1O5PA

Solution structure of holo-neocarzinostatin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure Investigation for Releasing Mechanism of Neocarzinostatin Chromophore from the Holoprotein
pubmed doi rcsb
molecule tags Antibiotic
molecule keywords Neocarzinostatin
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1o5pA00
2CBOA 1NCOA 1J5IA 2CBMA 1J5HA 1NOAA 4JW3A 2MCMA 2CBTA 2G0KA 1HZLA 1J48A 1ACXA 2G0LA 2CBQA 1O5PA 1HZKA 1AKPA
chains in the Genus database with same CATH superfamily
1KJVB 4GBXD 2YD9A 3GHBH 1H19A 1PF3A 3AT0A 1FVEA 2YGOA 4XNZC 2DRUA 3AUVA 3LY6A 4W9DC 3HZVB 3DK0A 4ZXBC 1ADQH 1GSMA 1M6OB 2ZUYA 2F08A 4LL4A 3Q06A 2H3XC 4F7PB 4KUCF 5IW1B 4GKOA 5B21A 4ODXB 3EHBB 2AABH 3O2DH 4BFFA 1CIUA 3DXAA 4Y19B 3VYOA 3KPNB 3GI9L 1U4FA 4PB9H 2IPTL 3L16A 4S1QH 4OF7A 2ZCZA 5HBBA 3LPGA 3NDYE 5BO1H 3VMOA 1IGIH 2KDGA 1QPKA 3IETA 4YHML 1JWMB 3WTUA 1ITBB 1JRHL 1P84J 3H9ZA 4YPGA 3HBPA 3WDJA 3T0EC 5IVXE 3S37L 5C0CA 4ONHA 1BVOA 3KWVA 1D5BA 4P9HL 3BKMH 4PRHE 4Y4HD 3NJMA 4JDTH 5BQ7B 2VDNH 1CZ8H 3Q2VA 4GW5A 5BRZD 4Y16A 2Y07L 1NCGA 2YN5A 1CDUA 3RDTC 1MFDL 3KXFA 1HX0A 3F00A 5F0LB 3FOMB 3GO1H 2W07A 3MCYA 4PW3A 1AHMA 3UTTE 1DQQA 4GIAA 1GHFL 3AU0A 2AAAA 1YDPB 2QTEA 2KYIA 4L37B 1BF8A 3F84A 1LMIA 4FQ1L 5KG9A 4BWTA 4V1DB 1ZLEA 3GMLA 1RY7B 4QJ4B 1WFIA 1NCOA 3AWEA 5IB4B 4XN8A 1RZJL 4IKLA 4YAQB 4NHCL 5E8PB 1XCXA 1WBXB 4U2ZA 3CHQA 3VXUB 4GAJH 5D6DA 5IHWA 2VLJB 1FL6B 4LSPH 4GMSL 1F4XL 3MR9A 4MCYB 4X9FA 3N6YA 1OB1A 4MYPA 4HJIA 4OJEH 4LOUC 3UG3A 3ARGB 3IXTB 2RTTA 1IKFL 4EE2A 3MCKB 2P48B 1QRND 5FHBH 3LJ3A 5KSBF 3VI4F 3D3VA 2XSKA 3AMKA 1G6VK 1QI5A 4ZYKB 4HH9A 3TIEB 4OI8A 2VDRB 3P0YL 3ZHDA 3O0RH 1JCVA 4P9ML 2WLKA 3QIWC 4IKIA 1VEMA 5SX5H 3L4TA 1T1XA 1W80A 1UT9A 2HFGH 3WHXB 1K6QL 2NLJA 3ZDYF 2VSCA 1XB3A 3W9DB 3Q8AA 1ZS8A 3GMNB 3QCUL 3IXAB 3V4VH 4BWUA 3FFOA 4FRWA 5FKPA 5DI8A 3EZJB 4P3CL 2B7DT 4HQQL 4NQQA 5I8EA 3BAEH 5JXEA 4NX0A 4KZCA 3ARVA 2F5AH 4X7SL 2VMDA 1PG7L 3FO0L 3HE7B 4PVMA 2R69H 3JWDH 4RFNB 1T5XB 2NDGA 1KNOA 4X6FA 1OV8A 4U1JB 5FA3B 1U8NA 1RJZA 4BZYA 2CWRA 3IDXL 3I9GL 4M3KB 1Z32X 3RHWK 3JSSA 2XTSA 4JK0D 4N8CL 4Y4KB 4ODWA 4NNXA 3ILQD 1JIBA 1F3DJ 1SBSL 5ADPH 1MQKH 5D7JC 1RXLA 4FQ1H 1X6NA 5IMOA 5LWYH 3QQDB 1HHKB 2FIKB 2XG5A 3LIZA 1LEKA 4WQOA 3MNVA 4RNRB 1CFTA 2N0KA 5CZXC 5KVDH 5EU3B 1O7VA 3BAXA 2GCYB 2CR0A 5DD6A 4RMRA 3ZXAC 5KVMC 1JUFA 3GSXA 4P49A 3ULSA 1XF4B 2R0KH 1RJYB 3MJWA 4OZGE 4JFFE 1E42A 2FQFA 5I5JA 4QHMB 3EO1A 1FNHA 4TOYH 4UV7L 5H37G 4LHUD 4S2SB 4L8DA 2NSXA 2DMCA 2R0LH 4RISL 4H0HB 1YSOA 1QLFB 4PTUB 4XCFH 4F80A 4WU5A 3RPKA 5KSAD 1T7ZA 4ZXBA 4HIXL 1KCSH 1CE6A 2Y72A 2HX9A 3G5XA 3KL5A 5IR1A 1A2YA 2FEEI 1CPUA 5E9AA 4HBCH 5I75C 1K5NA 4JL2A 5HI3D 5C6PB 5I74C 4R83A 4LPUA 2R0WH 2BCMA 3TBSA 1MI5D 4S1SH 1QR4A 4K07A 3QQ9C 3ENEA 4PVLA 1QACA 4FQXD 2O5YH 1S7TA 4NBXB 4R4ND 2H1XA 4IBWA 4JFEA 1BG9A 2J71A 1EVTC 3IETB 4L9LB 4R96A 2N3JA 2WQXA 4F20A 1HILA 2WVSA 4X98B 1YNLH 4F33A 3EYSL 1S7XA 3EDDA 4XPBH 3H7BA 1BQHA 4I0PA 3MLTA 5A16B 5AB9A 4HIHB 3HG5A 3HZYA 2XBZA 3WG7B 1LP9B 3LKOA 1VF5C 4PJ7A 1A7NL 2XCMC 1G7HB 4E41A 3W1ZA 3RWFB 1KN2H 3REWA 1NBZB 3IMVA 5BV7L 3FQRA 1L4IA 4DP6X 4OZGA 2XA3A 1FORH 5HJ3A 4ZFOB 1CE1H 2NY7L 3LXUX 3RG1C 1QATA 2DEYX 3L9EA 2CDEB 3PU7A 2BY1A 4KXDA 4WVRA 4BCZA 1V55B 5JUEL 5GGTH 2BVOB 2Z7ZA 5DJ2B 1RVFL 1JZ5A 1R47A 1FZMB 3FUNA 4FNRA 3GHPA 4XWGH 1NGWB 3LD8B 4PI0A 4DQOH 4AC2A 4MDJB 2P8PB 5C7ZA 2DYRB 1Z3GL 3DV6B 3S35H 3UFIA 5E94B 1BD2A 3CFIC 4MA7L 4PY8I 2NQ3A 2NCMA 5F0JB 3GINA 4X4ME 3ARFC 4U1HB 1V7NH 1Y1DA 2IH1B 3L7FB 2AK1L 5CEYA 4E42B 5HPOA 2J7LA 5JPNA 3GXNA 4EAEA 4WJ5A 3SOBH 4TUKL 3AT8A 3GWJA 1ZE3C 4B0MB 1AC0A 4Z7AA 1CIDA 1ZT4B 1NEZG 4PJBB 5IB3A 5A1AA 2J12B 3WKMH 4ZUTB 3HN3A 2HH0H 3KDMA 1E4XI 4BK8A 4POZD 3GZOA 3ARGA 4YHMH 5FX3A 5BOPA 5DA0B 2AAVA 2H26B 3D69A 3CZNA 5FO8A 4WWPA 4UM9B 2C3VA 5DMKB 3QAZC 4I18C 3D3VB 1YEJL 4YBLB 4FA8A 1KCUL 2LHAA 2XG4B 3GMQA 3DO7B 4E0RB 4NO3A 3X1GA 4G8GB 2AJSL 4ZODA 1MEXL 1RQ5A 1WPCA 4WNQA 3MC0A 3OWEA 2FEDC 3MRQB 1M6UA 2MPAL 5L8KB 2C4FT 4EKJA 1WC7B 2WXJA 3PE9A 3UYOD 1QSEE 5FW8A 4IOFD 4JFED 1SJMA 2NY0C 2JJSA 2WP3T 3DK2A 4ZS7H 1C08A 4H1LG 2XVKA 5AVSB 1E3XA 2CO6B 4L37A 2G0LA 1XZ0A 5EOCL 3II2A 3AWFA 5J1AA 2LLLA 4ANWA 4PCSA 4H0GA 1H15A 3AB0C 2UZIH 2VE6A 3GI8L 1MHHA 4P2AA 2NY3C 3QCTH 5K59F 4TPRL 4C83B 3IRZA 1U8HB 2DLGA 3IE9A 2UZIL 3E8VA 2XY2A 3AM8A 2VO5A 1TMCB 2JELL 3FOLB 4P5MA 2FYYA 5D93C 1NKGA 5GGVH 1HQRA 5HDBE 3L3JB 2EDHA 5IMOB 3QULB 4U1KA 2A5UA 3UZEC 1L3WA 2CO7A 3ABZA 4NENA 4Y5XA 3P69A 5T8IA 2QFPA 4QIRA 1A3LH 4BSVA 4W9EC 4Z5RB 3KCPA 1M42A 2CBTA 4UAOB 2Z7UA 1JZ8A 3NT0A 4BUGA 1R3LB 2HRGA 4NNYA 4LLYB 1DBBL 1P4BH 3NPZB 4G42B 5LAPA 3W0WE 2W88A 4QHMA 2I9LA 2XXCB 3A21A 4PJAF 1A1OA 1FZKA 2LLGA 3JTBA 3T0EA 4IKKA 1B0IA 2CIIA 2VRQA 4MNQD 4LIQH 1AG6A 3II1A 1BZ9A 2D3JA 3NSXA 1SLXA 5A6IA 3IPEA 3CN0A 1CICA 3RWHA 4J6IA 3F7QA 1D5IL 4ES9A 5GGQL 3B43A 1F6AA 1TQBC 2YRLA 5D71H 3ZRFC 2D7MA 1PDKA 4HIEB 2VIRA 1MCIA 3V52L 1M7XA 5D70L 1OQXA 4MJID 1DBMH 4P5TC 3KDPB 1U36A 3IBOA 2BC4A 3MGOA 4KVPA 2WQWA 1JGIA 1FVEB 2WNXA 3ZL4L 1RJLA 