1O5PA

Solution structure of holo-neocarzinostatin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords Neocarzinostatin
publication title Solution NMR Structure Investigation for Releasing Mechanism of Neocarzinostatin Chromophore from the Holoprotein
pubmed doi rcsb
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1o5pA00
2G0KA 1O5PA 1J48A 4JW3A 1HZLA 2MCMA 1AKPA 1ACXA 2CBTA 1HZKA 2G0LA 2CBMA 1NCOA 2CBQA 1J5HA 2CBOA 1J5IA 1NOAA
chains in the Genus database with same CATH superfamily
4XP4L 2TRYA 3O3DA 5PAZA 4MZIA 1J7VR 3ESVF 1PMYA 4AIZB 1KGUA 5BZZA 3OGOE 4UTAA 2G5BA 5ISZE 4MZ3A 4P2RA 15C8H 2BXZA 1X6LA 3OQRA 1NCDL 2HFFB 4XNQA 1RAMA 4FFWD 1AO7D 1MVUB 3HG1D 1DO5A 3L95B 1NPJA 1UA6H 4DZ8B 4NFDA 4E9WA 1LK2B 1LVEA 3MUGB 3TEYA 2V5MA 4TMPA 5D2LB 2J57A 3HNTH 4KUCF 4I1PA 3WXVH 1A3LL 1OP3K 5CP3H 3VSQA 3V0WH 1UQSA 1J5DA 5HHPA 2XQBH 2IF7A 1T0PB 2VDMB 1MVYA 2PW2A 4KTEH 4HEME 2OSXA 5CP7B 4R4ND 3P4OA 4J8QA 4HWZB 2CA3A 3QORD 2I24N 3PLYA 3VDAA 5JXED 5L0QB 1RZ7H 4ZBJA 4OSUH 4GI6A 1TLMA 1L6XA 1GGBL 4BDVB 1MFCH 1R47A 2XXCB 3HZVA 1VDGA 4HMDA 2G3XA 4PLKD 4Y5VB 1R3JA 1YEWA 2WWMC 4EZJA 3OX8B 4N20A 3RB7A 5FYLE 5BV7B 1C16B 1SJHA 3FCSA 4NRYA 2PWFA 1ZKAA 1I1AB 4YR6A 4TQHA 1KIRB 4N0RA 1BD2D 2VLKA 3K4AA 4LPTA 1EO5A 3RL1B 4IKNA 5DEZA 4AI7A 1DUYA 3PABA 1AAJA 2X6MA 3SE4C 3BSZH 1L7IH 3H3BC 4GIPD 1AOHA 3LZNA 2MPAH 5KJRH 5FM4A 2NDGA 5AB0A 2Y2TA 4GRMB 3U4AA 3EO0A 1SNRA 1XEDA 3P9LB 3QARA 2P7TA 5E8DH 5F1IA 5BMFL 1IT9H 3C8HA 4HJ0C 5CJXC 2EE0A 2GTWB 4RRPM 4JGJA 4KXZI 4W9ZA 4G43A 4N3UA 5JPNB 1KJ3H 4PI0A 2WINA 3A4EA 4NNYA 1MN4A 4NUGH 3QHFH 5KW9H 3ENEA 2MHAA 4KRPB 4XMVA 4ODWB 4PG2A 2DWDA 2XJLA 3CZUB 4CC1A 3FQUB 3WD5H 4I8DA 4K4KA 4X5WB 1MCWW 1ZA3B 4I5BB 2YUWA 5F9WB 1UTDA 4QRPD 2BP5M 1RHFA 4U7MA 4OJFH 1FP5A 3OMNB 5HPOA 1U91B 1JRHI 1WA0X 5CLZA 3JBG7 3S4SG 2AKRB 2F74A 2QGCA 4H1LH 4Q89A 1GC1L 2Z7WA 4HFUH 4JFED 1PQZA 5HDQH 1EFQA 2VABA 4GG6F 1PEZA 1J48A 1JD7A 4XO9A 1LEKB 3L3DB 2LGNA 4K07A 1ICTA 1RIVH 4HEPG 3BLPX 1VKXB 3N43F 3H6AA 3O9WA 1ACCA 3WEXA 4APQA 3VFOA 3O4LA 3QO0B 1MREH 1I1FB 2M1KA 2BNUA 5D1QC 2E8YA 3NSFA 4Y1AA 4F8OA 1SRDA 2NUTB 3WLBB 4R0LA 4I2XE 1OT4A 3NJNA 1ZPUA 2N01B 2NT0A 4N5ED 4PJXE 3R4DA 1D7DA 1OPOA 1V3JA 5FCSH 3TT3L 3Q8EA 3EYQD 3B2UD 2J6EL 5H37H 2OMXA 2VQUA 2HG5B 1AO7E 1RP8A 1E4JA 3HG1E 3N1QC 1FQ9C 4M4RA 1SPDA 2Z7UA 5GRJL 1N68A 4C54A 2CIKA 5FW7A 3C9NA 1TKWA 1PZCA 2NZ1A 3SDDA 2GQHA 1QUNB 4UAOC 3RWHA 1X7QB 1JTOA 4GMSH 2JKRM 1CDCA 3MV9A 4PN6A 3WGVB 5BO0D 5L2JB 2BSED 4KKNA 5EBLB 4I18A 4AQEB 2WVSA 4Z7QE 3SD2A 1U8CA 3VFSB 3D39A 5AAMA 5DS2A 2A9NL 3B9KA 4JFPB 5EIIG 1KJVB 1R5WB 4BSVA 3T5WA 1KB5L 2HVBA 4OFVA 1UOLA 4QHNB 3BAEH 4PS7A 3U79A 4W9HC 5DRWB 4GQQA 1UD3A 1KLUB 4JN1L 5HDRA 1WDAA 4CBPA 5DUML 1D9KD 4R96B 4AZ8B 2OYKA 4PJGF 3ZE2E 3LKNA 2Z8RA 1R3IL 4H44C 5HYSA 1C08B 1B9KA 1IX2A 3IJSB 7FABH 4FADA 4JQVC 3GIZL 4K23L 4X9GA 4KKAD 2R4RH 4FQQA 1HI6A 2FJFA 3DO3A 4F9LC 2G60L 5JUEL 1AKJA 1R6VA 4UNVA 2DI9A 2JMRA 3P9WB 4UAHA 1P1ZB 3RAJH 2G4GA 5A2CA 5LBSL 3MRRA 1G7MA 4KTDH 4XBPA 3X11A 5I6NA 3INUL 3BAYA 4EI6B 1JPTL 1OP5K 4OFDA 2P5ED 1I3GL 5CILH 5FGRA 5FV2A 3FT9A 2W60A 4HPYL 5DJYA 2VR8A 3A3YB 2B1AH 3T4AC 5IWLC 2CRIA 4KAQH 4TOYL 1I8IA 2XBZA 5FYKD 2ATKB 1OGAD 4QRQB 5DO2C 3GJFA 3LAFA 2BJML 4Q9RH 3BAKA 3HA0A 1K4DB 5LN8A 1R24A 1MCWM 4FHBD 2VN6A 4X98B 3SKOA 2WYZA 4GUOA 1OK0A 1GZHA 3ZRCC 2IQAB 1BPLB 1PIGA 3UZEA 4PJ8C 4JAMB 4I3RH 5E70A 4N2BA 2X4RB 3P73B 5DWUH 5IB1A 4OF3A 4GKLA 2IADB 2BP8A 1F45A 3C6LC 1UH4A 4M7ZB 1KBWA 5B7MA 2J5WA 1G7QB 2FRGP 3P2DA 4KVPA 4UCFA 4AMKL 5J1SC 1CGWA 4FXLA 1FAIL 2W94A 5CEXB 1IAOB 4PJEB 5FYLH 3ULSB 4XPAL 2FVNA 1T89C 2YC1A 3D9AL 4QRPE 4FHJA 1BMZA 4AEFA 5JDSB 2OTUA 3PS6A 1FH2A 3JWOC 3M88A 4J1UA 4R84A 3CJJA 4JFDB 1UT1A 5D5MA 1UYWL 1LWRA 4K94H 3WTWA 4HF5L 4YHYC 5EEVA 3CN0A 4JFEE 4JE0A 3VD0A 3C6SB 5FC9A 1DN0A 5TJWK 3J2PA 4Q9CA 4MD5B 4L8CB 3JT0A 1Q9KB 2BNRB 3AAZB 3TVMC 4U1SA 4P04A 1ML0A 3IFLH 4RH4A 3BSGA 5A3ID 5IB4A 5GS2D 4JREB 4PWGA 3LIZL 1GAFL 3J8F7 5C0DB 2ZPKH 4MQTB 3ZKMC 4WHDA 3V4VL 1NIEA 1OOAA 1FFPB 2EDLA 2AQ3A 3ASNB 2O5XL 2WXGA 1BV8A 4L9DA 3IJHA 4RMRA 5C0JA 4GQ9H 1H8NA 1TCMA 2HUHA 4IBLT 5D96B 5HDLA 3ZZ1A 4HBCH 2GJ6D 3RI5F 5K59E 4QO1B 1CLZH 2V0AA 3HMWL 3I9GL 4UYPA 4U0RC 4P0DA 4KMTL 3ATFA 4HXBL 3D2UB 3ZQWA 3B2PA 1B0RA 3FT3A 5EPMB 4RMBA 5DZAA 4DEUA 4CL7A 4OR1A 1JAEA 4G2AA 1GW0A 3VRJA 2DQIH 5E6UB 2O6DA 2F54A 4XO5A 1ERNA 1U3HD 1AGEB 1N64L 1GL4B 1UWFA 3DOIA 3NDYE 1MFEL 1LTXA 3CC5B 4HHAA 4NJ9H 4RGNC 5CIPH 3IJEB 5DS1A 4BSWB 4PH8A 1NFDE 3SOBL 5D7KD 2H32A 3CQFA 1KXQE 2ED8A 3DX2A 5TE6L 2DTML 5I8EA 1SBBA 3WHE1 4AQAA 2WBWB 3ALWA 1ZLVH 3THMH 2YD8A 4ZRGA 4AV5A 1EDYA 2WV3A 2YK1L 3NVQA 3O2DH 4W9FC 1IL1B 3B6SA 1OPGL 2XPGB 3NIFB 4WU5A 5I16B 5ERWB 2G0KA 1NLDH 5MHSE 1I3RA 1B3JA 3WELA 5IW6A 2F5AH 3L3IA 3OV6A 4JO2L 3ZMRA 3HAEA 1N0XL 4TVSa 1KTLB 2ZUYA 1EUTA 2ESVB 5J1AA 1R1CA 2DIEA 4UT6L 3WS3A 2C9SA 5HHMB 3B8YA 2P5EE 3GMPA 1A5FH 3RZCD 4OQTA 1QBBA 2APBA 2AJYL 2IPUK 3D51A 5FYKE 1OGAE 1MNUL 2KZKA 1V7NL 3N40F 3RIKA 1WP6A 1ZJAA 5EBGA 1VF5C 1U3NA 1RFDL 3DYMA 1BIHA 1KCLA 