2COQA

Structure of new antigen receptor variable domain from sharks
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'ARVDQTPRIATKETGESLTINCVLRDTACALDSTNWYRTKLGSTKEQTISIGGRYSETVDEGSNSASLTIRDLRVEDSGTYKCKAYRRCAFNTGVGYKEGAGTVLTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords new antigen receptor variable domain
publication title Structure of a shark IgNAR antibody variable domain and modeling of an early-developmental isotype.
pubmed doi rcsb
source organism Orectolobus maculatus
molecule tags Immune system
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2coqA00
5BS0E 3H7LA 4HUMB 2GK2A 2XZZA 3U7AA 1PX4A 1HH9B 2AQ2A 4HCRA 2KZWA 1MIEL 1QZ1A 2FX9H 5FYLL 4YFLF 3B2UD 1R5WB 1OM3H 3EO1B 4P46A 1KB5B 2F74A 4G8EB 3GK8H 4JFHD 1NCCH 1KCLA 4KI5E 1EAPB 1MRCL 4HPOH 1A9BA 2R2CA 3S5LA 4FFYL 2P5WD 5ILTL 1NMAL 1M1SA 4HH9A 4UUJB 3MRMA 2BNRA 1KBGH 3CCHA 4U1IB 2OR9H 3EJYC 4UQ3B 3TP4A 4I2XE 4DAGL 3SPVB 3PJSB 3RNQA 2WV3A 4J6RL 3DHJA 4XP5L 5F6IC 4L3CB 2XACC 3RZCC 5EUOF 3PDOA 2QV2A 4JO3L 2F5BH 3RDTA 3U0PA 2AV1B 1WIPA 2N4IA 5CINL 5TDOA 4YHLL 1DDHB 1Q0XH 2DOCA 1T66C 2XPGB 2NR6C 4NM8L 4CGTA 5AYUH 3PHSA 3Q5YA 1CGSH 1QVOB 3A6OA 4NRYA 4AT6A 2AJVL 4HEPG 2YWZA 1FBIH 2E7BA 1U91A 4K7PH 5GSVB 1T5WB 1A3QA 3FTGA 5CP3H 5B3NA 4M1CC 4RIRA 3ARED 2AEWA 3MV9A 4N0CD 1O5DT 1DP0A 1TJGH 4Q2ZB 5HHME 1JI2A 3PV6A 4KAQL 2VXUL 3HS0A 3O2DA 4UT9H 1WCBB 3ARDB 3JV4B 3MFFA 5IJVA 3WS6C 2NY0B 2PXYC 2NW3A 1CICA 4JKLA 2ARJB 1UZ8B 5MEQB 5LCVL 4YDJA 1P7QA 3ARWA 2FD6H 2XQYK 2F53D 4UI2A 4H8WH 5EU6E 2PF6A 4ZYKA 4PG2C 4R7NA 2BRRL 3LIZH 4JFED 1DQJA 3O2DL 1EERB 1EBPA 5IFJA 2KUTA 2FHFA 4F2MA 1E4JA 5CEXA 5D1XB 2ICES 3QFJE 1XFPA 3DURA 5D7LD 5I74C 1X5HA 4PJGB 2FIKB 2J3SA 3TN0D 3GSUB 4NQCD 5IVOA 3I84A 2WMPA 1T0MA 2CRMA 3HE7D 2AI0L 1OAKL 1P9MA 2WBJA 3BN9D 4RA3A 4GRWF 1WISA 1EHNA 1FVEB 1X7QA 1Z2KA 3SKOA 1WAAF 3PE9A 5JXED 4GAJL 3GMOA 1XCQB 1I1FB 1JNJA 1H3PH 2VDPL 1NFDF 5T33H 1FORL 1UQSB 4KKBD 2XQBL 4TOYH 4JDZA 3IDNA 3QI9A 2Z35A 4OQ1A 2XICA 1XF4B 1QTYT 2XWTA 4D0DB 3I6KB 3O6FD 2WLYA 3T65B 1CGXA 1HHHB 2ZOLB 2R8SH 3IJSB 3PWNB 3TT3L 3D2UA 2JB6A 1QEWA 1JHTB 4I13B 5D2NB 3BHBB 1LD9B 5BVJA 1RZKL 1JZ7A 4O4YH 3GJFK 2DWDB 5D1QC 1LEGB 4P57A 1LDPL 5DJ6A 5DJ0B 4Z76A 4AJ0A 4JFZH 3PWVA 3TNNA 2AK1L 1QRND 5IVZA 4X6CA 2V9TA 4MA8L 6FABH 4LNRB 1PLGH 1S5HA 4GW4A 4Q9QL 3FAXA 5KG9B 1CR9H 1X5JA 3BKJL 2AXHA 3KYOA 5HHQA 5IKCB 4U1MA 2FL5B 2JB5L 3MRBA 1MY7A 5HYJE 3I02A 2Q8AH 4DKEL 4HZLA 4FFWD 4XPBH 4U7SA 1OAUH 3K74B 4NO2B 1KXVC 2BVPA 4ZS7H 4ELMB 4MQXC 1C08B 4MWFA 3MRPB 1KEML 5CD5D 1I7RB 1INEH 2ENYA 3DYPA 5IB1A 2X4SB 2HRPL 1V8HA 3MO1B 3ZHLA 1KPRA 3EYFB 3P0YH 5I15L 4GXUN 4KKAC 4WV1C 4YFLI 3RL2B 4F58H 3LN4B 3RWCB 5E5UB 4YHOL 4L8CB 3FB6A 4BFIB 4N8CH 2E9WA 4P2RA 4G6JH 1K5NA 3UTTD 2D7QA 2FWOB 4IS6B 4P2QB 4OGXL 1TPXB 3SCMB 5I30L 1F2XK 1IC7H 4QXUH 3U9UA 1DBKL 5E2WH 3OR7B 2K7QA 1RUQL 4KDWA 1NDMB 3BN3B 5TE4L 5JORA 4IRSC 4P3WA 3D85D 1QSFA 3FFCA 4N0FA 1FV1B 5I66A 3GMLA 3DX6B 5IESL 3QIBB 1XGTB 1U8LB 4I0PC 4JM4H 3VFVA 1S9YA 3ZTNH 1UWEL 4K71B 3H6JA 3OF6D 1EHLL 3ARXA 1HHJB 4OLVH 2ZCKH 1T3FA 2YUVA 4K3JH 1U3HC 2YA1A 3ARVA 5FDWA 1JGDA 1Q72L 1KULA 2OMNA 4JQIL 4Z7VB 3U36B 1J7VR 1QFPA 3ARFA 5CGYC 3WMSA 4GFTB 4MDIA 3BPOC 4JJ5B 1YEIL 4PJCA 4CL7A 1J86A 1NGXB 4S2SB 1KJ2B 5E5RB 4GKZB 4FQ2L 4OGAC 4YC2B 5FA3A 3B9DA 5CUSH 1IBGL 2EIDA 2IH3A 4UZGA 3QHTC 2WWMC 4I4WA 5D9SA 5EUOA 4YDKH 1J9CT 1N7ML 1U6AH 2PR4L 1IGIH 3DO7A 1HXMB 5EFIB 5J0BA 4XCNA 1F58L 2BK8A 3EYUL 1T0PB 1CFNA 4X4XB 1DVFA 4K7PY 3WEXA 1FNEA 1YMME 2ADIA 4AH2A 1F4WL 3GRWH 4K8RL 1CDCA 4RFNC 3ROLA 3WDHA 3CX5J 5C0CB 1O0VA 4LRIC 3MMEB 3HFMH 4GRLD 1H3WM 1FGNH 1FCCA 4TQEH 2HJFA 3FZUD 4M00A 2PYEA 4LLMB 1FC1A 4X98A 3NFPA 1KIPA 4M9PA 1NMBL 3MNWA 2IAMD 5FXCH 1FAKT 1KJ2L 3A6CH 3ZE1E 2DKSA 5JLZB 2ILLA 1GGYA 1I85C 2HKHH 3TCXA 4GG6F 3TF7C 3WSQH 1UWXH 1UG9A 1ZLSL 3PWPA 4QNPE 1ROWA 3GSQB 4QGYA 1ZGLA 4JHAL 4PJIE 4RGOH 2P8PA 3FQTA 4KY1L 1YJDC 5F7MC 1A7RH 1G6RB 3G5YB 3S3PA 1KLUA 2N56A 4LQFH 5DC9B 2X1PA 5LWYL 1JUFB 2AXGB 3NH7H 4HGKC 3U9PL 5FA4B 2ITCB 5HTSA 1M7DB 4KXZH 1U8NB 1I8KA 4KU1A 1B0WA 3D39B 4B5EA 3TV3H 4O2EB 1Q9LA 1WAAA 4Y1AD 2UWEB 5SWSD 43CAB 4JKPL 3SKJH 4PV8B 3S3JA 1E4XH 3UP1A 2LAAA 3IKKA 2WM0A 4KHTH 4MCYA 4RNRB 5EU5A 5I1GL 5J12B 4CMHB 1AGDA 4W81A 5LBSH 5L8JB 5IT2H 1T7XA 3HC3L 4ONFH 2AJYL 2XTJE 5ADOL 4MVBC 4MJIE 4NC0B 5C6PB 3GJEA 3UDWA 3UPRA 5DZNA 2OS7A 1VACA 3UO1H 5DA4A 1MHHA 1CG9A 4KI5F 3SDAC 2H2PC 3RX5A 4HQQH 1A8JH 1RZ8B 4WEBH 1XF3A 1N2RA 2SEBB 3MTRA 1ZVSB 1LP9B 4K23L 4PJ5A 4MD4B 2FZ3A 1HILB 1IL1B 4ACPA 1PY4A 2DIJA 4HGMA 4LFHG 2XWBB 3P30H 3FT2A 1NGQL 2EIZA 3LQAC 5BVPL 3HMXA 4E5XA 4QT5B 4WVRA 3DPBA 4ZOAA 5C0BB 3HR6A 5JW3H 2F8OA 1CTNA 5JUEH 2W9DH 3DMMC 2GJZA 2VZOA 2ZCHL 3ARRA 4G42B 3ZT6A 1YEDB 4D9LL 3TH4T 2NXYD 1CGUA 1I8LC 3RWEB 3CH1A 4WNQA 4OQTL 4HK0B 4OD2B 4YFDB 3DRQB 2GY5A 4JHZA 4RGMC 2GITB 4TUJB 4NZJA 3JVGA 4MD0A 1F6AA 1BD2B 4E0RA 1KNOB 4OCWH 2V6HA 4LDEB 3SOBH 1P7KB 4ONGL 1ZAGA 1YN7A 5GRVK 4NT6A 1AKJA 4QRRE 5F88B 5F7LB 1MLBB 1EIBA 4PGDB 2EYTA 1Z6JT 5EC2B 4NKIL 4MNQD 4PRPB 4PTTB 5CZXD 4CNIA 3K4ZA 2YPKA 