1QX1A 2ZOKB 3OGCB 3I02A 4ODSL 3C8HA 4I3SH 3WKYA 3FCBA 1P6AB 4MXVE 3L3DA 1LO2H 4PJ7B 4WI0A 3HVNA 2EVFA 5C09E 3QEUA 4OZFB 5TQ2L 1MJUH 5AKTA 3BPLB 3GB7B 5B1CA 2CNYA 1LM8V 4U3SB 5BO0D 4XMKL 1DSWA 2C34A 3IYLW 5CILL 4AK2A 3D4ZA 4ZPVA 4AW4A 4MA3B 4I0KA 1XCQA 4H25A 4H8WC 3D0LB 5CGMA 3MHZA 3VFGH 2NT1A 2PTUA 2LR4A 2MOQA 1QFPA 2XWTB 3T71A 2CCVA 4OIFA 1ZA6B 1QTSA 4QOKA 4HX1B 4W9ZA 3D9AH 5SWSE 3T08A 5DRZA 2Q2EB 3B6SB 1HDMB 2EECA 1FYTA 2ARJB 4WRLA 4XPFH 3GS7A 3EKCA 3H0TB 4ODTL 2M2DA 1JNNL 2Y5TB 1QVOA 2QL1A 4WV1B 3QXDA 3IMSA 5I19L 3T2OA 2A74C 2F7IA 1BJ8A 2V5RA 5C0EA 3G6JB 5DJXB 2VQ1A 1H3WM 1I82A 4N2AA 1VADB 1LQSR 3KGRA 3HE6A 2CKBL 4IMLB 3ZE1F 3GYRA 5D9SB 2EC8A 1WDAA 4B0MM 1IFGA 2UYLA 5CP3H 3SE9H 1P4LA 1HQ4B 3CZSA 1X7SA 2NTFB 3FO2B 2BSSB 4FULA 4GQRA 3NOIA 1RMFH 4CVZA 5I8KH 2UUDH 2QGBA 3SPCA 4FF9A 5GRUL 5BZZA 5DZNA 4LB8A 5JW3L 1YPZB 5LCVA 4JHWH 4XXWA 3FCTB 1L5GB 3P30H 5FHBL 1S7VA 3TU6A 1VZHA 3V8OA 4AJVA 3VI4E 1U58A 4JHWL 4XOCA 5DMGD 4M8QA 3NACH 4RRPG 4G6JL 1PGRB 2WQSA 5I1DB 3SDAD 3M45A 4I0PC 5DZ9A 2CPCA 3JXAA 4NQVB 1GH7A 3CVIH 1RHHA 4R26H 3TWYA 4A2DA 2DICA 4HH8A 3BUPA 5F7HA 4G7SB 1QSEB 2DQTH 4XP9H 3D0VA 3CSYB 1JF5A 3HC2A 4A2GA 1RK0A 1Z7JA 4NSKA 3DX4A 3P3SA 3KWUA 4NB7A 3BN3B 4U1MB 5BS0D 1EHLH 3FQNB 2X5PA 1YAZA 4FHBD 3IJHA 4YGAB 5DJDA 1UD3A 2NXZC 1U30A 1N59B 2EIZB 3PWPA 1A7OH 2RA1A 3OJDB 4C83A 3P9WB 4EN3B 4DK6A 2JKIS 3EOYG 3ZYOA 3Q6GH 4OQ1A 4NFBA 1VKXB 3TBBA 4D9QD 2GFBA 1BPLB 4GS7C 4XMXA 4TLKA 3S3DB 3WAKA 4AIZB 4CJ0A 3VD4A 1KPVA 1E50A 4JKNA 3V4UL 1R5VB 1QO3B 4ONOA 1JGEA 1XF3A 1BBDH 3LEVL 2VM4A 4LSSL 3F7KA 2QADD 1HL9A 3DX8A 3A6CL 4OTXL 4XCCH 4X9BA 3FFCD 1KPUB 3ET9F 1FCGA 2D0FA 3DO7A 1FFNB 4F3FB 4DKEL 5HHNA 4E0RA 3OF6D 4DGIH 1J05B 3OKMA 1GC1H 4AIZA 5E7BA 2GTZA 1G4RA 1FVDA 4AVIA 1QSFD 1JDCA 4S1QL 1OGAE 3BSZH 2A83A 1AS7A 2Y1ZA 3K1KC 4KJPC 5L7XH 4LHUB 1WWAX 4PJDE 3OKNB 4HC1L 5FK9A 1OGPA 2FLBT 4FKKA 4JZNA 3SYAA 1BQ5A 2B9AA 4A2FA 1ZXKA 2VDRH 3ZL4H 5I1EL 3QWQB 3MKGA 1G9EA 3B5HA 2XWJA 2WCSA 2ICEB 3DHPA 3KW7A 2ITDA 2I07A 4RAVA 5FKAB 3GIVA 1R46A 1J18A 1PQZB 3U0PB 1P9MA 2AXWA 4Z7VF 3EH5B 3FK3A 2GY5A 4JRXE 3W39A 5CEXB 4JFPB 3HUJE 3HHSA 1XXFC 1A6WH 1R33A 1E7UA 4H5SA 1ZGLM 1LO5B 5HD8D 3ZSTA 4X9GA 3QXUA 5BZDA 1AIFB 4Q6IA 4OLWL 3M17A 4QYOA 3QDGE 3KH4A 3QUXC 5LN8A 4IRSB 4Y8DC 4MS8D 2IGFL 2HUHA 4AT6B 5CLTA 4WFEE 4F58L 4H13C 5D1ZD 1UCBL 5KVGE 5E2UH 2NUPA 1U95A 1CL7L 3BQUA 4FZEL 4JO2H 2DLFL 1AJ7L 2WZ0A 1TITA 3RVWC 1ACZA 3QZMA 3CK0L 1R9FA 3IMUA 2VDMB 2RMNA 1ACYL 1AGDB 4JRXA 5I76A 2VW6A 3A3YB 3HHSB 1S9YB 3VFUB 3T0DA 1TVHB 3FTWA 4TULH 3WN5A 2GABA 1FNFA 3SBWC 3KYAA 4BBWA 5ICYB 2ZAHA 1VADA 1OZTG 2Y2TA 4N9GA 4Q9QL 1KXQA 3CXHK 2VQ1B 1FO0H 2DLIA 1SHMA 1E40A 3MRBB 5GRZA 4N24A 2Y7NA 3GBEA 4CADA 1E9PA 3CSPA 3QXDB 4YXHH 1NANH 4ZMNA 2HWZL 1NGPL 3NSJA 3AACA 5JXEC 2M26A 1JPSH 1XGYL 4WU7B 1R3JA 5BO1L 4ZPTA 3TV3H 3AS2A 1DBKL 1FF5A 4G6KH 4PB9L 1D5MA 3VSVA 2YPKB 2ZKHH 3QQXA 3ERXA 1QSED 4NUQA 4R0LB 5JHMA 2IAMA 4FXGC 2WAQA 4EOWL 2VJ8A 3BAJA 1CI3M 5HGAA 1Q9KB 1EXGA 2Y36L 5IQ9A 3ABMB 1QG3A 3PNRB 1KYOK 2W60A 1XGRB 3GXFA 2P7TA 1KXTB 1VGKA 2DQDL 1AMYA 7TAAA 3CDGA 3SGKA 3UC2A 2WSDA 1G87A 1UEMA 4UQIM 1GKEA 3WBDA 4M5SA 1KCBA 3MO1B 1GKOA 4KFZC 1A3RL 2EICA 3BVVA 4XNQA 4HCRH 3D0LA 5I66A 2PW1A 1M2VB 1U2YA 2NNFA 3C6EA 5FA4A 1T20A 5GS0D 2B2XH 4RWHA 3U46B 4FJZA 1UXSB 4NM4H 1F02I 1QNIA 2WTOA 4GBXC 2ADIA 3SQBB 5HHVH 1ETB1 1TU2A 2A7BA 1JF6A 1E8YA 1ULVA 2VLKA 4OF3A 5G55A 4B9JA 3WXWH 4EI6B 4HPHA 1G1CA 2HVJA 2RHEA 1J5IA 1BEXA 5AEAA 1H3PH 1VB9A 4KMQA 4XWOC 5E23A 1Q72H 2RD0A 3HTLX 3A4DA 5BJTB 4EEEA 2Q5BA 3QAQA 4HUUA 4Q4IA 5B4MC 1M9SA 4HALA 3BOVA 1KB5A 3VGFA 3TH2T 4NAJA 2HKAA 4QRRB 1OB1B 5EU5B 3CH1A 1K4DB 5LBSH 2WWKO 4FZEH 3GK8H 3OL2A 4NO0A 5HYJE 1Q72L 2DWEA 2ADFL 3TYFB 3MREB 4I2XA 4KY2A 2X1XR 3L4ZA 1NAML 1WZLA 1BJ1H 5KBLA 5ALBH 1JBJA 2ITCB 3UEZA 1I7ZB 4Q9BA 3KMDA 1P9MC 2ZONA 1U6AH 4F8LA 4K7FA 4MJIE 4G8GD 3KPOB 4HSAC 4EI5C 4WEUD 1UOKA 4PS8A 2X1QA 3DROB 3MPCA 3QBTB 4GT0A 3RGBA 2OTUB 2BP8B 3NG5A 2CGRL 1J0IA 43C9A 2O1AA 4PRID 3NK4A 3VXNB 2VDLB 4AIOA 1PZUB 1K3ZA 1PKOA 3U79A 2GHZA 1F3JB 4NQTA 2R2EB 3ETBJ 1DUZA 5F9OL 4LCCB 1AQMA 2UWEB 2R9HD 1HK6A 2ED9A 3IMWA 2CXGA 2GYSA 1UJTA 3W3BA 1YNLL 2HJFB 5HYJD 2WZPA 5KOMC 4XXWC 2VXUH 1MWAH 5J0BA 2O5YL 1NBVL 3MGTA 3MRKB 1N2RA 4XI5D 4PG2C 3PJNA 4H44C 4M7JH 3FBKA 1AQKH 2BNRB 3P2TA 2ZX9A 1MWAL 3U6RA 3EH3B 3EJCA 5EZJA 1LILA 2CD0A 2WZPD 3SGEH 3VFSA 4A7SA 1KENL 4FKEA 1PJWA 3DXAB 1JV2A 3T77A 1I7UA 3BWZA 4ZTOH 1PZSA 3HKFA 3HW7A 3POHA 4QXGH 3MV7E 1IC7L 4ZZKA 1JGVH 4YSRA 4KVNL 4XAWL 5JYLA 3TTYA 2EACA 5E08L 2IAMC 2HFTA 2ZUUA 4MGXA 4OZFG 4BSWB 3QUMH 2IXQA 4PRPE 2AK1H 5MEOB 3DETD 3LS4H 1NGWA 5JHLL 1A22B 4IRSD 4Y7OC 4HOXA 3HI6L 2UYLB 3L5JA 4ZK8A 4FA7B 3IWVA 3EJZD 2ZZUT 4JVPA 3AC0A 1F18A 2AEPL 3JWNG 4FLQA 5EUOE 3F01A 2ZKMX 1SXNA 3FPXA 4PJ5A 5E5MB 4XVSL 3WY2A 2CGYA 1H3GA 4ZXBB 3VFNA 2JCCE 4YE0A 4X7CC 1G6RH 2JWYA 5T1KA 5I1LB 3FT9A 3DUUB 7PCYA 2D9QB 1JWUB 3HI5L 2HFEA 2JXMA 1Q0EA 5IW6B 4YE4L 4MA7H 2Q8BL 4ZSOB 4ZMPA 4Y5YC 1ZLVH 1MRCL 2VDOB 3H3KA 4ATWA 2Y7SA 1ZV2A 4FNLL 1F45A 3AGVA 