4HAKA

Multicopper oxidase cueo mutant e506a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHADTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multicopper Oxidase CueO mutant E506A
rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 137
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA03
2QDWA 1N70A 2Q5BA 2ZOOA 1PAZA 3UACA 1M56B 1ET5A 3T71A 3TASA 5A7EA 4EF3A 1IKOP 2DWSA 3WI9A 2YAQA 2VW4A 1AG6A 3NJHA 3RYMA 3N55A 2IWEA 2EIJB 1GS7A 3CVBA 1JERA 3FSZA 3T6XA 3V9EA 3T6ZA 1HAWA 3NJIA 2AZUA 1CYWA 2I7OA 4A2DA 3PAZA 1BYOA 3S3CB 1JVOA 2HLEB 2AVFA 5F7BA 4YL4A 1HFUA 3GYRA 4G7RB 1BQKA 2PPDA 1HAUA 4GP5B 3S3DB 3QJUB 1ILUA 1SF5A 3ERXA 1A4BA 5D4HA 3OM3B 3H4HA 2Q9OA 5B7MA 3H56A 1BYPA 2J57A 3U25A 1AIZA 1FA4A 2AANA 1NPJA 2IH9A 4A2FA 2AFNA 3EHBB 3JT2A 4GY4A 1NIAA 1J9QA 4N8UA 3NJJA 2P80D 3BQVA 2TSBA 3DTUB 2FNWA 2WO3B 3ZX1A 4YSUA 1F56A 3WNIA 3UADA 3BVDB 1NINA 2FT6A 2DYSB 2J56A 2J5WA 3FSAA 4G71B 1OCOB 4BK5C 4AKOA 1PZCA 4YSPA 3FYEB 4A2GA 1WS8A 3TU6A 5I28A 5AZUA 1IC0A 3FSWA 1SF3A 4E9VA 1KDJA 3NJMA 2PPAA 2WO2B 4YSRA 3WKPA 2JXMA 4BWTA 1JZFA 1SDDB 1AS7A 1GYCA 4A2HA 3H4FA 2UXVA 2BWDA 4KO6A 2IWFA 1A4CA 1SHWA 1ID2A 2YXVA 5B1JC 2XUWA 3NYKA 4HHWA 3NJNA 2Y1AA 3T9WA 4A66A 2YARA 1VLXA 4E9TA 1CUOA 4W9ZA 4JHVA 2XX1A 2LLNA 3FQ2A 1V54B 2XVBA 3DIVA 2R7EB 1JZHA 2Y69B 3OQRA 4GP4B 4K9JA 2XX0A 1NZRA 1OCRB 5FC9A 4F2EA 2ZWNA 1RZPA 4M4RB 1WA0X 2AZAA 1MZYA 3PAUA 4FAAB 3S8GB 3PPSA 1ASOA 1NWOA 1OCZB 1ZPUA 4RH4A 3WG7B 2YXWA 1TKWA 4CSPA 3MX0B 4UANA 1RKRA 4X4KA 5I5IA 1BXUA 1QLEB 4KNUA 3FU8A 2BP0A 2BP8A 2IDSA 4E9RA 3CZUB 3WIAA 3QJRB 1ZDQA 4KO9A 4L0PB 1OF0A 3FT0A 4G70B 4GYBA 1AZRA 2X88A 5D4IA 3X1FA 2RACA 2BP0B 2BP8B 5I6PA 1EZLA 1XMEB 2FJSA 2FWLB 3TBBA 4G7QB 4YSSA 1KCWA 1L9RA 2XLLA 1ET7A 1FFTB 2I7SA 1TEGA 5PCYA 3UGEA 1JOIA 2UX6A 2N0MA 4QKTA 1BEXA 4ENZA 4DP4X 1KGYE 2CUAA 2DY2A 1PF3A 2VM3A 1IBZA 4YSQA 1WS7A 1AOZA 2DWTA 3PCYA 3SBPA 4F7KA 3FU7A 1AAJA 1MG3C 1QHQA 1WAEA 2PP9A 1WA1X 2GHZA 2UXTA 3ABLB 1OE2A 1ZDSA 2FQGA 2HX7A 2VW6A 1JZEA 4JKNA 4P5SA 4W1TA 4CSZA 1KBVA 3NSYA 1AQ8A 2NRDA 8PAZA 2IDTA 3HB3B 3UABA 4A68A 3NJLA 2FQFA 2IWKA 3FYIB 3X2QB 3C75A 3KW7A 1GY2A 2P80A 3T6VA 2BZ7A 3NP4A 4JHUA 4BDVB 1BQRA 1X9RA 3ABKB 3WNJA 2XV2A 1J5DA 4E9YA 4A2EA 2XXGA 3WKQA 6PCYA 1NIDA 2CBPA 3OMAB 3SBRA 2VMJA 4KO7A 5EHFA 1ZIBA 2YAFA 1OE1A 1R1CA 1A4AA 1NICA 2HRHA 4FA7B 2UXGA 2HZHA 1RCYA 3SQRA 3NT0A 2YQBA 1XB3A 3IEAA 1GS6X 1OE3A 4YSAA 1NIEA 4YSOA 5B1AB 3NJGA 1A8ZA 1BXAA 2UX7A 3AG1B 2JKWA 3N2JA 3NP3A 1AZUA 3AW5A 3ZIYA 4GXFA 7PAZA 1AZCA 1DYZA 4P5RA 3PAVA 1L9TA 1JXFA 1KYAA 1A3ZA 4WTQA 1E5YA 2ZXWB 4NERA 1ASQA 3V9CA 4F2FA 1TU2A 2YAEA 4AZUA 2EINB 3FU9A 3CVCA 2QDVA 2CCWA 4HZ1A 7PCYA 1PLBA 3JTBA 3TBCA 1AANA 3EH4B 1AS8A 5TK4A 3AG3B 1PNCA 4WKXA 2BW5A 3MBWB 5AKRA 4YSCA 3ABMB 1ETJA 5D4JA 2DV6A 2GC7C 1JZJA 1PNDA 1ASPA 3QQXA 1GS8A 1J9SA 1L9QA 4AKQA 3EF4A 1T5KA 4DP5X 2EIKB 6PAZA 5I6LA 1NIFA 3G5WA 1BAWA 4HCFA 2CJ3A 2YAOA 3OMIB 2X87A 2IDQA 4YSEA 1QNIA 4HAKA 4G7SB 3FS9A 1NWPA 3QJSB 5I6KA 2GB2A 3T6WA 1WA2X 3AG2B 4HHGA 3X1GA 2YAPA 4DP7X 3DKHA 3FQ1A 1L9OA 1E30A 3NJFA 2PCYA 2VSKB 4PAZA 1I53A 3AY2A 1OV8A 1NIBA 2H47C 1PZAA 1J9TA 4ZK8A 1JXDA 3FPYA 1AR1B 1IUZA 1JXGA 4AI7A 2BZCA 2XV3A 5E9NA 4HCGA 2W8CA 5IY5B 5B7EA 1SDDA 2IDUA 1V55B 2HX9A 3CDZA 4KOBA 4Q89A 2PP8A 2DYRB 5I5JA 4YVNA 1OCCB 1MZZA 3X1BA 2PP7A 3CDZB 1AACA 2XXFA 4DP9X 1M9WA 1L9PA 1SJMA 5PAZA 4KOCA 2QPDB 1IBYA 1W6LA 5F7AA 3NSDA 2BHFA 2MRYA 4KO5A 2BW4A 4NAJA 2VW7A 4BDVA 5I6MA 4BWWA 1FWXA 3L45A 4DP1X 3QPKA 4DPBX 2QPEB 2H3XC 2HRGA 4G72B 3QJVB 3GXUB 2IAAC 3NJKA 2PPEA 2UXFA 3ZDWA 5AFAA 1EHKB 3CVDA 5B1KA 2WSDA 1L9SA 4YSTA 1XB6A 4A67A 4YSDA 1V10A 4E9XA 1KV7A 1URIA 5TK2A 1E5ZA 4HALA 2W88A 3OMNB 4TXVB 3EH5B 1M57B 2XU9A 1BQ5A 1RZQA 2PCFA 2YAHA 5B1BB 3QJTB 4DP0X 5I26A 3ZBMA 4M3HA 1SNRA 2FT7A 2GIMA 2PPCA 1UATA 1AS6A 3EH3B 4N4YB 1XB8A 1PMYA 1ILSA 3AZUA 3NSFA 1CC3A 2CALA 2IH8A 1PLCA 2GI0A 1A65A 1MG2C 2ZONA 2FQDA 1DZ0A 1W8EA 3IE9A 3S8FB 1B3IA 3CG8A 4AKPA 1PY0A 5LDUA 1JVLA 1MDAA 2YAMA 4E9SA 3FPXA 1NPNA 3TA4D 4KNTA 4UF7C 1NDTA 3NSCA 3GDCA 3HEIB 3PLYA 4HIPA 4DP6X 3QJQB 5B7FA 1E67A 2A3TA 1NTDA 3IN2A 4YVUA 3S3BB 1ZIAA 1E65A 1OOWA 2JFCA 3KW8A 1BXVA 4HCIA 1KDIA 3X1EA 3IBOA 1PLAA 1KCBA 3AG4B 2PPFA 2VN3A 2B3IA 4NB7A 2I85A 4BWUA 2E86A 1SFHA 2J55A 4Q8BA 1W6WA 3PXLA 2HX8A 4E9QA 1J5CA 2XV0A 4UAHA 2B08A 1YLBB 4BXVA 5ANHA 2OV0A 2MTAA 2OJ1A 4MFHA 2FTAA 2IDFA 1AZNA 2XWZA 4GP8B 1ZV2A 4QLWA 3D12B 5B1JA 2OCCB 4PCYA 1PZBA 1CURA 5B3SB 2GSMB 2VM4A 1AZBA 5I6OA 2EIMB 2BO0A 1KBWA 2FQEA 3ABGA 1ET8A 2H5UA 4DPCX 2TSAA 1JZIA 1SHXA 2HXAA 1ADWA 1CYXA 4BXSV 2XYBA 3OD3A 3X1NA 1TEFA 4KNSA 3UAEA 2CAKA 3ASOB 2PLTA 2FT8A 1J9RA 1GY1A 1PCSA 3FU7B 1N68A 2VSMB 1GR7A 3ASNB 4DPAX 1GSKA 4DP2X 2R7EA 3IN0A 3UAAA 4AX3A 9PCYA 3FSVA 1X9UA 3FQYA 1AG0A 4E9WA 2GBAA 2EILB 2QT6A 1SFDA 4DP8X 1GW0A 2BWIA 3SBQA 2GC4C 1JZGA 5I6NA 5I5MA
chains in the Genus database with same CATH superfamily