1TJHL 2C3VB 4L8SC 3T1FA 1EO8H 4JZNA 1NC2B 2LU7A 4QXWA 2FYYB 2FO1A 3VGAB 2Z93A 3LRGA 3CXDL 3SKNB 3VFMA 5KSUA 3UJTL 4XWGH 1J8HD 5TQ2H 4N0UA 4P4KD 1OPGL 3WS3A 1GC1C 3QUMH 3WIHH 5CIPA 1U8KB 3QEQE 4PRNB 4MXQC 3QDJB 4NZTH 4S1RH 3RA7H 1X4YA 2DLEA 5IB5A 3GEWB 3KYMA 4FXKB 1I8IB 1Q38A 3CGTA 4I3SL 5JPNB 4JFFA 1ZSDA 5FCSH 2IANA 4ZAKD 1AGBB 3QJFB 3QWRD 5CP7A 2XRAH 1HHIA 3MXWL 2D0FA 3V4UH 4KDTA 3WUWB 5KVFL 3BJ91 1ETZA 5HPMB 3QQ9D 4AEEA 1U42A 1WICA 4OGZA 4PRHA 3DX8A 4Y2DA 3QNZA 1XIWC 3MRFB 4I3RH 4RQQA 3ECBB 3QNYA 1MI5B 4DJMA 4G7VL 4U6VH 4ZTOL 2Y25A 3QXAB 4WTZG 4NQXA 4D8PB 2NZ9D 2GSGB 1S9VA 2M26A 3PL6C 5DD0H 2H26B 3L3DB 3O3EB 3JTSA 5BW7C 3OL2A 4L3EE 4F3FB 3H9SB 4JKWA 4R4BA 2A83B 5GJTL 1Y6NR 1NBVL 3E1F1 4GXVH 1YEJH 2GQHA 4PJGE 3GO1H 4R97C 2XKNA 4HG4J 1I9IH 4Q6IA 2YD4A 4K55A 2CLRA 4J7RA 5LQBH 3GJFA 3HC0B 3QCVH 1HZHL 2YKLH 32C2A 3VFPB 2YC1B 4IMLA 5C0AB 4PLJC 3BH9A 4X6BA 4GOSA 4JFOA 4R0LB 3SGKC 3KPSD 2EDTA 4HFUL 3H9HB 3PABB 4N5UA 4Z77A 4OCLC 3TIEB 5E9DA 3AS3A 4XCFL 5ACLA 4LLWB 1B0RA 5TQ0H 3SKMB 1A3RL 2LE9A 4F7TB 25C8L 1F6FB 5D71H 2RB8A 3IJYA 2IPUK 1MQKL 5DEFB 4Y89A 1ZVHA 4FQPA 4OSUH 5D2NE 3VFTB 1YECL 1JGEB 5E99L 3NACL 4OKVB 1YY8B 3BJLA 4K07A 2UZXB 3ILQD 2XFXA 3BGAA 1FZOA 2VXSL 2BNQE 2DKUA 1ORSB 4GBXD 5I1LB 1NL0H 3C8DA 3B9KB 1L0QA 1ODAA 1IILE 4XT1C 1A64A 3RWFA 5DRXA 5J89A 3MBED 3HI6L 4PJ7A 1BOYA 3QCUH 1ZT1A 4IJ3C 1AIFB 1E0OB 4BH7A 4WUKL 2B1AH 3GMPB 2MMXA 1AP2B 2JJUA 3AXLA 2HLFC 3RAJH 5BS0A 2H9GA 4MX7B 3C8HA 4MSWB 1Q1JH 4M7LH 4PUBL 1A5FH 4MS8C 4YHIA 4LEXH 2YRPA 1T6VN 1MUJB 5J1AB 4PJAB 4ELME 4H0HB 5FK9A 1YJDH 1QNZH 5I2IA 4KV5F 4QKXB 5C9KA 2Z8SA 5FUCC 4M5YH 3OTTA 1UVQA 3BEWB 4ONHA 1DTUA 1VADB 2IG2L 3QXWA 1K8DB 4PS4H 2I9TA 2PYFA 5GGSY 4YPGA 12E8L 2ZPKH 3D0VB 4X9FA 2WANA 4AIOA 4YHNB 2ADJB 1ZLVH 2Y5TB 3CSGA 3CSBA 3N1PC 1XR9A 3STLB 2F54D 1ACYL 2FATL 2WUCL 3MRGA 5T3XD 4L9DA 4MD5A 1AO7D 4RZCA 2EE2A 4I2XA 4Y16B 5FYKD 3WFHB 1QP1A 3BWAA 3WFBH 2NY7H 4HKJA 3VFOA 1FVDB 3JBG7 2PTTA 2PKDA 4KC3B 2ZG1A 4PIRF 4NSKB 3MBXH 3IDYC 5M95B 4FQLH 3BSZH 2W9EL 3FQNB 4ZNEA 1NGPH 4C4KT 2YOCA 3V0VB 4MA1C 1K3IA 1RIHL 1UA6L 2H32A 1ZVYA 4G80A 1OSPH 1UJ3C 1H8SA 3BIAX 1N59A 4JVPA 1LE5B 1U58A 1W0WA 1QBMH 4IRJD 1OQXA 2RAMA 1FJ1A 4WO4B 4KTEH 5E4EB 3LQAH 3NOIA 2VLRB 3C5JA 1UB6A 2CKNA 3C5ZD 3GSNH 1SM3H 5C0NC 3AS2A 4PRAB 1A4JB 4Z8FH 3RPKA 3ZE1F 4NQDA 3FN0H 5IMLA 4S1DC 3KXFB 1QYGL 4Z7WB 4EBQL 3WXVL 1KEGH 2BC4B 4OM0L 3BKCH 1CDIA 4UTAL 2V5MA 1MCQA 5EU6A 2RIKA 1MCOL 2C1OA 4QNPF 5F1KC 2D0GA 3T4AA 1P2CA 3RBSA 4PJIF 4IOIA 5C07B 4RCAA 1GHFL 3QJHA 4HUXA 5DJCB 3VXQB 4PLOB 4XHJD 2MKLC 5GJSH 3QFJA 2XXCB 5DD6A 4P46C 5IFHH 1G7LA 4KRPC 3ZTJH 4LF3A 2X70B 2BVYA 5EZJA 5EU3B 5GGQH 5C0IA 4QCIB 4GSDH 3QWOA 3ZHDA 1JV5B 3CVIH 4HV8B 1R3IH 5D6CA 3NCYP 5ESVB 2HVKA 3BZEB 3SO3C 5F7WC 1CGTA 1IAOA 4F57L 4G43B 5AAWA 2PW2A 4L29B 1NLDL 2ZSVA 4U6XB 1F11A 1S7QA 5H2BB 4JN2A 3V6ZB 4FZEL 1EEZB 2IALA 3T0EB 1D5ZB 3G04B 1NDGA 3K0WA 4W6YB 3C08H 3H3PL 4PGBB 4FN0A 3DVGB 4HWBL 4I18B 4QRPE 1GC1H 3RVXC 3FO0L 1F4HA 1QLRB 5HGGS 3QRGH 3RDTC 4R7DB 1C7TA 5D7KE 3GMRA 4OCMC 5HI5C 4LVNB 3UJIL 1NEZB 4LHJB 1RURH 4LCYA 5EPMA 4XNYH 1DUZA 1I1CA 1P6FA 3SE9H 2XIDA 2YPVL 2MHAB 3E6HA 1OLLA 1FLRH 2O5YL 4JO4H 4GS7B 4Y4HD 3RWJB 2CO6B 4PYHA 1E4WL 1AE6L 1TQBC 3DNKA 3PGDA 3T2NL 1MAMH 4OLYL 3MREA 3IJHA 4JRWA 1RUAL 2EYRB 1E28A 4LHUD 3DWTA 4TUKH 5JOEA 5CJXA 5EU4A 3SO5A 3CIQA 5EB9A 1ITCA 2AV7A 4O2FA 3U30C 4DGIH 1KIQA 4ZDHA 3AREB 3ZKMC 3B5HA 5EBMA 3U6RB 2QQQA 1CICC 4X8JA 5HYJA 4LCWA 2AEIT 4ODWB 1M6OA 1RZJL 4JR9L 5MEOA 4MJ4A 4Y4FD 1W0VB 5FKPA 2VDRH 4IM8A 3QG6A 5HGAA 5TDPA 3O9WD 4KK6C 4ZUTB 2NMSA 4PRDA 5T1KA 5ID0A 3BUTA 3MOBH 1A6TA 3W0WE 4YXLL 4HIHA 2F53B 2P49B 3MLWL 5HYSA 1EJOL 5CLWA 7FABH 3OJDB 5FO9A 2XN9A 4X0KB 4M7ZC 4POYA 1KV3A 4MNGB 4P9HL 3QG7L 4RGNC 3T77A 4G8GE 1P9MC 2WBJC 3CXHJ 1A1OA 5EA0L 3TO4D 4DVBB 3TN0B 1CXLA 3RUGA 4YIQA 3BPNB 3GI8H 4NQCB 2DMKA 1M05A 3LDBB 4UDTA 1N0LA 1JYXA 1CL7L 3ARQA 3NN8A 4BA8A 1TITA 3RVUC 4YHZH 5C0BE 4E42A 1CBVL 4XMLH 2WBKA 3QIUB 3KPLA 2DDQL 2VE6A 3DV6A 5DEGA 2Z31B 3Q6FB 1LO4H 1CD1A 4NQEE 4QRQA 2ERJB 4K3EL 4PJ9D 4P4RB 4GG8B 3C5SA 4TRPL 3BO8B 1FFPA 2FJGB 1PG7L 5GZOC 4L4TD 3KYNA 3RVTC 2FB4L 3O6FB 4HXAL 4HGWB 1W72B 5HJ3B 3VXOB 2P24B 3ZT7A 4PG9A 1U8OA 5JOPD 2A74B 4QYOA 1YEEL 4LSSH 1H5BB 5F9JA 4KRLB 1BD2E 2EDBA 2G9HB 2YD6A 1Z9SA 3BE1H 5AZ2L 3IGAB 3OQ3B 5GS1B 1QRNB 2AVGA 3VFGH 4XPGH 1K4DB 5FHAL 1QLFB 4JFYA 3C9NA 1RZFH 4MGXA 5DMKB 3LKSB 1QACA 1SQ2N 2GK0A 3PV7A 2CRYA 5HVHB 5I9QC 3MRCA 1C16B 5AUMA 4YDIH 3BESR 3WO4B 1PVHA 4DQOH 3KPRB 4FS0A 5EWIL 4LAJH 4Y5XB 4YHKH 3QDJE 4EDWH 5JNYB 1KTDA 5I1KL 3VWJA 5D8JH 1W72L 3BQUA 2AKRA 1TTUA 5EC1B 2IADA 1C7SA 4UB0H 5I18L 3Q6GL 3O8XA 3CVHB 4P23A 4XNUH 1CFSA 4YAQA 2FH8A 4FQIL 5GRUH 3L5WB 5JMRA 4MA7H 4FQ1H 2C1PA 3CC5B 3HNTH 5FUZH 3VRIA 4PY7B 4KJPC 3WFEH 5GGTA 1MI5E 4LP5A 3UTTB 1ERNA 1HKLH 4QHLA 1UZ6E 3PP4H 3LN5B 3CFJB 5IFAH 3WUZA 1NSNL 1MJUH 4ESKA 5T3ZE 2YUWA 1HE7A 3BEVA 5E7BA 2GSIA 2E7HA 5I1EH 4Q6YA 1OF2B 2BP3A 3D85B 2Q3AA 3UTOA 2FIRT 3RX7A 4X6DB 5I0DA 1FFOB 1OGTA 4Z5RA 5JW4R 1MIEH 2BJML 1ZA6B 3ZKNC 4M6ML 5FYLH 