2GBVA 1WPCA 3X12B 5D1XC 1MH5B 5GRVL 3X1GA 2BMKA 3K71B 2WP3O 4GKSA 1KTJA 4OF5A 4JO1L 2O5YH 1PY4A 4XRCA 3WFEL 3ZTDC 2XUWA 4JFFD 4P2RE 1LE5B 2K78A 2WTRB 3I2CL 1R3LA 5FYJH 3CN3A 4YSRA 5H35B 2W9LA 3FRUB 1ED3A 3KPQA 4RMUA 4XZ4A 5H8DA 4HS3A 3HC4L 4B0MB 4X4MA 2AXGB 2J56A 2NNRA 4TTDC 3WN6A 4RDQG 3BPCB 3IGKA 4I1RA 4DN4L 2X38A 5IWLA 2X53A 1T3FB 4ZAKB 1QACA 2MIZA 3E6HB 1HIMH 1J8HD 4XWOC 4LCYB 2Y0SA 5BXFA 3DSFH 3GBLA 2I9LB 3TBTB 4MAYB 4APXB 1LILA 2VLLA 3N85H 1G9ML 1AG0A 1EEYA 1KV7A 1JNNL 1F3DJ 3PP3H 5DZVA 3ZQXA 2YAOA 1LDPL 5AVWB 2R2CA 3DURA 1XFPA 2BY2A 3GI9H 7TAAA 5IIEB 3AACA 2B8OT 3WTVA 4MCNA 1TTGA 5FLVA 2NTSP 4XVTH 1CICD 4C83A 1U8JB 3MLVH 3FO2A 3DNKA 3DIVA 3HG4A 5HGHA 3CFNA 1A65A 2R27A 4N9OB 3SE8H 2QVMA 2GJ6E 2Z93B 2YBRA 1T20A 2AAAA 3BP7B 4PUBL 1KV3A 4J23A 4CU6A 1RSFA 2PXYC 2WXFA 2VLKE 2Y06H 4PGDB 2CQVA 1BZ7B 5ANMA 1ZT7A 1TJGL 4JJ5B 5I71B 5IW1A 4TTGA 3QWQB 4WI5A 2VC2H 2BP3A 4G8IA 5F6IC 5A2LH 2W88A 3ABKB 4K9EH 3IDGA 4NZRH 5EU5A 3K2KA 3C5ZD 5L9DL 1PG7X 5GSVB 5CAYB 3ARVA 4HYTB 1B0IA 1A3ZA 4TVPD 2VH5H 5G4OA 3LS4H 2CO6B 5DR5H 4DP7X 3GKWL 4OZHB 1RUAH 1UATA 5HDWA 3SKNA 3BOVA 5DD6B 5CINH 1JF5A 1Q0XL 3U0WH 3BCFA 1OP3H 4JM4L 3SKMA 2YWZA 5IBTL 2NZ9D 1Z5HA 5E8PB 4A6YA 2QHRH 5EU7C 1L9OA 2MKLC 3CNKA 4PRPA 4ZTPL 5T1MA 4MMXC 1BZQK 1TSHA 2QPUA 4KKQA 5LAXB 1CXKA 3S2AA 3BKCH 2NY7H 1SJVA 3GBNH 4QOKB 3VNYA 3L4CA 3CH1A 4ZFZB 3MXWL 2V9QA 5MEPB 1CGYA 3WJJC 3HPLB 2PETA 3L9RA 2ZAHA 1EWHA 4W9CC 3SE6A 4LSRH 3ROLA 4Z7UB 4QXTA 4KROD 2ALAA 1KCUL 4HZLB 4O2CB 3LXUX 4I77H 2O5ZL 5C0CA 2OMBA 5LBGA 4XX1G 4KKRA 4WQOA 1DR9A 1MI5B 3BISA 3N91A 1X5FA 3UJTH 1Y18B 1NAMA 4N0UB 4F80A 3NP4A 3H3PL 2VE6B 4UQCA 2X1OA 1FJ1B 3EYFA 1LE9B 3BZ5A 4JFFE 1W0WA 2ARWA 2GITA 3GGWB 4O2FB 4MQSB 1Q90A 5E6SB 4IYKA 5AW5B 5H94A 2N1TE 2X41A 1FGVL 1A1OB 5J6GA 4PRNB 3S98A 3SQRA 1MEXL 4LPXA 5B22A 1H6EA 3SE4A 4OFYA 5TDOA 2MMXA 1HXMB 4GPVA 2J1WA 2ZQKA 3L45A 2HT3D 3ZT6A 2VW6A 4YSCA 2ZF8A 2B59A 1TEGA 3QO1B 4FCHA 3G6JA 4DERA 5FDWA 1J8HE 1CDIA 2YSSB 5CJXA 2XY2A 3Q6FA 3D39E 5EUOF 2F54D 4XE5B 1UXLA 3LNEA 3P69A 5HVGB 1TQCB 1A7RL 2NRDA 4L0YA 3BAWA 1SHSA 2F15A 2XRAH 3J27A 1BEYL 5D7LD 3SY6A 1G6VK 4JM2D 2G3ZA 2M83A 4PREA 5AZEL 3IKKA 4DWHA 4EMZA 4DUXA 5CKGA 4MJIA 4RMQA 3FQ4A 2UY7A 2K4WA 1CYXA 3FN0L 4TSAH 5M94B 5L88H 1ZTXH 2YRBA 1DBKH 1KLFA 2GTQA 3PHOB 3SQBB 4UQEA 1HAWA 4F7EA 1QWHA 1P7HL 3CBRA 4WO4A 4DGVL 3ZBMA 1Z0MA 1A6VL 4AGLA 2EH8L 5DFAA 4R7DA 4OCNC 2VXQH 1UZ8B 4WW2C 4PLOB 2CK2A 2VDLH 4N2CA 5D1QA 5DJDB 3BAXA 1GIGH 3L2LA 3LHPL 1BZ9B 4WI7A 2XA8L 2A9CA 2HJKA 2EABA 4QEGA 4HUXB 2JIXA 2HYMA 2A9ML 4S1RL 4V2CB 4ZO8A 4XR8C 5IJBC 2ZT9C 5DYOB 3DMMB 5CJOL 1A6WL 3UX9B 1AY1L 5I74C 2CLZB 1AR1D 1JF6A 2B14A 4PJ7E 2B4CH 4K3JH 3RGVB 4TVPE 4OKVA 1FFNA 1EAPA 1A6ZA 1JPSL 4GBXD 2HTKD 4RFNB 5DS8A 1MJUH 3SY0B 1BMWA 2NTFB 4WO0A 3MV7A 5A2FA 4HJGA 3VA2C 3HE7B 1T1XB 3F84A 1M42A 2HN7B 4M6NH 4M7LL 3L6FB 2DLIA 1GS7A 1JGDA 2X89A 1AXTH 3QDMD 1DQMH 1CXEA 4JFYA 1Q94B 4XCFL 1NEZA 5ABDE 4NQQA 4GS7C 1ES0A 3MBXL 4U6VH 2D7NA 3NJMA 3HB3D 4U1LB 4NKDB 2XZQH 3DHJA 5D5ME 2LQRA 4JDZB 4KH2A 3HUJA 1BSIA 1CFVL 1FVCA 1NCNA 1ASPA 3NSCA 4UOJA 3PL6D 5C7ZA 5JHLL 3F7VB 1L0QA 1M1XA 3M45A 4YFLI 5EOQH 4E41D 4X8JA 4XNXH 3I75B 1QRND 2CJ3A 2A6IB 2CHWA 2R2BA 5F6HI 1AE6L 3NACL 1HL4A 2JKJA 3BVXA 4JQVA 5DYFA 3OPZH 4BWTA 2ZKWA 4N1EA 4Y5XB 4AT6A 3OR6B 3QEUB 4F9LA 4AEIL 4KMLB 1F2XK 2ZUTA 3POHA 4NO2A 3MOBH 4UDUB 1N6VA 3NCYS 2V7NA 4JO4L 2ARJQ 4POYA 2RQEA 2Z8SA 3DTUB 1CE6B 4HDIA 1OP5H 3N06B 1JZHA 1ZVSA 4PJHA 5C0RL 3W11D 2JKIS 3SQOH 5KJ7E 4PJFF 5KVFE 3IBEA 4XB8A 4U6YA 4P5MA 3UABA 4JRXD 1W72A 4WSJA 4FZEL 4Z9KB 3T4AA 3HTLX 3MUJA 4EPSA 1AZZC 1CYWA 3TYFB 5I0DA 1A14L 1JZIA 4G83A 4NJAL 3RTQD 2HJLB 3MCKA 1TEYA 3L8QA 1FNEB 4IOSD 4XC1H 1A1NB 1IC5H 2JJUA 3KEDA 2R1WB 4PJ8A 5EZOH 1CZ8L 3ZHFA 2F54E 5LNDA 1OANA 3BP4A 4KUCD 4NZTH 4XNUH 5D7EA 1AHWC 2PTUA 2DD8H 1CLCA 3M46A 3C6LA 5IUCA 1JGVL 2KUTA 5I8OH 2P5PA 4IKLA 4M6AA 5D7LE 2PP8A 4ANUA 1HOCA 3V52H 3BH8B 5BRZB 1E8WA 2EDQA 4BGLA 1JZJA 1EHLH 5B4MD 3MROA 5TQ2H 3RVTC 5C09A 3TN0D 5DDHB 1T89A 1NGYA 2W07B 5DHYA 1BXXA 1P84J 3TEXA 2GIXA 3QJZA 2C3XA 5DD3H 3B3IB 1CWVA 1PLCA 1RJYA 3RUGA 1NGZB 3S37X 3NFSL 4BV1A 3TVMA 1FIGH 2BW5A 1CFBA 5KVEE 5MI0B 2NYZA 5LUMA 2EIBA 4LCCC 4X0NA 4LIQE 4NENB 2ZUXA 1NC2D 5ICXA 3PWUA 1HEJC 3TA3C 1BVOA 3ZDXE 1T03H 3KLSA 2WVVA 3RY5A 1UENA 2LFEA 4PJDA 4XCEB 2AGJH 4Q4EA 2F53B 5A16B 4HPHA 3QNZB 4X9FA 1F1AA 1NBCA 4KXAA 2WXQA 2V2TA 2DQCL 2WLKA 1GC1C 3WUWA 2PW1A 2B16A 3IDYC 3LMJL 3SDCB 1CT8A 2B9BA 4H4NA 4LU5H 4YHOL 5I6OA 3Q1SL 5C0FB 4K5MA 4YAQB 1LXMA 1NMAL 3CN4A 3SEPA 4MNQA 2XA3A 3RWCB 5A2BA 4GLRH 4KGLA 3TBBA 2ZE0A 2WBXA 3QDME 3BQUC 2IWKA 4I48A 4X6FB 2Z9TA 3FH8A 3ZYIA 3MRDB 2IH3A 4XN4A 3A47A 5LGHL 1Z9NA 3FONA 1P53A 3MHZA 3MLZH 1U8OB 3DUSA 2EADA 3WL9A 5C08B 4E41E 2F8IA 4HJ0D 3VCLB 4NHCL 5DVPA 1QRNE 4M1GH 4PGEB 3A0OA 2Z92B 4P9ML 4L1BA 5C0BD 4BFJA 2AHIA 3PV6B 4Z76A 1R34A 2BDNL 2YRZA 1QR1B 5DK3A 3TIDB 2E7DA 2QSCL 1DLFH 2A83B 4PWJA 5DRNA 4XAWH 4WWNA 5SWSA 3UTTA 5CEYB 8PAZA 3F6LA 3DROB 3EXJA 1K8DA 3RPBA 5F1NB 1H9VA 2YGPA 4I13B 5AENA 1FPTL 