1A1OA 1H19A 2ZOOA 2MPAL 4PP1C 1Q94B 3EJZD 2IBZX 4LPYA 1BZ7A 5FO9B 5CCHE 1TETL 3DMMA 5ELIA 1B0GA 2AXFB 3OJ2C 4LSUL 3VD7A 1UQSB 2ENSA 1LK3H 2VW4A 1D5IL 4TQEH 1QQDB 1H3UA 3C5ZA 4OCWH 4WHYG 3H42L 1E0OB 1HH9B 1JERA 4NRYA 1KPUA 1HAWA 3DOSA 3LS5L 8FABA 2VDQB 4UBDD 3L6FA 2D7PA 4K7PY 4XCCL 5F9JA 5HPOA 3HMXL 2LGNA 4YL4A 3NCJL 5FA3A 2JCCA 4KC3B 3V5HA 1I8LC 3PJSB 4O2CB 2IANB 1PG7W 1HAUA 4MJ5B 1ILUA 4P49A 3U7YH 5KBDA 4WEEA 5GZOD 35C8H 3CPLA 3QIBD 2F7OA 4WTZG 3VRJB 4RZKA 1IGTB 5IBLD 3CU7A 3QUMB 4L4JA 3HG1A 4G8GE 4LGSB 4W4NA 3UYPA 3QUMH 2J5LC 4CC0A 4MA7H 4PGEA 2IH1A 4M5ZH 4PJCA 1CGUA 2FYYA 4M7ZB 3Q7JA 1F8TH 1W8OA 4PMEA 4TYUA 3NJJA 1NFDE 1ZCRA 4PHZA 3FF8A 3QEGL 4PRDA 4AM0B 1SVCP 3U9WA 4XTRD 2IV9A 2VDRB 3BAYA 3BH9A 4KVCH 4EO5A 4YSUA 5I0DA 3RBGA 5ERWB 2CQVA 5E5MA 4N26A 4G9DB 1ZHKA 2KH2B 4UNIA 2A38A 2XBZA 4MDIB 2R23B 3V4VA 1QFWI 1L6PA 4GO6B 5ILTH 2E46A 4N8CH 1MCWM 2WNWA 4A2GA 2CGRH 2PYFA 1OK0A 3CBRA 3VD9A 3JUZA 3RGVC 4NC1C 5CU9A 3P4OA 2EVFA 1H9VA 2NY5C 2XWCA 1N8ZA 3WN5A 1T4KB 5ICXA 3FT2A 4PBDA 5JPMB 4N9GB 4X0NA 5LNGA 2HMID 1SHWA 4OJEH 4EDXB 2YA0A 3L7EA 3MUGB 3DC0A 4L0YA 3IKCB 3B2MA 4XCNB 2Y1AA 4KKAD 3C6LC 2AGJL 3BP4A 4XBMA 4MBRA 4X6CB 1Z9PA 2EXYC 4W9ZA 3IGKA 1VHPA 1MWAL 4K9JA 4Y2DB 1F3JB 4KHTH 4ZFZB 3VFTB 3OZLA 3ZOAA 5L2JB 5DD1H 3BEWB 3QPXH 4BZ1H 5IEHB 2IANA 3OKMB 3BQUB 4YHOL 3OKKA 3DPBA 1KGUA 3U4KA 2EEBA 3NFPA 5L2KD 1KTLB 2BXZA 1JGEB 4KAQH 1BZ8A 4W68A 1I3RB 3GMRA 4UANA 5T5FH 4AG4H 5HSFA 4KITB 5F1KC 4F1SA 4FG0A 2IDSA 3EUDA 3HMWL 4X6CF 3QP3A 1CFTB 1U8QA 1N4XL 3FT0A 2WIMA 4MA3A 4YGVB 5DHYB 2WSKA 5DJ8A 4UWQB 3NPZB 4W4OC 2N4IA 2BNQE 3EDKA 5EN2B 3GZKA 3SZKC 1LD9A 4KK6C 4D8PB 1CD9B 4QRBA 5DRXA 4Y2DD 3FT3A 4OLWH 2Y2WA 4HMDA 5CP7B 3V6FB 4E5XB 4JM0A 1N6QH 1CWVA 3IMBA 4X8GA 1U8OB 1YYLH 2GTQA 3LNGA 4MD0A 4LSTH 2AC0A 4XNBA 2D31B 3SJVA 2XQYG 2YC1B 1HYRC 5FS5A 4DEPB 4TSAH 2ZUXA 4UOJA 5EULV 1WBZB 4AEHL 5D7KE 4BGLA 4AIOA 1KCSL 2J8UE 4IBTA 4R26L 5A2JH 3HPJB 1FG2A 3UAJC 1U3HB 1CXHA 1YEFH 4JKNA 1DL7H 3AMKA 1S46A 2VABB 4F7PB 3GUFA 4KZEL 3S98A 4IRZH 3NSYA 1UD2A 1CXIA 3OR7A 5D96B 4GPVA 4B3EA 4PJIE 4YWGH 1MVUA 1MCBA 4YAQA 3L3GA 4CW1B 2A9BA 4OZIE 3MBXH 4XCFH 3ZMNA 2JK5B 4XXDB 4OQTH 4MZ3A 4BDVB 1IAIM 4PREA 4ZMZA 1LEKB 5GSRB 2PCPA 4XX1G 3WNJA 4U6YA 1QTYT 1JPTH 3Q2LA 1IVTA 1NIDA 1UM6H 3R4RA 4KV5E 3O3UN 4I9XA 4POYA 3BD4A 1AC0A 2Y3AA 4KO7A 3S9DB 4FQXB 5E9DE 4F8OA 4M8VA 3HJ0A 1QABA 3WFCH 4UTBH 1OIOA 5AVWB 3PWJB 5K9OB 3KYNB 3UJJH 5DD1L 3MLXH 5B21A 3SQRA 3N40P 3LN4A 4LLQB 4Y1AB 4NOFA 4AGLA 3M1CA 2Y7MA 3ARWA 1XGYL 3D52A 1R5WA 4K3DH 1BIIB 3S88H 2HKHH 5AWNL 2Y6TE 4JFOB 4JR9L 5C6TH 1FPTL 2NX5A 2F5BL 3W9EA 1CGTA 4Z77B 2XJLA 4AEFA 4UUJB 4LP8A 5D7IE 3D06A 4QRRE 1XH3B 1XCXA 3A4DA 2CJTA 3BE1L 4NXKA 3VXMB 3ESOA 1KELL 3FONB 3OPZL 3PRZA 1Y1UA 3EFOB 1AHWB 3NZHL 3GBNH 4JQIH 3PAVA 2DM7A 3BAWA 5H37H 3LAFA 4KXZH 1VJSA 5GGUB 1J05B 1MLBA 2NY0C 3UBXB 3WD5H 1ASQA 4Y16A 5I74C 3GD1C 3ARBB 5J3HC 2EINB 3PWVA 2DQCL 4OGXL 2E7BA 3GSQB 1ACCA 3KPPB 3P4NB 4FG6C 4F8NA 2J8UF 2RQEA 3N44F 3MAWA 5ACLA 1JZ5A 5C07E 3AUVA 3GT6A 2X70A 5J12C 4KZDH 4FMVA 4ETQA 2HKAA 3UPAA 3SIKA 4ZTOL 3RJQB 2H26A 5KS9E 2HLAB 1MFNA 1MCEA 1Y18B 4ZSOE 4GAGH 1I85C 2CKBL 4OM0L 3Q8AA 4UTAA 1BX2B 4NN5B 2ERJC 1RPQA 2FJFA 1QSFD 4GMTH 2CRMA 2WGXA 3QWNA 1T5KA 2EVHA 3SD5A 2ZOWA 3QDMB 2PCFB 4HJUA 4BQBA 2YAOA 3LH8A 5IF0A 4QNPF 5DYOB 4A7VA 2YMTA 2NSXA 2NX5B 2ZUSA 2RALA 4FFWC 3W9EB 1ZA6A 1G7MA 2LU3A 4GQPH 4M6AA 1RV6X 4ZJ9A 2BCKB 4XAKE 1RZIA 3KPQB 5BXFB 4WUUE 3T6WA 5JOFA 15C8H 3WAKA 1DUYB 4MCYB 2G5BA 4P2RA 4XCCH 4AQ8C 3LPOA 4YNYB 4G2AA 4WJ5A 3SO3B 4APQD 4JRLA 5GQBA 4PAZA 3FB8A 1UXMA 2W0FB 4YR6B 3VCLA 4N25A 4GKLA 1FE8H 4OLUH 4OT1L 3FPYA 4PYHA 1AR1B 3DSFL 3KPNB 2DYPA 1VGKB 1IGCL 3PJSA 4OCMC 1M4KA 2HX9A 4ZMXA 4FS0A 5I5JA 1T6VN 1A02N 4I5BA 3EKCA 4FQXC 1RL1A 4NPKA 5DVMA 2WQUA 5C0AB 4WCYH 3ARUA 1X9LA 3RX9A 3CZLA 4DP9X 2YRBA 1KCVH 4ANWA 1L9PA 1SJMA 1F45A 4O2FA 4F8TA 2HVJB 4LRIC 3ZL1A 2JCCE 3TH4T 5IESH 4JQXC 4OB5L 3BT2H 1OP5K 3GSNA 2ZOUA 4BH7B 1NAMA 1DJIA 1NFDB 5J1TC 4XPTL 1NFIB 3BUBA 5TF0A 3VFMB 2C3HA 5I1LA 3Q8FA 4K9EH 5LXVA 3EO0B 3IU3A 3ARDD 4MQXC 3ISRA 4HZAA 2VQ4A 4K07A 4MAYA 2OL3A 3HG1E 2EECA 4H4NA 5DZNA 4A67A 1N59A 1XR9A 4X5XB 5E08H 3GRBA 4KKNA 1E5ZA 4WSJA 1UA3A 1N5YL 3TEXA 4UILH 4TNVF 4Z0XA 2C1PB 2XQYA 3MUHL 5B1BB 2DF3A 2ZYSA 3EH2A 3L3JA 3HS9A 5GS0L 3C60C 5CIPB 1VFOA 1IGFL 2OPCA 2WWKO 2F61A 3I6LE 4LK4A 5TE7H 3ARGC 1D9KA 5LBGA 2BS71 3GLDA 4N4YB 4Y5VB 1T5WA 5DD0H 3WYRA 3I75B 5AUMA 2HFTA 1CGYA 1EFXD 1CCZA 2VQUA 2GSIA 3U0TB 2IPTL 5E9DB 1DQJB 2ZONA 1A7PH 4OLXH 3MBEC 4OGXH 3TWYA 1QI5A 1JZ7A 5AOKA 1H0DB 1ZT4B 4PJBA 1G7QA 4F33A 4GSXA 4QJ3B 3RWGB 3V4VL 2VO8A 3EYOA 4EBQL 4NNPH 2YD6A 4JRXD 1A6UH 1RUPL 2JTDA 1NLDH 4NSKB 1BFTA 3KJ6H 2BHZA 4JE4B 4PJXE 3GRWA 4NP4L 4RZCA 1E9PA 3MHZA 1FIGL 2OTWB 3FU3A 3QDHA 3T8MA 4EZLA 5E1QA 1S9VA 2OJEA 1TR7A 3K8LA 1BXVA 3LZFH 3BAXA 2CK2A 3L16A 4NC0B 3RVXC 1AFVH 4LVEA 2J73A 4OIIL 3W39A 4ZPVA 4NB7A 2NY4C 2AV1B 4M6MH 2VLRD 1W6WA 1DBMH 2XT1B 4BFKA 3Q2NA 1Z0MA 2X4UA 2F7IA 5J9PB 3FQUB 1G7LB 1JI1A 1CLCA 1V7ML 2VDPH 1D6VL 5AYTA 3VH8G 2EH8H 3GS7A 2E47A 4MDJA 3QCUH 4NN5C 3QE5A 2NY5H 1AZNA 4GMSL 3T3MF 3VFGH 3MLWL 2J88H 3GPSA 3O9WA 