1O5PA

Solution structure of holo-neocarzinostatin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
b'AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neocarzinostatin
publication title Solution NMR Structure Investigation for Releasing Mechanism of Neocarzinostatin Chromophore from the Holoprotein
pubmed doi rcsb
molecule tags Antibiotic
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1o5pA00
1NCOA 2G0KA 4JW3A 1J5IA 2CBQA 2MCMA 1HZLA 2CBTA 1O5PA 1NOAA 2CBMA 2CBOA 1J5HA 1J48A 2G0LA 1HZKA 1ACXA 1AKPA
chains in the Genus database with same CATH superfamily
4NQXA 4X5WA 2A0LC 4OJYA 4QXTB 4JFDD 1BBDH 5GISH 1JZ2A 1GC1L 2ICES 5LGYA 5IR1B 5AKTA 1KCUL 3IE9A 3TFKD 1K85A 2DDQH 1DZ0A 2YO3A 1YEGH 4X6DF 1MCWM 2VUKA 3SDCB 5JDSB 4JPWH 1YQVH 1MWAA 3OD3A 1U9KA 5FFGA 2CKNA 2NUPB 5JO5B 3H7BA 2LU3A 4J6RH 3IGAA 3MV8D 1G0XA 5ETUB 2XA8H 2GIXA 2PXYA 4WFGD 4XCFH 3GLAA 3GZOA 1G9HA 1BZ7B 3IF1B 2BINA 3IDIB 1PKQA 2TRYA 5FX3A 1BBJA 3X13A 3BVNB 1HVXA 2JCWA 4OFDA 1I3GL 1JHKH 2XI9A 1L6PA 1U30A 2TSBA 4RFEA 1R34A 3C60A 1N3NB 4OZGF 5FYKD 1EO8H 1BXAA 3EFFB 4QEGA 3KYMB 4LBEA 5J0BA 3BVTA 5IOPB 3BAIA 2FZ3B 3GSOB 1NMCB 3ZZQA 1CE1L 4JFZL 4XCNB 1JV2B 2F5BL 2Q7NA 5D6DC 2E7HA 3GHPA 1FI8C 3TVMD 3L4XA 5DVNA 3IE4A 4XNYL 4GBXB 1MCOH 5D1XE 5DJZB 1N2RB 4Y16D 1PLGH 4F15B 2BRRL 2CRYA 2HX7A 5F7EL 5F7YC 4L8BB 1RUQH 3FU9A 1R75A 2DI9A 1R3JA 5FDWB 1SJHA 1Y18B 5IF0B 2IGTA 3MBEA 2HT4C 4OGXH 3V8CA 5A2JH 2XN9A 2D2CC 4YH6A 2A4EA 1X44A 2E8ZA 5F1SA 1AP2B 3FB7B 1EBPA 1YMMA 4LVNC 4MCYA 5AG8A 4ZW8A 5E9DB 4ONHA 1NPJA 3O2VL 5DJ8B 4N2CA 3DGGB 2YGOA 5D7IF 3ZSTA 2R4RL 2Y7MA 5HYQA 2VLJE 5I66B 4ZO7A 4HC1L 1NMAH 4YK4B 3SYQA 1CGTA 4TSCL 4LRNL 1PDKA 3PWPD 1K3IA 3NJMA 3DMMB 4K23H 1I8AA 4G9FB 2MCPH 3VGFA 3NP3A 3B3IB 4BSJA 2K6WA 3FUJA 2NXYC 3IETA 4ELKB 2DJMA 3SCMA 2WTOA 4PG2A 4JRXB 5TDNB 4NPJA 4JDTH 3ARFC 1DVFC 3DLQR 3BSZH 2XKUA 3MSPA 4UV7H 3HI6L 5I18L 1P7HL 3T09A 2OSWA 2B39A 5C9JB 1GRWA 4WWKD 3FOMA 4QRFA 2KH2B 4TQPA 5MEPA 2R9HD 4XPTH 2EEAA 5CINL 4L37B 1HHHA 5DVKA 1J10A 3MQIA 4I0PB 2H3NB 5JR1H 3SDAB 1ZVSA 3LDBB 5IW6B 4AEFA 1QQDB 4MX7B 3HC0B 3UAJD 4W4OC 2WBXA 1TJMA 1KJ3L 4AH2B 3PAYA 2C3HA 1MCIA 2ADGB 3QZWA 4JY6B 1KYAA 4PJBA 2MQGA 3H4HA 3K2UL 2CJ3A 1TCRA 2CG9X 1AC6A 4JFFB 4ZUTA 2BIOA 3DURB 1G7HB 2P8LA 4YZFF 4YFDB 3TNMB 4YDMA 1RK0B 5D4IA 4HMCA 3VXUB 2XJKA 1SDDB 1T0MB 3EUDA 4ZUWA 1KGJA 4QRTA 4OT1L 3GM0A 1F4WH 4XXCA 3I85A 4N0RA 4NEHB 3F8UB 1HDMB 1S7VB 4MB4A 1FG9C 2JLPA 5E08L 2VDLB 5L2JB 4QXVA 3U25A 3RAJL 2VRKA 4LZKA 3ARGD 3AWFA 3EBIA 1TZOA 5G4NA 3B6SA 3X1GA 4R6UA 5GIRB 5I0YA 3DJ9A 4LNRA 4OLZH 4AJWA 5T5FA 5K33A 3V52L 2XBTA 4EZMA 3NESA 2PPFA 3C75A 3H3BC 2CUAA 4FCAA 4LXFA 3TT1L 4A2EA 1TTFA 5MERA 5I6OA 4LSVH 3IDYB 5AZUA 3QO1A 3EO0B 3STZA 4XMXA 1KCRL 3L3JA 4L4TB 1H5BB 4LO9A 3RUGA 2CLRB 1JE6A 4GUPB 3QQDB 5EA0L 3RWCB 1EFXB 3BP5A 2OX5B 3MRPA 3ISRA 5AVZB 2DWEA 4Y4KD 2X4SA 3DK2A 1I1AA 3MUJA 2QADD 4MMZC 1CCZA 2MNWA 1PZDA 4K5OA 4OQ1A 1RZGB 1EAQA 2Z65C 1ASPA 2B1HH 4KMTL 2B77A 3HRZB 2HH0H 5AVUB 4BCXA 2BWQA 4KZCA 5I16A 1AXSB 4PI0A 5GISL 1VZHA 4G2AA 4K9EH 1PFCA 1XCXA 5CBEA 5DJYB 5KG9B 3GI8H 3MX0B 3UO1H 3I75B 4YJZL 4MDIA 1NFIA 2DDQL 1CXFA 1YEGL 4PJHE 4F7EB 5HYSB 4JEGB 4JPWL 3T8MA 4G7RB 1YQVL 1RSFA 5C3TA 4KKBD 1WISA 3VWJD 4K7PY 3ZX1A 2UVEA 1JK8B 1JPST 4J6RL 4BD4A 2F8OA 1QEWB 4D0CB 2PWEA 4N2GA 2D7MA 3SYOA 3V4VH 2WMPB 2XN9E 5LGJB 3HKZA 2BIPA 1OAQH 1XGUB 4PJFF 1YMME 5D1QB 5HDRA 4BKSC 3M86A 2XG5A 2CJUH 1ZA3A 1TMQA 3W37A 3ARUA 3HR5B 1JHKL 4EI5D 1F2QA 1GGUA 4XN9A 1NAMH 3IDJB 3V79C 3BKYH 5CJ8A 5F1NB 4C56B 3OJDB 4WK0B 4YOKA 1EO8L 1SXNA 2G9HA 3KNBB 3V6OC 2J25A 5TD4A 4K7PX 1HU8A 1R4XA 2CCVA 5HHVH 1KCSH 1ZPLA 2V0AA 4HCFA 1UH2A 1RUAH 5D96B 5KEZA 1RULH 4BE5A 5JIMA 3LD8B 1HHJB 4DETA 2PR4H 2VISA 3NRQA 2ZYHA 2H0FA 1MCOL 3K6FA 4LOVA 4Z7WB 4G8IA 1PLGL 3H4FA 3D8MA 3KL0A 4HJGB 3RWIA 2R15A 1RUQL 1YPZB 1N0LA 3L08A 4N0YH 1FNHA 4FABH 2A6IA 4NO0A 3EJYC 2CR3A 1CE6A 1NDTA 4OGXL 2VW7A 1KXHA 2RMNA 3RVXD 3F5WB 3MRCB 1UB6A 2GC7C 4ZT1A 4NQCD 4FMVA 3Q06A 2CBQA 3WNIA 4RZCB 4QYOB 1BVKA 1LEGB 2OW7A 2YMXH 3QXWA 5M94B 2X2HA 2DM4A 3GIVA 1NMAL 2LAAA 4V1DB 4X99A 2PP9A 4R7LA 3QA3B 5FM5O 3NCFB 4K9EC 5F70A 4PJBE 4TVPL 3WEBA 3HE7A 1P84K 4K23L 3W56A 4FHBD 2QSCH 2M8XA 2YD2A 5I6NA 7PCYA 3N1PC 1WA1X 4N0UB 1F6LL 1QFWI 1AS6A 1YYCA 3UDWA 5EIIB 1BJ8A 1E3XA 4JRWA 5E56A 3W57A 4JDTL 2Q2EB 1MWAH 3DPBB 3OSVA 3BSZL 2G75B 4WK4B 3NJNA 4JS7A 3WFCH 3OTTA 5DUMH 5BZWA 4K8RL 1YA5A 1VFBA 3BD3A 4PJAA 4DHLA 4XPTL 4GB9A 3T3MF 1QSEE 2B5IC 5G55A 2CE6A 1GCYA 4D0DA 5JR1L 5DSCA 4EZKA 1BQHB 5E94A 3G08B 3AABA 3MRKA 3RPBA 2R0KH 2ZKHH 1ORSA 2FT8A 3QUGA 3RRQA 2RA1A 3P30H 5J6GB 1ERNA 4X9FA 3MN8A 3DYMA 5FUZH 2LTQB 4AQ8C 1HXKA 1ACZA 4ZQKA 4BWTA 2X4TB 1I8MB 1FVDA 3OVUB 1HH9B 3BQUB 5FECB 2HA1A 2UZXA 3OV6A 3BP4A 2EDKA 3S0PA 2NSMA 3CSFA 1INQB 5HI5C 3B9DA 3IMTA 3WGVB 4TQ8A 4XHJC 2MIZA 3HBQA 4UQIM 5DI8A 5CFAA 3LEYH 2XYCA 2NYYC 3KH3A 1URLA 3T4YA 3GKZA 4QOKD 2R1WB 1MDAA 3Q5TA 2ZX9A 1WSST 3FO9A 1DDHA 4B96A 1QD0A 1JCVA 1ZJBA 2QR0B 4P57A 3D51A 1RUKH 1AACA 1AGEA 2A9MH 4YAQA 5FYLE 1OY3B 3E6HA 1R5IB 