3E3QE

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
total genus 32
structure length 111
sequence length 111
chains with identical sequence F, J, N, S, W, a, e
ec nomenclature
pdb deposition date 2008-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e3qE00
1NMBL 2EXWC 4HT1L 1II4E 2XQBL 1OAYH 3EOYG 3MC0A 4OAWA 4P5TB 4E41B 3MV8D 2HLAA 3OZ9H 1BQLH 3IDNA 2DD8H 1UT9A 3KVQA 5EOCH 4MQ7B 3HG1A 3HC3H 1KCLA 4JPWL 3V5KA 2XQYG 5DFVD 3DVNB 4R7DA 1D5ZA 1MVFA 1T2QL 4WI4A 4BSWB 4Y4KD 5E56A 3NZHL 4AY0A 5BZDB 5MENB 1N5YL 5FUCC 3GGWB 4QHUB 4RAVB 4PJGB 1QSZA 1AR1D 4XX1E 1MLBB 3ULVH 4KXZH 1I7TA 1JRHI 3GMRA 1G7PA 2NY3B 3IAPA 5BS0E 1MLCA 4QGYA 2GCYB 3LS5L 1SJHA 2ICWA 4IEFB 5DZOA 3PL6A 5JXAL 5AZEL 1XIWA 3RUGA 4G7YL 4X9BA 3NCFB 1EO7A 2QQNH 3DWTA 4QXTA 5J3HC 1GAFL 1CIUA 4LQ1A 3WNMA 5HYSA 4JFFB 2HG5A 4ERSL 5ESAA 5KSBF 1BLNB 4G8GE 4DVBB 4TUOA 5I66B 4UINH 4FXKA 5I74C 3PABA 1U93B 3I75B 3IF1B 4O2CA 3PP4H 4JJ5A 3CXHJ 4NCDA 1OWWA 3GI9L 1NUNB 3U83A 5DR5L 1OQOA 4XPAH 2D03L 1K6QL 5CGYD 1OAYL 5BJTB 1KJ3L 3LZFH 4JPVH 2YHGA 3HCVA 1KUMA 5D70L 3SE3C 2BVUA 2Z31C 3IXAA 4MQXD 4MJ2A 5KJRH 4RFNB 3UYOD 2AGJH 1S7QB 4LL9A 1JF1B 3VWJA 1QBMH 1NFIB 1LEIB 4GG6F 1G7MB 1FNHA 4K3HA 4PY8I 5E8PA 2NY2D 5C0JA 1I8LC 3O2VH 2D0HA 1A4KA 4FG6C 1IGIL 3QIWA 3ULVL 4I0PD 3LEVL 5BS0B 2FR4A 4XB8A 1DQML 1A1MB 1PX3A 4F2MB 3Q2CA 2FEEL 3BPOC 1SVCP 4PJIE 3FRUB 2X70B 1OAQL 1RI8A 2R1YA 4JKKA 2JTDA 1YNTB 3MV7E 4ETYA 3UZVB 5ACZB 4S1DD 2DLFL 4FRWA 4NM4L 1NCNA 3IDJA 4G8GB 5IWLC 3QG6B 1QBLH 1J1PL 1LDSA 4F9LA 1X7QA 1GJIA 3S5LG 1WQVT 3L3IB 1Y6MR 4UOW1 3GB7A 5EZJA 5MHSD 1RZKC 3SDCB 2YZ1A 4ONOA 3HI6H 3QUYA 3VGGA 4WJ5B 1IT9H 4YFDB 4KUZL 4I77H 2AV1B 4JPVL 4QRTA 5GZOC 2DQCH 1G6RA 2HKFL 1U41A 2JB5H 3BIBX 2X1WL 5EU4A 3JZ7A 2YD6A 4CL7A 4PRHA 3KPSD 4O02H 5HHQA 4K7PH 2ZCHL 3BPCA 1FYTE 1SM3H 3ULVE 1UACH 4HC1L 1P1ZA 4R0LA 1U8QA 3MMEA 1NGPH 1MEXL 1IGYB 4OD3H 1JZ4A 2Y4SA 4OZIF 3RBSA 1X4YA 4JY4A 1FDLL 1S7VB 2GJJA 4DVRH 4O2FB 1S7UA 4NO5B 3W2DH 3BD5A 1M71A 5GGVH 5AYUH 1BZ9A 5FM4A 5L9DL 1DLFH 2X6MA 4M3KB 1ZHBB 3MLRL 5EORH 4ZYKB 4LPVA 1D5BA 1AO7D 4PJIB 2HJKA 3NZ8B 1FFOB 4JFZL 3EO9H 3MV7B 5E6IA 1C12B 4P5MA 1M6OA 4S1QH 4U1SA 1MCKA 4G6KH 2BMKA 4ODVH 1SMAA 3TBTB 5JQHC 4Z7WF 4EN3D 2EEDA 3DHMA 1J1XH 1GHFH 3H3KA 3WUZA 3QG7H 4Y5YB 3DETD 3VFPA 3AB0C 4JPIA 4J8RB 4KZEL 5EO1A 2H32A 1A3LH 3CFIC 5CSBA 5DD5L 1IT9L 4POZC 1R24A 5DEZA 5GGTH 2ZUWA 4U1IA 3PDOA 1DBBL 1NC2D 5TPWH 4V1DD 3RGVA 3TBYA 5HSFA 1QSVA 1B0GB 5E7FA 5IMMB 2HFEB 3D18A 5LJYH 5E4IA 2UWEF 4UOW0 4YXKH 4MD0B 5GHWL 2G60L 1MUJA 3MO1A 3N1PC 3BN9C 3DNKA 1FYTB 4MVBC 1FAKT 3WKNA 4Y4HD 1QEWA 2ADJB 4N9OB 4MCZA 1NGPL 1MFNA 1YEEL 4WI2A 4QY8A 2E7BA 3VFWA 4X6DE 1JNNL 1UENA 1HIML 1DUZA 3BZEA 4JR9L 4HHAB 2CKBL 3MUZ1 4YGVA 4Z0XB 5J9PB 3IS0X 1BVZA 4DK6A 5A40E 4NN6B 1MELA 5BVPL 5EORL 3GO1L 3VXRA 3I2CH 4DCQA 5IB5B 4OCYH 4P9HC 4APQC 4A6YL 3OB0H 4P9MH 4K3DL 2CQVA 2FYYB 3LB6C 3EO9L 3C60A 3PWNB 3TA3C 4AIOA 4I18C 3ORJA 5JW3L 3RZWA 3REVB 4S1QL 4MNHA 1ORSA 1UEMA 5BXFB 5I17B 3DXAA 3VXPA 3EHBD 4YR6A 3M45A 3IGAB 3DMMB 3O6FD 2V9TA 4PJXA 3AS1A 3CSYA 3V7AG 4D94A 3EDDA 3GJFH 2OTUA 2AJYL 4NQXB 5KN5B 3B5GA 4ODTL 3CLEL 4PRIA 4J2XA 2C9AA 1ZSDA 4HMDA 1O5DT 3QA3A 5SWZE 5H94A 4P2OA 4EBQH 3FZUD 1TENA 3E0GA 3WE6B 4BQBA 1R3JB 4LHUD 1A02N 2ZUYA 1XH3B 4KJWD 5EN2A 3S96A 4QNPE 5HYQB 4PBVC 4OIBA 5DQJB 4JRXA 5JIIA 3T0EA 4M7KL 4KK6D 4PYGA 1FVEB 3BDYH 3U7WH 1S7WA 3HE7D 1XR8A 2E6QA 1SYVB 4X7SL 4KJYB 3VWKB 4YHOH 4U1HB 3DVFA 2X4NB 4K7PY 4X6DB 5C8JA 1R5WA 2UZIH 1G84A 4H0IA 1SY6A 3MLXL 2NY1C 2D0GA 1WLHA 1PJ9A 3UAJC 3CFDB 3SCMC 5BQ7B 1AD9B 4JKPH 5FUCE 1TETH 2AI0H 3SE4A 1FL6B 2P5WD 1H5BA 4LSDA 3RIFF 3ULUD 3HKFA 5DT1H 3MFFB 5GGVY 3TP4A 3I6GB 3ILQD 1SEQH 4XBPB 3DARA 3CX5K 3HFML 4OGAC 5A1AA 3JV6B 2VXQH 3NCJL 1EPFA 4Q0XH 3BO8A 4RWHA 5CLWA 3NTCH 4UIMA 1YN7A 2DQGH 3D0LA 1TTUA 1KTLB 1MWAH 3MRDA 5EU6A 4X6FA 3MODH 2JB6A 2YD1A 2K7QA 5JHDA 4JM2C 1HKFA 1NSNH 4CBPA 3EZJB 3HNTL 5SWZB 1FL3A 4NC1E 4Y8AA 4KI5D 5HYIA 6FABL 3OGCB 1AQDA 1IC7L 4X6EB 3ZYJA 1F8TH 4P59L 4BH8B 5JW5B 5IMKA 3WEXA 1OAZL 5MERA 1BECA 3BRGC 3BDYL 5EA0L 3NCYS 3QWOA 4XAKE 1JPFA 5DD6B 3JVGA 4K7FA 4KTEL 5L2KE 2ATPB 2XWTA 4WFHE 5KVEL 5E0QA 2HTKC 2XY2A 4X5XB 1P69B 4QHLA 1T4KB 1PZUB 1R3HB 2LABA 5CZXC 3O6KH 1RZKL 3ZKMC 1PVHA 4JB9H 5CP7A 2JK5B 1NCCH 4CN4A 5MEOB 2X4OB 4PP1C 5DDHB 3Q6GL 4NUGH 3KR3H 4KMLB 1LEKA 4HZAA 3TYFA 3O4LE 2EIZA 4ZSOA 4JO1H 4NKOA 2AV7B 1Z6JT 3UTTD 3D6GA 2IAMA 1AKJD 4QWWD 4NRZA 3MCLH 2PYEE 1RK0A 1WZKA 2QKIB 3FQWB 5EBWB 2VXQL 4AEHL 1GZPA 1TJIL 1EERB 1MHHA 4L3ED 4Q0XL 2AJXL 2I27N 2Q8BL 1A14L 1JGEA 1A6PA 4KAQL 5I8KH 1T20A 4KQ3H 1JVKA 4MAYA 5EH1A 1OAKL 1DLHA 2QSQA 5I74B 1F4HA 3OKMA 4NO0D 4P9HH 4M02A 3CC5A 4AT6B 4AMKH 1YN6A 5IJKC 4NP4H 3P9MB 1YJDC 4PTTB 5C3TA 1AE6L 4JLRA 4XVSL 1QFWL 5GSVA 5D1ZA 3MLUH 3MCKA 4YDKH 5L2KB 1BEYL 2J1KA 3RWIA 3QCVH 3OKEB 3ZKNC 5J6HB 3CK0L 1CL7H 2BDNH 5EG6C 2BHYA 4HBQA 3QUMH 3T3ME 3K0WA 2PKDA 4HJ0C 1QUNA 2HN7B 3O6KL 2E6PA 4C4KT 3THML 3EOBA 3U2SA 1G7JB 5B39G 2V17H 3NIFE 5FO7B 1AHWB 4N0FB 3NPZB 3VXQB 1VPOL 1B9ZA 