5C97A 1NIDA 3KPOA 1WRFA 5DRZA 3BYTA 3WS6C 3WUZA 1IV8A 4JRXE 5B1KA 4OIBA 2NY5H 5DZOA 5MEOA 3AGVA 4XXCC 4L23A 1SYVB 3E3QC 1YMHB 3VB8A 1B6DA 1MQ8A 3RBSA 3UYRH 1L9NA 5CCJA 3UTOA 1DQQB 1IFHL 3QP3A 1WZLA 4NWTL 5I1CL 4KZEH 3LPPA 1P2CB 4BZ1L 1FLRL 1VGKA 4DKAA 4YZFE 3CN2A 1UOVA 2RCSL 3QC6X 4LLYB 2KHAA 5KS9A 1ZV2A 1N59B 3QISA 3ARTA 5AW0B 5D1XA 1R5IA 4JRYD 1NSNH 3ARDC 4N1CA 5DZJA 5A2IH 1A02N 1PSKL 4YBQD 3ZRFC 5J13C 4Z77B 3I6LD 1ZT1A 3QDHA 2Y1VA 3LB6C 4GSDH 2Y7QB 1B2WH 1DVUA 3RI5K 4FP8L 5JIIA 2LAAA 4J8RA 5ACLA 3MBWB 2OK0H 4TULL 2PYEB 2UWEB 5KVGH 5D72H 3HZMA 3QZWA 4DGIL 3ZE1B 1H0DA 3Q3GB 1GGIH 2V5TA 4ZPVB 4H26A 4MB1A 2Q86B 4D8OA 3QDGA 4FYTA 3SODB 3FOLB 5KVFH 2JKXA 2H1LM 2A77H 3DX4A 4AYDC 2VLMD 4ISVA 3CLEH 1S7VA 2ILLA 4LLQB 2J6WA 5E2WL 4DOHB 1VZGA 5K9JL 3MX0A 3BO8B 2MNUA 5I5IA 1LP9A 2EKJA 2BIHA 3H53A 1T6BX 3KGSA 2EVIA 4R5TA 3EBAA 3CFMA 4WY7H 1A8JH 3EO1B 3VXQB 5LHDA 3ARYA 4DTGL 3L4ZA 2Z31B 1HZHL 4FJZA 3CAFA 2QLVB 4NGHL 3LX9A 4QLRA 3GMRA 1F58H 3NABL 2JKWA 1DBJL 2FWLB 2WXOA 1HXYA 2JXMA 4DZBB 3P30H 1AJ7L 2PXYA 4RNRA 4HU8A 5E2VL 1RU9H 2IWGA 4Q6YA 2CUIA 2E7HA 1PTZA 3EYUH 4WHTA 4XHJD 1CLVA 4XMKL 3D0LA 4ALAH 4PV8B 5I1GH 1L5GB 3E6FB 5C8JA 4CILA 2EXWC 5JHDD 2DMGA 5AWNL 4N2FA 3WIHA 2W0FA 2X7LB 1DJSA 4XPHL 3AADB 3KW7A 5KVEH 2OR7A 3D85B 3NIDF 4A2GA 1KTKE 1OO2A 4LIQH 4BZ2H 2LLLA 3EBGA 4XZUA 3VI3B 4NM4L 1EHAA 1ZS8B 3DVGA 5C0BE 3TPUA 1GHFL 1CXLA 3FN9A 4FTVA 4YHML 1XTLA 1AIFB 4GAJH 2G5BB 4Y9BA 4AGQA 3F7RA 3ZKXB 2EDXA 2IDSA 4P2RB 4BK4A 3EYSL 4BM7A 5KYNA 1C8QA 1ZSDB 4MMXA 2DLFL 2AVGA 1YJDH 2UXVA 2ZUQC 1RURL 2W9EL 4MNGE 3UADA 4CSPA 4M5TA 5LXGL 4ZK8A 4YOKA 5CHNA 3WJJA 1KG0A 4U4BA 4M00A 4HD9A 5E23A 4XT1C 4QGTA 2QGBA 4GKNA 4PRHD 1Q72H 1XF5A 4IRZL 4U1GC 3M86A 4P4KC 4FGMA 3TVMD 2GK0B 4ES8A 4F7MB 5TE7L 3MBEC 3CV5A 1M4KA 3KNBA 1RJLA 2ADGA 1UQSB 1E5YA 2AI0L 2PW2B 2VLJB 3OHMB 1AS7A 3OLDA 4JRYE 1NDTA 4BRVA 1MFAH 1CTNA 1XF1A 5IJKC 3GSNH 3ILEA 2N0KA 4OD1L 1DBML 3DK0A 1NOLA 4X80L 3I6LE 1MUJB 2HLEB 4HLZH 4KRLB 5KBMA 5DMGC 4PJ9C 2A6DA 5CCGE 3HZVB 3V0EA 4QAMB 1R3JB 2Y6SC 5TQ0H 3RWGA 3HRZC 1F41A 3WXWH 2V4LA 4OB5H 1D7CA 1SJHB 4IDJH 3FCSB 4RA3A 5ABAA 1E2ZA 4XBEH 5HGDB 2P5WD 1E3FA 2X28A 4ERSL 1EIBA 4BXVA 4YR6B 1EO7A 3M07A 4MXWH 1R5VA 2BOBB 2VLKB 3ZL2A 1EZVY 2VLME 5ACMA 2VDOL 4MWFA 2WOBA 4YXHH 1BYOA 1CG9A 1OHZA 1WCBA 5E2UL 1DUYB 1MWAA 5EZIH 4K3DH 3HUJE 3PABB 3BX7C 2I7OA 2OL3L 2WIMA 5DD0H 4JGMA 4WDIA 3VYOA 3MR9A 1T7VA 1KYOK 1UUNA 1F42A 2C1OA 1HHHA 3CDGA 3EO0B 4U4IA 3NMEA 2P7TB 5F1IB 4J4PA 5IJDC 3K6NA 1AQMA 5CJBA 5EUKA 4JK0D 1BHGA 4UT9L 1TFPA 4G43B 3T3MF 2WINB 4J3UA 4HX1B 2RIKA 4NNYB 3LS5L 1LO2L 3SN6N 5I66A 2K45A 1KFGA 2K9FB 4G3YL 2V6HA 2WQXA 2XLLA 1K2DB 3UTTD 3MJ9L 1E43A 1FA4A 3N0AA 2MHAB 4KOCA 5IVXF 2DWDB 5IREA 4OI7A 1WAAE 2P28B 1FE8L 1G9MC 4WW2A 5L2KA 3UBFA 2DQDH 3AWFA 1OM9A 1XB8A 4F8TA 1UCBH 1ZEAH 2WN3A 1MAJA 2XV3A 3NIGF 1OP4A 3HHSA 4YX2H 5JHDE 5TTRA 2F74B 3Q7JA 3OF6A 1ND0A 3N44F 1MHPL 3P1VA 2VABB 2HVJA 4M1DH 1SVZA 4JPVH 1OVZA 4YC2B 3CVIL 1DVXA 2GB2A 3O9WB 3VRIA 2NY2C 3WEXB 1B6UA 1EZVX 1XH0A 3O4LB 3VFOB 4APQB 4Y4HC 2ODIA 3NT0A 2HT4C 4OCYL 1AZCA 2BNUB 4Y1AB 4UQAA 2ZP9A 5D7SH 4R0LB 3HLAB 4LCWA 1JPFA 3LSOA 4DEWA 1W8EA 3SJVD 1KDIA 4IOFC 3KLAA 3L48A 4ZO6A 3ATEA 4IDLA 4YPGA 1A0QH 5IHUH 2DDQH 3P77B 4MASA 3S34H 3ZDYF 4QGYA 1WC7A 5C09E 1U21A 2N7BA 5EOCL 1I7RA 1KXTA 5HD8C 4FQ2L 5I2IA 3L9YA 4HH9A 2GSIA 2YMTA 4M4RB 1FG9C 2CIKB 2E6JA 3RKDC 3C9NB 1TKWB 1CGXA 1V05A 3SDDB 3ABMB 4AYFB 3RUGE 1RZPA 3II3A 3KCPA 3W82A 2AXWA 4PRHE 3ZGHA 3RWHB 3ARSA 4LRIC 3LXAA 1M2OA 5FM5O 1JZ2A 5T1LD 3MV9B 2EO7A 4J12A 3QFDA 4GT7A 3WNPA 3GRWH 1NICA 4I18B 3DGCR 3FYIB 2HB0A 1U8CB 1WGVA 3GM0A 3TZVC 2VDML 2YKKA 3D39B 4N68A 43C9A 3B9KB 3SDAD 3TNMA 1GMIA 4BSVB 1LDSA 2DQTH 1HJBC 1JS4A 1ZLEA 4RZCA 3BQVA 1FSKB 1T0OA 4KJQD 1RUPH 5DLML 2K7PA 3SKUD 1KPVA 2XKSA 2FK9A 3CMOL 3JWDH 3LKNB 4KOBA 3CVHL 2WSPA 4OI8A 1J05B 3ZZQA 4EIUA 4YK4B 5HJ3B 4WJ5A 3X14A 1UM5L 3AB0B 4ZSOE 3WNIA 4AIOA 2Q6WA 1S3KL 2ADIA 3SGJC 4G9FD 1HI6B 2FJFB 4JQIA 5B1JC 3MRFA 5BV7L 5KBNC 5KAQF 4F7TA 2K6ZA 5KEZA 1AKJB 2P5WE 1QSED 3TBWA 2BVQA 4MFHA 3U9PL 4X4YB 1SOSA 3KWWA 3MRRB 2QQKL 2VSDA 1G7MB 4XBPB 1UM6H 1SXAA 1ULVA 1NCWH 2A6JA 4JG0L 4OY9A 1AHWA 1UKTA 2DL2A 2W60B 1CL7H 4H0LC 3W81A 1OGPA 1PYWB 2JQAA 2XVGA 1I8IB 3UACA 3D8MA 3G3LA 3B7YA 2HLAA 3GJFB 2FATL 3QAZC 1G7HA 1U6AL 3MNDA 3NEEA 4EN3C 1D3CA 1R24B 2ZOKA 1XGYL 1OTSC 4RESB 5GGRA 1MW1A 5KSBA 3DSNA 3FZUC 2B39A 2WXJA 3T71A 5ACZA 5IB1B 5AAPA 2BP8B 4OZFA 3DRTA 1NGPH 2XN9A 2CDFA 3HR6A 2QT6A 3UTTE 2VT0A 2O6CA 3OHXC 3PWNA 1G5AA 3BUPA 4GRWB 5JW3H 1KJMA 5LCVA 4LCCA 4ABQA 3PV7A 1XH2A 3TA3A 1V5JA 3MREB 2JJVA 2CGZA 1FNSH 4E9XA 2OTUB 2Y23A 1HHJA 3T8XB 4URTB 4J1UB 2VDNH 3KLLA 4RQQA 4IIQB 3LRGA 2X6AA 3S0PA 3ZZLA 1DN0B 1P7QA 1P5UB 3QPQD 3DJRA 1PG7W 3CHRA 1GVIA 5AOMA 3V6OE 2GY7B 4MJ4A 4JL1A 4U1SB 5C71A 2RFXA 3A4FA 4I1NB 4Y16C 3CCHB 2AK4A 1TVBA 2H8PA 1HCFX 1XF3A 5LG6A 4DFHA 4DGYH 4X99A 3TWYA 3BGMA 1F56A 3CGTA 2NR6C 5AVXB 3SJVE 5GGRY 1JHTA 3DV6A 1SLUA 4GW4A 4IQHA 5J4MA 4LASH 2V5YA 5BVPL 4LT7A 3BQUA 1PVHA 1A6TA 1EQWA 