4AMXA 4I0PD 3RVTD 1DVFC 1LMKA 3IGLA 4HWBH 3NRFA 3BWZA 5I6OA 4OCXL 4QRRD 4PJCB 2X0UA 3PWVB 4DKTA 2GY5A 2ZX6A 2NNFA 3HW7A 1QLFA 1A3QA 1TMQA 1F11B 4NPYB 2AABL 3NEOA 2XN1A 3BAKA 3INUH 4Y4HD 4P2QE 3Q01A 4L37B 4W6YB 2FT8A 4LPVA 4ZUWB 3IS0X 3RTQD 2K8QA 3A0OA 1U8PA 3BGFB 4W9FC 1NL0L 5DJXB 8CGTA 4AX3A 3ZTDC 2HFEB 2ICEB 3L4ZA 1EFXA 1DLFH 5T5NF 5E95B 3TEYA 3BRFA 1SVBA 2F18A 3VD2A 5HHXH 1JPSH 3CSYB 1JD7A 3OHMB 2A6KB 3SBQA 3LN4B 4DAGL 3LZOA 3M07A 4EEEA 3KYNA 1EH9A 4MZRA 4B9ZA 1WIUA 4I0PA 2FIKB 5FGCE 3VXRE 4KJQD 2WOBA 1A0QL 1IEBB 2DWSA 5F96L 2H45A 4ZFFA 5FO9A 4LARH 2VWEC 4TNGA 3F7VB 1E6OH 1N0LB 2G3XA 5AW9B 3T6XA 4DVBB 1GYUA 3F12B 3IJEA 3V9EA 1J8KA 2AZUA 4A2DA 2I7OA 2OMWA 3PAZA 5IUSA 1M7DA 1EEYA 5EU7E 1AGBA 2DMBA 4WUUD 1T0MB 1UWXH 2JK5A 1F97A 43CAB 1TLKA 5I82A 4WI2A 4DESA 4V11A 3ERXA 1A4BA 1KBPA 1TVDA 3OM3B 4B3VA 2Z1PA 3QRFM 3L3OB 4XRCB 3TBVA 4CDHA 2P5EA 1JGLL 2QKIA 1MHHA 1XCTB 1Z6JT 4GG8A 4QXUL 5EU7C 2C3VB 4ES9A 2EEDA 3K6SA 2VISA 4ODXB 2XG5B 2IH9A 5ITBH 4G8IB 3WJMA 5GGRY 5E1HB 1OO2A 2BWQA 2OR8A 1N26A 5IMKA 1JZ2A 1WIPA 5SV4A 3DK2A 1AD0B 3DGGA 4MZ2A 2IH3B 4GJTB 1ZWIA 4LLMB 3E0GA 3FSAA 1ONQA 3OLDA 2CLRA 3TS8A 1PZCA 4OF7A 2AJZB 2O5XL 3QUZB 5ACZB 1KIRA 3FT3B 1OAKL 5CR8A 3N41F 1WS8A 2E9WA 2WCPA 4OLVH 1T20A 3FSWA 5D1QA 2WYHA 5KVDH 4E5XG 3NIFF 4QKXB 5EU3A 3DTXB 4YGVA 2AHIA 2EUZA 2CO7B 2QLVB 2O6FA 3MFFB 3GEFA 7CGTA 5E8NA 4DKFL 3E6HB 4QO1A 3ZYJA 5E6SB 4Z7AA 5B3JE 2VXVH 1CTNA 3MRRB 4KVCL 2Q86A 4POZD 1S7SA 2A4EA 5FIEA 2D4FA 5FFGA 3KXFD 3N85H 4WNSA 3T9WA 2Q7AA 3K74B 3NFPB 2YD0A 3LMJH 2XX1A 2V5YA 2Y69B 1SBSL 1R75A 1HU8A 1WIOA 2ESVE 3DHMA 1A6WL 3LN5A 3T0EC 1RPUA 1HXYA 3CSTA 3LPFA 3MCG1 3TNMB 3V5KA 4Z7NB 1RZPA 3MCLL 1MZYA 4H1LB 3U2JA 2JXMB 3T1FB 1ZPUA 1OCZB 4V1DA 1ZSDB 3QEQB 1GZQB 1TQUA 1XMWA 3SOBL 4CSPA 1XBRA 3G5ZA 2GCYB 4C58B 3N5AA 2NT0A 5HHQA 4GRWB 2NOYA 4AV0A 5IESL 3D39B 3MROA 4ODVH 3VM7A 1LO0H 1ZY9A 1BBJB 5ADPL 2X4RB 5J8OA 5KBPA 1TT6A 1EZLA 4AENA 4YHYC 1F4XL 1CIUA 4JZJB 5HPMB 3RWIA 2FJSA 4XMKH 5JHAA 4JRXE 4KJWC 1L9RA 1MN4A 4NQDE 4R4FH 2CKNA 3DGCR 3KXFA 1EO8H 1QEXA 2K7QA 5CS7A 3VRLE 3DUUB 3V4VB 4M4RA 2F54D 3ECUA 5DGRA 1KGYE 3S2AA 4M7KL 3REWB 5ERWA 2EO9A 3APMA 1EO5A 1KCKA 3MODL 3KL0A 4ODBD 4XMPL 4XOAA 3Q3GB 5H37A 4K3JH 2EZ0D 5D6DC 1CLVA 1UJTA 5HJBA 1YEEL 3EYUH 5DHVH 3TOPA 2ZXDA 1S5HB 4U1KA 5E70A 2BVUA 3MR9A 3O8XC 1IEAA 3TBYB 3GSWA 4P5SA 2Z91B 4W1TA 3EG9A 1OAUL 5IFJB 5GRZA 3DXAD 5HVHB 1QZ1A 4JN1L 1UD8A 3WFZA 2W07B 2WXGA 1SXBA 4S1RL 3FYIB 4EN3D 1CD1B 1B4TA 1E2WA 4PI0A 3GNMH 1UEMA 5ANMA 4BBWA 1DLHA 1I7TB 1ZT4A 5E24E 1L7TL 2A9NH 4JHUA 5FYLL 4FXKC 4JW3A 1C7SA 3WLBA 3S7GA 4OCLC 1UACH 4PJEB 1VACB 4NC2B 4FERA 4PJFE 4NJAL 3N50A 5SX4I 1QYGH 1JXJA 4AYEC 2FNBA 1HH9A 1SM3L 2R0KH 4L48A 1REIA 4X6EA 5AB0A 1XDTT 1T5WB 1O7DC 3RG1C 3VI4A 3N42F 3GQFA 5ALCH 3ULUF 1OF2B 2P5WB 4U4BA 1MCLA 2IOMA 1R3HB 5DS1A 4I88A 5GGVH 4RIRB 3HB3D 1KJ3L 4P3CH 2BVQA 5IHWA 3GXIA 5GZNA 5D7IF 3DLQR 3NZHH 4NFCA 1LO2L 1E27B 3WDHA 5C0CA 2EIZA 1QMUA 4L3EA 2OTUA 1HT6A 3VJ6A 3AGWA 3N2JA 2CNZA 2DW5A 3CUPA 4MAZA 2H8PB 1WFNA 3GXNA 2OL3L 7PAZA 1SUJA 2ALWA 1ZHNA 1MFAL 2Z7UA 4QI3A 4MJID 5DEFA 1AKJB 1OALA 5AWNH 1SVZA 1OP5H 4HH8A 1XGYH 1IGJB 2ENJA 1YC8A 1T04B 4K3DL 4IKIA 3RDTA 3GJFA 1OOAA 4QR7A 5K59F 2V8MA 4N22A 2KS0A 2Y25A 4XVSH 1DQDL 4MZIA 4CU7A 3JTBA 3BHBB 4HLZG 3TBCA 1AANA 2LHAA 3EH4B 5DS2A 3D07A 1WH0A 2DMCA 4WKXA 3WL9B 5IGXH 35C8L 3ZDXB 1G1OA 4YSCA 3ZQ9A 5ID1A 3GK8L 2PW1A 3U7YL 5TH2B 1V3LA 2EDKA 3QDJB 3Q2CA 1OSEA 2WVSA 3QQXA 1GS8A 2PYEE 3QNZA 4IJ3B 2GVYA 4GG6F 4UQIM 2YD8A 3OQ3B 4EQ2A 3C5JB 5IROA 3LIZA 3DXAA 4DP5X 1X9QA 2FRGP 4AT6A 2QL1A 4HCFA 4EN3A 5AOLA 2XQ0A 2H1XA 2V5RA 3K81A 1X5KA 1HSBB 4LU5L 4F80A 3JWDH 4B9GA 1IBGL 3BPCA 4G80A 4AOFA 4F7TB 2GB2A 2XHNA 1IKFL 3KEHA 3M17B 3ZO0A 4EN3B 3C9NB 4NZDA 3WHXB 4AGMA 4KK6D 4R90L 4NT6B 2EEXA 1KCSH 1ES0B 1QBML 2BCKA 4FI7A 5CBEB 2FECI 3HZYB 3RBSA 2BIOA 4FFYL 2XWTA 5K93A 4ISVB 5C0JB 1K9TA 3SDCC 5IMOB 2BSRA 4HEMA 4H40A 4OZGA 3L8QA 4BM7A 2D4DA 3IMSA 3VWKB 5GS1A 1H8LA 3JWNC 2CK0L 5KANI 5JTWA 2KPWA 2IDUA 1I7ZA 3DJZA 1SLVA 1WD9A 4QXGH 3MOBH 3UTSA 4G59C 2KDGA 1MFEH 3L1OL 4MAYC 5I6XB 1DSWA 4IIZA 1E4XI 1JMZA 3IXTB 4ELME 2ZWLT 1QO3A 2QVIA 5F7NC 1PZ5B 3AROA 4GSDL 2JWYA 3VUAA 5FYKD 5FUOH 4BWWA 4QRQA 1JI2A 3UTPD 3ILDA 2BSBA 2N59A 3PNWA 3QO0A 5BO0D 3ARBA 3PL6A 2BOCA 3ZKXB 2OI9C 3PREA 1HHKB 4FNRA 2OTUB 4KI1A 2IAAC 4XI5C 5DJ0B 5BPPA 1NANI 3INOA 5H4ZA 3JZYA 2NY1B 4AH2A 4CNIA 4NUJA 1J8SA 4GKZB 1UD6A 4WV1A 2FUTA 4O4YH 2FL5A 1KV7A 4HUWA 2ICWB 2IOOA 3VX1A 1EBPA 2VUYA 1YNLH 4LLUA 3D0VB 4IBLT 5LNDA 4HJ0D 1ZGLP 3VXSE 1MRFH 2HJKA 1R5WB 4MCZA 2VZ3A 3AXLB 3QJTB 4E36A 3QNFA 4B5ZA 4GKSA 4ZW3A 5HY9B 3CE1A 2XBTA 3V5DA 2QADB 3ZBMA 3MGTB 2Q20A 2K9FB 1M2VB 5I76B 2GIMA 1N6VA 3JTTB 3O3EA 4HXBH 1R0AL 2C9XA 4N1HB 4PGDB 1UA6H 2EDJA 2CRIA 4MX7B 5JIHA 2DIEA 1CE1L 5IMMA 2DQUH 3BIBX 1LHZA 2VXTL 4X5QA 3N40F 3QFJA 4J7RA 2YKKA 4FXKA 1NM9A 3FFDB 2EIDA 1YMMB 4XAWH 4Y5XB 1A9BA 5M7QA 4HUXB 4JEGB 4P9HC 2DQJH 3QULB 1S7UA 5D2NC 2KI6A 3O0RL 1TQCC 3QFDA 4I1NB 3QEGH 1JFQL 2H1PH 2OMXA 1MNUL 