1O5PA

Solution structure of holo-neocarzinostatin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neocarzinostatin
publication title Solution NMR Structure Investigation for Releasing Mechanism of Neocarzinostatin Chromophore from the Holoprotein
pubmed doi rcsb
molecule tags Antibiotic
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1o5pA00
1J5IA 2G0LA 2MCMA 1AKPA 4JW3A 1HZLA 1NCOA 2CBMA 2CBQA 1J48A 1O5PA 1NOAA 2G0KA 2CBOA 1ACXA 1J5HA 2CBTA 1HZKA
chains in the Genus database with same CATH superfamily
2X53A 5AKTA 2DQCL 3VH8B 1UC6A 5MEPA 5E2JA 1QSFA 1RJZB 3A4AA 2YRBA 4X0KB 1MLCA 4N0YH 4R3SB 2D31B 2B59B 4LIQH 1BOYA 5HVFB 3TF7C 2ZICA 5IVXE 3HG4A 1A3RH 4KTYA 5HHPA 5IT2H 1AHWB 1ZV9A 4HJ0C 3RP1A 2ALAA 3FJTA 4WI7A 3ECBB 1CD0A 1NMBH 1XL4A 4M7JH 4O02B 3ME0B 5SX4I 3C6LC 3S3PA 3N04A 4KC3B 1ZWIB 3OPUA 1IQWL 2OMTB 1F56A 4ZRGA 3RVUC 3ABZA 3VWKC 2VDPB 4Z3GA 4B9KC 2HLAB 4LEXL 1MI5D 3VGFA 3WGVB 5I6LA 1SJMA 2IANB 3UAFA 5C07D 1E4XL 2DEYX 4S1RH 3V0WH 3WDIA 1Q9WB 4NPYB 1HCVA 1CU4L 4YSSA 2BY3A 3IFPB 3KYNB 3UTZB 5BRZA 2HT2D 3NTCH 1AIZA 1GKEA 4I2XB 3NEXA 1MCKA 2V7HA 2Y1AA 3LIZH 4K9JA 2BRRH 1NCIA 3IMWA 2PP9A 4NZUH 5B4MD 1NAMB 3VXOA 4A2LA 4JHZA 5DJYB 3ZL4L 2DZEA 4GLRH 2OM5A 2ZWZA 5KVEH 3ULSA 5J56B 3O3BA 4J8QA 5C0BD 2GIMA 2PYFB 4DK6A 1XXDC 4I4WB 1DQIA 3UYPA 2ESVD 5IR1A 1ML0A 4WGVB 5F9DC 4JK0D 4WUUA 4BQCA 1JWUB 3CDGB 3P4OA 4HKZB 3QG6B 2H2PD 3HG1D 3LDBC 1A21A 2NUPB 1IAII 1TTUA 2DB8A 2ED8A 3EBIA 3RWEB 4L05A 3ZSSA 4U6HB 2X12A 4MZ2A 1KJMA 1NGYB 4JG9A 5F1NB 5EU4A 1FWXA 3TJPA 5LNEA 2AXGA 3W39B 1KCVL 4LCIH 3SBQA 4WDIB 5D93B 3JYBA 4JANA 4JJ5A 5DA0B 1A7NH 4G9FA 2NCMA 2NSQA 1BVNT 3E0GA 1OTTD 3Q8EA 4QD2E 5J6SA 1S7SB 3VXQA 4FQHA 3CSBA 5AG9A 43CAB 4AZ8B 3OJMB 1VF5C 2FX8H 5EIIG 2CKBB 1GS6X 2LV4A 4DOHB 3MBXL 4Q6IA 4RBPK 1M1XB 2C4XA 2N1TE 3EOTL 4QWWD 1S8DA 2BNQE 1CXHA 3SJVE 3AROA 1J1XL 3U6XA 1P69B 3FB7B 3N0PB 1ED3B 2VTFA 2FQFA 2YD2A 2QTEA 4DKDC 4L8BB 5I2IA 3GC3A 2FBJH 4M8QB 3KLSA 3MRMA 3VFUB 2BXZA 2V2XA 4YDVA 2WBJB 3V6ZB 1NCWH 5HHVH 4M6OH 1M1SA 1N6VA 5B3SB 2XG5A 2Z35A 1UKTA 3CVBA 1DJWA 4P2QD 1SJEB 3AGWA 3LH2L 1E42A 4FZ8L 3I84A 4IGBA 2OULB 3I02B 3VSQA 4BSVA 4ELDA 3NSCA 2B1HH 3BGAA 3QDMD 4HEME 2JJTC 5MEQA 3IJSB 1P5VB 1R5IB 3IJHA 4OCLC 4PLNC 2Z31A 3V79C 5MHSE 4H1LA 2EH7H 1QA9B 1MI5B 5C6TL 4IBUA 4WO4B 5AW8B 4GAJH 3VXUD 3LKSB 5HYIA 3MRHB 1RUQH 2K9FB 3RZCC 3ILPA 3TBTB 3WJMB 2GHZA 2C3VB 1S9XB 4OGXH 5J4MA 1OXYA 1F6AB 1S5HA 3ULUC 3EO9H 1QTYT 2G2PA 4L3AA 1RZ8B 3ML9A 3R18A 1SJHA 1MCWM 1NIAA 2R2EA 3HA0A 3GINA 4FTDA 4L5FE 5HHQB 5GZOD 5I18L 4OZFH 4Z76B 3FCSB 1E27B 1BM3L 2DQHH 3KXFE 3L5WA 3QC5X 4JFXA 2VDLB 3UJTH 5LWYH 3P30L 3JV4A 2W9DH 1IUZA 2O61A 4RMQA 2DMBA 4AK2A 1OF0A 4XNYL 3MFGB 4HCIA 4D8PB 2XTJE 3TIEB 2YXWA 2OR7A 5L88L 1MFMA 2ITDB 5C0BB 3CHOA 3MRCA 3I3DA 2ESVB 2RTTA 2O6DA 1JHLL 3GRWL 5GSVA 1KCRL 3WNLA 1ZS8A 1HKLH 4N9OB 1AY1L 2YXFA 4ZUSA 1EHNA 2A3TA 4ZUUA 5F7FA 2BSCA 1CZ8L 1I3RA 2DLHA 3MLXL 3VFOA 5CGYC 2KQNA 3FB5B 5CFAA 1HT6A 3D85A 4MNGE 1S6NA 3FUHA 4HX1A 3DX3A 2P45B 1FDLH 1HEZA 3OPZH 3S0PA 15C8L 2J88L 1F11A 1J8SA 2HXAA 1WC7B 5CCGE 2YAPA 4X4MA 4QHUA 1IC4L 1IC5H 4PY8I 4UANA 5J7CC 4M7LH 3QIUD 1JXDA 3ATBA 2F54D 4H8HA 4RIRA 1UOVA 5TQ0H 5AL0A 1PZBA 2W95A 4ES9A 1TO4A 3ARUA 4NQED 3K0YA 1BZ7A 3KPRE 3FUMA 1QHOA 2DH3A 2XYCA 4HXAH 3TNNA 1MRCL 3HG5A 5SX5K 4KKZA 2YGNA 3OSKA 2AEPH 2WXNA 4DN3L 1CGTA 4BFIB 3CMGA 3DYOA 4K5MA 1YEFH 3PF2A 5ADPL 5I0DA 1G7HB 4E9QA 1BIHA 4OCSL 4OZHB 1ORQB 2YKLL 4C56D 4RFOL 1B2YA 3AXLA 3ZE0E 1I8MB 5D7HA 5A1AA 3KS0J 3O9WB 2DLFL 2V3DA 3IETA 2RIKA 1OWWA 3FFDA 4OFPA 4PJ5E 4NWTH 3MOAH 3CZFB 4G8IA 5ENWA 2LE9A 3GHEL 1W0YT 3PQYE 4A2EA 3ATFA 2XN9A 4OZFG 4DFIA 3IDIA 1S7TA 4G43A 3GGWA 4PWHA 3MODH 2NY2C 5D4IA 1Z32X 1IC7H 5FC9A 4M1GL 3BKMH 5AYUL 4P2QB 5C0CD 4P4KC 1DANT 1ZHNB 4E42A 5I0WA 1U42A 3N1MC 7TAAA 3X11B 4X6FB 1T7WA 1NJ9A 3N40F 3KEDA 3FU3A 3CDZB 4LSTH 3PYCA 2G0LA 4N68A 4BHUI 3B2VL 3FO2B 2FD6L 3G5VB 1TCRA 1U33A 4KRPD 4AXWB 1KFAH 3GPEA 1J1OH 3S98A 3CZSA 2NNXA 4BZ2H 4GQ9H 1INQA 4RCAA 3DSNB 4NYLB 1E4WH 3GSUB 4WWNA 3GTVA 2WYTA 4QUOA 1YY9C 4X6BB 1WO2A 4HGMA 5E6RB 4GXFA 1TENA 2OJ1A 3CVHL 1RIUL 4X0NA 5JUEL 5CLXA 4FTVE 4FLRA 3SDDA 1FA4A 4HS8H 3KNBB 4OFKA 1MREH 2J4WL 4AVJA 1GOHA 5TJWK 4LEOA 4L2YA 5F3HB 3MRRA 1BHGA 2RGSA 2DQCH 1BZ9B 1AIFB 1IVTA 2NYYD 1UGKA 2R2HB 1KDJA 4PV1C 2OI9B 4HUNB 1MJJB 3SB3A 2G75A 1CGWA 4M02A 4OV6F 1K8IA 2GUOB 4QHPA 1KBPA 4F5CE 1XR8A 5EUKB 3TNMA 3UAJC 4QAMB 1IQWH 3IGLA 5C0EA 2H45A 5EH1A 3QRFM 1ZVSB 4ZOAA 3MRQB 4X9GA 5KJRL 3MC0A 4LEXH 2JELL 3Q3GA 1U3HA 4LCCB 3SJVB 3VXSE 2FR4A 2A83B 3NA9L 1E4XH 3LEXB 4ZW5A 5CZXD 2GB2A 3TC9A 2ZOKA 1CU4H 2MCMA 3IE9A 2VSKB 1U6AL 4DJMA 1QTSA 1N59B 4D0BB 1NC2D 5F96L 1A65A 3S3CB 1XTLA 2QZQA 3GI8L 3HI1B 3GZOA 3CFEA 5B39A 2GAZB 1AXIB 1OOAA 4O2FB 2NZ9C 4NQEB 4HPYL 3TBVA 4TUJA 4EN2A 3BVTA 3NZUA 2EKSA 3SDCC 3PJSB 4IU3A 5DJCA 2FT8A 5E8PB 2G0KA 4GRLD 3ZL4H 1F3DH 2Y1ZA 5GS3A 5KYYB 1AMXA 1MCOL 2CIIB 4NSKA 3EJQA 4XO9A 4NRYB 5AZEL 3THML 3D0LB 1GGIL 3VWJC 5EOTB 4C56B 4DESA 3WD5L 1JWMA 3SODB 1W0WB 1T1YA 5F0PB 1FF5A 3CSTA 