5JDJA 4NRZA 1T4KA 5GGTL 5KSBE 3FKUS 1ND0A 3HPJA 2VH5L 1EHXA 3ARFC 2JCCB 5IM7B 5GIRA 4TVSa 1EV2E 1KIRB 4KUCF 4BZ1L 1Z0NA 5BRZE 1Y0LA 4RAUA 3RNKA 1WJ3A 2QSVA 1MRCH 3C6SB 2A2QT 3W11D 3OHXB 4FFYH 1NMAH 5DD3L 3CJJA 3CFBA 3EIFA 2BOBB 5CD3B 3OMZA 3OAYK 1A9EA 2QHRL 2W1NA 2NTFA 2OTPA 4Y19B 3EGSB 4FTVE 4ELMF 2AJZB 3QXDA 1QSED 3RL1A 5CEZL 1AI1L 3IFPB 43C9B 4DAGH 1X5KA 1AH1A 3WL9B 3MCG1 1RHFA 4HJGA 2APVA 4J6RH 4XP5H 4LAQH 4TSAL 3P4NA 1DVFC 3O3AA 3VH8A 1D6EB 2CKBB 4HT1L 5CWSA 4PJBE 4OUOA 3WDJA 5CINH 1ZWIB 4P5TA 3GSXA 5C0DA 3FRPG 1LMKA 1WCQA 4NM8H 5DFTA 1NC4D 3FQXB 1FO0B 3OJMB 4XXCA 2XV6B 1FQ9C 5DHVA 4WU5A 2AJVH 1FRGL 5EG6C 4UQ2A 3WFDL 3PIQA 4YEFA 4EIGB 1PAMA 5E6ID 3FFDA 4GRLB 4IOFD 4KAQH 2VXUH 3UX9B 2FBOJ 4DUVA 2ZKHL 1QHOA 5DRWB 1N6VA 1S7XB 4F33B 3WFCL 1REIA 2E9JA 3DX9A 1H3TA 2IAMB 4XNQB 5EO0B 3TO2B 1AR1C 5LCVH 2OMBA 2VRAA 4XBGA 4F7EA 2ZOKA 3VFWA 4P0DA 1KB5A 2BRRH 5FECA 2ZSWB 1EAPA 3E3QE 2DQDL 3O2DH 4XH2A 3V6FA 4U1GC 4YJZL 1FO0L 2E6JA 5K9JL 2OSLB 2QBWA 4NC1E 1HSAB 1N3NB 3D6GA 5ITFB 3WJJA 1CK0L 3V5KB 4U1IA 1MRDL 2GTWB 1XGQB 3EZJB 4QRRA 4BH8A 3QB7C 4HS3A 1YNLL 3SPVA 2AI0H 2XG5A 1OAKH 3QXUA 1R24B 3WLBA 1WITA 5J3HD 4G7YL 3BKML 3U7YL 3HA0A 3VG0H 4XI5C 1ZE3C 1P6AB 4Y1AB 4EUPB 5H35A 1YEHL 5JDSB 3DIFB 3ZE2E 2VDPH 4LLUB 2HTLD 4I9WD 1FORH 2XQBH 4KJWC 2G5BA 3MLSL 3PWJB 3EYSL 3QEQA 3UEZA 4UIMB 3ILPA 5DD1L 3UDWC 4ZFFB 2P4AB 3TT3H 2XTLA 4FZ8L 2V2XA 1LO5A 1YQVL 5C1MB 3CSYA 1RZKH 5CKGA 1UH3A 3ARDA 4GMSL 4IBLT 2VLRE 5FUOL 3L95B 3G9VA 5I16A 1LDPH 1I7ZB 1G7JA 2I07B 4N5EC 2OX5A 1JNHB 4C56D 1SJEB 1UFUA 2AXFB 4R2GC 2R39A 2AK1H 1S78D 4CADB 4MA8H 1IEBA 4Z7WE 1H15B 2LVCA 4HUKB 4JZJB 5DVNA 4GAYB 2ZCLL 1DBBL 1GJIA 4L3EA 2Y6SC 2JB5H 3BRGC 1QOKA 4DKEH 1F90L 2IFGA 2X1OA 1BEYL 2J6EA 2J8UE 3MODL 3I3DA 5DYOA 1S5IL 3DBXA 1K9TA 2MCG1 1HHGA 1BWWA 1KEMH 3F6LA 4JPWL 3KNBA 4WJ5B 1CYGA 5E8EA 3S7GA 2AEQL 1M7IA 2NXYB 2XNAB 4X6FB 4FNLL 2HRPH 3JVGC 1RZ7L 4UMGA 2BHUA 5BQ7A 2CIIB 1FL5B 4JFHE 4EI5B 3U4BL 1I1FA 4YHOH 3BDYL 4KRMB 2ZUQB 3UTSD 2P5WE 4LCUB 3VJ6A 3GB7B 4OGXH 1O7SA 4RFEA 1A1NB 3HTLX 5I30H 1UXSB 2Q76B 4GKSA 1DBKH 5DJDB 1T66D 1RUQH 2NR6D 3I6KA 1BGXL 3WV0A 2HVJB 5DVLA 5T5NF 1J05A 1NEZG 1JHTA 4MNQB 2LTQC 1BM3L 3D69A 2BY1A 3SGEI 5CILL 3DUSB 4UOJA 2VQ1B 2E8YA 4M1CD 1JPSL 3GSVA 4Y4KB 2BNQA 3VXMD 1N5AB 5DJ0A 4BSWA 3NCBB 4WI6A 1K2DA 1NBQA 1D9KA 1BQHA 1UWEH 3JWOC 4GAGL 5EBLB 4WI3A 1EHLH 2NNAA 1RJLB 1BBDL 2CLZA 3B8SA 4OFDA 2J8OA 3MGOB 3OXSB 4YFEA 3QUXA 2VABB 1Q72H 2CDFA 4KDTC 4Z7NE 1ZA3A 3HE6A 5ERWA 3AVEA 4MXWL 3U83A 5IKCA 3NFSL 2WZPD 2EDOA 4XCEB 4P59L 1T1YB 4Y2DC 3QIWA 3M1BB 1KG0B 5HYQB 1AC6A 2D4DA 4O51B 4QY8B 4OZFA 4W4NA 1YEIH 5E8OA 3RQ3A 1U2CA 2P5EB 5FB8B 3Q5TA 3T08A 4FQ2H 4XWOC 2DL9A 4GQPH 1IBGH 1A14L 1RVFL 2YK1L 1S7TB 5FF6A 2F53E 3Q5OA 3MO1A 3MV8D 5MHSD 4L1HA 1NFIB 1N7MH 1OWWA 2PR4H 4JFEE 4A6YB 3LN4A 4WUUB 4MNGE 5KS9A 3MUZ1 4HDIA 3EYUH 3FO2B 4Q6IC 1G9EA 3F7VA 5F7YC 2CDEB 1A7BA 4LSUL 3O81A 3SCMA 4H25A 1XGRB 3E2HB 5D7LE 4LEOB 1MHEA 1F4WH 5LJYH 3C2SA 1UCTA 4XP6L 4K8RH 3OR7A 4LMQE 3BZFA 4H1LB 4N9OB 3LOWA 4NQCE 2NY3C 5IROA 1EA9C 5AZEL 5I1CL 4G8FA 2X89A 3U0WL 4V1DD 3TA3B 5A16A 4JFDB 1E6OL 3HZVB 5KANI 1NMBH 3KPSB 3O4LD 1EAJA 1U8LA 4MZ3A 4ODHL 1MFEL 1OSZB 1Y6KR 4HJJL 5IIEB 1HHJA 8CGTA 1HNGA 2P8LB 2UVFA 1X9QA 2JLLA 3QNXA 1TDQA 2EXYC 4J8RB 3EOTL 1OP3H 3DETD 1ZLSH 3TBYA 4XNMA 3V5DB 4JHAH 5IV2A 1T2XA 3GSWA 3FOMA 2FBJL 4XVSL 4KY1H 4E41E 2D7TL 5EIVA 4GBXB 4HLZH 4FXLA 1ZEAL 3T0VA 4LNVA 2W60B 1QRNE 4JCMA 3U9PH 1BX2B 3S34L 1IQDB 1UZ6F 2CXKA 2EDFA 1MCKA 2CK0L 3MBEB 2DL2A 1A1MA 1F5WA 4JKPH 2FNBA 4M1DL 4R4FL 2JE8A 4DKDC 4X7DC 5DR5L 2C4FT 4G6KL 3SDXB 2R4SL 2X41A 1SVZA 5I1GH 5KOMC 3EJJX 1FE8L 3IDIA 1KT2B 3VFUB 4U1KA 5KSBF 3HC3H 2G2RA 5ADOH 4PJHB 3SY0A 4KI5C 5DJZA 3MYJA 1AC0A 2BVOB 5IHZB 4C57C 1WWBX 3AS0A 2H8PA 1C1EL 4F7MA 3C60C 2A9NL 4IHOB 5HGDA 1T20A 4LLMA 4IRSD 3D1MC 4CVWA 4KROC 2J5LC 2YPLD 4LP4A 5A2JH 1G0DA 4H5SB 4NN6C 5EN2B 5INDB 3P9MB 3N1FC 4DKAA 2DQHL 4K23H 3OB0H 3UTTE 4PP2A 1KXQE 4I0PD 3NZ8A 3DRTA 1ULVA 3AGVA 4QRPA 1R3HB 2VLJD 2IPKB 1AO7B 1J10A 4M61A 4LBEB 2PTUA 3V7AE 5BVPH 5IMMA 4QOKB 4Y5VA 3BUYB 4GKNB 5DUBA 3PGFL 4KRNA 4PJBF 2ZCHH 4PB0L 1MPAL 4I77L 5LGKA 4JFPB 4D9LH 1WV7T 3BGFB 5J6GA 3JUYA 1WBZA 1CF8L 4HAGA 3U82B 3SDDC 2WP3T 4YQXL 5CFHA 4XX1G 4WW1A 1EXUB 3SGJA 1GH7A 4LLVB 3MJ6A 1UXWA 5CLTA 4PJ8D 4FABH 1I3RB 1CN4A 4YNYB 3WJLA 1D5IL 1CU4L 2P1YA 4H26B 3KDMB 3X3GH 1V3LA 3NFNA 3C5ZB 4AIZB 4PJEB 2JK5B 4ONGH 4NRXA 1OHQA 2NY1B 1NGZA 1GIGL 3AAZA 3AB0B 5A2KH 4NKIH 4NPYB 4KH2A 4NNYA 5HGHB 3W0WA 4OZHB 1E6JL 3NCCB 2DRUA 3QAZC 5TPWL 1YC7A 1KELL 2OTUB 4H0IA 5C08A 3SBWA 5BV7L 1EBAA 2Q86B 1YYML 3UJTH 1JHKL 1OPGH 4G8GA 3HNVL 4JVUA 3EDFA 4UINL 1FG2A 1R3KA 1T7VA 3MRIB 2R15A 1IL1A 4K3DL 2XA8L 1RV6X 1XF2B 4F7PB 1B2WL 4QHNA 3EFFA 5LG1A 1EEYA 4HIIB 4I3SH 2VLKD 1SJXA 3QCTL 1T0NB 5C0BA 3MXWH 1EFXD 1UJTA 3GGWA 5KVFH 1GZQB 5E94A 2UUDH 3ZE2F 4NQEA 3ZYOA 5EZIL 3GMMB 1XF5B 2R29L 2HFFA 1CWVA 4G7VH 1RJZA 4U1JA 2CO7B 1GOGA 1SBBA 3GMNB 5I17A 1PG7W 5FO7B 3VXTA 4CDGC 5CHNA 4ZXBD 1ZXQA 1FZKB 4HIJB 3QUZA 4RFOL 5IB2A 1IM9D 5A43C 5TDNB 