4HAKA

Multicopper oxidase cueo mutant e506a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
489
structure length
476
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHADTGMMLGFTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506A
rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 137
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA03
2WO2B 2HRGA 1WAEA 3V9CA 2EILB 1URIA 2UXTA 5I6PA 1KBWA 1FFTB 3NJLA 3ZX1A 1ZIBA 1GS7A 1V54B 4PAZA 1MZYA 2PCFA 1XB8A 4HALA 1AIZA 2IDQA 4BK5C 1ZDSA 2YAHA 3PAZA 3V9EA 1PNDA 4QKTA 1SNRA 7PAZA 3NJGA 5PAZA 5IY5B 1BXUA 4N4YB 1SFHA 2XX0A 1OF0A 3FU9A 4DP9X 5B7MA 2LLNA 2PP8A 5B1JA 3H4HA 1CUOA 2FQGA 2XUWA 1AS7A 2JFCA 3TBBA 1ZIAA 3AG3B 1BYPA 3FYIB 2GB2A 1ET5A 2JKWA 2I85A 1GR7A 5E9NA 1AZCA 1KV7A 4UANA 4KOCA 4E9XA 5AZUA 3OMAB 5ANHA 1NWOA 4F7KA 3RYMA 2ZWNA 3NJMA 1M57B 2X87A 4YSEA 6PAZA 4P5RA 4DP2X 1PNCA 1J9TA 2ZOOA 4UF7C 2QPDB 3S3BB 5I5IA 1W8EA 1ZDQA 2IH9A 3X1FA 2J5WA 8PAZA 5EHFA 1WA2X 1F56A 2N0MA 4G70B 3PAVA 3CDZA 1DYZA 2HX7A 1KGYE 4BWTA 2UX7A 3IBOA 2GC4C 1AZBA 4AKOA 4A2HA 3NJFA 3PXLA 1JZJA 7PCYA 1PCSA 2H3XC 3WKPA 4RH4A 5D4HA 3KW8A 1AZRA 3ZBMA 2PP9A 3FQYA 2XLLA 1NZRA 4DPBX 3EHBB 2IWEA 2GHZA 2XX1A 1J9SA 3FU7A 4E9QA 3WNJA 1TKWA 1RZPA 2EIJB 3CG8A 3OD3A 3H4FA 1W6WA 2H5UA 3DKHA 1E30A 2DYRB 3AW5A 2W8CA 3ASNB 5AFAA 1JVOA 4DP5X 3QQXA 2YQBA 2PLTA 4N8UA 4DP4X 1IBZA 3NYKA 1BXAA 4HCFA 2R7EA 2PPFA 5I26A 2VSMB 1KDIA 2FT8A 4HHWA 1NINA 2DYSB 3MBWB 4KNTA 2YAEA 1RKRA 3ERXA 6PCYA 4YSAA 3JT2A 2HXAA 1JVLA 1GYCA 1A65A 1NTDA 2HX8A 4E9WA 2XV3A 2W88A 4BWWA 4CSPA 3NP3A 1JZEA 2YAQA 3X1BA 3X1GA 1DZ0A 1CURA 2DY2A 3SBQA 2IDFA 4G72B 2HLEB 3NSDA 4L0PB 1BAWA 4YL4A 1CC3A 5B1AB 3FU8A 5F7BA 4HHGA 1AZNA 1ET8A 3QJQB 2B08A 1SHWA 2XYBA 2AZAA 4G71B 3MX0B 1SJMA 3IE9A 4HCGA 1PF3A 2BW5A 4YSPA 1SDDA 3CZUB 2YAPA 3EH4B 5A7EA 4A2EA 4M4RB 4DPAX 1OE1A 4JHVA 3UAEA 3WIAA 1XB6A 1BYOA 4BXVA 2CUAA 3IN0A 1V55B 2PPAA 5B1BB 4DP8X 1CYWA 2BZCA 3NJHA 1ILSA 5B7FA 2I7SA 1R1CA 5D4IA 4BDVA 4NAJA 3UABA 3ASOB 3GDCA 2PP7A 1AS8A 3TBCA 1GS6X 3FPYA 4K9JA 4KNSA 3AY2A 1JXFA 1GS8A 4ZK8A 3UGEA 3L45A 2QDVA 2GBAA 2FT7A 1A4AA 1E5YA 2BP0A 4Q8BA 3G5WA 4YVNA 4EF3A 3GXUB 1NIDA 2BHFA 1L9TA 2EIKB 1SF5A 2UX6A 1ID2A 3OM3B 4AX3A 2UXGA 2YARA 2AFNA 2ZONA 1ZV2A 2XV0A 2TSAA 3C75A 3QJUB 1YLBB 2VM4A 1OOWA 1AANA 2DWTA 3WI9A 2AZUA 2OV0A 9PCYA 2E86A 4JHUA 3T6WA 3ABGA 1MZZA 1MG3C 2OCCB 1ZPUA 2VM3A 4WTQA 1SF3A 3X1EA 4Q89A 3UADA 2DWSA 3NSCA 5I6LA 1SHXA 1HAWA 1AR1B 1MDAA 3FYEB 1A8ZA 4GY4A 3DTUB 2QDWA 3QJSB 1J5DA 5TK2A 1TEFA 2PPCA 3FQ1A 4DP1X 2FT6A 4FA7B 3X1NA 1AS6A 4QLWA 1NICA 2YAMA 2FQEA 3FSVA 1PMYA 1E65A 4F2FA 2H47C 2GI0A 3GYRA 3TA4D 2FTAA 3NSYA 3TU6A 1ET7A 2BWIA 2Y1AA 2P80A 5AKRA 3FPXA 1EZLA 1PLBA 4A2DA 1PZAA 4AKQA 1JOIA 1V10A 2PPDA 2EIMB 2Q9OA 1QHQA 2BP8A 4KO6A 3PPSA 1AACA 2XXGA 4A67A 3ABLB 3CDZB 4KNUA 3TASA 4DP7X 1AAJA 1T5KA 4YSDA 2VW4A 2CBPA 1HAUA 1BEXA 2JXMA 1JXDA 5B1KA 1OCRB 1PLAA 2OJ1A 4GXFA 5I28A 3N55A 4BWUA 2MTAA 2GIMA 2X88A 3IN2A 4YSRA 3QJRB 2WSDA 2YXWA 5LDUA 2EINB 2FWLB 2IDSA 3FU7B 3WNIA 1NIAA 3NP4A 2YAOA 1NDTA 3U25A 3HB3B 4DP6X 1AOZA 4FAAB 1NIBA 3T9WA 4E9TA 3CVBA 1L9PA 1PZCA 2AVFA 4HAKA 3SQRA 1A4CA 4G7RB 5B3SB 3FT0A 3AG1B 1J5CA 1OCZB 2XVBA 3SBRA 1XB3A 2R7EB 1GY1A 2VW7A 3AG4B 5F7AA 1IUZA 1ASOA 2RACA 1I53A 3IEAA 1HFUA 4KO5A 3NJIA 1JXGA 3S3DB 3FSZA 4GP5B 1BQRA 5D4JA 2I7OA 1WA0X 1E67A 1UATA 4HZ1A 1JERA 1PAZA 4HIPA 3NJNA 2IDUA 3EH5B 4GYBA 1NIEA 3NT0A 2HZHA 3PAUA 1BXVA 2PCYA 3T6VA 1MG2C 2XV2A 2GSMB 3KW7A 1NPNA 3QPKA 3T6ZA 2VN3A 1WS8A 4TXVB 4GP8B 4M3HA 3SBPA 2IH8A 5B7EA 5I6OA 4G7SB 1SDDB 3JTBA 5I6MA 2HRHA 2J57A 1AQ8A 3NJKA 2BO0A 3T71A 3WKQA 1TEGA 5I5MA 1ASQA 2FNWA 1FWXA 4F2EA 3BVDB 1OCOB 1PZBA 2PPEA 1OE3A 1X9RA 4JKNA 1ILUA 1L9QA 3H56A 4BDVB 3ZIYA 3FS9A 3NJJA 3ZDWA 3FQ2A 4YSCA 1ADWA 1VLXA 1GW0A 4YVUA 1FA4A 3AZUA 5PCYA 2XXFA 2FQDA 2YXVA 3FSAA 1L9SA 1N70A 3OMIB 1B3IA 2VW6A 4KO7A 2A3TA 1GSKA 4A68A 1KCWA 2NRDA 4W1TA 4HCIA 4AI7A 2BP0B 4UAHA 2HX9A 2BZ7A 1M56B 1PY0A 4YSTA 3AG2B 5FC9A 1L9RA 3FSWA 2Y69B 3QJVB 5B1JC 5I5JA 1NPJA 3EF4A 3UACA 1RCYA 4KOBA 1BQKA 1KDJA 2XWZA 1W6LA 1EHKB 1IBYA 1AZUA 2J55A 4PCYA 4E9SA 2YAFA 4DP0X 4ENZA 1SFDA 1N68A 1ETJA 1J9RA 1J9QA 1XMEB 1NIFA 4G7QB 2CALA 4MFHA 2TSBA 4E9RA 3CVDA 1PLCA 3S8FB 1KYAA 4P5SA 4AKPA 1IC0A 5I6KA 4GP4B 2J56A 4YSUA 3PCYA 2QT6A 2UXVA 4E9YA 4YSQA 1JZHA 2GC7C 1KBVA 2MRYA 3S8GB 4W9ZA 2CAKA 3QJTB 1OV8A 3X2QB 1RZQA 3ABMB 1CYXA 1TU2A 3HEIB 2P80D 1E5ZA 3T6XA 1GY2A 2Q5BA 1A3ZA 5I6NA 2IWKA 1JZFA 1AG6A 1JZGA 2VSKB 3ABKB 2BWDA 1WA1X 1QLEB 3CVCA 2IWFA 4DPCX 2XU9A 2IAAC 2UXFA 3N2JA 4E9VA 2DV6A 4KO9A 4NERA 1NWPA 2BP8B 1BQ5A 2WO3B 2CJ3A 3UAAA 3PLYA 4YSSA 2B3IA 2BW4A 2FJSA 3D12B 2CCWA 3S3CB 4YSOA 2AANA 2IDTA 1OCCB 1M9WA 4WKXA 1L9OA 4NB7A 5TK4A 1X9UA 4A66A 4CSZA 3BQVA 2VMJA 1WS7A 3OQRA 3DIVA 2FQFA 4X4KA 1IKOP 1KCBA 3NSFA 3WG7B 4A2FA 2ZXWB 3OMNB 1OE2A 4AZUA 1QNIA 1ASPA 1AG0A 2QPEB 1A4BA 3EH3B 4A2GA 1JZIA 4BXSV
chains in the Genus database with same CATH superfamily