4D9LL 1F8TL 2MH4A 4KKPA 4Y4KD 5TQ0H 4XWOC 5IROC 2QADD 4GLRI 3GNML 3SEPA 3H6JA 3QJQB 2X6UA 5ADOL 5JHLA 3QUXA 2X09A 1RZFH 1MY5A 4AQ1A 1OKEA 1ZIAA 4CRPA 5BS0B 4QF1B 3VU1A 4NO3A 4V1DE 4G7VH 4EI6A 5EO9B 4LASH 4EQ3A 1EDQA 1A21A 3QQ3A 5KVGH 2E86A 1J1PH 1I1AA 4LDEB 2WPGA 1IAIH 3NCEB 5HPMA 4KTDL 5DURD 1MOEA 2M1KA 2Z0UA 3AT8A 4W9IC 1WBXA 1EMTH 1QHPA 2EYRA 2BZDA 1MEXH 1H3GA 2QQKH 4N20A 4BSWA 1D5IH 2CLVA 4TQEL 2O6DA 4XVUD 3MRKB 3ZY7A 2GUOB 4S2SA 4APQC 9CGTA 4Z76B 2GSGB 1SEBB 2XFGB 4YHPB 2H9GA 3TCXA 5JIDA 2FLMA 4LVNC 2EIMB 5INDB 5L4FA 3MNVB 5GPRA 1KZYA 3FOLB 3CMOL 2KPNA 4GW1A 4HWEH 3RIKA 1JNHB 1HSAB 1JZIA 5EOTA 3IDJB 3KWVA 3WELA 4NQDA 1J0YA 1ICTA 3R1GH 1TEFA 2J5LB 3EF7A 5D71L 1SEQH 1WRFA 4AVKA 3DPBB 3RTQC 5L9DL 3FRUB 3AITA 3U9UA 5EWIH 3X14B 1A4KB 1R47A 4Z0BL 3ZR6A 1MJ8H 3PP4H 3FCSB 4RFNB 4BSVB 4DP8X 2ZE0A 2GC4C 5E8EA 2XPYA 3K6IA 2Z8SA 5B39G 2H3KA 3IDUA 1T20B 1D5XA 1DEEA 1MVFA 4WFED 2EYRB 1MWAH 3QZNA 3K5RA 3H9YA 3RYMA 4LLMA 1RU9H 1JWUB 4HX1A 3FO9B 3ULSB 4Y4KA 5A43C 5JYLA 1FO0A 1MFAH 1MFBL 1TTBA 2IWEA 4TQHA 5JHDD 4P4KB 1ZA3B 4DERA 6FABL 1JF1B 1MRCL 2X42A 2ZOLA 3SYOA 2FATH 4L3CA 4PJ7B 4BH8B 4MD5B 1R3LA 2FECL 2ZKXA 5FFOA 3QUZC 3GFUA 2C3VA 3WN5C 5DA4A 4F15B 1IBGH 5CEZL 1CLOL 3L13A 4AM0A 5GZOC 3V8CA 3LPWA 1U9KA 2E6PA 3NPSB 4X9HA 4ZNEE 1YSOA 1RULL 1UUNA 5GS3A 3VFUA 4M1GH 5JIIA 2V5SA 3RA7H 3DK0A 2OZ4A 1QSFB 3O4LD 2AANA 4L8SA 2AXJA 2IAMA 4YIQA 5ISZA 3VE0A 1FLRL 2WW8A 4RAUB 4YUEH 5EH1A 3VFNB 2YRLA 3VRJA 1J12A 3TIDB 3QDJE 1L0QA 3CH1A 4I13B 4FXKB 1DFXA 3RVUD 3Q1SL 2WO3B 32C2B 1QG3A 4J3OC 1QASA 5HHMD 1CK0L 1WHOA 2O6EA 3VXNB 1NINA 4D3CH 1NKOA 3EH1A 3II1A 1I82A 1UB5A 2DIBA 1CU4H 3HNTH 3LVEA 2VLMD 3FFCD 4M6NH 1S9XB 1VEMA 1E50A 3QIUD 4OD3H 2ARJA 3R0NA 1SQ2N 3ZHDA 3KJ4B 3GTVA 5D7LD 3KPSD 4XN8A 5JOEA 3MLRH 3TH3T 3GBDA 4PJ5E 5CEZE 1EVTC 5IJDC 4PVNA 4JRFA 4R4BB 3QIWD 1YEIH 3LKQA 4L29B 1JZDC 3H4FA 4N87A 3WEXB 3FOMA 4LP5A 1HZLA 1HKLL 2IPUG 4KFMA 3F65A 1OGAE 2CH8A 2HSIA 2ATKA 4PJBF 1HNGA 3J7HA 2YARA 4HC1L 2WINA 5D93C 4XI5D 1LK3L 3WEOA 3BKML 3WSQL 4H20H 2R7EB 4ZOEA 5ISZB 1O75A 1HHGB 2XX0A 3I6KA 1P4IH 1CF8L 5F0LB 1QR1B 1QSEE 4JM2B 3TVMA 2W60A 4HDIB 5E4AA 5HHXL 4PG9A 2IAMC 3PAUA 3A5VA 4ZBJA 3M1BA 1PZ5A 2ENPA 5I9QC 1N3NA 2DLGA 5E9DA 3QK0A 3JV6B 2KZ1B 4EN2A 4GW5A 4PJGF 4IIQC 2BP8A 4QOKD 4PY7B 4L0PB 2JJUA 5TE4L 5AVUB 1UVQA 2FBJH 2RACA 1HILB 4X4YA 4WW1B 3TBBA 1IQWH 3GSXA 2AV1A 4YFLI 2IGLA 3BGAA 1B90A 1N2RA 5D7KD 4XP5L 1WVZA 2I27N 2VL5A 1WZLA 3VQ1C 4P46B 3RVUC 3QIBB 5CEXA 3F01A 2ITCA 4M1DL 4GXUM 1RY7B 2IGTA 2DWTA 1FVEB 1E9PB 3GO1L 1EZVY 4LCCC 5DK2B 5DXWA 2WZPA 2ZXCA 3EBAA 1WAEA 5MP6H 1UH2A 3C5ZC 4BJLA 1RSFA 1NCUA 1AO7B 3DBXB 5EBLA 5C07B 3RB5A 3TA3B 5JXEA 1ZDSA 3PY9A 1P4LB 4M00A 5FWQA 4JY4B 2F19L 3W2DH 2X3BA 1HCYA 1S7VB 1UWFA 4OCSL 5I24A 1RFDL 3K5SA 3HB3B 2PWFA 3SGDI 1JZ3A 1XO8A 4NQDB 4RFEB 2IWKA 3EFFB 2DN7A 4FA8A 3IDJA 3DOHA 2GSIB 2AV7B 5DC0A 1YEWA 3QJFB 1ZLVK 2BZ7A 5ID1B 4TSCL 5ITFA 1ZVYA 1BQRA 4NQEB 3LIZH 3NFSL 2FSEA 4WSGA 3CK0L 5JIMA 2LFGA 5FECB 5IR1B 5J13C 2YAFA 4ZT1A 2WZPD 3WIFA 1U8HA 3BMVA 2A9ML 3S96B 3U4BL 1E4WH 4UTCA 5DJ6B 1NICA 1UM5L 3VMPA 1UH4A 1UUSA 1UJ3B 1QLEL 2FAUA 2A5UA 4W9KC 3M1OA 1NQBA 5GRVL 1KTDA 4ZDHB 3RJDA 3VM5A 4YXKH 5E9DD 3ZMEA 5LAPA 4Z7OE 3F85A 5GS0H 5D70L 3WENA 3IFPB 3TT3L 3D0AA 1AZUA 2BVYA 5JA9A 4JREB 4B96A 1I8MB 2N56A 4D0DB 3FTWA 1UJ3C 5EEZA 4WFEE 2F53B 4GSUA 4JN2A 4LARL 1QPXA 2PWGA 3ELAT 5IHUH 4X9GA 3B2UD 3RNQA 4W6WB 4TUOA 1HDMA 1DJWA 1CQKA 2HWZH 4X4MA 2CDFB 4NBYB 5CJBA 5JHDE 3LN9A 4PJ8C 1H6TA 2C4XA 1YAIA 5BZXA 1MAML 2V4LA 1HVXA 2A77H 5F7EH 3MXWL 3CFMA 4Y1AD 3P54A 2ZKHL 3K72B 3MRJA 3D4CA 4PJ9D 3QISA 4ABVA 2Z8VC 2VDOH 3IB4A 4AQEB 4GRWF 3L81A 3M88A 3U4EB 4TVUA 1TTAA 1V27A 4PGZA 2CIKB 5T1MA 2X1QA 3ULVF 3PE9A 4AY0A 2W9EH 4MCYA 3G5WA 3KLLA 3TA3C 5DJZB 3MJWA 5GGTH 1JHLL 3L9RA 1AR1C 4Z7WE 4LMQI 3GMLA 4D0DA 5FKAB 1NBZB 4PS4L 4I2XA 5FF6A 2X4SB 3ZO9A 2JIXB 5MP6L 3KR3H 5K9QG 4R2GB 2L3BA 3IGFA 3PU7A 4HU2A 4ZDHA 3NRQA 1PZAA 1T1XA 1NC4D 1NCCL 5IV2B 2OYMA 5CSZA 3S36H 1UJ3A 3DJ9A 3W1ZA 3E8VA 4N1CA 4G6MH 2D7MA 4YOKA 2KL6A 4XPHL 4K3GA 1ZVHA 25C8H 4JX0A 2PNDA 3HI6H 3WTYA 1X5XA 3UAFA 3LD8B 4OGAC 2ZSWA 3VNZA 2H2SC 1FIEA 1XSOA 5I6MA 4NRZB 5AAMA 3TNMA 1QZNA 3WFEH 1UZ8B 2VLJA 3RURA 3QZWA 1RHFA 1CYGA 1NCDL 4X7DC 5EU6B 4JKPH 4Y4FB 4XODA 3NDZE 1KEML 3CAFA 1FZMB 4AIZB 4BFEA 3SYCA 2QGDA 1MIEL 5E2VH 1J8HB 1MHCA 3MV7E 4L9LA 1HJCA 3HAEB 1T6WA 3MXWH 2VL4A 1WUNT 1B0IA 1WCBA 2NMSA 1NC4A 2WSDA 4HMEA 4JG5A 5BOZG 5DFVC 3UTSD 4LLQA 4Y1AA 4L4TB 5KAQG 2APXA 4EKXA 1I1YB 1TQBC 3R19A 4BFOA 3G6AA 4MNQA 3VG0L 3PDOA 3HFMH 3MRGB 4CMHB 4QEGA 1AI1L 4UT6H 1DZBA 3OTTA 4GAJL 4JFFE 4EDWH 2BIMA 5IHUL 1FVEA 3HG1D 4ZZKA 3O2WL 4PS8A 4ZMPA 2AJYH 5CCKL 2FD6L 2GIXA 3BN3B 4YE4L 3UTTE 1FDLL 2OX5B 5SWZB 3IDXL 3WOVA 2G75A 1Z1WA 4X99A 2WBWB 2BFGA 4AWJC 4XP1H 3GSXB 3CVHA 1AXSA 1U8LB 3G08A 1PLCA 2WN3A 4QHUB 4AK2A 4Y89A 3AC0A 1DANU 3F7LA 5E6ID 2JQAA 3CU1A 2XWJB 4ZUTB 3B37A 3EO1B 5F3BA 4ZS6D 1RPKA 1GRWA 1ZHLB 1ETZB 3MLYL 5JHDB 3WJMB 3BEVB 2J43A 4Y9GA 3BVNA 1BLNA 1EJFA 4PP1D 3L9BA 