1TTGA 2GJ6B 3TTSA 2GBTA 3ZDWA 3GMRB 2XETA 4PJIA 4K4KA 5F9JA 4H5SB 4C55A 4M4RB 3AS2A 4XNMA 4LEXH 5ESVB 1DO6A 3UAFA 1O5DT 3L6FB 3O11B 4N0FB 3D18B 4L9DA 4UU9B 4GH7B 4FTVD 1U8NA 4OF3A 2NY6D 3GSUB 1VACA 2V7NB 1BOGB 2IADA 3VMPA 2BZCA 4N3UA 4NSKA 4HOWA 4AKOA 1MOEA 4DK3A 5K9OA 4BZ2A 5EWIH 4Q8BA 5DC0A 2HPTA 4X0KB 4OLYL 5C6TH 1ZTMA 2B1HL 5E8EA 5T1MB 1UASA 2HH0L 2MHAB 2PXYC 4D3CL 5GZOD 1DUYB 3IAGC 4KXCA 2Y7LA 1RUPH 4K9EL 1T5XB 3V7AG 3Q3GB 4ONFH 3EXJA 5ACMA 3L48A 3GI8L 5EOTB 2UXTA 3HZMA 5D7JD 5INCB 2ESVA 5ITFB 1MKFA 3GLDA 5I1KL 1WC7A 3P4MA 4JKWA 4MA1C 2ENSA 1WPCA 1NEZG 3C60C 4ZUVA 4HIEA 4PJXF 3P77A 4D9QD 4Z76A 4G6MH 9PCYA 5DS8B 1T1YA 4N5EC 3KLQA 4LCWA 5F7LB 1DBAL 1XBRA 4UILL 4FXGA 5B1AB 3QWRA 3V4VL 1E9PB 4IHOA 5BZDA 5FM4A 1OAQL 2EAEA 3MRFA 3BH9B 4FXKA 2XFXA 4EI6B 5AB2A 1EHLH 5BS0D 1RD6A 2CJUL 2O26U 5F9WC 4R97C 1NAML 2BSTB 4Y19A 3BKYL 3FRUA 1YEIH 1YN7B 3MBEC 4MQXC 1I8KB 1U8CA 4U7SA 5EMYA 1W8EA 1UWFA 2ZX7A 2HVKA 4CC4A 4KRPC 5HHVL 1KCSL 3KBHE 2X6AA 3LPFA 2WSDA 4BK4A 1JFQL 5DZ9A 1GVIA 2IPKA 1U8OB 3JXAA 1PG7W 1RULL 3MUZ1 2PR4L 1NSNH 2YJLA 4Y4FD 1XGPB 5T5FH 2EC9U 2F7RA 3DX6A 2BY2A 2IWFA 4FYRA 1VGKB 4JDEB 4N0YL 2WLZA 4XCEB 3SKNB 2X41A 4FABL 5C0DB 3HN5A 1KLUB 1MVFA 3E6FB 3LQZB 5F6IC 1FFNB 2ITDB 3VDBA 2XTJB 5F0JB 2FX7H 1MJUH 1Q9KB 1Q8MA 2W1NA 4JREC 1NMBH 3OXRA 4PJAE 4U6YA 2X4UB 2BW5A 2I5YH 2KS0A 2ZOOA 3FBKA 3SCMC 3ABGA 1JK9A 1UC6A 1XCQB 2EDMA 3IYLW 4PG2C 3FCTB 2XXCB 3G5ZB 3QEQB 3PL6D 3OQ3B 2VDQH 2YMXL 5LB1A 2R69A 2VR7A 1TJGH 3NFPB 1E27B 5JHDD 1U8HA 3VXOB 1ZT7B 1WDAA 1M7IB 3WLWD 3VXSD 3VD5A 1BX2A 1A6ZA 2QSCL 2QJDA 3WEOA 5I2IA 5FYLH 3UG4A 4XBPB 2RQEA 1AR1D 2AXGA 4EIUA 1CYXA 1HL8A 4XBGB 2CPCA 2YD8A 1XD0A 2EZ0D 4WGKA 2XXFA 4YXKH 5CZVH 1SMAA 4P3CH 1YZZA 1JN6A 3EOAA 4X6CE 5FA3A 1WFOA 2Z9TA 4M9PA 2EDXA 4ZFFB 2NNAA 5IVXE 5CEZD 3WTSA 3WFCL 5DUML 2ZUVA 4L8SA 2Y69B 4RQQA 2EO1A 4ODWB 1ZLEA 4KQ0A 1S7WA 4JFEB 4TUJB 5EOQH 2KDGA 4NNXA 1CVRA 3RDTA 3ZHLA 4ES9A 2VLKB 1IO4C 1YMHA 3FU6A 4U1MA 1GSMA 2BCMA 1CBJA 2BIQA 1HSAB 2P8PB 2WINB 3BI9X 4I4WB 5GSVA 4MMXB 3CVHA 1QLRB 4XXCC 1AKJD 4KROB 5JNYA 3VQ2C 3L9RB 4Y5XA 3UACA 4ZX4A 4PJIE 4HPOL 4N2HA 5FGBA 4PRNA 3HZYB 4GFXA 1NGWA 3QUXB 3P30L 2AF2A 4JVWA 3B3BA 5A2BA 3BJLA 3DX8A 3LNGA 1V7ML 3OAZK 2NR6D 2J8UA 5E4OA 2YEZB 1IJ9A 3CSTA 4JAMA 2N7SA 3LVEA 4HS3A 4E5XA 1JZ5A 2IBZY 3SGDH 2FIRT 4HIXH 3X1FA 4DZBB 1YHPA 1O6SB 3BAEH 4OZHA 3RTQA 1LHZA 3LEYL 3LPGA 4OCWH 2KPWA 2LV4A 4UTBA 1G7PA 2CBTA 4KJPC 1ZY9A 2GSIB 4M8QB 5IEHB 3LKRB 4B9GA 1RUKL 4UOZA 2V6HA 4JHBA 4YFLF 2A9ML 2IDTA 4M6OH 1J5IA 3VMOA 1MAMH 1I1AC 2DQ6A 5L2KB 3PNWA 3ASWA 4UIMB 1IV8A 2X53A 2VZ3A 2IBZX 3MUUA 1UXLA 4LEXL 3KPQA 1BAFH 1VHPA 4LCWE 2X3AA 4OFPA 5KANI 1ZS2A 3OC5A 3QORA 3BESR 4TNFA 5AW1B 5IB5B 2WLNA 1A9BA 5BZZA 1NFDA 4IOIA 3O3UN 1KN2L 3KXFB 4CJ1A 5F9OH 5HDBB 3ETBJ 3A6BH 3AG2B 4EZLA 3FONB 4JN1H 1IEBA 3GS0A 2YPLA 1UJ3B 2H26B 6PCYA 2GJZB 2ED8A 4NUGH 3NIGE 3V0EA 5DD0H 5IVZB 3AY2A 3LKNB 5JLZB 5C6TL 4Y19E 5DO2D 5JW4R 1M2VA 1IM9A 1O7VA 3LN5B 5T3XE 3J7HA 5IQ7H 2UXVA 3AC0A 2OMYA 1RUPL 2W65A 3O3EB 4ONFL 5HI4D 1B3JA 1OGAA 4XX5A 5I8EA 4EUPA 4PTUA 5EU3B 2WZPD 2NX5D 1S7TB 3C9NB 3W81A 1WD9A 2WQXA 4CN6A 1ET7A 2A6KA 4YC2C 4UINH 3ARDB 4UOJA 2IGLA 2ZUWA 1SXAA 1N64H 2BWDA 3CFNA 3FQXA 4EDXB 4HX1A 4G6ML 1KB5B 4NRZB 1FL3B 3MOAH 3FQ2A 2WVTA 5FK9A 5HHME 5I9QB 2VM3A 3VGDA 3PPEA 5DC4B 3CFUA 4M5ZH 2H8PB 4ZW7A 2VM9A 4K15A 2DJSA 2EEXA 1PY0A 3S3PA 3HW7A 2FBOJ 1EHLL 1ZLDA 4M1DH 4O51A 3UAEA 1ZRUA 4NKOB 1G7JB 3L95B 3STBA 4ACPA 1UYWH 3MJ7B 2E6PA 1YEIL 2D31A 1AGFB 3MLZH 5IB1A 3NK3A 3U36A 1OCRB 4OZFG 4Y4HD 1JPSH 4C4BA 2KPNA 3GKWH 1KPVA 2QLYA 3KPSA 2ZSWA 2H2PC 3ZE2B 4JRYE 3KYKH 3HPLA 4R9HA 2FSEB 3UABA 1JTOA 3P0VH 1AZVA 4PW9A 4LOEA 1NSNL 5T5FL 1IBZA 3OR7B 4FJ6A 2NW2A 5DD6B 1PW3A 4MCZB 4MXQC 4TULH 5I6KA 2L8AA 3WNKA 3NRPA 2A6JA 3KCPA 3L3KB 3FRPB 5E8NB 3ZE0E 3UPRB 3HE7C 4DESA 1MJUL 4QXTA 1V3MA 3KW8A 3V4UH 4CU6A 1NMBL 5HVFB 1AS8A 3E3QC 5J57B 3S37L 3KD4A 4PJ7B 2MQCA 1JV5B 5IR1A 5SWZD 2WCGA 2I5YL 1KCWA 1DVXA 4M61B 1UWEH 3UDWC 2WWOA 1GS7A 3IAQA 3SDCA 5JDSA 1QW9A 1EANA 4P5TB 2VDQL 4QJ4B 3B2VL 4FG4A 4IRJD 2NUPA 4BZ2H 1TJGL 5JO5A 4P3DB 3GXIA 1L6XA 5ETUA 3WN5B 2ZCHH 4K3GA 3EYQC 3GRBA 3H9YA 4OLWH 1SVBA 5AENA 1K5WA 3PYCA 2JLLA 4JGNA 3G5YB 4N2KA 1JDAA 3IXAB 1OP3H 3IRPX 5EU7C 1BZ7A 1ECYA 1LYQA 1T66D 3IF1A 1QBLH 3IDIA 4OFVA 3VXPB 2J8UE 5BQDA 4AUYA 3BVNA 4YXKL 4MS8D 4C59B 2OS7A 5CZVL 2I26N 3VXRB 4P3CL 4AZUA 5GHWH 4BFEA 2BY3A 2R59A 2H47C 4RWYH 4F57H 3BO8B 1N3NA 4KI5C 3B34A 2YD3A 4Q7DA 3EFFA 1PZ5B 3L7EB 4UB0L 4X4MA 3KYMA 4NKDB 1P7BA 3RU8L 1PPIA 5IOPA 5I5JA 2FZ3A 3S3CB 1CDYA 1NBYB 3GSOA 2CNZA 5AKRA 5EOQL 3OKKB 5JA8B 1YQ2A 4XCNA 2ZXDA 4MAZA 4RAVB 4Y7MA 4GBXA 4K7PH 3W9EB 4GS7C 5DJZA 1N2RA 1NIAA 3U6XS 1BFSA 4OCNC 2CGYA 2FX8H 2ZE0A 4L8BA 2VUYA 1V55B 4H2AA 4EIZC 1Y18A 5IF0A 3P3UA 1NCAH 3QNFA 2X0WA 3EF4A 5T3XH 3A6OA 4NRYB 1ADWA 1QSFD 1AP2A 2BX5A 3K91A 3FB7A 1JPGB 2IALB 4PJEB 1BZ8A 2OCJA 3LXBA 1GAFL 4LLAA 1MF2H 2HRLA 5E9DA 1UWYA 2NZ9D 5DJ8A 5CBAB 3DGGA 4ZK8A 4HIXL 3BGMB 5C07B 4JO5A 3QUKB 5IZ7A 4JUTA 3UCRA 4FFVC 2WHVA 2BHFA 5AAPA 