1EJ6A 1S7SB 3NFNB 5EORL 3NACL 1PW3A 2ED8A 4RMUA 3UTQB 4XNUH 4F9PA 5HI4D 3J2PA 3MV9A 4ZMLA 2RGSA 3ULVC 1WUZA 2FX7H 3D0VB 1UJ3A 4XC3L 2AHIA 3IDIB 1T3FA 1A9BB 1P69B 5D7SL 4LMQE 4K94C 1NJ9A 1WAAE 2ZSVA 1U0QA 2UXFA 1A6WL 4KWUA 3FSVA 5F8RC 3OG6B 2Z31D 4NWTL 5D7HA 1YCSA 4JCWA 6CGTA 5F93C 4XRCA 4RH4A 1MCOL 4Z7WA 2QQQA 3REWB 4EO5A 5FM5O 2H32B 4JDVB 1ZLVK 4PJFF 2BNUB 4WUUD 4LU5H 2OYMA 4AUJA 4D7BA 5DC2A 3ZR5A 5E95B 1WBZB 3EYVB 3OWRA 3IJEA 2CK0H 4UYQA 1KPVB 4AGPA 2R4RL 3TPKA 1RIUH 2HVKB 3MRJB 4XMWA 1SOKA 4PU2A 3UDWC 1BZDA 3HB3D 4XP4H 4PJAB 3QCVH 4APXB 3WTYA 4CU7A 3RZCA 3LIUA 2BWIA 1UM5L 4GUCA 1E9QA 1MHHB 3B2DC 2O5ZL 5EO9B 4HKJB 3F7VB 4X6DF 4HV8A 3P4NB 3WEBA 3VB8A 3Q8EA 1T66D 3LMJH 3ZDYE 1A2YB 2CLRA 3KS0J 1HC1A 4OUOA 4HUUB 4J3TA 4NQCD 2FZ3A 3EUUA 2BFVL 2CU9A 2HT3D 2NY6C 1CGXA 4Q6YA 4U1KB 1OE1A 1RHHB 5DHVA 3GSNL 2HT2C 4H1LH 3RDTA 1YMMD 1AGCA 1FIGH 4JQVA 3MNWA 1HI6A 1HT6A 5KZCB 4NWUL 4QRSB 4M03A 4PJIB 3OZKA 2O5XL 1MI5B 4JGMA 2VAJA 4GUOA 2VUOA 2ZG3A 1NSNL 2UXTA 3QJFB 1WWBX 1RUKL 2QPEB 1W16A 5FYJL 2NY4C 4PVBA 4YC2C 5TDNB 3FQ1A 2OK0H 1N3NA 3VH8G 2Y7QB 3CZJA 3CUPA 1I9EA 4Y8AA 4JO3H 1JXDA 4HLJA 2PPEA 3CDZA 4O51A 4XZUB 3WO3B 3N9GL 4NPYA 2H2SD 1COBA 3QIUB 2EYTA 4N2NA 5AW0B 3BKJL 1G1KA 3RNQB 2DI9A 1LDPH 4LHJB 4M1CC 1DFBH 1SJXA 5J1AB 1DJIA 4WWNA 4ZO9A 3O81A 1MCRA 4L4VA 1MREH 3ZOAA 3MV9D 4H26A 3E9UA 4G71B 2ZF8A 4BK5C 1BCIA 1PTZA 1G0XA 4DTGL 2KZKA 4LKXA 2P24B 1CUOA 5IB5A 1M1XB 1Z9SB 1BD2B 5FGBC 3PWPE 2WSKA 2CLZA 4XPAH 1TQCC 1T1WB 3SOTA 1FV1A 4XNMA 4DVBB 1AGBB 3KE0A 4Z7VE 3NJVA 1GYCA 2CA3A 4ANVA 3RAJH 3RL1A 5IFHH 3WHE1 4HETA 3ZQ9A 2Y9RT 2Q10A 5EA0H 1RZIA 3RBGA 1ASPA 3DPBA 3QXAB 1A21A 2VKXA 5F7WC 1EZVX 3WV0A 4YWGH 4JDEA 1I1AA 4F5CE 1LO3H 5K69A 12E8H 3QDMD 1WZMA 3QDJB 4PJ9D 5D96C 3NA9H 4K23H 3PGDB 1FZJB 4ZW3A 1NMBH 2OTWA 2QKIC 5JO5B 1XL6A 4XCFL 3ZHNA 3K6OA 5ADOL 3BAYA 1YZZA 2DTMH 3ARSA 5KYWB 3LKOB 3MODL 3IFOA 4LEOA 1QFHA 5LAXB 3IGAA 1SUJA 2IF7A 4MX7A 4M3JA 1DZBA 2DWTA 5GGSY 3A6BH 4HS8H 5KS9A 2ZWSA 2PR4L 4FNLH 4FFWC 4DAGL 1NAMA 2F53D 2JCWA 3TV8A 1T80A 2ZWYA 4HIIA 2JB5H 2AF2A 3CN2A 3N3EA 2APVA 3MX0B 3NQIA 3ESVF 4AKPA 5EBGA 3MRMA 1ZOXA 3EJZC 2OFQA 5BUGA 3G04B 1UA3A 4P99A 3MLVH 1IMHC 3AXLB 3Q6FB 3SDXE 4MHHI 4ZFZB 3GRWH 3MV01 5JHBA 5LBGA 1NMAH 4HMCA 5I17A 3D2UA 3R06A 1OTSD 4IBTA 2G75B 4PRBA 4P2OD 1XF5A 1DN2A 2Z31B 3HNVH 4UTBA 3DMMB 5K1NA 1QBBA 2NZ9C 2WIIA 4PLKC 4TRPL 5C97A 4WI8A 3AB0B 3N0PB 4QRUA 1KIUA 1IGIL 1OY3B 3MXWL 1FYTE 4APQB 3FB5A 1KLFB 4I3SL 3QUZB 2DQIL 4CBPA 5C07E 1KJMB 2I24N 4Q6KA 4WFGE 4G6FB 3JV0A 3QPQC 2DWEB 4LVHB 4PJDA 3L2LA 1T5WB 3TYFA 1QWUA 1BAGA 2R23B 4YHLH 1KB5H 1KGUA 4KTYA 4RIRA 2PR9A 4MNGA 3FUMA 5JOFB 1ND0B 5C7XH 1ORQB 3BX7C 6FABL 2KZ1B 2YD0A 3TTSA 4J3OG 2BOBB 2X4NB 4FL4C 1RUAH 5CJOH 3VJ6A 1ADQL 1S9XB 2J8UB 3D8MA 3CTTA 2Z3FA 4G8EA 3QHTC 4IS6A 4MA1C 3IDNA 5EFIB 3GSRA 5CZXD 3QO0A 4GJTB 2CKBH 3SY6A 5C0FA 4G43B 4N5ED 2CLRB 5L0QC 5GGVL 1MN4A 5B7EA 4NQEB 1J0ZA 1WWWX 3TCLB 1TKWA 4FNPA 1AOHA 1OALA 1U8MB 5H94B 43C9B 4YFEA 3F7VA 3HN5A 2DLTA 4OCSH 3EH2A 3SDXA 1SFDA 1M2VA 3W9EB 1A3LL 1UA7A 3BIKA 4LCWB 1XEDA 2GCYA 2NW2A 1ZXQA 3E3QC 1HCZA 1IILE 1QTPA 1MW0A 1GGCH 2ICWI 1W2KT 4UMSA 2EEBA 4JHUA 2D3NA 3NJLA 5TE7L 3TH3T 1R4XA 2CHXA 2QSQA 5E03A 3WDIA 5KVFE 4KMTL 1KT2B 3IKKA 2CO3A 4AQAA 1JHKL 3CIAA 4PRAB 2BSTA 4GI8A 3LEXA 4GSRA 4U1GC 1NLDH 1MJ7L 4G7YL 5CUSL 3HZMA 2FWOB 4XVSH 3DX6B 4ALAC 2R1WB 1LO0L 3GO1L 2A3TA 3SKNA 1G7MB 1XGUA 3HNTH 3PIQA 5DFVC 1KJ2A 2IPUG 1LK2B 3BMWA 2UY7B 3FRPG 4TSBH 4WNSA 3B1TA 3LS4L 3B8YA 3HRZC 4WO4B 2IWKA 2EC9T 1SVZA 2DBLL 2VOTA 2XFGB 3U4KA 4J3XA 3UYPA 2BXYA 3P73A 2BVUA 3QDJD 3PQYA 1JGVL 1A5FL 1TZHB 1U8JB 4GO6B 3QYCA 1FG2A 3FBQA 4GSDL 3M1CA 3NIGE 3L3IB 3LNGA 4OKVB 1FQ9C 3F6JA 1T2XA 2J55A 2BVPB 3QS3A 2QPFA 1LK3L 4PJGB 2BOCB 1Q1JL 1A4JB 5IROD 3HI1B 4J3OC 4MJIB 5GRVK 5C0GA 1BREA 5EOQL 3MXVL 4DVBA 2HMID 4WO4A 2BRRH 4JM0A 3FAXA 2KI6A 2EABA 4AT6A 1X5HA 4L8CB 4LRNH 2W0PA 5CN2A 1OP5K 1T0NA 1NC2D 2OMTA 1GGTA 5CBEA 1OANA 4KUZL 4S0TD 2R4RH 3QIWD 1UM6H 4OFKA 3KYKL 4R5VA 3JWNC 5BRPA 2BVQB 5MENE 3GZKA 3LXCA 4YJZL 4NQXB 2CRIA 1WHPA 3AY4A 1JTPA 5E00A 3VRLE 1QKZH 5HSFA 3UO1L 3HZ3A 4K5OA 2EADA 5DS8A 3FSOA 3SGJA 4KO7A 3BFOA 2R2CA 1FDLL 3W0WB 3FPYA 1KELL 1NFDF 3FTSA 4ZMAT 3P2DA 4YSEA 1OPGL 3NN8A 1LYQA 2JTDA 3PUUA 1MAMH 2XN9E 4JCMA 4RMWA 5INDA 3KW8A 5K1VA 5KYYA 1FA4A 5CUSH 4F91B 3BAIA 1GGYA 2BVTA 2CLVB 4L1LA 4MJ2A 3UBXI 2BDNH 5IHBA 4MCNA 4M1GL 3ZDZE 2VDPH 2A6JA 4ORZC 3RVWD 3S8FB 2V5YA 4MDIB 5EU7E 4PSRA 3ML8A 4U7KA 1N7ML 1RZ8A 4X4MA 4JHAL 5KBPA 2FR4A 4RWYH 5DJ0B 3KPSE 1WAPA 4RFOL 2XN2A 4NQDD 1TFHA 3ARBA 3MLYL 5CLZA 1H0DA 4H5SB 2C3GA 1BIIA 2EYSA 2XZCL 5MI0C 3VRIB 2OX5B 4PGDB 6FABH 1JNLH 5GGVY 4OU3A 2GJ6E 2NNRA 4G9FD 3WXWL 3I6LE 4GSXA 1KWGA 2R1XA 5I6OA 1HINL 2GW5A 3I75A 3QUZA 5D7IA 4C57C 5JZ7D 1N4XL 3AUWB 2FATL 2PP9A 5J13B 4O02H 5GZND 1CYGA 1R75A 1TENA 1IAKB 3L6FA 1MF2L 1JWMA 3QFJA 5IV2B 2F19H 1G0DA 3JWDC 2V17H 4QKTA 5EOQH 1NUNB 4HCRL 1DQDL 3FU6A 4O00A 4ZYKA 1ZTXE 3QI9B 4Z8FH 1N8ZB 4NRYA 1A7BA 2AXFB 3VX1A 4X99A 2ZYIA 4WJG3 1BECA 3P11L 2J56A 