5K1VA 5C0JB 3AMLA 1Q0YL 5DJZA 4L1SA 1F4WL 4P2AA 5DVNA 4Y89A 4NQVA 2H45A 3TX4A 3U1PA 1Y1UA 1JZ7A 1F1GA 2WQSA 2ZWNA 1CF1A 1LK3H 2OZ4L 4FQCH 3RIAF 2WWNA 1EA9C 1FZKA 3DI2B 2X10A 3DIFA 1X3DA 4S1QL 1AHMA 4A66A 2AJSL 3EF7A 4C4BA 1BEXA 2OJZH 2V2XA 4PJBF 4R4BA 2DLTA 1B0RB 3FT3B 2F1AA 4ZXBD 1TU2A 5F7FA 3K2MC 1G5GA 2WQAA 5B39A 3B2VH 5KSVA 2CO1A 3VRJB 4QHLA 4UZUA 5JPMC 3Q5YA 5DUBA 4HW6A 4IHOA 5I1HL 3T4YA 5JW4M 1UHVA 3ZXAC 1A7NL 4LNRB 3BN9C 4M8QA 5T33H 4QHPA 7CGTA 5CEZD 4M93B 5I8EB 1UWEL 4X5XB 1KB5A 4AQAB 2Y07L 3MV01 5LN4A 3WS6A 3QC5X 3DHPA 1IGCL 4MS6A 3QCUL 5DJAB 3QCTL 4NQCD 3D25B 1ZOXA 3QZMA 3H42L 4QXUH 4XXCA 3B6SB 1IB5A 4G9FE 4WU5B 3QEGH 1I3RB 2G30A 3L3IB 3SBWC 4OZIF 3HAEB 5J8OA 3LDBB 2O6EA 1C1EL 2BRRH 3WS3B 3LV3A 4C57C 3ARDA 1IKOP 3JWNG 1P4BH 5I15L 1YC8A 1KEGL 3Q5TA 3IPEA 3OF6D 2Q8AH 1BFSA 3D7PA 3T0VA 1I1YA 3L1GA 5DMJB 5IW3A 4BH7A 5GS0D 2Y69B 1E28A 4G7YL 2WLIB 1CURA 4GB9A 1P9MC 1JV5A 2AQQA 5KVDE 3K6IA 2VDQB 4I9XA 4G9DA 4CAGA 5GZNC 4F8LA 3K80A 3T1FA 5ADPL 3GHEH 3CBJB 4R26L 5FO7A 5E0FA 4LCWD 1VEPA 3UAFA 5DRXA 4G6MH 1ZT4A 2BMKB 1S7XA 2I60H 1SVBA 4GKSB 3EH2A 4BK5A 1TMQA 4XRCB 4BUGA 2FL5A 3GD1C 3NJGA 3QA3A 1N5AA 3O2VH 2HFEA 1N5YL 2Y2YA 3RA7H 3KPQB 3T6WA 3WNJA 1I9RL 3I9IA 4GO9A 2C4FT 1BQRA 4QRFA 1Y6MR 1SDDA 1CE1H 1L3NA 3IS1X 2DMCA 2OW6A 4R8WH 3GIVA 4QD2E 1HINH 1RPKA 1CXIA 3K6FA 2X2HA 3EOTH 3KW8A 3GLAA 5CLXA 3ZR6A 5BXFB 5I30L 2EIMB 5HSFA 3FQRB 5IMMA 2LU5A 2ZXGA 2VLLB 1EEYB 4UOW0 2DQJH 1MRCL 5FGBC 5CN3A 3M7FB 4WWKC 2XT1B 3DURB 3KXFB 1AZVA 3SPVA 1PL3A 3MTRA 4AYBA 3QPXH 3P0YH 1MHCA 3V4VA 3QQXA 4XO8A 4Q56A 4A7QA 4C83B 2DJ4A 3IRCA 3BH4A 5TPWL 5HGHB 2FECL 3QVAA 5CU5A 2OI9B 3EG9A 1NFIA 4JVUA 2ICWI 5CWSB 4OZGF 5HGAA 3CZGA 1T20B 4PSPA 4KHXL 4H40A 3GO1H 3OG6B 2P80A 3IKCA 3MXVH 3O41A 3TS8A 3D18A 3LQAL 5LWYH 1EJ8A 5ANMB 1THCA 3FUNA 3QI9C 5IW1B 5J11C 2F8XC 4B9GA 3DO7A 1E5ZA 2UV3A 4G8IB 2ED7A 3ESPA 4QKTA 2IFFH 3IDGB 5EU5B 2SODB 3E8UL 3FFOA 4ODVL 2CA4A 1QLEH 1UWXK 4KK5C 1DEDA 3G5ZA 4W9IC 3IFNH 5DT1L 2AQSA 2CM6A 3RVTD 4AVIA 3UO8B 1RZKH 3PWPA 3UEZA 5CEZE 3SE9H 2MH4A 1AQDA 2DH2A 3W39A 1W6WA 3MU3A 3U0TA 2RA1A 2WYIA 3G9VA 4PLNC 5EORL 4ZW7A 1QYGL 4NQCE 1IVTA 2HRPH 4AQ1C 4BKSC 2CO7B 4OT1L 4A7UA 4P4KA 3QXVA 3SKMB 1KIPA 2ADJA 3MBEA 3UJIH 1WGOA 3HG5A 1OSPH 4A6YB 2D0HA 4LRNH 5EZPA 4XXWC 4PRPB 4BZYA 1Y07A 5T1MB 2JQMA 3O3UN 4UM9A 3TA3D 3ILDA 1XD1A 2LU3A 3PWLA 1BAWA 1S7WA 4JCLA 5IQMA 4MVBD 4JB9L 5IJKA 2AXFA 3L9EA 5D7IA 5HVHC 2OLDA 3BJLA 4GY4A 4HJJH 1MQKL 2FD6L 1J0JA 2YZ1A 4ICXA 3ROLB 4YHKL 3VXSA 1PZAA 4QXTB 3N42B 4PJ9A 4LLVB 3VDBA 1NIFA 3HKFA 4OLYH 4X8CA 2BY3A 4LSTL 3FTSA 5C0CB 3DJTA 3LKRA 2JFCA 5KYXB 2R4SH 3HRZA 4PGCA 4LF3A 4BELD 4LCWE 1SN2A 2XIBA 1OV8A 1NAMB 3G5VA 2EEAA 2NY6D 2ZSWA 1UACH 3HI5H 4YHZH 2CMRH 2GITB 1OLZA 4JY5H 1RIUH 3T0DA 3DGGA 4N2GA 3AXIA 2D0FA 2ZONA 2ZJSH 4RSYA 3K0WA 4MAUH 1E65A 5TDOB 2WNGA 4CDGC 2WYHA 4OFKA 1RZ8A 2XC8A 3A4AA 2DBJA 4YO0A 1D5MB 1KC5L 3X3GH 4OJYA 4G5ZL 3G6JB 4HJTA 3REWA 3Q6FB 1GYAA 4JFUA 3IS0X 4KQ3H 2Y1AA 2C4XA 1JGLL 4BKTC 2PLTA 4IBTA 5KVDH 2AVFA 1H5BA 4WSKA 4NN6C 5TDNA 5DI8A 1R17A 2J5LB 5IUSA 4JY6A 4YJZL 3SO3C 5K1JA 3O3EA 5I24A 4PREB 2EDRA 4MJIB 3BGAA 3B7TA 2UY7B 4HBQA 1D5ZB 1XH3A 1YNTB 1S8DA 2YXFA 1ZS2A 3PU7A 3S8FB 2QPDB 1KLFB 2B0SH 3D05A 2GVYA 3E80A 3VE0B 4F7EB 1VJSA 2JV6A 4OU3A 1UXMA 1ZHKA 4WO4B 4PMFA 5D2NC 4KJYB 3KPRB 1TIUA 4KHTL 3W2DL 4R7DB 4MA1C 4PS3A 3FT0A 4Y4HA 4WTQA 1EJOH 5D1QB 1NA8A 2W65A 3MA7A 2LABA 3QUZC 1TTUA 1XDTT 2YHGA 2HJKB 4AOFA 3PGFH 2A74C 4PW9A 2JIXB 3NSJA 4ONGH 5AOKA 4HP5A 1HL9A 4G8GD 5C86A 3Q8BA 3NSYA 1YEEH 5SX4I 1U30A 1YEGL 1YCSA 4FNPA 1EAPB 3ZY7A 1A6ZB 1ZWIA 3CFJA 4MDIA 5ADOL 4N87A 5DS8B 3SGKC 3VYPA 5IEHA 5EIVA 3ULUF 2LE9A 1YDPA 3OZLA 3MV7B 2IDCA 4FG6C 1FO0A 4LRIA 4UAOB 1P1VA 2BVTA 4HUVA 1TYJA 1U58A 1JGDB 3OAUL 4N0FB 3ETBF 1UZ6F 1JWUA 2AZAA 4JFYB 3TZVA 3GUFA 2WQRA 1ES0B 4YGVA 3OKMA 5FOJA 3Q5OA 2ZKXA 4AQ8C 4HS8H 1OAYH 3HUJB 2NOYA 3LEYL 4KK9D 5GRVK 3BVNA 3EDDA 3HW7A 4X8JB 4RZKA 5IQOA 1MHEA 2R2BB 3IDXH 1TTBA 4NZJA 5FV1L 3B2MA 4OLUH 4A04A 4GO6B 2BWDA 3FTXA 5I1KH 1WWAX 1TSRA 4AT6B 4FMKA 5AW8B 3SGJA 1DVZA 5JMOC 1RZQA 1DQLL 2OCCB 5B1JA 5T3XL 4Y5YC 1DFBH 1PY9A 1P7KB 2V7NB 2R69A 2C3VB 4HDIB 5EHFA 4PJHB 1ZVSB 3V9FA 2FSEA 3HJEA 3SYAA 4R7XA 4NN5C 4P5MB 4RWYL 1W72B 3T4AB 3GB7A 3RVVC 3EADA 3R18A 4HWBH 3SB3A 1ZANL 2H2PC 1V10A 1F6LL 1FFOA 3MCKB 5KBKA 4EN3A 1VLXA 2CALA 1E4WL 3GYRA 4M48L 4UT7L 4JFQA 4MKTA 3WN5B 4PJ8B 5HP5A 5I18H 5JA8B 1AQ8A 1YEDA 2ZNWA 5GGQL 3BP4B 4Q8BA 1WQVT 2PPEA 1TDQA 4ZFFA 3EDKA 5IB2A 4LPYA 5IP4A 3BUIA 3F3HA 3H8NA 5DEGB 4XOBA 4XE0A 4QXGL 1ETJA 1MFDL 3FBQA 1HOCB 3GPEA 1TO4A 4TF4A 3MO1A 4LPUA 2EC9U 4JPSA 3MROB 4KDVA 2YZ8A 2GI7A 3DVIA 5C09B 43CAA 5LVEA 3EGDA 1NGYB 2SEBA 5DHYB 3B37A 2JWYA 1NLBH 2VSCA 3U7WL 2FH8A 4UI2A 2HMID 3E3QE 1Q9LB 1R4XA 5F7NC 1BYPA 3B9EA 4YHYB 3W5MA 1G7IA 2X6VA 5IBUB 5INDA 3SHSA 5HGBA 4JO5A 3K0YA 4Y16A 1JXDA 1D5BB 3VH8A 1BZDA 1HS6A 3B56A 4POUB 2W38A 5AL8A 4QWWD 4XAKD 2VMEA 3NFPA 2WZPD 2NR6A 2WVVB 1S9YA 3BKMH 3DX9A 4O58L 3WEOA 5C7XH 4PJDB 4P06A 4N0YL 1P69B 3PF2A 4L37A 2VXUL 4G8GE 