4HAKA

Multicopper oxidase cueo mutant e506a
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHADTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506A
rcsb
source organism Escherichia coli
total genus 137
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hakA03
7PCYA 5D4IA 3NJLA 1GYCA 2BP8A 1PNDA 2HZHA 2MRYA 5I6KA 4HHGA 1TU2A 2XXFA 2CCWA 4HAKA 1L9OA 1ILSA 2ZWNA 4A2DA 2Y69B 4Q89A 2XV2A 1GY1A 2P80A 2VN3A 3CG8A 2DV6A 3OMIB 3AG2B 1BXAA 1NPNA 4MFHA 1V55B 4A2GA 1JVOA 4F7KA 1BXVA 2AZAA 1GS7A 3IE9A 3WKPA 1PMYA 3S3CB 1RZPA 2UXTA 3PAUA 4DP0X 2QPDB 2AZUA 5IY5B 1WS7A 3CZUB 3PAVA 1ZV2A 2IWFA 3V9EA 1A4AA 1PLAA 3NP4A 2ZONA 1KV7A 2EIKB 1WA0X 2FT7A 3X1NA 1SDDA 4M4RB 3IEAA 1HAUA 1X9UA 3AZUA 5B7FA 2LLNA 5B7MA 2J5WA 3QJUB 3T6ZA 3FU9A 1OE3A 2YAFA 2IDUA 3FQ1A 2N0MA 5AKRA 1NIFA 1L9RA 1AIZA 2XXGA 1PAZA 2PPAA 3FSAA 9PCYA 4BXVA 1OCCB 4ZK8A 3BQVA 1WA2X 1BXUA 2CAKA 2W8CA 5B1JA 3NSCA 1L9SA 3QPKA 4YVNA 3KW7A 4W9ZA 6PAZA 2QDVA 3H4FA 3FSVA 3NSFA 4NAJA 2GC7C 5I5IA 5I26A 3WI9A 1MZZA 1FFTB 2VSMB 1BYOA 1NDTA 1BQRA 1W6LA 3CVBA 3NJIA 2GI0A 4DP7X 3DIVA 2WSDA 1XB3A 4DP6X 2Q9OA 1GW0A 3H56A 1HFUA 8PAZA 1QHQA 4JHUA 3JT2A 1NTDA 3FU7B 3PAZA 2BWDA 2GIMA 2OJ1A 2J57A 1JXFA 5PCYA 2XX1A 4WKXA 1ZIAA 3GXUB 2VSKB 4YL4A 4E9RA 1CYXA 4PCYA 1ZDSA 2YQBA 1PF3A 1IUZA 5AFAA 1ASQA 4KO9A 2YARA 5B1AB 1OF0A 2GHZA 4KNUA 3WKQA 1CUOA 4A2HA 4G7SB 2JFCA 2PPCA 3FU7A 3AY2A 3MBWB 1JZFA 3WNIA 4M3HA 2ZXWB 5FC9A 4JKNA 2PCFA 3S3BB 1NWPA 5TK2A 1SHXA 2DY2A 1NINA 4YSDA 1JZGA 2HLEB 2FT6A 2IAAC 3G5WA 2PP7A 3V9CA 3N2JA 3CDZA 1TEFA 3FQYA 2UX7A 2J55A 5ANHA 1BQKA 1AQ8A 1IC0A 3FPXA 3TBCA 4FAAB 5I5MA 1AZBA 2IDFA 2YXWA 5LDUA 1E30A 3UACA 3SQRA 1E65A 1N70A 1IKOP 4TXVB 5B3SB 4K9JA 1V10A 1W6WA 5I6OA 4GYBA 3TA4D 1PZBA 2XYBA 4KNTA 3T71A 1J5CA 3IN0A 3QQXA 3UADA 2AVFA 2WO3B 2FT8A 2FQGA 1JZEA 3PCYA 2BW5A 2CALA 5I5JA 3FS9A 1KDJA 1SJMA 1KYAA 3X1FA 3ABLB 4HCFA 2H47C 4BK5C 3IBOA 4UF7C 1OV8A 1BAWA 2FTAA 3ZIYA 1ETJA 3T6VA 4GP8B 4DP9X 1DZ0A 3D12B 3EHBB 6PCYA 4AI7A 3ASOB 2BHFA 1FWXA 2DYSB 2VM4A 1AZUA 1L9TA 4GXFA 4DP1X 1ID2A 2IH8A 4YSEA 2VW4A 1ASOA 4YSAA 1CURA 2CUAA 3QJSB 4CSPA 3UABA 7PAZA 1SF3A 1JZHA 2XU9A 4RH4A 1A3ZA 1GS8A 1PLBA 4PAZA 4BXSV 4DP2X 2XVBA 3EF4A 2HXAA 5D4JA 4KOBA 4YSRA 1KBWA 3X2QB 3U25A 1BEXA 4DPBX 1KDIA 1N68A 1TKWA 2HX9A 2HRGA 1NIAA 3HB3B 4AKPA 2CJ3A 1AS6A 1CYWA 3OMNB 1GS6X 3NP3A 3PPSA 1PCSA 3RYMA 3FT0A 1JZJA 1TEGA 1AS7A 4BWUA 2I7SA 4A68A 4E9WA 3OD3A 2HX7A 2R7EB 3NJMA 2IH9A 1AG6A 2CBPA 1OCZB 2PPDA 2TSBA 4E9QA 4GY4A 4QLWA 1JXGA 1NIDA 1M56B 3X1GA 1AZRA 3ABGA 3GDCA 5B1KA 3TASA 2FJSA 1ET8A 5I6NA 1QLEB 2JXMA 2XLLA 1ILUA 2XUWA 3IN2A 4YSTA 2JKWA 2VMJA 1A8ZA 1ET7A 1NIBA 4YSQA 5AZUA 1AG0A 2IDTA 2B08A 3NSYA 1T5KA 2PP9A 2R7EA 1WA1X 1NIEA 1OCRB 1R1CA 4W1TA 4AKOA 4N4YB 1PZAA 2QT6A 1ASPA 2YAPA 1W8EA 2QDWA 3KW8A 3S8GB 1MZYA 1NZRA 2TSAA 4A66A 3WIAA 4HZ1A 1XB8A 1YLBB 1URIA 1J9RA 3X1BA 3NT0A 2GBAA 3CVCA 3UAAA 3OMAB 1QNIA 1AS8A 2FWLB 1XB6A 4A2EA 1KBVA 3CVDA 4CSZA 2RACA 4DP8X 2H3XC 2GSMB 2BW4A 2UXGA 4Q8BA 2FQEA 1UATA 4UANA 5B1BB 1AACA 1IBZA 1JOIA 1MG2C 4BWTA 3TU6A 2VW6A 4HIPA 2BZCA 4WTQA 1AAJA 1VLXA 2EILB 1ZDQA 5D4HA 2BWIA 1E5YA 3NJJA 1RZQA 5I28A 5I6PA 2PPFA 1M57B 2I85A 3QJRB 2UXVA 2UX6A 3SBQA 2ZOOA 1J9TA 2AFNA 2BP8B 2A3TA 1DYZA 5EHFA 4BDVB 2FQFA 5TK4A 4G7QB 4P5RA 1FA4A 1AZCA 1I53A 1MG3C 2VW7A 1GY2A 1JVLA 2XX0A 3FQ2A 4GP5B 2H5UA 1WS8A 3NJFA 2BZ7A 2MTAA 1JERA 1ET5A 1L9PA 4YVUA 5F7BA 3ZX1A 1IBYA 4JHVA 3PLYA 2Y1AA 2OV0A 4X4KA 3AG3B 4BDVA 2BO0A 3NYKA 5I6MA 2XV3A 1RCYA 3AW5A 4QKTA 4EF3A 3PXLA 2W88A 2DYRB 4KO5A 2IWEA 1V54B 4G70B 1BQ5A 1NICA 1SNRA 4E9SA 3AG4B 3N55A 1XMEB 2Q5BA 2FNWA 1SDDB 3ABMB 4L0PB 2DWTA 4E9VA 3JTBA 3AG1B 1OOWA 4E9XA 3SBRA 3ERXA 4YSOA 3T6WA 4BWWA 2B3IA 4ENZA 3ZBMA 3ABKB 2YXVA 1EZLA 1HAWA 4DP4X 1A4BA 1NPJA 3QJTB 2J56A 4N8UA 3GYRA 1AOZA 2HRHA 1ZPUA 4KO6A 1E67A 3OQRA 5PAZA 2DWSA 1KGYE 4HHWA 3ZDWA 3H4HA 3UAEA 1SFHA 4YSCA 2X87A 3EH4B 2IDQA 1MDAA 5B1JC 3QJQB 2QPEB 2PLTA 2FQDA 1J9SA 4GP4B 3OM3B 1JXDA 4F2FA 5F7AA 2VM3A 4AZUA 4DPAX 4AX3A 1PZCA 2NRDA 1PLCA 1OE2A 4YSUA 3S8FB 4NERA 1GR7A 3NSDA 3TBBA 1SHWA 5E9NA 3T6XA 1A65A 1NWOA 1BYPA 4KOCA 3BVDB 2PCYA 1ADWA 5I6LA 1KCWA 2X88A 1M9WA 2XV0A 2HX8A 1A4CA 4UAHA 1L9QA 2GC4C 4G7RB 3FPYA 1X9RA 4HCGA 3FYIB 1GSKA 4NB7A 3EH3B 2GB2A 2YAQA 2EIJB 4AKQA 2EINB 2YAOA 3DKHA 3NJNA 1E5ZA 4DPCX 3ASNB 3T9WA 2AANA 3MX0B 4E9TA 1F56A 4YSPA 1RKRA 3DTUB 2E86A 4HCIA 3HEIB 3UGEA 1SFDA 2YAMA 1AZNA 2I7OA 1AANA 2IDSA 1J9QA 3EH5B 1CC3A 4F2EA 2P80D 1EHKB 3CDZB 1J5DA 2YAEA 3FSZA 4G71B 4A2FA 5A7EA 2PP8A 2BP0B 3S3DB 3NJKA 1KCBA 1PY0A 3NJGA 3QJVB 2XWZA 1OCOB 2EIMB 2OCCB 3WG7B 2IWKA 4HALA 1SF5A 4DP5X 2YAHA 3NJHA 1ZIBA 2UXFA 4G72B 3C75A 4KO7A 2WO2B 1OE1A 4A67A 4E9YA 1WAEA 5B7EA 2BP0A 3SBPA 2PPEA 3FU8A 4P5SA 3X1EA 1B3IA 3WNJA 1AR1B 3L45A 1PNCA 4YSSA 1JZIA 3FYEB 4FA7B 4KNSA 3FSWA
chains in the Genus database with same CATH superfamily
