4HAKA

Multicopper oxidase cueo mutant e506a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHADTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506A
rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 137
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA03
3UACA 1ZPUA 2W8CA 4DP9X 2PPEA 5LDUA 1XB8A 1JOIA 1OE1A 4M3HA 1EHKB 4K9JA 4YSOA 3RYMA 2VM3A 3NJGA 3OQRA 2AZUA 3N2JA 2I7OA 3WNJA 1ZV2A 2Y1AA 1RZQA 2UXFA 2PPFA 4DP6X 4HALA 1KV7A 2IDSA 4Q89A 4GP4B 1CYXA 5D4IA 2J56A 1KCWA 2CJ3A 4G72B 4L0PB 2FQEA 3PLYA 2WSDA 3WKQA 1PNDA 1SF3A 3PPSA 2FNWA 9PCYA 1NIFA 1JZJA 2PPAA 4M4RB 4P5RA 4A2DA 3QQXA 1JXFA 1A3ZA 4A2FA 2YAOA 3ZBMA 5F7AA 3FT0A 7PAZA 3NYKA 2FTAA 1BQKA 2QT6A 2ZXWB 1KYAA 1E5YA 1ZDQA 3AW5A 2FQDA 3OM3B 3S3DB 2PPDA 2UXTA 2BP0A 2GHZA 4FAAB 5I6MA 2RACA 3OMAB 1NIEA 2BW4A 1ASOA 1JXDA 3NJNA 1AZUA 2J5WA 5AZUA 5D4JA 1NZRA 4DP5X 2UX6A 3GDCA 1BYPA 1UATA 1XB3A 1AS6A 3FYIB 3WG7B 4E9YA 2B08A 2FT6A 3FS9A 4YSCA 2VSMB 1F56A 1AOZA 2YXWA 2H47C 2BZCA 1XB6A 2CALA 1I53A 1IUZA 4BXVA 3TASA 1CYWA 5TK2A 3ZX1A 3N55A 2FWLB 2VN3A 1ET7A 2X87A 1GY2A 2QDVA 3NJHA 1AZCA 3AY2A 1WS8A 3FQYA 1TEGA 2CBPA 1AS8A 3CG8A 3G5WA 4DP1X 3NSFA 1OF0A 2A3TA 1PMYA 3MBWB 2Q5BA 2DYRB 4YSAA 1HAUA 2IDFA 3T71A 3EHBB 4AKPA 5ANHA 2YAQA 4WTQA 1JXGA 3EF4A 1TU2A 4YSTA 3C75A 4W9ZA 3IBOA 3QPKA 1A4AA 4AX3A 4F2EA 4NERA 5B1KA 1PCSA 4QLWA 1V55B 4DP4X 1FWXA 1ZIBA 3NJFA 4HAKA 3HEIB 1PZBA 3IE9A 3NJLA 4YSUA 2QDWA 3U25A 1KBVA 3ASOB 3OMNB 2I85A 3QJUB 8PAZA 3DIVA 3GYRA 2GC4C 1IBYA 4YSPA 2IH9A 1BYOA 3SBPA 4UANA 1J5CA 2N0MA 3EH3B 1AACA 4KO9A 1E5ZA 3CDZB 2FQGA 1AAJA 4YVUA 4F2FA 2ZWNA 4BWWA 1NIAA 1GYCA 3NJMA 4CSZA 4KO5A 2HRGA 3JTBA 4X4KA 4UAHA 1RCYA 3HB3B 4EF3A 3CZUB 3L45A 1JZGA 4G7QB 2EIKB 2QPEB 1EZLA 5I6LA 1SJMA 1AZRA 1NIDA 2ZONA 2WO3B 4AKQA 3NJKA 3QJTB 5D4HA 4BDVA 4BXSV 4E9QA 2AFNA 4E9TA 1OCZB 3T6ZA 4G7SB 1OCOB 4BWUA 2VW7A 2PCYA 3AG1B 5AFAA 3V9CA 1L9QA 1ZDSA 4JKNA 2BP8B 3S3BB 1PY0A 2VW6A 2HRHA 2TSAA 1AQ8A 4FA7B 1W6LA 1NWOA 4JHUA 1SDDB 3S3CB 1J9TA 2FT8A 3ABLB 5F7BA 3T6WA 1L9RA 1M9WA 3TBBA 1PLAA 2UXGA 2DY2A 1BAWA 5B1AB 2EIMB 3NT0A 1DYZA 1L9OA 3PCYA 1NDTA 3PXLA 5AKRA 4YL4A 3UADA 4DPAX 1VLXA 4E9WA 3QJSB 2GSMB 3NSDA 5PCYA 3SBQA 3TBCA 2XYBA 3GXUB 1DZ0A 2XVBA 1L9TA 1WAEA 2Y69B 2JFCA 1PLBA 4ZK8A 1FA4A 3JT2A 4JHVA 1AS7A 5B1BB 2YAEA 2PP8A 3D12B 1IC0A 1GS7A 2BW5A 3X1BA 4BWTA 1QNIA 4KO7A 5B3SB 2GC7C 1KBWA 4YSQA 4DP0X 2CAKA 2PPCA 1PAZA 1SFDA 1AZNA 1ETJA 2WO2B 1CUOA 3FU7B 4HHGA 2PLTA 3UABA 1JZIA 2XXFA 2HX9A 4DP8X 4KO6A 1PF3A 2B3IA 4DPBX 2FJSA 1RZPA 4KOBA 4UF7C 1B3IA 7PCYA 2YARA 5TK4A 5EHFA 5I6PA 4GP8B 4P5SA 3V9EA 2IWEA 2GBAA 1JERA 3FPYA 1PNCA 4YSRA 2LLNA 1RKRA 4A2EA 3DKHA 4HCGA 3PAZA 4G7RB 1MZZA 4A68A 1TKWA 2YQBA 2I7SA 4BK5C 5A7EA 1ILUA 4Q8BA 3UGEA 4DP7X 1FFTB 1PZAA 1WA2X 4A66A 5I26A 2YAMA 1A65A 4GY4A 2XXGA 4A2GA 2VW4A 3H4HA 3H56A 1BXAA 1A4CA 4W1TA 1L9PA 6PCYA 3UAAA 4HCFA 2OCCB 1BQ5A 3X1NA 2IDTA 1J5DA 2FQFA 1N70A 3X1EA 2ZOOA 2IH8A 1ET8A 3EH4B 2J55A 3FU8A 2X88A 5I5MA 3T6XA 4DP2X 4QKTA 1SFHA 1AIZA 1IBZA 1XMEB 2E86A 5B1JA 1NTDA 3NSYA 3WI9A 3UAEA 1ZIAA 1NPNA 2AZAA 5I5IA 2DYSB 5E9NA 5I5JA 5I28A 3BVDB 3AZUA 1QLEB 4TXVB 2BZ7A 1R1CA 3H4FA 1BXUA 1QHQA 4DPCX 4HZ1A 2YAPA 4YVNA 2XV0A 4E9XA 1SF5A 3WKPA 5B1JC 1PZCA 1TEFA 1HFUA 3QJVB 2DV6A 3ERXA 4PAZA 3FSAA 2Q9OA 3ABMB 1J9SA 1W8EA 2VM4A 2NRDA 2XV2A 3NP4A 1ASQA 1SHWA 1AZBA 1NPJA 2IWKA 4HHWA 4N4YB 2OJ1A 3NP3A 2JKWA 4E9RA 3DTUB 1GS6X 2AANA 5B7FA 1OE3A 3KW7A 2EIJB 1JZFA 1NINA 1N68A 1ET5A 2BWDA 3FSWA 4GXFA 3FYEB 2XX1A 3EH5B 2HX7A 1E30A 1X9UA 1GY1A 2HX8A 2PCFA 1V54B 2PP7A 2H5UA 5IY5B 1KDIA 2GB2A 2JXMA 4A2HA 1A8ZA 3ABGA 1URIA 3AG3B 1MDAA 3IN2A 2BO0A 3PAUA 2IDQA 1SHXA 5FC9A 2EINB 2IDUA 4CSPA 3CDZA 2BWIA 4N8UA 4F7KA 1J9RA 1AG0A 1WS7A 2XLLA 4AKOA 4E9SA 3FSVA 2FT7A 2XUWA 2GI0A 3FQ2A 1JZHA 2P80D 2XWZA 1L9SA 1X9RA 3NSCA 3S8GB 3OD3A 2BHFA 1MG3C 3TU6A 4HIPA 2CUAA 2UX7A 2XX0A 4HCIA 4MFHA 3T6VA 3CVCA 2YAFA 1HAWA 3KW8A 2W88A 2HLEB 3FQ1A 1W6WA 3ASNB 4ENZA 1CURA 1JZEA 1MG2C 1AANA 1GS8A 3X1GA 1E67A 3IEAA 5I6OA 2DWSA 3SQRA 1JVLA 1M56B 2HXAA 2MTAA 3TA4D 3PAVA 1YLBB 5PAZA 3WNIA 2XV3A 1SNRA 1BQRA 1KCBA 1M57B 3AG2B 3QJQB 2P80A 1MZYA 1NWPA 4NAJA 3FPXA 2BP8A 3T9WA 2R7EB 5B7MA 4KNSA 1E65A 1ID2A 1BXVA 1OCCB 3QJRB 3FSZA 4KNTA 1JVOA 3ZIYA 3AG4B 3IN0A 1GSKA 1SDDA 2PP9A 3WIAA 1OV8A 4E9VA 2EILB 2GIMA 1BEXA 4RH4A 2IWFA 2YAHA 4KOCA 1WA1X 2TSBA 4AI7A 1OOWA 3BQVA 3CVDA 1J9QA 1KDJA 4GYBA 4GP5B 4YSSA 4BDVB 3X2QB 1IKOP 2QPDB 2HZHA 4PCYA 4KNUA 3NJIA 1KGYE 2VSKB 6PAZA 2CCWA 2MRYA 1ASPA 2YXVA 3FU9A 1AR1B 3OMIB 4A67A 1NIBA 2XU9A 1PLCA 4NB7A 4WKXA 3S8FB 5I6KA 5B7EA 1AG6A 1ADWA 2IAAC 2DWTA 2BP0B 4YSDA 3FU7A 1CC3A 3ABKB 2AVFA 1V10A 3NJJA 1OCRB 1T5KA 2J57A 2OV0A 3SBRA 2VMJA 1NICA 3X1FA 5I6NA 1A4BA 2UXVA 1OE2A 4G70B 4YSEA 3MX0B 2R7EA 3ZDWA 1GR7A 1ILSA 4G71B 2H3XC 3CVBA 4AZUA 1WA0X 1GW0A
chains in the Genus database with same CATH superfamily