4U49A 4NO0B 2JK5B 1A3LH 4R90L 3SGDI 3PQYA 2V2TB 3U6RA 1YO4A 3WUWB 1EDQA 1VESA 2PW1B 1HSAA 5EULV 3FU7A 4EI5A 4JKWA 4H25A 4M7KL 1CT8B 4U0RB 3T65A 1LMKA 4OM0L 4PRDB 5A2AA 1BVZA 5L7XL 2CJUH 5CUSL 1RMFL 2XDHA 3DECA 4JFSA 4A63A 4FXKB 4LSVL 4MNQB 1U2HA 3W9EA 2V33A 5J7CC 2FH6A 3MJ8A 2VWEC 2Z8VC 5F3BA 4C56B 1RLWA 1CGTA 2FLMA 3CFCL 4I48B 2F5BL 2APTA 5JPMA 4NO5A 3C60C 2V37A 4RGNB 2HTLC 5FHBL 1ZE3H 1N9PA 4NQED 2EE9A 3FONB 1NBZA 1SLVA 3DUSB 4NSKA 2ORBH 4P5TD 4O02L 3WL9B 1FAKT 2DS4A 3AY2A 2JCCF 4R4FL 3HS0B 1TZGH 3EFOA 4TL5A 5JHLA 2ADFH 4S0HA 4Z76B 4N2KA 1QX1A 1J1XH 3WJMA 1KENL 4F1ZA 4XMPH 4HOXA 1KULA 1XHHA 3S3DB 3JTSA 3SBWA 3QJXA 1ZV9A 1MHHA 5SWSB 2JB5L 1PKQB 1K8DB 3CHOA 2ATPA 4PYHA 5I76A 4EZMA 3KPOB 4GRLC 5DRZB 5DTFA 3G7TA 4PJ6A 1ZLUH 2BVPA 3QDJB 5MEOB 2PO6D 3HAEG 2X4NA 1P9MA 3V5KB 1WIUA 2N56A 3HR5A 3FTVA 4J3OC 1KN4L 3NZUA 1NCCL 2DKSA 4KNUA 1URIA 5E6RB 4A2FA 1VGKB 4KY1L 5T1KD 5A6LA 1UH3A 1BQUA 4MXQC 3T3PF 4WENB 5KS9B 5BV7C 2E3VA 5D1XB 1R5IB 9CGTA 5EF2A 5E5UB 4P5SA 1UD4A 1J87A 5CD5C 5C0GA 2PCYA 2B9AA 4NDMA 3FO0L 4GG6A 3T09A 1F6FB 1YUKB 5EF3A 3CDZA 1DBAL 1S5IL 2X6CA 3RIAK 3BUTA 3CQQA 3O3BB 5DK2A 1G9NL 5F72S 3HZMB 1TZOA 1JD9A 1H0DB 1BBJA 4CJ0A 1S7TA 3CX5K 3SYQA 4KKPA 4IBVA 4FQJH 2XXMB 4H26B 4Z7NE 3QDGB 4UINL 4B6ZA 1V3MA 2VISB 1T66C 5K9KA 4EBQH 4M3KB 3QCVH 1Q9OA 2J6EH 3QULB 4ISVB 3CSTA 1S7VB 5L8KB 3D07A 3KL3A 2DICA 3FO1B 5FUOL 2UZXB 3VSUA 1M05A 3MX0B 3S4SA 3GZOA 4XAKE 3R06A 1LP9B 4TLSA 4WWKA 4X7FC 4M5ZL 1F3RB 2GJZA 3MVSA 3CBKB 4HEPA 5F9WC 4MHHG 2VM9A 3Q6GL 4J2XA 3VJ6A 1EVTC 4M9OA 3A5VA 3VNZA 2CJSA 4FC3E 4IIZA 5FOBA 5CCKH 3GMRB 2W95A 1INEH 1UA3A 1HXYB 2JXMB 3QUKB 2PXYB 4RNRB 4G11A 1UB5A 4H0HB 1HHIA 2H0JA 3HNSL 4UM8A 3T3ME 1DTUA 1KPRA 4MCYA 3RPIA 3WG7B 1OTUC 2KT6A 3EH1A 1UWXH 4M6OH 4MYWB 1KZYA 4YSAA 4YDIL 5C8JB 3QWNA 2X87A 2YKLL 1JG9A 3CSYA 5DC0A 3ZHNA 5EU6D 2E9IA 2NX5A 4NQEE 1OTSD 3OR7A 1J10A 3L17A 2EE3A 2IQ9H 1WITA 3NIGE 1YY9C 3ESUF 3OPUA 1G7PB 1IZKA 1J12A 1V3KA 2ZCHL 1UJ3A 3MMEB 4YDKH 5JIQA 1JPTH 1WA2X 2YBGA 3DVGB 5KANG 4KV5E 3TPUB 4X4KA 3WKPA 1CBJA 2F6AA 4FTVB 5DFVC 3RVUC 4Z3GA 5CBAB 1WH0A 1MG3C 1HHKA 2UZIL 4OCXH 4I89A 3CE1A 4PR5A 5FHAL 5I6XB 4FNQA 4XVUD 4JFWA 2NY0C 3OKEA 4XXWA 1BG1A 4MMXB 1M6OA 4PRIA 1QMUA 5MEQB 1MXGA 4XPGH 3MRIA 4ENEC 5CHNB 1RI8A 1KG0B 1X9LA 4NZUH 4C4UA 4EUPH 4LMQI 4PRAA 3ZDYE 1AXSA 1VZIA 4GKNB 1XF5B 1ZHNA 2D2CC 1LL1A 1MJ8H 2EDYA 4I88A 4AMKH 4LQFL 3O6ML 1FAIH 1MF2L 1RJLB 2ADGB 4Y9FA 1B3IA 1DQDH 2VZTA 1MCNA 2Y72A 4P3WA 5EA0H 2WQUA 1GYCA 3DHMA 4J5VA 4AYID 3PDDA 3HE6B 5FA3A 2EYTA 2PTTA 4OTXL 4K3EL 4QRUA 1D7BA 1RERA 4YH6A 3ZR5A 4G6AC 1NTDA 1UYWH 2IDFA 5IMOA 2IJ0C 2BSBA 4HFWB 4BFRA 2Q0ZX 1RQ5A 1QG3A 4Z23A 3EJYC 2A6DB 4FZ8H 4K5OA 1L9TA 1KUMA 4TUUA 4AL8H 3Q43A 3DPBA 4ATWA 3RWGB 3M1BA 1DDTA 1BAFL 2NY1D 3QFJA 1REIA 4R2GB 3S48A 2P3YA 2VN7A 2VW4A 5EC2B 3TT1L 4PLJC 3AGWA 1ASQA 1R5VB 4G80A 3FUEA 4WEMB 2JLLA 3KBPA 3NZSA 1BVKA 2PR9A 4MWFB 2VZSA 1WCBB 1WUNT 2AEQH 4FFVD 5GGVH 1MWAB 2MSPA 3BN9D 2YEZA 1L9PA 4OV6F 4ODXA 5E08L 3I9GH 1KXVC 1G6RH 4WDIB 3MR9B 3F04A 4G1EB 1N67A 2C1OB 1HHHB 3CDGB 5F88A 3IFOA 4I87A 4HXAH 4L48A 4AM0Q 5EUKB 3KPPA 1CF8L 1A7OH 4QRRD 1OL0A 4GH7B 1CR9L 2Y3NA 4UQ2A 4JG5A 2Q1EA 2WUBL 2CE6A 4ZW5A 1AI1L 4PTUA 3D1MC 2BC4A 4TSCH 3RDTD 3MAWA 3SBRA 1OD7A 5I66B 5CFAA 1F11A 2JTYA 4K2UL 5D2NA 4CW1A 3NCXA 2O5NA 4WW2B 1HQRA 1DVTA 4PJEF 4F9PC 5L2KB 2V5SA 1WWBX 4BFIA 3QUZA 4Y2DD 4IBZA 3MOAH 3SGEH 2Y2WA 3D09A 1XCXA 3CWGA 2A74A 1BVLA 4FG0A 3QK0A 3DRQA 2X42A 3HHSB 4GMTL 4POZC 3KJ6L 3R0MA 1ND0B 4IHBA 2ZICA 5GZND 2X2UA 5EU6E 2HVJB 5I74B 4AVJA 4FNUA 3OM3B 5D96C 2DIBA 35C8H 3L9BA 5HDBB 5HYJA 3B4NA 3GLDA 1MCPH 4TV3A 1WK0A 2WW8A 4UT6H 4TNEA 3SGKA 5IV2A 3H9YA 4P59H 4ZD3L 1TZIB 3IDMA 4GXVH 3PJLA 3IXTA 3LQAC 3CIAA 1JPFB 1B9ZA 3LSOB 1YZZA 3BVDB 3KLAB 2VO8A 1AFVL 1V7NH 2C9QA 4UTAL 3B83A 4W6XB 2VRQA 2F19L 4WNSA 2DQFA 2YPVH 4YPGB 1OAKH 1KN2L 2UX6A 5A7BA 1WC7B 1I7RB 1KXTB 3AJ7A 2WY3B 3EKCA 5I2IB 4HH9B 2GSIB 4AQ8A 1QQDA 2B1OA 5GHWL 1LD9A 5BO1L 2NY3D 1FCCA 1OTTC 2VAAA 1OGSA 4CU8A 4YXLH 1SVCP 4JO1H 4ONFH 3WFEH 3KCPB 3VVWA 3I2CH 1NCJA 2APFA 5LQBH 2R2HA 3QFDB 3CU1A 5EN3A 5I8CA 3VG0H 3IAGC 3CK0L 4IRZA 1IM9B 3PJSB 5KG9A 3HC4H 2BSTA 5EFIB 1FHNA 3VDCA 5A2JH 2ZWSA 4W70A 4WWKD 1CIDA 5IF0A 4AJ0A 3RE0A 2XSKA 1T6VN 4JHAL 2CKBH 4WI9A 4Y5YA 1A7QL 4Z0BL 4XP9L 5C0AD 3STZA 1MKFA 2JTDA 3TIEA 3D0AA 1JOIA 2OYMA 5CD3A 1MNNA 2OSLA 1RUML 2H6PB 4Y2NA 2YAEA 1KCRH 4RBPK 4S1SH 5IROC 1IILE 2TRHA 3PQYE 4YSQA 2IH8A 5T5FH 3VXMA 4GAAA 4PI2A 3R7QA 1F5WA 3OXSA 1T21A 3RU8H 1IMHC 4WJ5B 3X14B 5I6LA 2A7BA 5EO0A 3T2NL 3APFA 2Q6WB 3NIFF 1QNZL 3GXTA 3HI1A 1VFBB 3MRFB 1MCEA 4F7TB 1LDPH 2CO3A 3CFBA 2DMBA 2JELL 1CK0H 3QI9D 4FQ1L 3TBWB 2BVQB 4EZKA 5F7KC 5I5JA 3EXLA 3MLUL 3KWWB 4HKXA 1QFOA 4YS4A 1I7TA 3MV8D 2A6JB 1WF5A 3WEBA 2FCBA 1AHWB 4N2LA 4P3DA 3FQXA 3P11H 5GIRA 4JX0A 4OZIE 4JDTL 3UAEA 1L9MA 1VEOA 2FHFA 1BQKA 1IAIL 2HLAB 2HH0L 4H5SA 2C1PA 4WUUA 1G7HB 4AC4A 1A3RL 5AYUH 2ZOKB 3EUDA 1GS8A 1SGKA 4QNPE 1S9VA 1BQ5A 1N0LA 3BAIA 5DMIL 3OQ3B 5GGRB 5KSBB 3DSNB 2XFXA 4Q6IC 3ILQC 3IT8D 