2ZIDA 1LK3L 2DICA 3LOWA 4C47A 2XZAL 2YBRA 3QR2A 4FKKA 3TBWA 4ZUWA 1BLIA 1AGCA 2HFFB 5D1QD 1I31A 5I6PA 5F7HA 2G60H 1IKNA 4UUJA 2BSRA 1ZIBA 4P5TC 5ILTH 2FJUB 5D70L 3OF6D 3QWOA 2K6YA 1RZ8A 2VQ1A 5E5RB 2C9RA 2PYEE 3VD5A 1S3RA 1HE7A 2R0KH 5MENA 5T5NG 4DVRL 1CVSC 1MFBH 3E8UL 4P3WA 5GGTL 1BWMA 1WYJA 3TN0B 5KJRL 1F3JA 3UROR 1F4AA 1PSKL 3BZFB 1C12B 3CHXA 4UBDD 1J5OL 3UTOA 1P6AB 2FD6H 2JIXA 4WV1B 4L9DA 5DJ2A 3QDJB 1YUKB 1CE1L 3KEHA 4AUJA 4B9KC 3V52L 1MCQA 3N41F 2XRAH 2FB4H 4JDEB 2AJSL 4WWKB 3CZSA 7FABL 5KSAB 3K6FA 4BINA 5EC2A 2ZXGA 5DHEA 1FHGA 1RLBA 3D87B 5AZUA 4PJHB 3BKJL 2OK0L 4XVTH 1MCCA 3EYFB 4L4TB 3S34H 5IR1A 2ZSWB 1LO0H 2UZYA 4AYFA 2YS4A 5ICZA 4LCCA 1NFIA 4Z7OE 2HG5A 2ZCHH 4UF7C 3S3BB 4LDCA 3GXTA 1W8EA 1ZDQA 2VXQA 3T3ME 3OKDA 4B7IA 2Z8VC 5GGVH 8PAZA 1A2YB 4GRLC 3TJEL 3QS3A 3PXJA 4FHJA 4OLZH 1TJGH 1SYSB 1BVKB 2KPNA 5LKNA 1T5XA 4HFUH 2RA1A 1PYWA 2NY5H 4BE5A 1QFOA 1AZZC 4NO2A 3WE6A 1HJCA 3PWVB 3GI9L 5E1AB 3I9AA 3T4AC 1TVHB 3QIWB 1JZJA 1SOSA 2NY2B 3PL6C 2KT6A 4PTUA 4ZFOB 3HI5L 1F1GA 2Y7QB 3QUGA 1A14H 3CX2A 3VXMD 3WIIL 4Y88A 3ZBMA 4AM0A 3GBMH 3SKOB 3VXSD 2EYTA 2ZT9C 2Z93A 3I02A 4N85A 4HUWA 3UPRB 3K6IA 3O4LA 2DM4A 1CDCA 1N12A 1YPZB 4TVSa 2QPFA 3BN9C 1JFHA 2A6DA 4PRHB 1LVEA 1UKSA 4P9ML 1SVCP 4FNRA 4EUPB 5FB8A 3CC5B 3NJVA 5KN5B 2XQYA 4JKMA 4P0DA 1OPOA 5E2TL 4H1LB 2YPLD 3L1EA 3VXME 5I1HL 3U1SH 4M62H 1QFHA 3FQTA 3LH8A 4WTWA 1WFNA 3ERXA 5TDOB 4DW2L 3E9TA 3VXSE 5D7KD 5DJYB 5EZIH 3RB5A 1HILA 3AABA 3FQWA 3LHPL 4HWBL 1NTDA 3IAQA 1LO4L 3S36X 3VQ2C 5FV2A 5KYUA 4AYSA 4XNAA 3RZCA 4OIAA 4HHAA 2G0KA 4Q9RL 2BOBB 1L0YA 2WUCL 4NNYB 1MRDH 2P5EB 2FHCA 4XP1L 2X70A 2ZCKH 4YEFA 3CFIC 4G72B 5EN2B 2Y24A 1OCWH 1UA6H 3WDHA 2YPLE 3RJQB 3FU8A 3HE7D 5E5MA 5K9KB 1IBBA 3BP4A 3KLDA 1QX1A 3D33A 5D55A 5D7KE 1CYGA 2R9HD 3BXNA 3C6LB 2G3NA 5C0ND 5FO9A 3SD2A 4H5SB 4QWWD 3WAKA 1RIUL 1ZVYA 3RU8H 5FO2A 4MJHA 4HSAC 1JGLH 1OPGL 4G9FA 3IN0A 3M46A 3EJZD 1OK0A 4NHUB 4JZOA 5I66A 1D5MB 3IDYB 3FT9A 3FBKA 4KUCF 3Q3GA 4ELMB 3S3PA 3ASOB 1AS8A 2VNCA 1ZAGA 3NDZE 1NFKA 5DUBA 2F68X 2BNQD 1BVOA 2ENJA 1MIMH 2DJMA 2OI9B 2VGLM 3AY2A 4GINA 4JLRA 4FADA 5IMOB 2VN4A 1A1OA 4FP8H 3QQ9D 3D4GA 2WCSA 4PJEA 5E99H 1VFBA 3HAEH 2R2HA 1MCPH 5IHWA 2A4CA 3MODL 4Z7QF 3MNZB 3P0VH 1VSCA 2A73A 1PIFA 1Q0YL 3DDFA 4OLEA 2MCMA 1BQHG 3VRIB 3NCBB 3OM3B 1BV8A 3QIBC 3TT3H 4F9PA 1N0LA 1N19A 2XOTA 3VG0L 4RDBA 2VIRB 3TFKC 2D0GA 3KGRA 4IKLA 4BQ9A 2BNQE 2Y6SC 1DLHB 5JHDD 3B2UC 1LMIA 1MVUA 3WI9A 4EN2A 4J3OD 2OV0A 3T65B 4UAOB 2H32B 1DSWA 2FIRT 3D39A 5IB3B 1GTFA 3FF7A 2CG9X 3TVMC 4DQOL 1DSFH 5IVXB 1OM3H 4JK0D 1SF3A 1OM9A 1P4LA 3FZUC 4Q89A 5GGRA 3GXDA 3MYZA 2AXJA 2RCSH 4MJ6A 4RMTA 4ACTA 4X8CA 2A6KB 1ZLVH 5AAMA 5D1XD 4ZUVB 3B2XA 4FQXD 4UINL 4X5XB 2PPCA 4F37F 1HKLL 1HIMH 4H25A 2QBWA 1TQVA 5JHDE 3UTZB 1DJZA 4HKBB 1AS6A 1XH2A 2XPYA 5EBWB 2R1WB 3P9LA 1EUTA 2FQEA 3QUZB 1JK9A 3QFGA 4NKIL 1DQQA 4K9EL 4N2AA 1AGFA 1G4RA 2DQEH 1QWUA 5F9WB 2RFXB 2Y7SA 3G6JB 5TE6H 5I18H 3T1FB 4YFDB 5B39G 4POYA 4JN2A 2O26U 4P2OC 4H8QA 3WIFA 2IBGA 1G6VK 4LVHB 4XC1H 4I5BA 4NQDA 5AAWA 4LPXA 4PLKC 4E9LA 4G80A 5D1XE 3L95B 3S4SB 4AKQA 4M7LT 4X9IA 3WNPA 1NEUA 2HN7B 3QO0A 5DQ9B 3MC0A 4KO6A 4XVJH 5ICXA 1AACA 4CMHB 2NTSP 2HVBA 1HU8A 3ATDA 1IGYB 3QC5X 5EOCH 2XFXA 3E9UA 1NCCL 3OC5A 4NT6B 3WU1A 4HZAA 4KXCA 1GC1L 4TOYL 4Z7VE 2V7HA 5B1KA 4APXA 4FQIL 3TL5A 3WS3A 3IBEA 3M45A 3FRPB 4LDEB 1DTUA 4KK5D 4W9KC 3SYOA 5JHMA 1WZ1L 5T3XE 2X88A 2E27H 3IN2A 1VZHA 5L9DL 3GIZL 2GFBB 5E9DA 2JJWA 2HA1A 5CGYC 1DBKH 2FL5B 1LXMA 4DO6A 4LEXH 1JZ7A 8FABB 2VR3A 1EHLL 1FG9C 1ZLSH 3TESA 5IQLA 3HFMH 4L8SA 4DZ8B 1WT5C 2ZNXA 3WNOA 3NOIA 5DVLA 4TUJB 3HUJA 1AQKL 1U42A 3EH1A 3HFFA 2OMXB 1YECH 4Q4EA 3GS4A 4WHTB 3PP4L 3SDAD 4IK7A 1RU9H 4UU9B 5DQDL 5CAYB 4YH6A 2X9WA 1C5CH 3ULUH 4NC0B 2OL3A 3B7RL 4GP5B 1WWAX 2VR4A 2ADYA 3MYJA 1IL1A 1ZRUA 3I2CH 5EIIG 1HDMB 2IDUA 2X42A 4ZO9A 2LFEA 2UZIH 1BXVA 4J8RA 4B5ZA 1HSBA 4HEMA 5DT1L 3QULA 1MY7A 1KIUA 2CGZA 5G5DB 3GINA 4KKZA 3UJIL 3UZVA 4AMWA 1IC4L 3MRCA 4WFGD 1T1YA 3MUGB 4N2DA 2YD9A 4WW2C 3P3RA 1S7XA 3TONA 2QQLH 3FTYA 4POUB 1S9WA 3V0FA 4ZXBA 4AQOA 1XCWA 3FUHA 3NJKA 3PQYA 1DHKA 2C7UA 4LVOC 4GBXB 5CP7A 5KOVC 4R5TA 3T0WA 2V17H 4HMCA 5AW2B 3HC4L 5L0QC 1Y1UA 3FCTA 2AW2A 5DSCA 5GRUL 2IH3A 3GSNA 5F7NC 1QUPA 4QY8B 4F58L 3LIZL 3BUBA 4LMQE 4WFGE 5I2IB 1K2DB 2ROXA 3AQZA 1SXZA 2CKNA 3O6MH 1JCVA 3EOBA 4FLHA 4YHPA 3W5MA 1NGQL 1P7QB 3NZ8A 3R7QA 2ICWJ 4YGAB 1X9QA 2P43B 1QPXA 1EA9C 3EUDA 5PCYA 3QQ4B 1ZLEA 4JZNB 1F11A 1L6PA 4KO7A 4L1DA 5HGDB 1B3IA 1UJ3B 4GG6A 1O7DC 1W2KT 3DUUA 4M8VA 5ENWB 1RIVL 3PRZA 3B3BA 3DV6A 4Z77A 4YS4A 3S88H 3H9SD 1FZMB 1XF5B 1IGFL 4NRXB 4XCFL 4FKHA 4ZTOH 3H53A 3W9DB 3GI8L 4FXTA 3EF4A 5AD0A 3FL7A 2NDGA 1Y6NR 1KDJA 4FJ6A 3OGCB 5FGBC 1W6LA 4Z7NB 2UV3A 4ECNA 2YKKA 25C8L 5IQ9B 5BOZG 2E9JA 5FX3A 1AZUA 1KB5A 2IPTL 3H3KA 4KKCD 4P5MB 4U1JA 4V1DA 4DP0X 4GXUN 1EEUA 2NYZA 1TYEB 4KK9C 4WTXA 1FH5H 1GMIA 4X6DA 4ORGA 1NIFA 5GGSA 5IQOA 4NUQA 3H9SE 3Q1SH 4KTGA 2CHWA 1FCCA 2GHWB 4FFVD 5I6KA 2FWUA 2DDQL 2NQCA 4MVBC 4M8QA 2WAQA 4PJ6A 2BSCA 1FH2A 1JYNA 2WTOA 4BFKA 4XCEB 4GEJA 1GZHC 3IS0X 1OSYA 3S8GB 2IALA 3ETTA 4H0LC 4JQIH 1BQSA 1YO4A 