4WQOA 3IGUA 3OXSB 5DO2D 4AUUA 3DVIA 3FT4A 1AFVH 1MFUA 5EUOE 2Z91A 3H9SD 4HX1A 1B2WL 2DICA 3GT6A 4HIJB 3HNTH 3FH8A 2WTPA 2GPZA 2AZUA 4QYOA 2P47B 4O9HH 1EHNA 4J39A 3B2VL 1T22A 4U6HA 5DK0A 1F58H 2NDGA 4RGNE 5CGYC 3EOBA 5I9QC 3FTYA 5GQBA 2VR8A 4JGJA 4Q89A 2AJVL 2EC9T 3SDCD 1HYSC 2JKRM 2L7QA 3LXBA 4YBQC 3L5JA 4JFPB 3BAKA 3ZKMD 4WGWB 2V9RA 1PZSA 4LSSH 3LNHA 1SHMA 4UTAH 3QCUL 3VJ6B 1JGEB 1DLFH 4Z0XB 1HCYA 2DMKA 1Q94A 1AKJB 1DBML 2B15A 4GI6A 1X5FA 4N0UA 5IMMA 1OWWA 2BFVL 4EDXB 4FAAB 4WIQA 2GAZA 2RACA 5I0XA 3CU7A 5G4OA 3QJOA 3WXVL 5FB8B 2J1KA 1JXDA 2FSEB 1NGYB 1NMBL 1DQTA 1RJLA 2UX6A 5EIIG 5I71C 2XKUA 3QXDB 4P23B 1CVRA 3AGWA 1AQHA 3U6RB 3QIWD 3K46A 4M5TA 4HP5A 4CDHA 4LVHC 2PTVA 2VMFA 3WLWC 3MBEB 1AOZA 5J89A 2YD7A 3MRHA 2R9HC 5A2BA 2NTSP 5F96H 5C2BL 1GYAA 1A8JH 4RGMB 1J8HD 4WHYG 5D7JD 4P46A 4MNHA 3D0AA 5M7QA 3WY1A 1XR8B 1NFDB 1ET7A 5IEHB 4ABWA 4RCAA 1IT9H 4HIJA 2NY7H 1FZJB 2X4UA 5KVEE 1S9XA 3SPHA 3S37X 1H3PH 3G5WA 3H42L 1D5IL 5TE7L 1OF0A 4LDOB 3WIIH 4PP2A 4X6DE 4HS6B 4UAOC 2VXSL 5ANHA 2Y5EA 5AVSB 2JE8A 2YAQA 1FQ9C 4OF5A 2W94A 5B4MC 3D69B 3EF4A 3ZTNH 4NAQA 3VDAA 5FGRA 3NMEA 4NWUL 4PRHD 1KCVL 1SJEB 4HFUL 4HIEB 4OGAD 1RL1A 4JANB 5FCUL 4OLUH 3KWVA 2FHBA 1G9NC 4PJ8C 1URZA 2DAVA 1PCSA 1NBZA 2P5WB 1TMCB 4Z0XA 5CZXD 3IAPA 3QEGL 5EEZA 3MLSH 4F8NA 3B9EA 4ZFZA 4OCMC 4OLXL 5DJXB 2NT0A 1FIGL 2ZPKH 4PMEA 1DLHA 4X8GA 5KS9B 3V95A 1RJZB 1BWWA 3G5ZB 1JZDC 2FSEA 4X7FC 3TEXA 3QI9C 4JFFA 4ZOCA 1MRDL 4NKOA 1UG9A 3B7UX 3QXDA 4P23A 5CIPH 3ZGIA 5J11B 4HWBH 5IW1B 3T3ME 2NNAB 3MBEA 1KPRA 4YXKH 2WWNA 4OFKA 1I3VA 2KLSA 5DZ9A 3VRIA 3ARGB 4PHXA 1FYTE 5KYYB 3G6AA 4JRXB 3RILA 4CILA 2HUEA 3OWEA 4ONFH 1NCBH 4K5LA 5JXEC 1FAIH 5IEHA 2V2TA 1DBBH 4X4KA 4UNVA 4BZ1A 2LOEA 4UUJB 2X3AA 4J4PC 4QGTA 1UWEH 2FRGP 4P3DB 4YNYA 3W0WB 4GI8A 3O2WL 3A4FA 2CZNA 4LHUA 2IG2L 5ISZD 1XH1A 2DQFA 4AKQA 2XIIA 3P11L 2O93L 1HEZA 3HBQA 4NRYB 2XJKA 3VXOA 2EE9A 4XBGA 4KI5C 4YLCA 2DQEL 3CZLA 4PY8I 1UWXH 4D8OA 5C07E 1LEGA 1MW3A 1DBKH 2IQAA 3QYCA 5J6GB 2ICEC 3U4KA 4ZX3A 2F53B 1LEIB 4H20H 4B5ZA 1PY0A 4NM4L 3FQUB 5KYXA 4ZW8A 2P3YA 2EXYC 3II3A 1CGTA 2LAAA 4PJXE 2FWOB 3N1GC 5HDBF 2YEZB 3ZKQD 4XNYL 3N6YA 1RIHH 3SE6A 3EXJA 4TUJA 2VDOH 3FB8B 1XF2A 3WGVB 1HCVA 4UU9A 1X5JA 1QSFE 1BJ1H 2M83A 1H3VA 2ZWSA 4RFNC 1MVYA 2K0RA 3TNMA 3QA3B 3HI5L 3QRFM 5D1QD 1MCIA 4HJSA 2OTWA 3DROA 3A0OA 1L0QA 2FO1A 3BPOB 1DANT 5PCYA 3TBCA 2IAMD 3ARGA 1IBFA 1DZ0A 4K3EL 4JRXA 1JGDB 1QOKA 1BLNA 1S7RB 3ZZLA 1R0AL 3RWCB 3BGMA 1Z5YD 5MENE 4MASA 2IFFH 1JE6A 2NY2B 4XMKH 5ALBL 5EUKB 3WKYA 4GOSA 5LGJA 1ZVNA 3M45A 3VXSA 1BPVA 1JF1A 3VSTA 5IT2L 1I8KA 3RTQB 3W0WA 1UT1A 4A6YB 5GGTA 3V4VB 2ZYSA 4K7PL 1MW0A 3GSWA 3QZWA 5IIEA 5E8DL 3AU1A 4U05A 2BZDA 3P9LB 5ACMA 5ITBL 2WBJA 2Z34A 4OVUA 4HCRA 5J6GA 4P59H 2JTDA 1I8UA 1MFAH 2HVBA 3U0PA 4GS7B 4AYGA 4F27A 3FQUA 4I9WE 5CKAA 2YARA 3SSGA 1U8PA 1OAJA 2YJLA 4LT7A 2IWEA 5EU3B 2XTJE 4PJAA 1KJMB 4DFHA 3DETD 1WQVT 2E6JA 5KG9B 3K4AA 5DFVC 3DWTA 5GGVH 2XWBA 3HCVA 3BKML 1TOXA 4C57C 4OI9A 2CCLA 1ZVYA 4JY6A 4NIKB 2H1PL 1UH2A 5TPWL 3UG4A 4KX9A 1J0IA 1JN6A 4AEHL 2XXGA 2B59B 5H2BA 4PV8B 2CU9A 4M48L 2BSSB 1L9PA 3B9DA 2DDQL 3MKKA 3LEYL 2DJSA 4R7XA 2QR0A 1P7KB 1QYGL 2CNZA 1J5DA 3RDTA 4ODWA 3GTNA 3MU3A 5C0EB 3GDBA 4PJDE 2V3FA 3PGDB 2GEQA 4KTEL 1XTMA 3BFQG 3KXFA 5I5MA 2C7UA 3Q3GA 4KVCL 4FI6A 2IBGA 3CN2A 1SY6L 2WNGA 4GBXB 3WI9A 1DO5A 4NUMA 2VLMD 2NX5E 3RWDA 3RIAK 4LP8A 3TO4D 4A6YA 4TXVB 2YIHA 1WPCA 5H94B 3MLWL 3F58H 3SE8H 2PYEB 2X4OA 3MRQB 4X8JB 2FO4A 3QQ9C 4MMXC 3IJHB 2YZ1A 2R69H 4YHYC 3P30H 4MX7A 5K9OB 4N2NA 2LABA 3WD5H 1YYMH 1WZ1L 2C4FU 2B4CH 2AK4D 1S7WB 4KQ3H 2VLKA 2ILLA 4WV1A 3MNMA 4FNPA 4X4MA 1KGXA 1BAGA 3QQDA 1KJMA 3KHQA 1IAIL 1OB1B 4HVBA 4Z7OF 4HGMA 2Y36H 2AANA 5B7FA 3MCKB 2JIXB 1N7ML 2EIJB 4PU2A 4XHJD 4EIUA 1DUYB 4N2AA 1MHCB 3NK4A 1M42A 2DPKA 2I5YL 2HPTA 4CVZA 5GHWH 3SO5A 4RGND 3AXHA 1XF3A 5AQ0A 3QEUA 1HQRB 2M2DA 2BSSA 2GITA 5EBWB 1KBPA 4B9YA 1FSKB 4QPEA 5DDHA 2V7HB 3H3PH 1OOAA 4G5ZL 3VW3H 3RZCC 4C4BA 4N8VA 2E47A 4ZXBA 2EIZB 4AY0A 2HRLA 1A7OH 4FABH 3MRMA 1A3RL 1HL5A 4FFVC 3P4NB 4LAQH 4XX5A 4QXTB 3BZDA 4RNRA 5JMRA 1NANH 1CIUA 2ZX6A 4BFNA 4ZG1A 2CMRH 4QTIH 2DD8H 1WCBB 4N8CL 4R7NB 3UIYA 4AC4A 3S8GB 4X6FB 2UYLB 3ULUC 5H94A 2F8IA 1T1YB 3A22A 4LL9A 3ARBB 3QGVA 3IJHA 2EVIA 3GRGA 3Q8AA 2X38A 2G75B 3JV5A 3BJLA 3CK0L 4PTTB 2X0WA 3QEQA 4YFDB 1RJCA 5F7EL 2AQ1A 5K9OA 4LGSB 3FQ1A 1MIMH 3D34A 3RX7A 1MG2C 2OULB 1BECA 3SKNB 4S1QH 3F05A 4FXGB 2OSLB 3N9GH 5HD8D 4GUOA 1ZANH 3CC5A 1TUPA 4OCYH 3S48A 2AEQL 3HE6B 2BP8A 4AMKL 1RP9A 3IPBA 3VH8A 3KGUA 1U8KB 1E65A 1ID2A 1BXVA 4HOZA 2UZIL 3DX3A 5HYIA 4ODVL 4AYFB 3BIKB 2QJDA 2FIKB 1OM3H 5EC1B 1BZ7A 1MHCA 3ZIYA 2Q3AA 5FWRA 2FL5A 3RVXD 2OJEA 3HVNA 4ZW3A 4XC1L 1OV8A 3NACH 4YIQB 4QHNA 2IWFA 4KVNL 3VI3F 4GG6A 1ZY9A 4N5EC 2V7HA 1UOKA 4OZIB 2SEBA 1HCZA 1XGTB 1Y0LA 3CVDA 3MYJB 3PY9A 1ZD6A 4RAVB 5C0AB 1YECL 4LNVA 1T66C 3CLEL 4HD5A 4JKMA 1YHPA 4G6FB 1XQ4A 2GUYA 2H6UA 3O9WC 4HUCA 3TA3A 4ETQA 2R4RL 2ZXCA 2ZWZA 1LP9E 4V1DA 1Y6NR 1QR4A 1TTCA 4JHWL 5EOQL 1H19A 2G5BA 1ZGLM 3QUKB 4O4YL 2A99A 2OJZH 4J3OD 5IVXA 3LZNA 4Y2LA 2UYLA 1PJWA 4ODXB 1F4YH 4APQD 3IJ7A 3HLKA 1YY8B 3K1DA 1WIPA 2ZSVA 3O41B 1N6QH 4G8GE 2VQ1A 3ME0B 4CVXB 1N64L 