4D94A 5HDBE 2C3HA 4X4ME 3BDBA 4JKMA 4NQTA 4U1LA 3F5WB 5CJXC 3ES6A 4Y4HB 1DBML 3EJZC 5EC2A 4Z7WF 4PTTA 4F15C 2Y23A 1HDMA 1HZHH 3OAZH 3LQMA 3MA7B 1C12B 4LHUB 4UAOC 3T0XA 1SYVB 3ESVF 2R0WH 3OR6B 4Y1AE 1FNAA 4HFUH 3BMWA 5SWSE 4PR5B 3VXSD 2VITA 1ZHBB 2H45A 3SDAD 2H2PD 4XCFH 3ARBB 1BF8A 2J8UF 4XPAL 1A3RH 1BLNB 1WIOA 25C8H 4LL9A 2W59A 1DLHB 1MQKH 3O3BB 3RTQB 2GT9B 2R2BB 1Q94A 3O9WB 1IGTA 3GMQB 3WN5B 4TSBL 1X4XA 1YECH 4RX4D 4M3JA 4RMSA 3NACH 2NY2B 3WIFB 1VB9A 3NTCL 1G7IB 3WUWA 4MAYD 2VXSH 3EYVB 5L8KB 1R3LA 4LVOB 3TNMB 1WBYA 1FC2D 3S6CA 5K9KA 4O5LL 4W4OA 5FGSA 4R4NC 5IR1A 1MI5A 1P84K 2DQEL 3RKDC 2FH6A 1F00I 1TQCC 2CDGB 2HYMA 3HI6H 3TO4B 8FABA 4JGUA 4WUKH 3K2MC 3CH8A 1CS6A 3GKWH 3C09B 5E8DL 3L3OA 3U79A 4ZFOB 4HFWB 4PUBH 2KL6A 3TIDB 4DTGL 4PGJA 1KPVA 5DHXB 2BVUA 3KHQA 5KSBA 3EO0B 2NY6D 2WIMA 1FZJA 3HC0A 4F7CA 3LKRA 1CFVL 3WE6B 2IG2H 5KSAD 4L4TB 5ANMB 5D7JD 2ZZUT 3MRHB 1A2YB 4RA0C 3U4AA 5C09D 4Z7NF 5BRZA 1YY9D 4MCZB 5LXGL 4R0LA 1YEKL 4WDIB 4HUUA 12E8H 1EX0A 4KJQD 2E7LA 3H9HA 3VCLB 4YEEA 1CGVA 3I9GL 4ZOCA 1CDYA 3TIEA 3FOLA 4HH8A 2VB5A 1ZKAA 1SBSL 1YUHB 5DK0A 4FTVA 2OTWA 2K7PA 1ACYH 2FATH 2ESVD 2NY5L 4NM4H 5JW4M 2P43B 1QR4A 1IM3A 4L9LA 4IMKA 5DEFA 1GGUA 1A21A 2V2WA 4MNQE 1BFOB 4FQQB 3TH2T 4JY6A 5LGJA 4WI2A 5F7EL 4U3CA 1JZ3A 1DN0B 3MUY1 1J1XL 3T2QA 1B0GB 2RFXB 1AD0A 2EC8A 1T04B 4PJBA 3ULVL 2W9EH 1M4KA 1U0QA 3VWJC 5DVKA 2QSTA 1FGVL 1J8HE 1I8MA 4MLSA 2D9CA 5IHUL 3IFOA 3O8XC 1RIHH 2X4QB 3B83A 4P23C 1UA6H 1XIWD 4X99B 1IAII 5DWUL 1HN1A 5SWZB 3U0TB 1HQ4B 4APQB 3K1KC 4HWZB 3GMPA 3QULA 1ZTXL 4KKNA 4FXGA 3R0NA 2J8HA 3CU1A 3IF1B 1GAFL 3REVA 5MERA 1QA9A 3N50A 1IEHA 1CIUA 1HWGB 1IGJB 1I75A 3BPCA 4JPIB 1KBGL 2BSTA 1QYGH 2IGFL 5JZ7C 1BIIA 4EBQH 5IVXB 4HPYH 4OM0H 4XPHL 4UTAH 4DZBA 5E8PB 1MCOH 1Z9OA 1OLZA 4D0BB 1CE6A 3F7QA 5F7DA 3MJ8A 1FSKC 1I3VA 5D2LE 2UY7A 4HC1A 2HJLB 4AK1A 4PJFB 4NP4L 5EO9A 1GHFH 4H1LG 3C8KB 4GLRI 1HINL 1AY1H 3STLA 1JPST 1CGSL 1EZVY 1LILA 2GCYA 5D93C 5IW3A 5L2KB 2A9ML 3QPQC 1UM5L 4XZUB 3RKPA 5I1AB 3F58L 1BJ8A 2DI9A 1R5VA 2L0DA 1TJGL 4ELKA 1R3JA 3O2VL 5L9DL 4NYLA 4LARL 4F57H 5IHBA 3O0RL 3N1MC 4XVTL 1DQML 1NLDH 3KPSE 1V05A 2V9RA 4AEFA 4KDVA 3LKNB 2XTJC 4FZEH 3CFEB 1DFBL 1R0AL 3H3PH 1S9WB 5GSRA 4HWBH 1TZHB 1QSEB 3WHXB 1CI5A 3UJJH 5AD0B 3FO0H 4WFFD 3KPNB 1RZGA 5EIIA 4MYWB 2NW2A 4P5TC 3UJIH 2VL5B 2VLRA 3DV4B 5SX5H 3MV01 1X5IA 4XXCC 3G6JE 2F15A 3UZVB 3BP5B 3TBTA 2YPVH 4BSVA 2O5YH 1NCTA 1Q9KB 4HUWA 5B38A 4ZPTB 3S4SA 1E4WH 1NC4B 1AE6H 3L3IB 2UV3A 3T2NH 4X80L 4LSPL 1RUAH 2JIXD 2CLVA 2X5PA 3P9WB 2EE3A 2Y1VA 3REWB 5C9JA 4ISVA 4PV9B 1HIML 4XVUD 1VEMA 4OCNC 1JRHI 2XA3A 4AENB 1TZIA 3ZKQD 1X5AA 2J8UA 3IAPA 2MTPA 1HCVA 4P48A 1HSBA 5TF0A 1RZJH 4JR9H 2IPTH 3DGGB 1L7IL 3GM8A 3W9DA 2H2SD 2VIRA 4PJHE 4JFQB 3MLRL 4YXLH 1YN6B 3MLWH 5INCB 2VYRE 1H0DA 2HA1A 1EJOH 1S7RB 2EDJA 1I1RA 5MEND 1TCRB 5FGRA 3QO1A 3WJJC 2W9LA 4JDTH 3ZYJA 4P9HH 5DMIL 5HHOB 3MRNB 2IBGA 3NMEA 3QG7H 1H3XA 3VA2C 2P5WA 1EEZA 5J1TC 4FQXD 1MH5B 4EXPX 1PLGL 5F21B 4HX1A 3KLHC 1L9NA 5EA0H 4EDXA 4YGVB 1HH6B 4O00A 2F54E 1A7NL 4UT6L 5T3XE 2DQFA 5EZLA 4EN3A 1VFAB 5FYKE 1UC6A 2R56L 1FVCB 4S1QL 1CL7H 2IQAA 3SDYH 1CIDA 1CBVH 2DDQH 3HI1B 5IF0B 5DUPL 2CRZA 2YZ1A 2OL3A 1OAUL 3CU7A 1JF1B 4YK4B 3X14B 4NCC2 5FYLD 3OG6B 4K3EH 3TVMD 3OKMA 4YR6B 5C0ND 4TRPH 2VDOH 1PG7H 1ITBB 5HI4D 1JRHL 3RJQB 3GSOA 1OD9A 3T8XB 4JREC 4NO0D 3ARDC 4HXAH 2BSRA 5IOPB 3S3SA 1MCJA 1GGCL 4TSCL 2NY0C 2ZUXA 5HHPB 3QDGD 4M6NL 5MEPA 4NCDA 4HMEA 1JGVL 1YEEH 4N8CL 3B3IB 4LMQI 4NBXB 2OL3L 3D18A 4PJEE 3TFKC 2Z4QB 5AZ2H 4LASL 1FLTX 4C56B 3DXAB 1KB9J 4KRPD 1Q8MA 5I1DB 5FHAH 1J18A 3VFRB 4OZ4A 4BELD 3MCKA 5JOFB 5TH2A 5JIIA 3KG5A 4OAWA 4JFEA 5HHXL 2W0KA 3UBXI 2KPNA 5FO8B 1QR1B 3CMGA 4LKCB 5HDBF 2ZCKL 4AL8L 5EWIH 3OSKA 5D7LA 1II4E 1NCNA 5ICYA 1EH9A 1MCLA 5I1KH 5F89B 1W72H 2YBRB 2DI7A 3TJHC 5L2JB 4Z78A 1LE9B 3N06B 3HE7A 3TBSA 3Q6GH 2I26N 1S7SB 2DQJH 5J13B 3WKNA 3PGCA 4KKCD 1LHZA 2VXVL 3RDTD 2E6QA 4FQIH 2DLGA 4NO3A 3FB5B 3UC0L 5KAQG 3BXNB 4JRYA 3HZKB 3FQRA 2BMKA 1YNTB 2BSSB 3RZCB 3T2PA 3UTSB 3BO8A 1XGPB 5EBWB 1MLCB 5D2NC 1AXSA 5ENWB 3UBXA 1BOGB 1KJ3L 1NSNH 3O6FA 4GKOA 4PJXB 2FJFB 2E7MA 2R2EA 1FIGL 4U33A 3HG1B 1D9KC 5F7NC 4CMMB 4PB9H 2Y7QB 2FX8L 4E41A 5JTWA 4LCCB 5I1EL 1IFHH 3KPPB 2BJMH 1UKTA 5DRNB 4M6MH 1DSFL 2EEAA 1LNUB 3MRQA 5GGTH 3QUXC 3IGAA 1P7QD 3INUL 3HE6C 3FT3B 5IBUB 2EKJA 1BMGA 2YSSB 5EIQA 2VH5H 3S37X 2EDYA 3W9EB 4KK6D 4TQEL 5L88L 2A6JB 1BFSA 3RWGB 3SE4A 4BZ1H 1URLA 1VA9A 3BX7C 3QISA 4Z0XB 1AGFB 1NANH 4ODUB 3W81A 2X42A 5DD3H 2YXMA 3C87A 3LKOA 2EZ0C 5BXFB 3VFNB 2QHRH 4LSRL 4XXDB 4LKXB 4AM0B 4FFVC 4YXHL 4WI4A 5CEZH 3FL7A 1L7TL 3FHAA 3DI2B 1K6QL 2J88L 5I74B 1T2QL 4N8VA 5FAAA 5DJ8A 1QQDB 5E7FA 4P99A 4TSAH 3WNLA 1P4LB 1MJ7L 1K8IB 5D1XD 2EDWA 3SCMC 3FT4B 4HT1H 2BY3A 1NKOA 4U3HA 1OCWL 3QI9D 3QEUB 5IROC 4HAFA 3TYFB 2D31A 4XGZA 1GL4B 1OD7A 5L0QC 4JANB 5JHDA 5B39B 1FRGH 3D2UD 3IVKA 5ALCL 3TV3L 4U1HB 3K8LA 4JB9L 3TBVB 1OF2A 4MLIA 1OAZL 2EIBA 3D85A 4K71C 2ZKHH 3RY5A 5FGCB 3BYYA 5EOCJ 4G6ML 4V1DB 5CBEB 1DEEB 2BY2A 2XKSA 4BQ8A 4EXKA 1NCWL 4XRCB 3RWDA 3O4LB 2HFEA 2QSCL 