2ZCLL 4NFBA 4ODXA 3O4LB 3S9DB 12E8H 5HGAB 3JWDC 1GZQB 4P4KC 2PYEB 3SDAC 3GJFB 2C4XA 1U3HC 2VR4A 3X11A 1IQDB 3WS6C 2V5RA 3TZVA 1TTFA 5DYOA 3W0WD 5D2NB 2IH3A 2ZSVA 1RK1B 3V6BR 3MRJA 5J06A 4NZRL 1G6VK 4WI3A 1Q0YH 1QR1A 1UZ6F 3MBEB 4KJQC 3VXSA 1NC4D 4G9FE 4WGWB 1W0VB 1PG7H 1RUAL 2Y23A 2Z93A 1EGJL 5D7JD 1CFBA 3SDYH 4Z78B 4OCSH 4C54A 4NP4L 3TM6A 1LE9B 4ISVA 4PJ5A 2BJML 5DVKA 4OD1H 1T1YB 1UJ3A 2MJWA 3QIBD 1IZKA 4L8SA 3ZE0E 3RGHA 1U91B 4PJ7F 4XP1H 3QCVL 1RZ8A 5HDOA 2BDNL 4QCIA 5EO9A 5CJQH 4TSBL 4JN1L 3QUML 3T65B 1YPZF 3MROA 4TPRL 4X80L 3QIUD 5FYJH 3Q3GB 1KCUL 1FNSH 4H26B 2DIJA 3I50H 2R0LL 3GBMH 1KXVC 1CFSA 4O51B 5KVMC 5HXMA 3WFHA 1AGDA 3BVNB 2EC9U 3KPPB 4ODUA 4JPKH 3KLAB 3PJSA 1MWAB 4D0CA 3VXTB 4B7IA 4X6CB 1HH6B 4IRSD 2GJ6A 3W5NA 2FZ3A 1OGAA 3FQXB 5C3LD 4ETQB 1HINL 2B5IC 1BGXL 1QLFA 3EDKA 2Y5EA 1OPGL 5ANME 3O6ML 1HH9A 4JAMA 3T0VA 3EJZD 3V6OA 1JZ8A 1K2DA 4G9FB 2Q7NA 4PY7A 2ADIB 2R2EB 3CSGA 4YIQB 3VMOA 4LLMA 1MRFH 4S0SD 1T89A 4NKDB 4M43L 3SDYL 3AB0B 4GT7A 2NW3B 2J3SA 1F6AA 2CDGB 1L7IL 2GUOA 4ZFFB 5CEXB 2Y72A 5KSUB 1S9KC 4JHAL 1NEZG 2BRQA 3RZCC 2HA1A 4NZDA 2ZCKH 4C56A 1IC4H 1RFDH 4R90H 3E6HB 1R3IH 2VDRH 4LKXB 5B8CA 5C0CA 1I8MB 1N4XH 1E4XH 3K8KA 4K8RD 4PRAB 2CKBA 3KPMB 3DURA 5J57B 1HEZB 1U8LB 4POUB 4Z7VF 1AP2A 1DBJH 1T03H 3OXRA 3OJVC 5LWYL 3FO0H 4IS6B 3H3PH 4XPTL 5E03A 2DQTL 5IBUB 1BD2E 4X7TB 4Z77A 5EPMA 1IGCL 4QRQB 1YEGH 1I4FA 1FH5L 3RRQA 1NL0L 5T5FL 2J2ZA 2FD6H 5JW4M 5JXEA 3N85H 4ZS6C 4YUEH 1PFCA 2APXA 1JGDA 5C0GA 4APQB 5ANMB 4RDQG 3SE9L 2FSEB 1NMAL 2OYPA 1KLFA 4I18B 1INDL 3FB7B 4G43A 4R9HA 2IWGA 3RPIA 3RWCA 3ZE2E 4LCWD 2A83A 2BX5A 1FNGA 1SYSA 1SJXA 3JWDH 5FEBA 5IEKA 2DAVA 2G75B 2PTUA 3SPVB 1Z3GL 4GRLB 5F89A 2N56A 4J1UA 3QUMB 4F9PA 3A6CH 1UH3A 3FOLA 5FYJE 1VESA 3LIZH 1H15A 2ZCKL 2VKXA 5HI4C 1IC4L 4U0RC 4R90L 4NWTH 4NZTL 3KJ6H 1C7SA 2IADB 4FQLL 1R3IL 5IOPA 3KPRA 5KS9A 1NCTA 2E7HA 1N4XL 4UV7L 3RVWD 1LE5B 3U79A 1E4XL 1A1NB 3T2NL 4LLAA 3LKPA 1CZ8H 4E9LA 3P0GB 1A1OA 5IW6A 4ZTPH 3Q5OA 3WD5H 1YJDL 1HYSD 1YYLL 4FTVD 3H3PL 1BD2B 1ITCA 3G6DL 3K1KC 1DVFA 4HWEH 1B4RA 5CS7A 5GS0D 3ELAT 5MI0C 5JIPA 2VLKD 3SCMB 4UUJB 2FX9L 4UBDC 3NACL 4M03A 5EB9A 1D5IL 2BOBB 2FD6L 4WFGE 4ZPTB 3WKMH 4MNGA 4U1MB 4ZFZA 4CU7A 2OP4H 4BK4A 3VA6A 4HLZG 4U6VL 4K2UL 1CFNA 4FFWC 5LGJA 5IBTH 3SJVD 4PGCA 2DTML 2WW8A 5F97E 2D9CA 4X5WA 1RZJC 4P23B 3V4UH 1DP0A 5IT2H 1FG2A 3WIIL 1RURL 3C5ZA 1DEDA 5BRZD 2CKNA 1UCBL 5ETUB 3LRSB 5KZCB 4HWNA 3C6LD 3LQZA 1VERA 43CAA 3A6CL 3ARYA 3QQ3B 4UTBH 2V2TA 3IJHB 3I3BA 4P46C 4PR5A 4Q9RH 4NT6B 1ZT7B 5IEHB 4D3CL 3ESUF 1GGIH 1F00I 1OAXH 5T1MA 1C5DB 2PXYA 1GPOH 1X5XA 4QRPE 2HFTA 3D5OF 4WI5A 5MEPB 1EJ6A 4NFCA 3VRJB 3L3DB 3G6AB 3B43A 4LF3B 4N8VG 3AXLB 1FIGH 1YMME 4HWEL 1OSPH 3QEHA 4CMMA 3TO4A 1S78C 3UJTL 4QOKD 3D39A 5FUOH 1RY7B 2EO9A 3S5LB 3I85A 2LTQC 5EU7E 2FO1A 4JZOA 4HWBL 3WNKA 2NY7L 3EOAA 4CMHC 2EH8H 1NCUA 2OP4L 4RGND 2F53A 2M8XA 4KMTL 1B6DA 1BFSA 4WEUD 3RBGA 2V5MA 5IBTL 1U58A 5AYQA 4WY7L 5KOMC 4DZ8B 2P42B 4ZUVA 3LCYA 2W0KA 1SJVA 2V9RA 5F7DA 2BNRE 2O5XH 3ES6A 4GAJL 4DUVA 1H3PL 5BCAA 2V9QA 1NBZB 4IRJA 5HHMD 5E2TL 4XRCA 4KXZI 5D1XA 5EO0B 4FP8H 3QYCA 3VFTA 1FSKC 4ONFL 2K3TA 1OAXL 5GRVK 5HDLA 4QRPB 5EZOH 2AK4D 5E8EA 2FEEI 2JLLA 3BP4A 1L6ZA 5F9WB 3IU4H 4G8IB 5FB8A 3BPLC 3EDEA 3OV6A 4PIRF 2E8ZA 2ZUQC 2ZUXA 4HUKB 1EIBA 5TGBA 2X7LA 3BWUC 1MIML 4YDIH 4ZUTA 5JUEL 3NABL 1ED3B 4XNUL 5IVXE 4WFED 1C5CH 3UTSA 4DN3H 2OJZH 1YMMB 2BNQE 4F8QA 3GFUA 1OSPL 2X4RA 1M7DB 3KNBA 3OJDB 4Z7UE 4JZNA 2Y36L 4RQQA 1HHKA 3V7AE 1D9KB 5E2VL 1JGUH 5FYLD 4IDJH 4PB9H 4QRUA 3S34H 2EH8L 2LV4A 4MJID 2YPKA 4P4KB 1JF5A 4I13B 3MV9A 4LPXA 3VRIA 4I48A 1UB5A 1FFNB 3VRLE 5CKAA 5DJ0B 1XGRA 4BZ2H 4RISH 1QYGL 3TIDB 3WIFB 1LQSR 1OP5K 4MXWL 2BNRB 3IFOA 4EDXB 2P8MA 3AS3A 3ARBD 5F7YC 4OB5L 4OLYH 3MUGB 5C0AD 1SQ2N 3P11H 4FQQB 1LMKA 1NANI 1X5JA 5C1MB 2A1WH 4I3RH 5K9OA 5EIVA 2E27H 5DFVC 4FP8L 2VQ1B 5CIPA 1VKXA 1RPQA 1CXIA 3TESA 4UZGA 3PUCA 3QPQC 3QULA 1RZJH 1VFUA 3AROA 4ZUSA 5J13B 4NNXA 2VXSL 4K3GA 3QI9C 4M6NH 4MD5A 4Z8FH 1ETZA 2JCCF 4I3GA 5ID1B 2J6EA 2NY0B 5DEGB 3ZO0A 5DJDA 3BQUC 4F7CA 2XNAA 5DTFA 4WEBH 2Q76A 4QKXB 4HG4K 5IVXB 3RTQC 1RZFH 3QQ4B 5DC0A 4R96B 1TVBA 3ROOB 1CFTA 2BNQB 5F7EL 5D7IF 3DGGA 5C6WH 1M05B 1NEUA 4Z7UB 4WV1C 3O6LH 3QJHB 2H9GA 4XPGH 4DQOH 4R3SA 1OP9A 3KPOA 2BC4B 4AIZB 4ONGH 1F58L 5L6YL 3TBWB 3VXUA 1JGUL 2EKSA 3S3SA 5CHNB 4YX2L 1CQKA 2ADGB 3P77B 1X5YA 4NRYA 3WFEH 3WLWC 1CXHA 5HGGS 2BVQA 1IFHH 1AJ7H 1G9MH 1KV3A 4UNVA 4XNZC 3BGMA 1LO4L 4OUUA 2AQ1A 2IJ0C 5JNYB 1CD1A 3VD4A 2EIBA 3OHXA 1KC5H 4HKJB 2O5ZL 4F7MB 3UXFA 1KPVA 4Q97A 1XGUA 3GSUA 1TMCB 3IDYC 4KY1H 3BZ4B 3TJEH 2KQNA 1RV6X 5LXGH 2BHUA 3LVEA 3OAZH 4N0YL 1S9XA 2VC2H 1L9NA 1A7BA 2VISA 4JKMA 5DUML 4XWGL 5GS2H 4LKCA 1RZIA 3QISA 3MA9H 1A9EA 2YR3A 1RZJL 3MRQA 3AREA 3RZCB 1S5IL 3U4AA 1R5VB 3EJYD 1DBKL 4M8QA 4XAWH 2QQLH 3FFDB 2K9UA 4W6WB 2AK1L 2CXGA 1IEHA 2KPNA 4N1HB 4N0CD 4OF0A 3K4AA 5FOBA 5B3JE 3PXHA 1ZKAA 4TULL 2NZ9C 5J1TC 1TIUA 1T66D 3HLAA 4HD9A 1ULVA 2X1OA 1I85C 1I9JH 4LLYB 5IQ9A 1BHGA 4F57H 5EBLA 1VADA 3I02A 