1E4KA 5AOZA 4B60A 1WFTA 1NMCB 5ESAA 4EOWH 4HMDA 4QXVA 1QTYT 4DUWA 2IIJA 2OSLA 4QF1B 4HEMA 4HWEH 5EIVA 4PG9A 4Y1TA 5HYQA 4O2CA 5MEQA 5DF0A 3CH1B 1FYTD 3HE6A 4DGUA 3GPEA 1NM4A 3MX0B 5BZDB 4G71B 1ZS8B 1M7UA 3FQTB 4HQQH 3OKMB 3H3KA 1T80A 3BIKA 2Y72A 2WIIA 2FIKA 4AYFA 2R8SH 2EYRA 2TRYA 1F4AA 2CHWA 1G7MA 1WK0A 3EFDH 5E99H 3KGSA 1MWAB 5ADPL 4GG8B 3MC0A 2DJ4A 3O6KL 4G8FB 3S35H 1WD8A 1F1DA 5DJDB 3QHFH 4FQLL 2EDMA 2CO1A 2WZ0A 3DX7B 3HPLB 4OZIA 3ETSA 3QIBA 4MQXD 1BZ8A 1NEPA 4QRPB 4RAVA 3DX9A 2OMWA 4P3CH 2DQHL 4LRIC 4NNYB 4YLQT 2IDSA 3VM5A 3LZOA 1G94A 2AXGA 1CD0A 4JZJA 3CXHK 5C07D 3WFHA 2BVPB 3QH3A 1UWXK 2WSDA 3FQNB 4E42A 2VZTA 5F93C 1DVUA 4AV5A 1RVFH 2H26B 5F9JA 2PO6C 3E2HB 4IKIA 3GRWA 2G9HB 3VGFA 3VU2A 4PJHF 5CCGE 3OTTA 4XB8A 1HOCB 4M62L 5DJ6A 4DKFH 5K1NA 1KYAA 3OZ9H 1A9VA 1FNSH 5B8CB 4GAFB 5DO2C 4QXGH 3TONA 5SWQB 2WSKA 5H4ZA 2YKLH 2VE6A 3GHPA 4NJ9H 4O02A 1DJYA 1J8RA 2AC0A 4U1IA 4X6CA 1JYWA 1NC4D 1MLBA 2EDLA 3IDIA 1YEWA 3GI8H 2FEEL 3QNZB 1UATA 1I3RA 1ZTXH 5KSBF 1MFDH 1WYJA 2WM0A 2B08A 2E27L 2F54B 3SDCC 2R0LL 2PABA 3OKMA 1HN1A 2VWEC 4PWJA 5HGBB 1RAMA 2VSMB 5F71A 5MEND 1XZ0B 2EICA 5G4NA 3ZKMC 2ZAHA 4OZFB 2DI7A 2MH4A 4XAKE 2BVQB 4OJFL 4LBAA 5CCKH 4TQIA 4LDCA 5JNYB 2JK5A 2VN3A 1DVFD 4G8FA 4LF3B 3GJFH 2QDVA 5D1XA 2DOCA 1AP2A 3QE5A 4ZUSA 2FJUB 2NXZB 2AS5M 1KN4L 5C6TH 3ZDZF 4YXLL 3NBNA 3S5LG 2PW1B 1M3JA 1XGPA 1Q72H 5E4EC 1PIGA 2WXGA 1ZSDB 1YEKL 2V17L 3EO9L 1NFIB 3ETBJ 4G6JL 4MXVF 1J10A 1J1XH 3T71A 2GTZB 3NAAL 1V8HA 5IHZA 3OGCB 1UZ8A 5L2JB 2P52A 4RRPM 2E9GA 4URKA 3IBOA 4LCYB 2FJHA 3TVMA 2FJGB 4AX3A 2XTJD 2O5XL 2QQKH 1EK3A 3GBEA 3RPIB 4FCHA 3QORB 1PQZA 3QIWC 1UXWA 3IRZA 4WAFA 5E6ZA 3NJFA 4E41B 1UA6L 2EDWA 2PNDA 5KYNA 2NQ3A 4IRSD 4LKXA 4PIRF 5D7JC 3TO2B 4BRJA 5AG9A 1UM4H 4LCCB 3SE9L 1F41A 2D3VA 5D70L 2G3NA 1FDLL 4EBQH 1KEMH 2HN7A 1MLCB 4M9OA 5ANMB 5CEZL 3IRCA 4WGKA 4YO0B 4TUKH 3TBYA 4M7KH 3M86A 2F54A 1WVZA 2HKFL 5EC2B 1XZ0A 4DGIL 3LNFA 2TRHA 1TETH 4JFOB 1IJ9A 2C4XA 2EXTA 2IMNA 1B4JL 3FTSA 3K6NA 3O8XB 4OZFA 5F6IB 3TBVB 3WTYA 4LF3A 4OGAC 3LIUA 5LNGA 1JK9A 5AAMA 1QSVA 3VXME 4XP9H 3VFOA 4FG2A 3BD5A 2EO9A 2KI6A 1A14H 5CZXC 3TIEB 3GTTA 1YC7A 1SQ2N 2KS0A 4G7QB 2EIKB 1FNLA 4GO6B 5EO9A 1B4TA 3D0LB 3JTTB 3QUZD 5ALCH 5K9QI 1FC1A 1AZRA 1G7HA 4YWGL 3OGCA 2WINB 3FUKA 5F9WC 4Y4FA 3L4UA 5HDBE 2B1AH 4FZEL 4FF9A 3VD3A 2C8NA 4IOIB 3V4VL 5C0RL 3QUYB 4XOAA 4UZUA 1F4WH 4J3OH 4LOFA 2W0FA 2C1PA 1ZJAA 3FZUD 1A5FL 3EJTA 1ZA3B 2HAZA 4F9PA 1QR1B 3EFFA 1HH9B 3O2VL 3F5WB 3V4PB 4PVLA 3QUMB 2X3CA 4AVJA 2NNFA 4OTXH 4PGBA 2MHAB 3WSQL 1PLGH 2W07B 1MLCA 4PJGF 2X1XR 4RRPG 5CR8A 1JGUL 3I02A 3Q8CA 3EG9B 3L95B 3BDYL 5JQ6L 1U8MB 1HESA 4G9FE 5E1GA 3TPUA 4DO4A 5L7XH 1N6VA 4JFOA 4QUOA 3OB0H 4ALAL 3P0VL 4Z7VB 4R7LA 1J11A 4J3SA 2XPZA 3GI9H 4H25A 5FKPA 2P45B 5DHYB 3IS1X 1DP0A 4FFZH 3WELA 2OX5A 4KPHH 1PZ2A 1B0GB 2VRKA 3EADA 2VZSA 4IS6B 4QHUA 1GZPA 3D0LA 3JTTA 2A1WL 5E2UH 4IIQC 1MHPH 3D3VE 3SBWA 3WO4C 4NPJA 4YC2B 2ZKHL 5BVJB 1PAZA 3QCVH 4NWTL 1D7BA 1G6RL 1OSYA 3FL7A 5IROA 4XX1G 2X42A 1BLIA 1S9VA 1BP3B 3AQXA 4OZHB 1QABA 2R2HB 4JMXA 4GKNB 1RZPA 2HH0L 5D1QC 1KXVA 3CE1A 4UI2A 1BX2B 4RFEB 1KACB 4JMNA 1PY9A 4OLYH 3V9EA 1ZA3A 1Y07A 4WCYL 2CJTA 2IAMC 1U3HA 4NQCB 3VNYA 4A2EA 5EU6E 3I50H 3EDKA 4GIPD 2YQBA 4AEFA 2YD6A 4DKEH 3Q9PA 4DH2A 2E56A 1HKLL 1YEHL 2MQGA 4FG6D 3ESPA 4GQRA 3QCTH 1ZHKB 5GGTH 3A6CL 1WT5A 2QHRH 4JRFA 1SXZA 4KKRA 2FH8A 5BJTA 4XWOD 3GS0A 2J1XA 3X1EA 5I1GH 4MNQA 4HCRH 2IH8A 3GIVB 3B5HA 1J5OH 1IQWH 2UY7A 4KK8D 4WEEA 4H8HA 5A2IH 4RMVA 3L6FB 3OC5A 5DHYA 4JO2H 4BRVA 4WVRA 1EERB 3FFCB 3UDWC 3O6LL 1QHPA 1FGNH 5KSAA 5DQJA 5LN4A 1OARH 3D6GA 3DETC 4IS6A 4NAMA 1BXUA 4I77L 4DUXA 4DERA 1PL3A 3BPNB 1E0OB 2YAPA 1BEYH 3MRPB 5DC2A 2WLLB 2EADA 1SHSA 2Y7LA 1SMAA 4OZHA 1FFRA 2R2HA 4F5CA 3FCBA 1HZHL 2BOLA 2ITDA 4FYSA 1O7SA 2VDLH 2VM4A 1QBML 4RFEA 1AZBA 2IWKA 4C4KT 1LLAA 4N4YB 5IHLB 4J6RL 1K9TA 1F4XH 1O6SB 1YMMB 1U8CB 1UB5B 3MLXH 4QLRA 2AHIA 3DTUB 3WJJC 5IVZB 3NZ8A 3G6JA 3MUUA 2NY0D 3CFJA 3ZE0E 1H0DA 2BWDA 3KPQB 3V6ZB 1AE6H 1P0SE 4G83A 3EH5B 2HX7A 4A7UA 3X17A 2DLGA 5TE4H 1H8LA 1DQDL 3TO4C 3K1KC 5FYKU 3LEVH 3F62A 2KDGA 1B88A 2ITFA 2DWYA 4N1EA 4A2HA 2WW8A 4DTGH 3VQMA 5JYLA 2XN9E 3AWEA 3IN2A 4UQIM 3L6FA 3O6MH 1PSKH 2NUPB 4KZEH 4OF0A 1T2QL 1CL7L 3LN4A 5F1SA 2NY5L 3N1MC 4O5LH 3FFCA 3UGXA 4F7KA 5F1NA 5HHOE 3DDGA 15C8H 4PUBH 2IPUK 3JWOC 2GK2A 3TN0A 5FOJA 5C8JB 2W65B 3C6LB 4WKZB 2MIZA 5CGTA 1NBYB 2EE6A 4XHJC 2IH3B 1UH4A 1KPVB 5E4IA 1YVLA 4YE4L 3ROLA 2FX7H 1UEYA 5DZVA 4HSAC 3EYOA 3H6AA 3R8QA 2APBA 3MCG1 4RGNC 1BBDL 1T04B 2FATH 1BDYA 3L1FA 4X5RA 4H0IA 4TNVF 4IRZA 4A7TA 2MTAA 3X3GH 4ZFGH 5I1KH 4LCWE 5I1IH 1YMMA 3GB7A 1U8CA 4YHPA 4B9PA 3PDOB 3AG2B 3HC3H 2P80A 4J1UB 4R83A 4XAKD 4CDGC 3VI3E 1VFAA 5DEFA 2W81C 1N18A 1OCCB 5BO1H 4NC1E 2NCEA 3KPQA 3X3FL 4K23L 3GJFK 3UP6A 4ZMVA 3G5YA 2ISDA 4MJ5A 2W0LA 3TEYA 5FCSH 4FQIL 2VN5A 3IDYB 4GKLA 3WY3A 2CA4A 1P6FA 4WW2C 1JF6A 2TSBA 2DQDH 4RX4D 4YX2H 2ZNXA 3R1GH 3QDMA 4JO4H 3ATDA 1JPSL 3GQFA 2YEQA 3QR1A 1JZ3A 1DQQA 1HHHB 2NR6A 4JM4H 4F7MB 1UJ3C 1YPZB 