2ZOKB

Crystal structure of h-2db in complex with jhmv epitope s510
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zokB00
4OLWH 1YEIL 2A6KA 1DVFB 3SDYL 4WI9A 2NY3B 3CK0H 4LP4A 2KKQA 2UZXB 3H7BB 2YUWA 4GG6E 3G6AA 3QNYB 4OF5A 3MUGB 1XCTA 2ZUVA 1P4LB 2YWYA 4ONOA 4AG4L 1MLCA 4DGYL 1RUML 2H8PB 5HI5C 2DKMA 3QXDA 4JO4L 1DEDA 2ESVB 3BH8B 3FL7A 4O00A 3WFZA 5IFJA 3ARED 4S1DC 2R15A 3L3IA 3QA3A 3QDGD 5J4MA 4Y5VA 1ZKAA 3TPKA 4KK8D 1CL7H 2VDNH 1JWMB 3HUJA 4MLIA 1JUFB 1FV1A 4OV6F 2P24B 3D39D 2FGWH 1MHEB 4PJDA 2DYPA 2O5ZL 3WXWL 2AJZB 4R7DB 4LLDB 3AC0A 3HMXH 2AK1H 4UB0L 3F6IA 1MVFA 2Y4SA 1JV5B 1F4HA 4UT7H 3BRDA 3SGJC 2BY2A 1AHWA 3DX7B 4DK6A 4NQVA 1E4KC 4XMKH 3KPRE 2VZOA 3MRBB 2A0LC 3SDXA 4OLUL 3QUXB 2HJKA 5F7EL 4A6YA 35C8L 4U1NB 5BO1L 2A9ML 2XQBH 3VFRA 2HFTA 3VXNA 4MAYD 4PRAB 3GI8L 3MXWL 3TCXA 3VFUA 3EZJB 3KG5A 3LVEA 5IJKC 1FH5L 3HG1E 5T3XL 2VSCA 2DLIA 3EZ8A 5F9DC 4FXLA 1RFDL 3HAEH 3PE9A 2VZSA 4PJHA 1QFUH 3A6BL 1FIGH 1HSBA 4M00A 1IC5H 4E5XA 4H88H 3WS3B 2KPNA 2Z92B 4NO3B 1S7SA 4YC2C 2L7JA 3G6AB 4MD4A 2VDPH 1XCTB 3V7MA 2OL3H 1CICB 1C7SA 5FHAH 3PWLB 3HHRB 2DBJA 2R23A 1ZV5A 1MLCB 3CD4A 3IU3B 3G6DH 1U8QA 1BWMA 1KV3A 4WCYL 4F58L 5JORA 5JLZA 4EI5B 4JFEB 5T3ZL 5TF0A 4GAJH 3LKRA 5JXAH 3N1FC 1RZ8B 3QA3B 1M71A 4Y5VB 5FHBL 1YEKL 3VRLE 4OZIA 3STLB 3GSOA 3B9KC 3ILQD 3OPZH 5CCKH 1NMBH 4PJ5B 4KUZH 1FV1B 2YPLD 4L3AA 4BH7B 3AY4A 4PJDB 1S9VB 4BH8B 5HGBA 4M5YH 2FIKA 3JV0A 5TQ2L 4ZG1A 1JZ6A 4LEXH 2YD2A 1NANH 4JO2H 3KWWB 3KDMA 5E6IC 2FHFA 4IOFD 2CIIA 3EYUL 2OQJA 2VXSH 4AT6A 4X4YB 5FYKE 1BMGA 5DO2D 2UYLA 1RZIA 2ADIA 2VZTA 3VFSB 5J7CC 3MLZL 5EC1B 3WFHA 4MB5A 4HKZA 2IFFL 3WO4B 1BQHB 1AY1H 1BFOB 4A6YB 1VGEH 3MUZ1 3LB6C 4J6RL 2EE3A 2R0ZH 2ADGA 1QD0A 5F7DA 3CUPB 3VFUB 4FHBD 3RWIA 4G42A 1PGRB 4BFEA 5LQBL 4FQXC 3GO1H 3PL6B 5CP3H 5JIKA 4KROD 1HSBB 1B4JL 2NXYC 1I4FA 3JWDC 4CVXA 1AD0A 3L95A 2PYFB 3NIFF 1YPZA 3UJIH 4L8CA 1TVBA 1S7SB 1EJOH 5I1LB 1ZA3B 4P2QD 4LCCC 4MD4B 2H3NA 1XZ0B 2F8OA 1KOAA 1ZLUK 4RWHA 1DLFH 4N5UA 1U3HD 4FS0A 2HKFH 5JORB 4WGWB 3I6LD 1WBXA 4Z77B 5JLZB 1NC2B 3HUJF 3LKRB 3W9DA 4DAGH 3LS5L 4R90H 1JK8B 5C0RH 1GPOH 5E4EC 4PJDF 3GSOB 1OTUC 2EXWC 3HPLA 2YD8A 1UB5A 1BGXH 2W60A 4HJJL 2P46B 3MRRA 1MFNA 3C5SB 3T2PA 3H9SB 1T80A 5D9SB 5HGBB 2PO6A 5DMKB 1TJGH 4APQD 3PABA 3QJHA 4D3CL 4RWYL 3QQNA 3MRNB 4R4BA 4NJ9H 1K4CB 4XC1L 4HK3N 4XPTH 1IC7H 2MQ0A 3AFLA 3KDMB 2EIZB 3Q5OA 4N1CA 1XF3A 1S7QA 4OD1L 3SDXF 4ALAL 4ORGA 3E1F1 4X98A 2R2BA 3MRPA 1JPFA 5INDA 3THMH 2UYLB 1RZIB 1KIUA 4KTYA 1IKNA 3C09B 3T3MF 4HKZB 3BXNA 1WTLA 4N0YH 4HC1A 4WFGD 1UCBL 4FTVE 2GSGB 4BZYA 4S1QH 1NLBH 1UVQA 4EI6A 4EVNB 1FNSL 4MVBC 1N6VA 5F7DB 3TBWA 5TJWK 1DANU 2VH5L 2YWZA 4PJHF 1IAIM 4EN3C 1QSFA 1TJHH 4PRPE 4TSBL 5L8LB 3BRFA 1WZ1L 4LASL 1BJ1J 4XVTH 4LVOB 3EFFB 2FX9H 4FQCL 4H0GA 5F7YC 3RL2B 4CVXB 1Y6NR 3BMVA 1DVFD 4OGXL 5DJCA 5DMJB 4HIJB 2NY3D 2FR4A 3RIFK 2HTLD 1TVBB 4O2EB 1A3RH 5HDBF 5D1XC 5IJVA 4GMSL 3MRLB 3L3DB 1QKZH 2GTZA 2H3NB 1TETH 2DM2A 5EPMA 5HYFA 2LAAA 1CZ8H 4LLQA 1F45A 5CWSB 4Q9RL 3NAAH 3OF6A 5FYJU 3WUZA 3FZUD 1U8HB 5F70A 4OZIF 1JYVA 5I8OL 3IS1X 5C7XL 5DFVD 4I4WB 3QHTC 3DBXA 1EGJA 3O8XA 3X14B 2R2HA 4DVRL 1ZVSA 3PWNB 5FYLE 3GZKA 4MNQE 2HYMA 4LCIL 1NL0H 1QA9A 2WBJA 3HPLB 2BK8A 3QIWA 3Q3GB 2IPTL 5JHLH 2HFFA 1ETZA 4UOJA 5ALBH 