1G7HB 5DHYA 4L8BA 3DIFB 3MTRA 4FFYH 3PGFL 4KU1A 3QFDA 3OX8B 4ONHB 4XNQB 4LMQE 1H3VA 2MOVA 1FZOA 1FL5A 5D6DC 1CDJA 1GOFA 3BYYA 5FUZL 1JYVA 4EXPX 3P4NA 4WFFD 3O41B 4JZJA 3LKOB 1MCCA 2VJXA 1CDHA 3S98A 3SO3C 4QHNB 3G08A 1K4DB 2VLJA 1OTTD 5E6YA 1X5AA 3QDGD 3GKWL 1FFQA 1MRDL 5CGMA 3NPSC 3C6SB 3EGSA 1PEWA 2CLVA 3FHQA 3P9LB 1XFPA 3P4MB 4XNXH 4F7PB 1FGVH 4HLJA 2Q87A 2YXFA 2DM7A 3X13B 4XBEH 4G8EB 1FO0H 3C9NB 4WWKC 2HT3D 5I2IB 4JFEA 5BW7C 2VC2L 4FQJH 1BIHA 3K2UH 2JJSC 3IFLL 2VDMH 3NFNA 3LKQB 4N90D 4MLIA 2A6DA 3EFDH 4LLDB 3MJ7A 2ERJB 3I3DA 2HT2D 3GNML 4RGMB 4C59B 2VXUL 3O9WD 1V3LA 1YDPB 2WBJA 4RA0C 4XAWL 4JVUA 3BP7A 4XPFH 3RY6C 2FNBA 1JK8B 4XNYH 5C9JA 3TNNB 1G7QA 4LU5H 4ZD3H 2LQRA 4ENED 1I9JL 1KF9B 3MRBB 2E7CA 1GGUA 5DUBA 4JDZA 1JPSH 5C07A 3LEXB 1XGTB 2BRRH 1LP9F 2I9LA 4TSAH 2B2XL 1IM9A 3L9RA 4PG2A 5FGBA 5T1KA 3PHOB 4NQTA 5F7UA 5FYKU 4QRRD 4Y4FA 5MI0B 1P7QA 4FNLL 4ZNEE 4OLUH 1FE8H 5J8OA 4O00A 1PX4A 3HHRB 1UJTA 3HUJA 2XIDA 2P5ED 1J8HE 2OTWA 2P7TB 3OKNA 3LQAC 3L1OH 2A9NH 2OL3H 1KGCD 3O2DA 1YYMH 3V4PL 1FGVL 1Q1JH 2BSED 3HC0A 2W92A 1BQHG 1I7ZA 1HCFX 5I8EB 2ESVA 1U2HA 2AEPL 3PWPE 2R23B 4HK3N 2PTTB 2BK8A 4JANA 4JHZA 5BVJB 4FQXC 3RNQA 4XBEL 2DQFA 5ABDE 1FO0L 2YUWA 5TE6H 1WBZA 2H26B 1KELH 4GG6E 3UBXG 3TN0A 3I6LD 4P46B 5CINH 2BNUA 4WUUD 1AGBB 3EFDL 3CX5J 4Y1AD 2ORBL 1CIDA 1V3JA 2ZJSL 4DTGL 3DX7B 2BSTA 1P2CB 5IBLC 1IARB 3KYNA 3OMZA 4KPHH 5JA9A 4L4VA 3GMNA 1S5HB 1U8NA 2G2RB 4PV8B 4XPFL 4LLWA 3VI3F 1PZ5B 1KFAH 2D31A 4MDIB 4OF7A 5MEQA 3UO1H 3GMPA 2QSCH 5JPMA 1V7MH 2R0WL 2FX8H 1DBAL 1ZWIB 4ZFOA 5F1IB 4NPYB 2FLBT 1RZGA 1TVHA 4DGIL 3IAGC 2VQTA 1KN2L 1KCVH 3CZFA 3R1GH 5HGDB 4OZGA 2Z8RA 4X9HA 3U1SL 4HH9B 4XVTL 1E4KA 3VFGH 4DGVH 3S36H 4U0QB 4EZMA 4ORGB 3OG4B 3V4VL 3L5WA 4JCLA 1NDGA 4X7EC 5IW1A 2LTQB 1A21A 4P48A 4HLZH 2ID5A 1RIVH 5DK0B 3GSWA 2XRAH 2IAND 4CMHB 3IKCA 1HN1A 2P8LA 1J8HB 4FOMA 1P4BH 5IFJA 4XCCL 4ZUWB 5T1LB 1UYWH 4JRYE 5JOPD 4LSPH 4GLRI 3FZUC 3IJSB 1YYML 3KG5A 2XA8H 4OKDA 5AWNH 2EICA 2G5BB 1UWGH 2ZSWA 4OF3A 2OR9H 4YBHA 1R5IA 8FABB 2ICES 4KK6C 4DKFL 5TE6L 3K80A 5KSAD 2R0ZH 3HE7C 4GG6B 5D8JL 1KELL 4OZIE 2DYPD 3VU2A 2IQAB 4IOFD 5B4MC 1NLDL 5JW4N 5D2LA 4PRPD 1N6VA 2R4RL 3TYGH 3H9SB 4MCYA 4KRPD 1LDPH 1EA9C 5HHOA 1UQSA 5IQ7H 4Q6IA 1T1XA 3E2HC 2FJGB 2WIIB 2Q6WA 1SJEB 1J0HA 1NGYA 3BPLB 4WHTA 2ZUQB 1JV5B 4XHJD 3QXVA 2DQUL 1MFBH 5DQ9B 4LCCB 1D6VH 3F7YA 3M1BA 2QADB 4HZLB 4HPYH 4Z7WE 5FM5O 5B38G 4RAUB 2CJUH 2XTLA 1IGJB 4L5FL 3HMWL 4M5ZH 5KANI 1MY7A 4CVXB 2NY4C 2LAAA 1YEDB 1FO0B 3GI8H 1PQZA 5JO5B 2QQQA 5B22A 2J88H 5CD5C 1NEZB 1CGVA 1CL7I 2UWEE 4UQ3A 4LSPL 4BSJA 3WFBH 4BQCA 3SQOH 1F90L 3LN4A 2B1HH 3PWVB 4WUKL 1JPGB 4DEPB 4LFHD 4BZ1L 3QCTL 1I1YB 2IPTH 1ZK9A 1Q9OB 4JFXA 3Q5TA 1WT5C 3TWCL 4OZIB 4OGXH 1W8OA 2WINB 5F3HA 4KHTH 1V3KA 2E7MA 4HKBB 4PGZA 5F21B 2RAMA 4L4TD 1ND0B 1MCIA 3LQAH 4NWUH 2IQ9H 3BGAA 3TYGL 4TSCL 3A6OA 1KTDA 5C09D 2GIYA 1RHHB 4Y4KB 3P40A 3QI9B 3D48R 1CFQB 1PGRB 4YPGB 4BSWA 4X9IA 5BZDA 2NXZC 2D7PA 3NGBB 4HFUH 3GGWA 5ADOH 4QHUA 3OJMB 4RAVA 1A47A 3GUTB 1Q9WB 4QWWC 5ALBH 1DFBL 4Z7WB 2BXZA 2NYYD 1DQQB 5F93C 2AERT 2CJUL 2EXYC 2OL3B 3FMGH 2EDBA 3S3JA 4YDVA 5E1HB 2XZCH 2VZOA 3W11D 2VLLB 1RZ7H 1B6UA 1RIUH 4XC3L 3ECBB 3VJ6B 1NCBH 3MYJA 2C4FU 2FB4H 3WXVL 4NNYB 3FN3A 1KJVB 2FGWH 3NFPB 3FCTB 4ZAKC 3RWHB 1NKRA 4JFFA 4J7RA 4OCRL 3QDHA 3EYVA 2UWEB 5I18H 5DUPL 4KQ4H 3RUGF 5A2KH 2VIRB 3H7BA 3STLB 4XNZB 3AM8A 1RUKL 3SKNB 5DGRA 4EVNB 2VXVH 3RWDB 2VDKH 2W9DH 2AJUH 1ZA6B 4BK5A 2OK0H 1A0QH 2IPTL 4MNQD 4M1GL 3T4AB 3QO1B 5IB1B 3IDYB 4LK4A 4OGZA 3VG0H 5DD0L 4NQED 4E42B 5EIIA 3KPSE 1VGEH 4NNPH 1U9KA 2W07A 1PKQE 3LQAL 3D25B 3MRKB 1A2YA 4P5TD 4E41D 4HPOL 3AY4A 4GXVL 2VR9A 2A0LD 5KVGH 2NY2B 3BEVB 2GTWA 1IGML 3NMEA 4Y0GA 2APBA 4KK9D 2XZZA 1QVOB 4PUBL 2NW2A 5C86A 5DRNB 3WHXB 5ADOL 4I0PB 2EYTA 4PJEA 2E9IA 4OIIL 2IMNA 5MEND 4L8CB 5KG9B 5BV7C 2YEZB 4UMGA 2NX5A 4FZ8H 5BS0A 3FAWA 1DANU 1KPRB 5CLTA 1F4YL 1WBYA 4GKSB 4K3EL 4YJZL 5TDPB 4OLZH 4L8DA 1DN0B 1T80A 5GPRA 3KYMB 1V7NL 5LKNA 2Z8VC 2X70A 4UILH 1QQDB 3B9KA 1GRWA 5ACZA 1G9NC 2PF6A 3X3GH 4OF6A 3ULUH 4KQ4L 5A2LH 1KJ2H 3N1MC 1VACA 3DV6B 4LHQB 1E4XI 3EO1A 4LDLB 3RL2B 3C09C 4RCAA 2VDKL 2W9DL 3L3IA 3NPSB 5CJOH 2AJUL 3J7HA 5EOTB 2PO6A 1A0QL 4I0CC 5KSVB 4FZEH 3SDCA 4R8WH 4JHBA 3S37H 4V1DE 4UT7H 1S7TB 1U8MB 1TQBC 4BFIB 3KJ4C 4MA1C 3BKYL 3O8XA 3TNMA 1T5WA 3KPSB 4WWKB 1UWXH 4N8VB 1VGEL 1PKQB 4LSTH 1CF8L 3EKCA 3F62A 5FCUH 5C6PB 3O11B 4PJ8D 4S0TD 1I1AC 3FL7A 3T2QA 2LVEA 1MHCB 5IB2B 1IGYA 4XH2B 1MVUB 3SDDD 2MQCA 4H5SB 5I30H 4QYOA 1JWMB 2NNAA 3UJJH 3QEUB 4O2FA 4XMKL 4UTAL 3QDME 1MFEH 3TH2T 2AJSH 3HZKA 3LOWA 4NO5A 4N1CA 2VDNL 4J23A 1JTTA 1S3KL 3MOBH 2BSRB 1TJHL 5HVHB 2GSGB 1VFOA 4LEOB 5DMGC 1J0YA 4Q2ZA 4HJGA 1FHGA 2WSKA 4OLEA 2QQKL 5IP4A 3IT8D 1C12A 4NO2B 5KW9H 1PEZA 2WZPD 2H3NA 4YEFA 1F4XL 4OV5B 3CUPA 5KVFH 2FH8A 1KCKA 1JUFB 4ELKA 4Y5YA 1OAUH 4G8GD 4L9LB 4LNRA 4J8RA 4KHXH 3U82B 3KPNB 4DUWA 2A6KB 4JG0L 4FZEL 4R8WL 1NC2B 4V1DB 4OFKA 3NH7H 2EIEA 4RWYH 5FECB 3QXUA 3MRNB 1FJ1B 3D3VD 3QRGL 3QZWB 1B0GA 5JHLH 4GBXC 4MD0A 