3D09A 2JJTA 2CRIA 4JUSA 1F8TH 4IEFB 4HIXL 5JA8B 4M7ZC 5BOZG 4JCWA 2AP2A 4EI0A 1HWGB 1RK0A 3D85D 7CGTA 4GH7B 5HD8C 1JPST 1Z9PA 3LX9A 3HNSL 1NFDF 2OW7A 3C6LA 4M8QA 4NP4L 3EJCA 5IB3B 4XNXH 1NBYA 3AQZA 4KKPA 4LHQB 4WDIA 5TQ2H 4AH2A 3IFNL 4JFEB 4GW5B 4B9GA 1CB4A 3RVXC 5EORL 2AJXL 2C9SA 1URLA 4LEEA 4L4JA 2AGJH 2FX9L 2FBJL 1QSEA 3RX8A 3RWJB 4V33A 4Q9RL 3QJXA 5I1HL 3AWFA 5I6NA 3F12A 3OR6B 4NHUA 4ZMLA 4FQ2H 3D52A 3PDOA 4YDKH 3M46A 4X4XB 1R33A 2XOTA 4IBUA 1NL0H 1AXTL 2H8PA 3U4AA 1WA0X 5C0FA 3NFSH 1QZNA 4G43B 1TJMA 5K59F 2NTFB 3MXWL 5KANG 5KS9F 1FBIL 4MQ7B 4JFUA 3RQ3A 4J3OC 4PGEA 5KN5B 4OM1H 4FLSA 4KQ4L 1AQDA 3RYMA 1TDQA 5D2NA 4APQC 4HU2A 4R7DB 4HBCL 4QAMB 4R8WL 2ICWA 4FP8L 3U1SH 3ZDYB 3OF6D 3ZIMA 1EX0A 1USZA 2P8PB 3HFMH 4CMMA 4DVRH 3S4SB 5I1CL 5DEJA 1AGFB 3QZPA 1HINH 4B96A 5IV2B 3LKNB 4NOBA 2BSDA 5I1EH 4YPGA 1CK0L 3PWVB 2VR5A 4LFHD 4LARH 1JYNA 4G9DB 3IFOA 4A2FA 4BINA 4WTWA 3ARFD 1FZOA 2WNXA 1S7TB 2CDEA 5KSBE 2C3HA 1XF4B 1ZHNA 4OFYD 3TZVA 4H4NA 3TBTB 3RFZA 3TEZA 3M6DA 4O2EA 5JHDE 5INCB 1KYFA 4AG4H 5B38B 4QRUB 3U48A 4G9FD 3BUPA 3OR6A 1D5XB 1NZRA 1GJWA 3K72B 1P1VA 4MQXC 2A77H 3L4XA 1IEAA 5ERWA 1BCIA 1WGVA 2VDRH 2VM9A 4X4XA 2XZAH 4XPBH 4FDWA 2FBOJ 2JI2A 2ZJSL 3VFMB 5BRZA 4POUB 5D71L 1F56A 1S2EA 3NA9H 4MYPA 2WXNA 4NN5B 3MGOA 4PJAF 2A9DA 4TULH 4XCCH 4BXVA 1IBGH 4CNIB 1XGQA 1CI3M 3GRWH 1MPAL 1JZ6A 1EA9C 1TSHA 1GRWA 1HDMB 4JPWL 5EU5A 1U58A 4JFHD 3BP7B 2PYFB 4UQ3B 3D3VD 3GO1H 1U33A 1OPGL 5I0ZA 4PVNA 4A04A 3M8OH 1F6FB 5LQBH 2ZCKH 2GY7B 1KBGH 2VUOA 2WLZA 4O02H 5KTEH 1MY5A 1PKQE 3BP4A 1INQB 1T03H 1HXYA 3S36H 3BXNB 5GRVL 2CXKA 5IV2A 3LKNA 1OW0A 2CDFB 3KJ4C 4FFWD 3RGVA 3DGDA 3QO1A 3NCEB 3RG1C 5HPOA 1EEYA 4UV7H 1CE1L 4PRPA 3MLRL 3IDXH 4LDLB 3SY0A 1CD8A 1G9ML 4G9DA 5EU6D 3KJ6H 4QLWA 1ZV5A 3KDMA 1CDJA 3HEIB 2B0SL 2Y9RT 1LO2L 1R5IA 4P2QE 2HLAB 4DQAA 2EO1A 3T0EB 4PGDA 3N1FC 3QJUB 2YRLA 3FONA 4GSUA 5INCA 5FYJH 1DVFC 5FO2A 1AOHA 4UBDD 4BZ2A 1YJDL 1EHLH 4QRBA 1D5XA 4D2NA 5D7LA 5CN1A 3VO0A 3QUML 5CF3A 1AXSB 5FECA 3HMXH 4Q4EA 1FF5A 5CO1A 4EDWL 1DFBH 2NNRA 2XFGB 2B9BA 3FK3A 3O0RH 4I18B 3L4YA 4ZO6A 5DZAA 4ZSOE 4KO9A 4PJBA 3SE3A 2FQGA 5C7XL 3RNKB 3BT0A 5FYKL 1IGTB 3OG6B 5D5MB 5AVVB 3VFRB 1FGVL 1OSEA 3VXRB 3VXUA 1YEFL 1ZRUA 2XTJC 4GUCA 4PW4A 4UQ3A 4WSKA 3DYPA 4AT6A 1PKOA 1J88A 3MJ8B 2H32H 2ZOKB 1KJVB 4P2RA 1KXTB 5KVGH 1NCWL 1CDYA 1KCSH 2EXSA 1M7DB 4IRSC 3SYQA 1SLUA 4PRDB 3X11B 1Q9WB 4LSUH 1MCKA 2BJMH 3VWKD 1AGEA 4ONOA 5LBSL 2AJUH 4NSKB 5L8JB 1O7DE 4E9TA 1I1FB 3LVTA 3QFJE 5IOPB 3HS0B 5FR3A 2PCYA 1L9QA 4OFQA 3DVGB 2R1WB 4B53A 4R0LA 1HIMH 3CQPA 4PJGE 4L18A 5IGXH 2GFBB 2D3LA 3EZJB 3Q44A 1OAQH 2QSTA 2ED8A 3Q8EA 3KPOA 3QZNA 4XN4A 3O4LB 1F2XK 5CWSA 1ZKAA 5F1KC 5IG7B 3TBBA 3HC4L 5TF1L 1E5BA 3SJVA 3UFIA 1TZOA 1K5WA 1S9YB 1YNLL 3MBXL 1K6QL 1L9OA 3BYTA 1N0XL 2IANE 1KCUL 4QRRA 3S6CA 2XN9D 4GJTB 2I07A 3X13B 2YO3A 3KWWA 3QUZC 4G1EB 3PWLA 4EJ1C 1TEYA 3BVWA 1T0PB 3EJZD 3D39D 4JDTH 4ONGL 2XYBA 5HHOD 1IGTA 2ZCLL 3AAZA 4L4VB 1TJGL 4MAYD 4UCFA 4OIAA 5J6HB 1IFGA 3CDFA 35C8L 3HZYA 3JVGC 4YLBA 1PG7L 2GY5A 1IEBB 1T2XA 3MJ8A 4L2YA 5D7IB 5E8EB 2CLRA 1ZVSB 4MLSA 1XH2A 4PRAB 4LCIH 2ZUYA 3FZUC 2BSTB 2R0WL 1D2OA 1ZLUH 3X11A 3PV6B 4EZMA 4Z7UA 3ECQA 5E6IB 3BKYH 5KVFE 1I9IL 4XMVA 5HJ3B 2JJVA 2WO2B 4JFQA 3X12A 4MA1C 1W91A 1JZIA 4LCWD 5E9DB 3FU0A 5FDWB 4NZRH 3VG0L 5AVZB 2A7BA 1OF2A 4DP8X 2B3IA 1E40A 2AAVA 3GMOA 3CSPA 3OKNB 4L5FE 1SY6A 2OAAA 4ZTEA 7PCYA 5EF3A 2XTLA 4DK5A 5I1LB 5I0DA 3SOTA 2KQMA 3FPYA 3ZMNA 1EFXB 5IVXF 4J3OG 3VXTB 5KVMC 1XGYL 1IGFL 1Q0YL 5CZRA 4MDIA 3FJTA 1AO7E 2WD0A 1IQDA 3M7OA 5C0CE 3AY4A 2JCCA 4Z3JA 5E00A 4AVKA 3MR9B 4HKJB 4IHOB 1BVKA 2ZYHA 4MXQD 4QRSB 3WL9B 3D18B 4GMSH 4XXCA 1DBAH 1MCWW 1A4CA 5JOEA 4G1EA 4YAQB 3SCMD 1K8IB 5SV3A 4N2BA 5EZJA 3BUIA 3SD2A 2XQBL 4KDWA 1CMOA 3LH2L 1TTGA 4DIXA 2WTRB 1WEJH 1IAKB 4MYWB 3MLUL 1S7SB 1IEBA 1SFHA 4IGBA 1GGCH 1K72A 3O45A 1Z7JA 3IXTA 4PRAA 1T1XB 2F7OA 4M9PA 2ZUVA 2AZAA 2AW2A 3F64A 2PWGA 3T2PA 4RWYL 4IRJA 3C08H 4PTUA 1BJMA 5CBAB 5E6IA 4OZIF 4KTDL 1QHQA 4AC2A 1LD9B 4DPCX 2O5NA 5L8LB 2QGEA 4XRCA 2X5PA 4PJFB 4FG6C 1JNLL 4QRAA 4W9HC 1NH6A 3WFZA 4XWOC 1OTSD 3NP4A 3MNWB 4N0UE 4YQXH 5CZVH 3CHRA 2IEPA 1EFXA 1G1CA 1NC2D 4KK8C 3VFSB 4RESB 3MNZB 1BD2E 3VFVA 1XT5A 3V7MA 4CN6A 1ET5A 3FSWA 4MKMA 2LTQC 4GXFA 1D6VH 3DSNA 3RFRA 5L9DL 1A3LL 3WL9A 5GGRY 3LPWA 1VFUA 2ZG2A 2OQJA 4GINA 4LPXA 3PXHA 4TTGA 5D7SH 1A6UL 2UZPA 4PG2A 1NAKL 4B41A 4MD5A 4XP6L 3NCJL 3P9WB 5DRZA 1F90L 3MZTA 4H44C 2IDQA 4URTB 1IAKA 5FC9A 5H37H 1S7SA 2IDUA 1R17A 2IADA 2RCSL 2YPKB 3BPLB 4NO0A 4AKOA 3QO0A 5JPNB 1E4XI 5A6MA 2CHZA 4K9EC 2OYPA 1O9VA 4DEPB 3BZ4B 2V0AA 3IDNB 4JW3A 3KE0A 2WZ5A 2QPSA 4L2LA 5JHDD 3GWJA 2NY0C 2ORBL 4OFVA 1ZHLB 1JDCA 2DWDB 3K5SA 1YEGH 4P49A 5L88L 2W88A 4DZBB 1WC7A 3MRIA 1WO2A 3BC9A 3T5WA 4PWGA 1HXMB 1UASA 4KKBD 4AL8L 4R96B 4K94L 5A2LH 1M56B 1LYQA 3FTGA 3VFUA 5D93C 3MA7B 5E2TH 4ANVA 1M57B 3IJSA 3MNZA 1T3FB 5GRJL 5KBMA 2OL3B 5D6DC 5C6WH 3NGBC 4H8VA 4MHHI 4KUZL 3TWCL 2BVEA 4KNTA 4FOMA 2MOGA 2OR9H 3VGAB 3DSFH 4AJWA 1SDDA 2RAMA 1E8ZA 5DFTA 3QRLA 