4PTUA 2P8LB 1WZMA 2R4RL 3MREA 3PABB 4X6EB 5E1AB 3QJHB 3EOYG 2I07A 4WI3A 1CGWA 2H32A 3FQNB 4U0QB 2ADJA 5I1AB 1RULH 3GK8L 4OCYL 1XF3B 1QLRB 1T1XB 4OI9A 4R0LC 5HD8C 2XPGB 4X98B 5K9OA 5KOVC 3V9FA 5FV2A 5INDB 1FNLA 3ZL4H 3VXUB 3EDJA 5EOQL 2YA0A 3QUXD 2XTLA 1ONQA 3GIZH 3VXOA 2NTFA 4R2GC 3E6FB 3TO4A 4RBPK 1MWAH 4QRRE 4YGVA 4BA8A 2G75A 5IHZB 3A6CL 4RAUA 4KDWA 2P5WA 4QTHA 3MRIB 4BK5A 4MGXA 4ZD3L 4H1LB 1YPZF 3FO9A 2LE9A 3E2HB 5JIPA 4LLWA 1U0QA 1HH9B 4NDMB 5GXBB 4NN6C 3KS0H 4W6YB 3BKCL 5D2LE 1B2WH 1V7MH 3S3PA 1FNGB 4DN4L 1CICD 3O11A 2DI7A 1GL4B 4HPOH 3SE3C 5EPMB 3VMOA 2ITCA 4XPHH 4ENED 2EXYD 1KB5H 4EI5D 4JFED 5CP7A 4HFUH 5D7JD 3VG0L 5IB3A 3ARFA 2Z4QA 5TQ0H 3O8XB 2ZSVB 3FQWB 4L8DB 3HRZA 2QHLA 4LKXA 5GRWA 1HKFA 1W0YT 1RUPH 3BUYB 3S4SB 2ILLA 1FN4B 4PJ5D 3QFJA 5GGQH 1MSPA 4S1RL 1QA9B 2WBJB 2AJXH 1FNEA 1F4AA 3QQ3A 3MUJA 3RVWC 3HI6H 1QFOA 3T0WA 1U58A 1NDMA 3DWTA 5FKPA 3H42L 4ZS6C 4P2RB 3DLQR 1FJ1B 4FQQA 3A67L 3QRGL 3ES6A 1AD9A 3GUTA 2OM5A 1OW0A 5EUKB 3S5LB 2A1WH 5C86A 5DFWH 4FQ2H 1KFAH 2ADJB 3K4ZA 2NY0B 1U6AL 3MCLL 1CXIA 1I7RA 1OP5H 5CSZA 1BREA 3MJ7A 5CIPB 5I19H 1I9RH 3FO0L 3CVHA 1WCQA 2L0DA 1FIEA 3GSUA 4P59H 4EJ1C 1ONQB 2G2RB 1DQDH 4DKAA 2NTFB 1MIMH 3MRHB 1SYVA 4IMKC 4YHKH 5E2WL 3TO4B 2VXUL 2HT3D 1H8SA 3O3EA 2DRUA 2G75B 4AIOA 3CDGA 2OMBA 2BHZA 5EBLA 3E3QE 2IBZX 2P5WB 4JN2B 1FL5A 3C9NA 1S9KC 4PJBA 4LFHD 5JA9A 1QQDB 3PL6D 3FO9B 4JKLA 2IF7A 2IPUK 3OV6A 5CGMA 3MGOB 1JPSL 1Z3GL 3WUWA 5TDOA 2ARWA 1RJYB 5HY9A 3B5TA 3MRGA 4I5BA 4YK4B 2N7AA 4Y8DC 3LSOB 3O11B 3K46A 5E1HB 3GM8A 5I30L 3D18A 1W0VA 5JO5A 3PDOB 1FE8H 3LHPH 1A7PL 2FJFA 5CP7B 4N1HB 1NC2D 1X44A 1LHZA 3GB7A 3NCJL 2Z4QB 1LK3H 4PRIA 4Y2DA 4J3TA 3V5HA 3CDCA 5EIVA 5GGTL 5BW7C 1A14H 3IDGB 3PQYE 5DYOA 5DQJA 1KCKA 4CN1A 4X6DE 3BKJH 2BNUA 1INEH 1FNEB 3TBVB 2WMPA 3WDIA 3H9SD 5DK2A 1HOCB 3QWRA 3VA2C 1NDMB 2VQUA 1CBVL 2AS5M 4AZ8A 4LMQE 2QTEA 1AD9B 3ES6B 2RJMA 4PJFB 4MCYB 5E7BA 3TV3L 1QYGL 5HHXL 5C0ND 1WFOA 2ZCHL 1UGNA 3QNZA 3TIDB 1I7RB 5F6HJ 4UNUA 3DI2B 4JVWA 3MJ7B 4QT5A 1KUMA 5A16B 5ADOL 3GSUB 3RL1B 2ZP0T 1FRGL 4KFZC 1DN0B 3HFMH 5HHOE 3VGAC 3VXRE 3OAZH 4G5ZH 3QPQD 3O3EB 3MRKA 4JZJC 4LPVA 2OXHA 4JHZA 1J05A 1C1EH 2DJSA 5TPWH 4Y1AB 4XNMA 5DVLA 4KHTH 3GMOA 1MOEA 3F5WA 1SBBA 4NO0B 4TQEH 5AWNL 1FL5B 3WUWG 3C9NB 1HYSD 2C1PA 4Z8FL 4RZCA 4N9OB 4K3DL 4E0RB 1E6JL 2HWZL 5TDOB 4M6OH 1PY9A 3MBEB 2YS4A 1J8HA 2BVTA 3QAZC 4ELMA 3CNKA 4OLVH 4ZYKA 2IQ9L 3QEGH 5MEPB 4KZDL 4TUJA 5SWZB 4PJGA 2CR6A 2EC9U 5JO5B 3B2UC 3KS0J 3MLVH 1WIUA 4D9QD 1RZJH 2AK4E 5ISZE 4IIQB 2XRAL 2B20A 1SJEA 4A6YH 1FFNB 3CFEB 3KJ6L 5GJSL 4YDKL 4ZTPL 5I1HH 4Y2DB 1KJVA 3BD4A 2BXYA 3LEYH 2QSVA 1I85A 2XA8H 1OTSC 5IQ7L 4ZTOH 3W82A 5F3HB 2DMKA 1SY6A 1UA6L 1V05A 4OGAD 1ZOXA 1MF2H 1NGQH 3RVXC 2BNUB 1WJ3A 4JO3H 5H2BB 5SV3A 3BRGC 2X4QB 5EZIH 2CRZA 5FUOH 1QSEB 3SE9L 5K9KB 3E3QC 4HEPG 4PB0H 3EKCA 1CGSH 1IT9H 5C07D 5C0GB 1JGDB 2VDMH 3C8KA 1CLYL 4HCRH 4ONFH 4NBXB 5FECA 1EK3A 3U36A 4YFLI 1KF9B 2CKNA 2OYPA 3VXUD 4QT5B 1F6AA 1I3RA 1RUKL 1ZHKA 4PJ7B 1G9NC 1UKSA 1KEGL 4BQ9A 4X5XA 4X7SH 2CUMA 4PUBL 3X12A 4LRIA 5IP4A 1T0MB 3JV4B 1DQLL 5CINL 2O5YH 2E5EA 3SDDB 3FB6A 4PJBF 1ED3B 4NHCH 1J05B 4L5FH 4LCUA 4MA7H 1KG0A 3F5WB 1PX4A 1YEDA 4OCWL 5AZEH 3TYGH 1PLGL 1H9VA 2W0FA 3LN5A 3SGJA 3GMRA 3UC0H 5DJZA 1WV7T 