2F7IA 2NX5E 3QJTB 1ZHLA 4N0CD 4ZTPH 4OCMC 4U3CA 1GTNA 1T22B 3IDNB 4XNYL 1PEZA 4IHBA 1T03L 3AM8A 2AAAA 5JA9A 1ZD6A 3BUIA 1DDHB 2BSEA 2GITB 3ARXA 4PP1C 5E8DH 5J13B 2B4CH 3LRKA 2DQMA 3FNKA 2FATH 4IKJA 3G9AB 2Y1ZA 1UOLA 1MIEH 1EHAA 5DC2A 5C0EA 4DEPC 5T1KB 1D5BB 5KS9A 2R2EB 1D6EB 1M1SA 2KLSA 3TO4A 2VXTL 4ZNCD 3V5HB 3D85D 1CT8A 4HS3B 5IESH 2C5DC 1FZOA 2OTUA 1F4WH 2HH0H 3VXQA 2CCWA 1CU4H 3UO1L 3GSVB 3RWFA 1E3FA 3HC0A 5DD0L 3QARA 4ZMPA 5JDSB 3UL4A 4PJ9C 4UDUB 4NB7A 4G6FD 2DQTH 4HS6A 1FSKB 4KKNA 4LSRH 3KYAA 4LCUA 1W0YT 4RAVA 3RVUC 5CXPA 1NMCB 4AL8C 1UYWL 1C1EL 4L3CB 3JT0A 2P8PA 5H2BB 1M9SA 2VDQL 1AD9B 1EUUA 1VACA 1LWHA 1CDGA 1XH3A 4XCYA 4IBLT 1ED3A 1NFDE 3QZWA 1U8IA 4Y2DD 4X4XB 3BWZA 4KAQH 1A4BA 1KCVL 3IRPX 2PYEB 5C0BA 2VDOL 3LNEA 3V9CA 4U6VH 3F7VA 4JO4H 3DRTB 5IGXL 1G0YR 2G2RB 4U2YA 1BFSA 3X11B 5KBNC 2PYFB 1NCWL 2FYYA 4FXGB 1S9YB 4QRPD 1CFSB 1B0RB 4QF1B 5E2VH 1KBBA 1RP9A 3QZPA 3F6IA 5I16B 5E1GA 4JPVH 4M6AA 1WCBB 3MZTA 4NPYA 1YY8B 4AQAB 3LXCA 4DGUA 4R2GD 2FX9L 4QTHA 3IVKA 4GQ9H 3IFNH 2Y0SA 2UWEF 1XF3A 4P9HL 2FH8A 2X4NB 1V27A 3ARDD 4X4YA 1I8UA 3BOVA 2EKJA 3I9GL 1NGZA 2X4RB 1A3LH 5KVEL 1MWAB 3M7FB 3Q13A 4Z7OB 3SDYL 3L3OA 1DFXA 3BT2L 3L5XL 3VGHA 4D9LL 2P7TA 3QJHB 4R0LB 1WBZA 3T3MB 5HYJA 2ZWLT 2F08A 2WZPA 1FZJA 2CPCA 3V0HA 3ZDYB 1HINL 1DO6A 5DVOA 4WO4C 3FMGH 4WCYL 5AB2A 4JG0H 4P5RA 3P77A 3MLXL 2ICEC 3BZ4B 2W65B 3Q6GH 3QI9C 1T7XA 1U92B 4WENB 4MBRA 3KVPA 1ZVNA 1R3KA 3O0RL 4N2BA 2HUHA 3D0VA 3QYCA 1AKJA 1JPSL 3UAJA 3HAEG 4URTB 2ATKA 4NWTH 2FJGB 3OKKB 5DUPH 5TDNA 3DMMA 5IBLC 3VTAA 5D1ZC 2UX7A 5EG6C 2NUTA 3ZO0A 4JM2C 5E56A 1IAOB 2VR9A 2X38A 1EANA 4FMVA 5JW4N 4IKIA 2VSDA 1B4JL 2FLBT 3CFDA 3NIGF 3BP7B 3DUHA 2W81C 3MPCA 4MXVE 5EU5A 4HU8A 2PP9A 2R59A 1U0QA 3FQYA 3D18B 4XWOC 3AC0A 1NZRA 2Z3FA 2IWEA 5KUMA 1KJ3H 4FZEH 1FORH 2O6CA 3VXMB 4C56D 4EN3C 4GUCA 2ICWA 1Z9MA 3ZN6A 1RZPA 4FF9A 4HIJB 2BY3A 1SJXA 4R7VA 3CTTA 1KV3A 3VXSB 4GRWF 1AXTH 1M7IB 1NCOA 2VC2L 5E8OA 2WTRB 4JKPH 3ULUD 2XG4B 2ATPB 2D0FA 5GSVA 1BQHB 1NGPH 2MQ0A 3SKMB 1SXNA 4JZJA 4OI8A 3HJEA 4JN1H 2WZ5A 4UYPA 2AI0H 1KCUH 4BH8B 5JQIB 4NZRL 5K39B 2YPLB 4U0RB 4JPIA 2JJSA 4B9CA 4C56E 1HK6A 3DOIA 4MMZC 5C9JB 3N1FC 5BVJA 2W88A 1K3ZA 2JK5A 3RGVA 3VFUA 5L88L 1A6UL 3C9NA 3X1BA 3PHAA 1OTSD 2PWFA 4BFBD 1UXLA 2AXGA 3IJEA 5JQHC 3WTYA 3P0GB 2DLGA 4NNXA 1RFDL 5F7BA 3WKMH 4JUTA 3LRGA 4DGIL 5ADOH 1ET8A 3QUKB 2CDGA 1LL1A 4FQHB 3M17B 2BC4B 2Z1PA 3FQNB 4HX1B 5I1CH 1MSPA 3RGHA 3NCWA 4J3UA 3VSTA 3HE7B 3IJSB 1A1MA 3VI4E 3O4LE 4PJGE 4U6YB 2GCYA 4TVPH 1SBSL 3MXWH 4OVUA 2QADC 2VDLH 1BCIA 1A9EB 3TH2T 2HTKD 1KENL 2JELL 1V7ML 3MVSA 4UMGA 3DBXA 4WI2A 5B39B 2J6WA 1T2QL 1C8QA 4B9ZA 1S7SA 3PWUA 4ZOCA 3GDCA 5DJXB 4A7VA 3GB7A 2G75A 1GS6X 4W70A 1W72L 3RNQA 2NY4C 4KNSA 1DVFD 1E50A 4N8CL 5DR5H 3EGXB 2DBLH 1JHTA 3THML 5I19H 3MJ9A 2K1MA 5HHVH 4QKXB 4UIMA 2BNQB 2X12A 4M9OA 3OAZK 5ABZA 2DYPA 2ICCA 4BKTC 3H9HB 2VE6B 1F45A 2H0PA 1F58H 1L9TA 1ZK5A 4GKNA 1DQIA 2C1PB 4OLXH 2DF3A 5DD6A 4DIXA 5EZJB 5I75B 2UZXA 2OJEB 5CP3A 4FGMA 5DRXB 1DQVA 3TCTA 2NNAA 1KN2H 1VDGA 2EDOA 4LQFL 4N1HB 1A25A 3BAYA 4LEEA 5JPNA 5IHZA 1NOLA 4GW4B 2EDTA 3NFNA 3L4UA 2Y07H 4KHTH 4RZCB 3P3UA 4LEBA 1G9NH 1YEKL 2A9BA 4G9FE 5GS0L 3CFMA 5JHDB 1A6WL 5JO5A 2EDKA 3TIDB 3FB7B 5I6LA 1XR8B 4YBHA 2VQTA 2FK9A 1D2PA 1D3CA 4POZD 2WSPA 3PE9A 4FG0A 5KBPA 4HIEB 5I24A 3WIHH 1I9RL 2GSIB 1E4JA 1WEJL 4KGJA 5C6PB 4G8GA 5I1KH 3CQPA 4FFYH 3HHSA 2IOMA 1SQ2N 1MFMA 5D1XB 5CFAA 4WNQB 4FQXB 3WE1A 5MEOA 1KGJA 4I4WA 4YDMA 2YD8A 5IB5B 2XKNB 3U7WL 5EIIB 1JV5B 3DVGB 3VFMB 2YJQA 3LS4L 1BFVL 3VM5A 1RMFL 4IOIB 3SB3A 5DTFA 2V2XA 2VRKA 1CLOH 4Z7VB 2DQCL 3EHBC 3X14B 3U2SB 2QMJA 4X4MA 1SUJA 5HVHB 3RVXC 1H6UA 1QHQA 2NNRA 3P2BA 2P9RA 3Q1EA 2ZXCA 3B37A 1KJ2A 1UT9A 4LHUD 5GZOD 4OF6A 1IGJB 1KT2B 3FFCD 1NANI 4XB3A 4Y5XB 5TGBB 5BCAA 3GHBH 5HPMA 3CZGA 1TQUA 3WD5H 2M1KA 1RK7A 1TJHH 2QHRH 2ADJB 4I18B 3ULVF 4M48L 3POCA 3BJLA 3I9IA 3MV7D 4FFZH 4QXUH 3BAKA 4J3BA 4W4OA 4MB3A 3FTVA 3WXWH 3BPLB 3HB3D 4HUVB 5FECA 1GZPA 3CWGA 1KLFA 3TPUB 1QZNA 3ZQ9A 2K6WA 2W95A 3K71B 1BBJB 3A47A 4UTAL 2FWOA 1MH5A 2CDFA 3D4YA 1I9IH 3FFCE 1RZGB 5L2KD 1HHIA 3QXUA 2P5WA 4RGOH 3IFOB 4OIBA 5FS5A 3BVVA 3WN5C 3VWJA 3L08A 3VD7A 4YXLH 2AQSA 2Z4TA 3LNIA 1E4KC 3A4FA 2ITDB 3FBQA 1PIGA 4CVXA 3SBRA 4X0NA 2C3HA 3APDA 1EMTL 3FOMA 1HHKB 3Q44A 2BFVH 1ASOA 3N42B 1R19A 1E2ZA 12E8H 3BP6A 4KO5A 4BFFA 3FO9B 4AEHH 3IWVA 2I9LB 1BQRA 2I7OA 4M1CC 1FVDB 3M86A 4HZ1A 3SDAB 5L2KE 1YEEH 2VO8A 4GAAA 3EOTH 3N44B 4HAFA 4OD2A 4X6BA 4P5TD 5GQBA 5BRQA 4KQ3L 5EPMA 1Z0MA 1ORQB 4HJIA 3SE3C 4YZFF 1WAAF 3EFOA 4KRNA 4TXVB 4XR8C 3H9YA 4A7GA 4HS8L 1T4KA 4PLJC 2YXMA 1I1FA 4TNEA 5DJ8A 1CL7H 2C9PA 3VFVB 4L3AA 3T0EA 1ODUA 4PGEA 3ARBA 4NYLA 4J28A 2J7LA 2MIZA 4WRLA 1YEIH 3BH8A 3T71A 3WKQA 4NQVB 3BUPA 3MR9B 5F7EL 2RGSA 3BSZH 5E8NB 2O61B 2DJUA 3GZQA 4LHUG 3DTDA 2GIXA 3MMEB 3BSHA 5IOKA 2DQUL 3CBRA 3BAJA 5ACLA 3RZWA 2Q20A 4U6XA 3U2IA 3E38A 1SM3L 3FQUA 4YHKH 1XGPB 3BD4A 3MTRA 1H5BB 5TH2B 4P2RD 1TTCA 1A0QH 2VZUA 4YVUA 1D5IH 1NLBL 3SPGA 2NY6C 3G9VA 4FLOA 1LM8V 2Q76A 1J5IA 3NJXA 