1H3VA 2E8ZA 2XZAL 3L3OB 4Q6YA 2FJFB 4N9OB 4BFIA 5HGAB 5CJXA 4ZMLA 4R3SA 1A9VA 2QQNL 3SPVA 4JVUA 4PRHD 1GTFA 1FYTE 5C09E 2V3EA 1KY6A 3ZZ1A 5JUEH 3MJ8B 5DRWA 1F1DA 4W9CC 5IBTH 3SY0B 2XNAA 2WN2A 3PWUB 2QJDA 3BPLC 4Z95L 5EZJA 4F7KA 1BXVA 2YHGA 4BUGA 5DFVD 4ZMQA 1BF8A 3N1MC 1JZDC 3LVTA 4MAZA 1OSPH 5DJ8A 4BQBA 2X7LB 2IEPA 2IMNA 1G4RA 1WGVA 2WOBA 2GSGA 3ARFA 4WW1B 3PAVA 5FR3A 3GJEA 5C3TA 4OCXL 5E70A 4KXZI 1XR9B 4RGOL 3X1NA 2DICA 1AYRA 2M2DA 5E8DL 3C60C 4M4RB 1J18A 2EEBA 1UD3A 4A7QA 3CN3A 4HWNA 4GAJL 4NKDA 5HI3C 2VLRD 3PFQA 2HTLD 3KXFA 3CD4A 4PD4K 2D4DA 1OE3A 5CKGA 1JCKA 1NIFA 1Z2KA 5CBEA 2B1HL 1F3JA 5JIKA 4HF5H 4R7LA 2NNRA 4AE1A 4GG8A 2HKFH 2JKNA 2XTJB 4AT6A 5FGCB 3D09A 3S98A 1IM3A 5KBDA 5ICXB 2CKBA 2BFGA 4QGYA 1EEYB 4MNGA 3S97C 1E27B 1U92A 2Q0ZX 1M2OA 3LH8A 1GAFL 3GMRB 3O8XC 4G8IB 1VERA 3KYAA 2ZSWB 4FQXB 5GZOA 4HZLB 1DVYA 3QG7H 3UC2A 5C86A 1BQRA 1EUTA 1MNUL 3FUHA 1BLIA 2BNRD 2XKSA 3JV0A 4Z7WB 3D0AA 3EUDA 4DAGL 3PGCA 4GW1B 3W0WE 4XN7A 1ZHKA 3GNML 4I18C 1MQ8A 3O6LL 2ALWA 3PWLB 4LASL 4Y9CA 5C0EA 2YRBA 3FU7B 3BH9A 1JRHH 5D4QA 4JM2D 4M5YL 2PNDA 2FSEA 2P8MA 4N28A 2W9DL 3FONB 1LO4H 5DJZA 4CVZA 3RBGA 4Z7NF 5KYNA 4PRIB 1E4HA 5TF0A 3WY3A 2IBBA 4ODTL 4LOFA 2C34A 5D6CA 4Z0XA 3VXMB 3MLSH 4K5LA 5CMAB 4X9GA 1LE5B 4NDMA 3AITA 1AOHA 2R23A 2JJSC 4R0LA 5FYKL 2YARA 3ULVC 4WFGE 3TEZA 2ZUXA 1UXWB 3LRGA 4HUCA 5T33H 4UM9D 5AYQA 5D7LA 4HH9B 5I1AB 1IEHA 2QV4A 5E2VH 3O2DL 1KIRB 4ZFOB 2GPZA 2B4CL 3MRJB 1R75A 4XNYL 1NWPA 2EYTB 3GXTA 1MFBL 1MVUA 3BUPA 3MRQA 1SHXA 1PZ3A 4UCFA 2QADC 3WO4C 3KDMA 2PTTA 4M3JA 3VRJB 1IJNA 1UA6L 4GSRA 3WKML 2J55A 2XFXA 5I1HH 3VXSB 3FMGH 1E5UI 4AQ8C 1Q9WA 3VXRE 4NJAH 2X6CA 3BP5A 5JW3H 2Y2TA 3DARA 1MI5E 3GMNA 3UACA 3FQUB 4PRPB 4R7XA 4KY1H 6FABH 1TTAA 1XH0A 2P46B 4UQ2A 7FABH 5GPRA 1N5AA 1MCDA 4HMCA 1KEML 1P4BH 4FLHA 4PVMA 2CO4A 1R0AL 4P2OA 3KR3H 3IDYB 5BS0D 1CFQB 1XGYH 1GOHA 2AVFA 2V33A 4P3CH 2G4GA 4WDIA 2PW2B 4KX9A 4P2RB 5AZ2H 2DWDB 3FS9A 4QXGL 3X1FA 3GSWB 1GYVA 3P0VL 5IQ9A 4MD4B 5JPMA 1FDLH 3D69B 4ZPTA 1IC7L 4FNTA 1F90L 4KRMB 1D3CA 3EADA 43C9A 4RDQF 5E4EC 2OW7A 3MLVL 1TZAA 2EO1A 4F9LA 2QV2A 3AS1A 3CBRA 2QVKA 4XXWA 2G9KA 5FYLL 2XVGA 1VIWA 1ASOA 4Y1SA 3EXJA 2XXCB 4TN9A 4Z7QB 1IT9H 1A6TB 4LNRA 4FXKC 2XZQH 4K5PA 3LXBA 4ODVL 1FI8C 2AEPH 1FC2D 4G9FE 1ZGLP 1SXZA 5DURD 3SKMB 2XXMB 3O0LA 4YUEL 3ELQA 1BEXA 4LAQL 4BKSC 4RFOH 4ZAKC 5F88B 3HR5B 3UEQA 5FM8A 1THAA 4EOWL 4MS8D 1BREA 1QO3A 4QJ5B 3OHXA 4YLBA 3RVVC 3QJFB 5KSBB 5D70H 2WB1A 1G84A 3ZGIA 4AGPA 3MRHB 1FAKT 2G30A 5J13C 2F8IA 3A6OA 2WK2A 5BZWA 1Q4NX 3HMXL 3RWGA 2ITCB 5E7BA 5GGVY 5TGBA 3RLSA 5EA0L 1FUNA 4JRYE 5L8KB 1YEKL 1OB0A 3GI9L 4HUVA 1G9NL 4KTDL 3NEXA 3GKWL 4FG4A 4XBPB 1KJ3L 4Y4HC 4HQQH 3RI5F 3U6XS 4WI6A 4CKVX 5HHOE 5F7KC 3S3JA 1UM5L 2N4IA 2QGEA 3ULSB 3DV4B 2WBJD 4E0RB 1FNEA 2IOMA 3ARVA 3N9GL 4OQTA 1ND0B 5HHME 3TC9A 5DD5L 3P4OA 1OP3H 2EO9A 5JW4M 2B08A 2GJRA 1RZIB 1DQVA 2HWZL 1OW0C 3FTVA 2Z35B 4WAFA 3MRMA 5C0JA 5T5FH 5SX4H 2GJPA 2OTWB 2IOOA 4TOYH 1MZYA 3P77A 1SEBA 4PLOB 3U0TB 1Q0YL 2G3XA 2OMWA 3HUJB 3JXAA 4A66A 4Y5VC 3EJZC 2I26N 4MKMA 1IFRA 4LLQA 1OAYL 1J9RA 1B4TA 2ZWKA 5E9AA 1RUML 1UWGL 4IIQA 2WQ8A 2DWEA 1OAQL 4LOEA 1O6SB 1IAKB 3KPNB 2J1ZA 1NCHA 4Q6IA 1E4XH 2AEOA 4MJ4A 3FQTB 1V3MA 4M8VA 3VFGL 3WUWG 4RVBA 1HL4A 4RGNE 2EDDA 1UACL 3J7HA 4HCRL 4N2EA 4YQXH 3S2CA 3UO1H 4QWWC 5MEPB 3GT6A 1MY5A 5B1BB 1IBZA 3IWVA 3CSYA 5DS8B 3I6GB 3LPWA 3D34A 1BEYL 1HWGB 1CMOA 2PO6A 5K9KB 1N6QL 2V2XB 5LCVA 3VQLA 2ZOKB 2V8LA 1P2CA 3TO2B 3WEMA 3V4VH 1E5YA 2F5AL 5EBWB 4GLRH 5ISZE 1NGXB 5I6PA 4HD5A 1IARB 3UFIA 3MBEC 1JWUB 3MLUH 3QK0A 5E2TL 2G3NA 3PFUA 4Y89A 5HGHA 3L4TA 5ADOH 4N8VB 5EU6E 5DC4B 3N41B 3WFDL 2NTSP 5E00B 4BZ1L 2FE0A 3LZQA 1PZSA 2UWEB 1AMXA 1I53A 1LO5B 2OSXA 2YSTA 1OPGL 3BD3A 5GRWA 3MTRA 2CCLA 3QIBC 5HHPB 3TH3T 1OQOA 2NY4D 4HKZB 2DQCH 5CINH 1IGMH 4JX0A 4BA8A 4FL4B 1OAZL 1AHWA 1B0IA 1TZGL 4Y19E 5D1QB 2HLAA 4LZKA 3DX9B 3LV3A 2R1XA 5DD0L 5DHVB 1I9RL 1OGTA 3JWDH 4J5VA 5AVTB 2F54D 4E9LA 1PIFA 4N8CL 4XPHH 4BZ2L 1ZANH 1Z5LB 3RVWC 3K2KA 4AYMC 3AG4B 3N55A 3QQ3B 2XZAH 3ZDYB 2VDQH 5DJCB 2DS4A 3F2LA 4BZ2A 1B4RA 4PJIA 1XEDA 4JDZA 2DKSA 4KMLB 5CN2A 4BUHA 4GG6F 3ES6B 2Y7NA 4NCDA 4XGZB 5BQ7B 2QPFA 3ARGD 2ZG3A 5JZ7D 3MA7B 4BCXA 3A6CL 3D7PA 1RQ5A 2Z6FA 3MLXL 3RTLA 4Z95H 5CCKL 1CU4L 3QCTL 1EA9C 2XWDA 4CILA 3BVVA 3DI2B 3L7EB 2C3VA 4AENA 2VO8A 2YWYA 2WZPA 3MCKB 5MENE 1JYXA 5E9DD 1KXTB 4JO1L 3ZTJH 3DYMA 3NGBC 1EEZB 4FQQB 5DWPA 3PQYA 1PZ5B 3VNZA 3VE0A 3V0EA 4PWHA 1J48A 4OCXH 5C3IA 5D1ZA 5C1MB 4RGOH 2X2IA 4G8FB 3APFA 4NQVB 5E8DH 1ZVNA 4LBEB 5CIPB 3EOYG 4GAJH 2Y4SA 1H3GA 4IDJH 4YSUA 3GMLA 2JLPA 2LU7A 4PMFA 4PTTB 4KTEL 3UZEC 3AT9A 3QQDB 3S48A 4IBVA 1YC8A 2CKBH 4IGBA 3RKDC 5JHDB 3T3PE 2B1HH 2FHCA 4FNLH 5ACLA 3AMKA 4MSWB 1YNLL 4TLUA 2YPLB 5CILL 3RTQC 3RZWA 4E5XG 4PV9A 5IG7A 1YY8A 3ULVL 4HUKB 1GAFH 4M8QA 5F9DC 1NEUA 2LVEA 1T04A 1QSED 3VFRA 1MRDH 2R9HC 2YAQA 1WWWX 4J27A 1MNUH 2FDBP 5INCB 2R0LH 2KZBA 2X0WA 1HNGA 3B5GA 4GB9A 3BAJA 4JO2L 3GNMH 5I9QC 3O45A 3KPSE 3O6LH 3DPBA 4LASH 1XGQA 1EHLH 1CBJA 2WQVA 2HT4D 3DYPA 4O2EA 4Y4KD 1SOQA 1OAXL 5DZOA 4NO0D 2VDOB 2W9DH 2P9RA 3FT2B 1R3IH 1UG9A 1HZHL 1CICA 3WIIL 1HIML 1FCCA 1OTTC 1PY0A 3I85A 4QRSA 3M8OH 3SE9L 