3UPAA 4IBYA 3D08A 3EDFA 4QRRE 3T6QC 3PWVA 4URKA 4K55A 4NAJA 3VFVA 3IJ9A 2WWOA 1ROCA 4ZAKC 4OZFB 2FJSA 2XN9B 1F02I 1EZSA 4LLAA 4Q58C 3HBQA 4S1DD 3KLHC 4CADB 3LVEA 4HQQL 3SDXB 4MAYC 3UAJC 2EDKA 1KJMB 1XXFC 2OP4H 3PFQA 4LCCB 1CUOA 3B5TA 3DHUA 3FFDA 5IBUG 4RX4A 3N1PC 4WI4A 3KHOA 4H13C 4LHUA 1HHJB 1F6AA 2DWEB 5E2TL 2E7BA 4RQQB 1Q0XH 3GSOA 3BWUC 3KYOA 1KNOA 2IDUA 4Z3IA 1P7QB 2DWXA 3LOWA 2XVKA 4ZMYA 5FKPB 1IKFL 4ZTPH 1JPGA 1XSJA 1ZD6A 2RFXB 1SDAB 5HHXL 4ZMTA 1KJ2H 1DANU 1OSYA 1MFBH 3BI9X 3BW9B 2AK4B 3IDYB 1TVBB 1MXDA 2H8PB 1XF3B 4HSAC 3FL7A 1SN0A 3NTCH 4LL9A 5I9QC 4B27A 4LK4A 4X6EA 5EBWB 4TQEL 1JHTB 4XBGA 5I71C 5C07A 3C09C 3BUBA 4GW4B 4EIZC 4D94A 4YHLL 2YAFA 4JS7A 2HP4A 3BQUB 2EDTA 1A6TB 5DJZB 4QJ5B 3QZLA 3C60A 4PJIB 3W1ZA 1LWHA 4NQVB 3TBCA 5ITBH 1H19A 3QUMA 2M2DA 2VLRA 1EO8L 4QIRA 4LCIL 2KI6A 3FHEA 4NKIL 5DJ8A 3DIFB 1FZKB 4I0PC 2QR0A 4MXVE 3CLWA 2YD9A 3LNGA 2CHZA 2NLJA 2V2XB 2VDLB 5DXWA 3MZGB 1W15A 5AVZB 1TU2B 2AQRA 3EJPA 3AY4C 3H0TA 2R56L 4OZGE 1LK2A 3II1A 3MUGA 3PPEA 3WKNA 2KLRA 5KSVB 2OBGA 4QHLB 3N41B 1YPZF 1S5HB 2EACA 5HHQA 2KMWA 2AEPH 5DUBB 5C0AE 1M57B 1UKQA 3QPKA 1HZKA 1O6VA 4UTCA 2XXGA 4Y1SA 3JSSA 3WDHA 2D03H 3O6LL 1QBMH 4RMVA 5IVZA 4QHMA 1KYOJ 1GCYA 2OFQA 1XAUA 4HWZA 1H15A 4GRLA 5EUOA 4OZHF 4Z3JA 5CSZA 4GI8A 4XMTA 4WUKH 3IWVA 3BESR 2CCVA 1NM4A 3LZQA 5H37G 3CVHA 2VM3A 1A1MA 4Q2ZA 1GGCH 3N2JA 2B08A 4HHWA 2OR9H 3QZBA 3W5NA 3ULUD 3QT2A 3A24A 2BW4A 2CIIA 3U36B 4DSYA 1NBVH 2PPCA 1IGJB 3FN0H 3MV8E 4FLRA 3ARDB 4PGBA 3TA4D 4Y4KD 3CFEA 1MCIA 1I1YB 1A2YA 1F3JA 1ZHBA 4KJPD 4P23D 1E28B 2QV4A 1JSYA 3M1CA 5HYJD 1JV5B 2BHZA 5DU7A 3W3BA 1PZSA 1TTRA 5E5RB 3VACA 4DKTA 3PHAA 3NCFB 4HUMB 1NCAH 1OAQL 5DEJA 5FO7B 4JHZA 5J9PA 2NXZC 3HFML 2XA8H 3SKJH 3AUVA 3S3SA 1ZT4B 2EDNA 1U8NA 4BFNA 2CDGA 4S1RH 2XOTA 1C8PA 1ODAA 1DQJA 1C5BH 4NHUA 5KOVC 3QA3B 4BFFA 4ABWA 3EJZC 3HOGA 5JZ7D 2HFEB 2R29H 3BFOA 3G6AB 2WTOA 5JXAL 1K85A 1TQCC 2XZAH 4F57H 2WKOF 4OLZH 2QKSA 1FORL 4G6FB 4D0DA 5LGYA 4HC1L 5HHVH 3MPCA 4G6KH 5LLIC 1SDDB 4MGXA 2FGZA 4BH8A 4XOCA 1YYLH 2WB7A 1ZA3A 4IS6A 4YWGH 2KBGA 1EV2E 4P4RA 4X7TA 2D31A 4P9HC 4XCFH 4QF1A 1NAKH 3SIKA 2XWTA 2MTAA 4JPIA 5CZRA 5E6YA 3KE0A 2VDPH 4BFGA 1LEKA 2WBJB 2BP0A 5IEKB 5EWIH 3TYGH 1DQKA 3OJ2C 1FYTA 3WKQA 1GJUA 3SPVB 1SEQH 1G4RA 1GOFA 3W37A 1TOXA 5IB3A 1MHCB 3V4VB 4YFLF 2N4IA 1COBA 5FXCH 4P2OD 5EB9A 2EEBA 2EZ0D 4O5LL 1BQLH 3T08A 2HJFA 4PJCA 4OBRA 1A6UH 1NFIB 1RH8A 1SOXA 2C7UA 1MIEL 5HGAB 4FFYL 3RGVC 3IKCB 4AGNA 1CDYA 3D18B 1KLGB 2WD0A 5DMYA 4EJ1C 2OZ4A 3J7HA 3ZU8A 2FBOJ 4HOMA 1KBGL 4WWOA 4PJFA 3DO7B 4F8PA 4H88H 2ZCLL 4UQIM 4KO9A 1TZAA 5L2JA 4WF7A 1HL8A 4WUUD 3PNWA 4NJAH 3G5ZB 4ODHL 3L3JA 4X83A 1T5XB 4L5FH 2HX7A 1GZQA 3PWPB 4NXSA 3PNRB 5I23A 1Z1WA 2ZUQB 1AQDB 3W39B 3C8KB 1BFVH 5EBMA 3QEHA 1GZPA 3ULVL 4PP2B 5DRWA 4AC2A 4NQUA 2WUCL 5HHOD 1GPOH 4WI8A 3IMUA 3SCMC 1XTMA 4AZ8A 1I9IL 1JGVH 4F58L 4A55A 4P4KB 2AJXH 4Q9QL 4HCRA 1KGXA 1DL7L 1KIPB 2ADJB 3MBEB 2ZUVA 3REVB 2HWZL 1J1OL 4PS4H 5F7EH 4ADGA 3DX6B 3GEFA 4JANA 4Y5XC 2B1HH 3ULUE 4B60A 4UM9B 3QWRD 3PWLB 1S7WB 1L3WA 3N9GL 4JKPH 2AXFB 1QSFD 5D7IB 2FR4A 2PP7A 4FRWA 4PJAE 4NP9A 4HWEH 3LZFH 1ZAGA 2Z91A 1YEHH 3NFSH 4MA8H 3VXSB 1IC1A 1K6QH 4N22A 5HYJE 5DJCA 4ZUVA 4PJ9B 4ZQTA 2VDQL 3DWTA 2DI7A 1AC6A 1NMBL 2BWIA 3LKRB 3QXTA 1TQSA 4HIXH 2ZAIA 4TXVB 3OAZK 3P3SA 2Y36L 3HRZB 1O6SA 4LVEA 4NWUH 4OGXL 4PGCB 4EDWH 4M5YL 4NNPL 4KKCC 4ODTH 4X98A 5D6CA 1U8MA 4JFXA 4BINA 2FX7H 3PFUA 2IQAA 4ZX4A 1CPUA 4JAMA 3MJ6A 3L5IA 1A21A 4WGWB 3ZKND 3P73A 3V4UH 3DGGB 5ECGA 3ARQA 4IGBB 4ESKA 2IOMA 2YOCA 3MKKA 4DKDC 5E1IA 5I0YA 1CCZA 1YEIH 3OSKA 4YDJA 3LMJH 2ZYIA 2ZCKL 4E9SA 1KXVA 2FO4A 1OD9A 4MCZA 1RUQL 1RZ8B 4YO0B 1G9NC 5DJ0A 4IMLA 4Y4FC 3TCTA 1SJEA 3REWB 4JFDA 2CGRL 1INDH 2DJSA 4KVCH 4KITB 2YWYA 2WKGA 2X44D 4BE6A 5I1EH 2FAUA 4DPRA 2BNRA 1MRFL 5LGHH 1H5BB 2BZDA 2H3XC 2Y7OA 1R3KA 3LH9A 5TDNB 5IKCB 3T8MA 4JY6B 4F9PA 3O3EB 4CSSA 3L5XH 4GW5A 5D4IA 2XYBA 1CLOH 3BUYB 3BYYA 3TV8A 1A4AA 2J88L 4A7GA 3FPYA 1S8DB 3N55A 3VGAB 3KM1A 4K15A 1ZHKB 3MNMA 4IBUA 2Y1YA 3TBSA 3OTTA 3UTQA 3EOAA 3DTXA 4FQXC 1ADQL 2ZF9A 2NY2B 4QO1A 5C6TH 4OLEA 1S9XA 4Y4HB 4OCSH 3SDCC 1EMTL 4Z7QF 4KY2A 1I1AD 2W65B 2CR3A 3MA7B 4XMLL 3FRPG 4R5XA 5TGBA 3II2A 1CTMA 5FUCC 5TF1H 4AV0A 2Z35A 3Q2WA 2JB6A 3KR3H 4W6WB 2X4SA 4WUUE 5IQ9A 5A43C 2XX1A 4H20L 3AS0A 2XTJC 4ADIA 3ZDZB 3MLXH 3ZE2F 1WHPA 1AGEA 1BJ1J 3CC5A 3CFJB 1ZWIB 4MDIB 5IEHB 2YO3A 1Q1PA 5E8OA 3FTUA 3RJQB 5HHOE 1QHPA 5ALCL 3QYMA 1YDPB 2NPLX 4UILH 2J71A 1FO0B 1ZY9A 1XGRB 3QAQA 2E27L 4NFCA 1U58B 2BIIA 1HNGA 5AYQA 5J89A 4JKLA 4A6YL 2MFNA 1JWUB 3Q8FA 4MZRA 3TZVB 2C9AA 2XPGA 4ZUSB 1FC2D 4KRPD 4HT1L 3OKMB 4YGVB 4BE5A 1IC4L 1KCSH 1UGKA 1KZQA 1QSFE 2I85A 4BFKA 3EGXB 5HBBA 1QWNA 1KTLA 4RBPH 6PCYA 3ESOA 3BVNB 3IRPX 4HLEA 5IROA 1HKLH 3MDJA 5L6YL 1JGUL 4M3HA 5MENB 1NCIA 3GKZA 5AW9B 1HESA 5IVOA 3OXRA 2P47B 5JLZA 2IBZY 4L3EA 3UL4A 4HKZA 3H4FA 1HNYA 4RFEB 3UCQA 2VQ1B 4Z8FL 2XHNA 3VI4B 4BXSV 1OM3H 4QYAA 2ZCZA 5D1ZB 2UVEA 1NAML 3GHBH 3GXPA 3WKMH 1MRDL 5C07E 2VERN 4LHJB 3X12A 4NT6A 4IMKC 4LEOA 4H8WH 5K39A 