2XQBL 5ABDE 2FQEA 4KXAA 4HXAH 4G8IA 2CQVA 3O3BA 3L1OH 3VDCA 3CLFH 1WV7T 2WHVA 5K39A 3VXRB 4YVNA 4EUPB 1AFVL 4QTFA 3GTTA 3MJ8A 1HU8A 5JHDA 4JE4B 2CA4A 2F1EA 3FUKA 3HHRB 1MCNA 4OBRA 4YO0B 2FTAA 4ZAKB 1JK8B 1AQ8A 4QHKI 2A9MH 4JRYA 1TYJA 4KPHL 5J3HC 3KVQA 4EIGB 3BN9D 5I1DA 1XDTT 4LQ1A 3JQOB 4J4PC 5TDOA 2RCSL 1A8JH 1Z1WA 4UM8A 3F3HA 5F96L 5JHDD 2RAMA 1GC1L 1WEJL 4D0CB 1I9RL 1JPSL 2R8SL 1MHPL 1ZGLA 2WZ5A 2UZYA 2RQEA 4OI7A 2X3CA 5I5MA 1Q0YL 3PWPB 4XP5H 4AJYV 4Y19D 4HCIA 2J5LB 5HHOB 4GG6B 2YXWA 1ASOA 3JWDL 3SKUD 4BFIA 3EO9H 5KYUA 1WC7A 2PO6B 1ITCA 3B3IB 3O6FA 1ZDSA 2HTLD 3CHSA 1WA2X 4MAZA 4CNIB 4N5EC 3CVHB 2A0LC 2VL4A 3OR7A 1IGYB 3CQFA 2WJ7A 3DOSA 3W5MA 1JPFB 4BDVA 3GSNB 4CJ1A 5HHME 3MBEC 2YA0A 5DHDA 5FUZH 1DSYA 1IGJA 3V6FA 4K94L 5AB2A 2VLLA 3O41A 2XBDA 1U8QB 1JE6A 3O11B 1CTMA 1WCBB 2YMXL 4Q9RL 1RIUL 2VZUA 3MBEB 3MACL 3MV11 3O2WL 4LFHD 4PTTA 5E4AA 2FEJA 3HMXA 3ZYJA 5GSVB 4AUYA 1RL1A 5J11C 4JHBA 4BZ1H 3PXLA 4H2CA 3ULVL 3L95A 1DEEA 3SDCD 5CJQH 4AMXA 4BZ1L 1F1AA 1RULH 4Z0BH 5I71B 4O51B 5CS7A 3SGDH 4L3CA 2O93L 1MFUA 4DZ8A 4Y2OA 4N2LA 4ZPVB 1ETZA 2VN4A 2GTQA 5IHUH 3KXFB 1SY6H 3OMZA 3UO8B 2RACA 3H8NA 1PCXA 4OGAC 3CFKB 1S7XB 4ELMF 1HXYA 2D2CC 3OB0K 2BIOA 4UV7H 5DK0A 3EJJX 5JW3H 3RHWF 4N2BA 1JFHA 5J6SA 4Y9GA 1Q9LA 4R0LC 5BMFL 3MXWH 2C7FA 5ANMB 5IEKB 3VGBA 4WHTA 2XQYK 3CHXA 4YDVB 3W0WD 4Q74A 2DW5A 4N22A 1OM9A 2EDTA 3LNFA 5BNXD 4B5EA 2IJ0C 1N18A 2A6KB 3VXME 4C8XA 4JFDE 4JY4A 3PHAA 4E41B 1V3JA 2BSRB 3LH8A 3MFFB 2E7LC 1FJ1B 1G9MH 5E8EA 4CILA 1GCYA 2W65A 2XQ0A 5KSUA 3OX8B 3ZO9A 4UF7C 4U31A 3C75A 3N42B 3EADA 4HEME 2VNCA 2OP4L 2VR3A 3SQOL 3FL7A 5ISZA 4K9JA 2E9GA 4UCFA 1MFMA 4C56D 3QEHA 3ROLB 3RUGF 5D5MF 2HRPH 1CZ8L 3PHSA 1LE9A 1A7QH 5I76B 4Y1AE 3B9KA 1KIQA 1K9TA 3EJPA 3TASA 4OGYL 1BYOA 3X11A 3FO0H 2H32A 4JDVA 1HCYA 4WI7A 1QAWA 2XWBB 2A9CA 1KY7A 1GAFH 3KH3A 4XO8A 3CMOL 2VLRE 2K70A 2HXAA 3OJVC 4ISVA 5FYJE 2WUBH 3FU0A 5CLWA 2EKJA 3K0YA 1G7LA 2V17L 1KPRB 3N43F 4PJXF 5JYMA 1UM5H 1YC7A 1NCBH 3QI9D 1I1FA 5D6DC 4G59C 5IFHL 4NRXA 4W9JC 3HG3A 3TM6A 1KBVA 2DN7A 1EEZA 5I5IA 1PZ2A 4UM9A 3K8MA 3U7AA 1KGCE 1C5DB 4X8GA 1EWHA 2Q87A 3CD4A 2EE3A 4MKMA 4JB9H 3AFLA 4TYUA 3VD9A 3RTLA 4A7TA 3AG1B 3QHZL 4ELKB 3BRDA 4JVWA 2IPKA 4KKQA 1JNHA 1AXIB 1Q90A 3L5XH 3STZB 4PV9A 2B8OT 3E2HC 5CD3A 3LKQA 4OI9A 4YSTA 4Q6IC 3E8UL 3DYMA 4MDRA 5I18H 3VXTA 4AGNA 4HH9B 1JSYA 1IGFL 1CXEA 3B2XA 4MNQB 4XI5C 1UT1A 3TOPA 4TXVB 2WQUA 3DXAE 3C2AH 1E5AA 2E75C 2DMKA 4XNAA 2XX1A 5HHOD 1GZHA 4QTIH 4L3EE 3WEXB 1FH5L 4MAYD 4WEEA 2DYSB 3BO8A 1A9BA 4MD5A 3EJRA 4DN4H 3S8WA 4XMTA 1A0QH 3OKDA 3LKNA 3D85A 3S0PA 3ARPA 3NJIA 2DQUH 5DZAA 4UU9A 1A6UH 5L9DH 2X70B 3D50A 4XVTH 1U8HA 5HHOA 4GG6A 2OL3H 4AOFA 1ZMYA 4DNLA 5T3XE 4IOSA 3U1PA 2X2HA 4GH7B 1FE8H 3MV8D 5DLML 3BKML 3L3OA 3K2KA 3QZWG 4P23D 1TZGH 3IFPB 2HX7A 3HUJF 1PPIA 4P4RA 3T5WA 4D3CH 5ERWA 1CJYA 1FNLA 2B3IA 3KXFD 1NGXA 1UC6A 1UHVA 4BGDA 2FJGB 4M1CD 4DGYH 3HZYB 3FT3A 4KKLD 3VDAA 3ULUH 1ZLDA 3WIFA 4N86A 2Y1YA 3RDJA 1U8IA 3U4BH 5KVEE 2P28B 1K2DB 2EEAA 1DBAL 2JNZA 3JWNH 2EDDA 3BP5B 4UBDD 5TQ2H 2NX5E 1IC7H 1A1NB 4LCYA 4P2OA 1OAXH 3NZ8B 4ZUVB 1IV8A 1PD0A 3O2VH 5GRJH 1ILSA 1F6FB 2WGXA 1E4WH 4DO6A 3VXPB 2X40A 2UWEA 3CX5J 4FE9A 3VYNA 2D03L 2EH7L 2NX5B 3MQIA 4L23A 3FQXA 4NCC1 3IKCB 5E2WL 1BVKB 2DM7A 4YQXH 4ECNA 3BQUB 3KG5A 2R56L 5GS0C 1KN4L 4Z8FL 3D3VD 1NBVH 3K6NA 4O2FA 1SDYA 4Z3GA 3V0HA 5JW5B 1JV5A 3V6OE 4P48A 3M8OH 2GJPA 2VAAB 4K71C 4ZDHB 1A4KB 3QNYB 3QXWA 1HINH 1MCFA 3B7YA 4JKKA 3UCRA 3BH9B 2V2XA 5EORH 1MDAA 3IRCA 4NGHL 1VESA 4LPCA 3AREB 4UQ9A 2ITEA 2C26A 5E5UB 4EDWH 1R0AL 5F1OB 3U0TB 4V2CB 4XH2B 3FKUS 3TIDB 1BMZA 2LGNA 1HXMB 3R19A 3NVQA 1JMZA 1HN1A 3Q9QA 3UZEA 2XZAL 2VZ1A 1J5DA 5GS0L 5FWQA 5SWQA 3HNTL 1IE4A 4NKOB 4DETA 1J1XH 4WUKL 4EI5A 1FGVH 2ZP9A 4JPWH 4QO1B 1TMQA 1UQSA 1NBZA 2AEPH 2XPYA 4TUOB 5SX4I 1RVFH 3HB3B 3GK8L 1PIGA 3ULVF 1LEIA 1P1VA 1JHTB 5KVGH 2H5UA 1OAJA 4GMTL 4P5TA 4Q89A 5EO0B 2Y06L 3MRFA 4IJ3B 4OT1L 4E9RA 5MHSE 1DBJH 1MVUA 2QSVA 3FHEA 1WS8A 2LFGA 2XA8H 3B9VA 3MOAH 3P3TA 3PJLA 4WI2A 3GT6A 3I6LD 4JMXA 4XNQB 5E99L 4AZ8A 3FAWA 4HMEA 3V5HA 2A6DA 4YUEH 4YLQT 3UG4A 5AFAA 1N6QL 5C7XL 3F7YA 4YSOA 4ZAKC 1CFVL 1QMUA 4NKDA 1THAA 4BFOA 4B9GA 2WLNA 4PRNA 3EYUL 3T9WA 3QQ9D 3ZKXC 2BXZA 1GIGH 4MS8C 5IOPA 2WBWB 2YUZA 1TVBB 3O2VL 1QSZA 4I9XA 5GRJL 4I87A 3CHPA 1A6VL 1OE3A 2AJSH 3KLQA 2YXFA 1GYUA 4BSJA 1JXFA 1H6TA 3SHSA 4J39A 1KN4H 1W91A 3PABB 2V7HB 5DK2A 1NAKL 4KKNA 4DCQA 3DSNA 3C87A 2ZUTA 3CPLA 3V0EA 5ID0B 4MXWL 4Z9KB 4PJAA 2HWZH 4JDZB 2F74B 4NUMA 5C0IB 1OOAA 4D8PB 4LO9A 4U1MA 5D2LB 1OHZA 4N85A 5KEZA 3C5JA 3NFPB 1BYNA 1I9IL 2J6EL 4K2UL 4HJ0C 3GMPA 5CJXC 2YPVH 3NCMA 1WFNA 4NM8L 1SMOA 2CDFB 3ZN6A 2L7EA 5AAWC 3KM1A 3MROB 3QHFH 1P5VA 5CD5C 5D71L 5E6ID 4NKIH 3NUKA 3K4AA 5SWZD 4AIXA 2DTSA 4ABVA 3FH8A 2WLJA 4ZO6A 1LEKB 2EXSA 1EGJA 4YIQA 3VGAC 1C5CL 2EVGA 1RIHL 1HZHL 1AIZA 4YR6A 4ZG1A 1UCBH 1WBYB 3ECWA 1GOFA 1P4IH 4ZD3L 4IK7A 3X1FA 3GSWB 5L6YL 1NMAL 3LZQA 3VWKD 2F53E 1O6VA 3WGUB 5ID1A 3S88L 1CDBA 1T21A 5BCAA 4YDKL 2NYKA 1CGSH 3ZDXE 3JT2A 4F8NA 1QNZL 2FGZA 3QNZB 