2OMTA 4ODTH 2XWZA 3SE4A 1GJUA 3WG7B 4M4PA 3VACA 1OARL 3SOBL 1SF5A 4YLCA 4FFWC 4FI8A 1DO6A 1F4WL 4M62H 4Z7UE 3W9DA 5EDSA 3WIHA 1KTLB 5I0XA 1X5KA 5IJVA 2AF2A 1OE1A 1ZJBA 3O2DH 2XN9A 5IMOB 1DFBL 2EDOA 2B3RA 3GMQB 2B4CH 4JMNA 1A1OA 1A2YB 1UZ6E 1EEQA 3MRDA 3DYOA 1MFBH 3B2PA 1LDSA 2Y23A 5JO5A 1Y18B 4KKBC 3O3DA 4LEBA 5K9QG 1CXKA 3VGEA 3ILQC 1KC5H 2RD0A 1C08A 5IMMA 4QI3A 4U4BA 1UA6H 3WKMH 3QUKA 4FTVE 3K4DA 4HD9A 3B5TA 3HNVL 3N6YA 1DVTA 2DV6A 3V0IA 1BPLB 3FULA 4HLJA 1E5AA 4H0LC 4B9YA 2LFGA 1U3YA 3ARYA 2XYCA 1JVOA 4HC1A 1OM9A 4QRPA 3K2UL 3BZ5A 2GCYB 1G7LB 1VACA 2E9IA 3FCTB 5JHAA 1KEMH 4FXKA 4ADGA 3L1OL 4CMMB 4LLMB 3SJVE 4P2QB 2X1QA 3HRZC 3BYYA 1DHKA 3WUWA 4QXGH 3P0VH 4DF9A 4EMZA 3P2DA 3GC3A 3O3EB 4NS0A 1U8NA 4X9IA 3ROOB 1U30A 2FZ3A 3CZGA 4CRPA 1IC7H 2W80C 1MFUA 1X9UA 5JDSA 4XAKD 4GPVA 1F90H 1P0SE 4YOKA 3EOAB 2VDRL 1QASA 1BIIB 3MLVH 1YN7A 4TNWF 4KH2A 2LQRA 5IF0A 3A0OA 4OAWB 2N0MA 4PJDB 2XG4A 4LSQH 5DJAA 4XCFH 2DAVA 3EXLA 3H9SD 3CU1A 1T7WA 3O8XB 4OFPA 4LB8A 4BXVA 1B0GB 2CLRA 1UH3A 5B1JA 1PFCA 1ZE3H 4W81A 3WFCL 2ICWI 2K6WA 3FFDA 1T2XA 1HTYA 3QEQE 2AEIT 4LVNC 5BO1H 3CFDA 3E9UA 3DMMB 5DRZA 1GGCL 1PD6A 3ARDB 4LAQH 4HLZG 1IEBB 3CVBA 1TJGL 1AQDA 3VI3F 2N0KA 3DIVA 2WSDA 1F18A 2EABA 3EYOB 5BMFH 5EFIA 3H56A 4AIEA 2CDFB 4W9KC 4WK0B 3IPEA 1BVLB 4GRLA 2QPUA 2WP3T 5CEYA 1ES0A 2PWEA 1KSRA 4UOW0 2IV8A 3BZFB 1QFWL 3F5WA 4MXVF 3GI9H 2VSKB 5E0QA 2IANA 4KTDH 3WNLA 4P59H 3LPGA 3SKNB 1IGFH 1KJ3H 4KXCA 3V9FA 3RWJB 1UM5H 3R4RA 2OLDA 1MFDH 4G80A 3N9GH 2VKWA 5T1LD 1JHLH 1QTSA 3EIFA 5FOJA 1PJ9A 1BMGA 1DJYA 1KB9K 3PV6B 1AR1D 1E8YA 3TA3A 1JF1A 2AJVH 2QADB 4OCRH 2VLKA 4GRWB 3VFMB 2RCSH 1NC4A 1V27A 1KXQA 3GM8A 1R3JB 1Q0YH 3D2UA 1CDBA 3BVNA 2BIQA 4TVPL 2XZCL 1JZGA 3DURA 1RUMH 1UWGH 3IAQA 3KBFA 3OKKB 4JFFE 2HLEB 5ETUB 3HG2A 2ICCA 3VXUA 4GRMA 1R3KA 4FQ1L 3BIBX 5D1XD 1IC0A 3UP1A 1HT6A 4F2ME 3K6OA 2BRRL 5C71A 5AOZA 2A2QT 4HCRH 2WMPB 3GIZL 4PJCF 5LCVH 5LDUA 5C0CB 3PABA 2FO4B 4X6CB 1T0MA 4W6YB 1IAOB 1QTYT 2BCKA 2E4TA 3CDYA 2VR9A 3G5YA 3HI5H 1N6QH 5HHVL 1JK9B 2Z93A 1AY1L 1JWSA 1S4IA 3RIFF 3QQXA 4F58H 1RLWA 2F5AH 3WJMA 3U0WH 3N44B 3P30L 4H44C 1N64L 1XH3A 2DLTA 3QEUB 4WV1B 1XMWA 3AWEA 4BKTC 1XBDA 4A63A 2VZVA 3HAEG 4N0FA 4QRBA 4E5XA 1OV8A 4BZ1H 1A7BA 3TPUB 4BH7B 3PREA 1BVZA 1H3XA 1OPGH 2IADA 1D5MA 5TDNB 3VRIA 2W9EL 3CFJB 1A9EB 5DS1A 4ZZFA 1EO5A 1EFXD 1HC1A 2WVVA 1UUNA 4WO4C 3LKRB 2FSDA 5FKAA 4H8WC 3QNYA 3DBSA 3TO4A 1Z9SB 1JZHA 3ZY7A 2XU9A 4PWIA 5DD0H 1I9RH 5CGYC 5B38A 5DTFA 1EAJA 2DBJA 1LP9A 4N8CH 3WDHA 5SWZD 3BQUB 4BZ2H 3BP4B 3HG0A 3BEWB 2X9XA 4IM8A 4R2GC 1JF6A 3BGAA 2HX9A 1X7TA 5FYJU 5J13B 3ETBJ 5TFSL 3BT2L 2WIIA 2XT1B 2R29L 5DF0A 1WAAA 3NP3A 4Z7OB 1ZA6A 4UNTA 4LPXA 1UKSA 5I0DA 4W9FC 4AIZA 3H7BA 2APWA 3L1EA 1OF2B 2UUDK 3QDMB 5CD3A 3NFPA 3WTVA 3D3VB 4JFOA 4Y4HB 4EN3D 3V4UL 2R7EB 4ODWB 2XQYG 5D7IF 2WZAA 4HS8L 4LIQE 1QBML 1DLHA 3SDAD 3MLXH 4JO8A 2HRPL 4DW2L 2TSBA 2JCCA 3QCTH 3HE7D 1VEOA 5D96C 3CK0L 4AH2A 3QDGD 5EZIL 5HYIA 1VZHA 4MCNA 2YQ2A 1UM6L 4TF4A 1A7QL 2JKSA 2XUWA 4U6VL 2JMRA 4JO1H 3D6GA 4MDIB 4YFDB 4TVSa 4Y1AA 1H19A 5HDRA 3RA7L 3RTQA 1QQDB 2Y06L 4F7TA 4N22A 3OLDA 4Y5VB 2L7EA 4LCWE 2X70B 3S0PA 2YBGA 2DQGL 4ZT1A 1G94A 4NUMA 4NPKA 1DQDL 1ACCA 5MERB 1FVDB 1DVFC 5AOLA 4MQ7A 5G2NA 1NC2B 3NZ8B 1TFPA 3MMEB 3MYJB 2ZT9C 2X6AA 3F7RA 4NQDD 3X1BA 3C5SB 3KBEA 2APSA 2PN5A 1F6LL 3OKDB 3B7YA 3QXWA 2PXYB 4IRSC 2UYLB 1VESA 1AI1H 4M5TA 1GKEA 1RUKL 4FFYA 1IEAA 3G04A 5CILH 1MH5B 4BFOA 3AS3A 2CLZB 1PAMA 4K3EL 3IXAA 3IGFA 4FJ6A 1OTUC 3DX8B 2A9AA 4F37F 3MBEB 5E6UB 4A6YB 1B6UA 3MACL 2ZAGA 3UAFA 3B1UA 4ONGL 5C0IB 1HQ4B 3L4VA 4QTHB 4EKXA 5A2KH 3DVGB 1TPXC 3EGSB 5JW5A 1E6OL 4J2XA 4J39A 1YVLA 4PJEB 4JO2H 2EUXA 3H54A 3L2NA 3DV6A 1MF2L 3EJPA 4LESA 2Y1VA 2VSDA 1T21A 2FQFA 3GSVA 1S9VB 1OAXH 4POZC 5DO2D 1TENA 2QSVA 4XBMA 2XX0A 2VN6A 2PUQT 2EYSA 5EF2A 1HIMH 4RRPA 3BKJH 2DYPA 3BAYA 5EOQL 2NUTB 4UOZA 2MNUA 4N2BA 2DJSA 5IFJA 4MJJA 2P24A 3Q2NA 3HZYA 1T1WA 3MRPA 1OARH 3SOBH 2OV0A 1UCTA 4OZGE 3G9VA 1F4WH 4NXSA 2P5EE 4UUJA 5DK2A 1U41A 3FT1A 4FXLA 1KGIA 4Q4IA 2H4EA 4BK4A 1DFBH 2IWEA 3EYVB 3FH8A 3S37L 2B5IC 1WD8A 1QBBA 2X4NA 4AK2A 1AE6L 3WN6A 5E1HB 5D2NC 2DWTA 3BSGA 3QUYA 1F42A 4YIQB 2V7HA 4HGMA 1K6QL 5DZPA 1J8RA 3I2CH 4QOKA 1R24A 3QI9D 1W0VB 4MJIB 2GI7A 4OW6A 1NDMB 4HC1H 2EH7L 2JE8A 3DXAA 3HNVH 3CGTA 5JLZA 2XIIA 1BX2B 3MOBL 4F7MB 4P0DA 4I2XE 1CJYA 3MGAA 3B2MA 3FFCE 3K2UH 3E8UL 5B8CA 3WGVB 1Z5HA 4YAQA 1MKFA 4FHJA 3VWJB 5KSAB 2PKDA 4AQ1C 3F05A 2CO6A 4P46A 3UAEA 2B2XL 2P5WB 1YZZA 2BFVL 4NKOB 3QORB 4PJGE 3VFNB 3UAJC 3OGCA 1TXKA 3FO9B 2OYKA 3NCMA 4XX1E 2PLTA 2V5YA 2B77A 3Q5OA 1DANU 3X3FH 1NCJA 3QC6X 4C47A 4EAEA 4H5SB 4OM0L 4WFEE 5HPOA 3KD4A 2P8LA 2I69A 2VDRH 4PGBB 1MEXL 1TZIB 2NY2D 5IROA 3BVXA 4XPBL 1R5VA 2Q7YA 3ABZA 3T04D 2J73A 5I5RA 4MDRA 4XBGB 4ANVA 4YXHL 1LDPL 1J8HE 1XIWA 3L5IA 5HDBE 1QACA 1JSYA 3P2TA 4PY7A 5EO1A 3SDXB 1E2ZA 3QBTB 4X4YB 3NK3A 5EOTB 3HAEA 3WFCH 4NBXB 3VA2C 2YZ8A 2ESVE 4W9EC 5DJ6B 2ADIB 3MNWB 4L29B 5DQ9B 2LW3A 1I1AB 1ZEAL 2FB4L 3QIUA 5I9QB 2ADJA 4YR6A 1BBDL 1D6EB 