1TZIB 2ENYA 2G60L 3I3BA 3UTSD 1E4KA 2R56L 2EC9T 3MCG1 2IBGA 2O61A 1Q0XL 4L4JA 3BMWA 3IDYB 1LNUA 1AGBB 5DJ2B 1U9KA 4AJ0A 4TTDD 3HE6C 5B21A 5I71B 3ULSA 1Y6KR 2MCPL 3DI3B 3D87B 5L2KA 4HWBH 3O8XD 3QUZB 2FL5B 4NIKB 5F71A 8CGTA 2VB5A 4FQPA 5IJKA 5L6YL 5L9DH 3CXDH 5HI4D 2OTWA 1TMCB 1SHMA 2J5LC 3W81A 1FGNH 3H9HA 3RDTC 5FA3A 4P2RD 2KZ1B 3WL9A 1AO7E 1XGTB 4WEBH 3TEUA 1JNLH 2ID5A 1OAUL 2XXCB 2EE2A 1U2HA 5I1EL 4JLRA 4QNPE 5ILTL 2B39A 2GITA 2NY0D 1EZVY 2IG2H 2FRGP 3C8KB 1Y18B 5LGJB 3L7FB 3TGXA 1K5NB 5JQHC 3RY5A 3W0WE 2AEWA 2B5IC 5GZNC 1I3RB 3QI9C 2VUYA 5DXWA 3F58H 1FAIH 1N0XL 3RUGA 2E9JA 4J1UA 5GSVA 1JWUA 3B9KA 4QRQA 3TO4D 3X12B 3WV0A 4ZSOB 2HMID 1M7DB 1T3FB 1DCLA 3C60B 3FB6B 4G8IB 2YR3A 4XCNB 3D3VE 1KEML 2P5WD 1WEJH 4OCLC 4WHCA 4X0KA 3ALPA 5CJXC 4KKLD 5E5MA 2V7HA 2W0FB 3WS6C 1JZ5A 4OI7A 3MUHL 2B2XL 1G9EA 3GMRB 3VDCA 1NCAH 1JFQL 4ELMF 4XGZA 2B4CL 2JE8A 3DXAE 5DJZB 2X9WA 5E6IA 5T33H 4FA8A 4MAUL 3S35H 1N5AA 1LWRA 1FSKC 4PJGF 4JY4B 3BE1H 3WIFB 1IGML 3T65B 2FJGA 1LNUB 4QXTA 1CGTA 1EBAA 4POZD 1A7NL 2CLVA 4JEGB 4WV1B 4Y5YA 3RWGA 3UTPD 4GG6A 4HS6B 1JRHL 3MA7A 1GH7A 3BKYH 1Q1JL 2QADC 1ZE3C 1RURH 3NFSL 3NCYP 4JJHA 4ETQA 2MPAH 4NO5A 2A38A 3B3IB 2Y6SC 2OTWB 1I9IL 4FQXA 5HVGB 1XF2B 3TLRA 4KKAC 1PD6A 3H9HB 3BJ91 3PGFL 2B0SL 3RWDA 3QHFL 2X1WL 3KPQA 4H1LH 4QTIH 4UI2A 5FA3B 2X1PA 4HIEA 4ODXA 4X83A 1VADB 1T6WA 4XNZC 4W6WB 5CBAA 1A1OA 2DQFB 4KKBD 1RVFH 4LCCA 1SQ2N 2GITB 4EOWL 5HDQL 4C83B 1KN2L 1ADQH 2G9HB 5IMKA 4I77H 1P7KA 4QRUB 1LEKA 4QYOA 4FP8L 1RI8A 1KTKE 3KPRA 5EO0A 4M93C 4TSCH 3NFPB 5DD3L 2DM4A 5DK0B 3UZQA 1NUDA 3B9KB 1FNHA 1SM3H 2AQ1A 5JOEA 1KXVC 1YUHB 4L3CB 4PLJC 3C5JB 1WFTA 4N0UE 4Y1AD 4Y16B 4NO0D 1J87A 4H25A 3NCCB 5E5MB 3OXRA 5ABDE 4DGVH 5KVFH 4YDIL 5FAAA 3HG1A 3LY6A 4IEFB 4OFPA 1Y0LA 1BFTA 2EDFA 3MBED 3L9RA 3PWUA 1V7NH 1ROWA 2H2PC 4F9LC 3SKNA 2UWEE 3LQZA 5SWZD 3TBTA 2FH6A 5CIPH 2QSQA 3RWGB 3VE0B 4U1KA 5CD5D 2AXJA 5BZDA 4FRWA 1O5DT 3LMJL 4I3SH 1I1YB 2APBA 1KENH 5I8KL 4KJYB 3WFCH 1KULA 1A6VL 4QLRA 5FF6A 4EN3A 4BUGA 3DECA 4NO5B 5T1DL 4H20H 1X5ZA 1EEQA 2OXGA 4LOUD 4FQXB 3SQOL 1EFXA 2ARJB 3FQUA 5LCVL 1QFWM 5E00A 3U46B 1QSED 1EMTL 4KJWC 4UQ3B 3T0EE 4P5MB 4ZFGH 1TQCC 2CJUH 3U6RB 1DE4B 1MAML 2D9CA 5D1XA 1KBGL 5HHMB 1AJ7H 5CBAB 3V7AE 3UTTD 4OJFL 4LF3B 5C0EA 5FOJA 3ET9F 5I2IB 1OF2B 3RUGF 1LEKB 1NCBH 4QYOB 4P48A 3QULA 4PGJA 4TTGA 4LSUL 3KPRB 4EBQL 5ESVA 3RZCC 4Y0GA 2EDQA 2WWKT 3CJJA 1JRHI 2JJSC 3OGCB 3SDDD 2DQJH 3IDNB 4OFYA 1EEZB 4R96A 1BQLL 1DL7H 3RWJB 3IDXH 4Y2OA 5IEHB 1OP9A 3O81A 4H25B 1CLZH 2M1KA 4I2XB 4JANB 3FCTA 1WZKA 1OPGL 1ZTXL 3VG9B 3R06A 3IKCA 5CJ8A 4JFDB 1T03L 3L9RB 4R0LA 1J5OH 5DLML 2KQMA 3FQXA 3M45A 4GG6F 3SKNB 4WHTB 3VD9A 3LQZB 2YZ8A 2YHGA 3TFKD 4C55A 2E6QA 5IB5B 4LEOB 1FZMB 4XPAL 4D94A 2VLME 2YKLH 1CR9H 2XIDA 1DBBH 4OLXL 3OJVC 2FO4B 1M05B 1T20B 4V2BA 4JFZH 2X4SB 3QUZD 2VNCA 4Z78B 2WP3T 3EHBC 2OI9C 1ES0B 4TPRL 5ERWB 4PLNC 4GS7C 4EN3B 3F7YA 3OTTA 4ONGL 3T1FB 4XTRC 1XGPB 4TNVF 4ZAKC 4WO4A 2HLAB 1H15A 5GGRA 3RAJL 4U1MA 2CKBB 1IMHC 1CG9B 4I3RL 5F88B 5E08H 3P9LA 2EDHA 5I1DA 3DUSA 1AGCB 3MXVH 4ODHH 3SE3A 5E99H 1PSKL 1UENA 4NKMB 5D71H 3ZYOA 1CIDA 2RCSL 5D6DC 5AZ2H 1YN7A 1MCFA 1OARL 1O7SA 1JHLH 4U1JB 3U9PH 3ECBA 5T3XD 2FD6L 1V3KA 4M6MH 4G8EA 2MKLC 3H8NA 2OR9H 3DX9B 3GMNA 4PREB 