2PPFA 1CXFA 4HKZA 1VPOL 4N8VB 3DX0A 1EHLL 2NT0A 1EEUA 4N1HB 1GY2A 3KLLA 2VE6B 4Y4FC 4FXLA 5ANME 2YUXA 4OLZH 3QDMB 5C09A 1EZVY 1UB5A 5E2UL 1RZ7L 3RAJL 2WANA 2MNJB 1J0YA 3ZE2E 5AL8A 2YOAA 2C9VA 3BEVB 5JORB 1NM4A 2GIMA 5HHVL 2B1AL 3NCCB 4IBZA 3LPWA 5G2NA 4YK4C 3OV6A 3CFCH 1NBCA 2NW3A 1MJJB 1UWYA 2VDQH 3E9TA 3R7QA 3SDDA 4K7FB 4OV6F 4MJ5A 5C92A 3EDFA 1DVUA 4LHUA 3Q6FA 4FFTA 3V6FB 5LJYH 3KR3L 1NCBL 1DL7H 5ESVB 3APMA 3S5LB 4NLAA 3UTPD 3WUWA 4OZHF 3QARA 1HAWA 4JKPH 4Z7UB 3P54A 1OCOB 5IFJA 1R3KA 1T0MB 1U3HD 4GFXA 2JI1A 3NCYP 4WTZA 4ZDHA 1SXSA 3ALPA 5B4MD 4I8DA 2MTAA 3FB8B 3P2BA 2BNQB 1JV5B 1MLCB 4HHAA 5E6IC 1J87A 5C0AE 5CCHE 3X3FH 4DPCX 4WGWB 4KNQA 4XX1E 5IVZA 4XODA 4X50A 4R7NA 4XH2A 4W4NA 4KTEH 4OCMC 5AW3B 3OGOE 4Z7VB 1KXVA 2VYRE 5BQ7A 1UZ6E 4L3FA 4P2QA 1AACA 3LIZL 1FYTD 4E41D 5C0CB 2TRYA 3DX7A 2R4SH 3GM0A 3JTTB 5GGRA 4EPSA 3QP3A 3WYRA 2VDOH 1PFCA 3FN0H 4M02A 1CBVH 5T3XD 1E6OL 2FWUA 4HT1L 5AYTA 3ZDZB 3B56A 2FYVA 3V0IA 3MNDA 4R5TA 4BQ8A 4E9WA 4OFPA 1BGXH 2EZ0D 3W9EA 2VWEE 4FN0A 1BA9A 1MIMH 3BP4A 3BSHA 3RGVC 3T0ED 2ZXEB 5FGCE 1DJSA 2NR6D 4OJAA 3ZT6A 2YS4A 4LZKA 4AXWA 5C2BH 2BSCA 3U0WH 1CF1A 4MRCA 4PVNA 1SXAA 4K8RD 2AFNA 1C16A 4JJ5B 4ONFH 1KIUB 2JKNA 4CVUA 3IGUA 2PYEA 5KVEL 2YGVA 5C9JA 4LLMA 5IMKA 4HJTA 4W9CC 4XN7A 1DP0A 3EFFB 1DQKA 3IJHB 3IGKA 3LOWA 5CP3A 4H8WH 1DL7L 3ZKXB 1J1OL 1JL8A 3QT2A 3CVHH 3GF8A 4GIOA 4X6EB 5SWZB 3SO5A 1NTDA 1T03H 1DQDH 3Q5TA 5KSVA 3D25A 3TPUB 2XI9A 4MBOA 2EEFA 4PEEA 3Q1EA 3EBIA 5KBKA 3FT4B 1E9OB 2DWSA 3FONA 1B4RA 2VLKB 4KO6A 4J23A 4ZUUB 1CBJA 4KJQD 4JQIL 4I0CC 4WV1C 2DIJA 3RKDD 1RK7A 2DB8A 2J21A 4GUPA 3SN6N 2VTFA 1ZGLP 2WWMC 3ROOA 2QELA 1LTXA 1YHPA 4UB0H 5JXAH 1CGVA 2Q8BH 4HOMA 3RL2A 2X4OB 3LHPL 3T6VA 3X3GL 1D9KC 1ZT4A 3WLBB 1YEFL 3AXHA 4HJJL 1CR9L 5G5DA 3T4AC 3NJFA 5DD0H 2ZTBA 4HS3A 4NWTH 4LKCA 5DI8B 2QVMA 5IBTH 4ETQA 4WI3A 1IB5A 1T1ZA 3VI3F 4D0BB 2R4SL 4Y89A 2M8XA 4ZD3H 1JGUH 2P5WD 2XN9B 4E9QA 3TF4A 3T4AB 5EF0A 5EU5A 3BPLC 3LS5L 4GXVL 4NXKA 5F7EL 3QVAA 2IOIA 2P80D 3JWOL 1RLBA 1QHQA 3FJTA 4CC1A 4JANB 1XT5A 4JM2D 2IDTA 4QWWD 3HLKA 1HOCA 3HNSH 2YSTA 4TLUA 2R1WA 3UROR 3K8LA 4LPYA 5A6LA 2AQ1A 1I3RB 1CXLA 4KJPD 4IRJC 3CC5A 2A9ML 2V5TA 1HH6B 2GIYA 4I4WA 4NQSA 2QMKA 4JM2A 3V7MA 3MLWH 1D2PA 5ADPL 1UB5B 3A4FA 3RJOA 1IBYA 4M6MH 1SEBB 4GRWF 2VH5H 4HXAL 3QQ4A 3L1EA 2VDNB 2Y24A 4JG0H 4UI2A 4A7VA 3ULUE 1NCWH 1AS8A 3DVGB 1NBYB 2OM5A 3MJ7B 5EIIB 1OXYA 3D09A 1EAPA 5EO1B 3MBXL 1XF1A 4NQCE 1SLUA 1YEJH 4KPHH 1PKQA 3RWDA 1M71B 4FLRA 5IM7B 3G9VA 2IPTH 2I60L 3O6KH 4FDWA 4DEPB 2CO4A 2WYZA 2GJRA 4N90E 1AFVH 4QCIA 3QZPA 1NPNA 1SY6L 3VNYA 3DURA 3TWCH 5CSBA 5JHAA 2X28A 4ZUWB 5ITBH 3BHBA 1UOWA 2PXYC 3FCGA 2IEPA 5L2JA 4XO9A 2CO7B 3PGFH 4DP4X 1HSBB 3D4CA 3NIGF 2IADA 1BPVA 2WUCH 4PR5B 1BV8A 2WB7A 1M7DB 2PCFA 2YZ1A 5J12C 1XH3A 3EO0A 2OMVA 1ZSHA 2QR0B 4GW1B 4LGRB 4JN1H 4L2LA 2J6EA 2ZXAA 3ILPB 3O9WD 4NKMB 2X6AA 5EU6B 4HIHA 4V1DD 1PIFA 3V0WH 4QF1B 4Y1AA 1BQSA 3REVB 1IGMH 1GZPB 2JH2A 2ZOLA 1HILB 4X98A 3VFVB 3SDAA 1PSKL 4BSWA 4N2KA 3APDA 4OB5H 2Y7LA 4GINA 5FM4A 1M7UA 4L8SA 1MHEB 2A77H 2XZCH 5EG6C 4PGCB 5FUZL 3K2UL 3GI8H 2AQTA 3V55A 1T7WA 3VI3E 3MRGB 3WFBH 2IBGA 4PCTA 4JO8A 4JPKH 4YPJA 3D39B 4PIBA 3SJVB 4GAJL 4M6NH 1IAII 1BBJA 1OZUA 4O2EA 2NZ9D 4PLKD 5C0CD 4NYLA 3VFPA 4PWGA 3W5NA 2AJVH 2LOEA 4LQFL 4I48A 4X7DC 1H8SA 4PJEE 5ACMA 4ANXA 3AITA 3WUZA 1VFBA 2NY5L 3HLAB 4N0FB 1Z3RA 4RGMB 4X5QA 4U0RB 4ZOEA 3OKKB 1P4LB 4G7RB 4GAYA 1D5XB 1UH4A 2GUOA 4JO4L 4OLUL 2AKRB 3OKYA 4KDVA 1BWWA 3MRHB 3S34H 3U82B 2XNAA 1IVTA 3KYNB 1IBGH 4Y9CA 1C5BL 5HHMD 2D31A 1XR9B 3ESOA 3PS6A 3VFWA 2GSIA 2OW6A 2VMCA 3PREA 1OK8A 4BCXA 5KSVB 3HE7D 1AO7D 2DDQH 3QWNA 4RA0C 1Y6NR 2A9DA 1ZEAH 4JN1L 3FQUB 5HYIA 2VDNL 2J1KA 4AL8H 3EFFA 1IGCH 2CRMA 2W9EL 3HFFA 3RILA 2C4FU 3QHFL 2RFXA 4FXKC 5E2JA 1HDMA 1J9SA 1LD9B 3F5WA 4K8RL 5T5FH 2WTRA 1SOQA 3U7WH 4MXQD 4YBQC 5I17B 4J8RA 1ZA6A 1TPXB 5T5FL 3B9EA 3HRZB 1T22B 3LB6C 4WO4C 2EO7A 1A5FH 1NGYA 4O02B 4Y4KD 3FU9A 1R5WB 4FTDA 1IGCL 5DHXB 2KLSA 4JS7A 4LOFA 4ZX6A 1RIVL 4CVXB 3QEQB 3ZKSD 2J25A 2VLKD 2WQRA 3KPMB 4M7LT 4NIKB 4WHYG 4M7JL 1XD1A 2ETWA 1FL3A 2PABA 3LXAA 2XN1A 9PCYA 1F3JA 4XOBA 5DT1L 4PUBH 4BEIA 1DDHA 4Z3HA 4P3WA 4HS3B 1ES0B 5CJ8A 3F5WB 1BFOA 1NM9A 2BM3A 4J8RB 2P43B 4WENB 3SDDB 2XWBA 3BDYH 1U8OB 2FVNA 3QH3A 3FB7B 3X13B 5MERA 3AAZA 2EIJB 4L9LC 3N44B 1ACYH 2BC4B 3MGOB 2C9RA 3ATDA 1UXSA 1NC4B 1S3RA 3HUJA 5CU9A 4PYGA 5E1AB 4D0CA 3VE0B 5L2KE 1HCVA 4DUXA 3EFDL 1GTFA 4Z7NE 3RWGA 2PXYA 5C0BA 2NY0D 4OZ4B 1M3IA 2E46A 3VWJB 3K5SA 1QABA 5BZWB 2BWDA 2B3RA 3DPDA 4JO4H 3T1FB 1JF1A 4WNJA 1QI4A 2X2UA 3FH7A 2QLVB 5ALBL 5HGHB 3HPJB 1CLOH 1EDYA 4ZQTA 4JQXC 4PJ9B 2BIIA 3K7UA 1QSEA 3M1BA 4OLEA 2ADFH 3EFDH 1XH0A 3VXSD 2LVEA 3N41B 1A14L 3SKJL 3FSAA 3ARBC 1VIWA 1FJ1A 2C3XA 1WBYA 1JYNA 1KEGH 4JM2C 4XOEA 3VRLF 4OAWB 2DIAA 3ARFA 5CSGA 2R0WL 1UWGH 2VDKH 5CWSA 2BO0A 3ZT7A 3VQMA 3RP1A 5JW4Q 1VAHA 5K33A 4TNWF 1ZANL 2WGNB 2E7HA 3G5YA 4GS7B 4GP5B 4Z7OF 2A9NL 1KIPB 4XP6H 1QYGH 2MEJB 2ESVD 2NNCA 2WXIA 3QEHB 5D7LD 3ROLA 2OTUA 5E5LA 4YSDA 4JAMA 1SBBA 3ML9A 1O75A 