3D39A 4BV1A 2O93L 2UY6B 4Y1AD 1KYOJ 3WEAA 3N42F 1NOAA 1NPJA 1WAAF 2A1WL 3WE6A 5ITFA 4KKAC 2P8LA 4N2NA 3S36X 4CVXA 2ZXQA 2CPCA 3ASWA 3OQ3B 4GI8A 1QRKA 1R0AL 1KCVH 4Z77A 4JDEA 1LWRA 4N0RA 1JPEA 3MLWL 5CEYB 1LWHA 3QIBA 4LLWA 2Q5BA 4TNVK 1ZXKA 2C3XA 3EFOA 1E4HA 1EJOL 1KV3A 5T1MB 1AO7E 1XGQB 3KXFB 1KJ3L 3KL3A 1I53A 5F6IC 4G8GD 1FVEA 4KRPB 3RDTD 2XQYA 3PIQA 3LAFA 1UJ3B 5I8EA 4G6FD 5F93C 2H6PB 4F7TB 3PP4L 3MBXH 2XTJB 4BUGA 2FJFA 1TEFA 3EOTH 5FECB 3WNPA 2H9GB 3QUXC 4XPFL 3C5ZB 1J1XH 3ET9F 3VXNB 1RZGA 4YHIA 5HDQL 2B8OT 2F7PA 2V9UA 4GKZA 3F6LA 2ALWA 4TUUA 3ULVD 2A6DB 2MRYA 2VLME 3ZMEA 1U3YA 2YA0A 3GZPA 4LPTA 4F7PA 4NJ9L 4DGUA 1BQHG 4MNGB 4PRBB 3BUYB 3U2IA 4C4BA 1IEBA 1RUPL 3VU1A 4HSQA 2IXQA 4M1CD 2Q6WA 1HILA 5HVWA 2QJDA 4MAYC 5KYXA 2M2DA 3LH2H 4PJIA 4FZ8H 3DIFA 5CD5D 4WFED 4UIMA 4WNSA 2YLHA 3IK2A 3LIUA 4M7ZB 2BCKB 4MRCA 1M6OA 1YNTB 2ITCB 2H0FA 3LOWA 4IOSA 2VE6A 1NA8A 4HIEB 2PXYD 1QEXA 1WS7A 2QV2A 4XTRC 3KPRB 4JL1A 1BMWA 5DJ8B 5CJ8A 3WTYA 1WITA 4N87A 2IWEA 4ANKA 1BFOA 2BO0A 2UZYA 3B9KD 3GSQB 5LG6A 2ENJA 5DA4A 4TN9A 5C6TH 3C08L 5EU3A 4ANWA 3TCXA 4WEBL 4HIJB 3VJ6A 1LQBC 1YUHA 3APCA 5HXMA 3QNXA 1PIFA 4NNYB 4JHWL 3VX0A 2R4RL 4Z7OE 5DO2D 3ULUE 4I9XA 2WZPD 4AJ0A 3GHBL 2MNWA 1KELL 4O2EB 2QDVA 2E76C 3BESR 5JMOC 1NC2B 4ODBD 5E4EC 2V5YA 3MA7B 4G5ZL 5CCKL 1FQ9C 3HCVB 5I18H 5GRVL 4WHTA 1BM3H 4JQVC 3VA2C 3P30H 1IBGH 3NRQA 4BUQA 1IAKA 4Q58C 1ZOXA 2NLJB 3ZO9A 3DJSA 3W57A 4XNYH 3SBWA 3G9VA 5L88H 1YEDB 4XXDA 5E4AA 2HX7A 5ERWB 3QDGE 1OPGL 4N5EC 4JUSA 4R0LB 3A67L 3DPBA 5I71C 5HD8C 1JHLH 3GRWH 3F6IA 1KCRH 3ARBA 3PHOB 3O8XA 4IM8A 2E7LC 3MO1A 4U6TA 1AY1H 5EBWB 2YEZB 3ALPA 5AVYB 5I1DA 4AV4A 3ZJAA 1CZ8H 4MKMA 4XBGA 3MLXH 1XCQB 1KXTB 2FUTA 5DZNA 2WV3A 3O4OC 2VR6A 1XFPA 3EADA 1WTGT 5I1HL 4FTVB 4BQBA 15C8H 1BOGA 1GRWA 1SM3L 1UASA 2J88H 1AD9B 2A74B 2JB6B 4X4XB 1G0DA 4TSBL 4Y9GA 4FFWC 1IC4H 1YN6B 4XXWC 4RNRB 3SE3C 3TH2T 3WTWA 4MXQD 2Z4TA 4OR1A 4X99B 2R2BB 4XCFL 1UXSA 4TLSA 3SYOA 5C7XL 1NANI 2UYLA 3OGOE 3SN6N 3EYVA 1A7RL 1MRCH 5D96C 1RP8A 1SOSA 3KWUA 1D9KB 3DVGA 5JPMB 4A2DA 3DGGA 4DN3H 4N4YB 2CNYA 4OCSH 4PD4J 1JPSL 4TKWA 3JXAA 2YKLH 2YQ2A 5D1QE 5J9PB 3KYOB 4RFOH 3OZKA 5HI5D 1FSKC 1Z9MA 4ZTEA 2DLFH 3K7UA 2IEPA 1JZJA 4P2OA 4JFOB 3L95B 4H26B 1BQKA 3VXSB 3GHEH 4JCWA 4ES8A 4JCLA 4NQVA 1HDMA 5FA4B 3VD5A 2QELA 4JZNB 2IGFL 4PJFA 2NXYC 3GSNB 4YFDB 3FQNB 5CJQL 4Z7UE 5SWSA 3OQRA 1WBZB 1OAJA 3MUUA 4M1GH 4F2FA 5AYUH 3BRDA 2JSFA 1N26A 1O5DT 1J5CA 3PWJB 4MD5B 5C08D 1FG9C 5JQ6L 2F2HA 2X4RB 4AUJA 4Z9KB 2Q86A 3B2VH 4F80A 2FD6H 2DMKA 3MV8A 3WEXA 3FUEA 1BBJA 1NKRA 2D3LA 3RVXD 5SWZE 5H2BA 4GS7C 1W72A 3TEZA 1QWUA 3KPNB 4LBAA 5HY9B 3BW9A 4ZUTB 6CGTA 1R6VA 5FX3A 1GXEA 3FUFA 2WVVA 1T4WA 3CVHH 1RIUH 4PJIF 3VB9A 1RD6A 3X3GL 4AQ8C 5JIMA 5JUEH 4ETQB 2C9AA 3O45B 5ICXA 2J4WH 2A0LD 1BQRA 5FXCH 3VQ2C 3W38A 5CF3A 3L3IA 2YAFA 1XIWB 1OHQA 4W70A 5E1AB 3ZDXE 3JZYA 1ZHLB 5AAMA 3WV0A 5A43C 2HFEA 1T83C 4QHLB 4E9LA 1J9QA 3P54A 4MB3A 2YXVA 1P6FA 2ZAHA 5CZVL 3KVPA 3VDAA 5DRZB 1AO7B 2CO7A 5E1GA 4N2AA 4K4KA 5DTFB 2P80D 4M61B 4PGBB 3IBOA 2J8UE 4QRAA 2VWEE 3D12B 3QJOA 4H5SA 1QAWA 4ZTPL 2R1XA 1WAPA 3D34A 5CIPB 2GHWB 4FNSA 2ARJQ 2ETWA 5KJRH 3UEZA 1G0XA 3IAQA 1TG8A 1TO5A 2JELH 1D3CA 3CC1A 3FTVA 2UZXA 1REIA 2VXQA 3NA9H 3NESA 4DP6X 3L17A 4RSVA 3KHQA 4TS6A 3D3VA 3NA4A 3QWNA 1QSED 2ADJA 4OGAD 3RB5A 3G08B 4PJHE 4FI7A 1U6AH 4G83A 1XEDA 2NNCA 3FQUB 1KZYA 4FL4B 4FJZA 4W1TA 1KXVA 3MI6A 5F96H 5FLUA 4QOKE 1JK9A 3GI8H 4HH8A 5J0BA 4JFEA 3EJPA 4M93B 1X5AA 1AR1D 4PFEA 3UBHA 4HPYH 3QI9C 1SEBB 4JY4B 2W65A 3N40P 1UOLA 4HMEA 1DZBA 3BPLC 4W6YB 4CJ0A 1JK8A 3FRUA 1VCBC 3VTMA 3U79A 5FYLE 1MCOH 5AZEH 4V11A 1K8DB 3THMH 3GMMB 4F7KA 1GGIH 3MV7D 4LKXA 5CZRA 3IU3A 2NTFA 3B3IA 4L3FA 5T3XD 3CXHK 5ID0A 3WD5H 3V7AE 1H3XA 2WLMA 1PL3A 2WQUA 2OPCA 4IMKC 2WLHA 4AJYV 1SF5A 4WUKL 3MREB 1FFNB 2Y72A 3KPLA 3WS3B 3K6SB 3VW3L 1OZUA 2HTLD 2VDNL 3EGXB 4KH9A 1VFAB 3FKUS 4EI6A 2A1WH 3Q7JA 3REVB 3D0VA 3UACA 3VFVB 3H7BA 4KHTL 4IJ3C 5DZOA 4GINA 2NX5D 4W9FC 1CXLA 3S4SB 4P46A 4AGPA 4J3SA 2O5YL 2AQSA 2I60L 1R0AH 5IVZA 3PS6A 4WV1B 3RGVD 1PMYA 3RI5F 3PWLB 3VFMA 3MLWH 1ZE3H 4QRRE 4GUCA 2AQQA 5AOLA 1EJOH 1KLUA 1HI6B 2HJKB 1KJ3H 1NEPA 2P5ED 2YRLA 1CUOA 3RB7A 3VO0A 5C09A 4ECNA 1NWPA 5BRPA 4AQOA 5C97A 3GSOB 1T4KB 3PP4H 2Y2YA 3WIIL 3SCMC 3U4AA 3V4VB 1E7VA 1RUKL 5JIPA 4NS0A 5EHFA 2JJWA 1B90A 2FIKA 3QDGB 4XPFH 2NW3B 4HCRL 2VT0A 4LBEA 1M7DB 1PZSA 3FT3A 5HDQH 1L6XA 2WSKA 3K74B 4U1LB 1NFAA 3BP7B 4GBXD 5DHVB 5TPWL 6PCYA 5I17A 1A4KB 4MBOA 4KJQD 1CIDA 1M2OA 4JN2A 4ICXA 4NJ9H 1U0QA 3FB8B 1RUPH 3ILDA 1R46A 3WHE0 2C9XA 4P2RE 1JFQL 1BVLA 1IIKA 5AW9B 1Q8MA 4NENA 1LP9E 1U8HB 4XMWA 1BAGA 3T4YB 2IQAB 4NHUA 2Z91B 1Z66A 4XVTL 1I8IA 3NZHL 1L5GB 2F1EA 5LJYH 4APQD 3QIWC 5H35B 4HHWA 5IESL 1OTSC 2DMGA 2EDYA 3I6KB 1EXUA 3V4UL 3ZX1A 4HIQA 3C08H 3CPLA 4WEBH 4HKBA 3LVEA 4LK4A 4FNLL 3ZRCC 4CUCA 3J8F7 1U92A 4JHWH 5D1QB 2R4RH 4MMXB 2GSGB 3FN9A 1QSEB 4GIPD 2E47A 2NNFA 3GHBH 3JWDL 4NO0A 4Z7WA 3NDYE 3P69A 1KELH 5EEVA 5EBGA 4HU2A 3QARA 2MHAA 4G5ZH 5CCKH 3JTSB 3EDJA 4U7SA 2BS71 3F7VA 3P3TA 4AY0A 