4ZXBC 3C60D 4TRPH 2DQUH 3CSYA 4NNPH 4QXUL 3OKNA 1RIHL 4PJCB 1S9YA 3SJVE 1XGRA 1FGVL 4FTVA 1I3GH 4YUEL 1UM6L 5I16A 5GS0L 2Y36L 2EH7H 3U7YH 2AJYH 5MENE 4YPGA 1I1AC 4ZOCA 3F7QA 1S9WB 3N9GH 4PJAA 4PRPA 1MCPH 4B7LA 1XGYH 3IKCB 3TBYA 3B2VH 4JFXA 3VWKB 5EN2A 1LDPH 2OJZL 3ZKXB 4DQOH 1R3JB 4P2CG 2A0LD 2DQEH 3T0EC 3V4PL 4JFFA 4TOYH 4NWTH 3MLWL 1C5BH 3QCUH 1MNUL 4IMKA 4X7EC 4UTAL 2YK1H 4TVPL 1FO0A 4ODTL 2MCG1 3MLPA 1UM5L 3AMLA 1CE6A 4M61A 3C6LC 1N8ZB 5DDHB 3VRLF 3MV11 3SOBL 5KZCB 4MWFA 5E94A 2CK0L 1YEIH 1T2QH 4D0DA 1BLNA 1VKXA 3EDDA 1IGJB 4K94C 2XNAB 4U7SA 3P0YH 4U1MB 4AEFA 4PRHB 3ULVL 1UWEL 4Z76B 5AD0A 5HPOA 5ESQA 5I1DB 1DBML 5BVJA 4LLAA 4YDJB 1JGVL 3STBA 1BAFH 5E7FA 1JNNH 1U93A 1UWXH 2HJFA 3KYNB 4NN7B 3P4OB 1NFIB 2RHEA 3AAZA 4M4PA 4GBXC 1GRWA 2CPCA 3ARZA 5D5ME 3V0VA 2A73B 4OFIA 3PHQA 4PJXA 3U0WL 4P49A 5BW7A 4KMQA 3NFNA 5IFAH 1Z6JT 2OZ4L 2CDEB 3GMNB 5EWIH 4ODVH 3VXPB 1MRFL 1MAJA 1SY6H 4Y16D 5LAXB 5ITBL 4DKEL 3RU8H 5GRVK 1XGRB 3PF2A 1FZJA 3KYOB 1LILA 5MEQA 2VLKB 3DUUB 4BSWA 4X7DC 3REVB 4QRRA 1U8NB 1ZVHA 4J3WA 2A6IB 5GSRB 1C08B 4JJ5A 1CFNB 1FZOB 4JDZB 3OJDA 2JB5L 5KVDL 2HVJA 2CUIA 5F7EH 3NCYS 1FC1A 4JFXB 3WIHL 4YAQA 3HKFA 4NHUB 2A9MH 2P42B 4LKCB 5J06A 1KCSL 4ZUTA 4XCYB 3TF7C 1JHKH 5D2LA 1EZVX 5T3XH 3LB6D 2BHUA 4NPYB 2XKUA 3ZYIA 2J7LA 1CE6B 3HNVH 4JZJA 4LNRB 4RFNC 4YHOH 5GRJL 2B7DT 2OSLA 4KV5E 1ACYL 3P9WB 2ARJQ 1HI6A 2VXQH 4FQXD 2RQ8A 1VKXB 5J6HB 4D9LL 3HS0A 1NBVL 2MSPA 4MNQB 3OKEA 1NCDL 5EZJA 4M8QA 3HPJB 2EDYA 4JFQA 2XZQL 4BSVB 5CFHA 2BX5A 1I8LA 2XYCA 3P11L 2HN7A 4WCYH 5HHMD 4J3UA 5SX4H 5HYQB 5FGSA 3GSRA 5F96L 2YD9A 4WFFD 1F2QA 4HX1A 3UDWC 1HH6B 2H41A 5BRZB 3ROLB 3AAZB 4YBQD 3VH8A 1QLFB 3KPRD 3IYLW 1YEFH 3V0VB 2EKJA 4X5LA 1JI1A 4U1IA 5IMLB 4AENA 4ZUUB 4JPKL 5HHPA 4CU6A 3TO2A 3ZKND 1YMME 1J0YA 3V6ZA 2LU4A 2JELH 4NC1E 2X1XR 4OD2A 3C8HA 3QZWB 2R1XA 5HVHC 1BVLA 1FZJB 3QISA 4MMXC 4PJAF 5MEQB 4YJZL 1BFVH 4QRRB 2DTMH 4XVSL 2YEZA 3OJDB 4JFDD 2NZ9C 2W9DH 1EO8L 4U3CA 4PP1C 2A9NH 3AXLA 4KK6C 4YAQB 4JRYE 4LSQL 4R7NB 4L4VD 1H5BC 1ZAGA 1VFBB 4X4ME 1XCQA 1T1ZB 4BZ2H 1I9JH 3HI5H 3VGAB 3CIQA 1OSZA 1A21A 5DUBA 5TFSL 1P5VA 2Q20A 3LRHA 4XPGL 4OFDA 2R8SL 4F2MB 3FO1A 4MXWH 1KJ2L 1K9TA 4WFHE 4JQXC 1MREL 1DQQB 1YNKL 4S10A 1DBKL 3VWJB 3PQYA 4PLKD 5C0BE 4TUOA 1CLCA 4X6DA 2QBWA 1G7HA 1U3JA 4PY8I 4Z95H 5EZJB 5GHWL 1T7VA 2FSEB 4XI5C 4M7KH 2ICWI 3QAZB 5E8PB 2HN7B 2AP2A 1AQKH 3CDFA 3HE6A 4JKKA 3AROA 2F58L 1D6EB 3BPNC 4MA8L 5DA4A 2RAMA 3VH8G 1G1YA 4HX1B 3VCLB 3P4NA 5IVNA 4ZFOB 2VC2L 4RISH 4BZ1L 5KVGH 1BF8A 3VH8B 1JTPA 4YHLH 1UFUA 4WW2C 2LQRA 2BVQA 1JZ4A 1TCRA 1A47A 2BMKA 4RX4D 3SDAC 3GMLB 3KLAB 4DW2H 4F57H 1AGEB 1T2JA 4O58L 5HHOA 3GJFB 4XBGB 5HHNB 4XBPA 2CRMA 1TPXB 3VXRA 3RDTA 3S34L 3WSQH 2AEPH 2R1XB 2QR0A 1WBZA 3IS0X 5JQ6H 3G5ZA 3JWDH 4HUVA 4HGMA 4YHZL 3SE4A 3BHBA 1VFMA 5ADPH 1NEUA 3DRQB 4LDLB 3VWKD 4NWUL 4O2FB 3T08A 4HKJB 1AR1C 5D2LF 2EYRA 3AXLB 2MTPA 4IOIA 3P77B 3E0GA 3NCBB 3UJTL 1J9CT 4M48L 4P9HL 3QI9A 1WCBB 1UJTA 3ARGC 3EGSA 5CGYC 3MTRA 3PWPA 1XCQB 4P5TB 1DSFH 5I17B 1GC1L 3BH9A 2Q8BL 3T4AA 4HS8H 3HC3L 1UWGH 3OR7B 1UH4A 4ELKA 5DRZA 4HWZB 4GRWB 5J1TC 2ZUUA 4RFEA 5KZCD 5ISZA 5IG7B 3O0RL 1K8DA 5H94A 4Z7QE 5CJXA 4B0MM 4HUWA 3QJFA 3VI4F 4GT7A 3WS6A 4ZPTA 4MJIE 4GMSH 4WI5A 5ECJE 5EOCH 5LWYH 4PRHD 3S8WA 