4QT5A 1U3HA 3QJHA 1FC2D 2R1YA 2WBJB 4YHZL 3FPXA 5E2UH 2UVEA 3CBKB 1K8IA 2YK1L 4NNPL 3T0XA 1VRSA 2OMXB 4DETA 5DZOA 1HYSD 3NSCA 4UM9B 3GDCA 4OJDH 3SCMB 5GRJL 3TCTA 1HNFA 5I74B 5IJCC 2G2RB 5ESAB 3GZOA 5LXGH 4AQOA 1PLAA 1UB6A 4HFUH 3PNRB 3VXPA 4DVRL 1L0PA 2MOGA 4BE6A 4O02H 1UCBH 1OWRM 1NCTA 1NCIA 1P69B 5LWYL 3F7VA 4WI3A 3DSFH 1OP9A 1F86A 3DX8A 2NUTA 4TSAL 3GBLA 3BPOC 1ZS8B 4AMKL 3HJEA 3CH8A 3DJTA 3FXIC 4R97B 5DMIH 4OKDA 5B1JA 1UURA 4P4RB 5K9KA 1QBLH 1C7TA 4XNAA 3B9EA 1CURA 3R06B 3UZVA 1D3CA 2DKMA 1N7ML 4NUGH 2MKLC 3W38A 3B34A 1X5AA 3HNVL 4G1EA 4YDVA 1ZVSB 1DANT 32C2A 4Y2DA 3E1ZA 5F1NA 3FK3A 4ONGH 2E7MA 3P30H 4LAQL 4HOMA 5BRQA 1CB4A 4JJOA 4MAYD 5BO1H 4XCNA 2G9HA 2L4OA 2IAMB 3VE0B 1JJUA 3RP1A 2WQVA 5CUSH 5C7XH 4GQQA 4DPAX 3UTZA 1CS6A 2NLJA 1HL5A 1KNOB 3FO1B 4GXUN 4CL7A 5JXAH 2QSVA 3C5SA 1BJ8A 3QJHB 4KTEH 3L4UA 3BD5A 1QO3B 4PJXA 2DQCH 3HAEG 5I6NA 1OSPH 5GS0D 5HVHC 1ETZA 2BFVL 4HF5H 1ET5A 1VESA 1A3RL 3T71A 1T3FB 3NEXA 3VXQA 5IHBA 2ORBL 1QNZL 3GHPA 4HBQA 5AW8B 1RXLA 2COVD 2Y07L 3WI9A 3ZYZA 4XMVA 1J1OH 1G7LA 2J1KA 2D0GA 3GBNL 2XTJC 4Y19B 3M6DA 4M93C 4XO8A 3CVBA 5HGDA 2BINA 3MI6A 3OMZA 3B9KB 2OJZL 2GUYA 4RETB 4U2YA 5T5FA 1OTSD 4K8RD 2JKIS 2GBVA 3H2QA 4UQBA 1UC6A 2F5AH 3F83A 3ZKMC 4ESKA 15C8L 2PPDA 4M03A 1T1WA 3IDNB 2PTTB 2RFXB 4B7LA 1I8KA 3L5WA 4NNXB 5D4HA 5EFIB 5A2AA 1XCQA 2GABA 5KVFL 5IFHL 2O26U 2AJVL 1SBBA 5DVPA 5LB1A 3IAQA 3KM1A 4NSKA 4L8DA 3AJ7A 2NUPB 4WEMB 3S3PA 4BE5A 1A4KA 5LKNA 3RWGA 2FH8A 2BRRL 5A16B 4A2FA 4FA6A 4PJBB 3MTRA 3P9MA 1TCRA 4FRWA 4NWTH 1QRNE 3SDYL 4QD2E 5T1KB 3Q1SH 2P80D 4M5ZL 1KYOJ 2VDRL 3T0EA 1IM3D 4N2BA 4NQTA 4YZFE 2J21A 1EAQA 2KQMA 2JCWA 4JVUA 3K1KC 1A6AA 2XG4B 3SE3A 1ZLUH 1RULH 1QD0A 3EYFB 5GS2H 2C9AA 1MF2H 1JGUH 2ED7A 3DMMB 5DZPA 2DQUL 4GEJA 1JNLL 4BHUI 1QFWH 1NGXA 2UZPA 1DQQA 3SDDD 3WD5L 5CZVL 4HIEA 5L7XH 4E0RA 4N2OA 5MEQB 1GGUA 4P2OB 1WPCA 1T1ZB 4JQIL 5ACZA 3OC8A 4AQZA 4JO5A 2F58L 2V5TA 4M93B 4U1HB 1FVCB 3SD2A 5BOJA 5DK3A 1NGPL 2MPVA 2F1EA 3MJ8B 4Y88A 4I87A 1HHGA 1KYOK 1W72B 4WHYH 2YMXL 3NYKA 5EO9A 4MLSA 5L4JA 3FHEA 5KVEH 12E8H 1E27A 5CN3A 1WT5A 5D7IA 4GLRH 3K8MA 4NIYE 4UM8A 5ANME 1BW8A 5DJCA 4CMMA 2GT9B 5BUPA 1ADQL 4HQQH 1MHHB 4M62L 3FB6B 1NFDA 1P9MA 3MACL 1GSMA 5L0QC 1CGXA 4W9JC 1ASOA 1EXGA 3LNHA 1LO3L 3M7FB 1EVUA 3SYQA 2ADFL 1OARH 1AHMA 4J3OH 5T1MB 3ZUCA 1BEYL 1KIQB 4ONFH 1SLWA 1M7DB 3CVHH 3HKFA 3IDIB 2HFGL 4NOBA 3U4EA 4JFDA 2DMKA 4P2CG 4JRXB 1GGYA 3G6JA 3PAYA 4N68A 5A6MA 1WTLA 2CR0A 1T1YB 2EDWA 3VXNA 4LEXL 1N0LA 2BVOA 1KCWA 1WFJA 1FORL 2Z4QB 5MENE 4JAMA 5D7SH 1UT2A 3S34L 2YEZB 2WKLA 1BEXA 2I5YH 4XO3A 3BKCL 3LKPB 4WWKB 4OI7A 1YN7A 4KXBA 5J3HD 4PI2A 3ARGB 2DH3A 1IM3A 1KLUB 1HL9A 2FE0A 4AEHH 5JOFB 1S5HA 3HUJE 1BFVL 4XNYH 1BJ1J 1I1FA 3UYRH 4NUMA 3ULUH 4NZRL 4PWGA 1KPVA 4LLUB 5LAXB 5DYOA 4ZQTA 3BYTA 2O93L 3H3PL 4CMMB 3MV9E 3GDBA 4FNTA 5LXGL 1H3XA 4FX5A 4B9CA 1ZLSH 3E1F1 4KX9A 4QRUB 3F58L 4J8RB 4NQCD 8PAZA 5LLIC 1JGUL 1EJOH 1A4JA 3OWRA 5IHZA 4NPYA 2YPVL 3T6VA 1UXWB 1TPXB 5C6WH 4QTHB 5E2UL 3KCWA 4B9IA 2P49B 1V05A 4FQHA 3FQNB 3NN8A 1GJIA 1KBBA 1YCSA 5HJ3A 4Y4HB 1SXZA 4ZMLA 4TNVK 3WGVB 3QUML 5IWLC 5J6GA 1MXDA 3GIZH 3PL6C 5L6YH 4WZ9A 1OPGH 3DVFA 4MLIA 3FCSA 4J27A 4JRYE 4KGLA 3AS1A 1FLTX 1AHWA 2I24N 4NCC1 1S8DA 4NZUH 4DN4L 3SJVE 4DPRA 3RVWD 3RHWK 3FRUA 3K46A 3K71A 3IDXH 5IMOA 1K5NA 4KQ0A 1X5ZA 3NH7L 2XBDA 1I1FB 1BIIA 3NP3A 5CZXD 3BWAA 3KYMB 4OZGF 3ARGA 5IFAH 1T6BX 3LV3B 2EYTA 3U4AA 4UTBA 2XKSA 3H42H 4HWBA 4G80B 3D09A 1AO7A 3DBXA 3O4OC 3PWJA 3B2UC 1NBQA 4PB9H 3VDBA 1DJXA 1KLFA 2F08A 5EN3A 3H1ZA 3WY4A 2IJ0C 3DTXA 4FKHA 4ZFGH 2CLVB 2N0KA 4MA8L 4WI0A 3OZ9L 4XO5A 4AZUA 1FAIL 2QDVA 3ARDC 4MQXD 3K6FA 4I77H 4XPGH 3V4UL 4A7SA 3ULUL 1NJ9B 3ZSTA 3O6FD 1J87A 1XGPA 4K71B 5DVNA 1NEZG 2WXPA 4PUBL 3TWCH 2EIBA 3D4ZA 5I73B 2JELL 2ITDB 3WTSA 1NBYA 3IJYB 1BWWA 2JNZA 2OCJA 4N90D 4OCYH 2GC7C 3BFWA 3UZQB 1DBKL 4J8QA 1NMBH 3CDYA 5F7LB 1L9QA 1OP4A 4NEHB 3EF4A 3OJMB 5IBUG 3TC9A 1E90A 3G5VB 1AHWC 5JQHC 2WLLA 1F42A 4PSPA 3MKKA 3GI8L 2X87A 4X7TA 3VDAA 4LF3B 3HPLB 1HZHL 1OTTC 2WZ6A 1NCBH 2RA1A 3KAAA 3WFBL 3ZK0A 1IGYB 3FT9A 1RLWA 1IARB 1AGFA 3UC0L 4JCLA 5K5YA 4S1SL 1ZLWK 5L8JB 1BPVA 4PTUB 3K4ZA 4K15A 5EIVA 3ARFB 3APNA 3WS6C 3KE0A 3IDYC 4WK0B 3MJ8A 4DP7X 4H25B 2YFNA 2XZAH 2EIZB 3SE4C 2NXZB 3CFQA 5LGHL 4K3JL 4QWWC 2OMWB 2IPKB 4ZK8A 3RTQA 4C83A 4FFYH 4I77L 4L3EE 2YJLA 4ZXBC 5DJYA 1S3KH 3OF6D 3MBEA 4R3SA 5E9NA 1UCBL 1PTZA 1ETB1 4WEBL 5G5DB 4BGDA 4YHKL 2DYRB 2C1OA 3QDMD 5D72L 5C3IA 4ZFFB 1QVOA 3V4PB 1M2VA 4DTGL 1TCMA 4PB9L 2HJFA 2BS8A 2HVJA 3GRWL 4KROB 2QHLA 1K2DA 2OMTB 3H9HA 4CMHC 1QFWM 4OF3A 2VR4A 3WUWA 4HEPA 5C0AA 3IRCA 4KOCA 4G6KH 2F58H 4JDTH 1GYVA 1E43A 1JGEA 4HUNB 1DQLL 1FNEA 4NZFA 4AJYV 3JYBA 1OWWA 5F7HA 1D7DA 2DYPB 2XZQL 1I75A 4OUUA 1HXKA 3QPKA 4GUPB 2JJTC 2QPEB 5D7JC 1KB9J 2BSTA 3ATAA 3ZRCC 4G6AC 1NBVL 4B9JA 4TLUA 4FYQA 4GT7A 1HK6A 5TJWK 1O7VA 1D5BA 4MSWA 5C0CD 3FT4A 1M1SA 1P4BL 4X50A 2EDMA 2K9UA 3F2LA 4Q0XH 5BXFA 3CJJA 3LMJL 3PNWB 3QO0B 3WMPA 1MCPH 1ZSHA 4K8RH 1P6WA 3ZL2A 3FQWB 3NAAL 5AL8A 5I19L 3RGVB 2V9QA 