3GSUA 5AWNL 4OCLC 1TJGH 2YAOA 2H6UA 3FU0A 3F7LA 3T9WA 1AHKA 4KKLC 3OXSA 2TAAA 4LMQE 1ODUA 3N91A 3UTSD 1MIMH 2V2WB 2VE6B 3BRGC 1AZVA 1R33A 1GH7A 2WLZA 2VCOA 4R90L 1A1NB 2GJ6D 4TUKL 3VVWA 1EHKB 2QSTA 4U1LB 3QH3B 1A6AB 4GW5B 4KGJA 2VAAA 3CUPB 3O0RH 5CUSL 3ZSTA 3STZB 2WLNA 4NPYA 5M7QA 5DRNB 3WE1A 1D9KA 2EIMB 1NFDE 1SJHA 1CF8L 1BCIA 3T1FA 1MJ8L 1G7HA 1WSST 4JUSA 4JCLA 4XC1L 3UDWA 3B2DC 3TBSB 3AJ7A 3PS6A 5E6ID 1CFNA 1CT8B 1HEHC 4E9YA 3B7SA 5I0ZA 2WAHA 3M07A 3RKPA 3IJ8A 5D7HA 5C0FA 3QPXL 4Q6KA 1RUAL 1IQDA 4ZI8A 1EV2E 1TZOA 3RVXD 3VXQB 3LRHA 2XZCH 3V0HA 4NQSA 1BAFH 2WJ5A 2XXFA 5EUOE 5AB0A 3KYOA 1ZA3A 4UU9B 2CJUH 4FQ1H 1S7QA 2EIZB 2Y69B 3DTDA 2PR4H 4KXBA 4U6XA 2YQ3A 3K6SB 3OPUA 1JN6B 3N5AA 4Y5YC 1J05A 1DP0A 2APFA 2BRRH 3L1GA 4HLEA 4Q2ZA 2ILLA 5AYUH 3QRGL 4YXLH 1QVOB 1FNLA 3G5XA 4H8WL 3B7TA 2CHZA 4DTGH 2AAAA 2FWOB 1I8MB 3DIFA 1AGEA 5B3NA 3U46A 4W4OA 3CVHA 4EVNB 1AY1H 3A5VA 4JFHE 4N2AA 4PEEA 4XNQA 4JG5A 2GTWB 4H8VA 1H5BA 1MY7A 3AM8A 3P30H 3T0EE 4KI5E 2VB5A 5IREA 4PGDA 1UD4A 1A4AA 2C1OB 3S96A 4BCYA 2ZONA 5JORB 3G5ZB 1XR8A 3VXTB 3OLEA 5EZOL 4DUXA 2CIIA 2XICA 2JB6A 3EH2A 1U8LB 5CSGA 3V4PL 3AUWB 4P05A 3LZOA 4NQQA 2J72A 3IDXH 1SUHA 3VVVA 5CU5A 4WRLA 3GSNA 5EIVA 2J2ZA 1FHNA 4DWHA 4TULL 1J1XL 4JG9A 4UTAL 3CX5K 2PETA 2W9EH 5T3XL 2H9GA 5MEOA 4QXWA 3PP4L 5LGJB 5H2BB 3PXHA 3BOVA 1YMMA 1PAZA 4O2CB 4Y16B 3V6FA 3P4NB 3CC5A 2DQ6A 5DJ2B 3TTSA 3CFTA 1MFEH 3B6SB 1NCCL 2ZUQC 4XCYB 4GFTB 3ZZSA 4TTDC 3HG1D 4P49A 3TN0A 2WNXA 2EE2A 4PCTA 1KTCA 4GQQA 3FSVA 3NSFA 3QFJE 1LK2A 2C4XA 4JZJC 3PF2A 5H35B 4X99A 3VGAC 4C56E 5JOFB 4UT6L 1CD0A 4WUUD 1FFTB 1M7XA 4NQXA 5EZLB 1W0WB 1X5XA 3GSXA 3RGVD 4JFYA 2ID5A 4XB8A 3GBMH 3BT2H 2WPGA 4DJMA 2CO3A 2R29H 2W92A 3MLTA 2CDGA 1GW0A 4RMWA 1O7VA 5T3ZL 1LD9A 3TXAA 3JT2A 3UBXG 3VJ6A 4AOFA 1U8CB 32C2B 4I48A 2LHAA 3V4UH 4HVBA 3DRQB 2NY3C 5IVNA 3S36X 1QBMH 3JV6A 2YMOA 3OSKA 4OD2A 3LN4A 4QLRA 1JXFA 2HRPH 2R2BB 3D39A 2WXPA 4PCYA 2FYYB 3W37A 4QYOA 3X13B 3CK0H 1OK0A 1HL5A 4NSKA 4PFEA 1D5ZA 2BVPA 1UM6H 5EZIH 3TV8A 2OAAA 4D94A 1A7QH 4LL4A 4KO9A 4U6VH 5L4JA 4EQ3A 3BUIA 5CXPA 1OO2A 3RA7H 2VLME 2IPKA 3ATEA 3P3YA 1UD5A 5C0BA 1MUJA 5E2JA 1QLRA 4R4NC 2ZP8A 5MP6L 3NIDE 3T4AC 4A39A 4GKZB 2UUDH 4A7TA 2K9UA 4M3HA 2XA8L 5B21A 3QG6B 3B7RL 1DQDH 1ETA1 5I19L 5C6WH 2VIRA 1FNGB 1VSCA 4HJSA 4KMQA 1RH8A 3DSNB 3ZE2F 3WTTA 1WZKA 1EERB 2B9AA 1U9KA 3U36B 4I3SL 2D3VA 2JKTM 4JRXD 4G6MH 3N2JA 5G4OA 3WJJC 3EFOB 5ERWB 4FFYH 3WN5C 3ILPB 3LN9A 1Q72L 4XO3A 4F91B 2W07B 2AV7A 2I5YL 1G4MA 1KLFB 4Z7VB 4R96A 1RUKH 2X1OA 3KVQA 1DBKH 4WNQB 3BP7A 4HJGA 3QFDA 4K3EH 4BFEA 1NFKA 3L95B 1U93B 2OULB 4LVEA 4CC4C 4I1PA 3MUGB 3L3HA 5CJQL 3IMTA 4PP2B 2C1PA 1CB4A 2UY7B 1RK1A 2XYBA 5BOJA 2JI1A 4G43B 1CFMA 2D9QB 4QRRE 1FHGA 2DKMA 1QUNA 3MN8A 4JN2A 4KKAD 5DWUL 1SLXA 1E6OH 1HOCA 5GRYA 5C0GA 3CPLB 4QCIB 4RQQB 4W93A 3TNNA 1KCKA 3ZKXC 4J1UB 1MF2H 1WHPA 4HCFA 2XQBL 3V6ZA 3UBFA 4UDUA 2HJFB 3C6SA 1PGRB 4HLZH 3EYFA 4WO4B 1T7XA 4XI5C 5TPWL 3DETD 1RSFA 2V9QA 3EHBB 4NRXB 3O2VL 4AYFB 2OP4L 5IQOA 2FR4A 4G9DA 4FQCL 2UY6A 5EOQH 3ULAB 2XTJD 1S7RB 2Y1YA 2VW4A 4YSAA 2FH8A 1XF5A 1JFQL 1IE5A 4RIRB 3ZRCC 2ZXAA 5TDPB 4XP5L 3SDCC 1A4JA 5BQDA 1O75A 4R4BA 3OKLB 4X6DA 2W95A 4OUUA 1MLCA 1YUHA 3WOVA 4PJHF 4PJ9C 1PLBA 4ZMTA 5JIPA 5F7FA 3US1A 1SEQL 4N0CD 3MRFB 3ZE0B 3G3LA 1CTMA 3HN3A 3HI6L 2Z0UA 5D4JA 3S37H 2YPVL 3NDZE 4J28A 1DVZA 3L3KA 4XB3A 4N2OA 4KX8A 1AE6H 4AKPA 1M6OB 2C3HA 4JFDB 5EEYA 1DJXA 4PJ8B 2VDLB 2R0ZL 5AD0A 1KGWA 3RPIB 2RH0A 1J0ZA 2QHRH 3FHEA 1E8ZA 2HT3C 1A1MA 2XIDA 4WI5A 2HG5B 4R8WL 3QRBA 5D96B 3V0WL 1LQBC 1DN0A 2EECA 1USZA 1A6VL 3TEUA 4PRBB 4Z78B 5L2KA 2IH9A 1JBJA 3TH4T 1QBLL 2JKJA 2FH6A 3MOBH 1UT9A 3TCXA 4XXDA 3EJCA 4PJXB 2NSMA 5HI4C 5GS1A 3IJEB 3ZKNC 4TV3A 4TUOB 5AW2B 1JGIA 1ZK5A 2FJSA 3BPOC 3Q8BA 4JQXC 2JH2A 3ZTNL 4KHXL 3TIEA 2JXMA 3PHAA 1EZVY 1SDAB 3N42F 5E2UH 3QXDB 1DVFB 4JPIB 1J1PH 3UJTL 1IV8A 1D5BB 1B4JL 1REIA 3MJ9A 4IJTA 2D3NA 1NKOA 4OJCA 5DHDA 1HESA 3ZQXA 2MNWA 4E41E 1NCWL 4F33B 3NZSA 4IRSB 5IB2A 1KCSH 3E2HB 5E8OB 2ZXBA 3VXSD 2DQDL 2DQFA 3OMAB 1TJMA 5FA3A 4YXHH 1LDPH 2FWLB 4XNMB 1KIPA 3HAEH 3GZPA 3IMUA 4L8CA 4HG4J 3S4SB 5IHHA 3CH1B 5TTRA 4PRPD 3BN9D 1XGZA 4TSBL 4LDLB 3HC0B 2ZQKA 3D9AL 3II2A 3QUZB 4Q8BA 4FHBD 2ICEC 5T1KB 1U36A 3W9EA 4TQHA 1GIGL 1X4YA 1YUKB 2BNQD 1ZXQA 5ELIA 2NW2B 1JNLL 1BBDH 2FJUB 1BVKA 4LRNL 5BUAA 1HK6A 5AWNH 3KMDA 1EDYA 1QSFE 2AXFB 3MRIB 4L3ED 5I8EA 1IIIA 1ZTXL 4Y9EA 1II4E 4NRYB 2B1OA 4G8EA 3G6JA 5CHNA 3SBQA 3B9KC 5HYJB 4MWFA 4XPAL 1U8HA 3DUSA 3MFFB 3MV7A 1N0LA 2A3TA 4R90H 1JDCA 4AJ0A 5BRZE 4FGMA 4QHMB 4TUKH 1HWHB 1RJLA 5TK4A 2WZ6A 2JKIS 1R5IB 4F7PB 5HJDA 1PY4A 1MRFL 5C07E 3QDJE 4PRAA 5FGRA 3NJFA 5F7BA 4AQEA 4KU1A 3NG5A 3H2QA 2DIJA 3GEWB 4FG0A 1MJ8H 4X4KA 4HUMB 4J12A 3SYAA 1MCWM 4BDVA 2J8OA 4XC1H 3JTTB 1N2RB 3AW5A 4P4KB 3T65A 5KS9B 4WHTB 5I73C 4L1LA 3UBXA 2W88A 5DK0B 4IOSA 4HS6B 3L7FB 2CRIA 2WWNA 4E9SA 5HYQB 1QFWM 4PUBL 4WK4B 2VZ3A 5IQNA 3CHXA 4ZFZA 3RDTB 1V7ML 1SBSH 4N1EA 3MRKA 3SGDI 5FO8B 1OOWA 3GXDA 1LNUB 3M7OA 1RPKA 1OGAB 3W2DH 2XPZA 3ZTCC 4I0PB 