3TCLA 3ARUA 5ISZD 5TQ2L 3ROLB 2ZZUT 4NUJA 2J8UA 5CFHA 4PG9A 3IDXL 1U2CA 2DBLL 5M94B 3PP3K 2YK1L 3FJTA 3QNYB 1F13A 3WMSA 1AGEB 5I30L 3MLSH 2A9MH 1B4JL 3QDMB 3UJJL 5GRUH 1ZLSL 2B0SL 5J9PA 5D9SB 2VDLL 1KB5A 3MRHB 1HHHA 2E9BA 2Q20A 1CGYA 3ULUE 5ERWB 1EEUA 1P84K 1C8PA 1VEPA 5FV1L 2FIKA 3B9VA 4KDVA 2BVPA 3ZTNH 1JIBA 4BFGA 3VFRB 3PWNA 1YQVH 1DJSA 3QUXC 5KW9L 3REVA 3O6FB 2F5AL 3L5XH 4MLSA 4OFYD 1ADQL 1UFUA 4MAYD 1WCBB 3DMMA 3MV7D 5I1HH 1H3GA 2AAVA 5D7SL 2B7DT 2HYMA 5BV7H 1TDQA 3LKRA 3BD4A 5IKCB 2WBKA 1YY8B 4KI5E 4P4RB 4NQXA 5KN5A 1OARL 2RCSH 4PJXF 3NH7L 4M61B 4RWYL 5GSRB 3H8NA 3IETB 2ITDB 2YD3A 3WE6A 1YPZE 5H37G 2CK0L 1EUTA 1R3KA 4AEIH 1XH3A 1IC5L 5GGSY 4ZFGH 5HYQA 3HE7B 4N0UE 3CFJB 3LV3B 5C6TL 2PETA 1N5AB 1KIRA 2XICA 1NCWH 3GIZL 4G6ML 4KJYA 4EOWL 3KHQA 4U1HA 1INQB 2CUHA 1L4IA 5EC1B 1J8KA 1FYTD 5DRWB 4WI6A 4ODWA 3AS0A 3ULVD 4X6DA 1TZGH 2XFXB 4F80A 2HH0L 1G1YA 2D7TH 5HGBB 4FXLA 4X99A 4CU8A 1Z9SA 1CI5A 2P5WB 1FORH 3HPJB 2Y6SD 4WGVB 1F2QA 1DQDH 3ARGC 2O5YL 5BQ7A 1AD9A 4U1NB 3UPRA 2VLRD 4XVJH 1FL6A 1KJ2B 1NAMH 3TJHD 1IM3B 3BP6A 3UTTE 3VGAC 1IL1B 1A7RH 1DE4B 3MFFA 1CTNA 2AKRB 3I6GA 1RJCA 2ITCB 2PW2B 2EE2A 4NYLB 5GGSB 5ITFB 4L3EE 1UG9A 1NFDE 2R1XA 3JV6A 1WZ1L 2XOTA 4EQ3A 3LKNA 3ZLQC 1F45A 4LSRH 5I1HL 1CDUA 5BV7L 1A3RH 3OAUH 2DQEL 2YC1A 3CH1A 3WFDL 4NZUL 4WHYG 3LN5B 3OB0K 5SWZA 3TC9A 2CH8A 3OGCA 3LHPL 1YPZB 4M1DH 2Q86B 2EH7L 5A2FA 4HIEA 4X6EA 4OCXL 5GGQH 3TVMA 1KN4H 1HQ4B 3RVXC 3NIDF 4Z7VE 4YQXH 4BH8A 5JW5A 4N0UB 4NHUA 3HI1B 4U1LA 1G9NL 4J4PC 4L3CB 5EZIH 4JGJA 1PBYA 32C2B 1H3XA 1BX2B 4QEGA 5DD6A 1SBSL 3GJFK 4FXGB 2ATPA 2P46B 5ILTH 1NGXB 2W0FA 4X5XA 3BRFA 1BPVA 1A9BA 2M2DA 4KJPC 3VWKD 1N0LA 3W9DB 2JK5A 4AL8H 3WJJC 1UM5H 5MEOA 2X4OA 3TIEB 1UH2A 5IMOA 1OSZB 4WTZA 4FQ2H 3C08H 3W81A 5IMLA 4PS4H 2YD4A 5CILH 4X8JA 2BCKA 1N59B 3UTTB 3VE0B 1AKJB 5E1AB 3T4YB 2F58H 3HRZB 2E5EA 2A6IB 2AV7A 1A7RL 3ARVA 5ALCL 2GFBA 2CO7B 5DS8B 3CPLB 2YOCA 4KVCH 4L3EB 3W0WE 1NFDB 3FQWA 1DUYA 3E8UL 3L6FB 5JOFB 1JHLH 5EBWA 3S88H 1UCTA 5GGTA 5GRJH 2GT9A 5GXBB 4RZCB 5A3IC 2AEWA 1MHEB 2D7OA 3BIAX 3NBNA 4KTYA 4NO0B 5D71H 2HRPH 4LLUA 1KSRA 3T0XA 2X4UB 3CFBB 5FDWB 4G3YH 1OTUC 1KLUB 3MJGX 4PJBE 2R56H 2R9HC 3GBLA 5HVGB 4Z7VB 3GSOB 4PTTA 5D7LE 3BIKB 2VKWA 3RP1A 1CE1H 2J4WL 4H1LA 1A6ZB 3CMOH 4KKLD 5L88H 5AG9A 3P30H 4HGWB 4Y5VC 3OKEA 3ARDD 1ZVSB 5L7XH 3LMJH 3OF6D 5HYJE 2HN7A 3DVIA 5CZKA 1XCTB 4FQIH 4TNVK 4GKNB 4JFYA 4AL8L 1UXSA 4O4YL 2P4AB 5DMIH 1FYHB 1AHWA 2H1PH 3DYOA 1CICC 4N0FA 3VXQA 1XGPA 4OCWH 2UY6A 5CILL 3HZYB 4TNWK 5HGAA 3ULSB 5TDNB 5BV7B 1S7RA 1BQHB 1GZQA 3BI9X 4XB7A 3QP3A 3TO2B 2H6PB 3W0WB 4BH7A 3MRPB 1EXUA 5LVEA 1IQDA 1INEH 1MFDH 3EUUA 2IFFH 4ZQKB 2AJVL 4M00A 3S88L 4HS8L 5GRJL 5D2NA 2B4CC 5ITBL 3CVIH 3HZMB 1D5XB 3UBXB 3WIHL 3MV01 4HBCL 5GIRA 4AENB 1KEGH 5JPNA 3MBEA 3N1QC 5FGCE 5D71L 4GG8B 5J3HD 3SY0A 1IEAA 5F7HA 3C09B 2EDJA 4PJBB 1DSFH 3QH3B 3QIBB 3GJEA 5D7LB 1LE9A 2JIXA 4KK5C 4KMQA 4H25A 3IFNL 3KPRD 2IGFH 1TQBB 4HV8B 1JNLL 1ZV5A 4PJ9C 1E27A 3BHBB 4LLVB 1U91A 3IYLW 4FQCL 1CE6A 4IIQC 1NAMB 3IDUA 3QIUB 5L7XL 3MLTB 2FH6A 4U6XB 4HWZB 5L2KD 4Y5XA 1I1AB 3BE1L 4WFHD 5EUOE 3ME0A 2F8XC 4FQIL 3Q3GA 4H26A 3MRLB 4HIJA 2Z31D 1OW0A 3X14A 4PJDA 1QG3A 3DV4B 3OKKB 4TQEH 2DLTA 3P4LA 1MQKH 3B3IB 3CZJA 3HE6A 5H35B 3BVNA 1FVCB 3KPPA 5GGUA 3KLAA 3K46A 2IG2L 4MMZC 4HIIB 2E9JA 4W4NA 1QLRB 2O93L 3O4LD 4YEEA 4X6CA 5DURD 5CCKH 1B0WA 1U8PB 5DQDH 3GBNL 3FQXA 4FG6D 5JIKA 3I9GL 2XA3A 3F58L 2JELL 2VDQH 1CGUA 1LO0L 3OKLB 4O5LL 1J5OH 4FFVC 3CVIL 2VXTL 3HN3A 4FFZH 5FGCB 5I1KH 1KEGL 4G9FA 3OAYH 1EBPA 2HLFC 4LIQH 4Z5RB 2R2EA 4Y16C 3EYQC 3OQ3B 4XXCA 3DBXB 4XGZB 1JRHH 1YNKL 3SE8L 4XZUA 1HHGB 5ID0B 3I3EA 3MOAH 4IRZL 3VFUA 2CDGA 5TE7L 2VITB 5ICXA 4X8XA 1MH5B 4HS6B 5KSUA 4LARL 1NCAH 4HXBL 4J3XA 3IVKB 3BEWB 1EJOL 1GC1C 2KH2B 4G6JL 5DJ8B 2EC8A 3AU1B 5B38B 1T66C 4WO4A 5F88B 1FBIH 2GY7B 1I8MA 3T1FB 5GZOD 5EUOB 1W72H 1H0DB 4OLWL 4PRAA 4LPWA 5IHUH 4JM4L 3KPMA 3UROR 4LQFH 4ODHH 4FTVE 3MGTB 1SBBA 2DM2A 1ITBB 3D39D 4HUVB 2PYFA 1NBYB 1RIHL 4NKMA 1CK0H 4KKBC 4RFEB 4N5UA 4X7TA 1IKNC 2VLKE 1HWGB 5B21A 2HP4A 2XXCB 3EFFA 4GKOA 3B2UC 4M3JA 4YHMH 1MF2L 2GYSA 3STBA 2VLMD 3V52H 1QO3A 5TE4H 3CFCH 3FRPG 2X1XR 2HKHL 2P8PB 1ADQA 5C0BE 4R6UA 5ANMA 2VO5A 2YSSA 3MLWL 3WNLA 1AD0B 1EMTH 2FSEA 4KZDL 5F7KC 3FB7A 3QUXB 2Z8WC 5DZLA 4PPTA 2CSPA 4OTXL 1C16B 3O2WH 2HVJB 3HAEA 4G5ZL 3DOSA 4F7EB 1ZGLA 4GRLA 4QTIH 3QBTB 2QEJA 3QXAB 4MX7A 3O9WC 2R0KL 2D3VA 2DN7A 5D7IE 3FO1A 3MBXH 5GJSH 2FGZA 4UNUA 2WQRA 2FBJH 1NPUA 2IADA 1GGCH 3PV6B 3G5YB 3R4DA 4POZD 4GQPH 1FBIL 3ZL4H 1J11A 4XCEB 3PQYA 1LE5A 4JO3L 1WK0A 5I1DB 2X4PA 2H8PA 1QA9A 1MCOH 4FTVB 5KS9F 4ODHL 1N2RB 3BN9D 3MLVL 4MVBD 4HH8A 4Z7QF 3U48A 4D0BB 1CK0L 3P0YH 3KPLA 2VLKB 3BKJH 4QOKE 1WBXB 2DWDB 3KS0H 2BXYA 4BSVB 3ARGB 3C2AH 2PCPB 4R7NB 3MXVL 4U2YA 1IAIH 3IRPX 4LIQE 3EYUH 3VGAB 4BJLA 5DJAA 1FPTL 2FHFA 4AH2B 1CYGA 5I8OH 3WFCL 5C0BB 3NIGE 1MI5A 4HSQA 5DHVA 1N3NA 5J6GA 4OD2B 3U7AA 4P23A 5TQ0H 4LSQH 4IM8A 4APQD 4RMUA 4M93C 4MA3A 3KXFE 3LB6D 4P2RA 3ARWA 3C6LB 4P3DB 3TA3D 1JNHA 