4XP1L 1YECH 3HVDA 4NBZB 1WVZA 3F8UB 5DHVH 5ECJE 4ETYA 3QDAA 4EUPA 3UG3A 2VLRE 4F37K 4ZMNA 2WTRA 1VCAA 2ZX7A 3NABH 3ARZA 4NIKB 3W0WA 2N59A 1CMOA 4ZX6A 1FFOB 1JDDA 1AJ7H 1NIAA 3FRUA 4NC1E 4EN3B 3ULUH 2PYFA 3VXOB 3K2IA 2IMNA 4JFQB 4XMKH 5DFVD 1IAMA 2AJUL 4Q6IA 4Y88A 3RVUD 4E68A 2XZCH 1RZFL 1WBZA 1YEDB 3BPCA 5D2LE 3RLSA 3MRKB 1SUJA 3O6FC 1T3FA 4ZFFB 1VB9A 4ZAKA 5AWNH 4ZQKA 1YYML 3E6HA 1B4JL 4XPHH 4YUEH 2IANA 2HT2C 2BZCA 4XCYA 4GKZA 4MAYA 3UAJA 4Z78A 3MO1B 4XX1E 5E2JA 1I75A 2FLBT 4NM4H 2IBZX 2WNXA 3IDJB 2SEBB 4OZFG 3ZE1F 3NZHL 5K59F 5IIEA 3QQNA 4TVUA 3LYRA 1G7IB 3CZEA 4F2FA 3BHBA 4DW2L 1U8JA 2LT9A 5INDB 3B9VA 2UVFA 4AUUA 2Z31C 5HGBB 3EYSH 1E4XL 4Y16B 1RK0A 5DVOA 4KQ4H 3VH8B 4JUSA 4D3CL 3L3KB 2GSGA 4G6AD 1KFAL 2A1WL 3BP7A 4X6CA 4FYRA 4KNQA 3NFPB 1K72A 5E00A 2B5IB 3ZK0A 1S9YB 3DX9B 2WBKA 1BZ7A 1P4IH 3ORJA 4JJ5A 1NFDF 4L37B 4GINA 3EJYD 4FULA 5JOPD 2ZUUA 3KBHE 3L1OL 4EXKA 4PW4A 5T3ZH 3PQYB 2HRHA 3U6RB 1RZJH 1FGNH 1SMDA 1YEKH 2APSA 3QUXA 1OB1A 3S5LA 3IFPB 1HSAB 1SMAA 3VD9A 2BPBA 3FU7B 3NDZE 4EI5B 1JZ4A 3QJSB 4H25B 4I0PA 5CJ8A 3T65B 1FDLH 2Z8WC 2HKFH 3TH3T 1TNNA 1SYSB 5GISL 4D9LH 2CO6A 3W9EB 3AY4A 3MJ8B 4YQXL 4E2OA 3S88H 3TO4C 2C9XA 3A6BL 3D69A 5JPMB 1C12A 1OE3A 3NJFA 4EIBA 3ZTNH 1SXNA 3ZKXC 4HPOL 5E8PA 3ME0A 4GP4B 3BKJL 3IAPA 4ZPTA 2F1BA 5C0EB 1SM3L 4JN2A 5GGVY 5CSGA 2OCJA 1NBZB 4JPKH 1FL6B 4NSKB 3ECQA 3MLSH 4B9FA 5AB1A 2CZNA 4ZFZA 1IGFL 5MEPA 1HHGB 2J1XA 4JFDD 5D71L 4XNAA 5F71A 2X4QA 1AD0A 1A7PH 3EFOB 2BSSB 5FM8A 4AVHA 5JO5A 5K5YA 1OAXH 3H9SA 1YNKH 2BNRD 2ZOOA 3QHTC 5B1AB 3WJMB 2ZUWA 4HZLA 3WOVA 3JTSB 2OL3H 15C8L 3LRSA 2EDJA 4PBDA 3VGHA 1N8ZA 1T6WA 2XTSA 4NPJA 1MHHB 3MODH 1QFWM 4M62H 5EZJA 1MI5A 3NJXA 1FIEA 2ATPB 3RY6C 4YFEA 4B9JA 3BP6A 3K72A 1IM3A 5DLLA 4N1HB 5I76B 1UA6L 5IOPB 4PJCE 2VE6A 2ZKMX 2D7OA 2DV6A 4UT9H 3GLZA 1PX8A 4O51A 3CQPA 2X4NB 3HNTL 3QHZH 4ELMA 3GJEB 3HR5B 1YNLH 3WXVL 3E7JA 3JQOB 5IVXA 1H8SA 2Q3XA 5CLYA 2ENSA 3IAQA 4ILDA 5D6DC 3Q06A 2FT6A 4IU3A 3FQ1A 3MRHA 4N2NA 4LP4A 3GINA 5ENWA 3D2UD 1GMEA 3DXAA 2MOQA 4HJUA 5C0GB 1OW0C 2E7MA 3JVFC 3QO1A 4KZ0A 4NDMB 1U2YA 2GUYA 4GG6B 5C6WH 1RZ7L 2YSSA 3H4HA 4OSUL 2VN3A 5HYQB 5D70H 5CGTA 1TZ8A 5T5FA 4MS8C 3CDZB 1QFWI 4PIBA 4X9YA 1MFCL 3LEXA 5IHBA 3F05A 5J6HB 2LLNA 3IU4H 4AE1A 4U1JA 1EZUA 2CLRB 5EDSA 1BBJB 1NH6A 1TQTA 5JIKA 1S7TB 4XTRC 4OLXL 1BF5A 1DSYA 4OF7A 3EBIA 1U2CA 2F8VA 5K9KB 1UM4H 1Q9OB 3PHOA 3IGAB 3MRQA 1I3VA 4GXUN 2XNAA 1MLBA 4FQ2H 1DN2A 1FFQA 2DQUH 1NJ9A 1N8OE 2YEVB 4X42A 2APWA 2Q7AA 1M05B 3S4SB 2ESVD 1L7IL 3BSZL 5DK0A 3R06B 5IROD 3HZKA 5KJRL 3X17A 5HHMD 5JHAA 2GJZB 1Z2KA 2EAEA 5E1GA 5DJDA 5JOPE 5L4FA 4KXZH 5E8DL 4MQ7A 3WFZA 1BZ9A 3VJ6B 1HSBA 1JXJA 4F27A 3K81A 1KJ3L 2YN3A 3QG7H 5FOBB 3VQMA 3QR0A 4QLWA 4NUGL 3QHFL 5I1IH 5KW9L 4WI3A 4U6HA 4YC2C 1N70A 3RGVA 3X13A 3TH4T 2EIDA 1UB5B 3O8XA 4YZWA 2J8UA 4FAAB 1KGYE 3WD5L 4PJGB 1HHIB 5AKTA 1H8LA 4UM8B 1OCWH 1D5XB 1JRHH 1KPRB 4MCYB 2ZD0A 3C5SA 4X0KA 5SWQA 3RPIB 1I1CA 1IBGH 4PS8A 4OJFL 8CGTA 2J1ZA 4L1HA 4N0CD 5F7YC 4HFUL 5HDQL 5KSAC 3HG3A 3CSYB 4PJEE 3FAXA 1Q94A 1T1YB 2NX5B 3OR7B 1J8RA 1RIVL 3K2UH 4J28A 5CN2A 4MKMA 2X1PA 1I8UA 2GIMA 4U1LA 4N8VG 2PUQT 1MREL 4XMUA 4JFDE 3QUYC 3LPFA 5IGXH 1UJ3B 2VR7A 1Q0EA 1TJIH 3B34A 3LZOA 4ZAKD 4ORGB 4O02A 3LKOA 4U6XA 3RX8A 2HA1A 3SCMA 2QBWA 2BIMA 3L4YA 2BNRE 3NCCB 1HHKB 1OE1A 3GRGA 1S7QB 3UH8A 3I75A 4F7PA 3BE1H 3O3AA 3I02A 4KI5C 5D7JC 4MAYD 3SDYH 1CL7I 3OKEB 2BNQA 1XGYH 4Y5XA 2G5RA 1AYOA 1ZDQA 4XB3A 4NP4H 4PRIB 4WCYH 5FS5A 1TG8A 3D3VB 5HVHB 3OC8A 5AKVA 3MRIB 4FD0A 5F96H 2JH2A 2E56A 1CE6A 3RNQA 3PDOA 2YPLA 4PRAB 1AXSB 4LKCA 3H9ZA 5ANHA 1LO5A 4ENZA 5AG8A 1ZHNB 2DMKA 5GGSA 5E8EA 2K9UA 3O45A 3QQ4A 1VGEH 4PSRA 5GGUA 3VXPA 3AB0C 2YAQA 3TYFA 3H2QA 1IBDA 5JTWA 3WTSA 4PGJA 4WGVB 4RLDA 5FA3B 2EYTB 3Q2VA 2PTTB 4XX5A 4C59B 4QRUB 2BHFA 1F4YH 2YQGA 5IMOB 2WXMA 1UWYA 2EDWA 2LOEA 2YAMA 4CGTA 1KIUA 1ORSA 4WWPA 3DA0A 4O2EA 7FABL 4QHKJ 3OAYK 5GZOC 1WS8A 3DPBB 4XBMA 3M1BB 2R4RL 4MDRA 1X5YA 2BM3A 3QFJB 2IG2H 1AMYA 2QL1A 3TTYA 3S2CA 3P2BA 2YD6A 2EUWA 1JN6A 1XR9A 2IPUG 2Q7YA 5DDHA 2CKNA 3RAJL 3ZIYA 2W07A 1S7SA 4Y4FA 4G80B 1OK8A 3A4DA 3ROOB 5BVPH 1HK6A 3NIFE 3S35H 5CILL 1Q0YH 1BM7A 3J07A 4MMYB 4P5RA 3FKUS 1FNHA 4DH2A 1BVKB 1GS6X 1E8YA 3RPKA 5GGSY 1Z3GH 1RHHA 4KAQL 2YEZB 1RUKL 3T0EC 4NN6B 2ESVE 4ODXB 3M8OH 3UJJH 4Q9RL 1GTNA 2HRLA 1XSKA 4QOKD 2CCWA 4WHYH 4PJBA 3ALPA 4HZ1A 4PP1C 5KYWA 4RDBA 3AITA 4WWID 4ONHA 5F88B 3IFOB 1TETL 3KPPB 5DWUL 5I8KH 2NCEA 4IIQC 2PKDA 1OQXA 4R3SA 4UQ2B 5A16A 1FVDB 5AYTA 4PTUB 2XN1A 3GZPA 1P5UC 3VSVA 2BC4B 4JHUA 4P2CG 1JP5A 2G0LA 1A7NH 1F11B 2R29A 1MI5D 4G8AC 1Z9SA 5D2NB 1PLGL 2YOAA 4KK6D 3V4PH 4AUYA 2ROYA 4XP6H 4FQXA 5T3XD 4MA1B 2PABA 2HKAA 2DYPA 4GRWF 1HQRB 5FYLL 1TQWA 4YE0A 2E74C 3WEAA 1HILA 1JTPA 3GI8L 3QUZB 4BFIB 5GSRA 3UTPD 4PWKA 3DVNA 4U3SB 2GAZA 5C0FA 3GUTA 3QCUH 1FH5H 1JJUA 4NUJA 4WFGE 2A74B 1BVLB 4HK3J 5F9DC 2J72A 3DRQB 5SWZA 3V0DA 3H42H 5D5MF 5KSUA 3KYMA 4GJTB 1HN1A 3WIHL 3IMBA 2LAGB 1BZOA 1YG9A 4X6FA 3KPNA 4R7VA 1D5IH 4W9LC 3IFLL 1C1EH 2VAJA 3G6DL 4NZFA 2EDHA 4PHZA 5IV2B 5LXVA 