5J9PA 4L9LB 3K6IA 1OT1A 1KLUA 5I8KH 4PRNA 5F1IB 1DQJA 1QPXA 3Q9PA 4J6RL 4CDHA 1KFAL 4WWKC 1EZLA 4NHUA 4BUQA 3CVHH 4A2LA 1EO8L 4HX1A 2BSED 3RVTD 4UTCA 4OF7A 4H8WH 2X38A 2OMXA 3REVA 5D2LA 4HPHA 4KI1A 2FATL 4XAWH 5BVJB 4HU2A 2EEDA 1SFHA 2FJGB 4OD1L 3ATAA 3KPTA 4KJWD 4N0UE 3DGDA 1QTPA 5KOVC 1S9YA 3DX6B 3RWIA 4I77H 3GSNH 2WWKT 3BJ91 2NY1C 5EN2A 5EZOH 4DN3H 3WU1A 3V4PH 3RWEB 4JZNB 5K33A 3I02A 3IJSB 4CVUA 1PZCA 1Q0EA 5AYTA 4TULH 1J1XH 4RDQG 1GR7A 4K23H 2CA3A 2OJZL 3F12B 3HVNA 2V8MA 4MA1B 5T3XH 5LNEA 5FYKD 2ZYSA 4G59C 4ZXBB 3TBBA 3Q1EA 3PP4H 4RWYH 4C4KT 5BJTA 3VMNA 5SWSD 2PCYA 1A6PA 1VJSA 2WGXA 4Z3IA 4NBZB 3ESUF 1YPZE 3H8NA 3KDPB 3X12B 4OJAA 4K8RH 1IBFA 3V4VB 5CD5D 3LPFA 4B0MM 2VERN 3ZZQA 5FLVA 5ADPL 4L1BA 3H9HA 3QNZB 2EYRA 3T8VA 4UT6H 2Z1KA 2GB2A 2KZWA 1SDYA 5DRXB 4QRFA 3TJEL 1UT2A 4AGLA 3NJNA 4H26A 4QXTB 1EH9A 5C2BL 2PCFB 3VH8B 3T4AA 5T3ZH 1G6VK 3PWPD 1KCLA 3IRZA 3VXNA 2IDSA 4PG9B 4EI5A 2OQJA 4H13C 4GEIA 1AKPA 2ZSVB 4NQCE 5D7JD 5EU5A 5KJ4A 3KPOB 1H8LA 3Q6FB 4NT6B 2KERA 4WI3A 1RPUA 4J3OD 1CG9A 3G5VA 2WQXA 2WTOA 3KPLB 4XXCC 5I2IA 1KGJA 4ZPVB 1FNHA 3EGXA 2YAHA 3NJHA 2GIYA 4R3SB 3TJPA 4A37A 4OT1L 4E41A 3SPVB 4QD2E 2IAMC 1HJCA 1ICTA 4CC4A 5MP6H 3SEPA 3ARQA 3WKYA 4LVOC 5C0AA 1LEGA 2CE6A 2F8OA 3BEVB 4OIAA 4PJ5B 3X1EA 3FSOA 2XA8H 1BZ8A 1CS6A 2XNAB 5I19H 1I3GL 5FCSH 5F44A 5FYLD 2W5PA 4ERSH 1GYCA 3OTTA 1KYFA 2MRYA 2AMUA 5KJ7E 4I3SH 1N0XH 2F53A 4YO0A 2YEQA 3GXNA 3KPRE 4JFED 4B97A 2WIMA 1I9IL 2GSGB 3ARFB 1D5RA 4Y4FC 3OMIB 2I5YH 3GJEB 5FHBH 5I1JL 5JXAH 2YA1A 1ZT4B 1YY9D 4HKJB 3NCXA 3P3RA 2G0KA 1U95A 3NIGE 1UKQA 4AQAA 2Z8VC 4JMXA 4NKDB 4HOZA 5KG9A 2AQRA 5IVZB 1BG1A 5EO0A 2DMBA 3O11A 1QFWI 5K59F 1MHPH 2HJLA 5DWUH 1YEDA 2HTKD 3ARBD 5TDOB 5JR1L 5L2KB 4PJ9A 1CN4A 5CBEB 1F3JB 4IS6B 2BS8A 4X6EB 1TKWB 4H88L 2VZTA 1IM3B 1FFPA 1ROWA 4MCYA 1OD7A 2Z91B 1U92B 1MELA 2GITB 3QUXC 3A4DA 1QOKA 3OV6A 4DOHB 4X5PA 1ZWIB 4XCYA 1M1XA 1X6NA 1SN2A 5DLLA 3KVDD 1XF2A 2C4FU 1I85C 1U8MB 3QZPA 4I87A 1JFQH 4X5WA 1PIGA 3K4AA 2ADYA 4ODUA 5GXBB 1ZHKB 2NX5A 3D25A 3T0WA 4FYSA 1Q0XL 5DQDL 4DERA 3RY5A 1KY7A 2EDHA 4NAJA 3CHOA 5K1NA 4YZFE 1HILB 4KBPA 2F2HA 3HI6H 4Y0GA 4CVZB 3AQZA 4ZFFA 5F3BA 3C5ZD 5EPMB 4X4MA 5BO0D 1OQXA 4PJAA 4L4VB 4O5LL 5D6CB 4Z0XB 3FAXA 4LHUD 2R0ZH 4NDMB 2JV6A 2Z8SA 2ZJSL 1G7PA 4R0LB 4YHPA 4X6FA 4MNHB 4CC1A 3K8MA 3PJSA 1XCTA 4O51A 4R8WH 3TNMA 5KBKA 5D7LB 2JLLA 1A6VH 4W4NA 2BC4A 2XRAL 5E95B 2NR6D 1QBLH 4F92B 1I7UA 2XX1A 3U2SB 1NM4A 3QS2A 2IFGA 3C2SA 3VG9C 4P5TB 4QRQB 3GKZA 1MVUB 3UJJL 4QPEA 4HUNB 4NCC2 4FCHA 3GM0A 1RHFA 4JAMA 4QIRA 3ZTNH 4L4TA 3DTXA 5A16B 4DKFH 3OPZH 5GHWL 1F6FB 3NCWA 3WV0A 1LO0L 3OAWA 5E1AA 4FF9A 2BH0A 2XFXB 4JY5L 1S8DA 1ZT7A 5LXVA 2J1XA 3M17B 2X53A 2ZX8A 1BZ9A 3BP5B 1J12A 3O4LA 3GMNB 3BDYL 2XWCA 3MLRH 3ECVA 4IIZA 3GLEA 3FB6A 2W9LA 4DEUA 4UQ2B 2AXGB 1CD9B 1I4FB 2DQDH 2HRLA 5DYOA 1WUNT 3C8KA 4P2OB 3JV5A 3INUL 3PWJB 5CP7A 5BPPA 4HUXA 1VKXA 3DOIA 1KPUA 4WDIB 4XNZC 2ERJC 4HMDA 3UGUA 1DQTA 1AZBA 1KTRL 1U0QA 2Q86A 1WG3A 3JWNC 4W68A 2MCG1 3D9AH 2I07B 2QTVA 4N2DA 2V2TB 3LNFA 4ZPTB 1AQHA 4GS7B 4RMSA 4UQCA 4K9JA 1CIDA 2EDLA 4PJBB 4RSYA 3CPUA 3C60D 5EG6C 1ZSDA 1JNLH 3EDKA 3EBIA 4A7VA 1BHGA 1HHIA 5K39B 4YBHA 3V0DA 4PP1C 1OGPA 5HI3D 4C4BA 4Y7OC 1DSFH 5LN8A 3PCYA 4Z6AT 1KNOB 1KDJA 5DHYA 4XPAH 1TZ8A 2NTFA 3ISYA 4BFNA 3FU6A 3GDBA 2WZPD 4JZOA 1G7IA 1A64A 1XGTA 4KKQA 4APQC 4CMHB 3RI5K 1WC7B 2X4RB 4ZMZA 3PQYD 4AE0A 1MRFH 3SDCB 1GGIL 4TUJA 4RX4A 4X7TA 3ASOB 1J5OL 4AMWA 1H8NA 3O8XD 5AG8A 5B4MC 5J3HC 4DP1X 4F20A 4B9CA 3P54A 3EF7A 3KJ6L 3VSTA 1DANT 4OLVL 4NO3B 1A6WL 1ZHBA 1QO3B 4WWKA 3FUJA 5ALBL 1QR4A 1IVTA 4WVRA 1FYTB 5C09B 4RH4A 4UQIM 4HULB 3II3A 4ZSOA 4U6YA 5FGCE 3V0GA 3CLFL 2AERT 4BXSV 1BM3H 2OMYB 1W80A 2XCMC 5BZWB 3ARTA 4KMTL 3RWGB 3QCUL 4YS4A 1KBWA 1XCQA 2Y2WA 4ANXA 2EJ1A 4PUBH 4JS7A 3ECBA 2HH0L 1G7JA 2QGDA 1V7MH 4O02L 3GRBA 2QBWA 1JPSL 3TIDA 3U0PA 3QWNA 1HH6B 4PM1A 3JWNG 5AUMA 4Z7WE 2EDTA 4M6NL 3BZEB 1U8OB 4LEEA 3UTPE 3ULVD 1JMZA 5M95B 4J6RH 4BRJA 1KFAH 2Z4TA 5I6XC 3BP6A 3EBHA 1Q9OA 4P3DA 4URKA 1A7PH 1F4AA 3G6AB 1VPOL 1RZFL 1M56B 1T5WB 4XP1L 4KK8C 1ETZA 1AZRA 4PREB 5AW7B 2OMWB 3TASA 3X1GA 5LVEA 4ABUA 2FATH 4YSTA 4PIBA 2Q7NA 3Q2WA 4HOXA 2VMJA 3WAKA 2DWEB 3VD1A 3VXME 2QADD 3IDJA 1N19A 2PP9A 4WI7A 3GRGA 1QRNE 4W70A 3KLQA 3TS8A 4Q6IB 3LSOB 1FFOB 4KPHL 4OF8A 1U8IA 3D5OF 1JHKL 3AU0A 2R59A 5FO7B 2VXSH 5CEZE 4OLWL 5KYXA 4H2CA 3BJLA 3CSYB 5IQLA 4JDVA 2PO6B 2OJZH 5DJYA 2UZIH 2XN9D 3B3IA 1Q38A 2AS5M 3MBXH 3VI4F 1XGUB 1P2CB 3W0WB 1WFIA 3WE6B 4KKZA 3C5JB 4LSUL 4JKMA 3MV8D 2DQTL 4J8RA 1B9ZA 1KBPA 4M7KL 4NNYA 5HGHB 2FQEA 1UATA 3BLKA 1AD9B 3P0GB 4AYGA 5ADPH 2UZYB 1F00I 1UD8A 1FZOA 4Z3JA 1Q9LA 2IO5A 3RAJL 5B3JF 3TJEH 3ZHLA 2PW1B 3KGSA 5C2BH 2IAMA 2JF1A 1SUJA 1AHWB 3MGTB 5JMRA 3J27A 1CDIA 4P2RE 2HG0A 1H6EA 3LV3B 2R1XB 2CUIA 4H8UA 1ZSHA 2Y6SC 1OGTB 4FULA 4OH2A 1MFMA 2A74C 3K6DA 1JVLA 3F7QA 3ECUA 5DUBA 1A4KB 4R7DA 4JHAH 3VFTA 5AL0A 4UQ3A 3ZX1A 1T4KA 1G43A 3O81A 4FI6A 4ZAKD 1DDTA 1JPGA 5T5NF 2WLYA 3L4CA 1LWRA 3MI6A 3DX3A 3NRQA 2F5BL 4EF3A 4OT1H 