5HGHB 4LMQI 2WZAA 2XV2A 4HC1A 1RU9L 3MNZA 5AW0B 3AG4B 2Y9RT 2D2CC 3A0OA 4J28A 3FL7A 2FJUB 2WNGA 2Z93B 2O6FA 3MMEA 4GT7A 4PGDB 4DSYA 3HUJB 3MUZ1 4PV8A 1NFDE 3K4ZA 1OPGH 4NN7B 5CAYB 5EDSA 3A67H 3NJMA 1ZE3C 4YAQB 4RGOL 2DWEA 1L7TL 3T1FA 1XB8A 1OE2A 2IBBA 5GS0D 1PLBA 5LNDA 3KD4A 3WY2A 1G1CA 1UEMA 2AV7B 2VMFA 5JOEA 1HHGB 5A3IC 4ZQKA 3BPCB 1KPVB 4PJ8C 2XFXB 4Y8DC 4IOFC 2QVMA 2VGLM 3FRPA 4ABWA 5I1HH 2BIIA 2P46B 2NX5B 5SV4A 5JPNB 4NAMA 1SM3H 4TSBH 4GQPH 4UT9A 3G6JA 3RGVB 2A6JA 3RY6A 1PCXA 2YZ8A 4DP8X 2ARWA 2JCCE 3FS9A 4L4TE 5E03A 5IMMB 4K71C 4YSRA 5FM5M 4X83A 2GTWA 4JEGB 1IL1B 4XCFH 5ID1B 1M42A 2PYED 5C7XH 1H6TA 4NQDD 5IOPB 1C08A 4U1SB 3DA0A 3VRLE 1HCZA 4PJ9A 1A7RH 3M17B 5FOBB 1OP5H 4HT1L 5IEHA 3S48A 3AT9A 2NY0C 3UC2A 3OKYA 5EUOE 4ZMYA 2ZKYA 4MHHG 1X6NA 4N3UA 1JPSH 1Z5YD 1ADWA 3BRFA 1ZT1B 4GBXB 1COBA 1KNOB 1NDMA 3QDJD 3GB7B 1A6UL 5D4QA 4QRTA 3T8MA 3QPXL 1EEZB 1GL4B 4P5TC 4Y8AA 4PS4L 1UWYA 2XXMB 1MWAB 3HJ0A 1H3WM 2IGFH 2WC7A 2UZPA 5JW5B 4U0RB 4LOVA 4PJHB 2WLYA 3LYRA 1FG2A 1OGSA 1ZXQA 1U91A 2H41A 2JKIS 5GZND 2YD4A 3UEQA 5HVHC 3KPPB 1J88A 2O4EA 4QOKB 2EIBA 5JQ6H 3CFKB 3C6LA 3GBLA 3U2SB 4YLQT 1KGJA 3DHMA 4E5XG 5CWSB 1QBML 3VWKA 3NCEB 1R9FA 3MR9A 5ICZB 4PJCE 4FQIL 3MACL 3TA3D 4U2YA 1FNGA 3W5MA 4JO2L 2F15A 1VDGA 2DBJA 2XWTB 5IB1B 5F7KC 4W9HC 5I82A 4KXZH 2F1BA 2DEXX 3X3GH 1U4EA 3FCTB 2H0JA 4HV8B 1G9ML 1QLRA 4IK6A 4OUUB 1I9JL 1XGPB 2GCYB 1SBSL 2D7NA 4MDJA 3NJHA 5LAXA 1VA9A 4ABVA 4HEPG 4F24A 4ADJA 1QUPA 1F1DA 3QXAA 1R3JB 4GW1A 3LN9A 2X2HA 3NJFA 5C1MB 4QHKI 2ENPA 3NJJA 3MJWA 1JHTB 2GG1A 1F4WL 5E9DD 1U8PA 4Z7VF 3LZLA 4QRRB 1DZ0A 3C60C 5CZVH 4ZAKC 5C3TA 3KJ4B 3HBQA 4B97A 2YQ3A 4HBQA 1WP6A 2AHIA 3D25A 3MLTA 4JZJB 4ZTPH 1LD9B 3RUGE 3S6CA 5K59F 1XAKA 4N1CA 3R8BB 3CU7A 1P84J 3OKEA 4LLQA 4WFGD 5GGRB 5LBSA 2NY1C 4GW4A 4YXHL 3NRFA 3VRJA 4EJ1C 2KI6A 3AWEA 4LHUD 1IAIL 4Z6AT 1FH2A 1MHPL 1N2RA 2X1WL 5FWRA 5AWNL 3MYZA 4DCQA 5IM7A 2R56L 1V5JA 1SXAA 1DBBL 3CH1B 1OLZA 4N2MA 4DHLA 2X38A 1SQ2N 2WZ5A 4ZYKB 4A68A 1YVLA 4NNPL 5E00A 2F8VA 3T0ED 4LPVA 3GMQB 1E28B 4ZO6A 4P2RB 5E8NB 2AXFA 5GGVL 1F41A 2BMKA 4HDIB 1LP9B 3IN2A 4GY4A 2DQFA 5DI8B 4M4RA 1UENA 5D1ZD 3K5SA 5E2VL 1AHMA 4OCYL 4OZGE 4BCYA 2GEQA 2IBGA 3JV0A 4OLWL 3LKRA 4GKSB 1HNYA 4Y5VB 3APNA 5A2IH 3AT0A 2Y5QA 1E5YA 1IJNA 1F90L 3G6JF 3QFGA 4JKLA 5I1AB 4WUKH 4IHOB 4Y4FB 4NP9A 1Q0EA 3X1NA 1AZCA 3VW3H 5EIIA 3ZN6A 2VDNH 2CQVA 4A7GA 1Y07A 3QO1A 4KHTH 1I9EA 5CJ5A 3CC5A 3BISA 4GRMA 2NXZC 5K1NA 1YO4A 4LSPL 2O5YH 3OX8A 5E6IA 2I60H 4PG9B 4WFHE 1NLDL 1X5XA 2E6PA 5DZLA 5BJTA 5BXFB 1K85A 4GEJA 3IWVA 4AJWA 4Z3IA 1YPZA 5FV2A 5FF6B 4LQFL 4DKTA 5E94B 1P4UA 3DTXB 3LIZA 3N0AA 3ARYA 4BH8B 3C6SB 3L3HA 3OB0H 4NUGL 2KYIA 4XBPB 5JNYA 2YAOA 1AS6A 1DO6A 5K9KB 1SQMA 1DVYA 4X9YA 5HVGB 3WIIH 2XN1A 2AERT 2ZG2A 4OFYD 3COOA 1RUKH 4PJAA 2DYPA 4B41A 4QRUB 5FUZL 3WKQA 4JB9L 1NFDB 3DBXB 3FBQA 1DANU 4HCRH 4PP1D 4J3XA 1YEKL 3GYRA 5MEND 1JWSB 4MYPA 4LKCA 3RIAF 2P5WA 2VN3A 3MTRA 1DDTA 5TPWH 3L4VA 3STLB 4R7DA 5F7DA 4Y5XB 2WLLB 3WUWA 4NI6A 3ARGC 4YDMA 1EJ6A 2F5BL 4FQLL 5TK2A 4KRNA 3EZ8A 4PV9B 4AOFA 4JGJA 4NQCA 2LQRA 5KSBE 3QCVL 3X14A 1P5UC 3U48A 3RKDC 3MRLA 4FOMA 1JFQH 4HFUL 1CBVL 3P4NA 5LN4A 3KYMB 4LCVA 1JV5A 4FN0A 2JCCB 4ENZA 4PR5B 3WELA 3PHQA 1ID2A 5DWUL 4FXKB 5HP5A 3B5HA 2OSXA 3U7YL 1N0LA 2Z8WC 4XVTH 3NZHH 4JMXA 5GRWA 5CBAB 5FO9A 3BUPA 5IESH 1BX2A 1XGTA 4YFEA 4N2HA 3V4UH 3OLGA 4EDWL 2IV9A 1NAKL 1NBCA 1SY6L 3FFCA 4FNLH 1L9OA 3GJFK 4YWGL 1QATA 4CN6A 4RFEA 3HC0B 2V8LA 3Q5YA 1S2EA 4N2GA 4RAVA 2CLVB 4LHUB 5DRXB 4JQXC 1H6UA 1T1ZB 3AXHA 3JWDH 3WKML 1A3LL 3C75A 1EAQA 5AUMB 5EORL 2IAMC 3ASOB 2VDOB 4PRNB 3GUTA 1I1YB 5IK3B 2DWSA 1Z3RA 1RU9H 4UWQB 2JKSA 1PQZA 2HN7B 3MRDA 2VDKL 3P2DA 3S9DB 1V7ML 1VADB 1Z9OA 3HE6D 5F7HA 3PAUA 4NUJB 1U3ZA 2JI2A 3D69B 1KGXA 4Q14A 4PCKA 1H5BC 3R0NA 2FHFA 4QHMA 1RERA 4XN8A 4U1HB 4WO0A 5KANI 1OW0C 4RGOH 1L7TH 5TGBB 1ODAA 5EC1B 4PJCB 1EO8L 2GITA 4J3UA 2OQJB 3RNKB 1JNHA 3OGCA 4J3WA 4YC2C 1LO0L 3OMNB 1ZLUH 3VFSB 1IM9D 3KGRA 4R5TA 1YZZA 5F7NC 4JFFA 2WIIB 4G7YL 3ENEA 1HWGB 1QPPA 4P4KA 4XVJL 35C8L 1T0MB 4V1DD 5I8CB 1H8OA 2GYSA 4CGUB 2P5PA 4FXGC 1IEAA 3EIFA 3FCGA 5DFTA 1LVEA 1WF5A 4HJEA 1MEXL 3HE7C 1JZGA 1Q9LA 4JKWA 1XGZA 2I24N 2OZNA 4Z7QF 5D55A 2HWZL 4Y2OB 4EUPB 4I13B 3BI9X 3TT1L 2VRKA 1J0KA 4L3EA 5DZ9A 4HT1H 3A6OA 4OU3A 4BCXA 1OSYA 2YXMA 4LCYB 1HE8A 2W88A 4AYMC 1NBZB 1IKFL 4YDKL 3K71B 3ELQA 4CU8A 1X5KA 2DQGL 3NPSB 1FLTX 1YPZF 3RUGB 1NFIB 3D4YA 2LVEA 1A6UH 1RHHA 1HL8A 1IFHL 3CZEA 3QPXH 1JGEA 3AWGA 3GLDA 4PS4H 5BVJA 5E7FA 3NCFB 3QO0B 4B9YA 4FLOA 5JORB 1NL0L 4D2NA 1CICC 4GOSA 4PJAF 1EX0A 3H3BC 2Z6FA 4Y9EA 5J12B 1OCRB 3RVVD 4Q2ZA 2BY0A 5DVOA 5EF3A 1OIOA 4PBXA 2EDMA 2Y7LA 3UAJA 3JWDC 3VGDA 1MVFA 1RK1B 4MS6A 2OFQA 4M3KB 1JXKA 3S5YA 5JIHA 3TBSA 1ZV2A 1QBMH 3IPEA 5AW5B 1Y6NR 1NBVL 4F2MA 2XKNA 1G94A 3QWOA 3QJHB 4FQIH 3MACH 5G2NA 5SX4H 4OZGB 2VMCA 2PTUA 5C0JB 3QJXA 2PO6A 4JO2H 2BX5A 3BO8A 5DRWB 2EO1A 5EBMA 2EIZB 3BZ4B 2ODHA 4GG8B 3O6FD 4S0TD 4XNUL 3WG7B 3GS4A 3OJDA 1G9MH 1KB9K 3QPQC 3ZIMA 1I9JH 5IZ7A 1SBSH 3D2UA 3E6FA 4R26L 1ETZA 3VFNA 