4WFHE 5I66A 2XQBL 4U1IB 4DCQB 2P1YA 4WW2B 4OCWL 5DHVB 2KT6A 2VXQA 1CL7H 2D3LA 4NQEE 3DMMA 3PDGA 4G9FA 4PV1C 5KAQF 4G80B 1TQTA 4M6OL 1A65A 1N26A 4ELKA 5A2AA 1MAML 5GRXG 4MZRA 1D6EB 1OGAE 4M6AA 2C7FA 2C26A 4LHUD 5GS1B 4JRXA 1DANU 4S1DD 5TDNA 1QPXA 3OB8A 4WV1B 4F9LA 1T89A 2R69H 1ECZA 1RPKA 5J7CC 3QHZH 5C9JA 5D7EA 1OPGH 5HHQB 2VDPB 3F84A 5CCGE 4YS4A 3FB5A 4Z0BH 1BAFL 1U21A 3FZUC 1QFOA 4L37A 4X9GA 1JTTA 1DBKH 1OE3A 2H3NA 4I0PA 3SDAA 1OKEA 2YAQA 3BT0A 4EN3B 5IW6A 1CK0H 1DQLH 3ESPA 1MSPA 5F9OL 1MJ7L 2NY7H 1BVNT 1RAMA 4JN1L 1QQDA 4KK6C 4MX7A 3HC0A 4ZMZA 4GFTB 3QFJB 3Q2CA 4K5PA 1G87A 4AH2A 1FDLL 3VRJB 3OKEA 5I6XC 1OCWH 3V4LA 2ADGA 4NUGL 4JY6A 5IB3B 3S88H 5DD0L 2F8IA 4J28A 5A6IA 3IJSB 5IB2B 4FXGC 4JFFA 3TS8A 5IQ7L 5IB4B 3DURA 1G7HA 2JJWA 4PGEB 1OGTB 3LNHA 3TNMA 1RK0A 1QWUA 2E9WA 3PAZA 5CXPA 4BZYA 4FXKC 3KPSE 3VXUA 5DRXB 3CVBA 1SDDA 1T0MA 2AQNA 1X5HA 1FGNL 3EOBB 4OF7A 1CQKA 3S3DB 4UINL 3CVHH 1VEMA 2ZONA 1N64L 4AQZA 1Z66A 4RFNC 1HDMA 1S7VA 3BGFB 4N1CA 1HNFA 5L2JA 2DJ4A 2B16A 3MOAL 4CC4C 3BDYH 5ILTH 3S96B 1BQUA 3WJLA 1GSKA 4M5ZL 5GIRA 3GMMB 2WB1A 4FLHA 3VVVA 1M71B 4MWFA 1N67A 2ERJB 3B9AA 2FH6A 4OIBA 3OKOB 2LLGA 3WIAA 3NSYA 1UYWL 1YNKL 2RR3A 3INOA 3UP1A 4GG6F 5B1CA 4GQZA 1KYFA 3EO0A 4LGSB 3R7QA 1JPSL 3NJHA 4L4TA 1H5BA 1UENA 2QL1A 2HTKD 3GKWL 4UTBH 2CLRA 4N5UA 4F8TA 4GUPA 3QQDA 3BDXA 2WTPA 4Z3EA 1HHGB 1YEKH 1EFXA 2BIIA 3KYKL 1PX8A 2OX5A 4UF7C 3RWCA 1BAWA 3P0VL 4ZAKB 1RLWA 5KANG 3SSGA 1BSIA 3KBEA 5EEVA 2E47A 2ZZUT 3RWDB 2F54B 1RZGA 4A2HA 1EHNA 3EAKA 1ZLUH 3TF4A 3HRZA 3FQ1A 4H8WH 2QKIB 4D8PB 4RESB 1AXSA 4HXBH 1FL5B 5DMIH 4KVPA 5DJYA 3R7RA 2Y7SA 5EEUA 5KG9A 3MX0A 4AT6B 1JXDA 3I75A 4F7EA 4OIFA 1U4FA 3MCKB 5HYSA 1JNNL 1WFNA 2FNBA 1TLKA 3ABKB 1AQDB 1DL7H 1OAXL 1QOKA 4BZ2L 5EF0A 1XDTT 1D2PA 1JK8A 4L8SC 1ACYH 4PRPD 3IDNB 1QEWA 4ECNA 1A4AA 4D0CA 2QHRL 4DVBB 2W38A 4OLWL 2V8LA 5HYJB 2V2WB 3AFLA 3RDTC 3O4OB 1HAWA 2WMPA 5HJDA 5LGJA 1BXXA 5I74C 4J2QA 1XGUA 1QBLL 5D1QA 4E0RB 5DCCA 4EUPH 3ARED 4FFZA 5E9DE 1ULVA 3O0RH 5D72H 1NUFA 3S35L 3ULUC 4Y5XC 4A7VA 3KGUA 5FGBC 5GHWL 3IDJA 4YHOH 4J7RA 4F57L 5I17B 5AOJA 4RWYL 5F1NA 4ICXA 1F3JB 3OJDA 4C56A 2VMJA 1IAOB 4FFYL 4QTFA 4EMZA 2NY2C 1AZCA 2PTUA 2YAOA 4G9FE 4N0CC 1G7QB 1HHJA 4A68A 4HULB 2ISDA 5F3HB 4Z7WA 3D30A 2FWSA 1C8PA 5IMOB 2G60H 5IG7A 1A02N 2VERA 4GAAA 1BQLL 4HJGA 2FX8L 3RTQC 1YPZA 4JRXE 4GAFB 4I89A 1NCAL 1SPDA 3VFOB 2D9QB 2DJUA 5T3XL 3F5WA 3MRCA 3OPUA 4CRPA 4C4UA 1ZE3C 2DLGA 2CWRA 1FSKB 3WDHA 5JUEH 4RZCA 1JZGA 4QYOA 4WFFD 1XFPA 2PW1B 3F7QA 2BOLA 4HPHA 1DQJB 1XT5A 2XT1B 3DI2B 2Z34A 4V1DA 4H8WC 1M7UA 2VN6A 3QA3A 2UYLB 2OTUB 1KJMB 2DYPD 3NFNB 1CL7L 2AXWA 1FRGH 2WZ6A 2IQ9H 3QORC 4JFFE 3U9PH 2QVKA 4DQAA 4N0UA 4DF9A 3TA3B 2IANB 2GTQA 4H0HB 4U4BA 1E50A 5HGDB 4WUUB 3VXUE 5EIIA 3QDJB 3P11H 3HRPA 4GQ9H 5TE4H 3RGHA 3DPBA 3Q2VA 4MJID 4OGYH 2G75A 4NNPH 4K71B 2R69L 4N9GB 4Z7VB 3A22A 4PS8A 3RL1B 3TO2B 3UTTD 5AW5B 3OKNB 3QHZL 1XGQB 1OPGL 3DPDA 3I84A 3RNQB 1JVOA 4HVBA 2VR3A 4Z0BL 1MW2A 5JQ6H 3TCLB 1DBKL 3OLIA 2JF1A 3D05A 4HV8B 3LKSB 4XNAA 5F7KC 3QQ9D 1DQLL 5CO1A 2CAKA 3G08A 4QMEA 5BCAA 5BO0D 3HHSB 2ZSVB 3HFFA 3V0JA 5ID1B 3S88L 5C71A 5AFAA 3SPGA 5J6GA 3D34A 4FA7B 1DVSA 1AY1H 4WZ9A 3X12B 4ENED 4MS6A 1NUGA 4MLIA 5KVFE 1QHOA 3QJHB 2YRPA 1I8MA 5A2LH 4I9WE 4DIXA 1HH9A 2CRZA 1JWSA 3BQUA 3HI5H 1G1KA 2DB8A 4YHMH 5FECA 2DBJA 4GKNB 2BSRB 4JLRB 4R90H 2DEWX 1ZMYA 2IMNA 2Q7AA 4MZ3A 4YDNA 2EUWA 1INQA 3CVHL 4Q9RH 4XVJH 3KLDA 3PP3K 3FT2B 5K69A 1UWXH 4PWJA 3IDXL 2XICA 2NCMA 5D5MF 1A4KB 5DZJA 3UZEA 3BDYL 2R1WA 2Q8BH 1LO4H 5KS9E 1EO7A 1MCFA 4S2SB 4IU3B 4U33A 2QR0A 4UAOC 3S2CA 2DV6A 4URTB 4H88H 1LK3H 4A55A 3CXDH 1KNOB 1SHWA 1R5IA 3QDMB 4U6VL 2GJ6A 2NLJB 3GMRA 4YWGL 3QIBD 5D8JH 5HD8D 5IREA 4H5SA 4M4RA 3WTTA 2KL6A 2YEVB 3MRQB 3F7YB 5ESVA 4XN2A 3NEOA 3L6FA 4IIZA 3BISA 3O11A 3D18A 4L4VB 4N0FA 2VXQH 4UU9A 3RZCC 4UTBL 2BNRB 5AOMA 2P26A 3GSUA 2V7NA 5L4JA 1BOGA 1YEKL 3SDCC 5TDPA 4J3OF 1QKZH 1X4XA 3GBLA 4HZLB 4NN5B 1ZWIB 1FNEB 1B0IA 4M43H 3EH4B 1S9WB 4Q0XH 1ZHKB 1RL1A 1U8LB 5LO7A 4X0KA 5DMKB 4NZTH 1EVUA 4KFZC 3WIHA 5EF1A 5T1MA 2MHAA 4KGJA 1GMEA 4C56E 1MQ8A 3CX5J 3G5WA 1DUYA 4H8WL 1IKFH 3RY4A 3WJMB 4FNRA 4HXBL 2QGBA 1T5XA 5DMIL 3Q44A 1WZKA 1O7SA 1S9VB 3Q3GA 4XBMA 1MHEB 5EOTA 5INCA 3WEXB 5CILH 4OI8A 5ITFA 5LVEA 4LMQE 1ZGLM 5B7FA 5GGTA 4LVHB 5B3JF 6PAZA 4I0KA 4ZNCD 4Z7WE 3I9AA 2ZICA 3F65A 4W70A 5ELIA 4YHPB 3DX0A 4DUXA 4AQAB 4CUCA 5CF3A 5DS8A 5GGSB 2C5DC 1XL4A 2JKXA 4JZNB 1YPZE 1L9MA 1YC8A 1T2XA 2UZYB 3FTSA 4YFLI 2ITFA 1KWKA 1NMCC 5FM5M 1Q90A 3ILEA 4BIKA 1BFVH 1E9PA 1CTMA 4EQ2A 2AS5M 3OHXB 4ZX3A 2WXIA 4GBXC 4HWZB 3BH9A 5DXWA 4R96B 4EI6A 4F15C 3A67H 3D33A 3TL5A 3WMPA 5D72L 3GXDA 2GK0B 5C0FB 2PWHA 1E30A 2BSTA 2E74C 4FG2A 2OSLB 1YN7A 1I8KA 1NEZB 5DVMA 1BZEA 1Z2KA 2VDLH 4V1DE 2I32A 1KY6A 3V0DA 1B0WA 4FYQA 2EDJA 2XBZA 5DC2A 3HN8A 3O81A 5HY9B 4G6KH 1BM7A 1U8OA 1DQQB 2Y7QB 4N0UE 1XGPA 4NQDA 3FTXA 4YK4C 3U9UB 5BRPA 1VGKA 4JDEA 4F3FB 1SXCA 4XCEA 5C0DA 3SKNA 2EIZB 1BAGA 2B1AH 3LQZA 1KLUA 1IBGL 3E6FA 3AW5A 3FU7B 4W68A 1XGTB 1FFNA 1RV6X 2ITDA 5KVFH 1R19A 3DMMC 