2F5BL 5ETUA 3LRSA 1J0IA 5M7QA 5HHVH 2Y9RT 2YD7A 3DO3A 3PXJA 4QTIL 5HHME 7CGTA 4ZOEA 3IJHA 5H37H 4R2GC 4NT6A 1X5GA 2C7UB 1ZT7A 1DDHB 4XHQA 1AH1A 1MCPL 5D7IB 2B4CL 1JMXA 2AK4E 4MZ2A 5E00B 4BQ6A 5GJSL 3GMLA 4NJAH 1WFNA 3OXSB 5JR1H 3ZDYF 3DX9A 1XAUA 3RIAF 5MEPA 2VABA 4MDJA 3IDIA 3VRJA 2W60B 5SWQB 1I3RB 5IB4A 3PL6C 3C8KB 1S9VB 3GEWB 4KROC 1T04B 3F7VB 1XIWC 2YPLA 3CFKB 4LF3A 3AXLA 3NCEB 4QOKB 3RWJB 5DC9B 2XN9D 5CP3A 4ZUUB 5DMKA 4TVPL 1W2KT 5IROA 4L9DA 1GC1H 2V5TA 1BD2D 4X4ZA 3S5LA 1T7WA 4WENB 4LAQL 2VSCA 1DTUA 2NY1D 3SEPA 4I8DA 2ZUUA 3UAJD 1JL8A 3SCMD 4OF8A 4IOIB 1YZZA 3KYAA 3QPXH 2OMBA 2Z91A 3A6BH 1UKTA 5JQ6H 5I9QB 4XX1G 4GH7B 5K9JL 2OZ4H 3GIVB 5AUMB 1T3FB 4LVHC 3KXFB 4Y19A 3KYOA 4MJ5B 3U4BH 5JOEA 4OGAD 4R4BB 1LILA 2IF7A 4WHYH 4IOFC 3FN9A 1XF5B 1N6QH 3A67H 5HHMB 1FFRA 1RJZB 2YWZA 3QRFM 1RAMA 3CGTA 1TZIB 3EO0A 1W72B 5CWSA 1Q72H 3VWJC 1NBZA 5KZCD 1U8HB 4DN4H 4KRPC 4GMTL 5D1QA 1T0NA 2AK4B 1D5MB 1BAFH 4JM2D 3OKOB 2HTLC 2WWMC 1F2XK 4G6FD 1UM6L 1F02I 5AAWA 1ZGLP 1PG7W 5JR1L 1EUUA 3FT3B 4HF5H 4XHJC 4DKEL 1LP9E 3QIWC 2D7MA 4G8IA 3PHQB 1NMCC 3U9PH 3L3GB 2XKNA 4KTDH 4HKZB 1BVKB 4OCNC 1CT8A 4R4FH 4DZBB 4GW5B 3BH8B 3DTXB 1M7DA 5F1NB 2HTKD 3QFJA 3V0WH 1OQXA 2C3WA 2R1WB 3WUWA 5CZXD 3GHEL 1GC1L 1J88A 3NA9L 4GRMB 2C5DC 3ZKMD 4K9EC 1D9KA 4MS8C 4F9LC 3WXWH 3NVQA 2CLRB 3ARXA 4PP1D 5D5MA 3ARRA 1EHLH 4WFGD 1NAKH 5F96H 3QUYC 1FFNA 4HKXB 4U1KB 2VWEE 3JTSB 5CZVH 5DJ0A 4LP5A 3VFVB 1HI6B 1Q94B 3OB8A 4KKAC 1S7XB 3TT3H 3V8CA 4EDXA 5EOCJ 3IDGA 5C0IA 1TVDA 1T7ZA 5IHZB 5LGHH 4R0LC 2RHEA 5LQBL 4YHKL 5DRZB 3VI3E 1MFCL 3CAFA 3HNVH 4UQ2B 1WISA 2B1AL 5FF6B 2F54D 4B53A 1WZLA 5FYJU 4CKVX 3G6JA 3UYRH 2K1MA 5FOJA 1UA6H 2Y5TB 4YE4H 1HCVA 1LP9B 1TITA 2WUCH 4HF5L 4HS3B 5IFHH 3RVUC 3U9PL 1E4WH 1U8IB 3LS4H 5DEGA 4NGHH 4YXHH 2NYYC 3UPAA 2YXMA 3OSKA 5MP6H 3DRTB 4NM8L 1T5XB 4R96A 4WW2A 4R4FL 1QSED 3ROOA 2FDBP 5CAYB 3ZKND 5AD0B 1OCWL 3RA7H 5E6IC 1M05A 2XKSA 3MRFB 4Z7UA 5I1CL 4F3FA 4HJ0D 4PJCA 1YMMD 3O0RL 2BC4A 2X41A 3FTGB 2BOCA 3WXWL 5CHNA 3P77A 5D7KD 4WFFE 1NAKL 1JWUB 5IF0B 3ARPA 3JSSA 4UB0H 2FJFA 3V6FA 4GQ9L 2V2XB 5CZVL 4MA8L 4O2EB 3MZGB 2OXHA 3RGVC 3SDAD 5E2WH 2OJEB 1U3HD 5DSCB 4HKJA 2GSIA 1WCQA 1CU4L 3RHWK 1QFUL 1WF5A 5EC2A 2ARJB 4Y16B 5C0RL 1I3GH 2CDEB 3T1WA 3QJFA 2BNRD 3GRWH 4YNYA 4DFIA 3OKYA 3CDGB 4KJQD 4X4YB 1VB9A 1M7IA 1I7RB 3OPZH 2BVEA 2NLJB 4N90E 2W0PA 1GGBH 3CIQA 4PYHA 1UA6L 2CMRH 4NOBA 4YE4L 4PGEB 4UDTB 5L2JA 1Q0XL 2EE9A 3IJYB 4KDTA 1OGTB 4H8WC 1EHNA 4NN7C 3LS4L 1F6LL 5T3ZL 4YXHL 2HJLB 4XPBL 1ERNA 3L7FA 2DMKA 4UAOC 3RDTA 4JM2F 3BKMH 1IBGH 1JHTA 4XP6H 4UDUA 3N1GC 4LLYA 3UTQB 3C60C 4ELMF 5E08L 2DJ4A 3C5JB 1OF2B 3R8QA 1G7HA 5CUSH 4XTRC 3GK8L 2BNQD 2FL5B 2EDHA 4QRRE 2X9YA 3OX8A 5DJ6B 4ONHA 3TGXA 3FHAA 3BZDA 5DEFB 5JA8B 4DFHA 4GUPA 6CGTA 1VDGA 2P5EE 1YEIL 2DS4A 1JWSB 3LKOA 4UB0L 1I9IL 4P2OC 1X44A 1ZLUH 4NCC2 1OM3H 4DGYL 3SKJL 1KGCE 1XCQA 4UT6H 4O9HH 1XZ0B 3TPUB 4D9RE 3U30C 3P9LA 3BP5B 2UY7A 2YBRB 4XNMB 4HAFA 3FFCA 4OI8A 1I9RH 5I1IH 4K9EH 3KPTA 3KPQA 4GKZB 5J12C 1P84J 2MWCA 3KHOA 1QPXA 1CR9H 3FQRB 3C9NA 2YMXH 3GMMB 1HXYB 4ZO7A 3CXDH 4LGPB 3T77B 3HG1E 3FO9B 3I6LE 5BO1L 3KYKH 5I2IA 3O3AB 1GGBL 3LKQA 3NCMA 3SDDC 4GAGL 2CMRL 3O9WB 3ARSA 2AW2A 4P2CG 1QACA 3WBDA 3MXWL 1EDQA 2C3VB 1G6RH 2W91A 4MB5A 3SE4C 1IAOB 1YDPA 4Y8DC 1H5BC 1VGKA 4CW1A 2NXYC 1KENH 3RZCD 5DRXB 5HVFB 5ICZB 2DM3A 3VG9C 1UC6A 2WWKT 5K93A 3QWRA 1BIIB 25C8H 3OAZK 1CDCA 5IJVA 3MRBA 1BFOB 3T04D 4R26L 5E9DA 1T0MB 1U6AH 4LSVH 3U0TB 4JFDA 1A7NH 3F6LA 2Z35A 3LEXA 3RUGE 1XGTA 4QRRB 4KGLA 3RWGB 3TT1H 5IB3A 4OM1L 1OB1B 4JQIL 3KDMA 1A6TA 3RU8L 2P5EB 4ZXBA 5I1EH 5EFIB 5JOPE 1NUGA 2P7TA 2YKLH 3QNXB 4EI5A 4P57B 4HMCA 4XVUC 4YHNB 1F4AA 4ZS6D 4PGJA 4OAWB 3BSZH 5F9JA 5I8EA 1P7KA 2HLAB 4K9EL 3IDNB 5GGRY 3JVGC 2IBZY 1UWEL 5HHPA 4X98B 5A2JH 3HG1B 1MCHA 3CXDL 2H26A 3KYKL 3V5KB 2VNCA 5B39A 4R7DB 5I1AA 1D5ZB 1NUFA 3BN3B 4Z0BL 4PRPE 1AGBA 1RUQL 1MJUH 3BISA 3DX7A 1S9WA 3VFMB 1G6RL 1DL7H 3LEYL 1S5HA 1MCFA 5E8OB 3K8MA 4UIKH 2DLGA 5BMFH 5HI4D 5IVZB 1PZ5A 2IAMC 1G7PB 5E2UH 1ACYL 2O26U 1MLCB 5HHXH 2BFVH 1ZWIA 3L5JA 1SJHB 4GRWF 1P4LB 2ICWB 3BFOA 4PREA 5F1IA 4NPYA 3PL6B 2NR6C 4M7ZC 3B6SB 4KROB 1XIWB 5T5NG 2H45A 3RUGB 3BAEH 2R8SH 5GGRB 4QXTB 1KIPA 3GM0A 4ORGA 2HG5B 43C9A 5ESAB 1UADC 4OZGF 4ZNEA 2YD2A 4H8WH 4MAYC 5DWUL 5TFSL 2DDQL 3L7EA 5GZNC 4TUOB 4MHHG 4JREC 4FXKB 5DK0A 7FABH 4O2CB 1CDYA 1ZT4A 1NCDH 2OLDA 4UBDD 1YECL 2AXFA 2D7NA 3OWEA 4NC2B 4ZUWA 2M1KA 3BXNB 5T1DH 4Z95L 1RU9H 5D1ZC 1H8OA 2G5BA 4LVHB 3M17B 5KSAB 4FFWD 5C0ND 2DYPB 5C08D 3IXAB 2L0DA 4GG6A 3FB6A 2XZAL 1BVLB 2BP3A 5KTEL 2IQAA 4PRPB 2DKSA 4YC2C 3VWJB 3B8YA 4KRPB 3ZT7A 5C09E 2HWZH 1QNZL 1JYWA 3H9SA 4P46D 2X1PA 2YPVH 5E8PB 5C0JB 4YAQB 3BUTA 2Y6SC 1MNUL 1A4KB 3BW9B 2FJGA 1WEJH 3HTLX 3QIWB 5D2LF 4MAUH 2MMXA 3ZHKA 3SBWA 4LVOC 1NMCB 2FR4B 4YXLL 1JV5A 1QR4A 5HJ3A 3CVHL 5DQ9A 3TZVC 4LCCA 3W82A 2EDRA 1BOGA 5I19H 2R1YB 4CVUA 3GHBL 1IGJA 3HPLA 4ZDHB 2I25N 4GW4B 1MJ7L 2X4SA 4M5YH 3MNWB 2P24B 1WFTA 3RKPA 1W0YT 2R4SL 3ARQA 4CVXA 4I4WA 4A2LA 3AMLA 4H0HB 1S78D 4XBGA 2GAZB 