4TUOB 4X6DB 3VGFA 1KT2B 1G7HB 2DKSA 3MRFA 3M17A 4NC1C 5TDPA 3IGAA 3MV9B 4U6YB 5IT2H 1TCMA 5EIIB 1OT1A 4PV9B 3MLTA 1YJDH 5C7XH 2V5RA 1ZT7A 1OSPL 3HI1B 1MUJB 2ZWLT 2HAZA 4HUNB 4M7JL 2YZ1A 2GIYA 3LKNB 5AG8A 1JNHB 2JKXA 1DBAH 5KW9H 4HKXA 4IJ3B 4LLYA 4QRTA 1VFOA 3W9EB 3DX8A 2P8MA 3GHEH 2J5LB 3RVWD 5IVXE 1CXLA 2Q8AL 4ZS6D 2ED8A 3CLFH 4HK3J 2VLKD 4NKOA 3JTSA 3CH1A 2CKBH 4D8PA 4HUVB 3VA6A 5K9JL 3IU4H 1KN4H 1URLA 5EOQH 5LGHL 1S7RB 3M8OH 1J0KA 3SY0A 4F7MB 5GZOC 1CTNA 4IOIB 5IBLD 3OAUL 3NZHH 3QR2A 1CCZA 4C4KO 3QI9B 2ERJC 1LO4H 5DA0B 1QR4A 2C3WA 3ZKQD 3RVUC 3I50H 2AW2A 1ORSA 1S5HB 4R4NC 1A6WL 4X7FC 4X7TB 5JDJA 4N8CH 1IAMA 1KPRA 2VKWA 4ZD3H 3BPLC 3MPCA 1F42A 5TE6L 5C9KA 4RFEB 2AK4B 2XFXB 1N3NB 3QDHA 4WUKL 2Q86B 3BQUC 5H94B 1F8TH 1QSVA 2J8OA 4HUWB 4X6DF 2D9QB 3BKCH 2RFXA 4ZPTB 4OM1L 2NNAB 5FYLD 5M95B 4MNQD 4XXDB 2H26A 4BM7A 3QUYC 5CZVL 4RDQG 2XWTA 3BT2L 3RVVC 2XG4A 5CJOL 1BPVA 1RY7B 5I1CH 4TULH 1X5LA 3C2AL 1AO7A 3MLTB 2HP4A 1O7VA 5C0FA 5DEFB 1F4WH 1B0RB 4A2MA 4D0CA 3QDJE 4HH9A 4IMLA 2P5EB 5BOPA 3G04B 5BRZD 2J6EL 2FIRT 1J1OH 3KVQA 3V6BR 1NCWH 3VMPA 3W0WA 4LLYB 4QRTB 3OKYA 4Q0XL 4WI2A 4Y4KB 1F58L 3DX8B 3ESVF 3LH2L 4X9FA 4LSVL 3A67H 1YN6A 2DQHL 5CLWA 5KTEL 3W11C 4G3YL 3PNWB 5EG6C 4NFCA 5BXFA 5KN5A 1W8OA 2VDOH 3BP4A 3LV3B 4NKOB 4QRRD 3JTSB 3FTGB 1T4KA 5DC9B 3D3VA 4XNZB 1UYWH 4NRYA 1LE5B 2Y07H 4PD4J 3SY0B 4M1GH 3FMGH 3MJ9L 3WNKA 4Q9CA 2NY2C 1CFVL 2VIRA 3DXAA 1M4KA 4QHMB 4X8JB 3B9DA 3WLBB 1A64A 3RZCA 1T7ZA 4HT1L 3VJ6A 2VQ1A 1ORSB 2JJSA 3IAQA 1X6NA 3ULUL 3HR5A 1OLLA 4K3GA 3RNQA 1S7VB 4DK3A 4U1SB 4ZNEE 2EDRA 4OUOA 5EC2A 1IKFH 2RFXB 4G8GE 4MA3A 2R29L 3K81A 3VWJD 4UT6L 3GFUA 2AVGA 4JQIL 4NYLB 1TVHB 2DM7A 3R0MA 4RDQF 4U1LA 1YY9D 2Z8SA 1C5CL 5DI8A 1EO5A 2J88L 3X3FL 2PXYC 1A7PH 1VEMA 4CMMB 4OLWL 3NCJH 1TENA 2J4WH 2EYTB 5EOCJ 3CK0L 1OGTB 1I7TB 3B2UD 3NMEA 1GVIA 4D0CB 1WISA 1BFSA 5D7IB 3VFPA 2BSED 2K3TA 4LHUG 4N1EA 2HA1A 4GXUN 4ODWA 3BKMH 1XH3A 5JNYA 3W0WB 2CRYA 2OTPA 4HAGA 5BS0E 4PJIB 1J86A 4G6KH 4RIRB 4ZAKA 5FUZH 2YUZA 1CL7L 2VDNL 5GISH 1LQSR 5DHVA 2DLTA 3ARBC 1U8KA 2IAMC 1AIFB 5KN5B 3U9UA 3PWJB 2D2OA 2DF3A 4RGNE 2FGWL 2ZCHH 5FYLH 5ICZA 1TQCB 1T4KB 4N0UA 3WDHA 1W0WB 3HMXL 1FFOA 1QHOA 2AK1L 2OTUB 5A43C 4NRYB 3LIZH 1ZA6A 4Z18A 1E0OB 4UT7L 3MO1A 4KGJA 4YR6B 5D6DA 2VIRB 2MQ3A 1ITBB 5BVPH 4JKMA 4XMKL 1A22B 1S78C 4P5TD 3VFTA 1W72L 3JWNC 3HMWH 5F7KC 5F8QC 2UWEA 1ZLVK 3EYFA 1IC1A 4RQQB 4XX1E 3IDJB 4ZXBA 4YEFA 1YNTB 3FT4A 5K33A 4CADA 2XQBL 4LVNB 2ZOKB 1N59B 4Z8FH 2XG5A 2VDQH 3AVEA 1E6JH 3OSKA 4JCLA 4Y7MA 4OCSL 5FIEA 4M8VA 1ZT1A 2BVYA 3O3DB 1BOYA 1I1AA 2HTKC 4OZFB 5LBSL 4KRPC 3QUKB 3MV9D 1QFUL 5DI8B 3TVMC 1NAMB 1IC5L 2HJLA 1MELA 4H88L 2LFGA 4QNPF 3T0EA 1X5XA 5HYJE 3P9MA 4JM2A 1U95B 4KPHH 1KTDB 3S3SA 3UROR 2VDPL 2OL3L 3KJ4B 5DGRA 1C8PA 2UY6A 3BDXA 1LEGA 4ODWB 4UIKH 3C6LA 1UZ8A 2WW8A 5T1LB 1XH3B 3N50A 5JNYB 5KANI 4OUUB 2OI9B 3LAFA 4GAJL 2OK0H 4GMTH 4QHUA 2DM3A 5DT1H 2N4IA 4ZAKB 5SWQB 4GKZA 3HB3D 4HZAA 3OPZL 3SE9H 1NMBL 4P2OC 1U8KB 4M1DH 4Q7DA 2MKWA 2X9XA 5SWSE 2XWBB 4M5YL 3EDEA 2FO1A 5CKGA 2ITDA 2CLZA 4LEXL 2N1KA 1ZA6B 4YLQT 3QG7H 4HUXB 4JO2L 4MSWA 1WFNA 1AXIB 3P30H 4G6JH 1NPUA 3QI9D 2VXSL 4GBXA 3WKML 3PDGA 3G08A 3PIQB 3FJTA 4LARH 3CC5A 1G7QA 1L0XA 2UWEB 1FBIH 3EYFB 4EDXB 3D85B 1AY1L 3LQMA 