCSH 3NIFE 2V5MA 3F7QA 1YN6A 3BHBA 5JW3L 5DR5L 5GRYA 3FFCB 4WV1C 1SYSA 2C3GA 1NCNA 4K2UH 4GRWF 5JXEC 5HYIA 2E7HA 4MNQB 5F9AC 1ZHKA 5CEZD 2BJML 1VPOL 1LK3L 1L6XA 4XAKD 1BFTA 3NAAL 4K71B 4KQ3L 4BA8A 3MA9L 3W9DB 4JKWA 5E8NA 1T03H 5DRZB 1NFDB 1INQB 2ZP0T 1K8DA 3QHFH 4AEHL 4OCSH 4NJAH 1H0DA 2DWDB 3T2NH 1GC1L 3RWGB 4X7FC 4F7CB 1IGMH 2EDKA 3L5IA 5LGJB 2FR4A 4O5LH 1UWEL 1P4BH 3EYUH 4Z0BL 3GK8H 1WIUA 4HIXL 4PV8A 1JGUH 4NRXA 4G5ZH 3QJHA 1HYSC 2R56L 2GJ6A 4OI8A 4AMKH 3G5VB 4E41A 5C8JA 4WWKD 5AZ2H 5BRZD 4CMHC 3BGAA 1N2RA 4Y19E 5E1HB 3E3QC 4EN3D 3BZFA 3TT3L 2HP4A 1RMFL 3OJDB 1AO7A 3IXTA 3QIWB 4X5WB 2DN7A 2V5TA 4GH7B 1QFHA 2JJUA 1ZGLA 5B3NA 3NPSC 3UTTD 1VEMA 3OX8A 2BXYA 2A6JA 1CR9H 3MOAL 3X12B 4WHYG 1JWSA 4EEEA 2AJUL 4Z7WE 2JF1A 4X6EA 4HBQA 2EDJA 3RY6C 1I8KB 5SWSD 5J6GB 4NUGH 4B0MM 1SQ2N 2X4RB 5GRJH 3WBDA 3P0VH 4Z7UB 3B3IA 4R2GB 5IEHA 2V7HA 2ZCHL 4G80A 4XBPB 2P8PA 5HHXL 3S97C 1B0RA 1R5WA 2YBRB 1GC1C 3P73A 5I2IB 1GL4B 3P3YA 3S36H 2PUQT 3QZWB 5HHQA 1W72L 2FEDC 1RZIB 2VDPH 1I1AB 2E8ZA 4JFED 4U1IA 4ZNEE 4OV5B 3TCLB 5C0GB 5J7CC 4OGZA 3V7MA 5I9QC 4NRYA 3U2SB 3BPNC 3BAEL 5HGHA 3U1SL 1U8HB 2R1WB 4OF0A 3TIDA 3UTSE 2JCCE 4NC1E 3WLWC 2NX5A 4IDJH 5J12C 3JVGC 1TTUA 1TETL 3WS6A 4P2RE 1ZVSA 3SE4C 4JDVB 4HLJA 3TIEB 1Y6NR 2QEJA 4CVUA 2ADIB 1K6QH 3HC0A 1KJ2A 2ICWJ 5BS0E 2F54E 5AZEH 1X44A 1G7HB 1K85A 5I1AA 3O45B 3UDWA 4BFIB 2PTTA 4MYWB 5FYLH 3UTQA 5TFSL 1T1ZB 4PLOB 2YMXH 4AZ8A 4QYOA 4GRWE 1KFAH 35C8H 3MOBH 2A6IA 4JFHD 1FH5H 4QHLA 3ZTNH 4DAGL 1G9ML 3PHOB 1T20B 1LP9B 5FYKD 2Z9TA 4OZFH 3F12B 4LQ1A 2XZQH 4M7KL 3QWOA 4JPVH 4ZUSB 5KSAB 1NJ9A 5C0BB 1I3VA 3OL2A 3QT2A 4DZ8B 2IBZX 