2WBJD 1UHVA 3RZCA 2X4NA 1BLNB 2CPUA 3BI9X 1IFGA 4LPXA 5KSAD 1YG9A 1CVRA 1KIPB 4JZOA 4ZUSB 5MEOB 4L5FE 4KBPA 1SNRA 3VFOA 5T1LB 1ZTMA 3WLWD 1KIPA 1KB5L 1XB8A 4FC3E 1UFUA 4JZOB 4ZUSA 5MEOA 3JBG7 1NFDF 3LB6C 5IBTH 3T8XA 4HEME 3BC9A 4RGNB 4XNUH 4AJVA 4U1SB 1JVKA 2XRAL 5KSBF 1I85A 4HKBB 2AK4E 3RGVA 2A6JB 1PFCA 1XZ0B 2ALAA 4ZS6C 5IOPB 2OJEB 2XI9A 4C56B 2K6YA 3DUSA 1RIVH 3WJLC 1JE6A 3MV9D 2H6UA 1P5VB 3GSNH 1ZSDA 3CQQA 5E2JA 4WI6A 3O11A 4GO8A 1NPNA 5I1DB 1BIHA 2DQIH 2X0WA 4QDGA 2XOTA 5ITBL 3NZ8B 3NTCL 3GTTA 3K0YA 4DOHB 4TOYL 1Z9NA 4K23L 1E67A 5AVSB 4M3JA 2A9AA 5D2NB 1KWKA 5J11C 2WXQA 4UV7L 1E65A 1WSST 1DJZA 5D1QC 3FTGB 1P84J 1KPRA 3UZVB 1S5IL 3WUWG 3AG4B 4N2MA 4L0ZA 4Z7QB 3DOSB 5E6RB 1BEYH 4PGCB 4JKLA 4LKCA 4MRBA 5DFTA 5EU6A 5LVEA 4KKBC 5JORB 5DEGB 2CIIB 4XNDA 4WTZA 2H9GB 3OBAA 5F88A 2X12A 3OKEA 2OV0A 3FRPA 4V1DD 3DX8B 3HNVH 3MOAL 4PBWD 5BMFH 5T3XL 4G43A 4IM8A 3TX4A 4ODWA 2YWYA 2C1PA 4PCYA 1X7QA 5E1AA 2QZQA 3CC5A 1EO7A 2X4OA 2LT9A 1XV8A 3BDXA 3QXWA 3NABH 3IDGB 3VXME 4C4BA 1OTUC 1ZWIB 5AAWC 1D5RA 2ID5A 4MJIB 3ZTJG 5IIEA 4HIHB 4JY6B 2IQ9H 5C0BA 2XWBA 4DPCX 2EKSB 3RWDB 1J5HA 4NJ9H 5AW1B 4FQCH 3SBWA 1DQML 3WXWL 3UIZA 1U8MB 2CAKA 4FNLL 3HBGA 1IGMH 2UZYB 2CLZB 2XG5A 2ICWJ 4WQOA 2XV6B 2OYLA 3KWTA 3JWNE 1JYXA 1MRDL 2CLZA 4WHTB 5DLMH 4C54A 4U1JA 3IAGC 3Q48A 4JDZA 3F6JA 4TQ8A 1M3JA 1XBDA 4XPBL 3KWXA 3ECWA 3U79A 3RWDA 2R2CA 4N90E 1GH7A 4WWPA 3ZKND 2J71A 1GZPB 4Y5YA 3HN8A 3LRMA 2LTQC 3QPQC 4H20L 1CD8A 1D5MB 1F1GA 3Q6GH 3ECBB 4LHUG 4X8XA 2X05A 2F0CA 5I6XC 4L23A 4Q52A 4YMPA 5A7EA 3WFDL 5CP7A 3V6FA 4NQSB 4FQLH 1CZ8H 1VADB 3MRCB 3IJEB 4ZODA 2CUIA 2FR4B 5DFVD 4EUPB 4BQ6A 2RIKA 3LRLA 4XC3H 1M05A 4TPRL 5DJ8B 2VDQH 5I2IB 1G9NL 5BRPA 3NJIA 4KGJA 1FCGA 1Z9OA 2DQEL 5FOBB 1KLFB 1LNUB 2AVFA 4X0KB 3WE1A 1PSKH 3BZFB 1TJHL 1R3IL 4LBAA 3GYRA 1V7NH 3RY5A 1DUZA 2GK2A 1R5VB 1X4YA 4KK8D 4CN1A 3MX0A 4DWHA 4ICXA 2RR3A 3QUZD 1TJHH 3BDYH 5HD8D 1BM3H 3MR9B 3R0MA 1A6ZB 1E5AA 4JL2A 1ZEAL 2J20A 1J8HA 1MHCB 2DL9A 1OXYA 2EDDA 3R7RA 3BQUA 4YDLB 3OKNA 4JQVA 1WC7A 1WAAA 1QP1A 4ZUWA 4JFYA 1AI1H 1HH6A 4MNQD 5IB1A 3D0LA 1DJYA 1VEPA 1TZ8A 2TSBA 4NKQB 5B4MC 4ZMVA 5KN5B 4EDXA 4XAKD 5K1NA 1GGTA 4ETQB 3MRQA 3DTDA 2FT6A 5E2TH 4I89A 4RCAA 3G5XB 1RJCA 4YBLB 1OLLA 1OCOB 4GRLC 2ZUVA 3LSOB 3ZQXA 1P7QA 4PJBE 3MROB 4JO4L 1RFDH 3CZNA 3GSQA 5CGYD 5I0ZA 1B3JA 4IJTA 5DD0L 1NUDA 2EE2A 2WO2B 3QEQD 3KLQA 3WKPA 4GQ9H 3F6IA 1TQCB 1IGFH 4ZMNA 2VJXA 3BCFA 4LCCB 1SN0A 4MDIA 3KPTA 1PLGH 4NJ9L 2O5YL 4H8UA 4UAOB 2Q8BH 3V5KB 2WGNB 4UB0H 5E1GA 1U3HD 1T83A 4PJHA 4KROD 2R8SH 1E4XH 4UDUA 4HHWA 3HHSB 3RUGE 1T7ZA 3V79C 3MLUH 4NQVA 4KMLB 1JPFB 1JZHA 3NGBB 4KXCA 1R6VA 5IVOA 1OCRB 3C9NA 3MCKB 4WJKB 2OYPA 1P4LA 3WHXA 5GJTL 2R69L 4MQ7A 1P5UB 1ZD6A 4N5EC 3KGRA 3W9DA 1BF8A 1OQXA 1K6QL 1S7TB 2VXQL 1NCWH 1DO5A 1FZOB 1QI4A 4ODUB 1HOEA 4LRNL 5GJSH 4OLEA 2X9WA 4K5LA 4LFHG 2AK4B 1RKRA 2DZEA 4HVBA 2FX8H 1NGWB 5CD5D 2VDPB 3QIWB 3N6YA 4O02L 3SO5A 2RCSH 3ULVE 1DEDA 5FM8A 4H8WH 2X88A 2CLRB 4LOUC 4ES8A 1MFDL 1KIQA 4JO8A 2HJLA 1L0XA 5BVJB 2P24A 2R1XA 1GZPA 1G43A 2AABH 4G7QB 1AD0A 2XLLA 4K9EC 4Y5YB 4ELMB 5BNXD 3BRGC 3OJVC 5CFHA 1TEGA 4LOVA 4CBZA 3MREB 4BK4A 1F4HA 2B0SL 2OK0L 1JFHA 1FI8C 3WSQH 4B41A 1HHHA 1CICD 3OAYK 4ENZA 3F5WA 3NUKA 5I1JH 4AE1A 2VM3A 2HH0H 2C4FU 3L9YA 5D2LE 4LSSH 5L88H 3VFGL 5FA4A 2WQAA 2ZPKH 4FNQA 5FYKE 4Y4KC 4RGNC 2WAQA 2XRAH 4MCNA 1D6VH 1M1XA 2MIZA 2QV4A 4FQXD 3TBWA 2FQGA 1W72A 3GBEA 4R4NC 3RKDC 1JTOA 3L95B 1P7QD 4LVHB 3CUPB 4DUVA 4FQIL 3Q8CA 3BVTA 2X89A 4AZ8A 1E5BA 4GAYA 4XZ4A 5F7YC 1R3IH 4Z7OF 1KGCE 4KU1A 4M8RA 3IGUA 3V0VB 3ESUF 4DEPC 2ADJB 1S7XA 1F4WL 5TF1L 3X2QB 3D6GA 1UZGA 4TM9A 3MOQA 3L3IA 4G9FD 4XC1H 1K8DA 3EUUA 4R2GC 4HSCX 4K73A 1E7VA 5EBGA 4YX2H 1X9RA 1BGXH 1MNUH 3VXMD 1ERNA 1M71A 3V2AR 1G6RL 4P05A 4KKZA 1UOWA 1YYML 4RFNC 1NCAL 3FUEA 4ELMA 4QHPA 3OAUH 4YXHL 3GMRB 4LLYB 5H94B 1GIGL 2R0ZH 4RMVA 3KPSA 4PV9B 4PJEA 5FHBH 5FCUH 3G7TA 4ZFQA 4EI5B 1OVZA 3QIWA 4F20A 1N64H 1OTUD 1I3GH 5EIQA 4YHNB 1KEMH 1O9VA 3HMXA 1W15A 3O6FB 2YA2A 1EHXA 4WGWB 5KW9L 4OFYD 4WAFA 2DYPD 5C0EA 2J8UB 3N44B 4JJ5B 1BXAA 2VLLB 4KI5E 4LCWA 1R46A 4MQ7B 4HLEA 4F37K 2RQ8A 1OW0C 2VITB 1RSYA 3EBIA 4RAVA 3FQRA 4HKZB 1MRFL 3P2TA 2RHEA 1AZCA 3RI5K 3VXSA 4UIMA 5IOPA 4NQXB 4PU2A 2WXHA 1CTMA 4XPAH 4WW2C 4O58L 1F58H 3O45B 5HDWA 5EU5B 5TE6H 4NO5B 4N2CA 3FU9A 4MYPA 5D1ZC 5F6IB 3KLHC 1E28A 5BQ7A 2OMUA 4C47A 5JIQA 4JFHD 5K69A 3PP4L 4BKSC 4E41B 3H2PA 3MYJA 4OVUA 2R29A 3HC4L 2NXZD 3KGSA 4IS6A 4NO5A 5HYSA 4K9EL 3AXHA 5D4JA 2DV6A 2K0RA 1JWUA 3LXAA 1CBJA 4N28A 1Z3RA 3VI4E 2GTZB 3BZEA 1IL1B 4JHAL 5C0AE 4M43L 4UT7L 4JGJA 2Y9RT 3P4NA 5J13B 3QYNA 1Z5YD 3MRQB 2EIKB 3O6LL 1TENA 3MBXL 4NO0B 1I3UA 4FP8H 4XCFL 3UERA 3V4PH 3V55A 3VNYA 2JKXA 1KCVL 3KZ8A 3U83A 1JYNA 3CMOH 3MOBL 4MSWB 1QNIA 2J8UA 3E3QE 3SSGA 1T89C 4CN6A 3C87A 1RUML 2FZ3B 1BM7A 2EVGA 1QWUA 3U9UB 1FNGB 2N7BA 4GFTB 5FUZH 3X1GA 3T0WA 2HTKD 1GGCL 4XH2A 4NI6A 5LBVA 3GHBH 4OLUL 2P7TA 1M3IA 1YECL 3RWEA 3NJFA 2AJUL 2VSKB 3BW9B 1MI5B 4OZIA 5CLYA 5CCGE 2R2EA 3NSJA 2P5ED 1IU1A 4P06A 1WFOA 