4GG6A 3RVVD 3GSQA 3MRGA 2PR9A 3O3UN 2HFGL 3LEXB 5ANME 2MOVA 5HHNA 1BZOA 1J0IA 4BFKA 3L3DB 3L5JA 1MSPA 1BSIA 1HS6A 4H0GA 4UNIA 3PL6B 1QBAA 1VADA 2WQSA 3BH8B 3GIVA 3SDDC 2EVGA 3D3VD 4Y4HD 1U21A 5IVXE 4M6AA 2WN3A 1I9IH 3IDUA 3QIWC 4OLEA 3VX1A 5I1JH 2MOGA 4ETQB 1F6AA 4BSWA 3Q2VA 3QUXA 5D1ZB 4X50A 2QEJA 5F2FA 5DA4A 4X8CA 1TVHA 2XWRA 1UOKA 4A55A 2FECL 3GMLB 4J3TA 3T8XA 1DVUA 1RK0A 3L4YA 4LKXA 3B4NA 1S5IL 3AY4C 3FB7B 3HMWL 3UGXA 1RURL 3R1GL 5JR1H 3FTYA 3QJQB 1IGJA 1OSYA 4JJ5B 4Z7QF 3WFHA 4H88H 5C70A 4X6BA 4OV5A 2WKLA 1P5VA 4HPYL 3BWAB 2MJWA 4G9FB 3HG4A 1D6VH 4MXWL 4UYPA 4PV9B 1YY8B 4GI9A 2XVLA 4CKQA 3ENEA 2FEEI 3TL5A 3MXWL 4QWWD 4NJ9L 5A2BA 4LLDA 1A7NL 3H6JA 3FB8A 4EUPA 1T04B 5A2CA 4YH6A 2CH8A 3VFRB 1MCPL 4KQ3L 4MNQD 3L2MA 2Y07H 2IC2A 4PGCA 1VZGA 4LPVA 4LU5L 2CRZA 4QXUL 5FO9A 2M8XA 1XGRB 3MBED 1Q1JH 1XGQB 3HG3A 1Q0XH 5KSBF 1MCBA 2J43A 5KJRL 3D08A 1DQLL 3FPYA 3RZCA 4Q52A 1GSKA 5DFAA 1TJHL 2P47B 4TVPD 3MFGB 1EDHA 1AP2A 2AK1L 1GXEA 2YFNA 4UQBA 1TSHA 1JHTB 2JIXD 4OZFA 1HCYA 3TBWA 4OY9A 1PQZB 2BSTA 5HHMB 2WKOF 4CADA 3QIBD 2KKQA 2G9HA 2ZJSH 3UGEA 1PX4A 1SFDA 3BPNC 2VLJA 3L16A 3HHSA 5L0QC 5AW5B 2AV1A 3OJ2C 4RFEA 3RHWF 5A7EA 2XRAH 2F8XC 4NO5B 3ZYJA 1UOLA 1A1OB 2Y2YA 3MRDB 1SOSA 4B6ZA 3NA4A 2AI0L 5JO5B 3HUJF 1BFVL 3O3DB 4K7PX 4WGWB 3RVWD 5C92A 3CSGA 4LVOB 4HV8A 1EPFA 5GHWH 1LO0H 5IMMB 4I5BA 4RGNB 3ZT5A 2AQ1A 2YGVA 4TNWK 4UOW1 4HDIA 3GWJA 3HCVB 3L45A 5D93B 2Q2LA 5EOCJ 1CDGA 2GUYA 1BF2A 2IMMA 2OTUA 3BDYH 4AEHH 4KRPC 4Y4FB 4CJ0A 2RFXA 3KS0J 4A38A 3KCWA 2DWYA 5CBAA 3JWOH 4P23A 1PJWA 1FNSL 3INUH 4BSJA 1GY1A 2W38A 5EU6B 3AG2B 4A2GA 3WYRA 1Z9NA 1NUDA 4OB5L 1U8NB 5BV7C 2FZ3B 5JIHA 5JDSB 3L4XA 3QNXA 4Y8DC 5I1LB 2UWEF 3MXVL 4XOAA 4AGMA 3X17A 2F18A 4DP0X 1KLGB 3QWRA 5IF0B 2AJZB 1U3NA 1SOKA 1VA9A 4NENB 2VDNH 3QFGA 5DJAB 3LNDA 3OZLA 4J3OF 4KROB 5CWSB 3RKDD 2VMFA 2E5EA 1DDHA 3C6LA 2CLRB 5EF0A 3A67L 3ZDZE 5B7FA 3FFDB 1U2CA 2EIEA 4GUPB 2P26A 3BIKA 5DUML 3RTQD 1H6UA 3ZHKA 4F7CB 3CFDB 1NOFA 1L6ZA 1GGIH 1J5OH 5DRZB 3HBGA 2YAFA 2VQ1A 3Q5TA 4NEHB 1WZMA 2ZOLA 1RFDH 3E38A 4PMEA 3UCRA 4PRHA 1AQDB 3NCFB 4JPSA 2DLFL 1BMZA 4MMXC 1SYVA 2R9HD 4OLVH 2QR0A 4WW2B 4N2MA 1A6WH 3NDYE 5GRZA 1ZLSL 3ZDYF 4AL8C 3GRWA 1VCAA 1IC4L 1R3HA 2H2PC 5JHDE 3WNOA 2P1YA 4LSRL 1KCVL 1YDPA 1VZIA 2BSDA 2LAAA 2VN4A 3CLFH 3D8MA 4B50A 2YPLE 3QCUH 5DJ0A 1FL5B 3F5WB 2YSSB 2HH0H 4UYQA 3KLHC 4MJ5A 2MPAH 5MENB 1IFGA 4O02H 1LHZA 2AK4A 1JPSH 1OTTD 2VC2H 2Q8AL 3P40A 2CBQA 3O9WC 4JE0A 5ECJE 3SGKC 1KTBA 4J23A 4G80B 4XNXL 2DJUA 4M6NH 3EOTL 1NTDA 5JIIA 1HYSD 1NEZA 4ETYA 4LCCB 4FFWD 1UQSA 2FIKB 3HRPA 2VLRA 3TA3B 3DVIA 2VLKB 4KZ0A 3RIFK 2YOAA 1E9OA 1GA2A 1BM7A 4LARL 5AOKA 1G9MC 1VPOH 4BQ9A 1NDGA 1RZFH 5EN3A 2QQQA 1PF3A 3Q01A 3QAZB 2GKIA 4M7LT 4DCQB 3NFNA 3BVNB 4QR7A 4A2HA 4KKBD 3T3PB 3VXUB 2WXQA 4FQPA 1LWHA 1JNHB 3KNBA 4GRMB 3H6AA 3ILQD 4WUKL 3CZKA 1NUNB 2DYPD 5HD8C 2NNXA 5C9JA 4KPHH 4KKCC 2XWJA 1IBGL 2EDFA 1ZCRA 2NY0C 5JIQA 2H32H 5L2JA 1FH2A 4G5AA 1EEUA 2BNRA 5DC0A 4KC3B 1TMCB 4LBAA 5IOPA 1MJUL 5K9JL 4HHAA 2XFGB 4OLWH 5F8QC 1S6NA 4Q0XL 1NINA 2BCKB 3TCTA 3V0AC 1GYWA 4ELDA 3M7FB 4N85A 2PP7A 3HS0C 3UBGA 3L5XH 2NSQA 3MV9E 4JM2A 2G60L 3KPSB 2YK1H 5KVGE 5ICYA 4LSUH 1XH3B 2DQTH 4M7KH 3GUTA 3AAZB 3HS8A 2G2RA 4PHZA 1UD2A 4N0FB 1VB9A 1G6RL 1JV5B 3ZO9A 3PWNA 2F74A 5I6OA 2F58H 3PAYA 5C0RL 3FQWA 3Q9QA 4N2FA 3P11L 1D5XA 2K8QA 4UM9A 4UOJA 3RAJH 3VRIB 1G6RA 4CGTA 1Q90A 3KWWB 4OZ4A 4APQB 1JZEA 1KN2H 2IGFH 1ITBB 1C8QA 1ZS8A 2IBZX 2JNZA 2R15A 4N0RA 2WVVB 1AKJA 2ZF9A 5FYJL 4Z7UB 3EYUL 3F7YA 1KYAA 2YN5A 3RGHA 5FKAB 2VH5H 3QNYB 5DYFA 1BAWA 2VUKA 5B38B 4DP9X 5DTFB 1KWKA 4ZOBA 3FUNA 4N8PA 3A24A 3BAKA 2O4EA 1MWAA 3SZ6A 3FTUA 5IW1A 2IH8A 2P48B 35C8H 1NMCC 2QLVB 2CUAA 4Q14A 3NPSB 1F97A 4ATWA 4UIKL 2PWDA 4PH8A 3FN3A 3IT8D 3IETA 3WL9A 1MXGA 2OMUA 2ROXA 4NRZB 3U9WA 3V7MA 2D03H 4NAQA 5CD3B 3UYPB 4F8QA 1SLWA 4MB3A 1A9BA 3JUYA 1WYJA 2NXZB 2VJ8A 2WUCL 4PAZA 1OOAA 4FADA 2HFGH 4GKSA 1QFPA 3ZYZA 3NFSH 4JG1L 5D7IA 1CFSA 5BS0A 2DM3A 5KSUB 1SQ2N 4YFEA 1AD0A 2ADGA 2HRGA 3UERA 1P6AB 4OBRA 3BVTA 4TYUA 5INDA 5DQJA 3QR2A 2FJHA 4JHZA 4IK7A 2XN2A 4MB1A 2C9AA 4ZW7A 3SJVB 3T3ME 2HFTA 4OJFL 4FD0A 4OLZH 5GISL 4OZIE 2IG2L 1T89A 3DRTB 4A68A 4DGYL 4Y1AB 4F37K 2DLIA 1VEPA 4U1KB 3OD3A 4RMRA 3BVUA 3FCSA 1HL8A 3LY6A 4G8GE 2CBPA 3T0EC 1AXSA 1LMIA 5ITFA 4KI5C 4RAUB 2NCMA 3ZL1A 1TZHA 2AXHA 2AP2A 2VYRE 2ENYA 1NUGA 2XPGA 2DPKA 2VR7A 3ABGA 3GDCA 4M48L 4Y2OB 3W56A 1QLEB 2XLLA 1JK8A 2W91A 1UGNA 4BHUI 4LRIC 1ZK9A 4KKRA 1M05B 3HMWH 2F8VA 3QXTA 3R1GH 4PJDF 4LLAA 1P9MC 1RZJC 3U83A 2CDEA 4LIQL 2J12B 1DBJL 1ASPA 2OK0H 3QEQB 4YDJA 3F01A 4MXWH 1EMTL 1YC7A 3DGGB 3MZTA 3U2IA 2AMGA 4L37A 1XB8A 3MXWH 4ZUUA 8CGTA 1A7NH 2BY1A 1UB6A 1FBIL 3LB6C 4UT9A 1MCPH 3LDBB 3MLZL 4KQ3H 4X4XB 2YD2A 1AS8A 4MA7L 2WVTA 4L8DB 5JW5B 4U33A 4LU5H 4QXUH 5GGRA 3RFZC 3DUUA 4IBQA 4JKLA 3VD3A 2GSIA 2HFFA 3GI8L 2VDKL 5HYSG 5KJRH 2Y7QA 1P6FA 1DQLH 2WLMA 1PKOA 3GSVB 2WBJA 3V6OE 2YLKA 1TJHH 3W5NA 2JJTC 3IXTA 4X6CE 2AK1H 2W59A 5DLML 1FE8H 1RD6A 4M6OH 5D4HA 5E99L 3ULVF 4NZ8A 5C8JA 2PPFA 