4E9SA 5DJZA 4MJ4A 3GPEA 5A43C 4BH7B 4PV8B 4HKXB 2Y7OA 3I6KA 2I32A 2KZWA 3JYCA 2AMUA 2FECI 5JIKA 4WW2F 4L1TA 1ETZB 1VCBC 2GJ6B 2JKLA 5E7FA 1DVZA 2W59A 3EO1B 2OYLA 2LU7A 4A55A 4L5FH 3HB3C 3IDUA 3G5YB 2ZP8A 3Q5OA 2VRAA 3H85A 3DX1A 5BVPH 2QR0A 4ZMTA 1TTRA 3VGEA 3N9GH 4YX2H 3QDME 5GISL 4LCIL 1MIEL 4YEEA 1B6UA 4HIJB 1PY0A 2DBJA 3B2MA 1UADC 1V05A 2JI2A 3ARTA 3BISA 4PJGF 3VXQB 1NOAA 4FQIL 4JPVH 1I3GH 1NJ9B 2OTPA 1PX3A 1X5FA 5GJTH 2XTJD 2J43A 1U9KA 1RP9A 3F12B 3U4BL 4DP8X 1U3HC 5B39G 4MQ7A 2WO3B 4UUJA 1BFVH 1SHXA 4EZMA 4HWUA 3WIHL 5BRZE 1NPJA 3CXFA 5LWYL 4RAVB 1L6ZA 1CU4L 3BE1H 3LHAA 3QWOA 4WWKA 2ATKA 1TTAA 4XCCL 2WKOA 1BZEA 4Z7UE 1SXBA 4MTMA 2Z9TA 4OSUH 4Q97A 5IMMB 1NMBL 3G6DL 1WAAA 2I9TA 1FNSH 2EZ0C 4KMTH 1TLKA 4DAGH 4OLYL 2YMOA 4DPRA 1S7QB 3VDBA 4NRZB 4S0HA 4PJAE 4XCEB 1IRAY 2HFGL 2PMZA 4JO2L 2WCGA 4I77L 3EOTL 3CZKA 4XR8C 5I1LA 3GJFB 4MMZC 2YUVA 4PWIA 5D1XB 1T89A 3T2NH 2Y5QA 4DGWC 3RFZA 3UPRB 1FLTX 4OJYA 1NFIA 3ZTNL 3VG9C 3BAEL 1X5ZA 4ABWA 1UJ3C 4LEEA 3PPEA 4YSQA 5IF0A 3AMLA 4D0BA 5TK2A 4Q8BA 5I6MA 4YFLF 1KGXA 3B2UD 2WTRB 4KQ4L 2N7SA 4IEFB 1YMHB 2R39A 1Z9NA 3DV4B 4AH2A 1WJ3A 4WDIA 4G8GE 4M7LL 5DMIH 1JPGA 1WT5A 3HMXL 2NY0B 3JUYA 1AKJA 2FJHB 4K94H 4BINA 3L2MA 1MJ8L 2X4QA 3ECBA 4PP2B 4FLOA 1AS6A 4U1NB 1YYMH 3FTXA 5EFIA 5EF1A 2AQRA 3BVXA 2AV7A 5IIEA 4XWOD 3VXUD 2P47B 1IO4C 3B5GA 4KXBA 4RFNC 1O0VA 5DS1A 1MREL 1INQB 2XYBA 1BLIA 1NEZB 4QHLB 4YN3A 5DD5H 2OP4H 4JO5A 2IBZX 4R9HA 4LCWA 2X05A 1F90L 3K1DA 1UACL 2JCCF 2E47A 4MD0B 3S3PA 1UATA 1WFTA 5TJWK 3K71B 3QORA 1GSKA 1FO0A 3TH4T 1P5UB 4XGZA 4HZLA 2ESVB 2NX5D 1G1YA 4MAUH 5L2JB 1MDTA 1IFRA 5KTEL 2G3XA 3MV8B 1FI8C 5ERWB 3KPRE 4A6YB 4PHXA 2PR4H 2WXMA 4XC1H 4NN5C 4KI5F 4KKAC 4AENA 2CPUA 3O4LE 4JE0A 2XKSA 3LKRB 1XIWA 2K8MA 1NDMA 3MRKA 4ZUSA 2EVIA 2UXGA 1RJYA 3PNWB 3T4YB 5TQ0L 3ARFB 1A4AA 2GTZB 2O6EA 4N68A 1I9IH 2J6EH 1BOGB 1ED3A 3EJYC 4P2RB 4WEBL 5TDPA 1J05A 3MFGB 1LJMA 1R24B 2AXGB 4CC0A 3E3QE 2IDFA 5AYUH 5LGHL 1KACB 1K4DA 2BNRE 3CSGA 5D1ZI 1HH9A 4N90D 5DURD 3NBNA 2KZBA 5DTFA 1XD0A 1SM3L 4QRRA 5I1AB 1K2DA 2VR7A 3VH8B 1RZQA 3RGVA 2XWZA 4PLJC 2E9JA 5C08B 1AE6L 4F5CA 5ESAA 6PCYA 5HYJA 4HXBL 1J9TA 4EXKA 2FRGP 3NIFF 3UYRL 3NEOA 2X4PB 2QJDA 3B2UC 4H88H 4I0PB 5A16A 3MYJB 1NC4A 1PEZA 4S10A 3RGVD 3CQQA 1KYUA 3KWXA 3VI3A 3BVNB 3A47A 3GDCA 2C1OB 5DZLA 3VFWB 5MEQA 1C7SA 1U8CA 2W0FA 4LSPL 4KHXL 1TO4A 4JHAH 1SUHA 2HUEA 4AVJA 4XPHL 1ZT7A 3V7AG 4XCYB 2ICEC 1ZHBB 3L3GB 5GHWH 1EV2E 1CURA 2C9XA 5H2BB 35C8L 3BZFA 3WFCL 4WFED 1SRDA 2AZAA 1WITA 4HPOL 4NC1E 1CI5A 4NN6B 4ONFL 3QCTL 1CGSL 5D1QE 1H6FA 5JHDE 3BPCA 3ZZQA 4HA1A 4IIQC 1GHFH 1DBBH 1P4BL 2WLZA 4QMEA 3C09C 2CMRH 3BUYB 2GK0B 5JO5A 4FQHA 1NINA 1MWAB 3QRBA 3RZWA 4URKA 3ORJA 1XTLA 4L3EB 3FDWA 5F1NA 1UVQA 2EE9A 4OZIB 1D9KA 5T33L 4B41A 1J8HD 3C09B 1U21A 4CVZB 3A23A 3MAWA 2WZ6A 4ABUA 2FB4L 3KPSD 3QNXB 3AQZA 5AVWB 4YHZH 3GUFA 3RTQA 1ET8A 3TBWA 3AG3B 4JFQA 3TWCL 3BSZA 3NRFA 5I82A 3AQYA 4OGQC 2A74B 4RGOL 4KOBA 4ZW7A 3FYIB 1A25A 1OTSC 3C8KA 1RZFH 5EN2A 1D7CA 4YOKA 4FQHB 5HGAB 3VW3H 2D7PA 4JRYE 4WGKA 4WZ9A 1KEML 3HC3L 5EBMB 4Z3TA 4KRMB 2AXJA 1KJ2L 2VN3A 1AQKL 3FFDA 5JA9A 2C9PA 1SHSA 3IS0X 5IOPB 3RUGE 4LF3B 3WS6A 1TJMA 4XBPB 4B7IA 5C0CE 2WTPA 4FFZH 2E7MA 2CK2A 3X1BA 3DV4A 2OQJB 4PN6A 5DO2C 4OLXL 1SMDA 1I3UA 2NY1D 1YECL 3LTVA 3BT2L 1GYVA 5CM1A 1XF4A 2VB5A 2ZD0A 4MYWB 3FFCE 1V5JA 4NC2B 1XX9C 4JW3A 1N67A 4K3EL 5ID0A 3W82A 2NUTB 4BRVA 3GMRB 2WNWA 4MMXB 4UZGA 3S8GB 1OWWA 3MNWB 5C70A 2DM2A 4PGBB 3TBTB 1GJUA 3PL6D 2RALA 1KTLA 4WTWA 4QY8A 3X14B 1L0PA 1YEKL 3MV9E 4HUWB 4UT6H 4IS6B 5E4OA 3GIZL 3WIIL 4CVWA 2DQGL 3T8XA 2CDGB 2ZPKH 3P9MB 2WPGA 1WD8A 4X5LA 3ZKND 1EXHA 1RZ7H 1G6RB 3AU1B 4I1RA 3UBXB 2N1KA 4C54A 3H9HB 1KGYE 4TULL 4X9YA 2HP4A 2OBGA 2QQLH 4JZJC 2HKHH 3QFDA 4ENED 1R5IA 5E24E 1FVDB 1MELA 3GSNA 4WW2B 1Z5YD 2FX9L 4QTHB 3UMTA 3BDXA 2L3BA 2BWQA 1KJVA 1HKFA 3KYKH 2CCWA 2P8MB 1P4IL 5DA4A 3N41F 5CMAB 3D18B 4OF8A 2FO1A 4QRBA 1IGML 2J72A 4UAOC 4FFVD 1UD4A 2FO4B 5KN5B 5MENA 3DRTB 3BSGA 4AYSA 4PWFA 2A73B 3PQYD 2H6PB 2E6JA 1NUFA 3RWJA 1NEPA 1YUKB 2JK5A 2WYIA 2GSMB 3PP3K 2MOGA 2Y6SC 5CHNB 2X10A 2W92A 4ODBD 2HLAA 4YEFA 1KB3A 2G30A 1QA9A 1E8WA 2F18A 1YUHA 4QGTA 2Z31C 4UTBH 4ES8A 5IESL 4FERA 5E4IA 5EC2B 3B83A 4FP8H 4JANA 4AX3A 3ULAB 1NH6A 2YARA 4TQEL 4X5PA 3UTQA 4RETB 3MCLL 2WKLA 5F71A 5I0VA 1AZCA 4XNXL 1DUYA 1CFSA 1UCTA 1Q94A 2VMEA 3HS0C 2CBOA 2P44B 2PP7A 4G72B 3PWJA 3OQ3B 3IMBA 4JG1H 3MFFA 1YN7A 4WY7L 5L4IA 2Z4QA 2HB0A 4HD5A 3QJVB 3HAEG 3CFEA 2X2YA 5E70A 3MLVL 4IK6A 1YN6B 4P2OC 4YAQA 1MFCH 5D7IB 4F57H 3DJSA 3H9SE 5E0FA 3QQNA 5FO7B 4AM0B 3S2CA 4G82A 3PG2A 5BS0A 4PGDA 4DP9X 2NY2D 5F3BB 4ZO7A 4TVUA 5B3JF 4L3ED 1XL4A 1AZBA 1R1CA 3IGFA 5LB1A 4GRMA 4NUPA 3AG4B 4OY9A 5LBVA 2YAPA 4P5TD 3E0GA 1NIEA 1J1PL 3BQUC 4X5XB 4HFWA 4N0UB 3GLDA 4OGXL 1ZT1A 3RX5A 5IEHA 1F0LA 2XG4A 3GMQB 1WISA 2OL3A 2CM5A 4I2XE 4KNUA 1UFUA 3SE3A 3AY2A 1P6FA 4KK6C 3D0AA 1IL1A 1OL0A 2K3TA 3U9UB 2BH0A 4YL9A 5HI4C 3ULVD 4MCZB 4I3GA 2AI0L 3L54A 3I6GB 4LRIA 3POCA 3I9GH 3BPOB 2YAMA 2BCKB 2L7UA 1SYVA 1TCMA 2IGFH 2OJEA 2CJUH 