1EUUA 4U0QB 4M1GH 3CFKB 3OF6A 4M7JL 4QTIL 2HT4C 4ODXB 3EOYG 1EUTA 1NJ9A 4L4TE 4ZODA 5ANME 1QFWM 3CDFA 4RMWA 3TCLB 1MHCA 1TVHB 2FX7L 2DQDH 1KLFA 5BJTA 3BRFA 4HQQL 4P3CL 1ZT7B 5JOPE 4GW5A 4KQ3L 1FO0H 4YC2C 5D1QA 5K9JH 3DUUB 3X11A 3J7HA 4CVZB 3DSNA 5GRYA 1CK0H 2X1QA 5F93C 3QRFM 1MRDH 3HPLB 1YNLH 4C58B 3KWWB 1YYLL 4J4PD 4QHUB 5FKAB 5DC0A 1NEUA 4G7YH 1KCKA 3LSOB 3BKMH 3BT2L 5F7UA 5KJRL 2CKBA 1A02N 1HYSD 1D5XA 1NGWB 3ISWA 1YEHH 5D2LF 1H9VA 4ALAL 5H94B 2EH7L 3LKPA 1W8OA 5J6HB 4WV1B 4OUUB 4NKOB 3MLSH 3EO9L 4FHBD 1YNKL 3QUMB 3EYSH 2VAAA 1T1ZA 2WNGA 2XYCA 5HD8D 3SGDI 1LQSR 3UTZB 4FZ8H 4YLQT 1QSFD 3FFCD 1YQVH 4AEIL 3G5VB 5D70L 3QBTB 2QKIA 3UMTA 1N8ZB 3QHFL 5D72L 4M4PA 4GMSH 5FUOH 4UDUB 5DRWA 5D7IB 4IRSB 2B8OT 3DVNA 3MRKB 2YPLB 3OKEA 2IAMA 3R8BB 4LCIH 1KPUB 1SY6A 2Z92A 5IVXE 2C4FU 4I0PB 1RFDL 4Y5VC 1T5XA 4EEEA 3OWEA 1WT5A 4ZUUA 1QFUL 4GUPA 3ARFD 2ZCLH 5FYJL 3QIBD 1DBBH 4P3DB 3KLDA 1U3HB 3E6FA 1UB5B 1X44A 1QO3A 5HHNB 1F90H 4Z7OE 1BEYH 2QR0A 3RPIA 5KW9H 3G6JF 2FJHB 2WUBL 4PGCB 3WIHL 3MODH 1UENA 3MJGX 1S5IH 4K8RD 1SY6L 4JPWH 3CSPA 5CS7A 5T1LB 3BPOB 1NMCC 3SGJC 2AEQH 2A77H 1P5UA 3BZ4A 4FNLH 4GRMA 5BV7C 3IXAB 2ITDB 1RZ7H 3WJLC 1JWUB 3ZSTA 5CSZA 2XRAL 2QJDA 3VD7A 5GGRA 2HH0L 5EUKB 1ZS8A 3KS0J 1JK8B 3U4BH 4EUPA 1CFQB 5SWSA 1U8MB 1DZBA 2AW2A 3BDYH 1T1WB 3SE8L 1EEUA 5ETUB 1MCRA 3L9RB 4PJ8B 5A3ID 5I8KL 4UT7H 5B4MC 3N0PB 5ESAB 3CFIC 5FM8A 3QA3B 3L5XL 3LB6D 3B6SB 3E8UL 1BGXH 2EXWC 1QSEE 2OJZL 3P77B 3LKQB 4LPVA 5E00A 5E1AB 3SBWC 5DD0L 1VGKB 1B3JA 1BM3H 4ZSOA 4M93B 5DJXB 5CILH 2APBA 4RFNB 1DE4A 4G9FD 4BUHA 1AHWA 1JPSH 3DVIA 3L95A 1CFBA 3PDDA 3IS1X 4DCQA 1U92B 1AXTL 2OR8A 4KK5D 4HUVB 3MJ9L 4GAGH 4OZGB 5L7XL 3MV7E 4G6AD 2PTVA 5C0CD 3ZDZE 1JN6B 3RGVA 1BBDH 1JTOA 2NYYC 2DTML 4JZJA 5SV3A 2WINA 1LO3L 1T22B 1V3JA 2IBBA 1SEBA 2QQKL 3VD3A 3R06B 1OWRM 4LVHC 4XCYA 4LRIA 3NFSH 2EEDA 4ZPVA 4TNVK 5IBLD 4P59H 2CGRL 3AS1A 1WTLA 5KOVC 4ORGB 5FFLA 4U31A 1EFXB 4DWHA 3G5ZB 2DYPA 2YUZA 4QTHA 1HOCB 5ACZA 1JBJA 3E0GA 3CFDA 5CJBA 3IYLW 1A14H 3QUZC 1RVFH 2YK1H 1CE1L 4X6FA 5LVEA 4OV5A 5IQ7L 1CDJA 3DTXA 4ZXBB 3H8NA 4ODSH 1LGVA 3LPGA 3QR2A 4LCUA 1S7UA 3GB7A 4LSUH 3N9GH 2JJSA 2Q6WB 3CPLB 4MJ5B 2O61B 4XP6H 5F7KC 1QPXA 3D39D 3EDJA 5E5MA 1G7MB 2ADGB 3VGAC 1HXYB 5AZEH 4MNQA 5I73C 3FONB 5F70A 5I1CH 2Y4SA 4NWTL 4U6YA 1XGUA 3U0WH 3RVVD 3RBGA 1NUDA 4M7LL 1E6OH 4X9GA 1WZ1L 4XP1L 1KC5L 2XWJA 1FN4A 1U8QA 1YJDL 4ODHH 4TVPL 5EBLA 1DQLL 1MFEH 4PJ5D 5F9WC 2F8XC 4HJJH 1J8HA 3SDAB 4P4KA 3BW9A 4PRIB 4KGLA 4R2GD 3LMJH 3EYQC 3OXSA 1KCVL 3SEPA 4X7TA 4UV4L 2ZPKL 2G75B 2E7CA 3ETBF 5CBAB 5DQJA 3UAJD 4LLYB 4ZAKA 2FBJH 4YH6A 4XVSH 3HAEG 3QWRA 4AG4L 1T21B 1GZPA 2FSEB 2Y6SD 3DROA 2D7TH 4MAYB 3GSNB 4HKBA 2PW1B 2DICA 2IMMA 2V5TA 1MY5A 4GQ9L 4JY4A 3U46B 1ZEAH 4C56E 1JF5A 3GIVB 3M45A 2P47B 1DLFL 2B0SL 2EH8L 3S34H 3KLAB 1XH3A 4WWID 2CK0H 4JVWA 4CVXB 2DQTL 3FMGL 2Q7YB 4OFKA 3MR9B 4R4FH 4UV7L 5D2LA 5DR5H 4G6KH 1BZ9B 2QQNL 1LVEA 2R4SH 2R1XB 4W70A 1NGPL 1FL6A 4RGMB 5E2VL 2W92A 5F1NA 5F9DC 3S37H 1AKJD 4JM2F 3G08A 4LEOA 3KAAA 5K9OA 1FE8H 2FECI 3RY4A 3N1QC 5HGBA 2EYSB 4WCYL 1NCAL 4R0LC 1ONQB 1MCHA 5ALBL 5EO1A 1C1EH 2EDQA 1Q9OA 5KSAB 2A9NH 4KTEL 3LQAL 2WWKT 3RZWA 5C09B 4NUJA 5EOTA 1PYWB 1U8JA 1K4CA 3FRUB 5ITBL 3IRZA 4L9LC 4OKDA 4PJDB 4PRPD 4IMKC 2YN3A 2ED8A 5IIEA 4HBQA 4DEPB 2E8ZA 5KN5B 3AMKA 4NKDA 4NKMA 4TNVF 2ESVB 4JDVA 4PJXE 2NLJB 4XBPB 2X10A 5TGBB 2IAND 2JJTA 3EHBD 1P4IL 5DMGD 3QDMA 2VO5A 1X5ZA 2ICCA 2J7LA 5B8CA 3PGFH 3R1GH 4PPTA 5IB3B 2PCPA 3G6JA 5IBUG 3CD4A 3FB8B 4Y2DD 4U1SB 3VXME 4PB0H 1MPAH 5DO2C 4I77H 3ROOB 4D9QD 3OKOB 5GGQL 2BCKB 2X4NA 4OIIH 1F4YL 1CF8H 3HC4L 4K7FA 4XWOD 1IGCL 3MBEA 1XIWB 2VQTA 3BIKB 4YQXH 1VESA 4PTUA 2R0ZL 5C0GA 1VERA 2HG5A 3R0MA 1CXIA 4GW1B 4G9DA 1D5IH 1IAMA 1CU4H 3MOQA 3MRJB 3GIZL 1U8IA 4OTXL 3IDMA 5CGTA 5IG7A 5I76A 1JPGB 2V5RA 1GC1L 1GIGH 5E2TL 2DWEA 3E3QC 1QKZL 3H9SD 4LDLB 4R97B 4KHXL 1E6JH 5TPWH 1OB1A 3WNKA 1KELH 3ZYIA 1ADQA 2YEZA 2VUOA 1SYSA 3MV8E 5MHSE 3QH3B 3PL6A 1FPTL 4NC1C 5CMAA 5BV7H 4UIKL 4C54A 1JHKH 1QFWI 5DJ2A 3TH3T 5B39G 4MA3B 3HNVH 1SVCP 1HI6B 3EW3B 4UINH 3HKFA 1MAML 4YHPB 4K3DH 2XA8H 5D96C 2F54A 3IKCA 2KH2B 1B2WH 4IDJL 3R4DA 3Q1SL 2PUQT 1ADQL 3CMOL 1UADC 3QCTH 3BUYA 5DI8B 3IETB 4UILL 3OKKB 5E6ZA 4V1DE 4YHML 3H0TB 4HKZA 4PFEA 3O4LE 4G3YL 1F13A 5EZIH 1A4KA 5IW6A 4J1UB 3FO1A 4X4YB 4ZUWB 2R29H 4KUZL 3F7YB 4M9OA 4Y5YA 1OGAB 5F9AC 3PWLB 5JW4Q 5FOBB 5C0EB 5I8CA 3KPMB 1C5DB 3BGMA 3AMLA 1SJVA 4PRBB 4QHMA 5DXWA 4EQ2A 5F1IB 4LLVA 3B9KD 4RFOH 3EYOB 4IJ3B 4IRJA 1ZHLB 5E8NB 3I6GB 1U8PB 5E2JA 3OKDB 2RBLA 2FLBT 1AGEB 3C5ZA 3MLXL 3HR5B 1ZT4B 5SX4I 1QFWL 1DBMH 3K4DA 4NPYA 1G7QB 2HJKA 5J9PA 4KZEL 5IVXF 5HGHA 2K3TA 2FO4B 4NCC1 1YDPB 4LGPB 2EKSB 3BP6B 1NGYA 5IUSA 4QXGL 4CJ0A 4HEME 2JIXB 3T0AA 2AK4B 1UM6L 5SV4A 3OXRB 3NIFE 4MAUH 2C3GA 3T09A 1CT8A 3I75B 4JRXD 4GMTH 4Z7OF 2BSED 3B2UC 2QADC 4XPAH 15C8L 1WGOA 2V7HB 4EZMA 3MGTB 1OAXL 4F7PA 5ID1B 3CZJA 2ICEB 2YR3A 2VZUA 4AIXA 4TSBH 4B50A 2IEPA 1RUKL 3NTCH 3TBWA 1JZ8A 3VI4E 4PGZA 3MLTB 4YO0A 1GZQA 2GAZB 2YPLE 4I48A 5D1ZD 2OQJA 1CGYA 4I18C 1EVTC 3GMMA 3NIGE 