1HZHL 1MREL 1EEQA 4G7VH 3EW3B 3QUYB 1U42A 4RIRB 2MKLC 1UJ3C 1J8HD 3PWVA 4L8SC 2DQJL 4QRTB 4OT1L 1G6RB 5ESVA 1F3RB 5JDSB 2DWEB 4IHOA 5GS2D 5LAXA 1I1YA 1XGYL 3O3EB 2YRZA 3MV8A 3FO2A 3ZYZA 4NQEE 4CUCA 3BPCB 3PWPD 1AI1L 2YUXA 1P1ZB 4H20L 2OQJB 4HT1H 2XQBH 3S6CA 4KI1A 1IE5A 3WV0A 3WDHA 1HK6A 3N06B 5C09B 1ND0A 1LO2L 1SMOA 1WV7T 4JY4B 1N26A 1B3JA 1R3LB 3JV0A 1S7UB 3ABZA 1RHHA 4NKIL 4Y4KA 4JPWH 3SOBL 1WEJL 3GDBA 1BZ9B 1CFQA 4YPGA 3ARFA 4MD4B 3NZHH 3WS3B 1D5BB 1N5YH 3GUTA 4NQCD 1PLGL 3BPNC 4X7DC 1SY6L 4S1RL 3RWFA 3P4OB 1MCEA 2AXGA 2OL3A 2GHWB 3V6OC 1M6OB 2GK0B 2MNUA 2PNDA 1ZHNA 3LS5H 4RMTA 3DXAE 5SWSD 3PWLA 5AZEH 5JXAH 1T89C 3FCTA 3NFPA 3RWHA 1F3JA 1DR9A 4G7YH 4POYA 1FVDB 4JPIB 3FQUB 4ESKA 3P0VL 5EO1B 1GAFH 3HI5L 3QUZA 4YFLF 1CBVL 4Z76A 3F12A 3QAZC 3REWB 2VIRA 2CDFB 4S2SA 1R24B 4XC1L 3PDOB 3TBYB 3RWDA 4DKAA 4JRYD 1BZQK 3D18B 3INUL 5B8CC 4U3HA 4XI5C 4KKLC 1WIPA 4JRXE 3QO1A 4NQEB 1E6JL 4PB0L 3GI9H 1Y0LA 3QEGL 5DR5H 5C7XL 1JGVL 1QEWB 4JO2L 5KANG 2D03H 1K6QH 4XP5L 1KJ3H 4CVWA 3JTTA 4QY8B 5D70H 3D25A 3S35L 1DUZB 1G7LB 4WU7B 3BZEB 3RFZC 2EECA 5CJBA 5CEZL 1A6UL 1UB6A 3B5HA 1FZJA 3BEVA 3BX7C 3JWNC 1X5LA 1WAAF 4NN7B 3QPQD 5JXEC 3GSQB 3WHXA 3QI9D 4UAOB 4I0PA 1CVSC 1ZMYA 3TFKC 5KG9A 4B41A 2OI9B 3PV7A 3BQUD 3C60B 4HUMB 1IGIH 4YHIA 3LEVH 3RTQD 4WVRA 4MNHB 4PJEF 5IESL 1ORSB 4GKSA 1UEYA 3DXAB 1CGSL 1DQMH 4PD4K 3KYMA 1BFTA 3CSYB 4HCRL 1WWAX 5EU6E 4PBWD 4AG4L 1OAQH 2OTUB 4F9PC 1KCRL 4NBYB 3NIDE 5JHDE 2DLFH 4NM4H 1G7IA 2EDTA 2MCPL 3DV6A 4E0RA 1J1PH 3WLWD 5EOTA 5EN2B 3S96B 5EUKB 4I5BB 2FWOA 4ZOCA 4M6AA 4JRXB 2XZQL 3CDFA 1UGNA 3D3VE 1S7WB 3QO0A 1S7TA 2C3GA 4KVNH 1U8MA 4U7MA 4BFIA 5CD3B 5J12B 3KPSA 3F7PC 4M9PA 4KUZH 4N8VA 5ISZE 4PJ8B 5DF0A 3V5HA 2MCG1 2HKFH 2BY3A 1TCRB 1EO8L 4U05A 1DVFC 3SDDB 3F6IA 2ZCHH 4HUWB 1ONQB 2IPKB 4M62L 4HC1H 5IHBA 1BBDL 1WFOA 5IB2A 1MEXH 1JWMA 3RY6A 3CD4A 3SKUD 3QEUA 1FDLH 4LCYA 2R2HB 3VG9B 1NANH 2DMBA 1N6UA 2WP3T 1JGLL 1AO7A 5L9DH 3N9GL 2NZ9D 3G5VA 4NSKA 3C5ZC 2FCBA 3MLRH 2R2CA 4UV4L 4UIMB 1YN7B 3D0LB 4EDWH 4QHKJ 3MRDB 5EU6B 5F6HJ 1N8ZB 3M07A 4K94L 1MIEL 2O61A 4EN3A 4JFZH 4JG1L 5JHDB 2AXHA 2EYRA 3AGVA 2D7QA 1BFVL 4JFPA 1CQYA 3V5DA 1E4JA 1EFQA 3QHTC 3ZTJG 2VZUA 4L9LA 3WEXB 2PXYC 3EYOB 2RJMA 1A6AA 3KPNA 4HIXL 4ZODA 1IAKB 3C5SB 4KZEH 1ZA3B 3D3VB 3RWEB 3SGDH 1NC2A 5AEAA 3QWOB 1BWWA 5FECA 3MRNA 4K7FB 4KVNL 5D6CB 3PP3H 2XWTB 5DD5H 4Q9BA 1IKFL 5ISZB 1DBBH 3GMOB 4LNVA 1OLLA 4QHLB 5HPMA 2XTJC 4Y4HA 5GHWH 1MQ8A 2G60H 2X9XA 1IAII 5L8KB 3ROLA 5CP7B 4WWKD 3TO4C 2W1NA 4K8RL 3TYFB 2EC9T 3QNYA 3OR6A 1YEEH 1AGEA 4CDHA 4FQPA 2EIZB 4AQOA 4HUUB 1CG9A 2X4TA 5CBAA 2J8UF 4W4OA 1JNNH 4NKOB 3DSNA 1HIMH 1UWXK 4JR9H 3QEQD 2IAMB 1OLZA 2CKBH 2VLRE 2XT1B 4G6AC 4NRZB 2VL5A 5D9SA 1RK0B 3DX8A 3IFPA 4IDLA 2ZWLT 1J0ZA 5ERWA 4D8PB 1DQLL 1QKZH 4M7ZB 1GZPB 2B8OT 1BMGA 3NFSL 5BVPH 5JTWA 3GO1H 5TF1L 3SQBA 1YY9C 1Y18A 4EDWL 1ZHLB 3EDFA 4CJ1A 4NFDA 1JGEB 1FAIL 4A6YH 3VFRA 4K3DH 1T20B 4HDIA 3VXSE 5F3BB 1WWWX 4MAYB 3O6FA 5E95B 1QD0A 3FQNA 4JREB 4JHWL 5JW3H 1DLHB 3T2OA 2WUBL 3OKMB 4IRJC 5F7NC 1WCBA 4G42A 5D1XC 3CC5B 1IMHC 1YN6B 1X6LA 4YO0A 5IKCA 4PJ5E 3WO4C 4JLRB 3T0BA 2AJYH 3PWUB 1FGNL 5D1ZB 5GSVB 4LHUA 3K4ZA 4M61A 3CLEH 4ODTH 4W70A 5GSRA 5IUSA 4JN2A 4ZMAT 5EBGA 4D9LL 5BZWA 3QXDA 1M4KA 2EE3A 4OZHA 5INDA 1N5AA 4FQXD 4M7KH 4OGYL 3U2SB 5TDOB 2CR3A 4X7SH 3L3OB 2VAAA 4JKWA 4ODXB 4I3SL 3MRGB 2XFXA 3CVHA 5LBSL 4RMQA 5IHLB 5IBLD 5HGBA 2VLRB 4LVOB 2P5WA 3F65A 4X6BA 3MLXH 4LEXL 3HPJA 5E8DL 1V05A 4X6DF 4U1NA 5C2BL 5GS0L 3QDMD 2GJ6E 1K5NB 1OGAE 3KLHD 1QKZL 1MCDA 3TZVB 1J18A 3P2TA 2AABL 1DEEA 1MAKA 2IH3B 2ZSVB 5E24E 1KIQA 3MRJB 3VW3L 2AKRA 3L3HA 3BH9B 2PW2A 1QR1B 2MHAA 3U7YH 5I15L 5GRWA 4TRPH 4NYLA 3V6OE 3VXSB 5ITFA 5FO8A 5GS1B 5ESQA 2RQ8A 4OZFA 1MAML 2Y7QA 1JFQH 1DQTA 3FOMA 1J05A 3HFMH 4PJAE 5C0DA 3MYZA 2I24N 3NCJH 3IU3B 2VN4A 4CVZA 1U8OA 4ISVB 4PJ5B 3LH2L 4MQSB 3D69B 2BERA 4U3XA 3L3KB 4JRWA 1FFPA 3SGKA 4C56E 3HNTH 3SGEI 6FABH 3MNVA 5DLML 1HQ4A 1IC7H 2YRLA 4WWID 5EO9B 4P59H 4L3CA 1OAZH 4L1DA 4HFWB 4TUKL 1T1ZA 1BX2A 5EA0H 4M7JL 4FXGA 2YA1A 1FCCA 4KTEH 4DAGL 4W81A 1Q9KB 5KVEH 3WFHB 1AGDB 5B4MD 3OKDB 4ODUB 2CUIA 1QZ1A 1RZKH 4YBQC 2ZPKL 1P9MA 4RRPA 5KAQF 1KACB 2VB5A 2FZ3B 1RJLB 3DI2B 1N59A 3Q6GH 3VE0A 4NO3B 2GEEA 5E1AA 1LNUA 4U1JA 1QLFB 4IMKA 3BPNB 5M95B 2XWBB 3U7YL 1HH9B 1B2WL 3U6RA 4OV6F 4TRPL 3CPLA 4L3EA 1NFDA 4PY7B 3L6FA 4PJAB 1JFQL 2EDEA 3EIFA 4LLMB 4N8CL 4X5LA 5EULV 4AEHH 1TJIH 3GMQA 1K85A 2AJXH 4GSDH 5ACMA 3P9WB 2Q8BH 1A14H 2NY4D 4NO0A 3QAZB 4KAQH 4HXAL 5DJXA 5DD3L 2W65B 3CFBA 3AREC 5FDWA 4OFVA 4C56B 3U0WL 1OAKH 5CD5D 1KLUA 1CWVA 3QWQB 3GSOA 3KPRE 5KS9E 4Q7DA 3FT4A 4HEME 5DJYB 4WO4D 3ARDB 1AE6H 3RVTC 2CKBB 2C3XA 3MRCB 4HGWA 4XVSH 1A7QL 1QFWH 3DURB 1NDMB 1AP2B 1BEYH 1EK3A 2EDFA 3HNSL 5FKAA 1ZVSA 5CSZB 5C0EA 2ICWI 3CK0H 4GLRH 5EPMB 4QHMA 4HQQL 5I76A 1KJMA 4NQDD 3WJLA 4GKNA 3THMH 4A6YB 2YS4A 4LDOB 4JZJC 1NKOA 4DK3A 4MNGE 3MA7A 1VPOH 2ZCLH 4OIAA 2LU3A 5C0GB 5HI3C 1HSAA 2W9LA 4NDMA 5TDNA 2NXZD 3ULSA 2LU7A 4LLQB 1LVEA 2ICEA 1BQHA 1EVTC 1XF2A 4HCRA 3QB7C 