3GK8H 2QV2A 1OP3H 4PLJD 4RH4A 2YAHA 4XVOA 2YOAA 3JWNH 3OKOB 1GC1C 1SLWA 2X9YA 4AI7A 6CGTA 2W60A 1HILB 2B1OA 3BQVA 3DMMB 5DD3L 3SDYH 4XMLL 1NFDE 2YUWA 1EMTH 4IRZH 2YK1L 4BFIB 4PGZA 1MCRA 4HH8A 2BRRL 1QLFA 4ANXA 1UGNA 2CKBL 1U42A 1XBDA 4EQ2A 4I48A 1MJ7H 4NI6A 4RIRB 3MV9A 2VSKB 1G0YR 6PAZA 3LS4H 3GXMA 1A66A 3C09C 1NGWB 3BZ4A 1FVCB 3ARDD 1MAKA 3FTUA 3V55A 4FYTA 2X1QA 1IGML 4DGWC 2DIEA 1NIBA 2XU9A 4JQVC 4CU7A 1GAFL 3DRTB 4M56A 4PJ7B 3TIDB 4FEIA 2ZX7A 3P4OA 3MRBB 1J8SA 3DOHA 2VH5L 5ICYB 5CJ5A 4FHBD 4MB4A 4N1HB 2P5WE 4DZBA 1HXMA 4NUJB 5E0FA 1B0IA 4R96A 4K8RL 5EIQA 1G1KA 4NO2B 3DK0A 4PB0H 4TUOA 1HU8A 1UYWL 2YHGA 5B22A 7FABL 3L3OC 4AOFA 5K59E 2J1WA 1LO5A 1IFHH 2P28B 4X4YB 5KS9E 1NEZG 2X0VA 1N5YL 4YHZH 5IESH 1DL7H 2ERJC 4IOFD 3PGCA 1GR7A 1ILSA 1NGXB 4JL1A 2O61B 4OT1H 3K7UA 4ZUWB 2VMCA 4P9HL 1UM5L 2BNUA 3PL6B 1JUFB 1B2WH 3MPCA 4OZGB 3F7VB 3PJLA 4DSYA 2I9LB 2PPEA 5LJYH 5GISL 3B2VH 1FH2A 2X53A 3DV4B 2EYSB 5L6YL 1OLZA 3OKOA 4K9JA 1DN0A 5I2IA 3WEBA 4JRXE 1BMZA 2E75C 3B9KD 1XSOA 5FA3B 1U3NA 2PPFA 4XNMB 2GUOB 3KWXA 1FZKB 2AQTA 2OMTB 4Z95L 2DL9A 2J56A 1JRHH 1EAQA 1A4JA 2RFXB 2JKXA 2CJ3A 2EH8L 2A9NL 2H45A 3HZMA 3L9YA 4L3AA 1BF2A 4MJ4A 1FZMB 4P2YA 5EBMB 3K6IA 4RMQA 4RIRA 5FGCB 3D4ZA 1D5ZA 3WKQA 4BUHA 4KI1A 3W0WE 1PPIA 3KPMA 1NBCA 3FB7B 3QCUH 1G7PB 1NGWA 1CBJA 3HE7B 3L16A 4OB5H 1UADC 3D87B 5AKTA 1UD8A 5TDPA 4KRPB 4QMEA 3L3GB 4D9RE 3V7AG 1DBMH 2C34A 1DDHA 3ZBMA 4WHTB 3GMLB 4JN2B 4J3WA 4HUKB 2VXQA 4N68A 5DZLA 5AB1A 2VB5A 3RIKA 2QT6A 5EOCL 2F53E 3PDGA 1LGVA 4FNRA 4KK5D 3ZKXB 4DO6A 4DWHA 3VE0A 4Z78B 4D0DB 2IAND 4JREC 4EI5D 4WO4D 2EKJA 1LNUA 2LU3A 1A6AB 3P3TA 1KXQA 1YEJL 3RHWK 1Z3GL 4F9LA 5DS1A 1XCXA 3H7LA 5CEZE 1NDGB 2VZVA 3GDCA 3DVFA 5HYJA 3C12A 4GRMB 1E5AA 5KOMC 3WAJA 4FEMA 4GXUN 5I1DB 1EGJL 5EZPA 1HQ4A 2YXWA 2K78A 1OGAA 4Z7AA 5FAAA 4NNXB 4OZGA 1FL5A 4L48A 4FQJH 4YBLB 3V6OA 1ZMYA 3HUJB 4WWKC 3UZEA 3AS0A 1PCXA 3H42H 1D5IH 4GSDL 4QOKA 1ZLUK 3ARFC 4X9HA 1KC5H 1LXMA 2CBPA 2VXSH 3LKRB 2WVVB 4JG0L 3QULB 5AB2A 1BA9A 3KDPB 4LLUA 2OMTA 1QLEL 3AABA 3L81A 4NQEB 3NEEA 4NWUH 5JQIB 5E08L 3ML9A 4K5NA 1R46A 1FZMA 4QTHB 4FG0A 1NFKA 5FCUH 3GS7A 4G6AD 4Z7VF 5AVUB 3FB7A 3Q2VA 1G7PA 3KH4A 4AQ1C 3K6SB 2XA8H 4YL9A 3WHXB 1JNNL 1WUZA 5G4MA 3QEGH 2HVKB 4HS8L 3HG0A 4OLXH 5HI4D 4XB3A 1V55B 4DP4X 4PI2A 5I76B 1VESA 5E8PA 3NJLA 3O3EA 1A22B 2OMVA 3B5TA 3KNBB 1EAPB 3MNDA 3SB3A 2ATPB 5C0CD 4H8WC 5GGUA 4BGDA 1SM3H 1KB5A 1ZLDA 4HJTA 3P3YA 2W9EL 3HI6L 4HD9A 4KQ0A 1MRDH 4OFIA 4XBPA 2D2OA 1U8NA 3GYRA 3DO7A 2DLFH 1WFNA 1CICD 4Z23A 2XG4B 1IBYA 3Q6GL 5K1VA 3P9MB 1QHOA 4FTVB 2X28A 4XAWL 4OZHF 4TNEA 3QS2A 2BHZA 3UTTB 1BFOB 1LEKB 3TL5A 1J5CA 2X3BA 4XNUL 1NM9A 5C09B 3VWJA 2ITCA 5ID0A 4FFWC 1VF5C 3IKKA 4NNXA 3G5XB 2AQPA 5KJRH 3HUJA 4I0PB 3MTXA 3G6JF 3ZT7A 4JB9L 5CSZA 3KPPB 2X10A 2KLRA 1GA2A 4N2KA 4LU5H 1T89C 5AW5B 2ATKB 3IS0X 3LKRA 2IG2H 4Z9KB 1GOFA 3I74A 1F13A 1A7BA 3L5IA 2WZ6A 3P11H 4PY7B 5MI0B 4BZ2H 1L7IH 2EDNA 4QTHA 2B2XL 1SJMA 5C0BB 4Y88A 4UBDC 5D4HA 2ZOLA 3A21A 1I8MB 3TJHD 2C3VB 4KV5F 5T1KB 3D30A 4YZFE 4NM4H 4XCEA 2GJ6D 3WHXA 1MXDA 1D7DA 2PYEE 3BN9D 1IZJA 1XCQB 4XNYH 1BD2D 1X5IA 2NY3D 3OSKA 4WW1A 5EBLB 2TSAA 1EAPA 3HRZC 2ATPA 2QZ5A 5EBGA 1VADA 1UZ6F 3GIZL 2MCPL 3ABLB 3B3IA 1IVLA 2J6WA 1MSPA 3AREA 3CFKA 1G6RA 3HI5H 2D7QA 1FCCA 4E5XA 4KROB 3FB6A 4FE9A 4Y4KD 4FTVA 3EJSA 1MFVA 5EO1A 1PFCA 3I85A 1BGXL 2IFGA 4CU6A 1MAMH 3UTTA 1LEKA 5AKRA 2QLVB 3ROOB 4N3TA 1QNZH 2CR0A 3KCWA 5J0BA 1U8LA 3RVUD 3FULA 5E70A 4LRNL 4F7PB 1WHOA 3H6JA 1KYUA 3VWKC 1WBZB 2J6EL 1GKEA 5EU7E 1YSOA 2H1LM 5D8JL 1RULL 3ASWA 3NRPA 4XN7A 1CR9L 5LAPA 2YAEA 4IU2A 3NEOA 2E6QA 5DQ9B 2IO5A 4NQVA 1TQBC 2Z93B 1XAUA 4E0RA 1P4IL 4Y1AA 5CMAA 1TQCC 4X0KB 2AJYL 2B1HH 1KELL 5TD4A 4BHUA 1KBWA 2AF2A 2DIAA 2WTOA 1G7IA 3KLAA 5C0BA 2Q7NA 3MLYL 4Z1PA 1AZNA 2JB6B 2CUIA 1WWWX 2QEJA 4NIYE 1AKJD 4HHGA 4HV8A 3H1ZA 1T83C 1JV5B 2HT3D 3BAJA 5DJYA 3DA0A 5IJCC 3Q13A 2WWOA 2X0UA 4LLVB 3GD1C 3H2QA 1YAZA 5CN2A 1T4WA 3PWUA 4KKLD 2VNCA 3HW7A 4FLHA 4AJYV 4B7LA 4HDIA 2WSPA 4XN1A 3EJZC 4ZX6A 2BSCA 4OJCA 3PS6A 1JERA 2VMEA 3BKMH 3D7PA 5J6SA 2LLNA 1IC4L 3U7YL 3W56A 1MZZA 2VDNB 2VQUA 2H1PH 3GSUA 5TPWH 4EI6B 4M7JL 4MAYC 1SVZA 1QLRB 4IKLA 3CFEA 4IKJA 4AEHH 2PXYA 1OP3K 1LO0L 5HHNB 3LEYH 2DS4A 3N40F 4F91B 1F02I 1QYGH 4OCSL 5I17B 1FH5H 4MCYA 4HUUA 3L5WA 4PLKD 3CUPB 4Z8FL 3FB5A 3OJMB 4HOWA 1WTGT 2OSWA 2ADJB 3JBG7 4J23A 1LK3L 3MODL 4KVCH 5F89B 5FEBA 1IAMA 1SY6H 2UWEB 1V05A 4OZIE 1IGIH 3KBPA 1PD0A 4ENED 2VRQA 4PJCA 2Q76B 5C0AE 2Z93A 3QWRD 1H15B 1R3LB 1ACYL 5I0YA 2GJRA 3GSQB 3MLWH 1ND0B 5FUCE 1A6ZA 1A7QH 2XBTA 3MHZA 1DTUA 2P5WD 1MRFL 3FO1A 2DLIA 5E56A 3U1QA 2ZUQB 4ABQA 1V3KA 3GEFA 2XV0A 2E7MA 1RZIB 5KSVB 4FA6A 3LQMA 1NKGA 1YNKL 3BQUB 2HFFB 4MXQC 3VD5A 3LY6A 3BIAX 5B39G 3VGBA 4LP5A 1L0YA 3SCMC 4KY1L 4R5TA 5GS0H 4L8DB 3N50A 4AQAB 2O6DA 1RPUA 2JKWA 5AOJA 4LFHG 1RURL 4EI6A 3REWA 4Y2NA 5DYOA 3H7BB 1MCQA 4KMQA 3IJYB 5GS3A 2X4TB 3KW7A 3WN5A 2X9ZA 1N68A 2DMCA 2OL3L 3FYEB 2XX1A 1MI5A 2XXMB 3NFNA 1CPUA 4ZS7L 1YUHA 4G5ZH 1MJJA 4I4WB 4R26L 4XXDB 3QQ3B 