3LX9A 4WFED 4CN4A 1IAKB 3FU8A 5FO7A 1Q9KA 2OMTB 1M3JA 4J3OD 1PTZA 2C7UB 1I9RH 4LLQB 2X4UA 1ZS8B 4GUCA 1TPXB 2IH9A 5JUEL 3KYOB 1XCQA 1HFUA 3FCTA 3G5ZA 3QEQA 3L3DB 2B2XL 4F9LC 1OT4A 4CAGA 1T89C 3H8NA 3NFPA 1E27A 1FNFA 2IAMD 1ZSHA 3ZDYB 3VXOA 1ZT7A 1XH2A 1M7IA 4B7LA 2J57A 2XOTA 1FRGL 2IQ9L 4I0PC 3NCXA 3I6SA 5D7LB 3SDAC 2ALWA 3U9PL 3LDBC 4KJWD 4XBPA 2Z31D 4XBGA 5C9KA 2ENPA 3NIDF 2GIMA 2F61A 3N50A 4PP1C 3MZGB 4LIQE 1ADQA 3P11L 5FW8A 5TE4L 3TBYB 2IIJA 1QUPA 1QVOB 4OGYL 4ZFFA 4NNPL 4YEEA 3BFQG 1QSZA 3VWKB 3H85A 4ODWA 2PPAA 4BA0A 2Q10A 4JFEA 4TUJA 1LNUB 4PJCF 1VESA 2VLKA 2H32B 3B9VA 5EUOF 4JPKH 2P8PA 1HSAA 2WINA 4HP5A 4I4WA 3UADA 4DH2A 2VDKB 1QLRA 4WKZB 4I1RA 1D9KB 1FZKB 1HL4A 5B21A 3L9RA 1IVLA 3HZYA 1E5AA 3QUXA 1G84A 4YN3A 5JMRA 2YN5A 3WJLC 4R84A 5LN8A 1J0YA 1BF8A 1VFUA 1DCEA 2VJ0A 2X6UA 3BUIA 2OPCA 3W0WD 4GNKB 3OLGA 2WXHA 4OD1H 1QSVA 1QA9B 4BGLA 3HI5L 4YHML 4CMMB 2EIKB 2YEZA 1L0PA 4R90L 1EA9C 4L0YA 2J71A 2YQBA 1FC2D 2ODHA 2E6QA 3LN4B 1XH3B 4DZBA 1MRFH 4C83B 4QRRB 1XSIA 5ESAB 1ET5A 4H1LG 4Q9RL 1O6SA 2OZNA 2UWEB 4U2ZA 1USQA 3IDYC 3KH4A 2BVUA 1H5BC 1LO4L 2B20A 1WBZB 2Q8BL 4LBAA 1B2WL 4M8QA 2GSIA 4X42A 5IEHA 2XZQL 3G6JF 3LKRA 3W5MA 1KTKE 3B8SA 4H88L 3OGOE 4OLUH 3CXDL 1N59B 2J1WA 1TEFA 3ZTJH 5L2KA 3PGFH 3WBDA 1TVBB 4ERSH 4FQIH 4UIMA 3T3PF 5ADPH 5D8JL 4P23D 5C0RH 5T8IA 3U4BH 1X5KA 2XV2A 2NNFA 3HRZC 3D39B 4H0LC 4ZUUB 1FQ9C 1M4KA 3VRLE 3LRGA 2FYYB 4Z23A 1RMFH 2VXQL 1ZEAL 3ILDA 2BSBA 4TTDC 1L4IA 5IB5A 2Z0BA 4PYHA 3KXFA 4XMUA 1LM8V 3T1WA 1QKZL 4ZNEA 3FONA 3CXHJ 4NJAH 2ENJA 1UJ3A 2H26A 4NUQA 2GJZA 5FS5A 2XY1A 4M43L 4Q0XL 4PBDA 1VEPA 4NFDA 4NBZB 5IVZA 5IEKB 3LKNA 5JLZA 1SGKA 1L6ZA 4XTRC 3FO2B 3LN5A 2YA2A 1IKFL 2IH8A 4PJ5D 3DETD 5H37H 4DT2A 5AD0B 1OM3H 4GI9A 3VNZA 3O3EA 5D1QC 4DKTA 3FO0L 5AB0A 5TDOB 4ZMNA 5EU3A 5A2IH 2C4FT 1S7TA 3C9NA 3GXNA 5CILL 4AMXA 1IBFA 3ARDA 4O9HH 3C6SB 4KHTH 2ICWB 1MVUB 4AVHA 4K2UL 7PAZA 4ZMTA 5FO8B 2ZUTA 1KB5A 4NRZA 1FL3A 1CT8B 1HEZB 3U6RB 2N01B 1QLFB 3R19A 4L3EB 4RGNB 2IPTH 3F3HA 1DO5A 2XTJE 1HXMB 2JNZA 1BFVL 5D96C 2H8PA 1JF1B 3LD8C 2UZIL 4ODHH 1LD9B 4LIQH 3MRGB 3A67L 5CD3B 1RP9A 4GSXA 4NKOA 1G7JA 3QEQE 3L95A 3ULVF 2R2BB 3HTLX 2XVBA 1JVKA 5JZ7D 1IRAY 3EKCA 1AGFA 2XSKA 1NOLA 1E2ZA 3GSRB 3V5KB 2VDLL 4HLJA 4LPXA 4PS7A 3SDXB 4KI1A 5K5YA 3BN9C 4ZFOB 4ZMWA 3QIUB 1CMOA 5ISZE 4Z7NB 4ABQA 1AO7B 4G6KL 4A7QA 1MI5E 1HXYB 5A6MA 2FSEA 2VMCA 1QTSA 4QDGA 1ZANH 5I1LB 4FQCH 1OZTG 1CPUA 5AQ0A 3OR7A 6CGTA 1KXVA 2IF7A 5DD6A 4ZI8A 2F6AA 4MCZA 3RWFB 3VI3E 2WXOA 2B1AL 3BHBB 4PJ8B 3VQ1C 4HEPG 3FRPA 5E8NA 3UPRA 2VMFA 3C5ZA 4BWWA 5EDXA 3TV8A 2HP4A 1G94A 2Y07H 3BZDA 4FMFA 1LEIB 4OZFB 1UUNA 3KJ6H 4ZYKA 4MRBA 4PJ7A 1I9RL 1JV5A 4X83A 4JFEE 4PJGB 4CL7A 4M61A 2F1BA 1NIFA 1LL1A 3ZDXF 2VLKE 4M8UA 4KPHL 1EWHA 4IOFD 1JNHB 4P5TA 2FLRT 1DN0B 4B41A 4AV0A 3O4LB 1X5XA 5LNEA 2MJWA 3O2WH 4P3DA 4YHLH 4P2RB 1I7TB 5HI3D 4DKAA 3WN5A 1P7QD 3WIHH 3PGCB 4DERA 4KJQC 1X4YA 3G5YA 3IXAA 5EBGA 2WOBA 3BUTA 1CLYH 5CP7B 2BLFA 2XDHA 1BYPA 3VXPA 1FL6B 4UBDC 4CNIB 2KQMA 4ZFZB 5KBMA 4B60A 2OV0A 5HVWA 4OD2B 4XOEA 3O9WB 3VXRA 5GGTH 3DHUA 5IFJB 4JKNA 1B3IA 2FECL 2RCSH 4PWKA 3BO8A 5JIPA 2LTQC 2B3RA 1PZ5A 2YFNA 3L7EA 4NKDA 4J5VA 2AEWA 3GRGA 5C08D 1NBYA 3BQUC 3OKKA 1BVLB 2OJZH 1ZV2A 1XGZA 4DW2H 4CN1A 4JPKL 4RAVA 2XWTB 3L1EA 4BM7A 3ULVD 3W9EA 3DV4B 3RGVD 1AE6H 2JCCB 5L2KE 4OCSH 2OTPA 3CAFA 1TYJA 3IMBA 3UZEC 4KXBA 4NRYA 2WGNB 3S5LG 4GEIA 3EO1B 4PJEA 1JPGA 1EV2E 2IALA 4OD1L 3GTVA 5F6HJ 1PEZA 5C09D 2WLLB 4JPVH 5CGYD 3QEUB 5CBAA 3AG4B 4X5QA 4JFDB 5C07A 3BGMA 4H2CA 3QUKA 1MRFL 5CKAA 1XAKA 3S36H 3A4AA 4KKNA 4U1IA 5H2BB 3WFBH 1MHCB 4DCQA 4QI3A 2YA1A 4WW2A 2R27A 4EDWH 2EXTA 4WU7B 3RX9A 5DHVA 2E27H 4J3WA 1XF3B 3TCXA 5EO9B 3DOIA 5C0BD 4QLWA 2DQTL 3HUJF 5F96H 4G6AD 4G80A 1J8RA 1BGXH 4OLUL 3VU1A 1DQKA 2NSXA 3OBAA 4G7QB 4TVUA 3MRNB 5GS1A 4ERSL 4FQIL 3GPSA 5DMYA 4WV1A 3F12B 3P40A 4NP9A 4N26A 3U4BL 3ZRSA 2NOYA 5K9KB 1QPKA 3IKCB 3JT2A 4GO6B 2AJYL 3Q8FA 4U7KA 1BM3H 3SQBB 1A25A 2G0LA 4XODA 5KJ7E 4GO9A 3PUCA 4C47A 4WNJA 4EN3A 4ZSOB 2F58L 3A4EA 1H3PH 2X2YA 4PTTB 3QFJA 3V0WH 4N3TA 3G04B 4E41B 4OFKA 4LHJB 3VRJA 5J11B 3QZPA 2DQCH 5IB3A 2OCCB 2WJ7A 5BUAA 4BH8B 3IJSA 1UEMA 5IB2A 4LSSH 3M7FB 5IB4A 1OD9A 1Z9MA 4M4PA 4GT0A 1HYSD 4XP9H 4PGEA 1OGTA 3MYZA 4S0SD 1A3RH 3OG6B 2WAHA 1B4JH 3BWZA 1M9SA 4A7SA 2K4AA 4ICWA 5DRXA 4A38A 2B9BA 3ORJA 3ZE2E 1O6VA 3EH1A 2OM5A 3L3HB 3EOBA 1CJYA 1MVYA 4O9HL 3TJHC 3L16A 4KHTL 1MRCH 3GJFK 4WJKB 5BOZG 3T2LA 2WXKA 1GW6A 3EJJX 3GGWA 1NM9A 4HOZA 2VLLB 5E6ZA 3S96A 4Q4IA 4ETYA 3T2NH 2IPTL 2YWYA 4G42B 4NAQA 2Z0UA 4LLDB 3GMMA 3NIFF 2YBGA 4HUXB 1E4XH 5DTFB 1M71A 3DVNB 3PWPB 4V2CB 2EDRA 1OCOB 4LIQL 3OKOA 2GKIA 2C1PB 1A8ZA 3CZNA 5GRJH 1Y6NR 3UC2A 2Y22A 2XTJC 4XBEH 2IDCA 3DDGA 1MXDA 3ZYIA 3WO3B 4L29B 4LSQH 2DPKA 5AOIA 4ZO9A 2VN7A 1BLNB 2VRAA 5LDSA 1HHGA 3WN6A 3WENA 2Z8RA 2BY0A 3FTWA 4IGBB 1LWJA 4ZAKA 4FQCL 3FTZA 1YSOA 3FCGA 2A9DA 2X0UA 1KLFB 2QGCA 1C9SA 2P5WD 3CSGA 2F54A 3ARBD 1CIUA 5IJVB 5EZPA 4OZGB 4WSKA 5HHOD 2QKIA 3CZJA 2MCAA 4D8PA 4GOSA 1FL5A 5I30H 2VR8A 5GGSY 3KJ6L 1RJYB 2L7EA 4AT6A 