1VGEL 4U05A 1VB9A 2YC1B 2YUXA 2AK4D 3FT4B 4OZHE 3QDAA 2R0ZL 1NGYB 1ZMYA 5D96B 3GJFH 5IMMA 5KSUA 1NC4A 4NQEB 3OX8A 3JV6B 1ZT1B 3GMQA 1I1AB 3T77B 3MV7A 4JRXE 2HFEB 1D5IH 3V5KB 3BESR 3GO1L 3HC0B 2RB8A 1JGEB 4WI4A 3D9AL 4HEME 2A83A 5JZ7D 3FRPA 1MPAH 1NGXA 2HJLB 3FOLA 3GGWA 1IM3B 4RGNC 3UJIL 5EUOE 3HNTH 3P9MB 1EJOL 2R0WL 2GHWB 5DS8B 5E8NA 2P5ED 4HDIA 1G9NH 4HIHB 4PBVC 1QFWH 5DJDA 5C8JB 3G5VA 1T5XA 1DLFL 3FB5A 1TITA 5T1MA 3RWCA 4AMKH 5C3LD 2HKFL 3C6LB 4S1SH 1YDPA 4GRWH 2ICWB 4Y4KD 2W0KA 1P7HL 4OT1L 4DAGL 4PG9B 3K2UH 2Y6SD 4R90L 5C0RL 1GPOL 4KKAD 2VMFA 4TNWF 1V5JA 2EO1A 2HRLA 3NN8B 4YZFF 3KYMB 4WW1A 1JZ7A 3V4VH 1K85A 1FVEB 3S96B 4AM0A 3WO3B 1NAKL 3SJVA 1X5HA 1ORQA 1GGBH 2X2YA 1TJGL 3WNOA 4LCWA 3VMNA 4NJ9L 4MSWB 4QY8A 1G7LA 4K7FB 1IC7L 1RZKL 5F1SA 3TT3L 2VLJA 3BW9B 2UWEF 4ODUA 5BV7B 4MXQC 4JGJA 1WK0A 5C0CE 3TESA 4KI5E 4PJ9C 4DEPC 3I3DA 3G08B 4J3SA 3THML 1H3TA 4WENB 5IMOB 1KNOA 3WKNA 5DK3A 1CFQA 4N0YL 5ID1B 4PLJD 3P0VH 3LKPA 4DN3H 4FZ8L 1JFQH 4S1QL 2B4CH 1P53A 4YFDB 3B5HA 5KSUB 5AYUH 4O2CB 3QXUA 4DCQA 3TPUB 1IGMH 4UQ2B 4GG8A 1TJHL 1D5XA 3FRPG 2W9LA 2ZKHH 1KGCD 4XVTL 2HKHH 4KKCD 2FX9L 2H2PD 1T21A 3J8F7 5J0BA 1JRHH 4PD4K 3U30B 1MIEH 3O6MH 4F15C 2D4DA 1H5BA 1MCIA 4LIQH 1EEYA 4OFKA 5DTFB 4TNVK 3H7LA 1NANI 2FWOB 1CF8H 1QKZL 1R5WB 2FZ3B 2GUOA 1G84A 4L3EE 1TETL 3SHSA 1WT5C 1CZ8L 4L9LC 5F7UA 4P4KB 3F62A 3G5VB 1TLKA 3NAAL 2YRLA 3VD7A 1GGTA 1YDPB 2AV7A 1OY3B 4JPVL 3RX5A 2BNRB 4N0FA 4WVRA 3KYKH 3QG6B 1F3JA 1LEIA 4JQXA 4KJQC 2ZSWB 2G5RA 5ICXA 3Q5YA 1BJMA 5DJ0A 1NL0L 3CH8A 4GQPH 5JHLL 1G7JB 1ZHNA 4K3HA 4MA1B 3SBWC 3L3JA 4QWWC 5ALBL 1NGWA 5L2JB 3SJVB 3L3HB 4O4YH 3HC4H 2XI9A 5C1MB 1ORQB 1I8IB 4XMPL 3HTLX 4QF1A 5MENB 4GRLC 5J1AA 3PJSA 2DOCA 3FONA 4EKXA 5I9QC 4IRSC 4OZ4A 1G7LB 4QXGH 4CN4A 2GSIA 1RULL 4NNXB 3T3PE 1ZHBA 3BN3B 3DGCR 4M62H 4HH8A 4WW2A 1KNOB 3LKQA 5I75B 3HZKA 4ONHB 4XCEB 3SDAA 1P2CA 2XICA 5HSFA 3GIZL 1QPXA 4WJ5A 5E4IA 1JPGB 5FYJE 2I9TA 3P4LA 2BJMH 1ZHLA 3ZE0E 2PTTB 2J8UE 3I02A 4M7LH 1MWAL 4LQ1A 3U4EA 5B4MC 4DCQB 5BJTA 1KPUA 1IM9B 5F3BA 3TNNA 3LDBB 2W59A 3U2SB 2I24N 1MCWW 2HVKA 3PP4H 5HHQA 5D6CB 1MFAH 3EFDH 3MMEA 3S97C 1UXSB 1A7QH 3G5XA 3I2CH 3JV5A 2EEBA 4AL8H 2XWJA 4H0HB 3MRMA 1D5BA 1TZGH 3ARGA 2EIDA 1B2WL 1LK2B 1V7ML 3FFCE 3MC0A 2APTA 4HPOL 4QCIB 2C3VB 1Q38A 5IW1A 4XPHL 5T1DH 3V5DA 4I0KA 3GSQB 5T1LD 4JHBA 3VFGL 2JCCE 4O51A 4NKDB 4HFUL 2AV7B 4MJ6B 5IHLB 1QBLH 1F6LL 5FGCE 4KI5C 5TQ0L 4N0FB 4PJ8C 5E2TH 3MROA 5D1ZB 3B8YA 1F3JB 5D5MB 2W91A 1LEIB 1RUPL 3R8QA 4JB9L 3L5WB 4AK1A 3CZFB 2X1QA 5ICXB 5GGQL 1G7MB 1YMMA 2GJ6D 1GZPB 2AJXL 5KSAB 5J9PA 5I15H 4XAKD 2GYSA 3KPPB 3MX0A 5LG1A 4ZDHA 3SCMB 1NGWB 1MCQA 3QDMD 5HVFB 3BPOB 4QF1B 2AJUH 3TN0D 5HHVH 3BPNB 3MCKB 3N1GC 3PJSB 3FONB 4FFZH 1G7IB 2A1WL 5FDWA 3RKDD 4EUPB 4FQ2L 1KFAL 3R4DA 4Y4HC 3G5YA 2GSIB 4UIMB 3TBSA 4U1GC 5C09B 3U0PA 3B8SA 2I5YH 1I9RL 2VZ3A 4JRYA 4OKDA 4WW2B 1RD6A 5EZLA 3D85D 3TM6A 4P59L 1BIIB 5IHBA 3SDAB 2IC2A 1WGOA 2BNQB 4K55A 4KDTC 3CZJA 2I9TB 1DQDL 3MBXH 3ULVD 1MIML 4YHKL 1ZHLB 1IGFH 1RHHB 3WNMA 4NQED 1A6UH 4LPUA 1MH5A 4CNIA 3UBXI 3CFBA 5I1IL 2NZIA 3LN4A 4TVSa 2AI0L 1LD9A 2JIXA 4G43A 4L4TA 5E6YA 2D0FA 3X11A 1JYWA 3OG4B 4NOFA 4NRXB 4F33A 5HHQB 1JTOA 5C0BA 1A4JA 4Y88A 3G5XB 2XWJB 1BBDH 4WFEE 4ZUVA 1KB9K 5JR1H 1A6ZB 