5CP7A 5L2KA 4BDVB 3MUHL 4R7XA 1RUML 2CLRA 5TQ2L 3K2IA 1QSFE 3K4DA 2BC4A 3SDCA 2JKWA 1WIOA 4DZ8B 1F4WH 3BFQG 4NUQA 1NMAL 3V9CA 3PL6B 2BERA 2VOTA 2EYSA 5HHNA 3ECQA 3VWJA 1A1NB 4EIGB 1I1AD 2OXHA 1ND0A 5BUPA 4GSRA 5J6GB 5F7MC 1AGEA 3Q6FB 2FLMA 3GLZA 4Z3TA 5AB9A 3BVUA 2BNUA 3PDOA 3MUGB 2VLLA 5JO5A 3V6FA 1DN0B 3WHXA 3DRTB 1NOLA 2EDDA 5DT1L 3MRKA 3EUUA 2CO3A 3MFFB 5FHBL 5I16B 2WLIA 2X4SB 1FZMA 2CA3A 2Y7OA 4YXHH 3KLKA 3NCYP 5FYLL 4ANVA 3MRIB 2EDOA 3HBZA 1NM9A 4HS3B 1O6SB 5E5MB 3MNDA 3ZKSD 4OJCA 1YDPB 3ARDD 1IAIH 3QXTA 1MHPH 4OKVB 4PRIE 3HPJB 3T1WA 3BWZA 4NDMA 3LJ3A 3EJUA 2OYPA 1WSST 5E56A 2BHYA 5AWNH 1FZOB 1R3LA 2R56H 2YPKA 3AG1B 4FULA 1A1OB 4RRPG 5HDOA 3UMNA 1DBBH 2DWDA 2AJ3A 1I8MA 2W1NA 3IJYA 1BVKB 2ZUTA 1QO3A 4HOWA 4NNPH 5MEOB 3DX9B 4FKKA 3V4PL 3WO4B 5A2CA 3WTSA 1WGOA 3IDYB 3LNHA 4WK4B 5GGVH 1FYHB 4P9ML 4WKZA 3KGSA 1M7IB 5DMIL 3D87B 1NCBL 1A64A 2Z4QB 1MNUL 1R4XA 5JR1L 5E2VH 1PZUB 1AGFB 2A9BA 4OCYH 1KENL 4G80A 5EEZA 2VLJD 1KTLB 3WIFA 3L1GA 4OLWH 1J5DA 4ODUA 2J2ZA 4O00A 2A38A 1QOKA 1F90H 1OTUC 4TNWK 2FLBT 1G1YA 4AIOA 3RY4A 4HS6B 1EGJA 1TU2B 3FK3A 3OKMA 4DW2L 5GSRB 3QYNA 3L3DA 1TT6A 3QQ9C 3RRQA 4EI0A 5KYWB 4XX1G 3V0EA 1LO2L 4NRXA 4LSRL 5DYOB 4MB1A 1SDDA 4HUCA 4MAYA 1DJYA 4UTCA 4LSPH 5E5UB 4S0SD 1K4DA 1NLDH 4KK5C 2UXVA 3OHXC 1JZ4A 1Z9PA 5D4HA 5IG7A 2XVBA 3NJLA 4LQFH 1S9KC 1G9MC 4QKTA 4WW1A 1MFCL 1TCMA 2H26B 3MX0A 4FKEA 4DP4X 2RA1A 3MBEC 4HUXA 1BV8A 1DEEA 3QUKB 2P8MA 5FUCE 3ETSA 4NUGH 5KYNA 5AAPA 6PAZA 5LGJB 2EIMB 3F83A 5ESQB 2QADC 2N59A 3D18A 3WE1A 1MAML 1MQ8A 4OD3L 2YWZA 5CMAA 3RVTC 4AX3A 3JWNH 5FUZH 2EXWC 4JB9H 1Q72L 1U8KA 3QQ4B 2A9NL 2W0FB 2PP7A 4H2AA 1YEKH 4C59B 3H1ZA 1AYOA 3ABMB 2DOCA 5ECGA 2H3NA 4QKXB 3VM7A 1KBWA 2G9HA 2NNAA 2F8IA 3GJFB 2E0PA 2F5BH 4FQLH 1E4KC 4DQOL 4JQVA 3IVKB 2YIHA 3PAVA 2EIKB 5CD3A 3QCVH 3LCYA 5KTEL 1INEL 3W56A 2K3TA 4HFUH 5HYJD 1CBVH 4AYSA 2L0DA 4LHJB 1IIIA 3VSUA 4U1NB 4EDXA 3W5NA 3HJEA 3U7AA 5DWUH 3EKCA 4OCWL 3DOSA 2E7LA 1W8OA 3U7YH 1X5IA 1Z2KA 4PJBF 5I5IA 3RYMA 4JO4L 4FQQB 4W9IC 4XPGL 2DW5A 2DJUA 4PN6A 3LV3A 1FFPB 3OXRB 1ADQA 1P7KB 3RLSA 4EDWH 1NAKH 3RVWD 4XNMA 4B7IA 1SY6H 4TVPD 4YWGH 1EMTL 1U41A 4BUHA 2MKLC 1UH3A 4WUUD 4N6RA 3ARDB 3BDYL 4KKBC 1C5BL 3AREC 4AM0A 1SMAA 4AIXA 3WKMH 1A3LH 3UERA 1X9LA 3ZTEA 1BZQK 2Q3XA 3SE3A 1OP3K 2F7IA 4KJYB 5I23A 2WJ7A 2XI9A 5EORH 4LNRA 5EU5A 2FEDC 4UDUA 5IMLA 5A40E 4OZIA 2COVD 3HTLX 3V6OC 3ZDZF 3GNML 5T1DL 2VDKH 4WTXA 1V7MH 2XKSA 4EI5C 1E6OL 5D71L 4PSRA 4LLMA 1AYRA 1HHKB 4G9FD 4NKMA 1K72A 4NXKA 3JWNG 5IMKB 4S2SA 2CUIA 5LXVA 1PG7L 1KGCD 3MNVB 4JRWA 4W4OC 5FYKL 4I18C 3ZGIA 2OX5A 4A2HA 1FO0B 3MGTA 4N2LA 4PWJA 3V8OA 5C0RL 2HT3D 4P23D 4Y88A 2J8HA 1EO8H 4K94L 1H3GA 4HOZA 4XN9A 1M9WA 1LO0H 4F33A 5MERB 3MNWB 4DGWC 2NY7L 2WXOA 3QJQB 1P4LB 3BYTA 5GGRY 4F15B 4G7YH 5BVPL 1L0XA 4XVJH 35C8H 3JWNC 4X4ME 3C8KB 2DIJA 2VDRB 4A7UA 4HAFA 1SXNA 4XPHL 2OMBA 3QNYB 1YJDL 2VNCA 1HEJC 2RJMA 5MEPB 2EDJA 1QSFB 1MEXH 4KPHL 3D9AL 1WAAE 2FQEA 2CG9X 4FFZA 2EC9T 5C0ND 1MLCB 4KQ3L 3SY6A 2HWZH 3B56A 1OLLA 5HHPB 4FF9A 3TT1H 1D2OA 2C7FA 3BEVA 2L8AA 4ZX5A 5KJ7E 1F86A 2E9BA 4KV5F 1XVSA 1QPKA 1WZAA 2QMKA 3BKCL 4HK3N 1QVOA 1IKFH 4YDKH 1UUNA 1KT2A 2DQGH 5I0VA 1BD2E 1VEPA 2L04A 2PW1A 3CN4A 3FSWA 4KTDL 4Y4KA 2CR3A 1Q9KA 4Q8BA 4P9HL 1IFHH 4QRQA 1BPVA 5INDA 3GRGA 3ULAB 2WZ0A 4U6VL 3K6DA 1QRNE 2WNWA 5F7WC 3TN0C 2YBGA 2D7OA 1X5HA 4M6NL 5DGQA 1CGYA 2HZHA 1TZHA 1L0YA 1U36A 1KIUA 5FCSH 4B3EA 1AE6L 2G60L 4JPIA 1T83A 1NL0H 2QQQA 2XWEA 1HXMA 4QRBA 1YRKA 4KJWD 5BRZB 3SEPA 4GG6A 4H0GA 1B4TA 4GW5A 4NKIL 4OT1L 2V7HB 3WUZA 3K5RA 4JFUA 1G6RA 3SO5A 1CTOA 1KCLA 5GISL 2Y1YA 2NW2A 4WENB 3VXOB 1NBVH 3RWHA 2CHDA 2OCCB 1JGDA 4XI5D 1BCIA 1U21A 1JYXA 4PWFA 4XMKL 1EWHA 3VDBA 3S37L 3ULSB 2AK4D 3O3BB 3RBGA 5KBKA 4PRHD 4LSQL 4WI2A 4XZ4A 3UYPB 2DI8A 3VGGA 2JXMA 1FYTD 2X2UA 4WUUB 1PLGL 5C8JA 4XNUH 4V33A 4X6EA 3P4OB 3WMSA 1HNGA 4JRXD 4R26H 3TCTA 4D8OA 2HCZX 3D85D 4NCDA 4ZFFA 1CD9B 4NC0B 1RUMH 1KJMB 5TQ2H 4GYBA 4KMQA 2J56A 5EU4B 1AQMA 3CWGA 1CG9A 1FAIL 5KG9A 2AXGB 4MZIA 4B27A 2P28B 2A5UA 4KY1L 2RCSL 4JANB 4OF6A 3KLQA 3IJEA 5E6UB 2CXKA 2GC7C 4JJ5B 1SYSA 3ZE1B 4AKOA 1CI3M 1F1AA 1U8OA 2DS4A 2HRLA 4G9FB 3KDPB 3T3PF 4LLVA 3VXQB 4FQHB 1B3JA 4KK8D 3T6ZA 4IMKA 3S37X 3RKPA 4MVBD 5DEJA 4HUVA 4IKNA 3UTPE 4M4PA 5GJTL 3V0HA 1J5HA 4Q6IB 1VGKA 3T08A 5DT1H 5ACZA 3S3DB 5IB4B 3U9WA 1BG9A 1S8DB 4HD5A 5FHBH 3VSTA 3WSQL 2YN5A 4OZIF 5FYLH 2A4CA 2C1PA 1UYWL 5I2IB 4FD0A 2DYRB 5D7LD 5HHME 3HFFA 4PQXA 5HBBA 3DI3B 3MRMB 4FYTA 4B0MB 3CVHA 2WW8A 2V2XB 3BHBA 4YDVB 3IXAA 1L0QA 2KKQA 8PAZA 4FNQA 3D8MA 4ZUVA 3D09A 2XN9D 2XG5B 2Z35B 1AS7A 2BP8A 3QORD 4L37A 4ORGA 5C0IA 3ROLB 3ZIYA 3V4PH 4Y16A 5B38G 3QXUA 4HIIA 5EPMA 3S7GA 4P9MH 4C4UA 4JO5A 2B2XL 3CH8A 4NQXA 4IGBB 4O02L 5DMIH 2XUWA 5DR5L 1NCBH 4O51A 2FQGA 1T20A 2HP4A 1MNUH 5JR1H 3VD0A 3UZVA 1WT5C 4X8JA 4BSVB 2YQBA 1KENH 5HJGA 3JT0A 1JVKA 5JHAA 3VXMA 1CCZA 5MEQB 3IJHB 1X9QA 1XF3A 2Z31B 3HHRB 4U31A 5E70A 3D39E 4H1LB 5D7JD 2VLRA 2QVIA 3ZKXC 4CDHA 4DW2H 2EVJA 3IF1A 2EDEA 2AANA 4P0DA 3ILPB 2EILB 2F18A 4GJTB 3BKYL 1SHWA 1LO2H 