1XF5A 4YUEL 4O5LH 4Y16D 3IDYB 3MC0A 5F7FA 4EN3C 4FQXB 2DQEH 1BVKB 3GSRB 4LVNC 5FO7A 3MRLB 4LSDA 4X5XA 2R0KL 1P1ZA 2VLJE 1F3DH 1PQZB 4MA1B 2AP2A 3O3DB 5E8DH 1JE6A 1WEJL 1A7OL 1RK0B 1FYTB 4GS7C 1UJ3B 3MRRA 5TDNA 4DTGH 3MLYL 4NQDD 4XAKD 1D5BA 4JM2A 4NO5B 1S9XB 3ZDZF 4B41A 5F3HA 3TVMB 3MLZL 2H3NA 3DVFA 3AREC 3VRJA 1CFVH 2YUXA 3ZT5A 2LAGB 4N0CC 4WO4D 1ORQA 3VXRB 4X6EA 4LHUA 4NO0B 1OTTD 3QXTA 1HHKB 4P5MB 4UU9B 5LXGH 1YEKH 3OR6A 3GZKA 1VGEL 4MA7L 4FQ1L 1L0XA 4ZTPL 1FIEA 4HKXA 4BFBD 3QDGB 2HWZL 3KXFD 3I9GH 1UWXK 4U2ZA 3KR3L 1ZHBA 4AMKH 3SDCA 3MACL 3WFEL 1SBSH 1HKFA 1BLNA 2VDQL 4RSVA 4MQ7A 2NY5H 1I9JL 4CJ1A 4Y4FA 5J8OA 2GT9A 3GMQA 4P46B 3WN5A 1FNFA 2UZYB 5LAXA 4KRPB 5C07D 2F74B 2EE6A 5F7EH 4NKQB 1FAIL 2Q3ZA 4TN9A 1J1XH 1P69B 1A9BB 3S5LB 5TF1L 3TN0C 3ULVH 3SO3B 4OZGE 4XP9L 2FEDD 1FGVH 3K8MA 3TPKA 2P46B 4RBPK 2J4WL 1A6ZA 1KN2L 2A6KA 3HE7C 3MRMB 4OCSL 4WTXA 3STZA 5IHUH 3CCHB 2DLIA 3BN9C 5DVOA 1IZJA 2QSQA 2C7UB 5HBBA 1B9ZA 5DWUH 3TO4A 2VXQL 5HHVL 2Z91A 4WI5A 3RNQB 1ZTXH 5JXEC 2VLKE 2MSPA 5I75C 1GAFH 4PGEA 3PDOB 4KKBC 4HCRL 5D6DA 3T0ED 2A6IA 3RDTB 3U0PB 3HZMA 4KQ4L 5GQBA 5TDOB 4RWYL 1RMFL 1TVBA 4JO2H 1RSFA 1RZIA 3O6FC 1VFOA 2BVQB 1NLBH 4PJ9A 4ZO6A 2IGFH 4NRYB 5C0FA 4XPHH 1QBAA 1U91B 4LAQL 5ANMA 4ZUSA 3FTGB 1PEWA 4RIRB 3MV9B 1TQBB 1PX3A 2H6PA 3PV6B 3IFNH 3HS0B 3BVNB 2QL1A 4LCWD 3GUTB 4NP4H 5GS1C 3MFFB 5E24E 3U30B 5KSVA 5IJVB 1WC7B 3LH2L 4NQSA 1HINH 1A6VL 2CXGA 2NW3B 4CAGA 35C8H 4OLXL 2A9MH 3SE4C 1UM5H 4YDJB 1P7QB 3F58H 2XZCL 1TVDA 1BFOA 4ZYKB 3QO0A 5HVHC 4YZFE 2JJVA 1W8NA 3KPOA 1UCBH 3O2VH 3AU1A 2XN9D 3OKLA 4BJLA 5L9DH 4LARH 1DQJB 3O0RH 4HC1H 4XVTH 1DQMH 3SJVA 1MCPL 5IFJB 2AERT 4F2MB 3V4VL 3D3VA 4X9IA 5CEXB 4RAHA 5CSBA 3VXSE 5CD5C 3DURB 1WSST 4L4VA 1DFBH 4M7ZB 5I8EA 5FYKU 1R0AH 1DL7L 3W5NA 1JGUH 1FCGA 2OJEB 4RGNB 5HPOA 1T0MB 1QD0A 2D7NA 2WBJB 2FRGP 4LPYA 2F5AL 4RAVA 1X7QB 3SKOB 4QO1A 3DUHA 1P4BL 4JPIA 4RMQA 3R8QA 4K94C 2V7NA 4JDZB 3IDNB 3QI9B 2Z35B 1R5IA 5GGUA 4WHDA 2X4RA 5IVXA 1LEIA 3L6FA 3O4OB 4X80H 2XWTB 3PWUA 4LSPH 4OB5H 3AUVA 5E8PA 3QIUD 1Z3GL 3D2UB 4PJXF 2JB6B 1CXKA 4UTBL 1QEWB 3VG0L 3PHQB 1P7HL 2Z31D 4Y8DC 5BVJB 5I1HL 2HJLA 2B5IB 2W0LA 4HWNA 1HIMH 1NAMA 4LSTH 1ES0A 5DJ6B 3ZTJG 3HUJF 4P5KA 1OAYH 4Z76B 3C6LD 3MUGA 1GOFA 4R3SA 4M7LT 3PWVB 3TNNB 5IVZB 4X6CB 4QHKI 1P84J 1L7IH 1PFCA 1S5HB 4GW4B 3Q2CA 2XZQL 3L3GB 5I1AA 2VOTA 3MLRH 1Q9WA 4IEFB 3S36X 4J3XA 3KYOB 2DAVA 4U1MB 1MIMH 2HMID 2VMFA 3KPQB 1NAML 5DMIH 3I02B 4HZLB 4PJDE 2BVEA 4IIQA 1IJ9A 2VN7A 3CFEA 2BVPB 4OFVA 4ZO9A 2VSCA 5I9QB 1RIVL 3BQUD 3LPWA 4UT6H 1A7NH 2ESVE 1QSEA 4Y2OA 1DQDL 1VEPA 3IT8D 3EZ8A 3LRHA 5F9OL 2R56H 2X2YA 4P23D 4S1QH 1KLGA 1KPRB 1T1XB 3IXTA 2VL5A 2Y07L 3KPRD 1A6AA 5DUPH 2N7BA 4LSVH 3FB6B 5GS2H 4P2RB 1MCCA 3J8F7 4NNPL 2YD9A 1K5NB 3N1GC 4J23A 3MV7A 1MF2L 2HT3C 4NQVA 3RX8A 1AGCA 1NC4A 3U9UB 1JRHH 4DGVL 1S7WA 4GRLC 3DARA 5JZ7D 3FZUC 5BZDA 4PD4J 3OGCB 1GGCH 4TSCH 4QEGA 5JORB 1OT2A 1QSFB 3FFCB 4N0FB 5E6IA 4M6NH 5JA8B 2IAMC 5I66B 1JGVH 3K2UL 1RK1A 4R26L 3GMLB 3JV5A 1JGLL 3D25B 2OL3H 4L4JA 5BOZG 5JW4N 2X4PB 3VFVB 5B3JE 1S9YB 5JW5A 4LASH 2D3VA 5CEZD 4ODTL 1WT5C 3DGGA 2COQA 1J87A 3G6AA 1T3FB 1TETL 4S0TD 3PP3H 4LRNL 5DK2B 1AJ7L 2BNUA 3OX8A 4Y88A 5FDWB 1JGDB 4OFIA 1SJHA 3ARFB 2IH1A 2X40A 3QUKA 3QEHA 5HHXH 1U95A 5GS0D 5EU7E 4N0RA 4MDIB 2N1KA 1NPUA 1BPVA 1MJJA 2AJUL 4AL8H 4TTDD 4PJCB 4OGYL 3IU3A 3BWUC 1HH6A 3IDUA 3VXNA 2CQVA 5FA3B 1AQDB 3O2WL 5F8QC 2IH3B 5F1SA 4MDJA 3T3PE 1UACL 3JTTB 4I4WB 2OXGA 5D9SB 1XAUA 5EUOB 5DS8A 3UYRL 2VXVH 4N9GA 1G7HA 3RY6A 3FQWB 4Y19D 3UC0H 3ARUA 3NIFF 4P5TD 3DO7B 1WVZA 3HAEH 4XCNB 1EGJA 1A6UL 3RU8L 1CFNB 1TZGH 1DVFB 3WEXB 4WFED 1U3JA 1FNEB 5ICZA 4AH2B 2ADIB 5DVMA 1PZ5A 2WWKO 3OKNA 3ROLB 4OZIB 2ZUYA 1KJ3H 1ZLVK 1AHWC 3NIDE 2R1WB 2GY7B 4L3AA 3ZL4L 3TPUA 1FIGH 1MJ8L 4D9RD 4WFFE 2DF3A 1J5OL 2HJFB 3WNPA 2PYEB 4G9FB 4X98B 3NFPB 3RGVC 1KIPB 1DQQA 2FX8H 3VI4F 1INQA 3MNWB 2ATKA 2KQMA 4JZJC 4KJYA 1JPTH 1VKXA 2V2TB 5I8OL 1IGYA 1I3UA 1DSFH 1ZHNB 2DLFL 1JZ5A 2Z4QA 1G0XA 3NIGF 4C56A 3T4YB 3INUH 2QQLL 1MOEA 2P42B 3BH8B 4MHHI 4KKLD 3JWNC 5CJOL 2YZ8A 5L88H 2FGWL 5IW1B 4PREB 1EEQA 1ZGLB 1JFQL 4ZUVA 1GSMA 3FQTB 5J11C 1QPPA 5A1AA 1I7TA 2VR4A 3MNZA 4O2CA 2X05A 4LSRH 2VC2L 1KLUB 3ALPA 4YXHH 3UTQA 4J3WA 1L7TH 4S10A 1K6QH 1M71A 2J88H 1CTOA 2CRIA 1T2QH 4GRWB 1KOAA 4PBWD 2AJ3B 1B4JL 4CU7A 3HMWL 1I8KB 5K9QG 2ZUQC 3V7MA 1MJ7H 5HSFA 1Q9LB 3KJ4C 4K2UL 2P7TB 1A22B 3T0WA 2VKXA 2JJSC 3QZWA 5MENE 4F37K 1X3DA 1BHGA 3U4EA 4MCYB 2IFFH 1OCWH 5C3LD 5CEYA 5EU5B 4K9EL 5HVGB 5CZXC 5F3BA 1AGDB 4PLKD 1Q0YL 2CJUL 3ZHKA 1T6WA 4NN5B 4KK8D 3B9AA 3K8KA 4RRPG 5ALCH 1E4XI 2FJFA 1L4IA 1SMAA 3QDHA 3TT1L 5MI0C 4BKLA 4RBPH 3GJEB 1PSKL 1TMCB 1FFNA 4JB9H 3M17A 3OJVC 3UPRB 4XTRD 1FNLA 1OAZH 1X5GA 5IBTL 3EDDA 1NFDA 1MHHB 2Y7QA 1CG9B 1N6UA 4G6MH 4GAFB 4P4KC 3HUJA 4IRZL 4LCCA 1NCWH 3X12A 5DRNA 3VXMA 1T7YA 1XF3B 2QSCH 1UEMA 4OZGF 5FYLE 4OLZL 4HG4K 3BPLC 3JWDC 3VXUA 4PJ5B 3TFKD 4M7JH 3MXVL 4QTIH 2FZ3B 3ULSA 4K94H 4R2GB 3FT2B 3O3UN 3W9EA 4ZAKC 2EIZB 5EZOL 3V6BR 5D5MB 2FX7H 1MCBA 4E5XB 2OZ4A 2JF1A 4P3CH 3QDGE 1J0YA 3IB4A 