4LQFL 2V5YA 4XP4L 1UEYA 1A9BA 3K4AA 3MGTB 1HQ4B 1EUTA 5IW1B 4ACPA 1FE8L 3DIFA 3C6LD 5D5MF 1S9XA 3PV6A 4Z0XB 1U92B 5CUSH 3BQUA 1CU4H 1LK3L 4W68A 2CH8A 5JPNB 3IJYA 3B4NA 5DF0A 4PTTA 2I25N 2IANE 1Z5LB 1A14L 3MODH 3BPCB 3LEVH 4K9EH 2D4FA 1T04A 3BKJL 1INEL 1U8LA 1PSKH 1YMMB 1GYAA 3ZHDA 5J9PB 1I1RA 2DQDH 3MNWA 1X5FA 4OZFH 2PETA 5EO1A 1AHWC 3FN0H 4MYWB 2RCSH 4LLMA 4WUUE 2HFGH 4ZDHB 2QV2A 4KK9D 3BISA 1MVUA 3B83A 2EE6A 1NAMH 1MRCH 3V0WH 4F37F 2YSSB 1ZVYA 4LDOB 5FDWB 3N1QC 4ZUWB 4WW2F 3PHOB 4WHYG 5GGTA 1FZKA 3TBSB 3CAFA 4N90D 2F53E 4YXLH 1D7FA 1HWGB 1WC7A 3KGRA 2PYEB 1HHJB 5TGBA 1RIHH 2FBJH 4N8PA 3UMTA 4YUEH 5EZLB 2R1YA 2EDXA 2FEDC 1QRNE 3RTQB 4JG0L 2ZUQC 5J57B 2V5TA 3HFML 5IB2A 2Y5TA 4KV5F 1NGZB 4G5ZL 4AIZB 2H9GA 4OB5H 3K1KC 5D93C 2QSCL 1C1EL 1SEQH 2R69H 3CLEH 5TPWL 3CFBB 3GDBA 1E28B 1EAPB 1F3DJ 1BZ9A 32C2A 3NPSC 1ZANH 4V1DE 2EYSA 4JKPH 2JIXB 4G43B 3NABH 2NY6C 4JPIA 4F33B 4Y4FC 3MLWH 4MJIA 5C0BB 1MNUH 4JZOA 4Z5RB 4YIQB 2DD8L 5MI0B 4POUB 3W2DH 2BOCA 4XCFH 3D25A 4PR5B 4ZUVB 2ERJB 2C5DC 4OLVL 1WIOA 4KMTH 3QEGL 3DROA 3HLAB 4P4KD 4HWNA 1QZ1A 3NCMA 4HUUB 2IPKB 3MLVL 3PG2A 2NR6C 2VUOA 3MRCA 5IK3A 1RZJL 2FNBA 5I76A 3PV6B 1ZWIA 3MV01 4A6YL 2OP4H 3BQUB 3IXAB 2BNRD 3UAJC 5I73C 1UEMA 5I74B 4EEEA 3LEYL 5HDLA 4I8DA 2XA8L 4ZTOL 1JGVH 4KHXH 5F9WC 4J4PA 1MF2L 1HEZB 2IH1B 3QUYB 1IEHA 1U8LB 4JO3L 4N8VB 2PR4H 3LRGA 4HMDA 1MJJA 3JVGC 4PP2B 5EZIL 5IVXA 4G6FB 2N7BA 3LZFH 5IQ9B 1NBYB 5FUOL 3RQ3A 2XN9E 3BGFC 5MEND 1QR1A 1MHHA 1T1YB 4GXVL 5LXGH 2A2QT 1TTGA 4PB0L 1CGSL 1IT9L 1PDKA 3RGVC 2VDML 4HCRL 4ONFL 2APVA 2EKSA 3VU2A 1WC7B 3QYCA 5ANME 4LRNH 4YHPA 1J88A 3CDYA 5IFHH 5DUPH 5DSCA 1D5ZB 3JUYA 4S0TD 3KXFE 3EBAA 2R1YB 4L29B 3L6FA 4MNHA 3OZ9H 4X7SL 2IGFH 1A6TB 1BVKB 3GSNB 5EZOH 3ARBA 2IAMA 2AXFB 2QQLH 4YH6A 2I9LA 4K94H 1TTFA 2C26A 2O5YL 3MRQA 4V2CB 4DJMA 3LKOB 5KJRH 3IVKB 4LSSH 1Z0NA 2Z93A 3HZMB 4NHCL 3SO3C 4DUXA 1JCKA 6FABH 4L5FL 4U4BA 3U83A 3I6KA 1FVCB 2X4PA 5AZEL 3TYGL 2Z9TA 4A2LA 1IM9D 3MA9L 5KSVA 1E27A 1R3HB 2NZ9D 2EYSB 1X5KA 4H26A 4OAWB 1R5VB 3UC0L 4RFOH 4KK6D 3KYAA 3MLYH 4WI7A 5EH1A 1H0DB 5BMFL 1H3UA 1U91A 3BP6A 5BV7H 2CLRA 3SPVB 3BN9D 3DROB 1JGUL 1HHKB 2DB8A 3O3AA 2QSTA 3G9VA 1FQ9C 5IK3B 3QDJA 4F7CB 4HWBL 5D1ZD 4HS3A 1CE1H 3CXDL 4Y5XA 1VA9A 4XWOD 5IUSA 4LL9A 2VZ1A 3FRUB 5F96H 5KSAD 1FGNL 1J10A 3TVMA 3SCMD 5IVXB 3DO7A 2LTQC 3HZVA 2PXYB 4WEBL 3D5OF 1JNLL 1W72B 2H1PH 3KPTA 4LU5H 4Z7UE 4YX2H 2YUVA 5F7FA 5B8CB 3L3OB 2IG2L 1NSNL 2VXVL 2WIIA 3ARDC 3EOAA 3NIGE 5C09D 2EKSB 5L0QC 5IGXH 4XNUL 5ITFB 5DSCB 3V8CA 2VQTA 1GHFH 2COQA 3F58L 2BNQD 3BGAA 1FAIL 4CN6A 3QQ4A 3OKDA 4MNHB 4GUPA 3BO8A 4XVSH 1ZLUH 4P2OA 2ORBL 2IAMB 2I9LB 3EO0A 4IRJB 5FGRA 2AKRB 2BC4B 1YEEL 3MRQB 5C0DA 2X1OA 3D2UA 4JN1L 1WEJL 1QO3A 4ZNEA 2DBLH 3ZT5A 3QXTA 4M1CD 1KIPA 4P9HC 4PGDA 4G8GA 1KXTB 3BAEH 4PRBB 5T33L 3CPLB 4PJEB 1GC1C 3S35L 2CGRH 5CGYD 3BE1L 3BZEA 5KOMC 1NJ9A 4GKOA 3BP6B 1GZQA 4MZ3A 1BEYL 1RPQA 2R8SH 4S0SD 2YXMA 2ZPKH 4TN9A 3RIAF 4K3JH 3O3AB 2QJDA 1QPPA 3G6JB 3QDJB 4JFPB 5DQ9A 2WBWB 1L7IH 4HC1L 3BKYL 1DQJB 2EIEA 2Y5EA 1R3KB 1RURL 5GHWH 2C3XA 5FCSH 5BS0A 3KPMB 2MPAL 2EZ0C 5IVXF 5IBUB 4GAYA 5E8OA 5C08B 3AS2A 3JTTA 3UXFA 3MJ6A 4YO0B 4KRPB 1P4BH 1PQZA 1U3ZA 1VGKA 1WVZA 1NEZB 3TVMB 3QWOA 4KXZH 4QTIL 3ULUE 1A6AA 2FDBP 5TE4H 3DO7B 