4PW4A 3BDBA 2M2DA 1CI3M 1MQ8A 2ESVD 2FQDA 1RUQH 2F54D 4K9EC 3OMIB 3BGMB 1BX2A 3P02A 2BHZA 2FZ3A 3QNFA 4L1LA 4WY7H 1GSKA 4OCRH 1ZWIA 5EEVA 3PWPD 2TAAA 1BFOB 4GRLD 2QPUA 1PKQA 3ARGA 1I8IA 1XWVA 3HZYA 1RPQA 3UACA 4M1GL 3D0LA 3TZVA 3H9SB 1DE4B 3ELAT 4P5KA 1IBYA 2BVUA 4P2RE 1I8AA 3LQMA 4M61B 3NTCL 1S5HB 1NAMH 3PL6D 3B2DC 1KIQB 2OP4H 3PQYE 4XI5C 2ESVE 2F54E 2AJYL 4ONFL 1J9QA 5FA3B 4YUEL 4XVSL 1WSST 1JGIA 1GC1C 2WM0A 3KPQA 2IDCA 3PWPE 4XZUA 4E9RA 2E7DA 4F5CA 5F7DB 4W9IC 1P84K 4X80H 3VXRD 3MBWA 2I27N 3X17A 1U8MB 4ABQA 3X3GL 3MLZL 1JZHA 2GC7C 1X7SA 5GGQH 3BN9D 4CC0A 5GGVY 4OIFA 1YEDA 3UP6A 1VZGA 1J0YA 3ISWA 3SD5A 4W9GC 3ML9A 4CU7A 1RJYA 4F7MA 4D0CA 3MRFB 5E08L 3BUYB 3ROLA 5KEZA 2Z6FA 4ADGA 3VXRE 1KNOB 5F9JA 3R0MA 4TVPD 4WFHD 1O6TA 1SYVB 4LPUA 4DGVL 4DPCX 2XU9A 3N2JA 4Y5VC 4FHBD 3EJJX 5FFLA 1F6FB 4S0SD 3GTNA 4OH2A 1U8PB 5GGTA 3SJVA 3DURB 4PRID 1SDYA 4V1DE 4Y9BA 5F1KC 2CJ3A 4QI3A 5ECGA 1L9NA 4NBXB 3HI1A 1EVUA 4LSVL 3VQ1C 3FQXB 3FT1A 1ZT7A 1OCCB 2J20A 3D85B 2CLZA 1JK8A 1NFDB 3U0TA 3HW7A 4OI7A 5B8CB 1I7ZB 4TVPE 5E94B 3F83A 5SWSD 1JCKA 4BH7A 2FQFA 3HAEB 4FN0A 1UACH 2Z65C 3GDBA 5JOPD 4PRIE 4HUCA 1NM4A 1QNZL 3WG7B 1EJ8A 3KR3H 3R4RA 1ASPA 4AOFA 1P5UC 1KWGA 4XMPH 5CJ5A 2WVVB 2YC1B 1HQ4B 2VQUA 3TIEB 1E27A 2MJWA 1UM4H 3IMSA 3U9WA 5ITFA 1KPVB 1SVZA 1ZA6A 2ZWKA 4Y2DB 2HLFC 1II4E 1Q9LA 3SPJA 5GJTL 3V0JA 1FFTB 1XIWC 3NJLA 3QFDA 4S1SL 5KS9E 4IU3A 4PAZA 1MZYA 5D93B 1BOGB 5JXEA 3BUDA 5BVPH 1AKPA 2GT9B 5HJBA 4D94A 4XCCL 3ZE0E 1MLBB 5JOPE 2IAND 1BYNA 1Q94A 4JJHA 3F58H 2XVGA 4M3JA 4AL8H 5IFAL 2HKHL 3MLWL 4ZQTA 1J1OL 1JWMB 1ZLWK 3QIBD 1BXUA 1SFHA 1KOAA 5KSBA 1Q9KB 2DQ6A 4I1NB 4JFHD 4ODSH 4I3GA 4WW1B 3U1PA 4DP9X 4F8LA 4F8PA 3TFKD 2XZQH 4Z0XB 2Y6SD 5DHDA 2WIIB 1IGTA 1MFUA 3B2UD 3A6CH 3KYKH 4QHMB 1X5YA 4R2GB 2K9FB 4CBPA 1OGSA 1E0OB 3WDJA 1BYPA 2AVGA 3FYIB 4NQXA 3VSUA 5F0MB 2XY2A 2CBOA 4XPAH 3RUGF 2YBRB 3PP3H 3TVMD 1GZQB 2YO3A 3IRCA 4AJWA 4ERSH 4MAYA 3FZUD 1JZDC 4M6MH 1G7LA 4YLQT 2MOGA 3G5XA 4MQ7B 2XTSA 2H6UA 4MNHB 4F57L 4Q6IA 2BIPA 3H55A 2WLYA 5BO1L 3U7AA 1EH9A 5EEYA 2NSMA 4O58L 1HWGB 4JFHE 2IQAB 2X87A 5CFHA 2OXHA 2VR5A 4JO8A 2N1TE 4DP2X 2X6VA 3EZJB 1YPZF 3MOQA 1QZ1A 1S7WB 3CLEL 2F18A 1FL6A 4HWBA 4KVPA 1R3JB 1CBVL 4YHNA 4EO5A 1TVBB 5I74C 1BXXA 4CADB 2Q8BL 3ZHKA 3U36B 4ODVH 5FUOL 4YE4H 5E8EA 4P2OD 1E6JH 4XPFL 3JYBA 4LOEA 4N0YL 3MBXL 1G1YA 1L3WA 4M7KL 2VDKH 4HC1A 4PLKD 4XC3H 3PXLA 3WJJA 1SN5A 4UQ9A 1G94A 2O5NA 1OGAD 2LT9A 2X6CA 5TQ0L 2IQ9H 4BELD 1QBAA 4X8JB 4Y9GA 4JFYB 1SVBA 4ATTA 3OHMB 1WBXA 4LLWA 2E3VA 3K2KA 4M7ZC 3X13B 3UZQA 1F1DA 4NUJA 3NGBB 2YMTA 4CVUA 3AVEA 4BBWA 1KIRA 3D48R 4MA8L 1E30A 4OKVB 3KEDA 3ASNB 3VSVA 4F3FB 4C56B 3PIQB 5CINH 3L5IA 2LQRA 2J6EL 2YUZA 1FGNL 4TPRL 4ZRGA 2AK4A 3O2DL 1GAFL 2ZCZA 3SKNA 5I1DB 4XMKL 4AGNA 5CGYD 3F7YA 4CC4A 1FJ1B 5EWIH 3VGEA 3ARWA 1UVQB 3NZHH 1CGVA 4YHOH 4F8NA 4I77H 4N25A 4Y4FA 2P42B 5CHNB 1JYWA 3ZQWA 4IBUA 4YC2B 1RUPL 2HWZH 5C0AD 1GYCA 4E9WA 5DFAA 4BA0A 1I1CA 1IGMH 3US9A 3QC6X 1BIHA 4JHAH 2UZPA 1CURA 1DZ0A 3CFUA 3I02B 5KVFE 4PEEA 2IDFA 3JV6B 1MCRA 3HRZC 3BUTA 4NQUA 3NSDA 3MRGB 3VI4B 3H2PA 3O4LB 1N5AB 4PJGB 1ADQL 1F0LA 1I75A 4MCZB 3KH4A 1AZNA 1VFAA 5FDYA 1OB0A 5DFWH 2ZOLB 5TQ2L 4P59L 3WFHB 3EH4B 1P7KA 3MACH 3N91A 3ES6B 4O02A 2WJ5A 5DLMH 1WRFA 1MXDA 1BYOA 3AT8A 2OCFD 1P84J 3BGFC 4LAQH 4DP8X 3FQWB 1HWHB 1NAKL 3CUPB 3O0LA 3UGXA 3BAEH 4NRYB 4P9HC 4DGYH 4WIQA 4QHLA 4X6CF 3TYGL 5IVXF 1LK3H 1WO2A 1NGYA 4LLYB 1NC2D 2XZAH 3MKKA 2A9ML 4PD4K 4N2GA 3DHUA 3G7TA 3TT1L 4HZLA 5D70H 3VGGA 1W80A 3WO4C 3FKUS 2OSXA 1DVFB 1XO8A 5C0JA 3BWSA 4PTTB 1IM9A 5D2LB 3U9PL 4M93B 4DVRH 3E8UH 3RIFK 3MJ8A 1VHPA 1E3XA 5KJRH 2HCZX 5HHOA 1FG2A 4HW6A 1E42A 2H1XA 4XP4H 2UUDH 1PSKH 3M88A 4HJSA 4EDXB 2Q3XA 3NMEA 4HT1H 1EEYB 1CE1H 3CN3A 3OPZL 2EDNA 4WFFD 3L2NA 2AJSH 7FABH 3SGEI 4QRBA 1MG3C 1PX4A 4NN5C 5DUBB 4KX7A 4JLRB 4PRNA 3BMWA 5I1AA 3VW3L 1LNUB 2OK0H 3BKJH 3O4OC 3D4CA 1VFBB 5AW9B 2A9NL 1HAWA 3MKGA 4CKQA 4BJLA 5DEFA 5DMJB 1M6OA 1XCQB 3UJTH 1U3HA 5AW0B 1ZGLA 2UY6B 3CNKA 2WQXA 1TEFA 1THCA 1Z2KA 3U0PB 3ILQC 4KK9D 1VA9A 2CUIA 2E7CA 3MV8A 1KBGL 1S2EA 4GAGL 2Z4QB 1N0LB 2YAMA 2HVKA 4GKLA 3TJEH 1Q0EA 5J5EA 2WCGA 4XAKE 1WFTA 3SO3C 1CMOA 5AG8A 1T21B 1J0KA 4U1LA 2GUOB 3TU6A 5DJDA 1BQLL 4MVBD 3APMA 1IAKB 5CCKH 3GI9H 1F41A 3FPXA 1DQML 4XNQA 1EZLA 5EIQA 4XMWA 3MGOB 3VD3A 1JHLH 3ZYIA 1UXWB 4C4UA 1KEGH 2EIEA 3FU3A 3HI5H 5J1AB 3DX1A 1FL3B 3V79C 3QCVL 4X9YA 3VMNA 1DVTA 3LZFH 4MJIA 3ABLB 4U1MB 4KNUA 5IM7B 4CN1A 4PP1D 35C8L 2Y3AA 4JFZH 1X44A 1HAUA 1MFCL 3LPWA 1DVSA 4M02A 1KCSL 4LHUB 3BKML 3FFCB 4P9MH 3KS0H 3N55A 5I28A 5D7HA 3VXTB 1XMWA 2X28A 4R4FL 2C3GA 5E4OA 5F9DC 3WIFB 5I1HH 3CCHB 1FNGA 3DO3A 3MV7B 1P9MA 4F33A 4I85A 5I71B 4TNWK 2F1EA 1GGCL 3IFPB 3FUDA 4NZJA 4DW2H 5KBKA 3HB3B 5EU6A 1UZ8A 4PJ9D 4FRWA 2F7RA 2JE8A 3LHPH 4L1TA 3T9WA 1LO4H 3VFSA 3CVBA 4A7QA 1L7TL 4KZCA 1JD9A 2UVEA 3RVUD 4ZMOA 1LJMA 5B3SB 4F7PB 1YDPB 1J5CA 4MA1B 1OCZB 2XVBA 3CFKB 4XP1H 3ZR6A 3MA7A 5D7EA 5L2KB 1YMMD 5LVEA 2APWA 2ED7A 2OZ4A 3T2PA 1DL7L 4XODA 1XSOA 2OMVA 4XN4A 3PUCA 1AMYA 3GHEL 4LNRB 