2A77L 5IB5A 1JV2A 2D8KA 5IY5B 5JQ6L 3AXIA 2VZ1A 1ZS8A 1Q38A 5F7FA 3OL2A 3FAXA 4TVPL 5A7BA 4XNZC 2NZIA 1EK3A 1XGTB 4Z76A 3GZPA 5AVRB 2ZG1A 3UL4A 1MZZA 1UB5B 3S0PA 1AACA 4FLRA 3ENEA 2DD8H 3HNSL 4AGOA 4K3HA 5J89A 4K5MA 3UJIH 4GINA 3GMOA 4QIRA 4Z0XB 1HWWA 1LEGA 2HPOA 3LVTA 4BDVA 2V2TA 1BVLA 1LK2B 2H1PL 5DRWB 1MCPL 4IDJL 2HRGA 3L95A 1XR9B 4UM9A 3C8KA 3CXDH 1J8HE 3MV7B 5B8CA 3RAJL 1PPIA 3NJKA 3RX7A 3OR7B 1UM5H 3CVDA 3OF6A 4PJEE 1ZT1B 5B1KA 3T4YB 2O61A 1L9SA 4YSTA 3RFRA 2E7CA 2VMEA 2AXGB 4CSSA 3QRGL 3U0PB 3VMOA 1Q0YL 3G5VA 1MFVA 4YFDB 1UTDA 2NZ9C 4GXVH 4ADIA 3Q1EA 2DPKA 2H2PC 3GSNB 5GHWH 3QZPA 4YUEL 1J0HA 4YO0B 2NQCA 4R7NB 4LZKA 4JVWA 3N0AA 4PRBA 2Q10A 3EOTH 4Y1SA 3UPCA 1HI6B 4FTVA 1S7UB 2XA8H 3UTSE 1YEKH 4WFHD 1TEYA 4LIQE 2BSSA 3AACA 1SOKA 2UUDK 4OY9A 5HHME 3F7QA 3X13B 5GGVL 3NSFA 3LXUX 3OAWA 2GQHA 3LZQA 1HHIB 2Y06H 3E6FA 3LZRA 4LCYA 3VA6A 4NO0D 1R4XA 2O72A 4HJIA 4PGDA 4WKZB 2NY1C 2YGPA 4AYBA 4V2CB 5E6IC 3WNMA 6FABH 4OBSA 5EZJB 1RIUL 1W8EA 1U3NA 4NKDA 4GKSB 3A23A 3JWNH 3AABA 1RK1A 4NO2A 2F2HA 1BVOA 4YHLH 4DO6A 1Z3GL 5C0BE 4LP4A 5F7UA 1KTLA 3TA4D 1A7BA 3DSNB 3PWLB 3AQDA 3D50A 1I3VA 5KSAA 4KPHL 2DQHH 3F7KA 2OZNA 4UDUB 3GI8H 4MD4B 2HA1A 3PLYA 1MJ7L 2WMPA 4NUJB 2ZWKA 3NZ8A 5CJXA 1FP5A 4O51A 4CVUA 1TZHA 4PJ8B 4LCCA 3RPIA 4YWGL 4PJHE 4AYMC 4CA4A 4J3TA 3K91A 5LJYH 1C9SA 1QSED 1KXVC 3L08A 5D8JL 3IJ8A 2FIRT 5L0QB 1TZGH 4NO0A 2CJUL 4WUUA 5AW6B 5J0BA 1WZAA 2N1TE 4UDTB 5D1ZA 3PPEA 2L7UA 1P7QB 1RP8A 3DXAE 1DBAH 1VERA 1ND0B 1NGQL 3C60B 1X44A 4N2LA 4X6DB 4X9YA 2WWOA 2XIDA 4JKWA 3TYGL 4W93A 5DU7A 4I3SH 1MIML 5C09B 1GPOL 2X1OA 3ILPB 3PQYB 1JUFB 4ADGA 1JG9A 3MJ7B 3B8SA 1U8NA 3MLSH 2NW3B 3BWUC 1HH6B 1ODAA 2X7LA 2XA8L 2KBGA 5HGHA 1QRNA 3VH8A 2HXAA 4HIQA 4RGMB 5E2WH 1PD1A 1EMTL 3GMLB 4BXSV 4GS7B 2ENQA 4IU3B 5C0JA 2PLTA 3HE6A 43C9A 5L7XL 1QSEA 3MV8E 1XFPA 4JK0D 3GIVB 2V3EA 1X4ZA 2DICA 3B7RL 1YO4A 4X6BB 5EBMA 1ANUA 3FSVA 1AG0A 3CZKA 4X0KA 1NC2A 3NOIA 1BDYA 5F1NB 4X6FA 4ICWA 4MXQC 5CR1A 2B3RA 2IG2H 4Z23A 1XH2A 3C09C 3DMMC 1EZVX 2Z92B 3CHXA 3QCVL 4ZI8A 1IAKB 4TV3A 1DN0A 1CVSC 3A3YB 4MJIE 1IKOP 4NWTL 3T77A 4U6YB 3KPSB 3LD8C 2LOEA 1J0IA 2ZCLH 1HIML 3N55A 1PG7H 3AXLA 3E9UA 3B6SA 4G5AA 2SEBA 3I9GH 3AY4C 4GB9A 5DJDB 1T22A 2YS4A 4KKLD 3D2TA 4JFPA 5IREA 1UQSA 2FB4H 2AP2A 1VKXA 2G4EA 3D0VA 1K4DB 5IVNA 1HXMB 3HHMA 1YNTA 3FCTA 4JCMA 1LWHA 3QYMA 3ORJA 4H0GA 2DQMA 3B7SA 2FX9H 1U8KB 4JM2D 4UT9H 2EO1A 1U8MA 1D5ZA 4EOWH 1V3KA 2R83A 3GKZA 3WIIH 2OXHA 2LQRA 1BFVH 4FJ6A 3DO4A 1HTYA 1NPJA 4B50A 5AOMA 5CJXC 2R0KL 3BFQG 1IGYA 1P9MC 1WBYB 5KJ4A 2OQJB 3EHBB 4JZNB 1LTXA 3BQVA 4E5XA 3GMQB 4HPOH 2F68X 2FNWA 2WBJA 1ITBB 2P8PA 2E76C 1AIFA 3ECVA 4YGAB 3WXVH 4HFWB 1FORH 2AQQA 5DGQA 2DLFH 1C1EH 1N12A 1NAMB 5FECA 5KYNA 3C5ZD 3QR1A 4XWGL 1QRND 2FGZA 5GISH 3MREA 2CKBB 3ULVH 2GJPA 4QHUA 3ZKSD 4ZD3H 5D1XC 4A39A 1Q9OA 2FJHB 2P45B 5DJDA 3CDCA 2ITDA 1D7BA 1SF3A 1J8HD 1FF5A 3KYKH 4OCNC 1KDJA 3DURA 2A83A 4PJGB 2EVIA 1VENA 3VXRD 3EFFA 5FLVA 4ONGL 4ONHA 3R18A 4OF8A 1JZFA 1GVIA 2NY4D 1AS7A 2FLBT 4QOKB 1BMWA 5D2NA 1N10A 5GGQH 1DCLA 3GMPB 4LFHD 2Y36H 5EF1A 2Z31B 3C6LA 3M17A 5EEYA 2YBRA 2CRYA 2XUWA 1BYNA 1DVYA 3MGOA 3QS2A 5D2LA 5J7CC 3OKYA 4PD4K 4L2LA 3SY0A 2X3CA 3CFEA 1QBLL 4YNYA 2ZAHA 3DX7B 5F0JB 1NMAH 2LLNA 1CE6A 3VMNA 2ED9A 3HVNA 4OGZA 5EBMB 1I8KB 2FUQA 3O41A 3BWAB 5KVFE 1EAOA 4K5PA 4M7LH 4DZ8B 2ZWNA 4I1RA 4DGWC 1RURL 1MFMA 2Q6WA 4K5NA 3C08L 4ZQKA 1GJWA 1GGCH 3EGDA 4O02B 4FN0A 4FAAB 3PWNA 5G4NA 3UCRA 3S8GB 2YKLL 4KKCD 5C3LD 5IVXF 4P5KB 3KVPA 4KJPD 3BPOB 5I8KL 4JDEB 5K9QI 5B8CC 4N8VA 4KNUA 4Y4HC 3T8XB 3MBWA 3OG6B 4GOSA 1G6RB 3TT1H 3B9KD 3T3PF 3ZUNC 4Z3IA 4NCC2 1JUFA 1OF0A 3BH8A 4XO4A 1JPST 5AAMC 3ZKXC 1Y18A 2BP8B 3UBHA 1FGVH 4NRXA 3JV6A 3BZ4B 4O9HL 1IIKA 3QDGE 3I50L 3SYAA 4YSSA 5KYXA 2HLFC 1CG9A 3UGEA 3VXOA 1LM8V 4IHBA 2UX6A 5CEYA 1U92B 1PY4A 2Z0BA 1JNJA 1YAZA 3KLAB 4AL8L 5DEFB 4HJTA 2ADGB 2HT2C 4XTRC 2WP3T 4CU8A 1AOZA 2BRRH 1EEZB 4RMSA 3JVGC 3VQ2C 2WIIA 1XF4B 1PX4A 4F7KA 4X8JB 2WYTA 4P23D 2VR9A 4L3EB 3B9DA 5DD5H 3IJHB 2O6CA 3HG5A 4N2IA 2GHZA 5E00B 3TN0D 4XAWL 3EFOA 4XNMA 5CMAA 5DTFA 2X4SA 1XGQA 2AJVH 3QORB 2MQCA 1OE2A 2WMPB 4H0IA 1HXYB 1KC5L 2DQDL 2MEJB 2YRZA 4G1EB 4RIRA 1N67A 5F70A 2Y06L 2ZX9A 4DGIH 4WWKC 4HIIA 4Z77A 3LKQB 3WNPA 5E4EB 4HISA 3A4AA 2F5AL 2NR6D 3SKJH 3CCHB 2FQFA 5E8PA 3W82A 5DJZA 4XZUB 4ZOCA 4KK8C 3TLRA 5JIPA 1U8IA 2PCXA 2MQ0A 1NSNH 1P53A 1S7SB 2BMKA 3WTXA 4YEFA 1Z9LA 4GNKB 3BZFA 3IT8D 4YFLF 5CSBA 1NLDL 1W16A 1QVOB 1YY9D 2OZ4L 3DOIA 3FCBA 3C6LD 2WZAA 3IFNH 3W5NA 3OX8A 1YEDA 5CFAA 2BC4A 3CTTA 5LGJB 1MCDA 3UTTD 1NGYB 3KPMB 1EUTA 3CWGA 3X13A 1L6XA 3NRPA 1B0RA 1YEJL 4WLCA 4D0CA 4E41E 4HD5A 5ALBL 2KZBA 3MV8D 1E8XA 3ZQWA 2BNRA 2C9UA 2GTWB 2XN9D 3BUIA 1P2CA 2YPLE 1NCAH 2HG5B 3IEAA 1VZHA 5EIIG 3EDFA 1OE3A 5IMKB 2VZTA 1NIEA 1BGXL 4R7VA 2YGQA 2AQRA 4LF3A 4TNWK 2B1AL 2R4RH 4U1JB 1DDTA 4ORGB 4Z7WB 4MMYA 1A6VH 4ZX5A 2FO4A 3AW5A 3ZE0B 2AQ2A 3POHA 4IBSA 1JWMA 4MD5A 4WY7L 2XWRA 4P5RA 4R83A 4Y2DC 4PWFA 4RESB 5AZ2L 1JXFA 3UIYA 5FO2A 1IKNC 2NXYC 4G3YH 3B3IA 3DV6B 4KROC 3SKNA 