3MNZA 3MLSL 1YNLH 1XGRB 3IVKA 1P2CA 2DD8L 3V4UH 4AQOA 5F8RC 5DURB 2AERT 3MGAA 3EDFA 4HIJA 1I1YA 5F88B 1OTSC 4P59L 3UJTH 4ODUA 4TULH 4KMTL 5DUML 5DD3H 2Q7YA 2W60B 3MRNB 3VXMD 3M45A 2NR6D 3EOTL 2XTJC 4HSQA 4GXVL 4X80H 1CZ8L 2J8OA 4HK3J 4JFPB 4XTRD 3QI9B 2ICWI 3ALPA 1NCAL 2R29H 3H3PL 2WIIA 5H35A 1YA5A 1PKOA 2G2RA 1A1OA 3TFKC 2F53A 3ARGA 1PGRB 4P0DA 3HMWH 4LOUD 1G9MC 4PBVC 3HG1D 5FYKU 3U9PL 2ED9A 5IMMB 4FNLH 1OP3K 1F3JB 2H8PA 3QDJB 3QQ4A 2PYED 4FXKB 5F7DB 3FHAA 4JPKL 2DM3A 5IR1B 1T7XA 4NQCA 4P5KB 1WBZA 2DYPD 3ZKNC 2Y6SC 4GW4B 1VB9A 3LIZH 3OR6A 5DSCB 5MEQB 4PFEA 4HCRH 4RGMB 1NCUA 5D1ZA 3C09B 4KMLB 5EU7E 1QNZH 4HD9A 4HDIB 4PRHE 4LCUB 4PRID 3QXWA 2EDXA 3BIKB 2CGRH 2P49B 1HH6B 4DVBA 3JWNC 1UXWB 4CJ1A 3BUYA 3SDXA 1HIML 1DCLA 1T03L 4W6XB 4JRYB 2D0HA 1NBZB 4LNRB 1UXSB 3H9SA 3PHQB 1UVQA 1UCBH 3KPRB 4M1GL 5D7IB 3S9DB 5AUMB 3GMOB 3AGVA 2ICWB 2VWEC 1IGML 1QG3A 1ZWIB 3TO4C 1F90H 3UTZA 1AD9A 4PV9A 1P4BL 3EYUL 1ITCA 4NQXB 1JGUL 3DX6B 3GKZA 4JGJA 1MFDH 4G5ZL 4WY7L 3JZ7A 4AMKL 1QA9A 2OXGA 4S1DD 3AAZA 1UB5A 5B8CA 5DT1H 3DVNB 1ZLSL 3PQYB 5EC2B 3LH2H 4LIQH 3VD4A 1MCBA 5TQ2H 5EIVA 1CLZH 3VFPA 4CBPA 4ZUWB 5FA3A 2ESVB 1EHAA 5JHDB 1LK2A 1IAII 3IETB 5CMAB 3OAYK 1KIQA 4ZQKB 2C9AA 1KCLA 3FN3A 1CL7H 3RL1B 1C16B 3X3GL 1C8PA 4C54A 2WINB 1U8KB 5DJ6B 1EV2E 4OF5A 1EEQA 4MD0B 3FFCE 3TESA 2Y25A 5IW6A 1OCWL 2RFXA 1SBBA 2VNCA 3T77A 2APWA 1G1CA 1IGJB 1B0WA 1MCKA 3MRPB 1KF9B 4HV8B 4LSQH 2YWYA 4FZEL 4A6YA 4HG4K 1WFUA 3FRUA 4IS6A 4F7TA 1JHTA 2VDPL 4XRCA 4PB0H 4HXBH 1DN2A 3EHBD 1FSKC 3G04A 3SDDD 1NDGB 1RZKL 2UVEA 1HXYA 4FQJL 5C07E 4WFEE 5T1DH 3F7PC 1EEZA 1YMMA 5IB4B 1KXQE 4HEPG 1P5UA 