4G59C 1BZ7B 5EC1A 4MYPA 1UZ6E 5T5FA 2EDFA 1E4XI 3T1WA 5F44A 3V6FB 4HIPA 4P2CG 3V5KA 5KAQF 3MRDA 3P0YL 4YWGL 3B9KA 1ETZA 3GJEA 4N0RA 4UQIM 1FVEA 1OPGH 3T6VA 2LU3A 1UWXH 1XL6A 2H1LM 4O9HH 2BCKB 2P47B 1YMME 2BDNL 3DSNA 4P5TB 3IXAB 3PUUA 5IK3A 2EUWA 1SLVA 3ZE1E 4PRAB 2R15A 3QWNA 5LCVL 5D7LD 1V7NL 2BNUB 3P9MA 4D9QD 5DJ0A 3U4EB 2P5WE 5GS0C 3BVDB 1H9VA 5AVVB 1CFNA 4YE0A 3REWB 1EGJA 4PJ8A 2ENSA 1KXTA 3AMKA 3H54A 3EJSA 3MODH 4I89A 1KG0A 4TUOB 1EAPB 4Y19D 1S9KC 3AXIA 3LSOB 1JHKL 5AVUB 5LNDA 3JZ7A 2VQ4A 2K4AA 4G1MB 3SKJL 3VG0H 1NKOA 1NCNA 2B1AL 1LO2H 4MZRA 4WO4D 3MRCB 5C07A 3VJ6B 3WFEL 1ZPLA 3NFPA 4LP4A 5D7LE 1S7XB 3QI9D 4P2RB 4GQPH 3K6NA 4D9QE 3RWGB 1WFUA 2CNZA 1AQMA 2BP0B 4F7TA 2AXHA 4CVZA 2O6DA 1DUZB 2GTZA 2DJ4A 2ESVB 2F54B 1L9RA 3FULA 3PQYB 3QRGL 4KV5F 5CP7B 1IM3A 5B1JC 4Y19E 5FOBA 3WL9B 1IFHL 2XJLA 5IBLD 3PWPB 3QDGD 5D1ZD 3DO4A 4CA4A 4GRLB 4JM2D 4P23C 2YRZA 2HKAA 4PR5B 2X1QA 1TQCC 3T0EE 4JX0A 2ZXBA 1FO0L 3WY4A 4OUOA 3ZIMA 2Z91B 3IU3B 1L5GA 2QQKH 3F64A 4I8DA 4P05A 5EU3A 4ZMLA 1XGQB 3T4AB 3U6RA 3FOLB 4OD1L 4XWOD 3L1OL 5A2FA 1JYXA 3OAYH 4UDTA 2FUQA 3GSWB 2Q2LA 4LSUL 4EN3D 4PD4J 5IP4A 2YD5A 5EF0A 2O1AA 4PSRA 5EH1A 2BVYA 3QDGE 2JKJA 4EIZC 3VXRB 2Y5TA 2CAKA 5K9OB 4OSUL 3HPLA 1B2YA 2P26A 2BVOA 3IAPA 1CXEA 2HLAA 5D5ME 4ZS6C 2Y22A 4X83A 2LW3A 3RDTC 5JUEL 2CR0A 2HUEA 4ZODA 1NJ9B 1I1AC 5I6NA 4V1DB 4OFYD 4O2EA 4P3DA 5CCGE 1S7QA 3QQNA 2YPVL 1BW8A 5CMAA 1ND0A 1E9QB 1NCCH 2YRPA 5AKSA 1PKQE 5F3HA 4OB5L 4WKZB 1LP9E 3SODB 4YLCA 2YZ1A 1BD2D 1GC1H 4M5ZL 5KOMC 3X12A 4TOYH 5K1JA 1MFVA 1O6VA 4Z7UE 4FQIH 1BZ9B 1J48A 2VABA 1RERA 2VLKD 4KO9A 2JF1A 3LTVA 4PUBL 2E6PA 2JB6B 2MWCA 4QMEA 3UAAA 4TRPL 2VDLB 5L9DH 2JTDA 4JM4L 4JE4B 4KPHL 5JA8B 3AB0C 3TA3C 4PRIB 3KCPB 3V4UL 3L9YA 4F5CE 3WYRA 1DJGA 1EHLH 3IMRA 3OKMA 4AIEA 1BD2E 1T1WA 3IJHA 3L4TA 4DK3A 2I24N 1FFPB 3GGWA 4OZFA 3OLDA 5DS8B 5AOKA 2J1WA 2AV7B 1A7OL 4XRCA 3PAYA 5EBMB 2FGWL 3PWJB 2DS4A 3UO8B 5JNYA 2VLKE 4MD0A 2QADD 3Q5TA 1YQ2A 1ACZA 5SWSB 3PP4H 5DZNA 2KUTA 1AR2A 3OLEA 1IAII 5DQDH 1MJJB 1PU0A 5F9OL 5IG7A 5LNEA 3ZE0B 2YSSA 3UYRH 5BJTA 2EXYC 2NY4D 2WLHA 3ZDYF 3W38A 3VXQB 5FCUL 3C5ZA 1JWUA 3GMNA 1QSVA 2XWBA 1UD2A 3GZOA 3UJIH 2W0FA 1IC4H 3L2MA 4HS6B 3CDGA 4P3CH 1HHGB 4L2YA 2AQNA 4Y5YA 1BEYH 1RUAH 3ALWA 2G2PA 2X3BA 2QVKA 5GGSY 4ANVA 5DHVB 4PGCB 4JGMA 2HMIC 1R5VA 1UD8A 2F9BT 3WFBL 3LPFA 5CLXA 2IANB 3NCCB 4XCYB 5DFVC 3QG6B 4AMXA 5DJ6A 1HOEA 3MA9L 1NSNL 2DM7A 1ED3B 4BK4A 2QLYA 3C60C 1OOAA 3QIBB 3HC4H 4N20A 3V4PL 2PXYC 5GRUH 5CZKA 3TBVB 2GBVA 3P30L 1G7IB 1N64L 1QKZL 4IBTA 3LIZH 4OZGB 4O4YL 1YSOA 2CDEA 3AU1A 1LWRA 3HZMA 3GC3A 1ZA3B 4DCQB 1NGQH 3QEHA 2RMNA 2ZWNA 3TVMB 2ZXAA 3LEXB 3QUXC 1VEMA 4AV4A 1YEWA 4GG8A 4JGNA 4MZ3A 5C0FA 1PNCA 1RIVH 2QPDB 4AQEA 4B7LA 3X1FA 5ESQB 3L4XA 3WKNA 1IGFH 2IV8A 4XCFH 3GI8H 1ZT4A 2DKSA 4JRXA 5EBLB 4HK0A 4X4YB 5CGMA 3GUTA 4Z3IA 4BWTA 2WQAA 25C8H 2IGFH 2NR6A 3N40P 5DZOA 3F7RA 2NYYC 2WKOF 3D50A 2EDYA 2PCPA 2Z31A 4HIIA 1FNSL 5KSBE 1QMUA 1WBZB 2BOCB 1PVHA 3EHBD 2FIKA 4P2OB 3L9RB 3RVXD 5C2UB 3TCXA 4XO3A 2WXGA 3Q2LA 1OGAB 1E7UA 4WO0A 2COVD 2DDQH 3TJPA 3IK2A 3B2PA 2XPGA 2FJFA 3E1ZA 2KC0A 3HI6L 4J3XA 4V33A 1CJYA 3FT3A 1MJ8L 3HC3L 3DMMB 3CBJB 4XNYH 5EU4A 3RIAK 1T03H 4MDRA 1W72A 5T1LA 4HEPA 5I26A 2PPFA 1AE6L 4ZOEA 4XWGL 1TPXC 4P57B 1K8DA 4HQQL 5SWQB 3PFQA 5IF0B 5MERB 3CFJB 4YSAA 4IRZA 3SIKA 4GI8A 4XOAA 3US0A 3JT2A 3KBPA 5JHBA 4FLRA 1THAA 2APVA 1J8HD 4BWWA 2Z7WA 1I1YB 3PHOB 2YAQA 5BQ7A 1CZ8L 3L3DA 4A6YL 1BAFH 2VXTH 2JCCF 5C0AB 4R8WL 3AJ7A 3OKOB 3LHAA 1I7RA 3QUMH 3SY0A 4UT9A 3BKCH 1L6ZA 4HD5A 3UO1H 4HHGA 4NBZB 1I8KA 2W0LA 2B08A 5F7LB 2ZYHA 4TMPA 4M1CD 1XR9B 4W9EC 4ZFFB 2K6ZA 2YAPA 2I5YL 4J23A 4N2OA 4NHCL 1J8HE 1UYWH 5E6RB 4KQ4L 3UAEA 3QZMA 3TPKA 1INEH 4HOMA 3CPLA 2VDQH 2PPAA 4LL1A 1PD0A 4JPIB 4OJYA 1LK2A 5D4QA 1FFOA 5EA0L 2XG5A 1RZ7L 4KKLC 3CSPA 5LWYL 4NQSA 2XWDA 3EBIA 4PLJD 1FC1A 1HJBC 1TJIL 4XOBA 1PTZA 3V7AE 3VU1A 2VDOH 2FX7L 4J3OF 4K9JA 1MFDL 2K7PA 5E6SB 1VGKB 4A2LA 4WW2B 5IGXH 1Y7VA 4ZK8A 3L45A 4NNXB 2F8IA 3LKNB 3GMPA 3B7TA 1IMHC 1MJ7L 4LVOB 1CIUA 2NNFA 1ROWA 1B2WH 2DJSA 2EO7A 3B2VL 4NO5A 4OZHF 3O41A 3EJUA 5L0QB 4ISVA 4QCIA 4AIZA 3QA3A 3VD1A 3QEUB 1WIOA 2FX9H 4GKZA 2NY6D 3HHMA 4P9HH 3GMQB 1F3DH 4JGJA 4XMLH 3PJSA 3ARSA 4LB8A 1R0AL 4FI7A 1T4WA 4NQCD 1AANA 1E2VA 3I9GH 4QT5A 3PXHA 4NSKA 1DJHA 1CGTA 4JHUA 4X8GA 4EI5A 2DEXX 4PGBA 1MZZA 3RNQB 3SDYH 3BT2H 3IFLL 3L5XH 1QVOB 4D9LH 5EZLA 3A22A 2ILLA 4PQXA 2IADA 4U6HA 2ZUSA 5EB9A 4UQEA 3SOBL 3UADA 2D7MA 5K1VA 2H45A 1HOCA 5CEZL 1HHJA 4GPVA 4OI9A 4WCYH 4TNWF 4J12A 3RI5K 4UTAA 2XN9D 1OSEA 2XWXA 3MLXH 4D0BB 4XI5D 2PR9A 3MLTA 4XCNA 1RUKH 2ZG3A 3GKZA 1YYML 1GHFH 4NQCE 5E6IA 2QKIC 5J57B 3S6CA 3WHXA 1E6OL 1U8NB 1HQRA 4Z23A 3GTVA 1EQWA 2R0ZH 3P73B 4LO9A 1DQDL 4MX7A 5IIEA 2MNWA 2QLVB 2VM9A 1YEHH 1CDJA 1QP1A 3GK8L 1T0OA 2H7WA 3UYPA 3BC9A 5FW8A 2YBGA 3U30C 4GB9A 1F8TL 3RP1A 1PY4A 3WUWA 2AXWA 4N87A 4I3RH 3QEQD 4XPHL 1DVXA 4BQ8A 4WJ5B 3Q8FA 3FT2A 4PJ7F 3HMWL 4ZDHB 3HN5A 3VUAA 4YJZL 3N42F 2ENPA 5DD3L 1YQVL 7TAAA 2JXMA 4WHYG 3DYOA 3RFZC 3DOHA 2F58L 