2OP4H 4MVBD 1EAPB 3O6KH 2BFGA 2HT3D 3MCKA 5F0MB 4CMHB 3THMH 1AQDA 3GIZH 2VOTA 3CFBA 1PLBA 4IKLA 3GSWB 4ANKA 4XCCH 3O2WL 1RUMH 4YHLL 3IDNA 3NQKA 3L5WB 2D0HA 3WIHL 4DVBA 4Q58C 3T65B 5HYJA 1P5UB 2V2WA 5A7EA 4PCSA 4XO3A 1AI1H 4ZTPH 2O4EA 3LZQA 4DSYA 5KAQG 1CLYL 4PJEE 4E0RA 4D9RD 3ARGB 4KROC 1NPNA 3HC4H 1OTUD 1PQZB 3PG2A 5DWUH 4G6JH 5GGTL 3SDDD 2DL2A 3QUXC 4XWOC 5I17A 2RCSL 4I18B 1F3JA 3RYMA 1A6WH 1NC4D 1MEXH 4KXZI 5C3IA 4FNLH 1IAOA 5IJKA 1KB5H 1AR2A 4N90D 1N5AB 4FXLA 2WW8A 4HZ1A 3PREA 2PWFA 5SWSE 2OJZL 3B7SA 5JXED 2BZDA 2ZQKA 3C08H 3EH3B 4G11A 1G7QA 4UT6L 2EE6A 2R39A 5T1DH 1XGRB 3SOTA 2V8MA 4EF3A 5F3HA 3RX8A 3KJ4B 5T1LD 5HPOA 5IMOA 2EVGA 3CHXA 2MQ0A 2A0LD 2J72A 1AE6L 1CB4A 3A24A 3BSHA 3HKFA 3SY0B 4OCSL 4LCVA 5EO1B 5EZIL 1D5MB 1KCLA 3VFOA 2QADB 5CMAB 1KTCA 2F7IA 1UACH 1NCHA 5IT2H 1VSCA 3GPEA 4KMLB 2AI0H 2J5LB 4NWUH 1XMEB 4QXWA 2C9VA 4JPVL 4WEBH 1AGBB 1GYUA 3FKUS 2PW1A 1GS8A 1DQJA 3S36L 4FAAB 4JZJB 5E1QA 1HEHC 3QFJE 4WJG3 3WFBL 2UUDK 2VSKB 4N25A 5FM8A 4EDWL 5FOJA 3K72B 5FV2A 2UYLA 2OTUA 1KJMA 3NFNA 2E27L 2N1TE 3VWJB 1TEYA 2B9AA 5GS3A 3P4NB 3CV5A 4O58L 2QVIA 3ZE1F 3KLHC 2BXZA 3ARZA 3ZT6A 4NWTH 3TA3A 2IANA 2X87A 3WO4B 5HGDA 2F53D 2WWMD 1UJ3C 4WUUA 4JFSA 5DD3H 3P3SA 3QDJA 5AYTA 5MENE 3VFVB 5J9PB 3GTTA 2EILB 3SPCA 3VD7A 4Z7VA 4N9GA 3RL1A 3TO2A 3OKNA 3WTVA 1XGQA 1PU0A 3RNQA 4EI5B 1NKRA 1QYGH 1X6NA 1BM3L 4PRHD 1C8QA 1U58B 3TCLA 2X4PB 1EZLA 3TASA 4RAHA 4HV8A 3LKSA 4UQ9A 1F00I 3ZJAA 3ARDC 1H3PL 1OIOA 1IFRA 1NC2D 3HHSA 3AROA 3K1KC 3I6LD 4LCCB 2ZSVA 5DA4A 5ID1A 3CFQA 2DQCL 4JFTA 3WY4A 4AC2A 3X12A 5EORH 4DK5A 5I9QC 2CKBA 4LSSL 3QJHA 3ECVA 2ZG3A 4YBLB 1UEYA 4XP9L 5DD1H 2E4TA 4U4IA 1KXQA 2BSDA 2YD1A 4GKNA 4NERA 2BSRA 1B4JL 3C87A 1T4KB 3CFJB 4JLRA 1SRDA 2OJEB 2QZ5A 4LSUH 3ARSA 1UH3A 4NQCB 1QRND 4UOW1 4O2EB 1P1VA 3FT2A 3K81A 3NPZB 5DFTA 1MRCL 5D6CB 1I53A 2O6PA 4PP2B 3S5ZA 1ZCRA 2NXYD 4AEHH 1A4KA 2F54E 1VEOA 4S2SA 3T2NL 4IU3A 4TLUA 2RHEA 4OLVH 2OMVA 3ARFD 1E4XL 1Z6JT 1KNOA 5DHYB 3QDMA 4FLSA 4B95C 1KXVC 2NLJA 3BWAB 3QZMA 2D3VA 1RZ7H 3JV5A 5GRJL 1KCBA 3OZ9H 4PBWD 2B08A 3MRQA 3QYNA 3QPKA 4XBEL 3US9A 3C5ZC 3UROR 4TL5A 2DMCA 4L4VA 5CJBA 5DHVH 5E2WH 4LSQL 2BNRA 2FCBA 5FGCE 1T6BX 5HYJE 3FH7A 5L88H 2X6VA 3LIZH 4NZRH 2R1YB 2R4SL 4P5TC 3VGGA 4HZLA 1ZWIA 3OHMB 1FNEA 3Q5OA 3B37A 3W11C 1VZGA 5L4FA 1S9WA 4JMXA 1PZAA 4P2OB 1U8LA 2XPGB 5DMKA 3WN5C 4M7JH 2IV9A 1J9TA 2Y06H 4U0RB 5B22A 3QXUA 5BRQA 2ZG2A 2VDPH 2HFGH 3WJMA 4F93B 5I30L 5BV7C 3WY3A 3MV7B 1S9VA 2WYTA 1MHEA 1XIWD 1QTYT 2OP4L 3WEXA 1KTBA 3O6KL 2JKJA 3Q8AA 3P02A 5HPMB 5I5IA 4FFWD 4WI8A 3THML 3LS5H 1U3NA 1YYLH 2UY6B 3GIZL 2AQQA 2BPBA 1T20B 4OAWB 4YHPA 5AVWB 3QZOA 3JTSB 4AQAA 3NSCA 4XCCL 4XP1H 3LVTA 5GGSA 2WIMA 2Y2TA 4JZNA 1EGJA 1RUML 2LHAA 3RI5K 1EDHA 1XV8A 2UZYA 4IJ3B 2VWEE 4UOW0 4NO5B 1AI1L 5AL0A 1H6TA 4ZTPL 1TCMA 3OHXA 1MHHB 4CBPA 2HUHA 4TVPD 4HWZA 1GL4B 3VFPB 2ATKB 4R96A 4DGVH 1YYMH 2J6EA 2GK0A 4RDQF 3VA6A 3MLPA 4G6JL 5C0FA 3PWNB 4BQ9A 5D55A 2DLEA 2QMJA 2OSLA 2FEEI 1A6WL 1N6VA 1MEXL 1MJ8H 1NEZA 2HZHA 4FNLL 4JFVA 4QTIH 5FUCE 3U1SH 2WQWA 3HAEG 1ZGLB 4HOXA 2EEDA 3SE9H 4FCHA 2LU4A 3EYVB 4JX0A 5ENWB 3BIAX 4K8RD 2WKOF 3C08L 1G0YR 4YDLB 3OKYA 5T1DL 1DQQA 1SZNA 2JI1A 3QDGD 3V8OA 2Y7QA 1NM4A 2ZXCA 4YX2H 4FTVB 3PHAA 2IANE 2VJ8A 2XA3A 3U9UA 4WUUE 1UD8A 4WW2C 3QDJE 3TT3H 4F3FA 1QR1B 4EOWH 2EIZA 3RVVC 4RX4A 1HKFA 1IBYA 3FU7A 5J3HC 2GG1A 3LZLA 1XGTA 2JKWA 2PABA 4Z7VE 4DGUA 1ZKAA 1UACL 3MXVH 1IAKA 5IT2L 4BFBD 5CUSH 4E42B 2OMTA 4OFQA 2AERT 5FPIA 2Z7ZA 2MCMA 2AI0L 4NWUL 2C7UA 4LLQA 3QRGH 3EO9H 3T3MB 1ZS8A 3GBDA 2KLRA 1W2KT 5GS1C 3KYOA 4WEBL 5DRNB 5LBSA 1FH2A 5CJ5A 4TUKH 3L3DA 4WI2A 4WV1C 3MACH 4GJTB 1EUUA 1QFPA 3QC6X 1MNNA 4HCGA 2Z35B 5D7JB 1R3IH 4NXSA 3QXDB 2MTAA 4JGUA 4BFFA 1K2DB 2QSTA 2X7LB 3QEHB 4JY4B 4DP8X 2BM3A 5D7LA 4EN3C 1IEAB 4NWTL 3CVIH 3L8QA 4K9JA 4UCFA 1G6RB 1IL1B 1KXQE 2HT2C 1E6JH 2VTFA 2C4XA 1AZNA 3D06A 2XX0A 5E70A 4GMSH 5FYJU 3TBYA 2WBJB 1QVOA 3VE0B 1G1YA 1M42A 1X5JA 5FW7A 2JKSA 4JE0A 4ZUSB 3VWKA 3VXTB 4CC0A 2WIIB 4Y0GA 1JDCA 3SOBH 3VQMA 2ZPKH 5H35B 1QYGL 3P73B 1LNUA 4MNQE 1CDHA 3IGUA 3KL5A 2H32A 4WGVB 4J3OG 4C57C 3EJYD 1F56A 1BEXA 4WKZA 4AQEB 1D9KA 1FZKA 1HH6B 2ATAA 3BGFC 3HB3D 5D1XD 4PRID 4DEUA 4Y4FB 3IJ7A 5EORL 1V3KA 1M2OA 4Y89A 3CDCA 3WNOA 2XQ0A 4L4VE 1QA9A 4A7GF 4HWUA 2X89D 1SNRA 1BG9A 4CMMA 2BNRE 2ERJC 4PGDB 4UQ2B 3PHQB 2EXWC 2KUTA 1WWBX 4G1MB 2A73B 5AW6B 2LOEA 4LSUL 3RVUC 3LN4A 4GRWE 1XH3A 3QXVA 3WFEH 4C83A 4QRRA 1NTDA 5ESAA 2UWEA 2Q7YB 2JXMB 2VLJD 3PL6B 4AEHL 1WFJA 5E95B 3HS0B 1JXGA 2DWDB 1WBZA 3U4KA 1X4ZA 3K6OA 3FCUB 4XNUH 3QISA 3CU1A 4BCZA 1MFBH 1Q4NX 1VCBC 4X6EB 4OLVL 5GGRB 4Y9GA 2NXZD 3AT9A 3BEVB 1DBMH 4ZAKC 1N59A 5HHXH 3TXAA 5DZPA 1TVBA 2OQJB 2P45B 1KCVH 1RZ7L 4L2LA 4E2OA 1AR1B 3OM3B 1JZEA 3OZ9L 4H20H 1LLAA 2EC8A 2DLTA 3ZVVA 4ZUUA 4X2UA 3D39A 4FNPA 2QKIC 1Q9OB 2P5PA 2JKTM 5IQ9B 1TTCA 2FYYA 4X9IA 4A04A 5LCVA 2DQHL 2V3EA 4I8DA 3S48A 2ZUQB 1T5WB 2P80D 4HWNA 1A22B 1NANI 1CDBA 1VA9A 1ZXKA 4N2NA 4QT5B 1AHWB 4G9DB 2V9UA 2ZOUA 1BVZA 3LIZL 4NZRL 3FK3A 1JYVA 2GI7A 3GHBH 1HL5A 2EIJB 3V7AE 2CO2A 