1VGEL 4LSRH 3IGAA 1Q94A 2BSEA 5EO1B 2AVFA 2XWBA 1T2QL 1S5HB 3SDDD 1RZKC 4IKLA 1P2CA 1SPDA 2TAAA 1FFTB 3FULA 2EDTA 1SJHB 1ETJA 2R2EB 5D1XA 5F6HI 1UM5L 3FUKA 3H9SD 1MFCH 1TQVA 4JFXB 3SO3B 2BP5M 3L5WB 2QQLL 2YC1A 2QEJA 3QIWA 3JV4B 4FX5A 4XT1C 5ANHA 3VH8A 1RZQA 4PS7A 4QXWA 3Q9QA 1UT9A 1LEKB 2WOBA 1H3UA 5LB1A 2W60A 5GGSB 1MAMH 4OD3H 4X0KA 4ZO9A 3VUAA 4DPBX 3MRCB 4QJ3B 1AD0A 1Q72H 5IQ9B 5C0GA 5GSVB 1XSJA 2A9NH 1ZS8B 3EFDL 3GKWL 1ZGLA 4GG6F 4JLRA 1OD9A 5AKRA 4ZUSB 4BCZA 4ZUUB 1I3RB 3VFOB 2ZXCA 1U3HD 4EOWL 1I8LC 5ICYA 3D85B 3BPNB 3MRNB 4HX1B 4U1GB 2CJ3A 2NNRA 4DQOH 1HEZB 5EOQL 5LVEA 1F11B 1R17A 3P2TA 3RIFK 2J44A 5I6KA 4KOCA 3FZUD 4QHUB 5KTEH 1INEH 1C7SA 4PJIE 5AW3B 2WJ5A 4RIRB 3U0WL 2AEWA 4OUOA 1WS8A 4H20L 4D7BA 4I0PD 5AD0A 4WGWB 1GSKA 3N42B 1OAKL 4AMWA 4OCWH 4AMXA 2EDXA 2OTWA 3OM3B 1DO5A 1TTBA 4JO4H 3SKMA 3TNNB 4XPGH 4CSSA 3PWPE 3OKKA 2IDFA 4MWFB 4POZD 3PV6A 2VH5L 2Y7QA 4OF0A 4PJ8A 1MHHA 2OZ4L 2VJ8A 3RTLA 1NAMA 1NSNL 3TBYA 3QJUB 1RURL 4HJTA 4A04A 5CEZE 3WGUB 1EMTH 5C08E 3AXLB 5J6HA 1FIGL 1BD2B 1DBJL 3BDYH 1BQUA 1WA2X 1C5BH 3JT2A 4AYEC 4LU5L 3IETB 3DK0A 3FFDB 3CFCL 1EANA 1MW0A 4G8IB 4RWHA 5ENWB 5MI0C 3TFKD 4BQ6A 4BFEA 1WHOA 1G4RA 2XN9B 2GI7A 3IDIB 1S7TB 4KK9C 5TE6L 3QG6A 5HGBA 1Y6KR 2YUXA 1Q0YL 3V2AR 4D3CL 3FAWA 1JNNL 2MFNA 5BV7B 3GNMH 3VI4E 5T1DH 4E42B 5HHOE 1BA9A 4XXCC 1E6OH 5D71H 4EKXA 1NJ9B 3QIBD 5KVFE 4YSQA 1T1XA 4JZOA 5B7FA 1CYWA 3BQUC 3QJSB 1NANH 3TPKA 1PG7H 1TCRB 2R1YA 2VUKA 3CDCA 2H32B 2NR6C 3S97C 5FYKH 1SYVB 4BFRA 1BAWA 5I76A 4MNQD 1XCTA 1NC4D 3L1OL 3VXPA 5C0RH 1FVCA 4K94H 4P5TA 4R2GD 4AQ1C 1KWKA 43CAA 1IO4C 2NY7H 1OGAE 1IZJA 1KMGA 5BVPH 3GSRB 2VQ1A 5FEBA 2NY3D 1GAFL 3OBAA 3C5JA 4K7FA 5FPIA 4LEOB 3EUDA 3MJGX 4LFHG 3MRRB 3K1KC 1UT1A 3NGBB 4NCC2 1SN5A 4XPHH 2F7QA 1EEQA 2YBRA 1YJDH 2B16A 3LKQA 4M8QA 1Z9NA 2BHUA 1XF1A 3L08A 3D9AH 4KPHH 3SGEI 2VJXA 4FXLA 1CLYL 4KQ3H 1MZYA 3NIDF 4HFWA 4HK3J 4BBWA 2B77A 3HNVL 2FBRA 4XE0A 5HDBF 3SYPA 2X89D 1ZJBA 1UD2A 4JFPA 4QXTA 3C87A 2C9VA 1QPXA 2IJ0C 5JOPE 1XMWA 1K8IB 3CLEL 3IWUA 4IOSD 4Z7NF 1B3IA 2YQGA 1XR8B 3TNMB 1H8SA 3BKCH 3FT4A 5C0EB 3QS3A 1OD7A 4GAFB 3X2QB 3NSXA 3W1ZA 4IRSA 5EBLA 4KTDH 3DROA 3KBEA 2B1AL 4P9HH 5EA0L 1U3HB 4U6VH 2FR4B 2GJPA 2FYYA 1ZHBB 4IIZA 4C8XA 1XX9C 1VFOA 3MLZL 1T5XB 4M6NH 4PY8J 3DO3A 4E9VA 4KKCC 2BVOA 2ZOKB 5HHMB 3TZVD 1QA9A 4AM0Q 1AE6H 2G60H 3CSYA 4WO4A 2YPLA 4LRIC 2VDMB 3L4ZA 4TLUA 2HT4C 3C60A 4ZAKA 4YOKA 5D1ZI 4Q9RL 2XU9A 4HPOL 1GJWA 2CRZA 5B39B 4OT1H 3CFEB 4NKIH 1F6AA 3SBRA 3GIVA 1EXGA 5KZCB 4O2CA 4Q9CA 4J3VA 1RZ8A 3TBVB 2DM7A 3MV8E 5GISH 4TQHA 3CQPA 3BGFC 5DJCB 3T65A 4CMHC 3AMKA 2QGBA 2CBTA 4XMKH 3V0VA 1DJHA 3S37H 4NSKB 4LZKA 3NCJL 5HJDA 4LSQH 1Z9LA 2HUHA 1DQDL 2GJRA 2GY7B 1DJZA 1JWMB 3ARBD 1B0GA 1PLGH 5AVWB 1T1YB 3IMUA 3QC6X 2ITDA 2YGVA 3DSFL 2WCGA 3D39B 2M1KA 4KNUA 3ARVA 4JFDE 1M9SA 3KGTA 4OCXL 3I85A 2E59A 3WE6B 5ITFB 2P8LB 3OKLA 3DHUA 4CVXB 3R19A 4K94C 1AZVA 3TONA 4CILA 2BZCA 4AENA 3QRLA 1FAIH 3W9EB 2P9RA 1R1CA 1RP9A 2E9GA 4JDEB 4Z77B 4KY1H 2RCSH 3STBA 3AQZA 5PCYA 3L3OC 4A63A 4LLWB 2UUDK 3EFOB 4U49A 1NFKA 3MOQA 4CAGA 2K0RA 3WCYA 1FVEB 1UB5A 3M1CA 2YAEA 5FIEA 3UBFA 2CE6A 3PIQB 3RG1C 4AG4L 1BSIA 3VGAC 5I8EB 3MRBA 2AZUA 1BF8A 1YJDC 1AKPA 5E5RB 5GJTH 4RMUA 3DXAD 4KITB 1CDGA 1ZKAA 2FJFB 4TLTA 2Z8SA 4UM9A 3WSQH 5IVXA 1RZGB 2WNKA 4YHIB 3D3VE 5L8JB 2CA4A 1UYWH 4GKZB 2DKMA 2NY3B 4AT6A 4N24A 3H4FA 1BF5A 3IRPX 1ORQA 4PI0A 3BH9A 3L45A 3UTOA 3ZKND 1IEBB 3INOA 1TZ8A 2N4IA 2WYIA 3IMVA 3SGJC 2R27A 4JFEE 5SWSD 2Q6WB 4PJGA 4P9HC 2ED7A 3UPAA 2AAAA 2G2RA 1HILB 1RFDL 4LP4A 5FYJE 3VTTA 4BZYA 4YHYC 5KYXB 3H9HA 4PJIB 3PNRB 3DIFB 2B2XH 3IE4A 4Z3FA 1C16A 3PU7A 4NCC1 4O02H 5DR5H 4F9PC 1M6OB 2XLLA 3BIKA 5E1IA 1BYOA 3TWCL 1E8ZA 2VE6B 2VN5A 3F12A 3H54A 1DE4A 3TJEL 4ENEC 4X6CA 5LG1A 3U2JA 4WI9A 4NX0A 1NICA 2FZ3A 2HVKA 3PWPB 1BFOB 2UZYB 3KBFA 1L6PA 2VERA 3ARGA 2H1XA 5EU3B 2DJMA 3L5IA 4QGTA 3VJ6B 1YUHB 1K5NA 5CM1A 1IQDA 3QNXB 1LO3L 4ODWA 5D5MA 3UX9B 3BKYH 1P5UA 1VGEH 5F97E 1T2QH 3ZTDC 2BZ7A 4RRPM 3QUYC 2ICWA 3NJGA 2PW2A 2Q2EB 4ABUA 2EDHA 1A6ZA 4I5BA 1T1WA 1N8OE 1UM5H 2EDWA 3TBWB 5T1JA 1UM4L 4G82A 2ZCKL 2LU5A 2QQLH 4R4FL 4DEWA 2HB0A 4ZS6C 4V2CB 1IAKB 5AW2B 3A23A 4U3SA 2XTSA 2IMNA 1K4CA 1BZ9A 1X6LA 3OAZK 4ZNCD 1I3GL 4XXDB 2PWHA 2WWNA 1PVHA 2HKAA 1YN7A 1T80A 2Z0UA 5I1KL 3DJRA 3DPBB 3TASA 4N9GA 3FO9A 1BQLL 3EFDH 3GKWH 3KPSD 3O8XB 1J8HD 4HAKA 3DUHA 5C3LD 5I1DB 1UB6A 2GUOA 4H8QA 5ECJE 3GMOA 1EK3A 4XNZB 4DGIL 3RWJA 5C2UB 2E8YA 1O7DE 1WQVT 1H9VA 2EE3A 4G1MA 4EOWH 1HL4A 2JQMA 2CHZA 3LNDA 3WO3B 3MRQA 5EOQH 1BOGB 5D9SB 2XVGA 2BVYA 2R29L 2BNQA 4J8RA 1CXEA 3U0WH 1H5BA 4Y2DD 4H20H 3C2SA 2V3FA 3ZOAA 4UBDD 5GS2D 1JDAA 5CBEA 1OW0A 1OAKH 2APVA 4KBPA 1UXSB 4D0BA 3ILQD 3MV11 3BSHA 4YLCA 2UYLB 2E7HA 3U0TA 1BYNA 3EYVB 5I5RA 5IGXL 4Q7DA 2DM2A 3DVGB 2VH5H 3PGCA 3DGGB 5I9QB 2OZ4H 4Z7VE 1NSNH 4MXWL 3SSGA 1IAIM 1RURH 3OC5A 4OGZA 1DYZA 1SF3A 1FIGH 1DBJH 1SJXA 4FXGA 1XXFC 4P99A 4LU5H 4P2OB 1PFCA 2Z3FA 3R7QA 3KL0A 1NUDA 3CFCH 4YFLI 5EOTA 3HN8A 4CN4A 4Z7IA 3AG3B 4HEMA 2VR4A 4NQVB 1HDMB 3HE7A 5K59E 2N7AA 2FT6A 