4KY2A 2OJ1A 1F4HA 4N9GB 2VDML 3GMMB 4I4WB 4ES8A 4AH2A 4N2NA 3N44F 1ZVSA 5GRWA 3F3HA 1TR7A 3QEQE 1JWSA 4TM9A 4YSRA 4DEPB 1KULA 1MHHB 1RJZA 4Y16A 4K3DL 4PW3A 1G5AA 2EEBA 4OW6A 1U8KB 3MV8E 1JPST 3MUUA 5JXAL 2BFGA 3ZMNA 4ZX3A 5EUOE 1NDTA 1O6SB 3CU1A 2WOYA 4NZRH 3U4BH 1XEUA 1MW2A 3SQRA 5L88H 4D8PA 4G7RB 1A6UH 1UG9A 3AG1B 4PJ9B 3SYAA 5CSGA 2R7EB 2BLFA 2DLTA 2X7LA 4KK6C 4AW7A 5H37A 2OYPA 1GYUA 3E1F1 3L17A 1RFDH 5DA4A 4NX0A 4S1DC 4DGIH 4BSWB 2FR4A 5IVZA 3TWYA 1YMMB 1F13A 2R29L 3C2AL 4GSQA 4KMQA 3KPLA 4NM4L 1KACB 4CU8A 2HLFD 3BO8B 3LN5A 3U82B 1XIWD 4HKXA 5AVXB 3ZE1B 1HYSC 4UNIA 1K8IA 4J4PC 4K71C 2B59A 3P4NA 3N9GL 4U3XA 1KENH 2JELH 1LLAA 1V7MH 2FHFA 3I6GA 3QPKA 4P8QA 2C8NA 1T2QH 3AGWA 2BRRH 1F4YL 3CSTA 4K3JL 3C5SB 1TG8A 3I9PA 3FOMB 4I0PA 2D7TH 4F9LC 1HCVA 2CO2A 4N8CH 3SDDA 1K4CA 2X2HA 2J21A 3AQDA 3THMH 2OM5A 2PPEA 1QEWA 2NW2A 3MLRH 1H6EA 4CNIA 1RIHH 5L8LB 3CDCA 1MCOL 3DJSA 5D7LB 4ZAKC 2ODHA 4JR9H 3IM1A 1NC4D 3GJFK 3GUFA 4FMFA 5H35B 2EIDA 4H0GA 1N7ML 4MNQD 4X6BB 3BVWA 4XMZA 3O9WA 3GMLB 2X4QB 2UWEA 3KDMB 4WGKA 4Y19B 3V0GA 2GK0B 3V0WL 3QIUA 4FNQA 1N70A 1NMBL 3GLZA 1T6VN 2TRYA 4LQFH 1KYDA 4KJPC 4YR6B 2NSXA 1IVLA 4U3SA 1YJDH 4S1RL 2GPZA 3ARFA 5IMMA 5ECJE 5FHAH 3OZ9H 2XQ0A 4GFTB 1BAGA 2OMTA 4YSTA 3FSWA 2WW8A 1YEKH 5AW6B 5I5JA 3V6OA 2VMEA 2ICEB 3QI9B 1AGBA 1VRSA 4FQQB 4Q14A 1XVSA 3VFPB 3I84A 1NOFA 1UXSA 2E8ZA 3EO1B 3ZQXA 4OZ4A 4U6XB 1CD9B 1I8LA 4Z3GA 4B96A 5KYXA 1WEJH 4GJTB 4XNXL 3QDGB 4FDWA 4QRUB 1DCLA 5I76A 4JM2B 4KJQC 1EEZA 4GXVL 1U8OB 5DEGA 3HJ0A 4MYWB 5TE4L 4I2XA 4H13C 1YNKL 3EFDH 2E74C 4HH9B 4XVUC 5D5MB 2Q6WB 3WEOA 1OY3B 1LO3L 1R5WB 3HN8A 3U7WH 1BX2B 3KL5A 5K5YA 4AQ8C 3LS4H 3EOAA 1G7QB 3ZL4H 4LPWA 1VERA 1KXVC 2R8SL 5GRJL 1PKQB 3QFJA 2WYIA 1D5RA 1LP9B 4W9ZA 3QISA 6CGTA 4EN3B 4QD2E 4Z7UB 4JQVA 2FUTA 1J18A 3HEIB 2OMZB 1N3NA 1VB9A 2YPKA 4LSQL 2P24A 3T6XA 1DANU 3MRKB 3QCTL 4FXKC 4NI3A 3Q7JA 2CIKB 4QTFA 5A16B 3CFTA 5DD5L 2QR0B 4M8RA 1INDL 3KWWA 1HWWA 2N56A 5I8KH 1PJWA 1CK0L 1U8QA 4NERA 4AIOA 4CUCA 5CLTA 1BD2B 5IFHL 3LVEA 2ZWSA 1OSZB 4MMZB 1N0XL 3GMOB 2WANA 4QHNB 1T83A 2VDRL 3MJ7B 2EKSA 4H0HB 2VLKB 3TCLB 3ZRCC 1EXUB 1MELA 1WK0A 4L0ZA 1I85C 3INOA 4FNTA 3MNVB 2FDBP 2MPVA 1C5BL 4JKLA 2OMWB 4RIRA 5F89B 5TK4A 1YUHA 2G2NA 4S2SB 1D5XA 2HJFA 1DJXA 5BS0A 2BS8A 3Q0HA 3A4EA 3OQRA 1ZE3C 3LPOA 3UOAB 3SCMA 4OFPA 4PRPA 3AS0A 5F9JB 43C9B 1FAKT 2ZXWB 4P07A 4MJ2A 3LN4A 4NC1C 2ED8A 2QPEB 4NO0D 4X5WA 1KTBA 2FHBA 2VZ1A 3DXAA 1BFTA 2QADB 5DYOB 1IC5L 3MV9D 3ZKQD 3CVHL 3JVGA 4JFDD 2IF7A 1T3FB 3F5WA 5IEKA 1U3ZA 3DOSB 4KQ3H 1EPFA 2HVJB 3EJYD 5FDWB 1QQDA 2NY4B 4OM0L 1U8LA 3LB6C 1UB5A 4J7RA 2I60L 5H4ZA 3LV3B 4CJ1A 3KPSA 1ES0A 2D7OA 1U95A 2C3VB 4E5XA 3HNSL 3HBQA 3NA9H 2QPSA 4IBWA 2WB1A 4JMXA 5KVEE 4JFDE 1DSYA 3FHAA 1AD0B 2DQUH 1JPGB 1ZA6B 1A6TB 1SM3H 4OJDH 4BFIB 1KV7A 1MFEL 3TOPA 3RIAF 4JNXA 2BPBA 3WDIA 2IXQB 1ZOXA 4QGTA 5KWYC 2FEDC 1MI5A 1NLBH 3AAZA 3BW9B 1NGXA 3NJMA 2Q86A 5D7IF 1T7YA 4U7KA 5E00A 3ILQD 3VO0A 2YEZA 3RDJA 1FNFA 3MROB 2P8LB 3T2NL 3TS8A 1X4XA 3KLSA 1YN7A 1HC1A 4C59B 2CK2A 4IM8A 2BCMA 3ZT6A 3MCKA 5ICYA 2Y3NA 5ANMA 1ICTA 3ULUF 3W3BA 3K6OA 1HXYB 1V5JA 3ZPDA 3L3HB 4ZO6A 3H7BB 6FABH 5I1LA 4DETA 1TSRA 2VZ3A 5DMKA 4ONFH 4MCMA 3G5XB 3KW8A 4XVSH 3N04A 3ILPA 2CE6A 4RFEA 1COBA 4QRSA 5CILH 4APQC 3L1GA 2YFOA 5TFSL 5A3IC 4Z7QE 4H44C 1MY5A 5BV7L 3AQYA 3DVIA 3EHBB 3PDDA 4PJGF 4YDVA 5AYQA 2X1XR 2FO8A 4R7XA 4M6OH 1TKWA 1ACCA 4QYOA 3X3GH 4WU5B 1M05B 5T1DL 2X4OB 1BLNB 1DBAL 3K80A 1KLUB 4KHXL 5EEXA 5E8EB 1A9BA 4XHQA 2M26A 4ZO7A 4Z7IA 1S9VB 2EE3A 2IPUK 3AXLB 5FO8B 1NOAA 3MUY1 1QG3A 3ZHNA 1IGCH 3LKRB 5EF2A 4JB9H 1TU2B 3UZQB 5HI3C 5C08A 1Q4NX 1I7UA 1DR9A 4QOKD 3WN5B 3IDGB 1J8HB 1H8SA 4OLWL 2DI9A 5C97A 4A04A 3SKUD 4P06A 2B7DT 2QFRA 3CDYA 4IRJC 5CIPA 4LSVH 1KJMB 3EDEA 2GTWA 3LZRA 4AM0Q 1BPLB 4OD3L 5D2LF 5J4MA 4YPGB 3L2LA 2C9AA 1ZK9A 4D0DB 1KB9J 5I82A 3F7YB 4QRRA 3STLA 3DROA 1ZVHA 4N86A 1PZ3A 5D7SL 1PZ5B 4KFZC 1ONQB 2ITCA 2BZCA 2KDGA 3QNZB 1GGIH 3QQDB 4IS6B 3P4OB 4LLUA 3BVXA 1AHMA 1TYJA 2YOAA 1IKFL 4NAJA 3TBCA 4U7MA 3DIFB 4UT6A 2EABA 1MXGA 3UDWA 3D4ZA 4UV7L 2WUBL 2ZWYA 4ENEC 2C1OA 4S1SH 5GS0D 4YQXL 1VFAB 2R0KL 5CCHE 1BJMA 1MF2L 2R1YB 1MFBL 3OAWA 5HPOA 3JWNC 2DIBA 4LOVA 3SE8L 2OZNA 1P7KB 2MOQA 4GRWH 5IFAH 3AREA 1WPCA 1QLFA 2HKHH 3MLWH 5HYEA 3GO1L 1J1OH 1SJVA 2A74C 2H9GA 2P8MB 3F62A 3H7LA 3FH7A 3DO7A 2AC0A 3L4VA 2YGVA 4A63A 1RJLB 1GGUA 2D7QA 3OKYA 2XWJB 3GNML 4JO1H 5C7ZA 4JJ5B 1YLBB 1W9XA 4MD5B 4OGYL 4WUUA 5B38A 2DWTA 3RWHB 3VRJA 2AZUA 2NY6B 1A7BA 1E9OA 4QAMB 5EDXA 1NGYB 2ZTBA 2A4EA 4DN4L 1SJEB 1T20A 1NCUA 4NQCB 1LO0L 4WTQA 1YA5A 4ODHH 3L6FB 4F57H 3AMLA 3NK3A 1U8CA 3A4DA 3FYEB 4P23D 1M7DA 3NG5A 1HZHH 3UTSD 5TK2A 2SEBA 3U9UB 2BWQA 5HGAA 2OKMA 1O75A 3X1NA 1TJGL 1JNHB 2VWEC 3CLEH 4HPYH 2F53D 4FQLH 4WI4A 3MJ9H 3PV6A 5CSZA 5BNXD 5EEZA 2XN9B 2FSEA 3ZKXC 1GOGA 2Q8BH 3RPIA 4WHCA 1HN1A 4Z3TA 5FUOH 4R97C 4XPFH 2Y1AA 5AW1B 4N0YH 4QRFA 3MBXH 3I3DA 1R3LB 3TNMA 4M7KH 1OD9A 1OW0C 2R1XA 2D3VA 4O5LL 5TQ0H 3CFCH 2XACC 3K0WA 4ZS6D 1BQUA 3CZLA 3RTQC 3RDTD 2R51A 1ZTMA 1I1AD 3E6FB 