1DBJH 3L4TA 4G5ZH 4Z3HA 3MCLH 1KYUA 3RVTC 3QS3A 4I1PA 5D2NB 5KSUB 5IEKA 4M7JL 4YVNA 2DQJH 3E8UH 4PGZA 5GJSH 1AKJB 2Y06L 4PJHF 3FO2A 3O3DB 3FUNA 3O4OC 5AD0A 1LGVA 1VRSA 3BYYA 5HI5D 4WQOA 1Q9LB 4YDKL 3PWVB 1ZOXA 3WKMH 3I3EA 1IFGA 3AB0B 2AJXL 5TDOA 3T0XA 5F1IB 4R4ND 3UMNA 3CBKB 4XCYB 1LO0H 1DN2A 2BW4A 3C6SA 4X9BA 1YYLL 1FE8H 2ICWA 1MVUA 2W80C 1OHZA 1ND0B 2AZAA 3MA7A 3N9GH 4LB8A 4OVUA 5FO8A 4XP1L 5IJKC 2EE2A 1CT8A 1HEZA 1I8UA 5DJ2B 1QLFA 5AW0B 3U6RA 2VABB 4L3EA 4IRZA 2KMWA 3HCVB 4S10A 3OMAB 1V8HA 2X0VA 1HXMA 4XI5C 1N68A 5CZKA 1JF1A 5KYUB 4E68A 1LD9A 3FU0A 4MZ2A 5HDQH 4R26H 2P46B 3MRGA 1A7BA 4DGVL 1YYML 3NZHH 5CD3A 3MLTB 2R2BA 2VWEC 3FCSB 2LE9A 4Z3GA 2V2XB 4JHVA 1XR9B 3FQUB 2Y3NA 1MJ8L 2J1ZA 4QTIL 3GSRA 4X6BB 1EDQA 2YKLH 4PG9B 1GW0A 3U1SL 3V5KA 3SDXA 3QXAB 3ZDYE 2GEQA 4ZFOA 3QIUA 4UNTA 1N8OE 4IOSD 1ZAGA 1AO7A 1FSKC 3VTAA 1HXYA 4IJTA 5D7LE 4U2YA 4YDVB 2R83A 5I1LA 2TRHA 4FERA 4YX2L 5IBUG 2J8HA 4PQXA 1MXGA 2CO3A 4OJEH 3TT3L 3RWFA 2OLDA 1TFPA 4EOWL 1GXEA 4PJ8A 3BHBA 1IBDA 3NJIA 5TF0A 2QQLH 2D7OA 5K93A 4AOFA 3RBSA 2ICWJ 1LEIA 2EE3A 4KKPA 2EADA 1OE1A 4OZFA 3SZKC 2EDEA 4P59H 4KK5C 1NQBA 3TA3C 3QRGL 3EO9L 4L0PB 1OVZA 4PJGA 2JTDA 4N5ED 1ILSA 2EEBA 4GRWH 4TOYH 4RMVA 4TUKL 4TPRH 2C9RA 4CGTA 1JNHA 4G6FD 4LOFA 4ESKA 3MACL 5I73B 1DN0A 3FTGB 4K71C 5JW4Q 1Q1PA 3O4LA 4F33B 4YSAA 2XC8A 3HS8A 2NX5B 1TUPA 2AZUA 1FAIL 5HGAB 3MRLB 3SY6A 4IEFB 1E3FA 1KYOJ 1I7TA 2H6UA 3R06B 4P2RA 4PB0H 3SD5A 4F1ZA 6FABL 1Q38A 2EDHA 3PGCA 1KEMH 2ITCB 3WMQA 4JJOA 3WI9A 2WCPA 4MQTB 3FW6A 5CP7A 5C0JB 3GZKA 3N41B 2J1KA 4OFYA 1BW8A 1FL6A 3EJCA 1E6JL 4ZFZA 2HYMA 4B27A 5EEXA 4OD2A 3O9WA 4FG6D 1E43A 5EDSA 5IFJA 3AXHA 4QRRE 1SY6A 4HKJB 1R1CA 3FN9A 3L4UA 4FQHB 1PVHA 1EGJH 1Q1JH 3WOVA 1L7TH 3GC3A 3OF6A 1HWHB 3BVUA 3LKOB 3EJRA 1BVLA 4FF9A 4JHZA 4QHUB 3GK8H 4L3FA 1JPFB 1HSBB 4IDJH 4Y4HB 2XWTA 2P47B 4TQHA 1LQSR 1GGCH 3DV4A 1AIFB 5FB8B 2CSPA 2J6EH 2JCCA 3C12A 4C8XA 2IH3B 1T1ZB 4MA3A 4NHCH 3GXPA 4PD4J 2JKLA 2WVVB 4AJVA 4DP6X 2EDLA 1UT9A 1YDPB 1QNZH 5F7NC 4I85A 4KDVA 4PCYA 3D39E 3EO1A 3FU3A 2QFRA 3BH8B 1J05B 4UOQA 2LQRA 1BA9A 4NPYB 2WLLA 4AYGA 1ETZB 1NKGA 3QEUA 1CD1B 4JFDA 3FQTA 3FSAA 1T1WB 2ROXA 3UYOD 3ENEA 3WFEL 4WY7H 1J88A 5H2BA 4A67A 1MHCA 1E3ZA 1TZHB 4L2YA 4HCRA 3CN0A 2G4GA 4C58B 4WU7A 1FFTB 3MO1B 3ILPB 4IRJB 1XF3A 4XNUL 1NGPH 4HDIB 4JKPH 5EO9A 4MJHA 3UTPE 3U7YH 3QWQB 4KX8A 5E8OB 4AE1A 4AGOA 1TF4A 4MD4B 2KZKA 3BFOA 1DBML 3FHEA 3HI1B 1RZJH 4FRWA 4G43B 1XWVA 4NN5C 3SBRA 4L1BA 4ZW6A 2R8SL 2AANA 3MRNA 5LBSH 3DIDA 2ZXQA 4QWWC 1ILUA 4KXAA 3ETTA 3QJQB 3F12A 4JB9H 4H20L 1P5VB 3BX7C 1IARB 3SQOL 2EYSB 3SHSA 5K9KA 3GXMA 2J3SA 3IKCA 4LF3B 4HAGA 3SQBA 3ALPA 1J0JA 3DTDA 4B9JA 3B5TA 4L3EE 1A3QA 2VQ1B 4ZSOA 2VAAB 1QSED 4LVHC 4X4XB 4J23A 3GHBL 4GI8A 4PTTA 4XOCA 3G04A 5I8CB 4E41A 5LN4A 3MCLL 3PP4H 2XBDA 5CD5C 3IMSA 1S5HB 4LCIH 3E8UL 1FVCB 5GJSL 4BH8A 4YMPA 1IJNA 3LSOB 3H2PA 3B83A 4FQPA 3W39B 3NJGA 3OHXC 1T3FB 3SDXE 3FFOA 2WUBH 3W9DB 3WKML 2H32H 1QSFB 4Y2OB 4Z7NE 1LO0L 3S8GB 3L3HA 2PPEA 2XACC 4X5RA 2P7TB 2VDKH 3GMPB 3R18A 4PSRA 3S8FB 1FYHB 3CLEH 1FE8L 1XZ0A 2Y6SC 1L9QA 3N9GL 3VG0H 3KBPA 2VLLA 4ILDA 1U93B 4G42A 2WLKA 2FYVA 4LLDA 4HUXA 5DTFA 3DVNA 3PWPA 1F13A 3VSUA 5KSAB 1XH0A 5HDQL 3KMDA 3ZIMA 1TT6A 4PJGE 2C1PA 2VE6A 3NZHL 1K6QH 3LPPA 2Q76B 2WWKT 4BZ1L 4A39A 1WWWX 2H41A 2L04A 4OUUB 3O8XD 3PV7A 3OKLB 3O4LE 3APMA 1U2HA 2YKLL 3MLRH 4L29A 4P2RE 3HEIB 1ICTA 2CDFB 4BH7B 1OTSC 1ZIBA 1BLNA 1IGIL 1TPXC 3B7RL 4U7MA 1MG2C 2IXQB 1L9TA 1P53A 4IGBA 1GJWA 5AOZA 2ADFH 2DF3A 3OAWA 5FC9A 1QI3A 2FNWA 4I3RH 3TO4B 1DEEB 5LBVA 5CKGA 1PZ2A 1KY7A 1NGQH 2QQLL 2XVGA 4OZGA 3UAJA 3X3FH 1Y7VA 2HLFC 5IJVA 5DFVD 3WKQA 2HX8A 1AAJA 1BQSA 4FC3E 1ZT1B 1NCTA 1RJYA 1SLUA 4P59L 3ECWA 3FDWA 1L0QA 3VMNA 4AYID 4Z7OF 4TOYL 1EAPA 2ZXGA 3L45A 1TTAA 4TPRL 1VAHA 5I26A 2V3DA 4LRIA 3BZ5A 4AQOA 2ZX6A 1A8JH 3GSWA 3VWKC 3U0WH 2JCCE 5B1BB 4PB0L 3L5WA 3L4CA 2IDSA 3T65A 1U36A 5B4MD 1P5UA 2V5MA 4X6CF 5E9NA 1KEML 3ARTA 3RIAK 1RCYA 4NO0D 1S6NA 1YEEH 5IVXF 1S7RB 3ARGA 4FHJA 4DN4L 4PS3A 3FPXA 4HA1A 3VGBA 1D9KC 2FUTA 1F18A 2N59A 5GRUH 1PQZA 1NCDH 2PW2B 4PREB 2BIHA 2F15A 1UKQA 3RI5F 4XP6L 2H2PD 4I18A 1DQDL 3B2PA 4KGLA 1N5AA 1EGJL 3RFZB 4MDRA 2WXPA 1L7TL 1K5NB 3J8F7 2HRHA 9CGTA 1NGZB 3APCA 4PJIF 3RQ3A 3GK8L 2WO4A 1Q72H 4U6TA 4IDJL 1F97A 1XGRA 1SN2A 1GGCL 1FP5A 2J6EL 4WFGE 1YRKA 3SY0A 4NHCL 5EO1A 1D5MA 5IHWA 5CMAA 4J3SA 1E4WH 1QNZL 2X09A 2PPDA 4QHMB 4XGZB 1TZIB 4IM8A 4F1SA 4HGWB 3VSQA 5TGBB 2LT9A 5FHBH 2BCKB 5I82A 4F8LA 1IGTB 1U8IA 5ABAA 1AGBA 2JB6B 1BPLB 2DQFB 4ZSOE 1F41A 1CGSH 2WNWA 4KJYB 4XN7A 4WY7L 2Y3AA 4JZJA 2H6OA 4E41E 2CGRH 1J9SA 3K72A 2D73A 3IMUA 3VWJA 4APQD 4RGOH 5HVHC 4JQIA 1NGPL 3P4NA 4JKPL 1DHKA 2RACA 4PRPB 5C0AD 4OZFH 3AUWB 3T04D 1DBBH 3W5NA 1RZJL 2V9TA 2X4QB 3FOLB 4NBYB 2NY1D 4GKZB 1WE5A 3VFVA 4KRPB 5J9PA 1WZLA 1KMGA 4XHQA 1MZZA 4JB9L 4F5CA 2YUVA 3AREB 1O0VA 3FSVA 3CPLB 4EI5A 4Z3JA 2H2SD 1H8LA 2H0JA 1WGVA 1U58A 1S7XB 3NIGF 2X4PA 1AXIB 2XWRA 3FO1B 4AQ1B 2EXSA 5SX5H 4RISH 2FJSA 4AIXA 2BVEA 3K2KA 2D7NA 2OK0H 2W92A 5F6IB 1JPTL 2OMNA 3PWPE 3VG9B 