4KQ3H 2DKMA 4QRSA 3S9DB 5BXFA 4JQXA 4U6HA 2A6DA 3VFNA 3WXWL 4P2YA 4LKXA 5DLML 1KXTB 1PKQE 3H7BA 2R23A 2NZ9C 1T89A 4M3KB 4WW2F 3CH1B 2CMRL 1YYLH 1QQDA 5IGXH 1K8IA 4ENEC 3S5LG 3BT2H 3MV8A 2OZ4L 3RVWD 5KJRH 5C2BL 5F97E 1OP5H 1NBZA 4ALAH 2EH7H 2ICWB 1F6AB 5KVEL 2EC9U 4E0RB 5GGSA 4U3XA 3EO9H 1CZ8L 1YNKH 5LKNA 1YN7B 3MRDA 4NT6B 1AKJB 3OAUL 2EYTB 4EI5D 2X4OA 2YPKB 5B22A 3T1FB 4BSJA 3HMXL 4AEIH 5D70H 4YZFF 3UZEA 4FABL 2Z93B 3QHFH 5D72H 4YX2L 4OD1L 5C8JA 3OPZL 4V1DA 1F8TL 2LTQB 3X3GL 1D9KD 2VZ3A 5KSUB 4BZYA 4N0UB 3NA9L 2LABA 4WHTA 3WS3B 1LEKB 2JJTC 2NY4D 3QUXD 1RFDH 5I71C 3HNSL 5DFVC 5IB5B 5B8CC 3KYMB 1QFUH 4Y4KD 3MLPA 3ILQC 5E2UL 1CXHA 4MB3A 1MVUB 4JFFB 4MNHB 5FYJH 1ZSDB 3HCVA 3QIWD 2IANB 2YA2A 2YD7A 5F1OB 1VDGA 1EDQA 3Q48A 1ETZB 3DUUA 5C0RH 2WUBH 2AABL 3DX8B 3FB7A 4Y2DB 1SY6H 3QNZB 4PP1C 4JZOA 5C7XL 3MBEC 1WZKA 4U0RC 3QNYB 2R0LL 4F37F 1I9RL 1S9VB 3PQYA 2HH0H 3L3KA 4KVNL 2P5ED 2XXMB 4R4BB 3SE8H 5JPMA 5I8KH 4P9ML 2AJSL 3BIBX 3THML 1N4XH 3L5XH 3P4LA 3JWOL 3E8UH 2GUOA 3I2CL 2OJZH 2CLRB 3ORJA 3PF2A 3B9EA 2X89D 1JTTA 4L8BA 1DUYA 4ZO8A 32C2B 4WUUD 4M02A 5C86A 4IMLB 3BH9B 5DSCA 4Q9RL 4X6BB 3V0WL 4JFOB 3ARGD 4QF1A 1AXTH 3MRKA 4Z77B 2NXZD 3MJ9H 4U49A 4PJDF 5L7XH 3ESUF 3P4OA 4L8DA 1B0RB 1UEYA 2Z9TA 4MJ6A 3T2OA 2DTMH 4QXTA 4Y0GA 3IJYB 4I1NB 1LO3H 3TA3D 2QQKH 4JFDD 1FZMA 4NZRL 2B4CC 4JHWL 2R0WL 2VLJA 4NHUA 5H37H 5EOQL 2CGRH 3BP4A 3JSSA 1ZMYA 5J1SC 2XFXB 1ZHKA 1FZOB 2ZG2A 4FQHB 4Y5YC 5HY9B 1CLCA 3ARSA 4GG6A 4X6CE 1W0YT 1DN2A 3RWFB 5IMKA 2YA0A 5DRXB 4J2XA 1CE1H 4PJ7B 2OK0L 3VW3L 4DGYL 1ZT1B 4IRJC 3ULUE 3EUUA 4BH7B 1T7WA 5IQ7H 1RJYA 4RDQG 1OOAA 3C5ZC 4NOFA 3IDJA 1JK8A 3AXLB 1J0KA 1JIBA 1RUPL 5BS0B 1MNUL 2H9GB 1KYOK 1BBJA 4PJ8A 3L9RA 1MFDL 2Q87A 2APFA 3HRZB 5SWQB 4YHIB 4KZDL 5B3JF 5FK9B 3U2SA 4DN4L 3QQ4A 1LK3L 3EDEA 3RP1A 1IC5L 4QRUA 5E1AA 4ONHB 1VGKA 1TCMA 1UT9A 4NWTH 1I7UA 3GKWL 4ZS6C 1IZKA 2P8MA 5L8LB 2PYFB 7CGTA 2I9TB 1AR2A 4LIQE 1ED3A 1IEAA 4U7KA 4M8QB 4YPGB 4XHJC 4AEHL 1WZ1H 4XP1H 3V8OA 1KC5H 4U1NA 3LRSA 2B1HL 1MFBL 4TVPH 4OZGA 3L5HA 1DQLH 4JG1L 3NPSB 5BZWA 4FQCL 4HHAA 4KROB 4JRXB 1XR9B 3LVEA 1OTUD 4QRPD 2W0FA 3MRGB 4MD5B 1DBJL 4NN6B 4RZCB 4I2XB 1KCVH 1KCSL 3BWAB 3VFOB 2WAHA 3MUJA 3MYZA 2PTTB 1QSFE 2VLKA 3FFCE 4UV4H 4YBHA 4JPKL 3QFDA 3C60A 4POUB 1TNNA 5JQHC 4AG4H 2CR3A 4P2QE 5AWNL 3BP7A 3FN9A 1UKSA 4GQ9H 4NM4L 1I3GL 5D1ZB 2R1YB 4WW2A 1DLFH 2B0SH 2EH8H 4QOKD 4D3CL 1JNLL 2H32B 4XVJL 1WFTA 3NIDF 2DQTH 3M07A 3FMGH 1U58B 1W0WB 4LOUD 4ZXBA 3O45A 4JM2C 1FJ1B 1Y18A 4UV7H 3W2DL 2I24N 5E70A 2GTZA 2QQNH 2VDML 2BXYA 1UB6B 3C5JB 1CFTA 2B7DT 1IM9A 2J12B 5E2VH 5JIPA 4ETQA 1QHPA 1I1YA 2M1KA 2FEEI 4NDMB 2O61A 2Q6WA 4PJCE 4NQDB 4M6OL 3NPZB 5IMLB 4U05A 3V5HA 2BX5A 5HYEA 2ADGA 4WCYH 3D0LA 1NCAH 3BAEL 4M4RA 4Z7VE 5ALBH 5EU6B 3JV6A 5C08D 3RWHA 3QQ3B 3SDCC 2C1OB 5KVDL 4ZMAT 4LPCA 4NBZB 3SDDA 2EIEA 1OAQL 2VLLA 3T4AB 1P2CB 2X4TA 4R96A 5IB4A 1H3UA 3QAZB 3H3KA 3PNWA 2NY1D 5ITBH 3QJHB 4Y4FC 4MZ2A 3VXSA 2I5YL 3QFJB 3IDGB 5DD6B 3WN5C 2OBGA 1G7LB 5E4IA 3ZKXB 2V17L 4LF3B 2X4UA 4HPYL 1HEZA 4TYUA 4N68A 5EZJB 1MFAL 3KYKL 4OZIE 4N0YL 4R8WL 2UYLB 1JYWA 1LWRA 5IK3A 5C0IB 4XC3L 3QWOB 5HI3C 1P4IH 5D6CB 1K3ZA 4K7PX 2HVKB 5CBAA 1IAOB 3ARZA 4G9FE 4ZFGL 2O5XL 3FQUA 2LV4A 2PW2B 5T1DL 4HLZG 2ZSVB 2AGJL 4MAYA 1AY1L 4OFYD 3PDGA 5GISH 4FFZL 3TO4C 3VGDA 1Z5LA 4HUNB 5C0CE 2KQNA 2P44B 1F4YH 3C09C 3HC4H 1G9ML 1IGCH 4CVXA 1CQYA 5D6DC 2DMBA 4N1HB 2A0LD 4WEUD 4Q0XL 2R0ZH 5KBNC 1LO2L 3L1OL 4LCYB 4PJ9C 5EPMB 3MROA 1DUZB 2YN5A 4KVCL 3GIZH 4OTXH 3E6HB 3UYPA 5E2TH 4G8IA 3ZO0A 3HLAA 3UJJL 3QUYA 3PGDB 1QKZH 3MREB 3IJHB 1E28B 4KHXH 5KSAA 5EU4B 5D7JA 2AV7B 3TZVA 1KIQB 2AJXL 4ZDHB 1FPTH 5EBMB 1XCTA 4UIKH 3B2VL 4X8JB 5IEHA 4M5ZL 2B20A 5HYJB 4LCWB 4BUGA 4C83A 4POZD 1M6OB 5FKPB 5IMOA 3QG6B 5HGAB 4PRDB 3D39E 4IDJH 5ID0B 4WWKD 3Q1SH 3LEXA 3O11A 4BQCA 2UWEE 3CLEL 2KKQA 5TGBA 4HIHB 5GRJL 5HYSB 1ADQH 1BREA 3CMOH 4LLDB 4WENB 1JPFA 3K7UA 1INDL 4JAMB 2B39A 3ARBD 2K1MA 4UILH 2XN9B 3CZFA 3FN3A 4YHMH 5J7CC 5IQ9A 3WLWC 2BOCA 1AD9A 3MNVB 4G3YH 2DJSA 2XG4A 3T77B 3VWKA 3G5XA 3RTQD 2IPTL 4KUZH 4DUXA 3V4PL 1BVLA 4NFCA 2NY2D 4YIQB 3RUGB 1E27B 2H41A 1M05B 4UDTB 5D5ME 1IAKA 1FNGA 5ISZD 4JDTL 2VERN 4H88L 4E42B 3KPLB 4OLEA 2HLAB 2VE6B 1MREL 3DV6B 5DEGB 5ESQB 1LP9E 4NHCL 2G5RA 3MLXH 4D0CA 1CD1B 1N64L 4QRQB 3JUZA 3C5SB 1FFPB 1QFWH 2NZIA 2OI9C 4KZEH 3KYNB 3QWQB 2D0HA 3SDYL 5BRZD 1GPOL 4QXGH 1UM6H 4PG9B 1U8OB 4XPTL 4HSQA 4QYOB 2VN4A 3ULVD 5F9JB 4QRTA 2GFBA 2PO6D 2VDOL 1LK2A 3P9LB 3TYGL 3FCTA 1HQRA 15C8H 1C5CH 3RIAK 4YBQC 1OY3B 3C6LB 3H42L 3V9FA 1OAXH 2A73A 4XP4L 3HZYB 3VXPA 5H8DA 2HFGL 3PHOA 5JQ6H 3IRPX 4JFYB 5FV2A 5DQ9A 5DJYA 4KMTL 5GRVL 3W11C 1RUKH 2ORBL 4IIQC 3EOAA 2GK0B 1F3JA 4G6FD 2DLTA 3H0TA 5DTFA 5ADPL 3MRCB 3I3BA 3MCLL 5IEKA 2GEEA 4YUEH 2I9LA 2F19L 4ZQKB 4FG6C 4PRPE 4UBDD 2VSDA 5L6YL 5HYFA 5DO2D 1PGRB 5FOBA 1KTDB 5C0EA 3VWJB 1C5DA 3BQUB 3FHQA 2R0KH 2IADB 2IANE 3O8XB 4O02L 4TPRL 4P23B 1IARB 3A6BL 1WEJH 1CFSB 1MWAA 1A7OH 3EYOA 1ZHLA 4YAQB 5TJWK 4YDVA 5ECJE 3I6GA 3CLFL 4OIAA 3MLYH 2C1PB 5FIEA 4PJGF 1RUML 1YMMA 1FFRA 3VRIB 4HIEA 4F9PC 5SWZD 