1X5LA 1FC1A 3WJLC 1PZ2A 5TE6H 5SWSB 4N2EA 4P46D 3W2DL 1Q0YH 4D3CH 3QEQA 2IH3A 4ZPVA 1JNNH 2H3XC 5BS0E 2NT1A 4HOMA 4FQXD 2QSCL 3F85A 5IEKA 4CJ1A 3BLKA 4RMBA 1ITCA 3UP6A 5KAQG 1S3RA 2Q86B 3TEXA 2CWRA 3MV8B 4YPJA 3WEXB 3DLQR 1BBJB 3W11D 5C09D 3L1OH 5H2BB 3Q9PA 5PAZA 1W72B 4WNQA 4Y19E 1GCFA 4U3HA 2PN5A 4ACPA 3BMVA 4PJGF 2JIXA 1L3WA 5I6MA 4G3YL 5JDSA 2E6QA 2H2SC 2WVVB 4WNJA 4DO4A 1CICA 1HWWA 4GQRA 4KI5D 2EE2A 3I9PA 5DMGC 3WFCL 1MRDL 5FECA 1GAFH 5F0JB 4O4YL 1DQTA 5ICXB 2KZWA 3G6JE 4JFDB 3VFPB 1KSRA 4X6CF 1V3MA 2R9HC 5L0QB 2NDGA 3L3IB 3LNEA 2V2TA 3SPJA 1M6UA 1JZ5A 4W81A 1I8AA 3EYSL 4YGVA 1L9QA 1HN1A 2B39A 1CLYH 3QNZA 3PUUA 4FXTA 2HFEB 3ZL1A 2WP3O 4PRBA 3AUVA 1H15B 3HNVH 4XVSL 5CLWA 4WI6A 2I85A 1I3UA 4L4VD 2JE8A 2X70A 5D5MF 3ZLQC 2OLDA 4UT6A 4X7DC 3NJKA 1CL7I 2CO7B 2ZX9A 3CLEH 1YQVL 2FGWL 3AADB 5B22A 2EIJB 4H5SB 3JSSA 4C55A 2R1XB 1C5DB 4ZFOL 3T0EE 3PJNA 5I0XA 2AEIT 2E9JA 3MHZA 2B1AH 5EA0H 4MMZC 2UZXB 4MCZA 5JMRA 2WO2B 1SXBA 3BYYA 4UQEA 5JW4R 3D3VB 3MLZH 2ADJB 1QUNA 3Q05A 4JBSA 4A2MA 4NO0D 2XDHA 2LABA 1S7VA 2WLJA 4PGCA 5I75B 4M5SA 1CYXA 1JZDC 4Q9RH 4HPOH 4UOW1 1JK9B 5AAWC 2SODB 5IBLC 1DJSA 4JFEB 2Y1VA 1S4IA 2AQ1A 3KCWA 4IEFA 4PJ5A 2W65B 1N4XL 1QABA 5D6DC 3PQYA 3FO0L 3FRUB 3W0WD 4U4BA 2LR4A 3NCJH 1I1RA 4LKXB 4YDIL 1A6TA 2LVCA 2NTFB 3B3IB 3IU3B 1DQDH 3UTSA 4F37F 5ID0B 3ULVL 3ESMA 1N19A 3HZVA 3DSFH 1AKJD 2ATKA 3KPLB 2K7PA 2XA3A 2JB5L 2WCSA 4OCXH 4NKOA 1INDL 1PKQE 3D0VB 3H7BB 3PDDA 3S34L 2A4EA 1KYOK 4ZXBA 4P46B 2EIEA 1WLHA 2D0HA 5IVZB 2E6JA 1OCZB 4AVKA 4EQ3A 2R0WL 2NQCA 1TVDA 2I27N 5EF0A 4NKDA 3VFMB 3K46A 1NBYA 2XV6B 2WZ6A 2HT2C 1HH9A 3IPFA 3IS1X 1AQHA 1KLUB 1DVUA 2A74A 5I1EL 2XZZA 4RRPA 1PD6A 1MSPA 5KVGL 3AG2B 2GT9A 3SD5A 4AG4H 2QL1A 4TTDD 4RNRA 1TXKA 2R15A 4LGSB 5IROC 1CB4A 2FIKB 3HS0B 5DUJA 4DFHA 1J0ZA 4LBEB 3QFJE 5A6IA 3FT3B 2V0AA 4WI5A 2RQEA 2YAQA 4NHCL 3FT1A 5IMOA 3ZW3A 5I17B 3ZHNA 1CI5A 4JN2B 2H2PC 2D73A 2X41A 3STZA 3Q6GL 4XN2A 1J05A 2XWRA 3Q8CA 4PLKD 4C54A 5I1LA 3WEBA 5KSAD 5I24A 3CXDL 5C3IA 3VCLA 3H53A 1RFDH 2NCEA 1EDHA 1BVLB 5DEGA 4HJ0D 5FA4A 1R5VA 3DX0A 4OFQA 4G1EA 4NENB 4IU2A 3LKOA 4LIQE 2EADA 3CSFA 1JTPA 2VZ3A 1GGBL 1DHKA 3TWCH 1UD6A 4NHUB 2YN3A 3TJEH 1I8IB 4JHBA 1ZLWK 3VWKD 4AVIA 1NMCC 1UD5A 2ZG3A 3A4EA 3PY9A 4B9PA 4Z7QE 1EXUB 1KCWA 3CIAA 3FO1A 3CPLB 4HKBB 3QE5A 1E4KA 4QWWC 2EEFA 4JPKL 1LO3H 3OKNA 1AI1L 3VE0A 5HY9A 4Z7WB 4NO0B 1IBZA 4J6RL 4ZUTA 3BAEL 3O2VL 5F9WC 3ZUCA 4EE2A 1IMHC 3RIKA 1YPZE 5KSUB 2MHAB 1WYJA 4UF7C 1UM4H 2WXFA 2ZCKH 3G7TA 3MV9D 4LGRB 2BIQA 3MNZB 4R4FH 3K1DA 1AAJA 3MTXA 4UZSA 4KQ0A 5IB5B 2YMTA 3PABA 1K3IA 3MROB 2CMRL 3ATEA 1I3GH 1M3JA 1S9YA 2GY5A 2MSPA 4PJAE 1ZHLA 4WWKC 4KK6D 1D2PA 1NM4A 1G5AA 2XC8A 4PV8B 5KVEE 5I1KH 2CM6A 3WY4A 1EHAA 4EN3D 1V55B 3B34A 4FLSA 3V95A 2DV6A 3AREA 1BQLH 2DWEB 3T1FB 3QJTB 3BZEA 4FERA 4KKRA 1HSAA 2ED9A 4DGIH 2LHAA 4H8WL 4ZQKB 1W6LA 1L0PA 1RAMA 1EFXB 2XACC 3FRPB 3V6OA 2GFBA 3LQMA 4KQ4L 3ECWA 2J8OA 3TXAA 4ZSOE 2R29H 4G5AA 4EI5A 1KOAA 1Y1UA 2RBLA 3G6JB 2A6JB 1I7RA 1KTDA 3TO4B 4KZCA 2ZWSA 3BAIA 4KU1A 5I1IL 4W4OA 2E4FA 4I18A 1SEQL 2GTWB 5GZOC 1U8MA 4JDVB 4NLAA 1GYUA 4LVOC 3BD5A 5TF1L 1C08B 4I85A 4JG5A 3O0LA 2N3JA 4PJ9B 5IGXH 2YD6A 5IEHB 4IRJD 3IRCA 2OI9C 3S8FB 1SEBA 3UTTE 5EOCJ 4MXWH 2ENSA 2BLFA 1NEZA 2YUWA 3K81A 3R7RA 1NDMB 5E9AA 4ZMQA 1BLNA 2Y7MA 2I5YL 4NKQB 4QRTB 1P7QD 5HDRA 4Z3EA 1XD1A 4EMZA 2PPCA 5DC9B 2ZWNA 3DX6B 1XQ4A 4P5RA 1NCNA 4FMFA 3ARTA 3B2XA 3ORJA 3VRIA 4RDQG 4NO3B 4XO8A 3W2DH 4K15A 3TTYA 1MFVA 5E6ID 1FG2B 1YY8A 1JUFA 4M6ML 3ZKMD 1F45A 4KROD 3V5KA 3ZE2F 2VITA 2QSCH 3MXVL 3LRLA 3QIUC 5I5JA 2Q76A 1F1GA 3C6LB 1P4BL 1ROCA 1KF9B 2X4TA 1PBYA 3RHWF 3VWKB 2IDCA 4G7SB 3MR9B 2NSMA 2HFFA 4AIZA 3SQBA 3FU9A 2TSAA 1FNGB 1RKRA 2EAEA 4JFFE 2AF2A 4R96A 3FYEB 4G3YH 3FOMA 1F4YL 1N8ZA 1SY6A 2ZNXA 3WFCH 5J11C 2G3XA 3JTBA 2FE0A 1MRDH 2IDUA 4A67A 2P5WD 1Z0MA 2B5IC 4O4YH 5K69A 3HZYA 4QRPA 5FM4A 4E36A 5LAXB 1XF2A 2Q7AA 2DQ6A 3QXAB 4NQTA 3FQXA 1TEYA 4GW1B 1QNIA 4NQCD 2P4AB 2VZUA 3EYSH 4RX4A 1A7OL 3ESNA 1U8PB 4XVSH 2WKLA 4P8QA 5KANG 5T3XL 3VNYA 4EBQL 2GBTA 1NCTA 5L4IA 1YQVH 2FGWH 2WUBL 1NBQA 4JGNA 3D25B 1QR4A 5CJXC 3O3DA 3N44F 2W59A 4OIAA 4PHZA 1FAKT 1A22B 3GMLB 3OKEB 4LLQB 5IV2A 4HUKB 4GW4B 2MCG1 3FFCD 1RMFL 5F9JA 1MCDA 2VKWA 1N67A 4PWIA 3VRJB 4IJTA 4UAOC 5LHDA 4DP9X 4G42A 1N2RB 2UXTA 1ZCRA 1H6FA 4R83A 1UD8A 4DCQB 5IM7B 3HW7A 1IKOP 2J57A 1QW9A 4U6XA 5E00B 1MCCA 5DMJB 1FFRA 1WK0A 2AXFB 4V2BA 4ZDHA 2BMKB 1N4XH 4F91B 2FBOJ 3NYKA 2D3VA 4F2ME 3FO0H 2DQFB 4M4RB 4Z7UA 1W8NA 3OLIA 1JYNA 3CJJA 5FW7A 3LKRB 4R4ND 1ZLEA 4YDIH 2Z93A 3ULVH 4JKNA 1GGYA 5T5FL 3OXSA 4I9WE 4OM1L 4Q9QL 4I7ZC 2A6KA 1W91A 4Z7QB 4PJBE 4ONOA 4F20A 5EIIB 1NKOA 4K7PX 2JB5H 4LPYA 1GZQA 3NIFE 4PBWD 2PWFA 1INDH 2OW7A 5SWZA 3QO1B 4B3VA 5IJCC 3CC5B 3RPIA 1F02I 3AAZA 3S34H 4GRMB 2FCBA 5J5EA 2ZOUA 3OX8B 1SOQA 5A7BA 3Q8FA 2R0WH 1ZMYA 1YPZB 4N2BA 1WT5A 4PRAA 3QISA 1I1FA 4XP1L 3ES6A 2X1OA 3MJ9A 1ZTMA 5I1EH 1U8QA 4BD4A 1FORL 3FH5A 2YK1L 5KVGH 4UQDA 2Z1PA 3L3HB 3VXRA 3GBEA 2A99A 5JNYB 3ATDA 5JHMA 5DUPL 4L3ED 1IAMA 2G4EA 5B38A 4ISVA 