2E7LA 2GITB 4HUNB 4GO6B 2H6PA 1NBVH 4LRNL 3W0WA 1HQRA 3CCHA 1AY1L 3RPIB 3DUUB 3RWCB 1YMHA 4B0MM 4H88L 4ZQKA 2H2SC 1S8DB 1GIGH 2Q3AA 2EXYD 5DK3A 3KLDA 3HZMA 1ZEAL 5H2BB 1CD8A 3UBXA 4ACPA 1NC4A 4D0DB 4GSDL 4J1UB 3BT2L 4NZRH 4AENA 1HSBA 5D7JA 1HXMB 4ZAKD 2Z92A 3JV4A 3ZDYE 2AEQL 1CLZL 4PRNB 1CLCA 1H15B 2C26A 3DRQB 4JDVA 1RUAH 4PJBA 1EGJH 3QH3A 1ZGLM 2WBJC 5C70A 3QIBA 1EHXA 5E5UB 3KPRB 5KS9B 4XCFL 1U8KB 3UTPE 2BJMH 5FHAL 2N7AA 1QFPA 3OL2A 3TBVB 1F4WL 2LE9A 1J0KA 3LKPB 3BHBA 5E5MB 1A1OB 1X5ZA 5CIPH 3M8OH 4ALAH 3QIUA 1NJ9B 5HDQL 3MLTA 4PG2C 5FGBC 4U6XA 4Y2DA 2Z31B 4HWZA 4J6RL 3MGOB 4TSBH 3UTZB 4JN1H 4Y4FC 2ENSA 3MRLA 4TPRH 3D39E 4X80H 1KCUH 3T3MF 3DV4A 2R0LH 5DXWA 4MNGB 2BVOA 4ZFZB 2HT4C 5F7LB 1JPTL 5F7WC 5H35A 3MR9A 2VLME 5DURB 3NIFF 4IRSA 1CFNB 4HIIA 4PJDF 1D6EA 5LGJB 2L4OA 4PGCB 2WANA 3G5XA 1JZ5A 1EX0A 2WQ8A 3BWAA 1NBVL 3CLFH 4OFDA 1MI5D 5I1GH 1U8PA 3QDJD 1FG2B 4Y7MA 5IR1A 2XPGB 1HINH 1GIGL 4XMPL 4BFBD 1BGXH 3BPOB 1A7PL 4X6CF 1OPGH 3O6MH 43CAB 3TN0C 4EI6A 4PR5B 5J4MA 4RGOL 1JYXA 4QXUL 1KCSL 3Q6FA 1HHGA 4Q74A 5T1MB 4M43H 1CFVL 3GSNA 5CJ8A 3RNKA 4CAGA 3QHFL 2VITA 3V6ZA 2WNGA 1MH5A 4HS6A 4XPHL 1L7IH 3OG6B 1T2XA 3IVKA 3BZFA 4JHAH 5D7LD 5CBEA 1EEZA 5DJ8A 4LSSL 3AU1A 5B38A 3VDAA 1J86A 3M8OL 4ALAL 5F88A 3UTSE 1E28B 1PD6A 5DFWH 3MRIA 4J3TA 3QEHB 1E4KC 5EUOA 3TO4B 3X12A 2I60L 1H0DA 4P2QD 3D39B 3MSPA 2V5SA 5HYJD 3MGTA 2J6EL 1I1AD 1GGTA 4P99A 1NBYA 3H6JA 5LWYH 4XPTH 1YEKL 2DQTH 4PGBB 4Z7OF 4LBEB 5FM5M 4M6ML 2R69L 4G80B 1IGCH 4YHLL 4X4ME 3SKMA 3D85D 3MV9E 3UZQA 1FH5H 4U6YB 1NL0H 1ORQA 5T5FH 3CLFL 3VFNA 5FYKL 5I1GL 1B88A 5GRVL 2P8PA 4ZUVB 3FQTB 1ZHKA 3ZE1F 1CLOL 2BZDA 5F7DB 3DLQR 4Y19D 1AD0A 5DMGD 4EEEA 4LCWA 5CKGA 3ES6B 2AXJA 3SE9H 5JW4R 1NMAH 1INDH 1P7HL 2VDPL 3WSQL 2CGRL 4IRJB 3ZTJH 1C16A 4XRCB 2Y06L 2ICCA 5DVOA 4P49A 4PJFA 3VFTB 5J56B 3WO4B 1DBMH 1BP3B 5E8EB 3ZMRA 4Q6IC 1Z3GH 5FB8B 4BKLA 1MCJA 2MQ0A 3BJ91 1IQWL 4ZUTB 3OAYK 3G5YA 4NZTH 2D0FA 3UTSB 4FQLH 3STZA 4HAGA 3VGHA 4XCYB 2X4RB 2BY2A 3KNBB 4GBXD 1LWRA 4UV7H 1U92A 5I1DA 4JZNB 4FTVA 5K9QI 3T2NH 4RQQB 4MGXA 2XN9E 1HHIA 4LSUH 4D0BA 3VXUE 1YJDH 2P44B 2VLKA 1YYLH 4U7SA 1WBXA 3CFEA 3G6DH 3ZDZE 3X17A 3VGEA 1E6OH 3MV9B 5KVDL 3VRIB 4I48B 1FQ9C 1NGQL 2FX9H 1EEYA 1I8KA 3NACH 1XGRB 1D5IH 2HVKA 5CGTA 5FAAA 1DN2A 2EDLA 4AH2A 3SJVA 1I75A 3RKDC 2P8MB 4U6VH 1YEHL 1RULH 2COQA 1LO5B 4K2UH 3BD3A 5BRZA 4P3CH 2DTMH 3TA3B 4OLXL 4UU9B 1W0WB 4J3WA 5FA4B 4PJHA 3WIIH 1RURH 3C6LA 4L29A 2V7NB 4HGKC 4TTDC 3IXTB 1ES0A 5CIPB 3QUXD 4JVWA 1UCBH 2H2PD 1RVFL 1AC0A 1DBML 3QULB 3ZE2F 4JFHD 4NNXB 4OM0L 1GOHA 2Q7YA 5FKPA 2C7UA 3BOVA 5JORB 3BDBA 4ELME 4F7CB 2XNAB 5DTFB 2Q76B 4D3CH 3ZDXF 4PLKC 3OXSA 5EDXA 3ET9F 4WRLA 5GJTH 4CGTA 2NY3C 3DGGB 4KWUA 1U3JA 2I5YL 4YDJA 2Z0BA 3DSFL 5HY9B 5SWQA 3G04B 1S9VA 1WGOA 4GRWH 2XN9B 1FZKA 1L0YA 1UXWA 1YNLH 4LSUL 2EKSB 4GAYA 1KBGL 5EBMA 3RWJA 2Q3ZA 4NRYB 3QXWA 5HGHB 4MB4A 3RQ3A 2NY1B 1E6OL 3UJTH 2GI7A 3AM8C 3BGMB 2ARJQ 4WU5B 4HWBH 4OCLC 1CD1B 2HFGL 2NY7H 3ARGD 2N7BA 3OHXB 2NCMA 2VE6A 3EBAA 1JCKA 1KPVB 4KMTH 1XGUB 1RULL 2ZG2A 3GSUB 5LCVL 1RJYB 5C0BD 2DQIL 4P3CL 5C0NC 2APFA 4WY7H 3S8WA 4HIHA 4O58L 1OY3B 4XWOC 2X2YA 4R4BA 1S9XB 3GZKA 2VISB 1X3DA 3O2DL 4LKCB 2EDNA 3AY4C 1A9EB 1RJZA 4JVPA 4JCMA 1REIA 1TZIA 1W72A 4GAJH 3AREB 1H3PH 4N9GB 2F54E 4LCUA 4JM2B 1U8HA 4G6FB 2AK4A 5E2TH 1D5MA 4ELMB 5HDBF 4W6XB 3OKOA 3VXMD 3VD9A 2VR5A 1ACZA 5FOBB 4ONFH 4QTHA 4M7LL 5GJTL 5FHBL 3PHQA 3RVXD 2IALB 4E5XA 3L3GA 4NQVB 3B9EA 5EBLB 5CJXA 3JWOC 4HKZA 4J4PD 4L8BB 1I8IA 1QSEE 3T8XB 1MIMH 3V79C 2MFNA 1MJ8H 1YNLL 5JUEH 2ATKB 3NABH 4XNUH 4JQVA 1XF4B 3B9KC 5F1NA 1UVQB 5DK2B 1CLYL 4KJPD 2R1WA 3HMXL 4ZFOL 2R15A 3P4NB 1WVZA 4JZJB 1MOEA 2BHZA 1CGTA 2CPCA 2R29L 5EIQA 4MJIA 2Y36H 5D7KE 4WTZG 4CN6A 5E2VH 2D9QB 5F9OH 2CLRA 3AFLA 1AFVL 2PO6C 1L0XA 1KG0B 4QRSA 1FZMB 4UT9L 1O7SA 3GSRB 3V8OA 2ESVE 3JTSA 5D5MF 2APVA 3HZVA 3O8XC 5DC4B 4GXUM 5F8QC 3BKCL 3ARBA 1QYGH 3WN5A 1HI6A 1S7XA 5C0AA 3EJJX 4MXWH 3GSXB 3KXFD 3NFNB 1FNFA 5IHZA 4OB5H 5A3ID 2F54B 3DROA 1C08A 4K3JL 5DRZA 3MJ8A 1QLEH 3ZKQD 1TJGL 4L4VE 2WBJB 1LD9B 3BP7B 4GRWE 4G8FB 1T22A 1WWBX 1OTUD 2HJFB 1LP9A 3RI5F 2R9HD 4H1LG 1QSFD 2VXSH 4QT5B 3G6JF 5D72L 5FCSH 5DUBB 2B20A 4JDZB 1QSEB 1U3YA 4NQSA 4OZGE 3L3JA 2AVGA 1BM3L 5T1KB 4RFOL 3L9RB 1IM9B 5EZLB 1KLGB 1MJ8L 3WNPA 3QZWG 5AD0A 2ZKHL 1P7QB 5F7EH 5FA3B 4YHYC 4S1SL 3MRFA 3VH8G 2OS7A 4WW2F 2CLZB 2NY5C 2R39A 1F58H 5SV3A 1S7SB 2OTWB 3OKNB 5L6YH 5J7CC 4Y5YC 5F9OL 1ZTXL 1CICD 4PTUB 4YX2H 3FN0H 5DJZB 1N0XH 4PJCF 3UYPA 1HOCB 5IF0A 3HB3C 3T3PF 3SDAB 2ESVB 3WNOA 3SO5A 1U3HB 1KTKE 4JANB 3RNQB 1LO4H 5ADPL 2DQFB 4L3AA 1VFBB 2OJEA 2VDOL 2EZ0C 5F70A 4NHCL 4FHBD 2O5ZH 2BNUB 3K74B 1BJ1J 3UEZA 3PGDA 2ARJA 5AG8A 1UM4H 2BSTB 4PGDB 2UYLA 5D2LE 1QLEL 1WIUA 3CDGA 4L4VB 1C5BL 3GMNB 3VCLA 1I7RA 2NLJA 2W9EL 4OZ4B 1U8NB 4GRWB 4BQ9A 5HHOE 2IH1A 5C0FA 1WC7A 5DUMH 4N0YH 4XWGH 4YH6A 4UDTA 5DGQA 1S5IH 4N5EC 1TVHB 4KK5D 3UDWA 3CZFB 1DBKH 2RR3A 4OZGB 2DRUA 4X4XA 4YWGL 2HJLA 3E3QC 4C4KO 1W8NA 4PJ9D 2IBZX 2AK1H 3U46A 5K33A 4JQXA 1FN4B 5KBNC 