5HYFA 1I31A 1U58B 1MJUH 1FVCA 3NA9H 1HN1A 2GJJA 3LS4L 2CBQA 1X7QB 5E1AB 3O6FC 2VJ0A 2BNRD 4P2OA 5T3ZL 1XH0A 3VGAC 4DVBA 3TN0A 1ACXA 4MXVF 5F1OB 1SN2A 3H54A 5GRYA 3BT2L 3C2AL 3QEQA 1IAOA 3WEAA 3REVB 1LP9B 2VN7A 2D03H 1EO8L 1G7HA 3Q05A 3TYFB 4F8QA 1JYVA 5ITFB 5E8OB 2E9GA 1G1YA 6PAZA 3ZDZE 3QEHA 4MVBC 1FYHB 3NCXA 1EDHA 4FULA 3T4AA 3GSOA 3HAEA 2RCSL 1K4CA 2DJUA 1OLZA 2VLRA 1A8JH 4LAJH 3RWEB 1GTFA 2VH5H 3P9MB 5KVEE 2QSTA 4OFQA 2YN5A 4KQ3H 5IBLC 1GOFA 2ZUWA 3MRBA 3MLWH 4N8PA 1BZ9A 3DKHA 5E23A 2AI0L 3IRZA 3TYFA 1E30A 4YDJB 1G0DA 2FEEL 1AGCA 4XBGA 1JHKH 1YC7A 2G0LA 1NCJA 4L1HA 2VR6A 4O5LL 3ZJAA 2XA3A 4UCFA 1FZJB 4FTVE 3WNOA 2JTYA 4XP1L 1QSVA 3UTTB 3FDWA 1ZLEA 4A7GF 4U6VL 1CJYA 2LVEA 4DN3H 2PP7A 3OGCA 3SE6A 2BCMA 4JE0A 1A6VL 2BHYA 2PYFB 1I1AB 4BRVA 2X5PA 3L3HB 2EICA 1LO4L 3HIZA 2R0WL 2W5PA 1YJDC 3IDMA 5EBWA 4UT6L 4QRUA 4KHXH 3HFML 4RQQB 1YNKH 4ZFOL 3BGMA 4S0SD 1AGDA 2XETA 2JKJA 5D7JD 3B7TA 4Z7WA 4YS4A 2EACA 2JB6A 2GBUA 2UXFA 3X11B 1F0LA 4R5TA 4JPIA 5FXCH 1DFBL 1PEZA 5FYJD 3FULA 1KLUA 4GRWH 1J0JA 2BVPB 5F0PB 1IC7H 1G9HA 4HJJH 4PLJD 3DYMA 5I75B 1MQKL 3CPLB 4Y5XA 4UQDA 1MY7A 2YEZA 4FQQB 4HJGA 4XE5B 2IBZY 3V9FA 2WQ8A 1ZVSA 1KXQE 2XNAB 5F89A 4YX2L 4OZHB 3IJSA 1HINH 1KJ2L 3EYQC 4L29A 2X6BA 3BISA 5DQDL 4Q6IB 2CHZA 5EOCH 4JHZA 1EHLH 3B9KC 4KQ4L 4AJWA 5JLZA 3VI3F 2XY2A 3EH3B 4DQOH 5E94A 1RZJL 3EYSL 3QUKB 1RZ7H 4JFEB 3EDEA 3CZJA 4FQIH 2AEPH 4P2AA 1K2DB 3H9HB 4LDLB 2GI0A 1A65A 3EOBB 3VGFA 5DLLA 2HJKB 2B5IC 5IM7B 3TPUA 3NK4A 5KJ7E 2NY2B 4IRZA 3IPBA 2VDQL 1B3IA 2E59A 2HFFB 4PPTA 4TVSa 4F7CB 4HIIB 5EEWA 1SY6L 3KHQA 4J3OD 5LDUA 3PFQA 3G6JF 2YAMA 3I6GA 1JN6A 2G3MA 2ADJA 2HH0L 1IC5H 5E6ZA 4MYWB 4P59L 2EP6A 4KQ3L 4XNMB 4XP5H 3VI3B 3TIDA 2P28B 2NSQA 3K6DA 3DX6B 4LOEA 3SKOA 2NXZC 4UV7H 2BJMH 2FSDA 3DWTA 3RU8H 5B7FA 2ARWA 3QC5X 1S7RA 1UCTA 5D2NE 3ROLA 1GA2A 4EKJA 1JPSL 3LOWA 5KSUB 5I1EL 4W9CC 1K8IB 1LP9E 2HTLD 2YGVA 4WNJA 4X9FA 1KDIA 1HWGB 2R69A 3VXOB 2VN3A 3WIFB 4BWUA 4JO2H 1YEFL 4HS8L 1NFIA 1CDGA 5I75C 3P2DA 4NRXB 1X5HA 4MB5A 1HEZA 4OT1H 1HHHB 3A47A 2FSEB 3INUL 1MJJB 2JJTA 5D7JA 3QG7H 5IW1A 1UWYA 2E56A 3KH3A 3MCLH 3UZQA 1I7ZB 2FTAA 4JPKL 5JW3L 2IDFA 4PP2B 3JXAA 2N3JA 3BCDA 5MENB 1XGUA 5DRNB 4W9EC 2CMRH 5I23A 4PG2C 4O00A 4HWBL 4OAWB 5JZ7C 3EGDB 4O02A 4PJ7F 3ZRSA 2I32A 3NDYE 5FWRA 2DIJA 2DLIA 1MCNA 5I1HL 3N85L 1HZKA 3OKOB 4TQPA 2R8SL 2H5UA 3FZUD 3QCUL 5DDHA 5KUMA 3HBQA 5F8RC 5J06A 4FFZA 2F8XC 4YR6A 4QY8B 3SZ6A 2WXLA 1E9OB 5B22A 1PJWA 1XL6A 3FU5A 2WVTA 2OBGA 4UZGA 3CFDB 4AYID 4GQ9L 5ABZA 1I1YA 4I48B 5DF0A 4MGXA 1EDYA 4HJEA 5DDHB 1VFUA 1RZJH 3ASNB 4TS6A 3GMPA 4DP2X 1TO5A 1PY9A 2ED8A 3EJQA 1J0KA 3LRHA 2A6DB 2QHRH 3W0WD 2GBAA 1ZPLA 3JT0A 3FQTA 4YQXL 3PXHA 3OGOE 3RWHA 4I3GA 1JZGA 3DMMD 3BZ5A 3ESNA 3QDMA 4Y0GA 2WXJA 1Q9OB 2FJHA 1Z5LA 2AGJH 3BLPX 2R0LL 4KZ0A 3WL9A 3S37L 3D08A 2YAQA 4PY7A 1CLYL 2NYYD 4PRHA 5EPMA 3MZTA 3G9VA 4HV8B 1UOVA 1TXKA 4FQ2L 2J4WH 1JGLH 2AJXL 3U0WL 2Y6SC 4JFFB 3MNWB 2TAAA 4Y1AE 3ZDYF 3JTSB 3ES6B 5I8CB 3L17A 3UPRB 2JJSC 1U95A 3KYOA 1KB5H 5C0GA 3UEZA 4MNQE 4NDMA 3WMQA 4FXGC 3S3DB 1TJIH 4NGHH 1NANH 3FHAA 1KB5B 3P4LA 4WGVB 4AYFA 4K7FB 4J8RA 1MUJB 5F7WC 4NAMA 2BOBA 3MRFB 3VXTA 5D7LB 1U8KA 5E4EC 4XT1C 4ZOBA 3ARRA 1THAA 3Q5TA 1H15B 1HJBC 4PGBB 4XX1E 3MZGB 1NDGA 5FO7A 3U2SB 2XTLA 3BP7A 3IXAB 3DX9B 1A6ZA 5IM7A 3QBTB 2JKNA 2K8MA 1TVHA 3NVQA 2A1WH 3F7RA 3UTOA 5AAPA 5EOCJ 3W0WB 4PJIB 2A7BA 4AXWA 1YY8B 3SDAB 4MDRA 4PRPA 5C7ZA 5JW3H 3B5GA 1M7IA 2NY7H 1UWXK 1VACA 4K4KA 3EJYD 2BSDA 4XPBH 1KN4H 2Q3AA 4Y4FC 5FK9B 3KWUA 1NMBL 4LL1A 3SE9L 4E9VA 1DL7L 5FK9A 4HS8H 4ZFOB 4JFQA 1A3LH 3K2IA 3R1GL 1EAPB 2GEQA 1C08A 2ED6A 4QYOB 3C08H 4F91B 3ECBA 3PXJA 3W0WA 2UXVA 4TNEA 1FCCA 1MCRA 4XCYB 4OFDA 3FNKA 2YN3A 3MLSL 1IEAB 1M2OA 3RGBA 3TBYA 1U3HC 5BV7L 1XGRB 5EZPA 4N24A 3HTLX 4L8BB 1XIWA 1E3XA 3FB6A 2VDNB 2UYLA 4OJYA 1JZ4A 1WQVT 2MSPA 3OVUB 4OW6A 5CIPH 1I8MA 4KH9A 4X9BA 4WO4B 3NCMA 3CLWA 2IADA 3M8OL 2LU7A 4AH2B 2W95A 4M4RB 3ZLQC 2CBTA 3E3QC 2AZAA 1TZAA 4L3CB 4NUQA 3RKPA 1JCKA 3PPSA 2CJUH 2MCPH 3MV7D 4F57H 4HK0A 2HT3C 5T33L 3O4LE 3CIQA 5I5IA 5IIEB 1I4FA 1Q0XH 3TA3D 4GI6A 3U48A 1R34A 3CZUB 4OD3L 4X99B 1EIBA 1JHTB 4FQJL 3KPPA 5I1GL 4D8PA 5DQDH 4JFFD 4O2EA 4HT1H 4NQCB 5HHQB 1P7HL 2ZWZA 2I7SA 4HXAH 3QDME 4H0LC 5GGUA 5DQ9A 3UBXA 3OKEB 4NP4H 2B7DT 2D3JA 3FTXA 1TITA 1V5JA 1DVZA 4JL1A 3ZT5A 2DY2A 3QQNA 1FG9C 2HRLA 2YD3A 3L2LA 4PJDF 2JB5L 4LKCB 1KJVA 4M56A 1CFQA 4JY5H 5HJDA 1AAJA 2YD1A 4HKJA 3RL1B 4ZXBA 3N42B 3O2DH 5D9SA 4NM4L 5E5RB 2VXTH 1EJOL 4F58L 3GF8A 5CBEA 5A16A 5ISZE 4UT9L 4G9FE 4CSZA 2ZXEB 4F27A 2VR5A 4B9KC 3TA3A 3IFNL 3HZVB 2WCSA 4P5TC 2NRDA 2ZTBA 4PEEA 2GSGA 4N8CL 5KZCD 3QDGB 4JFXA 5TDOB 5AG8A 4CVXA 3IMRA 2V0AA 4U7SA 4I0KA 4QRRB 4R2GD 4BK8A 5F1SA 1T4KA 5JHBA 4WGKA 4OM1H 1TIUA 3K6OA 5CSGA 3CQPA 3PIQB 5DJAA 5I19H 3RZCD 2ZIDA 1U58A 4X4ZA 4DN4H 1OGPA 4MA7L 1FV1A 1IGIL 4M8QA 2GIYA 3ARPA 4X7FC 5H8DA 4Z7NE 3PGFH 3QORC 5T1LA 1A4AA 4EI6B 4M61B 4PV8A 4KK9C 2HRHA 5HGBA 2UXGA 2DWDA 3EGSB 4G8IA 3RPBA 2HT3D 3D34A 2DLEA 4K71C 1AQMA 4D0BB 4FFZL 4Q14A 3MUJA