5HHOB 4HQQH 1QRNE 2X1WL 3DBXA 5SV3A 4JKKA 4U0RB 4K71C 2VUYA 2IFFH 4P46C 3TJHC 2XWJA 1EGJA 3L3KA 1MCEA 5L9DH 4IIQC 5BVJB 3LEXA 5BZDB 3WN5B 1K6QL 2D9CA 4OZ4B 2AJ3A 3O6KL 4XPGH 3FB8B 5AZEL 1U8PA 1IAKB 5L2KE 5HYSB 5K9QG 5IT2H 4NOBA 1WWCA 5FYLL 4UUJA 2X44D 1I85C 2YMXL 2GT9B 4XP4H 5CD3A 5IOPB 1X3DA 3F65A 3DNKA 35C8L 4F3FA 3VXNA 1FH5L 3ZTNL 2EDNA 3D69A 3D25A 1J8HE 3HS0A 2B20A 5JDSA 4JQXC 2XZQL 4NQSB 3B8YA 3QQ9C 4JPVL 3ZHDA 5KTEH 2HN7B 2ZUSA 3HNSL 1NSNL 4KHXH 1JF5A 3PWLB 4LVHC 3BQUC 3TGXA 4QNPF 4PJ9A 2ICEB 2VLMD 3V4UL 2G5RA 3LEVH 4PBWD 4WHTA 3LVEA 4YAQB 2IQ9L 1YEIL 5EBMB 1CD9B 3CXHJ 4B7IA 3C6LA 3UJTL 4BSVA 4TULL 4KI5C 3FT3A 4S10A 3GIZH 3UPAA 3D9AH 2XN9D 3QDAA 1NFKA 1QR1B 1U8OA 2NY0C 2NZIA 3TYGL 4WNQB 4NQDD 1OPGH 2BOCB 5LG1A 4X80L 4OLUH 3C5SA 1RURH 1WTGT 2R29L 4Y2DA 3QEQB 3IJHB 1FG2A 1QLFB 4Y5YB 2ED7A 4UZGA 3AROA 5F7UA 1KJVB 4TPRH 4QWWD 1MCJA 4D3CL 1OGTA 1S9XA 4MQ7B 4U1MA 2P5WA 3T0EE 3BMVA 3LRSA 4TNWK 5IFJA 1ONQA 3V52H 3HMXH 5INDB 4FNLL 3HZYA 1JYNA 4OKVB 1HQ4A 4KROD 3GI8L 5IJVB 4JFXA 4DVRH 5DMGD 2MSPA 1U3HC 4JHAH 4BJLA 3TBWB 4LGRB 3LIZL 4XC3H 5DK0A 4HGMA 4KRNA 4HCRL 4YZFF 5JORA 3IU3B 3LPFA 4WUUB 1QNZL 2VAAB 1ETZB 5I17A 2MPAL 2HFGL 3BWAB 3STZA 5T3XD 3CMOH 1A14H 1FYHB 4ZD3H 5C0BE 4GAGH 3A67L 2ZG1A 1UCBL 1EAPB 2QADC 5KVGL 1BQHB 2UWEB 2NY4C 4RAUB 1WBYB 4M93B 3MO1B 1D7FA 1UWXK 1GZPA 4PG9B 4ZPTB 1JN6A 1V3KA 3IDXL 5DQ9B 3B2VL 1DDHB 1OGAE 4Y4FC 3V6ZA 2VDQH 5JXEA 3CFEB 4IJ3B 2EEBA 2EDDA 1T0MB 1DUYA 3DMMB 3CCHA 2BHZA 2EXYD 3LH2L 1BREA 3MNWB 4JR9H 4KRPD 4LIQL 4MQXD 3G5XB 5TQ2L 3AVEA 2H2SD 4YFDB 1WUNT 4RX4D 4EI6A 2XTLA 3STBA 4TN9A 3RZCB 5J8OA 1ZS8B 3VXQB 2B4CH 