3K6IA 3ZRSA 1JWSA 5FLVA 3C2AL 1MHEA 2PO6D 1B0RA 1QSFA 3CFMA 2OMYB 1RUPH 4HCFA 4NUGH 3IB4A 4RAUA 2A0LD 2OQJA 2JKJA 1TEYA 3GXMA 3BEWA 3B8SA 4U3SA 2D7QA 4WKXA 5KS9B 4GMSH 4M6OH 2QKSA 4X7FC 2IG2L 1JGDB 3Q13A 4H8WL 4XO3A 4JY6B 2PO6A 4KI1A 3T3MF 4ATTA 3ALWA 4KQ4H 4AG4H 3MNZA 3FU7A 3QZLA 1ASQA 1OSPL 5IQ7L 3QO1B 1I31A 5E6IA 2YLHA 3UAJD 3UJIH 2NY1B 2I85A 3ME0B 2TRHA 4HKJA 4J3OF 1KCVL 4NO2A 4JEGB 1GXEA 1Z5LA 5KJRH 3N40P 1DQJA 1XGPA 4KK5C 3TBYA 6TAAA 4F27A 4FQQA 2MHAA 5E6YA 1F4YH 1H3UA 3NJXA 4HAFA 1V3LA 2JF1A 2BHFA 3KLSA 1O6TA 3RRQA 1SEQH 1ONQA 1T4KB 2ALAA 4P57B 1IKFH 3MZTA 2FDBP 1P5UC 1Z2KA 3LZFL 4JKMA 3SDCC 2DQCH 3LKPA 3WJMB 4FQCH 3BIBX 1XGYH 1QOKA 4MQXC 4IIQB 4DGIL 4HT1H 4B53A 2OAAA 3ZKNC 1G6RA 1BZ9B 3GDBA 1K4CB 5ESAB 2UY6A 4FQPA 1SGKA 1JHLL 2XZQH 4FYQA 4OD3H 4AQEB 5E8DH 5JDJA 1CD1B 2H3KA 2W5PA 1T1XB 1SN2A 2E74C 4NO2B 1XGTB 1PZ5B 2SEBA 2V9TA 2WN2A 5BQDA 1CDHA 3U6XS 4QRSA 3MLSL 5M94B 1ZHKB 3IDGB 3N43B 2PWFA 4PJXB 4POZC 4B7LA 2A73A 1RURL 3LPPA 4M7KH 5EUKB 5LNDA 2DEWX 4PTUA 4G9FA 1AR1C 2BIMA 1TEGA 5DK0B 3SQOH 1KTBA 1E5ZA 3WTWA 1SNRA 1SDAB 4YHNA 2FYYB 3B2PA 2X89D 4OFIA 2BZ7A 2DZEA 2HSIA 1FH5H 2ZX6A 5IOKA 1G9ML 5J9PB 2VLME 3AWGA 5E8EB 5FW6A 4WHYH 3N42F 3O3UN 3VGAB 3QZBA 2Y6TE 3LPOA 3OX8A 2XQYG 3VE0A 1Y07A 3W81A 1NQBA 4UOW0 5TGBA 2IH3B 4XTRC 1U3HA 3HOGA 1B4JH 2DQTL 4XP9L 1FIEA 3OD3A 1RPUA 4YUEL 3HZKA 4G70B 4M48H 5CJQL 8FABB 1DFBL 4Z7WE 4ZUWA 1DTUA 5JIHA 2VISB 2ZT9C 1BF5A 4NNXB 3M17B 4X0KA 1ZTXL 5JMOC 3MR9B 4IGBC 3T1FA 3UC0L 3HS0A 1P7BA 3GEFA 3W0WA 2AABL 3O2DL 4JFPA 3RTQC 4OGXH 5K9QG 3C8KB 4KH2A 4I13B 5D72L 3RI5F 2D4FA 2NYZA 2R29A 5AAPA 3QIBA 1T22A 4JNXA 2G9HA 2ALWA 3B7TA 4TVPD 1AGDA 3X17A 4PRDB 2F58H 1OW0C 5I2IB 1CD9B 5CGYD 6PAZA 4EI5B 3S5ZA 4OSUL 4QXUL 5BXFB 3TESA 5I71C 4G6FD 2WC7A 1Y7VA 1CLOL 2BDNL 3WOVA 2ID5A 2VABB 2E6PA 3ZDXF 5DJ8B 1WTGT 5AW6B 2EXYC 3INUH 5TFSL 3TCLA 1FNGB 3KPPA 3ARZA 1ES0A 1MHPH 5EEWA 3NJGA 1TJIH 2JIXA 2ZUQB 1WT5C 1RPQA 2C9UA 3QORD 3CE1A 4LSQH 4L4TB 3MI6A 3U4EA 1YEDA 4XB3A 3BH8B 1N0XH 3JV4B 4HHGA 4KK8D 3GTNA 4R2GB 3QZWA 2IV9A 1D5XA 4TQEH 4AEIL 4OV5A 5FYKE 3AG2B 4MRBA 4OF5A 2DD8H 3B9KC 2CK0L 3JWNE 3SDCA 3FUJA 3G3LA 1GPOL 1D9KB 1L7IL 2ZXDA 3FU3A 4ZFOA 1WBXA 1OAYH 4LPVA 5JIIA 3EYOB 2YKLL 1FHGA 2PYFB 2EDMA 5DT1H 2HRHA 2D8KA 3V4LA 3HG1B 4PJHF 3EJUA 3JV5A 4NJ9H 4TVPL 4CU8A 4U6HB 5GSRA 3VWKB 1KLFA 5E0QA 5EIVA 4WI4A 5L88H 1KBWA 3CFUA 5BMFH 3ZTJG 3BP4B 4G6JH 1FH2A 2VXTL 3OC5A 4HBQA 2ICCA 2HJLA 5CEZE 1MNNA 5C0RH 4D0DA 4LFHG 5D1QA 3DOIA 3N06B 1XZWA 5GISH 1XWVA 2AQNA 1FRGL 2AEWA 5LDUA 2UVEA 1JJUA 4B9PA 4YDZA 1QTYT 4JFFD 1UUNA 1XR8B 1JGEB 4WW2C 2B15A 4GAGH 1SVBA 4NP4H 4YHPA 3X1EA 5D7IF 4TUKH 1SVCP 1RUQL 2J2ZB 2OZNA 2AS5M 4CRPA 5F7KC 3MUHL 4LNRA 1ZWIA 5A2LH 2OXHA 3JBG7 3SDXB 3V10A 2HLAB 4I9WE 5JOPE 1XCWA 4UNIA 2WIMA 3AZUA 3BWSA 5I15H 3SKJH 1G5GA 3FH5A 3GSVB 1R3IL 4U1SA 3ZYZA 1A3ZA 5D1XE 1AGEA 1HIMH 4XVUD 3CLEL 4Z95L 2A9NH 4UQ3B 2OJ1A 4UT6L 4W93A 3CDZB 1WRFA 5D96B 1KV3A 3ARGC 3NSCA 4Y2NA 1RK0B 4NSKB 2X09A 1CFNA 3HC4H 3KGUA 3TBTA 1SZNA 1JZ4A 4ODVL 4AMKH 3BQVA 2FECL 4MXVF 3VCLB 1XBDA 4PJ5D 3LRLA 4NQXA 5IQ9B 4GQ9H 5BRQA 2YMTA 5F0PB 3RIFF 4AL8C 4XVJH 1HFUA 1OCZB 4NGHH 5I8CA 1N10A 4N1CA 3CMGA 5F7YC 3W11C 2R2EA 4FCAA 5D5ME 2BS71 1CFTB 2FJHA 4LLAA 2FCBA 1FV1B 3AS1A 3LSOA 4XNMB 4MJ5B 4HEMA 1HHKA 2FIKA 2V2TB 3RDTB 3DIVA 3BHBB 1KF9B 5EC1B 2Z91B 2GSGB 1MY5A 2AV7B 3ATAA 3M1BB 2OYPA 1K5WA 1I3GL 1PLCA 4ZRGA 3K4ZA 2ZG1A 4RQQB 2XOTA 4DZBA 3P3UA 3EG9B 4ERSL 3LVEA 2H32H 2VDML 2B4CH 1MCSA 1TVHA 2FT8A 5J7CC 1DDTA 3KLAA 1FG2B 4MD0A 3VNZA 1N12A 3SCMB 1T0MA 1T4KA 4P57A 2ISDA 3CVHA 4OCYH 1BDYA 5C8JA 4R7DB 3GB7A 5HJDA 4ZFQA 1G7JB 4Y1AD 1DVFB 4KHTL 5D7JA 4Y1TA 5ICZB 5FGBA 1CDJA 4JGUA 2WP3O 1T83A 2UX6A 5E6UB 3VXOA 5C0GB 2VLLB 4MAYA 1MZZA 4X42A 3MRCB 1RZFL 3OR6B 3VXRE 3CXHJ 3H42H 4J6RH 3GBNH 2NRDA 2YSSA 1LGVA 4G8AC 4BD4A 3OPUA 2IAMB 1HWHB 3N1FC 4MJ6A 1HXKA 2KL6A 4UNVA 4ICWA 5EN3A 1M3JA 4PP1D 5T5FA 1JWSB 1TQUA 1DQLL 1LLAA 4P2RE 3RVVD 4AH2B 4AQ1A 4YGVA 3DKHA 1YPZF 3WEAA 3QDMA 3WD5H 2XN0A 5BOJA 4NKDB 5GS0H 2XRAH 4GYBA 1IC5H 3SYQA 1AXTH 3PL6A 4YK4B 4N8UA 3VTAA 1JI1A 1Q9WA 5DC4B 2MKLC 2DQJH 1OAZH 1BYPA 2DQEH 3LN4A 1A1MA 1YMMA 2ARWA 2Y22A 2CBMA 5FGSA 1RZPA 3VD5A 5CN3A 2D7TL 3BVNA 2A9BA 4ORGB 4UM8B 4C56A 4GRWE 3BUDA 3OGCA 2ZSWB 5I1JL 4WI6A 5MP6L 4LSVH 1UWEL 4H0LC 1XSOA 2ENQA 3B3BA 1TJGH 2OX5A 3RPBA 2NDFA 5M95B 3ATBA 4KI5C 2GIXA 4X6EA 5A3IC 3BT2H 2ADJB 1Z9LA 4XCYA 2Y5EA 4AVKA 1RUQH 3HLAA 1WZ1H 3LH9A 3DSFL 5CBAA 3GMOA 1FSKB 2BNRD 1UKTA 4JZJA 1F41A 3Q8FA 4EIBA 1ZLWK 1HHHA 2GT9A 2OI9B 1MWOA 2E8YA 4UOJA 3LKRA 4GXFA 4HISA 3QJRB 4Z6AT 3GNMH 4HIPA 5IJKC 1GOGA 1JD9A 1JN6B 5FYLL 2V2WA 3LZRA 4LNRB 2APTA 3II3A 2EYRB 4FXTA 4IRZH 1N9PA 3BFWA 3KWWA 4KJYA 2HT3C 5DQ9B 4HLZG 4WF7A 2Y3AA 2QT6A 1NGZB 2GJZB 4DKEH 2W8CA 4QUOA 4M8UA 2FZ3B 5F9JB 3AW5A 1KTDB 3BKJH 3SYPA 1WFOA 3RUGA 3TJHD 5JPMB 3FU8A 3A6CH 2G4EA 1BM3H 4OTXH 5T1LB 1T66C 1EGJL 1KCLA 1HSAA 5D2NA 5M7QA 1UXMA 4PG9A 3WSQL 4TNWK 4UNTA 3QRLA 3MCG1 2EDEA 3IGLA 5AW1B 4UZUA 5HXMA 1GMEA 2DDQL 2APFA 3LNHA 4G9FE 4QHLA 