3QIUA 4XMUA 5CXPA 1LWJA 4LCUB 5B21A 1W72L 3GEWB 5A6IA 1P4LB 3T0DA 1SGKA 3C9NB 3ESNA 2DF3A 2FGWL 4G6ML 4Y5VC 2UWEA 4BH7A 4G1MB 5F7HA 2FLMA 1SHXA 1I8LC 4IIZA 3WU1A 2AMUA 2XJLA 4QRPE 1CIDA 1CFVL 4D9RD 1OTSC 2VC2H 4N8UA 2A74C 3UJTL 4FQHA 4G8AC 1MELA 3GSQA 1ND0A 4AEIL 3KEDA 4AUYA 2FT7A 2XUWA 3UPCA 3GZQA 1YYLL 2F53D 4MZIA 5FM8A 4X7TB 1I1AA 3UOAB 3CK0H 4L1SA 5JOPE 2QKIA 3ZDYF 3OHXB 1JTTA 1MG3C 3TU6A 4I89A 1RZIA 4GAYB 3GS4A 2Y7MA 1NJ9A 2MEJB 4GT7A 3CVCA 4P57B 4ZW5A 1O75A 2HFFA 4TVPL 4PR5B 5CFHA 5CEZD 4S10A 3I9PA 1BJ8A 5D2LA 2FB4H 1A7NL 3E0GA 2AEQH 4AMKH 3HVDA 4CL7A 2P49B 1YLBB 4LZKA 1J05A 1KJ2L 2UVEA 2EEBA 5CILL 4MMYB 2WLNA 3Q01A 1SNRA 1KCBA 2UV3A 3P3RA 3LNDA 4BQBA 3H7BA 4BA8A 3LS5H 3IJYA 4GUPA 3WFEL 4AGQA 1OZTG 2AJZA 5DT1H 2F54E 3OJDB 5DMGD 2YBRB 4I4WA 1IB5A 2WN3A 5IZ7A 4XXDA 5EFIB 2NY2D 1DZBA 1WAAF 3FMGH 3CLEH 4ZYKB 2E6PA 2DM7A 3BAIA 2R4RH 1CXFA 3RTQD 4ISVB 5LKNA 1WZKA 2UZYB 3LDBB 1SRDA 3FTVA 2PCXA 2WQWA 3MFFB 3TJEL 2WXQA 4QRTB 2UUDH 3L3JB 2Y1VA 3MO1A 4F8LA 4KKBC 4O4YH 5JOFB 1FL6A 1T0NB 1C5DA 4UB0H 1QKZH 3KLSA 5DRWB 5H37G 2WJ5A 2CA3A 3FO9A 1EAOA 5CEYB 3ULSB 1AR1B 1XVSA 1QPPA 1LMIA 1SEBA 2LHAA 1N64H 2VLJB 5FOBB 4UT6A 3OHXA 4M5SA 1DE4A 1WDAA 2ROYA 4PY8J 1Z1WA 4JFVA 4OIFA 4IJ3C 3P4LA 2ZXGA 4FG4A 5K39B 4Q58C 2NY6B 5C0IA 3IDMA 4IMLB 4GW4B 4PLJC 4E41E 1ZLWK 1V10A 4I2XB 1TZGL 4LSTL 1G84A 2VMDA 3E1ZA 3TNNA 2OV0A 4PRBB 1GYVA 5F7DA 4MMZB 5EUOB 1OE2A 4G70B 1P84J 2IOOA 4Q9QL 1OAKL 5KYWA 3MZGB 3MOQA 3VD1A 4JJOA 3AUVA 4H0GA 5ANME 1D7FA 3O6KH 3RVWD 1GW0A 2QTEA 1N3NB 3PABB 1QWHA 4R4ND 1CGYA 5EF0A 3UACA 3OJDA 1GL4B 1W16A 4WEMB 3KPSB 2WVTA 4ERSL 3MREB 3ARDC 2VDKB 4PWKA 1MCOL 2QADB 3DTDA 5GRWA 1PDKA 2K4WA 2VM3A 4GBXD 4AM0Q 4Y16A 2A73B 1X6LA 1HEJC 4L9LC 5EF2A 4W9KC 1MCSA 3BH4A 5DVNA 4GP4B 1RMFL 4I85A 4QRTA 2PYED 4GRLB 4U1SB 5I66B 2ICCA 1TJIL 3G9AB 2NYYD 3PLYA 5BMFL 3MN8A 5J7CC 4XMPL 3HIZA 2CJUL 4UQ2B 3WS6A 3MV8A 3QDGB 3KYMB 4AIEA 3W5NA 2LU7A 4YHLL 1NIFA 2PPAA 4P5RA 5MHSE 1KGUA 4M62H 1JV2B 4IOFC 3JUYA 2XQYA 3CJJA 1E4WL 4B97A 4N9GA 1DJXA 2Q7YB 2BNRA 4S1RH 3ZL4H 2X40A 3NYKA 2WGNB 3MOAH 4TMPA 1XXDC 4ZUVA 1GGBL 3S3DB 1TQUA 4GW4A 2GHZA 2JIXD 3FRPB 3VXNB 1HHKA 5AZEL 3WENA 3LKQB 1G7LB 4I2XA 2BRQA 3FN3A 4ZDHB 2IGLA 1IJNA 3F7RA 2YUZA 3B9KC 4WY7H 2NZIA 2NW2A 2R0LH 4JDEB 2YRZA 1OWRM 1JFHA 2PCPB 1JCKA 1RERA 2ZXAA 5I8CA 2XWCA 12E8L 4GW1A 1E28B 4ZMXA 5CCJA 1O7DC 1RZJL 4OJFH 1Q9OB 4GAAA 1KIQB 2H47C 2YPLA 4PJ6A 2K7QA 5BUGA 4OF6A 2WXIA 5FYKE 1BREA 3TESA 2D4DA 4UDTA 3MREA 1I9EA 5DMKA 2H0PA 1EUTA 4Z7VE 2L04A 1D9KB 1AZCA 2BFGA 2A73A 4RDQF 3NAAH 1H3UA 32C2B 4KK5C 5HHPB 3UBFA 1IARB 2CBOA 2GSIA 5I75C 2IBBA 1XZWA 3ARBD 5EZIL 3GSXB 4EI5C 4MWFB 4WO4C 3CFBA 5I66A 5JW5A 2O5XH 4UTBL 5CBEB 3M1BB 4UQ2A 3KPRA 2AKRA 3M07A 2LQRA 3TYFA 1K5NA 4N0RA 3QYMA 3N06B 4LNRB 2N59A 3SN6N 4X9YA 2WXLA 1WUNT 2ZXEB 1H3GA 5HY9B 1FWXA 1OB0A 5LGKA 4UQDA 4JBSA 4OD3L 4W9CC 4P04A 4OZHE 3SE9H 2MPAL 2Y6SD 3OG4B 2JI1A 2VDPB 1P5UB 1FDLH 2EDTA 3JWDH 5T3ZE 1TJXA 3WN6A 4N2FA 4PJ5B 3LKQA 4N5UA 1A7RL 4AEEA 5JIDA 2JKSA 3N1QC 4NQCE 3ECBA 4R97C 3BUDA 5JYMA 5FFLA 4JM2B 3FTXA 2VKXA 5HVGB 2PCPA 4LGRB 3G6JE 3L5HA 2J4WL 2JXMB 1R3KA 4GQ9L 1ACZA 1E28A 1AH1A 1B4JH 1DO6A 2WQSA 1G9EA 4HZLA 4MAUL 1ZHBB 3SKMA 1E5ZA 1KB9J 4G6AC 4JAMB 3CDZB 4PW9A 3HAEA 2NQCA 5C0AD 1U4FA 4G6FD 5IMKB 3K71B 1A2YB 1DQMH 3ZTCC 4XGZB 2NNCA 3CFNA 5E9AA 4ILDA 4X6BA 2EJ1A 5HI4C 2Y5QA 1KB5H 1CF8L 4KV5E 4CMHC 1RK7A 2FK9A 3PNWB 1CLZH 5CJQH 1GYUA 5FFGA 4D3CL 4BFRA 5HHPA 2N1TE 1SN0A 4JPIB 4X99A 2MQCA 3BSZL 4LO9A 3FFCE 4OM0L 4ZAKA 3GSXA 4HFWA 1R24A 5CSGA 3IFLL 3CDYA 4JFDB 5IQMA 2ZKXA 3HA0A 5CBEA 3FUMA 3M1BA 1M6OA 3V0VB 1VEMA 3W5MA 2ESVB 1CICC 2K8QA 2X70B 1HJBC 1A25A 4PS7A 3NDZE 4FHJA 1QSFB 1A5FH 4BWUA 2WYTA 5AZ2H 1K3ZA 3KYOB 3MUZ1 1WFIA 3S3BB 1CFMA 3O2VH 3UZVB 3ZT5A 2HRHA 4P5MA 3K5RA 5DFAA 4FA7B 3JT0A 2ARJQ 3SPVB 2NOYA 4DOHB 1P5UA 5DS8A 3TBWB 3WSQH 2F68X 3K2KA 1ZLVH 4XB7A 1I7RB 4LGPB 4XC3H 1YMME 2EIMB 1CFNA 2C1OA 4Q97A 2VZUA 3BDYH 5DD0L 4Z3FA 5JQ6H 5EIIB 2B14A 2WBXA 5HPMB 4JVWA 5AOIA 4HXBL 1NDTA 1LWRA 1ZCRA 2OXHB 3EIFA 4L1LA 4ALAH 5IBTL 1VLXA 5IMLA 4OBRA 1ES0B 5E51A 3DO4A 5F7LB 5A6LA 3QDJB 4JAMA 4QRPD 3SBQA 3GSRB 4TNWF 3QUHA 1QASA 2J8UB 3TJHC 2DI9A 4EVNA 4OV5B 1LL1A 3D2TA 1CGSH 3BN9C 1KGCE 2C9RA 2EC8A 2VN6A 5JOPD 2XPGB 4HK3J 4S1SL 2A1WH 2NY3C 1WZMA 3EYUL 5DURB 5FO8B 2ZKHH 4QHLA 4M1DL 3GKWL 1BZOA 3F83A 4JPIA 3NN8A 1G6RH 3OBAA 2Z3FA 1KEGH 3U2JA 2KDYA 5HHVL 4LESA 5SWSB 4X9FA 2EDRA 2HH0H 1FIEA 2EECA 3B6SB 4EZKA 4Y4KC 4BK5A 2XY2A 4DPBX 1AIFB 3V5HB 3KYOA 5F7UA 3IGFA 5F1IB 5C0GB 1DQJB 3FQXB 3EOYG 4H40A 2E0PA 5T5FA 2PF6A 3RVUC 1SOSA 4N2LA 4R4BB 2BXZA 3GMPA 2JJSC 4Z5RA 1I85A 2N01B 4D7BA 3IGLA 4TUUA 3TBWA 3AS3A 4P4KA 2E9IA 1HKLH 1KIRB 1ILUA 1X4XA 2XWXA 1P9MA 2CK0L 3QUXB 4XNZC 3VFPB 3ZJAA 5EIIA 5HPMA 2YAMA 1UD5A 5AEAA 2CPCA 2IOMA 2OXHA 4A2GA 5BW7C 3B4NA 2NXZD 3FHEA 5HYSG 4HC1L 3S5YA 3QDJA 3NCMA 4HMCA 5CLTA 3P69A 3NJXA 1FNGA 5T33H 3SQOH 3QFGA 2J8UA 2UUDK 5DJ8A 1DUZB 1AHMA 2PN5A 2OW6A 2G4EA 3ZW3A 3PQYA 2HT3C 2UVFA 2DYPB 2X88A 4PS4L 3SGKC 1UOWA 