1K8IA 5D9SA 5I1LA 2YUZA 4H20H 3VGFA 4YE4L 1L4IA 4I0PC 3WXWH 5JPNB 3OPZH 2ZPKL 1S9KC 3K8KA 1VGEH 4QHUA 5DA4A 5HHVH 3WL9B 4XT1C 1FC1A 4QNPE 4ZSOA 4XAKE 5DA0B 2CMRL 2C3VA 3FQNA 5CD5C 1Q1JH 4JCLA 3EZJB 4N8VG 2PO6B 3MRIA 5IESH 3OKOB 4L4VB 3L3JA 1J87A 5HI3C 2VDLL 4PJ5A 3KJ4C 2Q87A 1MRFL 4N0CC 4HXBL 1Y6KR 4QT5A 3QO0A 3DYMA 4MA8H 2V6HA 2IMNA 1RUMH 3RX5A 2APVA 3WJLC 4MCYB 1D6VL 1JPTH 2YXFA 3WUZA 4LASH 5A1AA 4TSCH 3C09C 3RY6A 1YN7A 4HS3B 3NIGF 1C08B 3HZMA 4PREA 5D7JB 4HMEA 2NCMA 4GQ9H 4GS7B 4PGEB 2IFFL 2IG2H 1JJUA 1LO0H 1VFBB 1KTKE 1TQCB 1KB5B 5DI8A 3DSFL 2D7TL 3LKNB 4P9HL 4GG8A 2P43B 4P3WA 3ARFD 1LO5B 5TDOB 4TOYH 4WTWA 3TA3D 2EE9A 5TQ0L 5IT2L 4LRNH 1I3RA 3ZHKA 5CJ5A 4KTYA 5JHDE 4HEME 5DJ0B 1OARH 3C8DA 3RZWA 1XCQB 4ZUUB 4A2MA 1QKZH 2AXJA 4ZUTA 4XXDB 5C7XL 4N0RA 3MSPA 2OMBA 2EYTA 3EDJA 1A4KA 4YR6A 1JFQH 3FTGB 3I02B 3JVGA 5DWUH 4FQIL 1RULL 3VGAB 4MJ6A 2J12B 4KHXL 3SKJL 4JRWA 4JFEE 3LN4B 3NFPB 1IAIL 3RGHA 3RJDA 3LEVL 3LPWA 2A9MH 5K9JH 1N8ZB 4J3WA 4JY6B 4BM7A 3QH3B 5F7YC 2HLAB 5HVGB 1NDMA 2X10A 4AEIL 4UOW1 4RIRA 3K3QA 3LS4H 1MCPL 5DQJA 3RWFB 2R4SH 1DBBH 3FO9A 2VXUH 3UYOD 1EMTH 1FN4B 1JV5A 3HZVA 1UYWH 4ONOA 3VRJB 1OPGL 4W70A 3VRIA 1W72A 4M48L 1KPVA 1T2QL 4JPIA 2F8OA 3RVUC 5I19H 4ZTOL 1GXEA 1C5CH 1QLRA 3CFDA 1KG0B 4HC1A 2FO1A 3L6FB 4H88H 5HDQH 3V6OC 1R24B 2NNAA 3ZE2F 3HUJF 3HMXL 3AS3A 3VWJA 1UQSA 1FV1A 4JFHE 1NC4B 1DL7L 5BJTB 3IS0X 2DKMA 1KYOJ 1VGKA 4MQTB 2I9TB 4G6KH 1AIFB 1IL1B 1UH2A 4ZFZB 1NCBL 4JHAL 1FZOB 4XC3L 3FQXB 5FCUH 2AS5M 5D7LD 3LKOB 2FATL 3RI5K 1YC8A 4GAYB 3MLXH 3L95A 5DHVB 1RY7B 1M05B 2FIKB 2DQJH 1KCUL 2O61A 1IEAB 2WQRA 2IANB 4GAGL 5F3BA 4YHKL 