4Z95H 3AS3A 2ZPKL 3IDMB 1U8OA 2ZNXA 4LAQH 5GGTA 3IXTB 1ITCA 3N0PB 4V1DD 1VACA 4G7YH 2Z65C 3WFBH 3BPLB 4Z5RA 2JVUA 2MTPA 4OGAD 1H3UA 5J1TC 1DVSA 2GEQA 3IB4A 3WNKA 2DQFB 1KYAA 2J20A 4N24A 1CQKA 1N6UA 2CUMA 2LU4A 3LNFA 4HBCL 3U46B 3L4UA 1FZJB 5IOKA 2H2SC 1CLZL 1LD9B 2VAAB 2VKXA 1KEMH 4M93C 4UIKH 3R4RA 2BSDA 3CSPA 3CX5J 5LNGA 3ULVC 4JW3A 3MTXA 3PAVA 1M7UA 2R2HB 2B3RA 4NERA 5BPPA 1T0MA 4Z3EA 1USZA 4CVXA 1CDJA 5KG9B 2YSTA 4E0RB 2BSTB 1S3RA 4Q52A 4NJ9L 5G5DB 1JVLA 2WO4A 5IF0B 3ARUA 1G1CA 4Y5YB 3VTTA 3TIEB 4F24A 1NM9A 3ZYZA 3CXDH 5CD3B 5CF3A 2NXYC 2OSLB 3KYNA 4IMKA 4JM2F 3THML 5K9OA 4LSPH 3DIDA 4LL4A 3ZHKA 3VXMB 1KDJA 3DMMD 3O2DL 3OXSB 1T21B 4XVJH 2Q2LA 5J3HC 5EO0B 3JTBA 4S10A 4XPTL 3UZVA 3RGVD 5KUKA 3HI1B 1ZHLA 1NLDL 2HZHA 4H8PA 4JZNA 5IQ7H 2F5AL 3P9MA 3MBWA 4OZHE 2PYEA 3QWOA 2CUHA 4NKMA 2DRUA 4HKXB 2IAMC 1I7TB 2A2QT 3HE7D 2J1KA 2V9UA 3BMWA 3O6FA 1A5FL 1V7MH 4P3DB 3FU3A 3FQXB 5CGYC 2D3VA 3OD3A 5GIRB 3ZDXF 3FOLA 4AZUA 2A4CA 4E9YA 2QKIA 1MWAL 1DHKA 4OCWH 1MY7A 2VDOB 5F1OB 4XI5C 3DUUA 3SO5A 1E5UI 4QOKE 2C1PB 1BVNT 1TJHH 3JYCA 2VM4A 2Q87A 1JWMB 3VXNA 4ZDHA 4JQXC 1S9VB 2PF6A 3BO8A 1WFOA 5GPRA 1N0LB 4BYHA 1DVFC 2XWJB 3GK8H 3ZRSA 2XFXB 3Q2NA 5DZ9A 4Z7UE 4HLZG 3VGDA 1LGVA 3FTWA 3PWVB 3RHWK 3IVKA 1DE4A 3VFVB 4WZ9A 2O5YL 4ZFGH 4PM1A 1SOKA 1ZSHA 1NKOA 3FTYA 2XG5A 3D87B 3VXQA 3JTTA 5FYJL 2AMUA 1MI5E 5T3XE 4N0UE 3WMQA 3LNDA 2I7SA 4JUTA 3BZEA 1CBVH 1M2VA 4P46C 4XODA 2MJWA 4DZBA 3ARGB 3EIFA 1UURA 3UTPE 3B5GA 2VXTH 4LHUB 1L0YA 5ICYA 2EXYC 2W91A 3QRLA 3C5JA 3KYOB 1KNOB 3F00A 1HIML 5E6IC 4P07A 4OM1H 1P4LA 3DSFL 4K3GA 1JPGB 4HMEA 1EERB 1OP9A 1E6JH 3QRGH 1BIIB 3N85L 1H6TA 4KKCD 4WI0A 4BIKA 4FEMA 4X6DA 2FEDD 3L5JA 4J3VA 1JZ3A 1ZK9A 3POCA 4HALA 4DUVA 3CHQA 2FD6H 3GI9L 4X6EB 1ZS8A 4XBGB 5C07B 2DL9A 4KKZA 4QRSA 4XVTL 2NW3A 3MLVL 2P8PA 3TO4A 4AMWA 3FMGL 1AIFA 3C60B 4N6RA 2EP6A 3SE8L 3QUMB 2QDVA 2GT9B 5BRZD 2VLRB 5DJ8B 3PJNA 1ZSDA 4EKXA 2QR0B 4GFXA 5ICUA 1I8LC 3FFCA 1FG2A 3KGUA 2Y06L 5AL0A 2ZYHA 2D3NA 1WG3A 2NLJB 2XQYK 3QIWB 4P49A 4QTIH 5FWRA 4PU2A 4DPAX 2IDQA 4WV1C 3KDPB 3F7PC 4UBDC 4YZFF 4NQDA 3FDWA 3H0TB 1HWHB 3DYPA 1DSFH 5BJTA 3SYOA 4TRPH 4DK3A 1SQMA 4K9EL 4NZRL 2XPYA 3F12A 2GK0A 3BD5A 4QYOB 5KJ4A 4F7MA 5HHQB 3DDGA 1CD9B 3CD4A 5I0VA 1BDYA 5IT2H 2K3HA 1CXFA 1A6PA 2VLJA 4K7PH 4X6BA 5IVZB 3RY6A 4G5ZH 4QHMB 2VH5L 3LS4L 3FU5A 1M56B 2OXGA 1H15B 1XZWA 3PG2A 4GRLB 4W4OC 5DR5L 1RUAL 5EUOB 5LDSA 2X4OA 2F53D 4FHKA 4HIJB 4DPCX 1SY6A 2F61A 5CSZB 1IU1A 2V5RA 2IBGA 5CINL 1MUJA 3U0WL 2VZUA 3ABLB 3CVHB 1NUFA 3NOIA 3BGFC 1AGDA 4JQIL 2QHRL 1A1MB 2QZ5A 5IQNA 4Q2ZB 3SDCD 4ZOCA 5D6DA 2NSQA 2QPEB 3P0VH 3WLWD 3ZMEA 3BKCL 2NY7L 2CIIB 3GBNL 3O0RH 3U48A 1E7UA 5HGDA 4PGBB 3VFMA 3CFEB 1OW0A 5KZCB 2OAAA 1IGIH 4YIQA 5CJQL 1ZHBB 1A2YB 1F3JB 3HCVA 1M9SA 2BOBA 5J5EA 4Z3FA 4LSRL 2OKMA 4DUWA 1RL1A 4L0PB 3N42F 2NZIA 3WIIH 4I77L 2FHBA 2Z4TA 2PN5A 2Q3AA 2ITDA 2I9TA 2Y7SA 3HHRB 3MV11 1MIMH 3C12A 4Y2LA 5EMYA 1J9CT 4X8XA 5C08D 2B7DT 3UJTL 5J9PB 5K69A 4GEIA 1U8NB 3ZUNC 4B96A 2CDGB 3QEQA 2R0LH 3BIBX 2AQPA 1DQJB 4NHUB 2P9RA 4S11A 5E9AA 1EBAA 5DHVA 5EU3B 3BLKA 1NOFA 4G7RB 1YEGH 4HX1A 5I6PA 4PPTA 4S2SA 5LCVL 3WO3B 2LR4A 1K2DA 1KB9K 1OB0A 2EH7L 4D0DB 3FC8A 1P6AB 2J5LC 3L13A 3CFDB 4BH8B 4ZFQA 1IO4C 2YD4A 4MYPA 4IS6B 2IVFC 3MNWA 4LEXH 5SX5K 4P4RB 3P3TA 4X7TB 3G6JF 2D31B 5FYKU 4QF1B 4FLHA 2XWTB 1BXUA 5E9DA 4N9GB 2VJ8A 3C75A 4JPIB 4WO4C 1UC6A 2XRAL 5JHBA 1U8HB 4ZZFA 4F91B 4FJ6A 2BP0B 2XQ0A 2ZZUT 1HAUA 3BKYH 4K9JA 2RR3A 4KZDH 3OAWA 1FYTB 1QNIA 2CBTA 5IESH 1IGYA 3UCRA 4OI9A 1A7BA 5IB3B 3HLAA 1S2EA 2FBJH 1HCYA 1ZTXL 2VJ0A 3KCWA 4G5AA 5C9KA 5L88L 2P24A 4MBOA 1DBKL 2HJFB 4PJCB 1J9QA 3NAAL 5KSAA 3ZE0E 5BRZE 1GGTA 3CDFA 2C7UB 1JI1A 3P77A 2R0KH 1NGQH 2PYED 1CDGA 2XWZA 5AKRA 2O30A 3K8LA 1M3IA 2VDLL 3QUYA 3RWDA 2V8LA 4M43H 3T0BA 1GIGL 3KAAA 4PJFB 4AYFA 2D9QB 3TJHC 4PJ5A 2R8SL 3OB8A 3OKDA 5D7JA 1KTDB 4W81A 3ATAA 3PNWB 4L1LA 2NY0B 1XWVA 3L3JB 4TSBH 3QSKB 3TV3H 2X70B 1NCOA 1E4WH 3I6KA 1GZQB 4M48H 4UT7H 4J3XA 1CVRA 3GS7A 5EBMB 3QEHB 4ZW3A 1GZPB 1M7DB 2TAAA 3Q9QA 1MJUL 5INCA 2F53E 4MNHA 2DN7A 1NCHA 4M4PA 1BF8A 3ETBJ 2XICA 2Q10A 2Z31D 2YFNA 3ZL1A 1B2YA 1J05A 1L4IA 2DTSA 1AXTL 5HJ3A 3FCGA 1DQML 4BQCA 4UANA 5IFHH 5MP6H 4DPBX 4JANB 2IGFL 4U6VL 5FUCE 4LCUA 2R0ZH 3O11A 4ZMVA 5MHSD 1VRSA 3SBQA 2XZQL 1OE2A 2EIKB 3O2WL 1M1SA 2FR4B 4UNTA 3HUJF 4X4YA 1XR8A 2X0UA 2XTJE 2DMHA 3R0NA 3T6XA 5EOQL 4DQOH 5KTEH 3NBNA 1O9WA 4XNXL 4ZMOA 2X0WA 2Z91B 1FNAA 3OAYH 4LDOB 5DJCB 4ZUVB 1OWRM 2JJTC 1BAGA 5EU4A 5GZOA 1PZBA 1B0GA 3QIBB 4BJLA 5BS0A 1PYWA 3PP4H 3D85D 3FSZA 4MB3A 1O6SB 5C08E 3FT1A 5D6CB 1NOAA 3MOBL 1U8MB 4LOUD 2FT7A 4JFXB 2IFGA 3RIFF 2X88A 4N4YB 4A37A 2CK0H 3WN5C 4X9HA 3L3HA 1WAAF 4M7JH 2DQEH 4NFBA 4PJHF 2R9HD 4XC3L 2CJTA 1CB4A 2X3AA 3U6XA 4F2MB 5BQ7B 4P2RD 3VFWA 3T77A 4JFOA 4WKZA 3P3UA 4GEJA 4YDJB 3HS9A 5I0XA 2BY1A 3T0EA 4M7KH 4MB4A 5E4IA 4OM0H 3CTTA 2FO4B 4XC1L 4MCZB 5CUSH 1PU0A 2EDFA 3PHSA 3MREA 4K8RH 1QW8A 4HC1A 4JFHD 4IMLB 5DJ0B 3T8XA 4IRJC 3JWNE 1SJEB 4Y1TA 3T1WA 4NZTL 2HVKA 3CFCH 4IIQA 3MRBA 4PVMA 5AD0A 2DD8L <