4ZBJA 4U3XA 4LCCA 4WI5A 1OLZA 4OF0A 1DQML 3PP4L 2AQSA 2AQPA 5G4OA 3ARQA 2H1XA 4JFWA 4LCIL 1SY6H 4RGNC 4GG6B 5A16B 3H53A 5CLWA 1PAMA 3EJPA 4KKLD 3KPRB 4FFVD 4Z1PA 2WUBL 5BW7A 5HYFA 4ANXA 1T4KA 2L7UA 3CFJA 2ZKMX 4PRAA 2OJEA 3FOMB 5DFWH 4KZEH 5GGRY 1SXBA 4IYKA 4NQCA 2VDKL 4O2EA 1HHHB 3CLEL 4GP8B 3C6LB 5D6CA 2QDVA 4PP2A 2CO7B 4YSTA 5DRWB 2FDBP 4UT9H 1PGRB 3QIUC 3BEWB 4UQCA 4B5EA 3TIDB 4LQFH 1GGBH 2G5RA 4OZGE 4ZFGH 2ENQA 3OLDA 4IKKA 4P9HH 1RZKC 4D8OA 2PYEE 2DYPB 5DHYA 5LG6A 1WTLA 3IFLL 5T3ZD 3QAZB 1TFHA 3BUYB 3BWAA 4MAYD 1K6QL 4KKCC 4L9LB 3V2AR 1CFTB 4PJ8C 4KAQH 4ALAH 2E9IA 4HCRH 3TPKA 4QRTB 3Q05A 3MLRL 1KG0B 4XZUB 4MJIB 1GZQB 3KWWB 2Y2YA 3IDGB 1DVTA 2ICCA 3WIIH 4I2XB 2X70B 1FWXA 4LCWD 1BQKA 3G9AB 2ZOLB 5CJOH 1D3CA 1WAEA 2R1YA 3HFMH 2ADFL 4TM9A 4I3RL 3P54A 5CCKH 4P2OA 2XPGA 1JGUL 3W2DL 4U6XB 3MRIB 3JUYA 1T7YA 5AOLA 5FR3A 1KJ2B 4Y1SA 3LXCA 1F3DH 3A4FA 3V0VB 3VRIB 1BZ9B 2DMBA 3MV7A 4GMTH 4KNUA 5L8LB 3FXIC 5T3XD 3SGJA 1SVZA 3PJNA 3STZB 4HIQA 3O9WC 3AQZA 3CX5K 3PJSB 1RY7B 5HPMA 1UD6A 2UY6A 4OAWA 1T20A 2RGSA 2EYTB 3ETBF 3JTSA 3MKKA 4LOUD 1XZWA 1RZFH 1HN1A 4NO5A 1A4CA 2PCPB 2LVCA 1F58H 2BSSB 2EKSB 2P28B 3CD4A 1MHHA 2ZYRA 3VFPA 1I1YB 1NAKH 2ATKA 1QRKA 3KPTA 1HK6A 4JO4H 5GRUL 4EVNB 4ZRGA 1NCDL 2ORBL 3EBHA 3PWNA 4XNBA 4KNSA 2ED7A 2A9AA 5DQ9B 2FX9L 3KPNB 2ZXAA 4N2LA 1ZGLA 4F8PA 3LH2H 3QIBB 1TZAA 1RFDH 3TN0D 1ZVNA 3A3YB 3IS1X 4P9HC 3I6KB 3EYVA 3WEAA 3OWRA 5D7KE 5ENWA 4QTHB 3H9SB 1Q72L 3UX9B 3WSQH 4ANWA 4YZFE 4OR1A 4FTVA 4JRYD 4G71B 1DQVA 4AM0B 4ALAC 3TFKC 4PLKD 2Y5EA 1QR1A 2WLIB 3FF8A 3GFUA 5K1NA 2CQVA 4GSRA 1IKNA 4LLMB 4UDTB 5I1DA 1BXVA 2WXFA 1OT2A 3H2WA 3JVGA 3LRHA 4F5CE 1E4WL 5T1JA 2E86A 2G3MA 4E42A 3HAEB 4ZFOL 1WAPA 3AS1A 4YIQB 3LNDA 3ABMB 4KO7A 4QRAA 2JJTA 3QJZA 4RBPH 3EJSA 5FHBL 3VTTA 5GZOA 3F7RA 3L81A 5DRNA 2F08A 3BVDB 5KSVB 4OKVB 2DEYX 1CGSL 4LLWB 2Z35A 2YQ2A 5D7JA 3QXDA 2CGRL 4KK9D 3ILQD 3RL2B 5FO2A 1K2DA 3QEHA 2X7LA 4RGOL 5DRZB 2BNQD 4JY4A 3BAWA 3RBGA 3TBWB 1E28B 3FN0H 4QY8B 4OKDA 1CYGA 1IEAA 4HK0B 1DBBL 1WUZA 4XPGH 1G6RA 1IL1A 2G30A 4KDWA 4A6YB 5J11C 1OSEA 2NY2D 2WBJA 2H6PB 3MV11 4R7VA 3VE0A 4NQCE 3KWUA 5DUBB 2HXAA 3VXTA 4B9YA 4PLNC 2WIIA 4ZUSA 4HPYH 5FEBA 1WFIA 3PWUB 1KB9J 5H35A 3L5XH 3SIKA 3P73A 3S97C 3VSTA 1NDMB 3CZFB 3UTQB 1VFOA 3RTQD 1BFOB 5A40E 2PNDA 2WQRA 4RISL 1H3XA 1P7KB 2FJFB 5D2LF 2VDMB 3NCJH 2XWDA 4XMPH 1MLBB 3ZKQD 2OK0L 4AQEA 5AKVA 1OD7A 1HH6A 2X1OA 1TU2B 2WAQA 4HF5L 1EVTC 2ZJSH 3ZL1A 4H4NA 4KKAC 4Y4FA 1SY6L 1WIPA 5IW3A 1WP6A 1KDJA 2VH5L 5H94B 5MHSD 2ODIA 2B15A 3HG2A 3HZVB 4BV1A 4UQ2A 4PGDA 5KVGE 3IJEB 3TIEB 3PHQA 4G1MA 4XR8C 1CDIA 2A73A 4KZEL 3CQQA 3CQFA 1Z9SB 3QORD 3MUGB 3S3BB 1PG7X 1IIIA 4NZJA 1TNMA 2IGFH 4LDLB 5FYJE 3RJQB 5JQIB 2Q7YA 1XF5A 2JXMA 3PL6A 4UT9L 2VXSL 4WFHD 5E94B 3UTZB 5I76B 3HS0A 3KEHA 2DWDA 3NCYP 3ISWA 4WI4A 3CGTA 2EXYD 4UM9B 4LQFL 2QPUA 1GGBL 4X6EA 5GGRA 4X7CC 1CGWA 1ZVHA 1DCLA 2IAMB 4NQED 5AAWA 5JHDA 1FYTD 4P9HL 3BEVA 4IGBC 3MV7E 1UVQB 2R9HC 5E1IA 2KKQA 4JDVB 1PS3A 5K1VA 1FBIL 4RDQG 2OQJA 2F9BT 4QNPE 1FNAA 1RI8A 4DEPB 2Z31B 5KYNA 1OGAD 1OP5H 3F7PC 1I7UB 2XWEA 3UAJC 1T0NB 3BP4B 4OJFH 4PJXA 1WTGT 1TJHH 3UEZA 1Q9OA 4JJHA 5IQ9A 3V9CA 2XPYA 3AT8A 4WUKH 4JQIH 1Y0LB 1R17A 1T5WA 2H0PA 4QT5A 3QZNA 3WIIL 1AHWA 1F5WA 4G9DA 2YSTA 4H8UA 5CJOL 3HFML 2GB2A 4WWNA 1WD8A 4CMHC 3ESNA 3LZNA 5EZJB 4LRIC 2PP7A 5LGHH 1JP5A 1ZK5A 3NJXA 5DS1A 3TYFB 5CCKL 3OJMB 4GPVA 5D2NA 4TNEA 1UZ8B 5KSUA 4PVNA 1OANA 5CLTA 5ECJE 1AKJA 1P5UC 2TSAA 3O3DA 1VJSA 3GRWL 4PHXA 2AC0A 1Q9LA 4GMTL 1MCCA 3PWVA 3C5SB 3ARGC 3VD0A 4OJCA 5F1IA 5TFSH 4JL2A 4XCYA 2FB4H 1PYWB 1E5BA 5D7HA 3KPSD 4F7CB 1E5ZA 4I18C 1WBXB 4FTVE 4ODXB 3D3VB 1AOZA 1ND0A 3A0OA 2K45A 3EH5B 4DQOL 1BECA 5DJ2A 1SM3H 2ZP0T 1CC3A 1RZFL 3G6DH 8FABB 2VABA 4BDVB 4XMLL 2F1EA 3HCVA 3X1NA 4W9FC 5GGUB 1F58L 3NEEA 5KYUA 3EYUH 2F1AA 3KJ4C 1NAKL 1OV8A 4B0MB 3GSNH 3T3ME 3V0AC 2YN3A 4JO4L 3HG5A 5AW3B 5C0ND 1UZ6E 3MLTA 4LARH 1KB3A 4Y4KC 3FCSA 4FJYA 2PN5A 3K4DA 2V2XA 4PW4A 4ISVA 1XR9A 1EH9A 2QADC 3FQUA 4OM0L 4OLXH 4Z7UF 4PG9A 1LJMA 3LH2L 3EFOB 3QXAA 1F6AB 2J5LC 4JCMA 3RP1A 2OL3B 3R4DA 5E2JA 1YAZA 3TFBA 2K8MA 3WSQL 3HN3A 5E1HB 4YDVA 4JHWH 1ZHLB 5A3IC 5I1GH 3JYCA 3NIDB 4JZJC 3MJ6A 5BZDB 4W9EC 5E8PB 3SGDI 3QQ3B 3CG8A 3MRFB 3WDIA 4KKBC 3E2HB 3TA4D 3VWJC 2L7JA 3GUTB 2HKHH 2D7TH 3C2SA 1A6TB 1D5IH 1RLBA 4FKKA 4XC1H 5KVGH 5EBLB 5LKNA 3KPLB 3WO4C 4PJCB 1F86A 2AAAA 5EUOB 1JZ3A 2E7DA 4YLQT 4PAZA 3FTGA 4UDUB 5F88B 5FYJH 2OYKA 4F33A 2WZPA 5IBUB 5JW3H 2MMXA 2NX5A 5HGAA 3LZOA 3MRLA 1O5PA 4GBXD 4EI5C 1MCSA 2D3NA 4OQTA 2ZWNA 1OCZB 4JPSA 3CMGA 4HEPA 4JMNA 2ITCA 3U7WH 3L13A 1E65A 2NTFB 1DJGA 2N0MA 3FN0L 5C0JA 5DO8A 4XAKD 2JJUA 1OWWA 4XPGL 4YE0A 2YPVH 5KWYC 2A9BA 1ZDSA 4NO2B 4MJ6B 5PAZA 1AG6A 4LCCC 3BUDA 1ZT4B 1WWAX 4K3JH 1QZ1A 5JHMA 5E9DD 4BQBA 3LNEA 5CLYA 1UOLA 1E8ZA 1LO2H 4HKJA 3UERA 1E67A 3D6GA 1VF5C 4FQHA 4H44C 3K6DA 3MBXH 2LFGA 4HPYL 4N68A 4YBLC 5HBBA 5C0IB 3L5XL 5B39G 2DM7A 2DWYA 3MMEB 4DZ8B 3LKOA 4QHUA 1XD1A 2DTMH 5DLMH 3ECQA 1SUJA 1JPFA 1U8HB 1HSBA 3RVXC 4Y4HA 1JZIA 3QAQA 4HS8L 4A7UA 2AGJH 4J1UB 4HWBA 