2FBJL 1AHWB 5A2IH 3NIGE 4WVRA 4XX1G 4N68A 5E2JA 2MHAA 2V9RA 1ZOXA 2AGJH 4ZAKC 5EZJB 1I4FA 4OLVH 3DGGB 1JGEB 5ISZD 2XICA 5JW4R 3L1OH 2DIBA 3LV3B 4LSPH 3KLHD 3RNKA 1JZ7A 2XACC 4WJ5A 2D2OA 2DIJA 4YC2C 3MLTA 3IGAA 4GBXD 3MODL 3QEQE 3VWKA 4LAJH 5F7WC 2CRIA 3KYAA 4H20L 3HLAA 4YO0A 2IJ0C 3CVHH 3B9KA 3MC0A 4Z8FH 4PGJA 2YC1A 1JZ6A 4AY0A 3QUYD 3MCKB 1MF2L 3G9VA 1AGEA 4WEBH 1RJLA 4XC1L 1CDBA 5DUBA 2LQRA 3TV3L 3IYLW 1JL8A 1FYTB 3S4SG 1CFSA 2YUXA 5KZCD 5TE6H 1QEWA 5A40E 5IESL 3W5MA 1V5JA 4WUUE 3O4OB 2ATPA 3MLZH 4O02L 3RWCB 5C2BH 3MRJA 3RVTD 5DEFB 1OB1B 3DX8A 2D7PA 3FQWA 2DKSA 4IRSB 2CH8A 2RR3A 1PYWB 3CMGA 4LCCC 4Y1AE 5JNYA 2P24B 3ARXA 2UYLB 4TSCL 4DUVA 1PY9A 3D0LB 3MLVH 3X17A 3IU4H 3FB7A 3GMMB 1A6UL 1PEWA 3BP7B 3G5YA 5DFVC 4GQ9L 4OZHB 4FTVA 1LO0L 2B4CC 3ZE2E 3HUJE 2M2DA 5HYJB 4V1DD 4OZGF 5GRVL 4QTIH 3G5ZB 4L3EB 5CUSH 4Z18A 4F80A 1N5AB 4HHAB 3D0VB 5IW1A 4I0CC 3NFNB 1YJDL 1NPUA 5EORL 4BK4A 5ID0A 2A9NL 4GRMB 3U48A 4IJ3C 4MNQA 2HVJA 3ZE1F 1T2JA 2Y07H 4ZOBA 2X4NB 2EDTA 4JG0H 3GJEB 4OLXL 2KZ1B 3W9DA 5AD0B 5TE7H 2X4OA 5DRZA 4D0DB 1IEBB 4K8RD 3QQNA 5J57B 1QTYT 4FZ8L 3I6LD 2DWDA 3EJZC 1NBYB 1IKNC 1GGBH 3RWGA 2DLIA 3MGOB 3HTLX 2KH2B 3GHBH 4F7CA 2NYYD 3CFCH 5LGJA 4XBEH 3I75A 1FBIH 4EI5B 3TVMD 3LS5L 2IADB 3AMLA 3W11D 4F9PA 2J1KA 1I9EA 5J6HB 2PO6C 1QHOA 3QG7H 3CFIC 4GMSL 4BQ8A 4LLMB 2Z91A 3UTPE 4JQXA 3IKCA 3HZKB 5IIEB 1T1WB 2UY6A 4M8QB 3QIWA 4FQPA 4X5WA 4PLNC 1OOAA 4U3XA 3VGEA 1IM3B 3BQUA 1YJDC 3BPLB 4J4PC 4JPWL 4OCLC 1G7JB 3PL6D 4HS6B 5IKCB 4U31A 1S9VB 4NNPH 1CDYA 4KV5F 3NCEB 1A0QL 1I8KA 3WXVL 4WGWB 4LPXA 4G6KL 2X4RA 4K7PL 5D7JC 4QF1A 4XGZB 4Z7UA 1IAOB 1WFTA 4XBPA 