4TQPA 5EZIL 1IE5A 3ZDZE 1K6QL 4GRLC 1QSZA 2DYPB 4PJAB 3QWRD 4ONGL 3BUDA 3QT2A 3QPKA 3JTTA 3A4DA 4LKCB 4NHCH 2EEBA 5DQDL 4W9GC 3DPDA 4R7DB 4YK4C 3L2LA 3L5HA 5DJ6A 5F7DB 4FA8A 2BVTA 5B8CA 1DVXA 1PD0A 1JZ3A 4KZDL 2J8UA 4E0RA 3Q6GH 3B2PA 3DMMD 3LQAL 4FP8L 3T6WA 3NIGF 1KNOA 1WISA 3H9YA 3GM8A 3NH7L 4RVBA 3CXDH 4NQCB 3VFGL 2X9ZA 3C09B 3X14B 3MRLB 1S9WA 2ILLA 1YNKL 3P4NB 3MLYL 4WJG3 3V0JA 1SVCP 4NQSA 4PMFA 1G7IA 1FNLA 1CE6B 2PWEA 1CGVA 4XMZA 2BH0A 5CR8A 5KUMA 2ZX8A 3PHQB 1GGBH 2XQ0A 4PJHA 4NN5B 1PIGA 1WEJL 1N0LB 5GS0L 4CKQA 3D08A 3QR1A 3RDTC 1RPQA 5FO9B 1FHNA 1IRAY 2BP3A 1BX2B 1XGTB 5B1AB 3CGTA 4YVUA 2ADFL 2D3NA 2JTDA 3UTTB 2PO6D 3FFCB 5JPMC 4JPKH 4LCWD 4RAVB 1ORSA 4DP0X 3QH3A 4UOJA 3OG4B 1AI1H 4KV5E 4K7PY 1OE1A 4J6RH 1F3JA 3BAEH 3O2VH 3ULVC 1UHVA 3ZYZA 5L2KD 5ICUA 4HV8A 3GUTB 3P9MA 4HD9A 4URKA 4X9BA 4HXBL 5I15L 1WRFA 2VUYA 2NDFA 1CFSA 4L9LC 4OUUA 3DX1A 1T6VN 2F7OA 1HL5A 1AZRA 1PQZB 3C5SB 3GHPA 3GSVB 4G8AC 3V4PA 3FPYA 1U93A 2CMRH 1AHKA 1MCRA 5E6ZA 5CD5C 1LEIA 3IEAA 1PZ5A 3VWJD 1BPLB 4A7TA 5CGBA 3PWNA 1BF2A 3G6DL 4U33A 4QHMB 5CINL 2XXGA 5JYLA 1VFBA 2RAMA 1F5WA 2PXYC 4OJAA 1HHIA 2BVQA 4ELKA 5ES4B 3AM8C 2B9BA 2GITB 1JNHB 3IT8D 3OGCB 4Y5YC 2QLYA 3B9KC 4MA3A 4RISL 4H8WH 2LT9A 3IDXL 1I4FA 1AACA 4JFFB 4P05A 3WIHL 4BFBD 2CIKB 2NY2B 3NJIA 4KZEL 4B9FA 3D30A 1HZKA 4KQ4H 4P4KB 5EU7C 4BK5C 1LMKA 2X2IA 5CKAA 4XXCA 1QACA 5DO2C 4IS6A 4M00A 3TV8A 2Y23A 1IEAB 4RMVA 1JTTA 3EDDA 1YC7A 5I1IH 2GIXA 1Q9LB 2NR6A 3FHAA 3NCWA 2R0KL 3P0YL 1SEQH 3X1EA 2OKMA 1UZ6F 3ALWA 1JF6A 3D4CA 4X2UA 1BZOA 1T04A 5TF1H 1TVBA 4TXVB 4F9LC 1EXHA 3VFTA 4L3EB 5CSGA 4TMPA 4AQ1A 3WMQA 3BSZL 1E9OA 1E28A 1J10A 4OBSA 4UV7L 1R47A 5C6WH 1GGUA 1D5ZA 2F74A 1BM7A 4NRZA 1LP9A 3T3PE 4BFKA 5HDLA 3UG4A 1HAWA 3KLHD 3D52A 3U7WL 1Y1DA 2LU7A 1RHHB 2I5YH 5CKGA 4QT5A 1JGEB 2F58L 3FQ2A 5BVJB 4X5XA 5I1JL 2L7JA 4LO9A 1GMEA 1J5OL 3IXTA 1NINA 2XWCA 5AW6B 3QEUA 4OZIE 3T0AA 4PRHE 4YLBA 4KFZC 3ZDXF 4M6MH 1Q4NX 4YHMH 2EE9A 3CFNA 4G72B 3RPKA 3L2MA 3GXMA 3MXVH 4Q2ZB 3LZRA 1A6AA 1P4BH 2FO1A 4E9XA 3TBSB 1E7UA 4MXQC 1TTCA 1ZSHA 4F2MB 2XKNB 3QWOB 4UQ2A 3GMRA 2A7BA 2KDYA 1JERA 2W80C 2O30A 3QG7L 3S4SG 4MXVF 1YNLL 3BO8B 4XBPA 5EBMB 1F4YH 4LRIA 1HNFA 4UNTA 4TSAL 3OJDB 2ZCHL 3SKOA 2V9RA 4PJBB 4X50A 5HI5C 5A2AA 4RGND 2VDOL 3D2UB 3E6FB 1ETZB 5DSCA 3OB8A 3VFNB 5CP7B 5JXED 4HU8A 5L2KB 2FO4A 2AXHA 1SHXA 1DUYB 1HHHA 3GSXA 4YHNA 2HPOA 2CLRB 2BC4B 2BVEA 2P1YA 1M71B 3B2UD 3SDCB 3ZHDA 1AANA 4H8WC 2K78A 3C8DA 1A7OH 3KGUA 3T4AA 1I9IL 1F58L 4UDTA 2EYSB 2GJ6D 1U30A 2HYMA 2RB8A 3MJ6A 4PGEB 4WTWA 3VWJB 1XEUA 4BYHA 2OXHB 1ND0B 5T3XH 4EBQH 1CR9L 3G5XA 1AGEB 2CAKA 3DVNB 3EF4A 5KS9A 4YSAA 5FAAA 3WL9B 2BSRA 3PUCA 2WUBH 2FJSA 3NEEA 3PDOB 5HHXL 5C0FA 2BVPA 2VLLB 2WD0A 4L4TA 4NGHL 2VSMB 5H37H 5JO5B 3UG3A 3V6FB 3WHXB 5KWYC 3MRKB 4LVHC 3RVXC 5C9JA 3ZDZB 5HYSG 2VQTA 1XCXA 1TQTA 2AVGA 3GXNA 2WLIB 2YSTA 3V0DA 3ZQXA 1FZMB 4WKXA 1RMFH 3HRZC 1NTDA 5ABAA 2CJSA 2RMNA 4IBSA 1GTFA 4JM2A 2XXFA 4R8WL 3S35L 4GP5B 4NDMB 5EUOA 2F8XC 2YPKB 1R3LB 1KYDA 3G3LA 3WFHA 2DWDB 1J87A 4R5VA 1F97A 2A0LC 2H1PL 2YD8A 3IJYB 3IBEA 5DRXA 5AVZB 1QO3B 1T1ZA 3TM6A 2YD3A 1J9RA 2AQ2A 2QQNL 3IMTA 4WKZB 1AGCA 2Q87A 3V10A 4B5ZA 2HMIC 5T1KD 1DQML 1YHPA 2X42A 3QUXB 2WKGA 3FSOA 4Z0XA 4M8VA 4G80B 2QDWA 2E7CA 3WIFB 1VADA 4ODUB 3ZK0A 4YJZL 2J2ZB 2KLTA 1PNDA 3L7FA 3F6JA 2P3YA 2BIPA 5T5FH 3APFA 4OM1H 4Q9QH 4N90E 5INCA 1MFAL 5CNHA 3PXJA 3OKMB 1XO8A 3KBPA 4LEEA 3L3DB 2D3JA 3SGJA 3S35X 1R3KA 4ZMNA 3ML8A 1I1CA 3KPTA 4TNFA 1SDDB 4L0PB 4MAYB 3HC2A 1NIBA 2UX7A 3VFSA 1RK0A 5DVMA 4N2DA 1G7QA 2RH0A 1K4DB 3I6LD 4OGAC 3WS6A 1M7XA 4F9PA 3ZPDA 3KWVA 1RVFL 1YMHA 2WIIA 2O5NA 5IG7B 3ZMNA 4XP1H 9PCYA 1J1PL 4WW1B 1T0MA 3MX0B 3EJYD 4HUXB 2YO3A 1FORH 2EE6A 1SXCA 2YK1H 1T2JA 3E2HC 4WSGA 3RJQB 1WIPA 3O6ML 1AR1C 5F0LB 3SQRA 2FWLB 1QX1A 4RA0C 5H37G 5IQNA 1L3NA 1A25A 5DUPH 5T33L 3FU7A 5EZIH 1O7VA 3D18B 3NACL 4D9RD 1K6QH 3HS9A 4Q4EA 5CMAB 2WTOA 1HH6A 1S7QA 4Y2OA 1S7UA 5AVVB 4ONGH 1AGDA 1U8KB 2XN2A 4NERA 1NCDL 4X7FC 4WSJA 4FNUA 1EDQA 3QUYA 1F6LL 5JA9A 5E4EB 4Y4KD 5DQDH 2H3NB 3GKZA 3E1ZA 4RGMC 4KZDH 2G9HB 2NNAB 2R69L 3LS5L 1GA2A 2HTLC 1PD1A 2OK0L 3LQAH 4FP8H 3EOAA 4CVZA 3NH7H 1GW6A 3VFGH 5CD3B 3I6SA 3O4LD 1ZDQA 2CDGA 2WWKO 3OWEA 2BSTA 1YNKH 4KO5A 3MLYH 5CLTA 2WQAA 5DJDA 3U4BL 3VA6A 3RGVC 4WQOA 4EDXB 3B3BA 3ARSA 1DR9A 4AQEA 5I71B 1WUZA 3B37A 2OP4L 3DOSB 1UJTA 2XZCL 1WEJH 3VXME 5GS0H 4LHQB 1PX3A 1PTZA 4HG4J 1RK1A 3HHSA 3LV3B 4CVUA 3MRPA 3O4OB 3CHQA 2ADFH 3NIDE 4XNMB 1E5AA 5HDBE 2ZKHL 1NGQL 4YPGB 2BNRA 2YJLA 3T3PB 3CFDB 4N6RB 4Z7NE 5L6YL 4AM0B 5EN3A 5KEZA 4PVMA 4BKTC 3MRGA 4MCMA 3ZZLA 3CIQA 5KS9F 1DVZA 4KJQC 5D2LF 4LNRB 5BW7C 1X4ZA 5K9JL 4UB0L 1E65A 5I15H 4HXBH 4RFNC 4UDUB 5IMLB 1PPIA 5EZJA 4OZIB 1MG3C 5DMYA 4NFCA 4U0RC 4YX2L 1LE5A 4GUPB 4JMNA 1CFQA 1OGPA 1YLBB 1E9PA 3S5ZA 1KWGA 2E27L 5HDWA 5AZUA 2NUTB 2ZUQC 1WV7T 4S2SB 3G6DH 4AH2B 5DK3A 5CINH 2Y22A 1FSKB 5EO9A 2OX5B 5DZPA 1YEEL 3MGTB 4P48A 3FF8A 3I9IA 4APQC 4JRFA 3Q6FA 5EU6D 1JDDA 4LPUA 3TX4A 2TRHA 4RMTA 1WBYA 4F33B 4RISH 4APXB 2NXYB 3OAZH 3WJLA 3IDXH 3WIHH 