4XMPL 1MY7A 3FT9A 4EXPX 3QH3B 4MYWB 2IWKA 4PJDF 1AIFA 5FB8A 2IH3A 2CJTA 2ZJSL 1T1ZA 4FEMA 3T3PB 2QTEA 2WVVA 3FT0A 2BSED 3ZTCC 5ID0B 4PJ9B 1YDPA 4X7SH 3VD3A 2QLVB 3BH8A 1J05A 3DECA 2X88A 2DEXX 3ET9F 4HIHB 2IOIA 4LAQH 4NPYA 1JGIA 3VXNB 5CEZE 1ETZA 1CD1A 5CGTA 3KWTA 5KS9F 4AL8C 3FT4B 1T1WA 5K9JH 3VVWA 1OB1B 1CD9B 4I0PD 3KGTA 4KNTA 3SDAD 2LFEA 1TZHA 2BVOB 2JJVA 2IGFL 4IKIA 5AKSA 1W91A 4ZS6D 4OGAC 2EP6A 3B1TA 1VB9A 4MKTA 2PETA 4P2QB 5HDWA 3R0MA 1SFDA 5D2NE 3MO1A 3A6CH 3ILPA 2EECA 4IRJA 4M62H 4PP1D 4UMGA 4HDIA 4FQXB 3CFMA 1DZBA 3IU4H 2GUYA 5E8OA 3S5LA 1MN4A 1P7QB 3G5XB 3Q01A 4MD4A 3HI1A 1JF5A 4G43A 4J3TA 4A66A 1S5IL 2WYHA 3IFNH 1Z9OA 4Z95H 4FKEA 4N9OB 3VDAA 1PLCA 2VIRB 4P2OC 4DTGH 2JTYA 2AXHA 2FGWH 3VXUD 1P5VA 4U0RC 1OAUH 2EYSA 3SBQA 2AVFA 1TJHL 5I1CL 5I75B 4LF3A 5DLLA 2O6DA 3VW3H 3L4ZA 1JNLH 4WUKL 3T6XA 2FT7A 4JQIL 3ZN6A 5M95B 3ZBMA 1THAA 2W0PA 3SGJC 5ALCH 3UJTH 2VQ1A 2K7PA 4NENB 5L8KB 2UY7B 2VAAA 2K6ZA 4X4XA 5C08B 1G6RH 5IROA 2IG2H 3B2UD 5I8CA 5LGHL 4N87A 3ZKND 2OCFD 4Y2LA 1XTMA 4KVNH 2X28A 1S5HA 4IJ3C 1FVCA 5CP3A 5ABZA 3LSOA 1DSFL 4UM8A 4NI3A 3W39A 2CBOA 4OZIF 3DSNB 2J44A 2AJVL 4Z7WF 2NY4D 1T3FA 3R1GH 4YGAB 3N6YA 1EXHA 3W9DA 3DHJA 1IAIM 1YNLL 3WKYA 5J1AB 1A1OB 1QSFA 4I9WD 4Y2OA 5TFSL 5AB1A 3MUHL 3MTXA 2FB4L 2WXQA 2XXMB 2P7TA 3GMPA 2EVJA 2YD0A 5C0CE 5I15H 3U79A 1U8KB 1NICA 1SM3L 3G6DL 4POUB 4LKXB 4G8EB 1U93A 4HJ0D 5ICZB 1LQBC 2WNGA 1XO8A 3NRFA 4YDLC 4KMQA 3BVXA 5D70H 2JK5B 3EYUL 3JQOB 1A9EB 1FUNA 5KSAA 1B0RB 2F8XC 3HE6B 3ZLQC 3GSNL 4JVPA 3BIKB 4PY7B 4Q9QH 3ZDXB 2Q76A 4LARL 4TTDD 1IKNC 4OUUA 3DVGB 1OEZW 4DGYH 3JVGC 3HNTH 2HWZL 3OKLA 2MWCA 1VFMA 4Z3IA 2NX5E 2A6KB 2YGVA 5JYLA 1FGVH 3AQYA 2EYRB 2CDFA 4LQ1A 5TE7L 4BH7A 3K1DA 5GZOC 2JJTC 2BVTA 2IXQA 1CS6A 4B9PA 4JHWL 4FQQB 2FEDD 3TO4A 4Y2NA 1DEEA 4XB7A 5D7JC 5F7FA 5E0QA 4I3SH 3RB7A 1V10A 4ZPVB 3RNKB 4GRLD 5DS2A 4UWQB 3WHXB 3N3EA 2HKHL 2Q3ZA 4Y9EA 4CJ0A 2D7TL 4AUUA 4MJ2A 1ZT1A 4XC1L 4C56D 5CEZH 1T2QH 3ZYOA 5KVGL 1CL7I 1OCCB 4E9TA 3FF7A 3IBEA 4LPUA 3VD1A 2X42A 2K3HA 4AYBA 1IC0A 2WBJC 2ZG1A 3NG5A 2WPGA 3NH7H 5FYJL 2YMTA 5JW3L 5I8OH 2QVFB 2YAEA 4HZAA 2BK8A 2NW2B 4JHAL 3U7WL 2IOOA 1S7RA 3KPPB 1PNDA 2YPVL 2WYIA 4IMLB 3S3SA 3V95A 2PW2A 1WFUA 2D2OA 3GD1C 4PREA 3RZCB 5MEOB 5AW4B 3WS3B 2VQTA 4A2MA 4DP2X 3TEXA 4Y4FC 4CSPA 1G4RA 3O45B 1LO2L 1YVLA 4PRBB 1H15B 3U4EB 4GAGH 3RFZA 3ZTNH 1SJEB 1K5NA 1E7UA 3SKOB 1IT9L 2DTML 1HINL 1FV1B 1NGZA 4ODVH 2Z7UA 1TQVA 4S0TD 1KPUB 3KL3A 4V1DD 4W9ZA 5F93C 1J1OH 1TO4A 5EU6D 3HUJB 5LBGA 2AGJL 4LLVB 3U9WA 1I7RB 1P0SE 3VXME 2EUXA 3PXLA 1KACB 2FWLB 3V6OE 1JSYA 1NCWH 3P1VA 2O6CA 3PL6C 3TM6A 4BFGA 3HS0C 4N6RB 1YCSA 5EF2A 4X7SL 3N44F 3POHA 5SV3A 1E9OB 4FADA 4TTGA 2P5WB 3BVVA 4QHMA 1L9OA 2A74B 4OVVA 4XGZA 1S7QB 5AAWC 1TZIA 1T22B 2D03H 4TQEH 4HGWA 5TH2A 3GNMH 2K3TA 5TGBA 1AG0A 1KGXA 3WFHB 2BCKA 3JWNE 1IGTA 2JQAA 4G5AA 1M1XB 2JB6A 2DQFA 3QNZB 2GT9B 4HJIA 1AR1C 1YY8B 4KJYA 5FLVA 3OXSB 4KK8D 2I69A 1XTLA 3A6CL 2FAUA 2A99A 4M62L 2LLLA 2ZKWA 2ZUQC 3QJOA 4OW6A 4PHZA 5DJDB 3IK2A 1RU9H 3IU4L 4PRPA 1AHWC 1BP3B 3MPCA 4ZMXA 2G3NA 2X4QA 3FOLA 4MJ4A 3VRLF 3IFNL 3UEQA 4Z95L 1E6OH 1U3HD 1Z5LB 2DKSA 4XMKH 3P0YH 4BQCA 1QSFE 4GKZA 3BQUD 5D2NC 4DTGL 4PRDB 2FGWL 1AXTH 1TEGA 3AREA 3ATAA 5ANME 1OAUL 1AHMA 1PZBA 2CUMA 4N2IA 3QUHA 5K9QI 3CPLA 2VR5A 4OQTH 3SDDB 3VW3L 2QSQA 12E8H 1ROCA 1JNLL 2IDQA 3AB0C 4CVXB 1NC4B 1S7XA 4H8VA 3SJVE 15C8H 5ALCL 3FO1A 3L17A 4AQ1A 3UJTL 5J12B 3JWDH 1RZIB 1P84J 4OF8A 4JPQA 1GOFA 1G6RL 4ZPTB 1GIGL 2IG2L 1KBKA 3NDYE 4FTDA 3V0FA 2IWGA 3TEZA 4L0ZA 1A7RH 5KBNC 4KVNL 1F3RB 2AQ1A 1NCNA 2XYBA 1XL6A 3HLAB 5EEWA 4GG6A 3N0AA 4ZOCA 5A16A 3Q8CA 5IK3B 1MCJA 3KPRA 4WJ5B 3VGAC 4Y1AD 1I3RA 1X6LA 3DIFB 2GTWB 5SV4A 3B5GA 3K8LA 3PWLB 3FB5B 2Z8SA 4HWBH 4AK1A 2AAVA 2PCXA 3B5HA 3C6LA 2DWSA 2CO7A 4EBQH 1K8DB 2J2ZB 2LVEA 5DRWA 5AZ2H 3TV3L 1JZ8A 1GGIH 2D7PA 5BOPA 2FQEA 1CXEA 4ZFQA 4R4FH 5L8JB 4EKJA 3BEWA 4NZUL 3POCA 3TIDA 3OKEB 2IQAB 5G4MA 2FHBA 3LEXB 2DYPA 5D70L 1PL3A 1G9MC 4DO4A 3MC0A 1YY9D 2CO4A 2JKIS 3BUYA 3VFGL 1S2EA 1F4XH 2BOBB 2ZUYA 3GYRA 4Q9QL 4L9LA 1XF2B 2PP8A 1CFTA 1L5GA 2I07B 3BAYA 2F5AL 3KDMB 4DGYL 1EJ6A 3HNTL 4RDBA 5I0VA 3QFGA 4B5ZA 2ARJB 2HLAB 1FGVL 1KG0A 4XZUA 1QI5A 3QG6B 1GZQA 4MJIA 1EERB 3KWWA 4IKNA 4ZXBB 3IDGA 2AJ3B 4GAJH 4YXHH 1DJXA 1IE5A 3GJEB 1SBSH 3VI3F 4P3WA 4L8CB 4I2XA 2X70A 4UMSA 2YXFA 2ZOLA 3MNVB 2ZCZA 2Z91B 5I73C 4PRHB 1BD2B 3UXFA 3IDUA 1O7DE 1ETB1 1A5FH 3CMOL 3BAXA 4FQLH 4I3SL 4FQJH 4U6XA 3MRIA 4MWFB 2GAZB 1KJ2A 1OALA 1RXLA 4CADB 4NUPA 1YEDB 3LN9A 3OB0K 1YEJH 3V0VA 3VRIA 1BZ9A 1NGXB 3MI6A 3JWDC 4P5RA 1JWMB 1LO3H 2YXWA 3E7JA 3JWNH 1T2QL 5CEZL 1WH0A 2CHWA 4TLKA 1A66A 3TX4A 4BK5A 5DFAA 4AUJA 3PJSA 4M5SA 3BUBA 1W16A 3WE6B 1HZKA 3JWOC 3NH7L 1HQ4B 4NM4H 2EYTA 4JHUA 1NFKA 3M46A 3H7LA 5I8OL 4M1GL 3TH2T 4YE4H 2KZWA 5D93B 4POZD 5CP3H 1PKQE 2PCPA 1U2CA 4X98B 4Y4HC 2BSSA 2EKSA 5EIVA 2R2HB 3LYRA 2XTJD 1D7BA 1I1YA 2J20A 1KIPB 2VN5A 3HJ0A 4RNRB 1BBDL 4EVNA 4H26B 1GS6X 3A47A 3QBTB 3CN1A 5DQ9A 3KPNA 4KRMB 4X8JB 2R0ZH 3QIBA 4GAGL 3DYOA 3ZTNL 1C7TA 3I6KA 1CICB 1BPVA 4QTHA 5DUJA