4TSBL 5F96H 1NCWL 4HJGB 1RSYA 1INQA 3H6AA 4JKWA 1LVEA 4S0SD 3VXSA 5DVNA 2ODIA 3ABKB 3I9PA 3RWJB 1YNTA 4NCDA 3RWIB 4CUCA 2F6AA 1YYML 1MJ8H 5GSRB 1JGUL 4YX2L 1IM3A 2BNQA 4HHAB 2J88H 4R2GC 2AJVL 4LQFH 5C0AA 2EDNA 3WTSA 1E27B 1SQ2N 4GKSB 4NBYB 3V5DB 1YEFH 4HJJH 4PJCA 5FO2A 2XIDA 1SJEA 1U8QA 1UA6L 2BP5M 3KPRA 4KTEL 5AW4B 1EFXB 1WHOA 4IRZL 3WIAA 4XHJC 5IVNA 1NCAL 2OULB 1D7FA 4PJFB 4ZS6D 2ZCKL 4DP5X 2MRYA 3H9HA 5IB5B 4FNUA 4HUWA 1KC5H 2OV0A 2QKIA 3MSPA 1EBPA 3S3JA 3ZHFA 2HCZX 1KCVH 2YLKA 3MUZ1 4D94A 4OLWH 4P06A 4Z78A 1RMFL 2X9XA 1QI3A 2KLRA 1YVLA 4F15B 2ORBL 1DVFA 1GR7A 3KPQB 3HE7C 4HF5L 1TOXA 2HFEB 2XHNA 5LQBH 2X4SA 1DVXA 3IFNH 2YD6A 1IT9L 5CLXA 1U8PA 3D18A 4KKBD 3BKCL 2W0LA 2F2HA 3SKMA 1CFQA 5KN5A 1PEWA 3BC9A 1RZIB 3WU1A 3RIAK 1JZIA 2XKNA 3QEUB 2ENYA 1B0GA 1YY8B 3BH8A 2KBGA 3LB6D 4QHUA 4WO4D 1XMEB 3EF7A 3V4PH 3FTGA 1IM9A 2Q7YB 2J3SA 5D4QA 4AQ1B 4UT9H 1EEZB 4CSPA 3STLA 1D2OA 2DY2A 4RGNE 5DJ6B 2WXQA 3VD3A 3ULUC 4RX4A 2VR4A 3ZIMA 1HH6A 3NZHH 4YHKH 4QDGA 1B2WH 2BHYA 4WO0A 1ID2A 5PCYA 4Y4HB 3V6ZA 1USZA 1KLGB 2J1XA 4NAQA 5JR1H 3A24A 3Q6GL 4FMFA 5DEZA 5F1KC 4R97B 1L7IH 4NPYB 4PV9B 2RR3A 5CD3B 1BG1A 3ZE0E 1MQ8A 1Q0YH 2D3LA 2Y69B 3N85L 3S37H 3FO9B 4JCLA 2G9HB 4JFZL 4WSGA 2H0EA 3L5WA 2I5YL 3LV3A 4HS6A 3B6SA 4X6CF 2D2OA 3SDYH 3B9KB 4E9TA 3COOA 3VRJB 2YPLB 1JGLH 2XWXA 1PS3A 1XR9A 4HYTB 3DVNA 3EYFA 4OF6A 4N2FA 3NSFA 1TSHA 3SDDD 3NCEB 1Q4NX 2ARJQ 4BFJA 1KJ3L 1UVQB 5FYLH 5FC9A 1JI2A 5DJXA 3RVTD 1MCKA 3FC8A 1AO7E 1RUML 2X4OA 3CDFA 5AUMA 4X2UA 4E5XA 5BOZG 3L1OL 2HLFD 4ZW6A 2XIIA 1P0SE 4KDTA 4FAAB 3WNLA 3FT0A 1CWVA 2DF3A 3DUSB 4EVNB 4J3BA 5D4HA 1LO3L 1IBBA 1JAEA 1IAOB 3TP4A 2X12A 1SY6A 4N0UA 5D72H 1HE8A 1OB0A 4HEPA 4RIRB 3SE9L 3HC0B 4BE5A 3PV6B 3QWRD 3GXDA 5D6CA 2ZNWA 1SQMA 1T3FB 4LIQL 3GHBL 4BFEA 4MB3A 1HHJB 2D9CA 3W57A 2FX8L 3BGMA 4JM2B 1MW1A 1J48A 3G5ZB 2F54A 5ENWA 1YEHL 4E36A 4A38A 2PTTB 3RX8A 3ZYIA 3QPKA 1NC2A 2OMXB 3X13A 2DAVA 4X6DB 1PL3A 4XVJL 5MEPB 1MW3A 5IWLA 4GW4B 5HPMB 1QFOA 2NX5A 3VGGA 2F54D 4GPVA 4Z3FA 2VLJE 3C08L 1QR1B 3C9NA 4GEJA 1URLA 3TZVD 5I1JH 2HT2D 1KBKA 3C6LC 3HS8A 3QRFM 3UOAB 4PRAA 2WO4A 5DUMH 3T4YA 3VFOB 5F3HA 3QUYC 2W94A 3O11A 4LLQA 4MVBD 2K0RA 3TA3A 5C2BL 4Z95H 3EUDA 1VENA 4ICXA 3HPJA 4MCYA 3HEIB 4N4YB 3VD2A 1CF8L 2WB1A 5G5DB 4JREB 4PUBL 2CKBB 5HHPB 5CR1A 2O6CA 4JPVL 3WN5C 1OAZL 5I6PA 4F1ZA 1EFXA 5I1IL 2NW3B 1DSFL 1TEFA 1WCQA 3RWEB 4PMEA 5AG9A 1QO3A 1CQYA 1I1AC 2AJUH 3FT2A 1X7TA 2FJGA 4JGNA 1T83C 4FZ8H 4OQTH 3V9CA 3L1FA 4XPFL 5DXWA 1MSPA 2ZCHL 5E08H 4KZEH 4XAWH 1NGYB 1NMCC 2JIXD 4U1LB 2E4FA 4NFCA 4Y7MA 2JK5B 3QG7L 5DZVA 3CG8A 4JDEB 1H5BC 3HAEB 3HG4A 3GLZA 3T0EE 4U6TA 4W6YB 1WIOA 2DQGH 4K3HA 2FO4A 4P59H 2XTJB 4JFXA 3C5SA 1WWCA 1UXLA 2FT6A 1XB8A 3ASWA 2ZQKA 3LNDA 4LCYB 4QRTA 4CKQA 4ELMB 2BK8A 3QC5X 5AKVA 3L3JA 3O3EB 4JJOA 1JZFA 3B9AA 3EGXB 4PWKA 4PJIE 3QFJE 1T6WA 4FQCL 4WCYH 5FDWA 2V3EA 3QR0A 4X6CE 1EEYA 4Z77A 3GBDA 3GSWA 5HDLA 1EZLA 5HYSG 4OVVA 1T04B 5F9DC 2QZ5A 1DN0B 3TEZA 4IBSA 4WHDA 1GGUA 4YR6B 5EPMB 5FYLD 4MJHA 1QA9B 1IBGL 2VXQL 4NYLB 1QYGL 2DM3A 4V1DA 5BVJA 1J0JA 3MOBH 5E1HB 1S7RB 3PWJB 5I0YA 1P84K 2CUAA 3Q48A 1S3KL 4QRTB 2CALA 5HVHB 3DJTA 5IK3B 4U3HA 1DUYB 5JORA 3H7BB 1A64A 2OSXA 2XZZA 5J9PA 4MNHB 2UZXB 3NA4A 1UD8A 4PRIB 4UIMB 4G3YH 1ACCA 2CE6A 3MRRA 4YHNB 1BLNB 4RRPM 4PJBF 4XPGH 4Y5VB 5HGDA 4OJFL 4KROB 4DCQB 1F11A 5DUML 3TYGL 2P5ED 3EXLA 5E9DD 4EN3D 1EAQA 2DM4A 4QYAA 2NPLX 4BA8A 4K0OA 3GMOB 4DIXA 3QUZC 1GZPA 2ZOLB 3QJZA 4IU2B 4RESB 5DHMC 1OKEA 4KNTA 3RY6A 2EYRA 4PS3A 2XX0A 2OSYA 1WG3A 1I53A 1KYDA 2HVJB 5DJ0A 2PYEB 3CK0H 3WFBL 5DQ9A 5F72S 2XXGA 2VITA 4UQAA 3O6FD 5KVGL 3ZZSA 2H47C 2XBTA 3CXDH 4Q14A 2EILB 5A3ID 4G7VH 1L7TH 2KMWA 1NPUA 3TT1H 3KJ6L 1HHIB 1QD0A 1S7VB 2W81C 3E38A 4RZKA 3FFCB 1EHNA 1A1MB 4U1JA 1O9VA 2R1XB 5FA3A 3MRFB 1MLBB 1ZTXH 2E7BA 4IOIB 2IFFH 2WXHA 1JHTA 1REIA 3GD1C 4WK0B 3N40F 5ISZB 3NAAH 3HC0A 4P46A 2F7RA 1BVZA 1UG9A 4U2YA 3T0VA 4F33B 3CAFA 5EHFA 4B3VA 4CDHA 1NCTA 5D1ZC 4AWJC 1KCSL 1E5UI 2R0ZH 4Y4KA 2DH3A 2ZWNA 2Z7YA 4G8IB 4JG0L 4G1MA 3Q05A 1KTRL 2WD0A 1I8IB 1YEHH 3HFML 1FRGH 2YEQA 1NBQA 2AGJH 4JFWA 2Y0SA 2QGEA 3QI9A 5L8LB 2W9EH 1CG9A 3LQAC 4L1DA 3VFNB 2HT4C 3BEWB 3TN0C 3S97C 2OK0L 1DLFL 1MCWW 1J8HE 4FQXB 4RAUB 4ZBJA 2WO2B 4P04A 4ZQKA 1VKXA 2X4RA 2OMXA 3JV6A 1OIOA 1KCUH 2F54B 3HNVL 5ENWB 2QVIA 3W37A 1EJFA 1U93A 4KXZH 5JW4N 4LEXH 1KG0B 2YEVB 4P2CG 1N6VA 5J57B 4N6RB 3TNMB 3CFBB 5IESH 3ARDB 2Y1AA 2DEXX 1FP5A 2MHAB 4KC3B 4FXGA 1QUNA 1RZGA 2P45B 5IG7B 4HJUA 4P4KA 3HR6A 3OBAA 5F7UA 1AHWB 1UYWL 4WFFD 5GS1A 3HR5A 4UT7L 3S6CA 4PJEF 3PFQA 1JV2B 2GJ6D 2X38A 3LX9A 1PZAA 2VMFA 5DMGC 5B1JC 1B2WL 4TQ8A 3UTTD 1A6AA 1WAEA 2VQUA 3LMJL 3K74B 1W8EA 1KTJA 5AD0B 3ETSA 3TURA 4L8CA 5HDWA 3DOHA 1AJ7H 4HJ0D 3TNNA 3V5KB 1ADQA 4Y4FD 3VI4B 2P80A 1TO5A 3T2PA 3NGBC 2UY6B 2QADC 4AY0A 1UGNA 1AO7A 3AQXA 4H26B 4KO9A 1ZIBA 1AI1H 5CLYA 4LEBA 1ACXA 2AP2A 5C09B 3P4NA 5JUEH 5E5RB 1I1CA 3IN2A 1UACH 4XXCA 3MUUA 4NQCB 2GB2A 1DUZB 4TL5A 4TQPA 3HIZA 2Q3ZA 4KX7A 4B97A 3WLBA 4LCVA 4NP4L 4F9PC 3HE6D 3MNMA 5HDBF 3F6IA 1QZNA 3WJLC 5LGJB