3BJLA 5CN2A 4GUQA 3MZTA 5IHUL 1DN0A 3QB7C 1QMUA 4KZEH 5LXGL 2QFPA 4K73A 4GKOA 5AYQA 1ERNA 4HCGA 4KZ0A 1OQOA 3RTQD 3SZ6A 4GO9A 4YZWA 3TVMD 2Q2LA 2R0KH 3P0YH 4Y16D 1VACA 5T3ZD 2FNWA 4L8SC 1A1OA 1PW3A 4QXVA 1IBYA 4GS7B 3L5XL 1MY5A 3ARXA 1B4JL 3LQAC 5TDNA 3DECA 1TZAA 3PWVA 3NRPA 5KSBA 4YL9A 3BSZH 3H9ZA 4X9FA 5JHDA 1NQBA 2LAAA 1IM3D 4UV7H 1A6PA 43C9A 2XX1A 1QVOB 1AR2A 4Y7OC 4BQ8A 4A1RA 1KT2B 3UZEA 2Z4QA 3AU1A 5C70A 2PW1B 5ISZD 3S3SA 3U7WH 4G6ML 1Q9KB 4QRQB 2VLRD 1KTLA 5GS0C 5INDB 2F58H 3CHXA 2UVFA 5DQ9A 4IOIA 2CK0L 1JGVL 5EO0A 5HI4D 4FG0A 5I1JH 1J5OH 1TZHB 3RQ3A 3IDJA 1KIUB 2WXPA 4JPIB 1GJUA 5G55A 3NUKA 1HXMB 2BOCA 1S78D 1BLIA 2ZSVA 2OL3L 3I74A 5GRVK 4FNTA 4GG6B 1DVFD 1CMOA 5AOKA 5D1XD 7PCYA 2VL5A 3JQOB 4MLIA 4GW5B 3SGEH 1U2YA 3CTTA 2MQCA 2X6BA 3SKJH 3B7YA 1ZY9A 3KS0H 4KXBA 3QIWD 4QXGL 2NW2B 2VDQL 2JKLA 1OTSD 3RWHB 1O7DC 1RZPA 2XWJA 5C9KA 3CFJA 1CL7L 4MMZA 1MUJA 2FRGP 3M7FB 3G5ZA 3QG7H 1CD1A 2QFRA 4FQ2L 1Y0LA 1YNLH 3OL2A 4J7RA 4M9PA 2JXMB 1TKWA 5C8JB 4FI6A 1WA1X 4X6EB 4TSAH 2ZCHH 1XMEB 2R7EA 2VDOH 5AAWA 3TL5A 3MRFA 2X4QA 4I3SL 1VENA 1B4RA 2P42B 4OGYL 3QI9B 1AC6A 1CG9B 5KG9B 3BPLB 1MIML 4YHZL 2IAND 3IJEB 3FF7A 1I9IH 1F58H 1SYSB 4BRVA 3GF8A 2WWMD 3IVKA 2VZTA 1N12A 5GZNC 1F2QA 2KPNA 1BBDL 5DJ0A 2VL4A 1UXMA 1CR9H 1OP5K 5IVNA 4OV5A 1JNJA 5AB2A 4UQBA 4U1NA 5HHXH 3Q1EA 4HUVB 1KYAA 2HTKD 4NGHH 4E41E 1N3NA 1VGKB 3H0TB 1ZK5A 5EMYA 2APWA 2YPVL 4IJ3B 2R59A 3TA3C 5C07A 2PTTA 4FQJL 2C1PB 3CZLA 5FKAA 3LXBA 2B0SL 1W80A 1WZKA 5E1QA 1BJ1J 2SEBB 4R8WH 2YPLE 3CVHB 3BHBB 4LLDA 3S35H 2ZUSA 4DF9A 4Z23A 1JZ2A 3IXAB 3SDYL 4FFYL 4NM8L 2IADA 1HSBA 4ZUVB 4WTQA 4PJ6A 3B6SA 2H1PH 4KUCF 4ORGB 5C0IB 4L37B 1AXSA 4EUPH 4NZJA 4Y16B 4HIIB 3WEMA 4W9CC 5EPMB 1F3RB 1URLA 2D7PA 4J12A 2QQNH 3BN3B 3I6GA 1BECA 1RK7A 4NQXB 2GK0B 5IROA 4JPVL 1QW8A 1DQMH 3M46A 1T20B 3NFSL 4O51B 3LXCA 1A3ZA 3UZVB 3BUBA 4X8JB 1Q9OA 3PPEA 4LHUG 2PCFA 1EZVX 5DD1L 4BFNA 3O3UN 3VXMB 5I6XC 1T5WA 5I8KL 3UAEA 2Q7NA 4FQPA 3BN9C 3H55A 1XF3B 3MCG1 4JRYE 3UAAA 3HG1A 5ILTL 5I1GL 1MFAH 1K9TA 1QFWI 3GEWB 3IF1B 2ENQA 3MQIA 5HDBB 1KIQA 2OR8A 3ESVF 4XAKE 3PXHA 2YEQA 3AFLA 3G6AA 3IGAB 4MJIE 2K70A 1Q94B 4Z7NB 2XWBB 5BPPA 5CJBA 1P2CB 1GGTA 2JKRM 5KSBF 3N1GC 4TSCL 1EAOA 4NBZB 3US0A 1RVFH 5D1XB 4LOUD 3P77A 5KAQF 1J1PH 1EAPA 4BH7A 1F4HA 2YC1B 3QZPA 5BUGA 2WBJD 2Y3AA 3MKGA 2EZ0D 3QIWB 3WENA 3T0EC 3VXTA 2JCWA 3O6MH 2DM3A 5IHBA 5T33H 3S5LG 4TVPL 2W60B 3NACH 2JFCA 5D1ZC 3AB0C 1IGTA 1AD0B 5C0GB 1KTRL 3F7RA 1MW3A 1MG2C 1NCDH 1NPUA 1ZGLB 4W9EC 4JLRB 3CX5J 4M5TA 4IRSD 1MPAL 5IW6A 1WZMA 2WVTA 1SXSA 4UIKL 1JI1A 5ICYB 3VFWA 1EHKB 2R69H 4DKEL 3LS5H 5C0DB 1E5BA 5AL8A 4CNIA 3ARZA 3C12A 4EUPG 4IW4C 2OK0H 4PJGE 4Y4HC 1X7QB 5DYFA 4WO4D 4D9QE 3FT2A 4FQ1L 3C60D 3U4BH 4WWKA 4BKLA 4YEFA 3TESA 5IJVA 4IIQC 4P06A 4PRIA 4BEIA 5AD0B 1XGRA 2O5XL 2OP4H 3GXDA 4X6CE 1JXGA 3QDMA 2XZCH 2OTWB 4U2ZA 1E0OB 4MS8D 3SKMB 2B3IA 3OKKB 1VRSA 3ZRSA 2IFGA 3PV6B 2Y7QB 3L9EA 4PJ8B 3VXUA 3PRZA 5IFHL 1XV8A 1MHHB 3TBYB 2ZKHH 3P4LA 1NGQH 2YWYA 2CUHA 5D5ME 2FQDA 2NTSP 5J6HB 1UOWA 3HNSL 4A2GA 3F01A 3TP4A 4UUJA 4AWJC 5L6YH 4HUWB 4XODA 1ZLWH 2ENYA 2J1WA 2CDFA 1EVTC 4XN7A 4F37K 4WRLA 3PREA 1RPUA 2YA1A 4K71B 3T6XA 3WXWL 1LNUA 2F1AA 5F8QC 3ESOA 4OVVA 5K9JH 7FABL 5GZOA 4UB0H 1NCOA 3VG9B 1TQBC 5HGBB 3MCYA 4KDTA 3FFOA 1UCTA 2MMXA 3BWSA 4U4IA 4YX2H 4GI6A 1MN4A 1FZJB 2GVYA 2NY0B 4AYGA 3OB0K 1T1XB 2E27H 4JZOB 2BZDA 5FO7A 4ZK8A 2R1YB 4OQTL 4PB0L 3LPGA 5I76B 1XCTB 1XTMA 3D50A 1YEEH 3VXPB 3K2MC 3L4YA 4HUUA 2WANA 1FVCB 3IJ8A 4EO5A 4P5TB 4NQQA 4LOFA 3EHBC 4WI3A 1ZK9A 2X3BA 2VXVL 2IIJA 5BZWA 4YXLL 3IAGC 5IHUH 2APSA 1XF4A 5LXGH 2XWZA 2VQ1B 2FWOA 5L2JA 5IB4A 1ZSDA 5F6HJ 3C5JB 5HVHB 4K7FB 3SKNA 4TVUA 2JJSC 3QIUA 2LTQC 5ESAA 2YBRB 3CHSA 3H3KA 3LKQB 1EHLL 1KCKA 3O9WD 1XR9A 3FXIC 2I7SA 5J11B 3DTUB 4CSPA 3RFZC 4LXFA 4QCIA 1EAJA 4HFWB 3L5XH 4N0UE 4TVSa 1B4JH 3NFPA 4YHPA 2G3MA 4N8VG 4JFPB 3ROLA 1PDKA 3HE6C 4Q6YA 4QXTB 2Z1KA 3F2LA 5FM8A 1MQKL 3FYIB 3HZKA 3UFIA 1E2WA 3FT4B 1ONQB 2UXFA 3QQ3A 2G3ZA 4R97C 4E0RB 1UCBL 4IRSB 5EBLB 5G4NA 4G6MH 3DROB 1DLFL 1Q1JL 5CS7A 3VGHA 4G70B 4BSWA 1H9DA 2A6IA 2FYYB 2CK0H 1JGVH 4GP4B 4HCFA 5E6YA 3KPMB 2BVOB 3CSYB 3ZZ1A 3QEQE 2YPLB 3IPBA 4F58L 5C0CA 4F3FA 4PG2C 4XX5A 1JD9A 2OL3H 3MAWA 3C60B 4ZAKB 3DBSA 2R29A 2DTSA 5EO1A 4OZHF 3GIVB 4O2CB 3LKNB 5HSFA 2BFGA 1RZIA 3DOIA 1JGIA 3WMPA 5D7KE 4QXGH 5IB3A 2VDQH 1OZTG 5CJXA 4ZMTA 3T65B 1DDHA 3TO2B 5I73C 1CL7H 3V0VB 3K2UL 4Q0XL 4FQ2H 1ZLUK 1B0GB 1LEKA 2WP3T 3QZLA 1S5IL 5GGSA 5LQBL 5F1IA 1P4IL 1ZLVK 1LLAA 4JFHE 4M29A 5IQ9A 1OY3B 5DZJA 4QEGA 4I3SH 2CGZA 2VSCA 2ZUVA 3OKLB 3U82B 3QEHA 1MXGA 4OGYH 3L9RA 4AENB 5BNXD 2W81C 3U30C 2BNQD 2FYVA 1MIMH 4YHZH 3SJVD 3MRNA 3BIBX 3LKPA 2F53E 3QUZA 3MLVL 4YBHA 2D7TL 1G0YR 4FE9A 1BBDH 3RVVC 2IF7A 1YECL 1UB5B 4XPTL 1VAHA 3ZHKA 3QXWA 4DGYL 3WBDA 2J1YA 3MRBB 3NT0A 3UABA 2HG5B 3SYCA 3MLSL 2CCVA 4DUXA 1WAAA 5T1LA 3SDAC 4OLZL 1GY2A 4UM9B 2UXGA 2YPVH 2JKJA 3E6HB 5BO1L 2IWGA 4KAQL 5IVXB 3SQOL 4N2OA 2NXZB 1YYCA 4FQJH 4PJEA 1YA5A 4MWFA 2B0SH 1HXKA 2W0LA 1AVAA 5IIEA 4AT6B 2IFFL 3O6FC 4UTBA