3MLZH 4APQD 4D9QE 1A6WL 4QHLB 5E6IC 5K9QI 2DQJL 3BP6A 2JIXA 4TULL 4P2OD 1VGEH 1MWAL 4ZTPH 5DGQA 2HWZH 3KR3H 1OP3K 2VXTL 3MACH 1OGTB 3L7FA 4P49A 4KPHL 4Z5RB 2BERA 1FSKB 2VDQH 3VE0B 4NRZB 1T4KB 2FR4A 1I9JH 1ND0B 3HPJB 4TNWK 1NCDL 5ACMA 1I4FA 2L4OA 3OB8A 5GIRB 3H9SE 5D93B 3ULUF 4PJIA 1U93A 4MMXC 4PB9L 1Y0LB 1FAIH 4RAUB 5DDHA 3RNKB 1YEGL 1YMHA 1IFHL 5MENA 5TF1H 5L2KD 5A2FA 4RISL 3CFBB 5KTEL 4AYFA 4QHKJ 4XP9H 1BZ7B 2NTFB 2J4WH 1KN2H 4OCSH 4FQXA 3QXDB 3RL1B 1IVLA 5I1IL 2R2HA 1CD8A 5J3HC 5C0AE 2VXQH 3RY6C 5HHVH 5ICXB 3F12A 4HJGB 2HT2D 3P4NB 2HTLC 3MPCA 3O3AB 3VH8B 1OT1A 4HCRH 1NBYA 5CWSB 4KQ4H 5IJKA 4P5TB 3GSXB 4RWYH 1RMFH 5C0DB 3FO9B 4HS6A 5GRWA 1F3RB 3TVMA 2W0PA 4MJIA 5A2LH 4WU5B 3RWIA 4PJ7E 5F72S 4UQ2B 2YS4A 5F96L 3PIQB 3OB0K 1HHKA 4FMKA 1XZ0A 2FCBA 3RIAF 2KZ1B 3QDGA 2MFNA 1MRFL 1S78C 3LH2H 3ABZA 1A6VH 3DX9B 1JHLL 4EI6A 1PKQA 4OLXH 1RJCA 2QADD 1I1AA 4N1EA 4XBGB 4F7EB 1RULL 2ZOKB 1XR8A 2XZCH 3VFWB 4PBVC 5DJAA 3ZMRA 3A67L 1D5MA 3LD8C 2W07A 3DOSA 5FECB 4XAWL 1NKRA 1QSZA 5GGVL 1HH9A 4K9EC 1MCPH 1WFOA 4XH2B 2EO9A 4NN7B 3V6FB 2VZSA 3V4VH 4PJAE 4U2YA 5GS2D 2E3VA 1NCUA 1QFHA 4HLJA 4M1GL 3VDCA 1R5WA 5EORL 2D4FA 4JRXE 5KVMC 3EO1A 2H1PL 4PJCF 1DL7H 1CD0A 2C7UA 5J13C 4QRRB 4BH8B 5DZOA 2QEJA 4EN3D 4HS3B 4G8EA 3O41B 3WLBB 4Z7VF 4NJ9L 2F5AH 1TTFA 5HHOD 2ID5A 3LCYA 2F8VA 2E9IA 3LV3B 1B88A 4UUJA 4CRPA 5H35B 4DVRL 3S88L 2R9HC 1P4BH 1EJ6A 2B2XH 4ZNEE 2BVQA 2G5BB 1F02I 4NGHL 4UQ3A 3QEQB 1KB5L 3WDIA 3ILPB 4YPJA 3L7EB 4HMCA 3PJSA 4XPFL 4OZIF 3B9VA 3MLVL 4L3CA 4ERSL 1Z3GH 4UTBH 2V2XB 1LO5B 3MGAA 2LFGA 4LCCC 3H3BC 2Q7NA 4MXVE 1KGCD 3CSYB 2AV1A 4JREB 3BVNA 5I1HH 3GUTA 4X7SL 4BQ6A 5I1JL 5JXAL 4EIZC 1DDHA 2LU4A 2XPGA 5I16B 1WC7A 1G7JB 4TNWF 4WFGE 4NQDE 1QVOA 4XAKE 3JZ7A 2VNCA 1IEBB 5GSVA 1T5WA 1X4ZA 2XZQH 2UUDK 1DBAL 4Q2ZA 4HIXH 4JQXC 1WCBA 2C26A 1XMWA 3JV4A 1NCBL 4L3EB 1NAMH 3DXAD 1T89C 3KXFE 4LCIL 4OLUL 2ARJA 1UZ8A 5MEQA 2VZ1A 3WNOA 2ZUUA 5DYOB 5CGMA 1J0HA 3DBXB 1HHGB 1RIVH 3IAQA 3DX7B 3KNBB 3T0DA 2OJEA 5E8EB 3BMVA 3LEYL 1V7NL 1DQDH 1M7IB 5F9OH 4WTZA 5GZNC 5C07E 5BQ7B 4JRYD 2Y07H 5D1XA 3O6ML 4OI7A 5KW9L 4PJGA 3OAZK 2FIKA 1CLZL 5F6HI 4A2LA 1WZLA 3GSUA 4NNPH 3VJ6B 1MF2H 4RFEB 4GKSB 4OV6F 4Q9CA 4DGVH 4BQBA 2A77L 3EJYD 4P2CG 1FVEA 1TIUA 1JZ2A 4OD3L 1J05B 3CK0L 4M6AA 3D69B 3VGBA 3PHQA 2UWEF 1XCQA 3RZCD 3K2UH 4E41D 3GSVB 4R26H 2J6EL 4ZOBA 1UQSA 1JGLH 4UT7L 2BNQB 3T0EE 4BSWB 1K2DB 1D9KB 1BQHB 2RGSA 1XF4A 4D0DA 4PLNC 2NNAB 4ODTH 3T65A 1HHHA 2CLZB 2ZOLA 3IJSA 3PWNA 3DETC 3HG1D 3L3GA 4KGJA 4XMPL 1TETH 5D2NA 2R4RL 4LRNH 1AJ7H 2NY4B 1U36A 3BHBA 3QUXB 2FLRT 1LD9A 2CDFB 4LLAA 1ZA3B 3HE6B 1ZLUH 2DWDA 5ERWB 5D5MF 1LEGA 3KPQA 3QIWB 2XZAL 3U1SL 5C71A 2RCSL 4LCWE 4HWUA 2AJUH 1LP9F 2PXYD 4LNRA 4OZFB 5E8OB 3EOBB 4OGYH 4HULB 5KG9A 5HYSG 1EFQA 3AY4A 3O2WH 3UTPD 2YRZA 2X7LB 3ULUL 1UACH 5FF6B 2ENSA 1ZANL 2XI9A 1T1XA 4J4PA 4C4KO 2FL5A 3P73B 3UYRH 3VD4A 2XN9E 5GRZA 2X09A 1S8DB 1ZLWH 4NO2A 5KS9B 1A6UH 3RU8H 4HDIB 4ELMA 1C08A 3F7VB 3MRPA 1MFNA 1I7RA 5JHDD 2PN5A 2NQCA 4H25B 1MHEB 5EOCL 3BZFB 1VEOA 2DI8A 1F42A 3RUGE 2X4SA 3EYFA 3OGCA 3ZL4H 5L0QB 1MJ8H 3RL2A 1XGYL 4G8FB 1S3KL 1J5OH 3B5GA 3RWCA 4LIQL 4L8CA 4BFIA 4ODSL 5A16B 4LSQL 2I60L 3ZDYE 3D25A 4JE4B 1IAIM 2FWOA 1EGJH 4IS6A 4P2QA 2X4PA 3N9GL 3GNML 3ARGB 5I8OH 2DLFH 2IMNA 3BD3A 4KV5E 2NXZB 1DJSA 2QQLH 1NDMA 3QNXB 5DK2A 5CJOH 1FV1A 1WIUA 2FGWH 4YBLC 3TBYB 1BZQK 2W65B 2MQ0A 4HS8L 4XNMB 5C2UB 3DX6A 1JFQH 5IV2B 3GSWB 2RR3A 1EO7A 3QIBA 2QHLA 1RD6A 3FOMB 2D7PA 4CU6A 4BM7A 1XGTA 5D1QD 1TNMA 4XB7A 2VC2H 1EHAA 3UROR 3LMJL 1IC1A 2Q8BL 1X6LA 2EDEA 3U48A 4F9LA 1AQDA 1SEQL 3F8UB 1VCAA 3U36A 3JTTA 4Z7VA 1B4JH 1X5FA 3HMWH 4BYHA 3VFSB 4PJ8C 5I0ZA 4K2UH 3DGCR 1A1MB 3NA4A 3FQWA 3U7WL 3QP3A 4JJ5A 5I6XC 3L5JA 1NGXA 4S2SA 1KJ2A 2Z8RA 4GKZA 4K9EH 3TJEH 1BJMA 1TFHA 4MQXD 1Q0YH 2CJUH 3IDIB 4M93C 4U1KB 2HT3D 4OZIA 2G2RB 2R1WA 3SY0B 4NQUA 5DJZB 3MYJB 3OBAA 3TT1H 4CBPA 2OXHA 5FYJD 1PSKH 2H8PB 4F7MB 2C3WA 2ZNXA 2FGZA 5DD5L 1RU9L 1HXMA 5EFIA 5HGDB 1T20B 5IBTH 4KKAD 4G9FA 4X4XA 4WTWA 3KPRE 4IRZH 4XHQA 3S37L 1BQLL 2V2TA 1ZHNA 2ZUVA 2N7AA 4J3SA 4OLZH 3NVQA 3T4YA 4KWUA 4PP2B 4GRWH 5C0CA 3MXVH 1F6LL 3NZ8B 3BH8A 3DRTB 4ZO7A 3MMEA 4QRPB 2FHBA 4LPTA 3GBML 1R6VA 2VQUA 4URTB 5IVNA 5EZOH 5IW1A 4PREA 4M61B 5IMMB 2IPUG 4Y5VB 2Q1EA 3WFZA 5M7QA 5DUBB 2I25N 5JLZA 4WW2C 3WXWH 5DLMH 4FOMA 5CEZE 5SX5K 5J6GB 1KN4L 1CVSC 4ZXBC 2CMRH 4MMZC 1WBZB 2AJ3A 2ZG3A 4M62L 3GSQA 4PJ7F 1U3HD 5CZKA 4JLRB 4X6DE 2OZ4H 3R1GL 4WW1B 5C2BH 1NMCB 2P7TA 1UXWB 4JN1H 5CGYD 5BV7B 1G6RA 3G5YA 5K33A 5KVEH 5T1LD 3NFNB 1CZ8H 1JUFA 2DIAA 2AXGA 2E27H 1CDHA 1RY7B 4NRXB 4OIIL 2ITCA 5FA4A 2JCCE 3OAUH 1M7DA 1NGZB 3NGBB 1U8NA 3AAZB 4OGAD 4NNYB 3D39A 1WWWX 4O2EA 3HMXH 3VH8G 2UWEA 2WWMD 3W0WB 43CAA 1WBXB 4ONOA 4ZNCD 4PV8A 5C08B 4XX1E 4YX2H 4OD1H 5HVFB 4RNRA 3OPZH 1G6RL 1F8TH 4Y19E 4PJAF 3RGVD 4GH7B 3NA9H 4X7FC 4G8GB 1G9MC 2OR7A 1FG2B 1R3KB 4WFEE 4XC1L 1PBYA 4YDLC 1PKOA 3HNSH 1CLOL 4WU7B 4OQTA 2ICWI 4QHNB 3EFFB 5ABDE 1MHPL 1EEYB 4JEGB 3LPFA 5D5MA 5E2UH 4DZ8B 3LZFL 4MAYC 5KZCD 1D7FA 4D9RE 2DQCL 2CR6A 1RZ8A 3GGWB 4O58L 1JZ6A