1IAII 1TVBB 3AREC 5IFJB 2P24B 4BRVA 2L8AA 5C97A 4ZOEA 5FUOL 3SCMB 3BFWA 4JDEB 3GSRB 4X80H 1SY6L 1WZ1H 3AU1A 5IJCC 4WO4D 4WSKA 1C5BL 2WSKA 4OCNC 1AGFA 3U1QA 2N7AA 1A6ZB 1EXUA 1P4UA 2WO4A 3F85A 3FRPA 2H3KA 2LU4A 2D31B 3B34A 4GRWF 5CGYD 3SOTA 4FFZA 3VUAA 2EVFA 1MFCH 3RDJA 4YVUA 5AAWC 3JWNH 5BV7L 2AI0H 2X4NB 3PLYA 3CXHJ 1BFVH 3QUYB 2V7HB 3AG3B 4ELMF 3BZ4B 1QHOA 1CE1H 3ECWA 4IRJC 1DEEA 4F2MB 1B2WL 1RJZB 4J4PC 4QOKB 4BK5A 4GQ9L 5BZDB 3DXAB 4D9RD 3IMVA 2C4FT 3SDDB 4AM0A 3LXAA 5IFHH 1W2KT 1KOAA 2NY6B 2OMVA 3KGRA 1B6DA 3O6FC 3QYCA 4V1DA 5T3XD 4AG4H 5B8CB 2YIHA 4ZW3A 2AGJL 4NUPA 4H1LG 1CQKA 3LH2L 4ELKA 5J0BA 5K9OB 2IQAA 5D1XC 2CO6B 3AXHA 1RZ7L 4Z7OE 2DLEA 1L7IL 3OGCB 3N44F 3FOMA 1ZVYA 3NCJH 3PIQA 4PI2A 3SYOA 2XWEA 3AACA 1HOEA 2NCEA 2DI7A 3QDME 4OB5H 5KOMC 5I71C 4PS8A 4AL8L 5BNXD 1SBBA 3H7LA 1I9EA 1M9SA 1E67A 1PX3A 2P8LB 4U1SA 4G3YH 1DVFD 3MGOA 5AALA 5T3ZD 4Y5XB 2MQCA 3AB0B 2F54A 4N2KA 1J87A 3QXAA 2E7LC 2YN3A 5J1TC 2XTLA 1F02I 4OZHE 4PY7B 1PZ2A 3VW3L 1U4FA 2AQ3A 3A67H 4IRSD 3VGGA 3ZSSA 4FQJL 2NRDA 3AVEA 3UPRB 2V9RA 4OLXH 5CN1A 3QIUB 1HCFX 1OTUD 3BUTA 5C0DA 3GRWH 5ESQA 1NAML 1PKQE 2HLFC 3ZMRA 3ARGA 1MHCB 2FNBA 1ZLSH 3S36L 1T4WA 3UROR 1G9ML 4XHQA 3OXSB 2J21A 4TSCL 3WJLC 4AGOA 1XFPA 3FDWA 1IC4H 2G5BB 4BKLA 1FZKB 4PW3A 3POCA 2DEXX 1P7QD 4X8JB 4X42A 2ADFL 3MREB 1YN6B 1L9QA 4UAHA 4ZTOL 2A9NH 4GH7B 3EGDA 5KSVA 3K0YA 5E9DA 4QHNB 4HIIA 1Q94A 4POZD 3FQNA 3CFBA 4XE0A 3BPNB 4AJWA 4HWZA 1D9KB 2Q8AH 2XVKA 3Q8CA 3LEVL 3MZGB 4XNXH 2OMZA 2K45A 2NPLX 3EOTH 1AO7A 4NZDA 3W38A 1SJEA 4LCWB 1WIOA 3Q6GL 1JG9A 15C8L 4F2EA 4YDZA 1SVBA 5KEZA 4PS7A 2EQDA 4XH2B 2I25N 4Q9BA 3HKFA 1XVSA 3S3DB 1RULH 4XZUA 1A6UH 4HW6A 3MOQA 4P2CG 4CN6A 2ZKHH 1DVSA 1IQDB 4U1IB 3F7PC 5FKPA 2OL3A 2BVTA 1U3JA 4XNBA 5GGTA 3BKYL 5BUPA 1TF4A 1FFQA 3S35H 3K5SA 3KYOB 1ZA3B 4P4RA 1SRDA 4WUKH 3GXPA 4U6XB 2QZQA 5B7EA 5IB5A 1FGVL 1QSEA 2FD6L 2E76C 2N1TE 4KJQC 4EXPX 4POUB 3SGEI 4EO5A 4BFFA 5K9JH 1MJUH 3G5XB 1IU1A 4Q0XH 2I60H 5HYEA 3OB0K 3RUGF 1G87A 3DIFB 1CDCA 3U46B 2W65B 4ZX3A 4HHGA 3BGMB 2D7TL 4XP6L 3RWHB 3ZDXE 4M8RA 1IQWL 5DEFB 4Y4KA 2CGRL 1ILSA 4LQFH 4APXB 4NO0A 1XSJA 3EZJB 4IKIA 2QQKL 3BH4A 1TJIL 4PGDB 1MREL 4PJEF 3UAJD 2O61A 1MPAL 4MJIE 2Q87A 3HE6C 3TVMB 2PCPA 3UTQA 5E8NA 1F0LA 1G6RH 2HVJA 3IFOB 4N6RA 1JZ8A 5G5DA 4HUWA 1I1CA 2IOIA 3S3CB 5KBNC 2J2ZB 3PAUA 3P11H 1ACYL 3AT0A 2YR3A 1XGPA 2H9GB 1HSAB 4RNRA 3V5DA 5MEOB 3A6BH 3LZRA 4OZGB 4ZFGH 2H0JA 2ZCKL 5FYJH 1PLAA 2PYED 3V9EA 1T1ZA 3CC5B 4F8OA 1I3VA 3FT4B 4DHLA 3DHMA 3VXOA 1JWMB 1H6TA 3GMOA 3AZUA 4UZSA 4IHOA 5HYSA 3BESR 1ED3A 4DO6A 1RXLA 4FNQA 4L8SA 1JYWA 5D5ME 1ITCA 4LHQB 1BZQK 3M46A 2BP5M 2Z31C 4A7UA 2X6MA 4I4WA 4NQED 5TH2A 3GS0A 4K5NA 3WS3A 1K5WA 2CK0L 3GSXB 2WYZA 4JFYB 4TNVF 5FGBA 3WEXB 3JSSA 2IALA 2SODB 4UIKH 5GS3A 1MIEL 3D0VB 4KKLD 4YFLI 4QTIL 6PAZA 2EE6A 4LEOA 2DB8A 3NCYP 4I48B 2OS7A 1GGTA 1UZ8B 2WUCH 3E7JA 3HB3C 3O9WB 4FABL 3GTTA 3OKNA 3FFCB 4GMTH 4JG1H 2A4ZA 4NUJA 5D9SA 5IEKA 1RZJL 3LN4B 3O6KH 3VXPB 4RGMC 1LMKA 3D39B 3KWUA 3L3IB 1V7NL 1YMHB 1FV1A 4QYOB 2JTDA 2ZCHL 4CW1B 2TRHA 4NSKB 2CBTA 1D5ZB 4PJGB 1NAMB 4JCMA 5CLWA 3V5HA 4OJFH 4HZAA 4CBPA 2IG2H 2FAUA 1FVCA 4DGYH 1M2VA 2FEJA 1CL7I 5F9WB 1U8QB 3K2IA 5C0BB 5GGSB 3TBTB 3KM1A 1FF5A 4K94H 3SHSA 3D4GA 1NH6A 1SM3L 2YQBA 3H9SA 3NACL 1I9JL 2VIRB 3FQRA 1PEWA 4M48H 4O2FB 4GBXC 1ASQA 1JZ5A 1XF4B 3WMQA 3K6FA 3HR6A 1AGBA 5HDBB 3BW9B 4PJ5D 1JZFA 4PRDA 4LIQH 4JANA 1CE6B 4WFHD 5C08D 3LPPA 1DBJH 4L4JA 1TR7A 3SDXF 2ESVB 4R96B 4YHNA 4PIRF 3QSKB 3S7GA 3BP7B 3HS0B 1EMTH 4UT9H 3QFDB 3AABA 2CO1A 4HK3N 3L3HB 2J1KA 1IFHL 3ESOA 2WTPA 3LQZA 3VFSA 3T0AA 3U4KA 4KVNH 1FBIH 1RK1B 4IOSD 4K7FB 3V9CA 1XDTT 3WKNA 5IEHA 3MLZH 3MBWA 2BOCB 2ODHA 1UOVA 4WFFE 3H85A 2DLGA 4YPGB 1QUNB 4MA7H 4Q9CA 5I5MA 2BVOA 4MX7A 2WXKA 1HOCB 4U1HB 2HN7A 5D6DC 3FHQA 4N0YL 2EH8L 3GI8H 2VDKH 2Q1EA 3V6ZB 4PGEB 3SQRA 1E65A 5HDWA 1VFUA 5AAWA 3M1BA 3TT3L 3CV5A 4DZ8B 2IQ9L 4WHCA 2X4SA 4HIQA 5T1LA 5L2KD 4RBPK 1A7OL 5E99H 1NFDB 1RZ8A 2VXVH 1ZT1B 5DD1L 5EZPA 2ENPA 3BPCA 2IJ0C 5HY9A 1P5UB 3BSHA 1KJMA 2BOBB 5FUOH 3CN1A 5IBUB 2ZUSA 2A83A 1UXSB 5FK9A 4IOFD 1C5BH 4FFZH 4X5XA 1NMCB 1OWWA 1SPDA 1YUHB 1WT5C 4PJHA 4G6AC 4MAYB 4DESA 4TTDD 2W0FB 1DZ0A 3UP6A 4PV8A 3HW7A 5D1XA 4ZFGL 5MI0C 5BV7H 4YEFA 5EUOB 1Z9PA 2P7TA 4U3SB 3SSGA 2W94A 1JI2A 3BKMH 3EFFA 2EKSB 3D4ZA 3SQOH 2QGBA 2XOTA 3TONA 5KZCD 4PJFF 2I32A 4QF1A 3GO1L 1AGDB 3IU4L 2GABA 4GQ9H 4MYPA 5FM5M 4IEFB 1MHHB 2AQ2A 1DN0B 4QDGA 2QKIA 5IMLA 5EBMA 5HHXL 5I15H 4KK9C 1RVFL 3EKCA 4L4VD 2NY3D 3DNKA 3T08A 5GS1B 3LHPL 2BXZA 1P4LA 2VRKA 2AGJH 1D2OA 1PCSA 1MFNA 3TIEB 3T0EB 5KN5A 1CXFA 1UB5B 2IBGA 1UTDA 1JZJA 1TEGA 1TQVA 3C2AH 5AENA 2YGOA 1RZ7H 5IJBC 4L8BB 4LSPL 3I6LE 5IB3A 1L7IH 2EDQA 4XPTH 5HVWA 2HX7A 2UZPA 3FQ4A 3IU3B 2R2HA 3ZE1F 3FF7A 3ESVF 1KIUB 4EZJA 4R4ND 1OP4A 2X4UB 1JMXA 1EFXA 1NQBA 2CM6A 3HI1A 3W57A 5DZ9A 3CFKB 3RX7A 1LEIB 4AJVA 1H3UA 1T1YB 3E6FA 3R06A 5F9AC 3L9EA 5T1DH 4D0DB 4KTYA 1VF5C 4ZW6A 2C9PA 1ZGLB 1KIPB 3O3AB 1TJXA 4I7ZC 4WJKB 5DEGA 1S9XB 5SWZA 3DIDA 1QZ1A 2K1MA 4L8CB 