4NZ8A 4JG5A 1TOXA 5IKCB 3T0VA 3QEQB 3QNYB 1CDYA 3RWJA 4AQ1C 2HG0A 2IMMA 5AEAA 3MV8B 3PNWB 1SLUA 4PREA 1F97A 5AVTB 3EFFA 3K8LA 4FZ8H 2MCPL 5KG9A 5EUOB 1DP0A 2ALWA 5IUSA 2CLRB 5SV3A 1KIPB 1XFPA 5JHAA 2IVFC 2JNZA 3FW6A 4G8EB 3V9FA 2J6EH 1FGNH 4TPRH 1NCTA 3KPPA 4OCYL 3O2DH 4IHOB 2A83A 3PF2A 3NIFB 2VITA 4MNGA 2EECA 4XNQB 2PETA 2SODB 3NCXA 3TA3D 1TQSA 1PG7L 4M8UA 3W56A 1P1ZA 2XCMC 3CU7A 3OL2A 1AH1A 1RUPH 2NY1B 3W39A 1MRDL 1SXSA 4NQTA 2V5YA 4AV5A 4TUUA 4M5SA 3DVNA 1A9VA 2HFFA 1XD1A 3L7EB 2OXGB 2VERN 1GY1A 3FK3A 2MFNA 1ADQH 5JLZA 2HT3C 4L3ED 3N1GC 2IPKB 5KBDA 4OV5B 2YQ2A 5EO0B 4BEIA 5D4JA 2EXYD 4YHIB 5HD8C 3P4MB 4ZW7A 2YGPA 1JGLL 1KXQA 1P5UB 5FK9B 1O7SA 1FNGB 2OTWB 3BZFA 3KJ4C 1C12A 5F2FA 2VRQA 4WGVB 2ZICA 2W9DL 4JY5H 4XN8A 1E8YA 3ZT7A 3EBHA 1T04A 3QDJA 2YWYA 3OKLB 3ZTNL 2FEJA 1NAKH 4JDEA 1AXSB 1XIWB 2V9RA 4KXZI 4WWKA 5EZPA 4YFEA 5KSAA 3ZDXF 5SX5K 5B7EA 3TYGH 1SDDB 5I73C 5I0WA 4L3EE 2HMID 1P4UA 2VDPL 1OO2A 2Z92B 4FP8L 4PJHA 5DFVD 4DGWC 2BO0A 1DJSA 2EIBA 3APCA 5JPMC 4L4TA 4N8PA 2A9MH 1PGRB 5F9AC 4OIIL 3TEXA 3C60D 1PQZB 1RPUA 2DMBA 3TT1H 4L5FL 4WSGA 2PXYD 5AVQB 1MW3A 3B6SB 5HDRA 3W82A 3F7QA 4XN1A 4YFLI 1L9QA 3IKKA 2YEQA 2CWRA 1A2YA 3NJJA 3B5TA 1ETZB 1VLXA 1SYSA 1NUFA 3QDHA 1BVKA 4TNGA 3B7SA 1JD7A 1YMHB 2K4WA 2QVTA 3FB8B 3QUXD 5C0GB 4XGZB 1NPUA 2NMSA 4MNQB 3DSNB 3PWVA 5E1AA 3APNA 3TP4A 1TVHA 3QIWA 1UUNA 1DSFL 3MLSL 1OM3L 4W1TA 4ZFOA 1OAXL 2F2HA 3KLAB 4IOSD 4MJ5B 5F7YC 2BY2A 2Y7QA 3F7PC 3NQKA 5E51A 1F6AB 2RCSL 1PD6A 1QPKA 3VW3H 2BRQA 3QJVB 3NESA 5IBTL 1CGWA 1TO4A 4L9LC 4W6YB 4DO5A 3P40A 5JMRA 4HGMA 3QZBA 4HMDA 3KAAA 2NYYD 2J44A 5I74B 3UPRA 4ENZA 4PJAF 1HNGA 3MTXA 5HJ3B 3EYSL 1RK1A 1YPZA 5MEPA 5DJZB 5M94B 4JDZB 4PRHA 3MCYA 1KBGH 4GAGH 2JKSA 3CC5A 3VWKC 5I18L 3N06B 2TSBA 5IB4A 5KN5A 4H1LA 3O3EB 3NFPB 1FYTD 4XC1L 3V0VB 1ETB1 3N41B 2HFGL 3EO0B 1PBYA 2UXVA 3MV11 2WZ6A 5TDOA 3VA6A 3KYNB 4H2AA 5DJYA 4M7ZB 1DQMH 2UWEE 2K3TA 4MLIA 2JLLA 3RA7L 3MNMA 5HJDA 2BOBA 3LNFA 5EOCL 3UXFA 4NNYA 4AIXA 4IMKC 2P5EA 3D5OF 2P80D 4HAGA 3QCVH 3VNZA 4DUVA 5IJVA 2AEQL 5EN2A 2AQRA 2Q5BA 5TTRA 5FF6B 4P4RB 3TV8A 2D3JA 35C8H 3SYQA 5IFJB 3SE4A 1FYTE 2CO6B 1MFCH 2KQNA 4PY8J 1ZS2A 2QGCA 1KCSH 2CLVA 4NUGH 4F15C 3C6LA 2BS71 4FYQA 4H5SA 1FL5B 3NBNA 3BEVB 1DBKL 2J1XA 1GOFA 2VDQB 4LEXL 2FX8H 4R4FH 5IMLB 2BW4A 4MZIA 1ZLSL 2E4FA 2PWHA 4NHUA 1D5MA 1IJNA 2IDTA 1M6UA 5CNHA 1QI4A 3HRZB 3HS8A 1A4JB 4S0TD 4ELMA 4WKXA 2HLAB 4X6EB 2K45A 1QLEL 2VDOB 5EO1B 4A66A 4R7NB 1QSFD 1A1NB 3AUVA 4JQXC 1TZAA 1YECL 1JZ2A 1PAMA 4OJFL 5IMOA 4DF9A 3ABZA 1YEFL 5E6YA 5E8PA 2CU9A 3NIGE 1NKRA 3ETBF 4KKLD 3FUIA 2G9HB 3GHEH 1QR4A 4ZMQA 4A2GA 4OZGF 3BGFB 3VRIA 4HUUB 1FE8H 2EYRB 5LBSA 2J72A 1HEJC 4NO0B 2VIRA 2NTFB 3P0YH 4YWGH 4YXKL 2OCJA 1QSFE 4X7EC 1DLHA 4GRWE 3CPUA 3TBSB 2VDNL 4FYRA 3MV9B 3W9EB 4JFDB 2WMPB 3T65A 1E3ZA 1H3TA 2BDNH 2H32A 3IJHB 1ZE3H 5CJXC 5IB3A 3GGWB 1PX3A 4QKTA 1FRGL 5PAZA 5IVXA 3WO4B 3Q05A 2DMHA 4N4YB 4EAEA 5ID0B 3D69A 5IW6B 1ROCA 2QVIA 4MD0B 1LGVA 3QGVA 4OGQC 2PP8A 5INDB 2A6KA 1V7NH 4YDZA 1NCDL 4TLKA 4ZUVA 5DZJA 5TE7L 4X5XA 5IG7B 3VD9A 1A47A 3IPEA 4YPJA 4W9JC 1XDTT 5T1MB 5BJTB 3VVWA 5D6CB 3UTZA 4HKBA 1G6RL 5EBWA 1ULVA 2R1WA 2IBZX 2V8MA 5E7FA 1INQB 1A6VL 1OAUL 1A4KB 5DZ9A 3SKJH 3GMNB 1XGZA 2RFXA 4G8FB 4NN5B 2B1AH 4FQCL 3DARA 2W0FB 4PJDF 4HIQA 3T1FA 3VQLA 5FYJL 4OJAA 4YSEA 2BS9A 1RVFL 3JV0A 5ICUA 6PAZA 3O4OB 4OCXL 5IJDC 3L95A 1MLCB 2IH9A 2X1WL 3S4SA 1ZSDB 3SE6A 5DC0A 4NI6A 2HN7A 1KXHA 1RHHB 3QRGH 3IETB 3GBNL 4XO5A 5DQ9A 5H8DA 5L4IA 1FAIL 1BREA 2CHZA 5LUMA 4FQJH 1IGYA 5DLLA 4AJYV 5CKAA 3LD8C 2H3NB 4E0RB 3A67H 4NT6A 4QRTA 4NIKB 3QHZL 4Z7QB 2BMKB 1T2XA 5T3ZE 1FF5A 3SO3B 1O7VA 2CDEB 2VC2B 3AU1B 4LRIA 1JZ4A 3Q1SL 2J8OA 3FRPA 3JWOH 3OC8A 4NCC1 4MAZA 2BVEA 4NN7C 5IB2B 3MNWB 1IE5A 4PJIF 2RALA 3ZO9A 4LPCA 3ML8A 4OD1H 1RZIB 3L1OH 1MRFL 3IMUA 4DPBX 4LSUH 4RX4D 2RAMA 2FL5A 3GSRB 4JQIL 1O9ZA 4JDTL 5AZEL 3CH1B 3BYTA 8FABA 4G9DA 1J9CT 4H40A 1ZHNB 4PJFF 2PTTB 2DYRB 3AW5A 3CC1A 3Q43A 3NCYS 5BW7C 5KJ7E 4DZ8A 1SHMA 3HZKA 4OSUH 4RESB 1TFPA 2ZUQC 4MRBA 4RMRA 5E8DL 4FTVD 1ESOA 2B4CL 2FATL 3IB4A 1KCRL 2OMXA 3UMNA 3UJJL 1EAQA 3C6SB 1MIEL 3L3KB 4WHTA 4YOKA 6PCYA 1UM6L 4HK3J 4OB5H 4UU9A 4NPKA 4XE0A 4BZ2L 2FIKB 1TJXA 3BT0A 4Y8DC 4ZZFA 4K73A 5EZOH 4DKTA 2C3WA 3I6SA 1N59B 1HDMA 4TULL 3WGUB 4HC1H 4PUBH 2DY2A 4CBZA 3RX5A 4LXFA 2D31B 2X0WA 4B60A 4KK6D 4RMQA 2G9KA 4JM4H 5G5DA 5C2BL 2D0HA 4HUNB 3WXVL 5D9SB 2DQTL 2XTJE 1ZKAA 2C9UA 3MUGA 4LSRL 4S1DD 3V4UH 3QJQB 1ZANL 1SHWA 2Q8AH 2CH8A 2F15A 4QOKB 4BK5A 5SX4I 1I1RA 1G1OA 2V9UA 1HX0A 1LMKA 1EFQA 1L0QA 1W72B 4B9GA 3ZYJA 3V2AR 2B2XL 2Z7UA 1A6ZB 1UWXK 1A7OH 2K0RA 4GBXA 2IH1B 4QRQB 1HYSD 1XB6A 4J4PD 3FH5A 4KAQL 2CUAA 3E3QC 3IMVA 4NLHA 1PFCA 3CN1A 1ILSA 3NJHA 4JFSA 2I7SA 4NDMA 1R1CA 1CICD 5I2IA 4U6VL 1K2DA 3L3DB 3ORJA 4JO4L 3UABA 1NFAA 4XH2B 3VXOB 3O3AB 4FA6A 1BJ1H 4RNRB 2A9AA 1I7RB 1U6AL 3HLAB 4HMEA 3UBGA 3KPMB 3QQ4A 3N3EA 2FCBA 5CJBA 3WFZA 3ULVE 5HGDA 5I6XC 3V0AC 3K8MA 1HH9B 1UJ3A 4PHXA 4PJXF 5ENWA 2G3XA 4ZAKD 2DN7A 1E5YA 1JGEB 3G5WA 1FZMA 5C08E 1XF5A 3IFNL 4NRXA 