5FCUL 1BQLL 2DMCA 5I2IA 5JOPE 1XF5A 3QZWA 1OHQA 2VR9A 3EDDA 1RZIA 4KKAC 4PP1C 1TCRA 1I1AA 3BP5B 3IXAB 4ZDHB 1FJ1B 4OV5A 3TCLA 4JY5L 5C0GA 2FGWH 4TSBL 2XN9E 3U2SA 5B22A 4OZFA 3O11B 2VN7A 4YFLI 1I75A 3L3HB 2FWOB 3GSXA 1GSMA 2CSPA 5I30H 4M6MH 4LBEB 3VFSB 5I1GH 4OZGE 3OKDB 1X4ZA 1MUJB 2VLRA 3PXHA 2UUDK 2YD6A 3L1OL 4LVEA 3TIEA 4LSPL 4LPUA 3SJVA 2ADIA 2FRGP 4HUMB 3O4LE 1MAML 5H37H 2X4SB 2IBZY 1BF8A 1G7HA 4JCMA 3O45A 4BFIA 3O6ML 5IB5B 1T1ZA 4RRPG 2R2BB 4G9FD 3ZE1E 3CVHL 1OSZB 3C60C 3WMSA 3PHOA 5T1KD 3KR3L 5D6CA 4WEUD 1T20A 4GUPB 1LP9A 3GMLA 3SE3C 5F71A 3F12A 2ZSVB 5GPRA 2QHLA 3RGVB 1A7QH 2PW1B 5I1EL 2VLJE 4HUUB 4U6TA 4XMLH 2VR5A 5KSAA 2WBJC 4WEBL 1CK0H 3QFDB 1E4XH 1RI8A 1TPXB 5L8LB 4DZ8A 1W0YT 4JFQB 1XGRA 5CS7A 5TE6L 3I50H 1U8QB 2H1PL 4PUBH 1I9RH 4LLQB 4N8CH 5F88A 1W0VA 4RFOL 1QSFB 4K23H 3O9WC 1U8MA 5C2BL 5FXCH 1IGYA 4FQ1H 4M02A 4K3JL 1UJ3B 2W60A 4IRJD 3MRNA 4HCRA 3FB6B 1NEZG 2NY1B 2VKXA 1FFNB 4NHUB 2XQYG 3Q1SL 4JFPA 4I2XE 1XGYL 1IAIM 3MRRB 4GRWH 3MLVL 2BC4B 5IB3B 2EO9A 1FPTL 4HFWB 2DWEB 4WFGE 4JM4H 1N0XH 5CEYB 3IF1B 4H8WH 5KVMC 5C0JB 3WE6B 5FYJD 2ARJQ 2G5BA 5IMMA 2OR7A 4RAVB 1FO0H 1X9QA 3CUPA 1IAMA 4WW1B 1H8NA 3F7VB 5F7DA 4HIHB 4QCIB 2L7UA 5IR1A 1MCOL 1X5FA 4POZC 4JQIL 4OLEA 2MOVA 2HTLD 3VXSB 4MNGA 4Z7QF 2ITDB 5DSCA 1IGTB 4BKLB 4TUOB 5GSRA 1UZ8B 3A6OA 4LCUA 2LU4A 4OF7A 2DIAA 1N6QH 4YHLL 2LU3A 2V2XB 3BIKA 5EC1B 1HH6A 3DSNA 1UXWA 2LFGA 3GKWH 1J5OH 3QIUB 5E5MB 3QPQC 3IDGB 1NBZA 3TPUB 5F44A 1UXSA 3PHQA 1FYTE 5D7IA 3MRCB 3RJQB 2YUWA 3HRPA 5AUMA 3EW3B 1GGBL 3GMOA 4OFKA 2ICWA 3GHBL 3BI9X 2HAZA 4ODTH 2AK4D 2CLZB 3QEUB 3DX6A 2YEZA 1FBIL 4YDJB 5FYJU 4U1GC