3BW9B 5KAQG 3D9AL 4KKLC 3BKCL 2NLJB 2V9UA 1A6WL 1ETB1 1Z9OA 4OU3A 3UBXI 4YXHL 1LVEA 3WYRA 43C9A 3QORD 1UHVA 3KYNA 4BKLB 4IDJL 1HE8A 1JJUA 3LPOA 4DGYL 4E41D 3MBEC 1MN4A 4HPOL 3SZ6A 4NQDB 2MCAA 1HZHH 2GG1A 3WKPA 5KSUB 3GMRB 3K2UL 3MJ7B 4RGMC 5B1JC 1QBMH 1LQBC 2QL1A 3VD2A 1K2DA 2DV6A 5DEGA 1AIFA 3RDJA 3V5HA 3VFNA 2RJMA 2P7TB 4QHKI 4JFEE 1ZXQA 3G08A 1IM9A 4PLKC 4JG5A 1ASQA 3C60A 5ICXB 2P8LB 3M1OA 3BN3B 3ISRA 3BD4A 2ZUTA 1ZA6B 5FF6B 5DK3A 5AB0A 3BO8B 2MOVA 2CIIA 1M71B 4BSVB 5JPMB 3K0WA 4PJ7F 4OGXL 4ENEC 3T4YB 4DUVA 3SDAB 3DUSB 3O8XD 3QUXA 4WRLA 2NYKA 3LNGA 1KENH 3TCLB 3RRQA 4OCLC 1P4BH 1X9UA 1JGVH 1YEEL 4X98B 4AW4A 5JIQA 5EN2B 1C5CL 2K9FB 3CFDA 3P0YL 2DJUA 2VJXA 3L7EA 4NFDA 1O9WA 2EH7H 1T2QH 3AQDA 1CL7H 1URIA 4MDRA 2NY5H 4N2IA 3KLQA 3LZLA 3MRNB 3KBFA 3MV7A 2BO0A 2APVA 2DYPA 4K71B 3BW9A 5MHSD 3ZDYE 2J43A 4CSPA 3QRGH 1NMAL 1QA9B 3MRRA 1U93B 5TE6H 4P5TB 4OZGF 2NLJA 1KFGA 2BCKB 4WEUD 1U4EA 4KZDL 3LKOA 3QHTC 2VLLB 3QUYD 5C08A 3S88H 2RH0A 2C9VA 2F0CA 2XWZA 2YC1B 4BKLA 4YE4H 2YGPA 3PHAA 4F7EB 2C5DC 4E68A 1BSIA 4WHCA 1BVZA 1BBDH 1BOYA 4PCKA 3GGWB 5ECGA 2FDBP 1W0WB 4XP4L 5GGRA 2CKBA 3BVXA 3W2DL 2EDYA 4WI9A 3INUL 8CGTA 4P5KA 5F9OL 3W37A 3TS8A 5GSVB 3WEMA 2ZTBA 4JCMA 4PLNC 3DX8B 1BQRA 1VFBB 5IJDC 3NABL 5FYKD 2DMBA 2G2RA 4K23H 1WAAE 3EJUA 4Y0GA 1JVKA 2J44A 4QTFA 1UM6L 5CP7A 4ODUB 3SDAA 3DUSA 1JVOA 3SPGA 3BEVA 4FQIH 4ODSL 1T5WB 3AG4B 1H6EA 3C6SB 1GSKA 2CM5A 2GHWB 1JHTB 1QWNA 2PP9A 3WIAA 2BY2A 1J18A 3B2XA 4HUVA 1JWMB 5EN2A 2EDJA 2R83A 4XPGL 1HWWA 3N1PC 4NUQA 5IEKB 4HWZB 3D25B 1CWVA 1E2ZA 4HIXH 4J8QA 1MCEA 1N67A 1ORQB 3BDBA 2YA1A 1YNTB 1U93A 2ETWA 4P5TA 4M6ML 3SGDH 2BXYA 2EAEA 4FNSA 1SPDA 2BM3A 4N2EA 3KZ8A 3MOBH 2VLLA 2Y2WA 3HUJF 4N2HA 4G11A 4K2UL 1KYOJ 4F2MB 3IFNH 2YC1A 1A1MB 2DQTH 3T0AA 4TSBL 1HHJB 5B1CA 2Q8BL 4A67A 4F7EA 1EBAA 3PYCA 5DHEA 2AJXH 4PGCB 2CBMA 3BPOC 1WISA 2JVUA 3G7TA 4N2MA 4NQCD 5I71B 3DHMA 2FBJH 2XN1A 5DJ2B 3BZFB 2YD0A 5DMGC 3BKJL 1KIUB 5I1HH 1AGDA 4AK2A 4CW1B 4YSDA 3MLZL 4FJYA 4UM9A 1P6WA 4XT1C 4ZOAA 2NY2C 3M88A 2J7LA 5F8QC 4Y19B 3T0EE 1NICA 3UJJL 2DQCL 4YSEA 3JTSA 3RTQC 3ULVL 2WJ7A 2ZUSA 1FFNA 1P1ZA 2Z35B 1BQLH 4TTDD 3T65A 4ODUA 3MXWH 3SKJL 3TT1L 1FBIH 2GSGB 1QVOA 5IHHA 5KVEL 3DOSB 4KQ4H 4U3XA 1Z2KA 2A9CA 3FBQA 1KTJA 4UT6H 3ZXAC 4GS7C 5AOKA 4HLZH 5JW4N 3EH2A 1JF5A 2ENJA 4Q7DA 1JWUA 2WC7A 5D5ME 2I7OA 3VXRE 1ZV2A 4PYGA 3PV7A 3OPZL 1ZJBA 4J28A 1CLVA 2H3NA 4PD4J 4WLCA 3NIDB 4PJ9B 5IHBA 4UYQA 1CYXA 5I6XB 1CK0H 1EGJA 1KPUB 5T3XE 4BH8B 1MCLA 4B3EA 1V7MH 4FQCL 5LCVA 1TU2B 2L4OA 4N86A 1G0DA 1HHJA 3QXVA 3C5SB 5DJ0B 4OI8A 3T4AC 1A6PA 1WICA 2ID5A 5JLZA 1GTNA 1NAMA 3ARSA 1ZLVK 3BZFA 4R4NC 4ZMZA 1ZDQA 3GHEL 4S1DD 5LAXB 2I26N 1KYDA 4M61B 3TH2T 3C5ZB 2WZPA 4EIBA 4YHIA 4GBXC 1MH5B 2APSA 2XBZA 2LVCA 3CIQA 5J9PB 3O4LE 2MQ3A 3D2UB 1L0PA 2A38A 4GAJH 3OKEA 4J27A 2VIRA 4HF5H 4OLWL 2CR3A 1KGCD 2WWKT 1UCBL 2NYYC 4GUQA 4JPWH 2A6DB 3DOSA 3QZLA 2YBGA 3QJFB 3FDWA 3WTWA 3BI9X 3ZX1A 2WQXA 2FWLB 5FV1L 3BSHA 4H1LH 3UTQB 1NDMA 2NUTB 4U1NB 4GSXA 2P44B 4WWOA 1Y6KR 3FUNA 1PTZA 4L4VE 3NA4A 1HE7A 2OYMA 3GMNA 5TDOB 1AS8A 3IJEB 4U6TA 4DP1X 2E9JA 4QXUL 4RISL 3WFBL 4PJ8A 3MBWB 4KHXH 3UTSB 4ZUTA 4LSRL 2DKSA 1M2OA 1JD7A 5KOVC 2X9WA 1EXHA 1CE1H 3EHBB 4AKPA 2DM3A 1C5BH 4JKPL 3GSNB 4N26A 2FYYA 1G9MH 1JXGA 1TU2A 2BY0A 4WK2B 1A4AA 4Q0XH 4HUMB 3WS3A 1UQSB 4B5EA 2G4GA 3VTMA 1LO2H 5FLVA 2XWDA 5DJ0A 5I8EA 5EU7C 2H41A 1F3JB 3QI9A 5E9DE 4H26B 4NQXA 3V5DB 5KYUA 5LHDA 4U6YB 4WI8A 4NENB 4HKBB 5IMKA 3KL0A 2VLRB 4FYRA 4F3FB 2D8KA 5K9KB 5LG6A 5LAXA 1PIFA 1NOLA 3T0WA 2FLBT 2GKIA 4FQXD 5IKCB 1KFAL 3HJ0A 1MH5A 2DIBA 2ZD0A 5I8OL 4ZUUB 4N25A 4EDWH 2QVMA 2V5TA 5JXEA 2VAAA 3HZVB 3L3IB 4A39A 4NZUL 1Q0XL 4W9FC 5C7XH 2WLIB 3SBPA 2V2WA 3QWNA 3W81A 1JMXA 3BP5B 1KTKE 3ARBC 4J4PA 5IM7A 4Y4HB 2VR3A 3FOLB 4JR9L 1HJCA 4OSUL 1OT2A 2CWRA 3CCHB 1NGQH 1NIAA 5AKSA 4H8UA 3UTQA 2WV3A 3DARA 3LPGA 3JTBA 1MFBL 4ELDA 4FXGC 3L3DA 4EAEA 3PFQA 4NHCL 3E1F1 1RCYA 3HB3B 25C8L 3UAJD 4ZMNA 4EXPX 1E4XL 3L45A 1GHFH 2Y6SC 3FF7A 1Z5LA 2ICEA 3W9EB 4C58B 2DIJA 2ZKWA 4JDVA 4WUKH 2R1YA 3VRJB 1NGZA 4JFED 4AIZB 3BYYA 1LO4L 4NN6C 1SJHB 5SX4H 4YDZA 4F57L 3FTZA 1N9PA 4NRZA 3GMMB 2UWEF 4UIMB 4YEFA 2VN7A 3AMKA 4KNQA 1XEUA 5DHVA 3QR0A 1F3JA 3HAEH 4PJFE 4X7EC 5HDWA 4L3EB 4FHKA 4BSWB 1ZE3C 5TDNB 1FO0B 1AD9B 2FHFA 2VLRA 3HC4H 5TF1H 5I82A 4ZTPL 1L3WA 2CQVA 6FABL 1YNLH 2Q86A 5DHDA 3CLFL 1K6QH 3BEWA 4BEIA 1E90A 4ZW7A 1N0XH 2UZXA 5FO9A 3VFGL 4M3KB 3I84A 4O58H 5I74B 3L8QA 1JPGA 1VENA 4C56D 2E74C 5IBLD 3PCYA 1ZGLB 2VXVH 4ONGH 2CLZA 3L08A 5D2LF 5I1AB 1OALA 3RU8L 1KTLA 4H88H 2WKGA 4WK4B 2ZCLH 4X5WB 3CMOL 2GSMB 1TJGH 1XFPA 35C8H 4LLAA 5CHNB 3FOLA 1Z0NA 2ARJB 3W38A 5E6YA 1X3DA 2CLVA 5L0QC 2CO6B 3B2MA 4IK7A 2PP8A 2EP6A 3L1OL 3PWPA 3RA7L 3MRDA 2ZZUT 5AYUL 4HIQA 4JRYB 4U7MA 3S5LB 1GCYA 4FXKB 1L6XA 3UEQA 1T7VA 2GK0A 1RIUH 5AW4B 2R4SH 1TVDA 4DP0X 4RETB 1T5XA 1BMGA 1U9KA 4ZI8A 3CSYA 4IOSD 2IALB 4N90D 1TFPA 3TV8A 1KCRH 3VRJA 3CVIL 3F7KA 4K8RD 2X4PA 4UDUA 4XZUA 4MJIB 5DC0A 3ARVA 3GMMA 3MKGA 5DO8A 2F1AA 1X5XA 2XXFA 4NKMB 