3DLQR 5DI8A 3VXPB 5E7BA 3W9DA 1AHKA 4PP2B 2DMCA 1A64A 3QDMD 1A7QL 3L54A 1BOYA 2YARA 3OGCA 3QE5A 1TFHA 3OZLA 5L8KB 4P46C 1NSNH 1D5ZA 1PPIA 3KBHE 4PJCF 4P5MA 4QXGL 5E23A 2FNBA 4KJPD 3V4PH 3OAZH 1V3KA 4Y1TA 4QRRE 5BUPA 4N3TA 4N24A 4GT7A 3T6WA 1N64H 1QKZH 4LT7A 1PJ9A 3IDXL 3UZEA 4LSTH 4O4YH 3ULSB 2WXLA 3SO5A 2DWSA 2L7QA 3JWNH 3ZKSD 1V3JA 3ESVF 4M5YL 3Q6GL 3RFRA 2LU7A 3IGUA 1G9ML 2HT4C 3O41B 3REVA 4JAMB 4XCEA 5BV7C 4HETA 4KJQD 4HCRL 4P23B 5I0YA 4NKOB 4W81A 1YHPA 4I9WD 5DHYB 1I3UA 1T22A 1TQCB 3IDNA 4L8DB 5F70A 5C0IB 4XVUD 3ZMEA 4Q6YA 2BVPB 4YZFE 5FPIA 3BSGA 3PJSB 1DDHA 1WAAE 2GITA 1MCFA 1JTOA 6TAAA 5T33L 3UTTD 3IRZA 1KZYA 4LBAA 1I7TB 4TLTA 2WY3B 5T1KA 1D5BA 4DQOH 2H3KA 5E03A 5IT2L 2R29A 3DNKA 2R2EA 5IEHB 2IADB 4FULA 1D6EA 3VFTA 2Q9OA 1KJ3L 4FZEL 1FORL 4UOJA 3V5HA 2LTQC 4X7SL 4HS3A 4HKZB 2VLMD 3H0TB 3SDXB 1OT1A 3OV6A 1SZNA 2J8UF 3MLTB 3GSVA 3RDTB 4RMBA 5JDSA 1I1AB 2DWDB 4QUOA 1NCBL 1MREL 1EDQA 1DJWA 3HI6H 4UDUA 3VI3F 3VNYA 3UTTE 4PV8B 2K3HA 1MJ8H 3HC3H 4YHLH 4WFED 1WAPA 3LNGA 3UYPB 4F8QA 4UB0L 3QXTA 3IKCB 4UM9D 4XXWC 1AE6H 1AD9A 3WENA 2WXJA 4XO9A 4XWGH 4GUPB 4HQQH 1KTRL 1TITA 3QZLA 1FZKA 2VLME 4X4XA 4FNPA 4FL4C 4Y4HC 2PYEA 2AEPL 4WWOA 3AB0B 3F85A 3TA3B 1A4CA 1Q38A 4EI6B 4A6YH 3LKQB 2ADFL 3DRTA 4LASL 2Q3AA 5DRWB 4TL5A 4N22A 2HSIA 2G2RA 3X11A 5ADOL 1I3VA 2PYFA 3RPBA 1CGXA 1N10A 4WFEE 1UH2A 1S9YA 3CZEA 3RWDB 1CFSA 4CMMB 1B0RA 4QF1A 3LXBA 5D1QA 5FKAB 4A2MA 3NJIA 4JMNA 3T5WA 5I16A 4OLVL 3OLGA 5DMIH 1ZVSB 2JB5L 1YY8A 3OF6A 4AQAA 1EXHA 4ZD3L 3Q8AA 1PZDA 3CIQA 2I5YH 3B1UA 4NHCH 1IQDB 3U79A 4L3EB 3NT0A 2X4NA 3VGFA 3EBAA 4MQXC 3ARTA 3D25B 3LB6D 1NGWB 2X4RA 5EA0H 1MWAA 1RZ7H 1OP4A 5LWYH 4D8PB 3QJHA 4NC1E 4R0LA 3V6BR 4G7SB 3V6ZB 2HRHA 2DBLL 1Z3RA 3Q9PA 1TLKA 2FX7H 4BZ1L 5I19L 1MFDH 3BCDA 1KMGA 4OQTA 1UFGA 4PB0H 3O3DB 3KWUA 4XAWH 3BZ4A 2W65A 1EZSA 1S9XB 1U92A 1MJ7H 3MHZA 2BINA 5F96L 4OLXL 3B2VH 3C60B 2YD3A 3FB6A 2OZ4H 2PXYB 2FJGA 3OKKA 3OR6B 2FEDD 3UCQA 1KN2L 4PCSA 1K5NB 3P4NB 1W16A 1N9PA 2Y2YA 3ECQA 4W68A 2XXFA 5F3BB 1IAOA 1HKFA 2XWEA 4KHTL 5TD4A 1R0AH 2VJ0A 2EYSB 1G9NL 2LLLA 1DQJB 1LP9F 3OB0K 1SOQA 1QD0A 1KSRA 1WZMA 4XNUL 3QUXB 3BP7A 1VEPA 4JPWH 3IFLH 5I8OL 1XF4A 3JUYA 3QDJE 4IEFB 1PDKB 3TEZA 3D18A 2CO7B 5IREA 1QEWB 5AB0A 4AVJA 4PWKA 3VXMA 5CEZH 3RKDC 2XIBA 4HIJA 4RGNC 1N68A 4GW1B 5DK2B 4PY7B 3VXSA 1J86A 1M7IA 3AITA 3O6LL 3HR6A 1JMXA 1EERB 5DHMC 2YRLA 4G7YL 1ZTXH 2WTRA 2W59A 2XG4A 2ATPA 4O2CB 3CD4A 2B16A 4APQD 1BQHA 1E6OH 3SKMA 4ZNEE 5A3ID 3MJGX 1J87A 2J56A 3FB5A 4U1SB 4YSUA 3GK8H 2ZX6A 3EJRA 4BH8A 4U3SB 1CLOL 2YPLA 4WI6A 1FYTB 5C9JA 4Z76B 2FGZA 3B2MA 4XPHH 1SJHB 1OZUA 1J11A 4MMXC 3HMWH 5CCJA 3FT4B 2C4FU 1TZIB 2VJ8A 1EVTC 1A3ZA 1TJHL 4H7VA 5LXGL 1CFMA 1IV8A 2DAVA 1MVYA 3RUGE 4AIZB 4YX2H 5ISZD 4IBVA 2NQ3A 3FTUA 3QUKA 5DD3H 1YQVH 4FFZL 1Z7JA 4QXUL 1VCAA 4XP9L 4FQHA 4BSVB 1TPXB 4GKOA 1QBBA 1OSPH 2F58H 3ZHDA 3LPGA 3M17A 2BC4A 2J3SA 4HX1A 2VDMH 4X9BA 1NWPA 3HE7A 2PW1B 3IJSA 2EEFA 5HI3D 1WZKA 3S3JA 1BQ5A 3CH8A 3NZUA 4U6YA 1UD5A 4XB8A 1I9IL 1A9EA 4K3DH 2DD8L 4JY6B 4IRJD 2XN0A 4YSOA 2AANA 4Z3JA 5JXAH 1XSIA 4XN7A 1MNUL 3NK4A 5B39A 3NIGB 2B14A 3SGDH 4YXLL 1L9OA 5KZCB 1NEPA 4PWFA 3UFIA 2EE9A 4Z3HA 2EEXA 4C55A 3MREB 5A1AA 5E9AA 3WTSA 2JCCA 2BFVL 3EGXA 4QHUA 5B22A 12E8L 2D4FA 4F24A 2FVNA 2XQYK 5KVDL 4AEHL 2BP3A 3SBWA 1QSFB 5LB1A 2BNQA 1IX2A 1JV2B 2W80C 4GRWB 1AI1L 5D7JC 3H9HA 1YEEL 3B9AA 2VE6A 4NM4H 4LCIH 2C1PA 2X4UB 5DS1A 1BVZA 1KBWA 1WWCA 4ENED 5EZJA 3DSFH 2RTTA 2OJEA 1PL3A 2OR7A 3MRIB 5DK3A 5DRXA 3QUYC 5A2BA 1XB8A 5IJCC 2WVSA 4TQPA 3CLWA 1CL7L 4GW4A 1HS6A 3V9EA 4H20L 1PNDA 2HJFB 3QO1B 4RZCA 1QWHA 3KBFA 1YEIL 1F4YH 4FJZA 4N8VG 5JHDA 4HJJL 4NIYE 4K3JH 3TIDA 3QK0A 3FB7A 5BZDB 1XR8A 2VZOA 4HIEA 4OZFH 2XYCA 3TBBA 4KDWA 3L3JB 2GSIA 2H0FA 4HWUA 1RP8A 3LZPA 2ZWZA 4OZHA 3RJDA 4L37B 3JWNE 1T89A 5D1XA 1KY6A 4WNQA 1ZLWH 1AZCA 2GJJA 4FQXA 1N7MH 4N6RB 4F80A 2Z34A 3BHBB 1TDQA 5IB5A 5ANHA 1RUQL 2XKNA 1IVTA 4LAJH 5EIIA 1JV5A 3DVGA 3VFMA 4F7KA 3OWEA 5AW5B 3APFA 1UD4A 5F0LB 1NMBH 2EDHA 1B0GB 4IOIA 5LN8A 2E7LA 2J5WA 5I1JL 2X3AA 3X14A 3U2SA 5EHFA 1EWHA 4HDIB 3AY4C 5EEWA 2X6BA 2WC7A 2Y36L 5IWLA 3Q2CA 2VUKA 4NS0A 1KT2A 1NAML 5TGBA 4Y5XA 3TTSA 2H26B 2QKIB 4X6CE 1YCSA 5B4MC 5IVXE 3W11C 2P49B 3TX4A 2ADJA 2APSA 3B5GA 3RIKA 3K74B 1PCSA 1TZ8A 3ISYA 3NPSC 1VFUA 4K7FB 4UWQB 1L7IL 1R3IL 1E4HA 4EIGB 4X80L 4GXVH 3U30B 3RTQD 3OTTA 3RBGA 3W57A 1YNKH 4HUVA 4KH9A 1UOWA 3TPUA 2C4FT 1LO3H 3KXFA 5F7UA 2GHZA 5GGQL 1BBJA 3K4AA 1MW0A 5CJOL 3OD3A 1RZGA 4M9PA 1Q1PA 1W6WA 5GRJH 3DKHA 5DC9B 3IFOA 1ZXKA 3JWNG 4YZWA 3HNTL 2XBTA 3TH3T 1WISA 1MCBA 4FQ1L 4UV4L 3ZTCC 4EQ2A 4N8UA 5F6HJ 4AXWB 4G11A 4LSQH 1HHKA 3L7FB 4GSUA 3SOTA 3CSYB 1N6UA 1C5DA 3FONB 4FTVB 4AGQA 2HXAA 4J8QA 4ZOAA 3TTYA 4ZQKB 4LPTA 2I9LA 4Q97A 2EVJA 3JVFC 1FVDA 4QRSB 4HLEA 2AK1L 3OR7B 3SDAA 3BUQA 4LMQI 2A5UA 2EICA 3QJFB 5IFHH 2AS5M 1N0XH 2N01B 3BPNC 2VDRH 5KYYA 2HT3D 3OHXC 3W37A 1D9KC 5E5LA 2BNRA 1T1XB 4LVNC 4ODWB 4Z78B 2Z8SA 5HD8D 1C5BH 1W0WB 5I0ZA 3VFVA 3F84A 1EAJA 4YBQC 1MFNA 1SXCA 1BIIB 1OQOA 3MR9A 4NQVA 1ZMYA