4TULH 3RAJH 1MPAL 1NDGB 2EDOA 5IW1B 5CSGA 2X5PA 2OSLA 2OZ4A 2FL5A 3GSWB 3SGDI 3IKCB 2P8LB 1H8NA 4FN0A 5IFJB 5DJ6A 3PGFH 1A64A 5EU5B 5DEFA 4M4RA 3FN0L 1N0XL 5C9KA 4EUPA 4WDIB 3MREA 5FUZH 3QDGA 1G9EA 1JWSA 2ZSWB 5FO9A 4L1HA 3HR6A 3SDXF 2X89D 2YWYA 1R5IB 2F9BT 4XP4L 1OD9A 2B5IB 3TPUA 1XZ0A 4G9DA 3GKWH 1MRDH 3VXOA 2GTZB 4XNMA 2ZG1A 3JV5A 4OJFH 1O7VA 5ICYA 4FFVD 4XT1C 1UM4L 5D2LB 3QQNA 3GMMA 1HXYA 4MCYB 3T77A 1XMWA 3FO9A 3D2UD 2HLFD 5HHOB 1UQSB 4Y16D 3EYQD 3U0PB 1T1XB 2Q6WB 4LPTA 1NGYB 3IFLH 2R2BB 2W59A 1AGCA 4WHTB 2C3VA 3GNMH 4OQTA 2VXUH 1MCSA 3A0OA 1K4CA 1HKLL 3F7YB 5DRXA 3EYFB 5ICZA 1TCMA 3F5WB 1DANT 3L95B 3WCYA 5J1AA 1GOGA 3Q1SL 5D96C 3RAJL 4PBXA 1BFOA 1YEFL 2SEBA 4U49A 1QRND 3FONA 1UZ8A 4YHPA 5BOPA 5EU3A 4QRRA 4D9QE 3RWGA 4JFQA 2C1OB 2JJUA 1PQZB 4PLJC 4WW1A 2B2XH 4M6OL 4F8TA 5TH2A 4AQ1B 4UQ3B 5T3XH 4KKBD 1PSKL 2P5EA 3JWOL 4FNLH 1K8DA 4IBLT 5EFIA 2NZIA 5I1LB 3B2UD 5IFAH 3QCUL 4CADA 3TVMC 5KOVC 5ENWB 3O3DA 3QNXA 4XMLL 4JFXB 3DO7B 4WIQA 4F33B 4U2ZA 1G1CA 4OJFL 3WLBB 3V4PH 5F3HB 2BY1A 5AZ2L 5C08E 4WI9A 2NY5H 1F6FB 1JHKL 2AEPH 4X98A 3EOTH 1XR9A 3H3BC 4X0KA 2A74B 4WUUA 1ZLUK 1WAAE 1KTDB 4MJ6B 4Y1AA 3HAEG 3VGBA 3UP1A 2EKJA 3O81A 3W39A 3MJ9L 5DVMA 5INCA 1MRCL 5HD8C 3VFMA 2ORBH 2ZJSH 4DTGH 3S4SG 4MHHI 4XP9L 3ARFD 4ZO9A 4U0RB 5E8OA 2DL2A 3MLYL 1RUPH 5IV2B 3EYSL 4PJEE 1EFXD 2CIKA 1TZHB 2XWJB 5IVZA 2NX5E 4IMLA 4YDVB 2HFFA 2R0WH 1P4LA 2FECL 1YEJL 1N64L 1DBAH 3B6SA 3MYJB 4DGIH 4PRDA 2EEBA 4JY6B 1KN2H 1UKSA 5GGRA 5KSBE 3LPWA 3U1SH 4XVTH 1HYRC 1KB5H 3TLRA 3EYVB 2VH5L 2IANA 3LY6A 3V4VH 5T3XL 2JJTA 4F58H 3H7BB 3QUZD 4J3OC 3LSOA 1P4IL 4NC1C 3WL9B 3GRWA 1AIFA 4AM0B 1JI2A 4RBPH 5IFAL 2DIAA 3NA4A 3H9HA 3FB8B 2VZ3A 4ODSL 3BXNA 5K9KB 4XCCH 3DPBA 5C08B 4AZ8A 4D9RD 5FK9A 3ZKXC 5EIIB 3M17A 1AXSA 1BQLL 3OZ9L 5KSAA 2NY5L 4NIKB 1GGYA 4KDWA 1I1RA 1URLA 2DD8L 2G9HA 3MLZH 2DYPA 3EOTL 5EOCL 1CXFA 1A2YB 2DICA 2BSSA 4DKFH 1TXKA 3HC3L 3MRRB 2IFGA 2W38A 1BVLA 5D8JH 2AQ2A 4PRPA 1U36A 3QR2A 3AC0A 1BBJB 3HG1D 3ZKSD 5T3ZD 2GTWB 1AHWC 1NLDH 4LPUA 2NW2B 2R4RH 4R2GD 4HK3J 2QV2A 1NGZB 4YAQA 2EYTB 4PJEB 1RUPL 3BW9A 3S37X 2NX5B 4XXDA 3KLHC 5A2IH 5T3XE 4ZPVA 4NQCE 1WBYB 5DJCB 3HMXA 2DQUH 4L8DB 2F74A 5D2NC 1F11B 4RNRB 4WNQA 5KSBB 2FX7H 2QQNL 2XG5A 2EIDA 4F7TB 3B9KB 2YN3A 1GVIA 3PL6D 4ZDHA 1ZLWH 4KROD 1KB5L 1T21B 1XIWD 3QUKA 4GW4A 3MBEC 5SWSE 2E9WA 1TFHA 2P24A 3HMWH 3MNWA 4L5FH 4F58L 1VACB 4UINL 3BUYA 1EO5A 3EO1B 2GAZA 5CEYB 4DOHE 3PP4L 4PLNC 1MCWW 3I6KA 1QFWI 2PO6B 4RA3A 2ZUTA 4LRIA 2CUMA 4RIRA 4XPAL 1FV1A 3AAZA 3O8XB 1F90H 3TNMB 1T5WB 3LZFL 4WUKH 2V7HA 1IEBB 2DWEA 5JDSA 3PWPB 3OJ2C 4BZ1H 3MLZL 4M8VA 3QCTH 3O3EA 4LVNC 5KJRL 4Y5XC 1H9VA 3TWCH 2AGJL 4L4TA 4OI9A 2J8UE 2OQJA 3G5ZB 1QBML 3T0AA 1OW0C 2X4QA 5C09A 1H3TA 4QYOB 2NNAB 1B0RA 1HDMB 3DVGA 1A22B 1FSKB 1R3LA 3VWJD 3HE6C 4TSCH 1EBAA 3HZKB 3CSPA 3G9AB 3O2VL 5TJWK 2UZXB 1T83A 5F9AC 3FRPA 2VZTA 2HTLD 2WWMD 1YC8A 2OM5A 2EDWA 1OT1A 4MD4A 4NQCB 3WS3A 4Q2ZB 2VUYA 1B90A 1DQJA 3QIWD 3E3QE 4HJGB 1FNEB 15C8H 1LO3H 2EYSB 2FX7L 1DFBH 3P4OA 4YHYB 2GK0A 2H3NB 4RDQF 1PY9A 5SWSB 1QBLL 3SHSA 3CUPB 3RL1A 3WUWG 2A6JB 4XC3H 4XXCC 4ELKB 1DCLA 3WXVH 4DOHB 1FVDA 4LNRB 3FQUA 3S35X 4OFIA 1QOKA 4MS8D 1XGQB 4OCRH 1I9EA 3REWA 3HI6L 2F15A 4JRYB 5DUPH 2CDFA 3HR5B 2AJ3B 4MNQA 4I77L 1RUKH 1KNOA 2DQCL 2JB5L 2RIKA 3QUYD 4B50A 3TCLB 4WO4C 3D0VB 3R0MA 4NQEA 4O02L 4K7PL 4M1GH 5E94A 1SM3L 4NUJB 1BJ8A 1UACL 1KB9K 2J8UB 4KKAD 4PRHD 5DD0H 4PG9B 4P5TA 4E41A 2V2WB 4OD3L 1A7OH 1G7LA 4HX1B 4WU7A 4DVRL 4H1LH 4MQ7A 1A4JB 5DJ2B 4HPOH 3W2DL 3V7MA 4GXVH 4QXGH 5GGVL 3DVNA 1WSST 1KB5B 5AYUL 3CU7A 1HHHB 1DLFL 3GSQA 3VI4F 5MENA 1IGMH 2OBGA 3BQUB 4PUBH 1AXTH 2ZOKB 3RVUD 2KZ1B 3RTQB 2FIKB 4PJGA 4NOFA 15C8L 1LO3L 4W68A 2BVPB 4OIIH 1MLBA 4HW6A 5FGSA 2MSPA 1ODAA 5F7FA 2YRPA 4G6KL 2F8VA 4ODVL 4JE4B 2GCYA 4WV1B 1F4YH 4K3EH 4BUGA 2DQDH 1J1XL 1GHFL 2DMCA 5E6ID 3QG7L 1WIOA 1V7NH 1F3DH 3LKRB 3CMGA 4GRLC 4KRMB 1RUMH 1A3LL 2Z8SA 1IVLA 4AIXA 1I7UB 1BLNA 2DBJA 5GGTL 4DVBA 2Z4QB 5I66A 5TPWL 1R3KB 4KKCC 1U93A 3I75A 3IF1A 5EUKA 4YXKL 3QQ9C 4I5BA 1BWMA 1KIRB 3RGVD 4BELD 3SGJA 4L4JA 2DB8A 5CD3A 5BJTA 3BKYH 2DLHA 4ODWB 4PJ8A 1A7OL 1TCRA 1VHPA 1CF8H 3SDDA 4HUWA 4X99B 3LKSB 1IGTB 1ONQA 2IPKA 3IB4A 3MJ6A 4QXGL 2A38A 1S7QA 4K07A 1JF1A 1LHZA 3UPRB 2QLVB 4F37F 4MWFB 4YPJA 3BP6B 4GXUN 3QEQE 3S3PA 1NFIA 1LEIA 3I2CL 1H8SA 1G7MA 4OCYL 1AXTL 2R2HA 4XMKH 4UTAH 4P9ML 5D96B 2VDNH 3QNZB 3EAKA 3VXRD 1JN6B 2DJUA 2R1XB 1S3KH 4P23C 2D2OA 3WNNA 2DF3A 1TJHH 3LKNB 3Q48A 1A1MA 5I75C 2DQDL 4F2MA 3C60D 4J12A 1N8ZA 2YC1B 2PW1B 3FRUA 3DXAD 2QQKH 4XTRD 1RUML 5SX4I 3CH1B 1YNTA 2UZYB 1I3VA 3IS1X 4G8GA 4EBQL 3QG6A 1F4XH 1F5WA 5HI5C 4HIEB 4LP4A 3TVMB 3S97C 3SO3B 4PRID 4NHUB 3EYOA 3DUHA 1IAKA 3C5SA 4P2OD 4U1LB 4LPYA 1ZA3A 3C87A 3D3VA 3V2AR 3RWEA 1I1FB 3U7WL 4JG0H 1QRKA 5D6CA 2AEIT 4WJ5A 4YHOL 3PIQB 4GW1B 3MJ9A 4JRXD 3T0ED 5ISZA 2W0FB 3GMOA 3QRGH 5A16B 1A9BB 2AV1A 3VFSB 2PN5A 2UZIL 4EIZC 1NQBA 1G0YR 1GSMA 2FO4B 5TQ2H 3FB5B 5IROC 2KKQA 5IMOB 5IMLB 4JKPL 1TETL 2AI0L 3B2VH 2BCKB 3LRGA 3IDXH 4X8JB 2DBLH