5FGBC 2AQNA 2AEOA 3VX1A 3HI1A 4Y2OB 4KOBA 5CJOL 2HJKA 5BQ7B 1QPXA 3MNVA 2XZCH 5DZOA 1XGYH 1IGFH 5JHMA 4DF9A 5D72H 4M4RA 3ZGHA 4YSRA 1PNCA 2ODIA 1A6TA 1SJVA 5T1LB 3GXFA 4RSYA 4F37F 1ADQL 4Q8BA 5AOLA 4EN3D 2OMYB 4OGZA 2Y1ZA 2G2PA 4G80B 1WF5A 3FFDB 4D8PA 3MLVL 2XQBH 3L4TA 3NIFB 5DA4A 3H56A 1BBJA 4PRIA 4UM8B 5EWIL 2JB5L 3UAAA 5EDXA 1KBBA 1V27A 3S96B 2ZCZA 4KKQA 2X4QB 3MLUH 5E1HB 5SWZA 1QFWH 2ZOOA 4CSSA 1R3JB 5B8CC 3NQKA 1EXUB 3OKDB 3C5JA 2HKAA 3OX8A 4DKAA 5F0PB 2AK1H 3MRLB 4FQ1H 5T5FH 4AJ0A 5IMOA 4HPYL 3WUWB 2YUVA 4MMXA 4QRQA 4RWYH 2AERT 2CGRH 4Z7OB 4D9QE 4LQFL 1KLFB 4NC0B 4JRYA 1T1WB 3S5LA 4KTDH 2OP4L 1MHEB 2ED7A 4A7GF 5JDSB 1I3GL 2WP3O 2IPTL 3LQZB 2BNQB 4AGPA 1ETZB 1W72A 3DRQA 1JNLH 4NUGL 5GS1C 1T4KB 2R39A 1B9KA 4E9XA 1INEL 1GOGA 1SF5A 3GXTA 3MRCA 5B3JE 3T0ED 1PAMA 4NKMA 4QY8A 4TVPE 4DVBA 4PJ7E 3NFPA 1W0YT 3EO0B 1BPLB 4XO3A 5D1ZB 4OCXL 4Q2ZA 2NXZC 4WHYH 2QZQA 4AV4A 4FFYL 4JFXB 2WYZA 1Q0EA 1G4RA 3U9WA 4NPKA 3PWNA 4HPHA 4YDNA 5EV7A 1A3LH 2VO8A 2VDML 1KGWA 3RZCA 3QNYB 2V7NA 5GRUL 2E46A 2DMHA 1L7TH 4FTDA 5ESVB 1JGLL 3WEXA 3VXRD 1A6UH 4FNQA 4FRWA 3N0PB 4F33B 1NAKH 4DJMA 2FX8H 2VL5A 3PJSA 3O9WB 4KAQL 3RE0A 3ZOAA 5E94B 1GY1A 3LV3B 4XP6H 3NCJH 3EO1A 3QORC 1D3CA 5JQHC 4OZGE 4Y5XC 1C12B 1GPOL 1TT6A 1N10A 2WXJA 5T3XD 5CR1A 4HIHA 3RLSA 1TTUA 5CIPB 5BXFA 2JJWA 1JDAA 1EXUA 3GSVA 3T77A 4APXB 1B4LA 2E4FA 4LCCC 3E8UL 1ZT7A 1G7JA 5CJ8A 2EINB 5AD0A 3EFOB 2H2PD 3O11B 4IW4C 4ZQKA 1KLFA 1XSKA 3D51A 4M00A 3WY4A 1E9PA 3V4UL 1C1EL 5DTFA 4ZFQA 1VAHA 4WU5A 2ORBH 2NW3A 5FGCE 4ABUA 3TF7C 1X9RA 4LKCB 1A6VH 3OAZH 4OJAA 2BHFA 2BVOB 4NQQA 5GRXG 5DCCA 2E9WA 3AC0A 3O8XC 4HIPA 5F6IC 3KL3A 4K94H 4Z3HA 3A3YB 4DESA 1MKFA 1HAWA 1RUKL 4ICXA 5JUEH 3O4LD 2BDNL 2Z4QA 3ZT6A 5JHLL 1FN4A 1GS8A 3JYCA 5CJXC 2I27N 2DWSA 4IM8A 5GRJH 4CC0A 2F08A 4KUZH 2R56L 3TWCH 3V0FA 5IFJA 2XV3A 2ZAGA 3O3AB 4K9EL 3HR5B 3BJ91 4HXAL 4R4FH 1G9MC 1IGJA 2PW2B 3FCUB 3FSZA 3QNYA 4ZNCD 4TSAL 2XQYK 1QI5A 2VDOB 1JWSB 2FGZA 3FBKA 4FQQA 4L4VD 5KBKA 3O9WA 3QUYC 4UT9L 4X83A 5E8OB 3ULVF 3I9GL 5GRVK 4XMLH 1IVTA 4U1KB 4K0OA 2C9QA 4KXBA 2YK1H 1WBXB 3HUJE 5L2KB 2BRRH 2A5UA 2CKBH 3BZEB 1YJDC 4HWBA 2COQA 1I7ZA 3FCTA 2DBJA 4GP5B 5AALA 3T04D 1MCPH 2BLFA 5LO7A 2H9GA 3QG6B 1KIPA 4JGMA 1M4KA 2J20A 4ZFFA 4FS0A 3NJIA 4PJIB 4G8IA 5E9DD 2HMIC 4NQEE 4WFGD 4F93B 4X5XA 1BIHA 1OY3B 1CS6A 2R2BA 1D6EB 4LKCA 3DUHA 3ORJA 2MJWA 2VH5H 5JW4R 4KITB 3CVHA 3LZQA 4I88A 3RNQB 4RGOL 2BMKA 2D31B 1UUNA 4WUUB 1EZVY 4C83B 1HKFA 3V0JA 3SDCB 2W0KA 2EACA 2P5EB 1TITA 4ODTL 3IDGA 1N5YH 3CDGB 4AV0A 1IL1B 3FQRB 4N2DA 3QHZL 3SBRA 4WI6A 5TTRA 3PHSA 3UTPE 1UFUA 2HFEB 5HGGS 4P9HH 3HR5A 2A83B 5DJCA 3T1FA 1Z66A 5I19L 4YC2C 3GMQB 2R51A 3T2NL 4FTVE 4PB9H 3HBZA 3OAUL 1F11A 4N2CA 5GISH 5JW3L 1M1SA 3LRLA 3UTTE 3U9UB 5L6YH 4LRIA 1JWSA 6TAAA 2A9ML 3IPEA 4L4TA 4PJHB 5C09E 1H5BB 3WNPA 4JVUA 5EA0L 3TH4T 4JM2F 1U91A 1WBXA 2R1XA 4LASL 4Z95H 5KVDL 5L2KA 3IVKA 1MQKL 3QPXH 3EGSB 2EH8H 1GIGH 3FAXA 5DRNB 1E6JH 2D7TL 2PO6A 5BS0B 5KUKA 3DX6B 2OMNA 2J2ZB 1J1OH 1OAXL 2JKLA 3PREA 1KCWA 1OZUA 1M7IB 3IMSA 4IU3B 3N0AA 1FORH 1NCDL 2IH1A 4PJIA 4HJGA 3Q1EA 2J8HA 1AD0B 2IGFL 1SF3A 1WG3A 3HOGA 3PPSA 4MBRA 1KTCA 2RALA 5D7JB 9PCYA 5C0BE 4XZ4A 1JZJA 3GSNL 2KC0A 3H9SA 3QQXA 4YHKL 2ZNWA 4B9JA 1P7QB 4JVPA 3BAWA 4TTDC 1WBYB 2Y5TB 2D31A 4ZPTB 3VVVA 4X9BA 2FTAA 3EDEA 3D1MC 4NRXB 1KWKA 1E5YA 3SDCA 2FQDA 4YR6B 4YDJB 3ZDZB 5CD3A 1GZHC 3KG5A 3FUDA 2AJSH 4KZ0A 4AWJC 2D9CA 2Z1KA 3RIFK 1IL1A 3FQRA 3F6JA 5KZCB 4ICWA 1KMGA 1EGJH 5C92A 4K7FB 1QRNB 1ZTMA 3UPRA 4KMTH 4E9YA 4Z0BH 3HG1B 1JTOA 2P48B 4JHAH 5ILTL 1JHLH 3BPNC 4IYKA 2V9QA 1XF5B 4A37A 2Q3XA 3C87A 4G8EA 5HGDA 1U8JA 2Z1PA 4KUCF 1ZWIB 1IUZA 3L7FB 1RZ7H 1UB6A 4GSDH 2N1KA 1S78D 1NAMH 4JG0H 5F9WB 1QLEH 3IFPB 4OGYH 4NQSA 3VDCA 2DQUH 2X4SA 3CG8A 4UQBA 2F5AL 4HLZG 1RLBA 1RQ5A 3QIWA 3SKOA 4S1DC 2LT9A 1B9ZA 2IDFA 4IU3A 4ZMWA 4LK4A 2LFGA 3R06A 3I75B 3V9FA 1JNNH 3R4RA 2J8UF 3BFOA 4P9ML 4YSTA 5DQDH 1J8HA 3K6FA 1NBVL 5D7JA 3RWHA 3WXWL 3VI4A 1T21B 4AVIA 1EJ6A 4NT6A 2EEXA 3IETA 5F21B 1V3LA 4K3JL 3DV6A 3IDUA 3LN5A 3BH9A 2A6KA 4PRNA 2FE0A 4Q74A 1U8QA 3LSOB 3SODB 3U2SB 5F97E 1WBYA 3IE9A 4ZPTA 4K5OA 3BP6A 1CD9B 3GC3A 5J3HD 4J3TA 1S7VB 2AABL 3B7SA 3AROA 3BSZA 4YDJA 5F8RC 2LU5A 4YR6A 2I85A 1BVOA 4Q6IC 8PAZA 3D50A 4UILL 2V4LA 1FO0L 5EPMB 2NSMA 1G9NH 3MJ9A 2O5YL 2OZ4A 2EVFA 2XHNA 4PRHA 4L8CA 5J5EA 4XNUH 1UWYA 4NDMB 4AQ8C 1MXGA 1FG2A 3RB7A 4F20A 4ONHB 3HZKB 5IF0A 4M43L 1IKFH 2Z31B 3DMMD 1MI5E 5I73B 4OJYA 3LXCA 2F74B 4PM1A 4HK0A 3DI3B 4YVUA 2FECI 2NSXA 1MY7A 3KYKL 3WO4B 2ZWNA 3PWJB 3ZDXB 2C26A 3INOA 1MJ8L 1MVUB 2PKDA 3V52L 4MZ3A 1FP5A 3UC0L 3CPLB 4HIIB 4NZTL 5G5DB 3BIBX 4UAHA 3LD8B 5IR1A 4QT5B 2UWEE 2B2XH 4ZFOB 2GVYA 1H8OA 2YSSB 2M1KA 3DUUB 3U36B 2G3ZA 4G42A 4H1LG 1ACCA 4TVPD 4MA3B 3VXPB 3WTVA 3NJKA 1O0VA 2D73A 1IRAY 1HL8A 4DCQB 3HNTL 4HOXA 5BNXD 1KTDA 4XOCA 4XPHL 2HB0A 1MVFA 3P1VA 1RUAL 3IDYC 3GIZH 3KPNA 4MNGA 4QEGA 4FL4B 1R3HA 1XMWA 1AGCA 4LLMA 3RZWA 4ZZKA 3G5VB 2A0LD 1U8HB 1A7PH 3T6WA 1PZ5B 5ISZA 5JIKA 1M9WA 3O6FB 3PL6D 1FNEB 1UXSB 4XN9A