1PZAA 3K4ZA 5D8JH 3TWYA 3IWUA 3VW3H 1J5HA 4MD0A 1CBVH 1HNFA 3QFJB 4G6FB 4EN2A 4C56B 3C09B 3H3KA 1MJ7H 1URIA 3DX7B 3DHJA 1QLFB 1GC1H 1PLGL 4TRPL 1A21A 1BVKB 3FH5A 2ARJQ 4M9PA 3G6DL 1NCAL 4FJZA 3ZL2A 4EN3A 1VFBA 1KBVA 5I8EB 1KXHA 3CVDA 3JVGC 4OIFA 5AEAA 4G8EB 5GRVK 1R6VA 2WBWB 4MWFB 4M93B 1GMIA 3HE7A 1U3ZA 3MV7B 2WCGA 1CGWA 2X6UA 3QDGA 4ZTOH 3OAYK 3MR9A 3I9GH 4HS3A 3C6EA 2VISB 3WTSA 2EILB 5JPNC 5FM4A 5EO9B 4N1HB 3UTTD 1JNNH 1GZHA 5JIMA 1G7MB 1MCIA 3MYZA 4PRAB 4XI5D 1F4YL 4L3FA 3CZLA 5AAMA 4ZQKA 1T7ZA 4ISVA 4KXZH 3LEVH 5E0FA 4ORZC 2WM0A 2VR6A 4JFPB 1QA9B 5I0VA 2BP8B 1KJ2A 4BDVB 4LFHD 3HBQA 5GRVL 3TZVC 3Q6GH 2GVYA 4KFMA 5J6HA 15C8H 3T65B 3SDCD 3MA9L 1NGYA 3K8KA 2VDML 4P5RA 4DGUA 4GSDH 4KHTL 4NQDA 5DC9B 2KQMA 4PJ9D 4LLYB 3V4LA 5GGTH 5CF3A 3K91A 1ET5A 1JGUH 1LJMA 2ZTBA 2B59A 1FYTD 3MRKB 5C09D 3RL2B 5FCUL 3BKYH 2ZX6A 5I76A 3Q13A 4HYTB 3O6FB 3SE8L 1QFHA 2DYRB 3CZSA 4KO5A 1FGVH 1OP5K 2FD6H 2G3ZA 3L3OC 3GSOA 1SNRA 2HT3D 3LKOB 3PYCA 3WGUB 3DJSA 4Z7VF 3NABL 3FNKA 2XWBA 4HX1B 1GCFA 3ZE0E 4YNYA 2NX5D 3ABMB 4EBQL 2BSRB 2CNYA 4H2AA 1OD9A 5B1CA 3DX2A 5D2LB 1CXLA 3FOLA 2CHDA 4QRTA 5DJXB 4XP6H 5HI4D 3R0NA 1WZLA 3TBYB 3ZKND 4PD4J 1IQWH 4MQSB 2CGRH 2QL1A 3ZBMA 4JFDE 3ZUCA 3HC2A 5A40E 3CSPA 1DEDA 1TJIH 2J71A 1MREH 5J11B 3RWIB 3QJTB 3IFLL 2GW5A 2AQPA 4CN1A 1VGKA 3FZUC 4B53A 1FFNA 2OJEA 3DSFH 3F6JA 1RUQH 1ACYH 1TETL 3WNKA 2KL6A 3OB0H 1NGPL 5A6IA 4S10A 2AEWA 4N6QA 4PR5B 2IDQA 1TLMA 4CL7A 1Z3GL 3SD2A 3NIFE 3OKMA 1C5DA 2GJZA 2ZCKH 4MJ2A 3HG1E 1M4KA 4HJEA 3OM3B 5GSRA 5F7AA 2D7OA 2BSCA 3W1ZA 5EF3A 3LTVA 4PB0H 4UTBA 4FMFA 4LKCB 4MA8L 5L9DL 3HZMB 1I8KB 1CI3M 3ZE0F 3FCUB 1L0PA 2WCPA 5CAYB 2FL5B 5ESAA 3QI9A 2ZYIA 4HFWA 2CO2A 4N3UA 5E94B 1BVOA 1NFIB 2CK0H 1N59B 3CFQA 3IPBA 4H26B 4TS6A 2GUOA 2K7QA 2EADA 5DGRA 5I6LA 3CVIL 2X88A 4LPCA 1T5XA 4RSVA 1PYWB 2OXHA 4FQXC 3OXRB 1AYOA 2I27N 4F57H 5CJBA 4MCZA 1MCOH 5FIEA 3E6HA 4QTIH 5JXEC 1NA8A 3B9KD 3HOGA 4EI5B 2GC4C 1X9RA 2W0PA 2YUXA 4N3TA 4EI0A 3Q1SL 4OF3A 1RZJH 2R2EA 3T77B 4PY8I 5J89A 4WFGD 1PW3A 1W72L 3BX7C 3E1ZA 2D8KA 1E5ZA 1CG9B 5IW6A 1V7NH 4PJXF 4S2SB 2ZCHH 1F56A 1KJVB 5I2IB 1RKRA 2JTYA 2E86A 3HEIB 1I8UA 3MUZ1 4E2OA 1YECL 3EGXB 2NQCA 1JGLH 1H0DB 1WAPA 4PG2C 4ODXA 3BKCL 2KPWA 3PJNA 1CC3A 1T20A 4XT1C 4Z76B 3WSQL 5HYJE 4E41B 5LUMA 3CDZB 1P1ZA 2YAEA 3REWB 4ONFL 1C16A 2ZAIA 3G08B 4H1LH 4JQIA 1QUPA 4M9OA 1FZJB 1I9JH 2VXTH 2VZ1A 1FLTX 1BLNA 2AQQA 4AEIH 5E6RB 3I75B 5KYYA 5EIIB 3SYPA 3QB7C 3VXRD 5EBLA 4ZS7L 4XCNA 1MI5D 4RA0C 5BOZG 1P4IL 1NBZA 4XWGH 1TYEB 1NSNL 1NBVL 2WW8A 4GO8A 4TSAL 3WNJA 3NH7H 2V6HA 5KS9E 2NNAA 3OVUB 4JFQA 4MD5B 1WJ3A 1XAKA 4LLUA 4WWKD 2BNUA 7PCYA 4M1DL 5F96H 1IFHH 1U95B 5D55A 1QSFB 3UTSA 3MKKA 4AQAB 5DFWH 3QWOA 5GGQL 2F7QA 2E9JA 1SXNA 5EO0B 2GJ6A 1X9LA 3O11B 4X5RA 1RZKC 3FO2A 2N56A 2V37A 3HS9A 5BVPL 5F7DA 1OGAE 5IK3A 3MOAL 4U1NB 1QKZL 2X4QA 4MJ6B 1V55B 4ZMNA 1BA9A 4FZEL 3EJTA 1KXVA 2VQUA 3D2TA 3IDYC 2NY1D 1S7UA 4M3KB 3EW3B 1OAKL 2NSXA 5JOPD 2IQ9H 3QDJB 1RZPA 2MMXA 3LKQA 3O3BB 4FZ8L 5IP4A 1HE8A 5E6IA 2Y5EA 4MTMA 4ECNA 1Y07A 4X2UA 4YWGH 4S1DC 2BX5A 2NT0A 2Z31B 4M43L 4KNQA 2NT1A 5KVEH 3D25B 3UJIL 2OA9A 4R4FL 4EI6A 5TF1L 3KYKL 3DGCR 3L3JB 3DO4A 4MA3A 2C7FA 1MAKA 2Q3ZA 4HFUH 1XAUA 5BXFA 2LTQB 4ZFFB 1JGVL 4J3VA 3FQ1A 5FPIA 4C59B 4M6MH 2XQ0A 1HHGA 1L0YA 3HA0A 1BPVA 2C9RA 3K2MC 5IOKA 4RBPH 5HGBA 2JB5L 4PJAB 2X89A 4P04A 4ZK8A 3OC8A 3IJYB 3TOPA 2C9UA 8FABB 5T5NG 3NSCA 4JRYD 5F6IB 1G7PB 2DEWX 2VABA 2EACA 3GO1H 3PJSB 3IU4H 3QGVA 2EUZA 5JW4Q 3LS5L 4BBWA 1LE9A 5HHOD 1TNMA 2BC4B 2A6JA 2FBOJ 4K5OA 1RVFH 1S78C 2WXJA 1I7UB 4G42A 4ACPA 3LHPH 4U1MB 3WELA 2IV9A 3DK0A 5FB8A 5GJSL 4GQPH 4JAMB 5KYWB 5K1JA 1UUSA 1BD2D 2DH2A 2VXUL 3K8LA 4L4TB 4N0UB 3WD5L 4Z77A 3PAZA 4LSPH 2NW3A 2C7UA 4ZUTB 3Q8FA 4UV4L 1T3FA 1PPIA 1ZHNA 3F84A 4CUCA 4GBXB 1T2QH 1Y0LA 2IAMD 1L3NA 3N40F 1ZDSA 4L1TA 4FE9A 4LXFA 3LPOA 1A14L 2X4OA 4HBCH 4UMSA 4FXGA 4HMEA 1ZHLB 4JREC 3ALXA 4KNUA 4ORGA 2ITDA 2JFCA 1ULVA 3HG1A 3MRCB 4WEEA 2DRUA 3N04A 5DYOB 4K07A 3HZKB 4IMKA 4ZMPA 4HUXB 3HPJB 2Z3FA 4WUUA 3RURA 4UT7L 3G7TA 3GJFK 1DVXA 4C8XA 3RGVA 4HG4K 4Y4FD 5J12B 4GAFB 3VI3A 1T7YA 4AV0A 4NC2B 5TK2A 5ISZD 1TYJA 1DUYA 2XZZA 4J7RA 4TRPH 1ZSDB 2CRMA 3G6DH 1NCAH 2WXGA 4P8QA 5EU6D 2K70A 5E8EA 4S0TD 3TZVA 3FBKA 4AV5A 3QQ9C 4F7EB 4R84A 1T0NB 3BUYB 2Y22A 1QWHA 4JZOB 1HHKB 1R4XA 4NQCB 4Q4EA 4CBZA 1YYLH 3BLBA 3VQMA 2YRLA 4WJ5A 4YK4C 4QEGA 5E51A 2MCAA 4Y19D 4BM7A 4FQHA 4IMLA 1DCLA 3QUXD 5DO8A 1YEIL 1F4YH 3GJFA 1FSKC 1KJ2H 4HIEA 3LKSA 1SJMA 1E7UA 5AW6B 3KXFE 4NKIL 1HH9B 1P53A 4DFIA 1ZHBB 3L3OA 3QP3A 1TQTA 2GTZB 2FJFA 1JE6A 2F1AA 1K4CB 4HSQA 1DN2A 3FO0L 3MA9H 3L08A 4ZSOB 2VDMH 4U6YB 2ZPKL 1A22B 2ATKB 2V7NB 4KHTH 1LWJA 4JRXA 2P45B 3BN3B 3OAYH 1WD9A 2K3HA 4J3OC 4MNGE 3WFZA 1AMYA 5D1QC 1IBHA 3ECBB 1GMEA 1XD0A 4Z7AA 4NYLA 3DO7B 4NNXA 3RNQB 3KPRB 2J8UF 4JGUA 2E56A 2BSSA 1A3ZA 3D52A 3SE8H 1IGYB 5LGKA 4X8GA 5HJ3B 4WW1A 4DP2X 2XN0A 3BP6B 1Q9OB 1GCYA 4BSVB 5IB1B 5MEND 4P3DB 4CDGC 5LG6A 5DMJB 1N68A 3NIGB 1XR9A 4IBYA 3CLEL 3FT3B 4G1EB 1QI4A 4M4RA 4UZUA 1ETZB 2AJSL