2VC2H 2X4TA 3HZVB 5EFIB 4CBPA 4Z7VE 2FLBT 5MHSE 4J3OC 2LVEA 3DGGA 5CZXC 5IEKB 5E9DE 2FGZA 3MNZA 4PYHA 1RVFL 3SQBA 2AGJH 2NQCA 3EOBB 5J12C 1A4KB 4KAQH 1QVOB 1MCCA 3GKWH 2PYED 1ADQL 4I77L 2GK0A 3CFDA 3V79C 1EHLH 3S34H 2P8PA 1EX0A 1RK0A 1IBGH 3RTQD 4X5WB 3QQ4B 3L5JA 1EVUA 1HHIA 4TSCL 3E6HB 4LVHC 5D1QB 1KTLB 4MJ5B 2Y7QB 3EO0B 4UDTB 5C0DB 5I8EB 4G80B 2ZJSH 4W4OC 4CMHC 4U1HB 5DD0H 1JF5A 1QO3B 5IV2B 4U2YA 4B41A 4F80A 5A2FA 4DGVL 2JIXD 5KVFL 1K8IA 4GW1A 3NCFB 2A6JA 1X5YA 3GSVA 5C0BD 5KSBE 1E6OH 3REWB 3HC3H 3P73A 2V2TA 1U8PB 1CK0H 4PJ9A 1V7NL 2VL5B 3LPFA 1FYHB 1GZQB 3ARFC 5KVEH 1X6LA 5HYJA 4CL7A 4MLSA 1CD1B 2V17H 4MQ7B 4LGRB 2VERN 5HYSG 3ESUF 1C5DB 1RIUH 4I3SL 2V9QA 1QP1A 5DQ9B 5SX5H 5DRWB 4OBRA 1KENL 4Y8AA 3WFCL 5DMGD 5F7WC 1MCRA 3RWHB 4H20L 3QUYD 4PJGE 1OGAE 3KPNA 3WHXA 4G6FD 2QKIA 3QWOB 1B4RA 1A6AB 2X4TB 4RBPH 4ZOBA 1MJ7H 4U6XB 3INUH 3DGGB 2EDJA 4ZFGL 2RGSA 2CJUL 5SWSA 1HQRA 3SKOA 4C57C 1AJ7L 1TNNA 4XP5H 1WT5A 2D31B 5C9JB 3S9DB 3LD8C 1DFBH 3DTXA 5EU3B 5DJXA 1CGVA 4LAJH 1RQ5A 2GK0B 3CFDB 2R2EA 1G1CA 4JG1H 1NCBL 3OG6B 2ICCA 4XX1G 2P8PB 1RK0B 4XZUA 1T83C 4KQ4H 3W11D 3QO0B 1OAKH 3SGKC 5BQ7A 1CXHA 1I8KB 2AEQH 2OR7A 1PG7L 4HK0B 2AEIT 5LGHH 4DFIA 2DQJL 2P7TA 3IDXL 5JHDB 1WQVT 2D7MA 4N68A 4OZHA 5GRXG 3SBWA 5T5NG 5CEZD 3ZTNH 4F7EA 5JW4R 3OKKA 4GRLA 4QOKE 2Z0BA 1WLHA 4JRXA 1S7WA 5EBWB 1OQXA 2NXZB 2DQTH 3P73B 5FKAB 1IRAY 5C0AB 5FB8A 3ULUC 4HLZG 3AM8A 4XCCH 1ZS8A 4WUKH 4P46D 3QEHA 1IZJA 5EUOA 1Q9LB 1VERA 2YKLL 1CR9L 1UXWB 4OM1H 1DBBL 3RFZC 4MCZA 4JFZL 5CZVH 5E95B 4YFEA 2D7NA 4C54A 3H0TB 3RX7A 3RY6C 1CWVA 43CAA 1NBZA 1SMAA 5F8RC 3TYFB 1GIGH 1NH6A 3TCLB 3WHXB 2QKIB 2PXYD 4M4RA 2BOBA 4R4FH 43C9A 1OD7A 1GGIH 1DLHB 1B6UA 1FVDB 5FO7A 4YNYA 1HQRB 1IGIH 5JW4M 4D9RE 3CFJB 1G7PA 3MXVL 4ODHL 3QCVH 5E99L 4L9LB 1E4WH 4NSKA 1JF1A 3O9WC 4K7PY 5D71L 5E56A 2DQHH 5AZ2L 5DJXB 1JHLL 3U9PL 3EUUA 4WWKC 2R2EB 1QEWA 3BEWB 3T2QA 1QFPA 4HXAH 5C0CA 4J23A 1BD2D 4PJ8A 4M6ML 5ALCH 3VFVB 2IALB 5D72H 4LBEB 3VXSB 2YD3A 1YYLH 3VXMB 25C8H 2GJZA 4YDVB 3H3BC 2OR9L 3EYVB 4UU9B 4CVWA 4IRJD 1OWWA 1MCNA 5D7KE 3TZVB 1M7IA 4TRPL 1ZT4A 2DQUL 4NNPL 4R9HA 1G6RB 3LN9A 3NZ8B 3VXTA 2VE6A 4HZLA 4OZGA 1F00I 2FJHA 4GKSA 4OZHB 1I3GL 5T5NF 3FO2A 2D0HA 1ZEAL 5DJAA 1ND0B 2EH7L 4FN0A 5F7MC 2AJYL 3U7YL 1ERNA 3A6OA 3BSZH 2Q6WA 4GRLB 5CBEB 1LGVA 1RZ7H 1XGQA 3H2WA 4KRNA 1H8NA 4IRSB 3OHXA 3N9GL 1MCPL 4Y4HA 4NRZA 2V7NA 1S5IH 3FN9A 4XHQA 3B2VL 4H5SB 1E4XL 1WBYB 1LDPL 4JO1H 3C6SB 4NQCE 4Y19B 2DQEL 2F54B 1ZS8B 4R3SA 3TIEA 4LPWA 5DD6A 4MD5B 4TOYL 2AJVH 4NWTL 1C5BL 1I85C 4L3EA 4BSJA 1GOHA 2YK1L 5HYIA 3BDBA 1Z2KA 3GSNH 2Q7YB 2OR8A 1UJ3C 1HKLH 2D7TH 1HXMA 4N5ED 1CQYA 2DLGA 5H35A 4LPXA 5C08D 1T2QL 3WE6B 1XIWC 4NBYB 4PGBA 1IEBB 5H37G 5CEZH 3U7WH 3OB0H 3HNSH 3P0YL 1GSMA 4BUHA 4M6AA 2ZUYA 4OV5B 2XT1B 4E9LA 5EA0L 1KIRB 5E8DH 2ICEB 4GW5A 5C0IA 3RPIA 1BAFL 1AKJA 4HF5L 4IS6A 4TNWK 2YPLE 5J3HC 2XTJC 4BFGA 1JF1B 3IFOA 1JNNL 3DVGA 2GFBA 2IH3B 1VDGA 2L4OA 3U4BH 4LRIC 3VRJA 5L7XH 1OTTC 2V2XB 3RY4A 4ZFZA 4R97C 1YEGH 1MAKA 2RR3A 2YRZA 3OWEA 3UEZA 5GPRA 5D1QD 1HSAA 1Q72H 5IFAL 5TDNA 2GJZB 4OZHF 1GJIA 2X70B 4MS8D 5EWIL 4ODVL 1RK1A 4KUCD 5J1SC 1JGLH 1M7IB 1SY6L 1ZT4B 4ZOAA 5FFLA 1A1NB 2VE6B 3RU8L 4QRSB 4M7ZB 2VR5A 2J8UA 4NKIH 4ODSH 2YRPA 5JXED 2BHYA 1HHHA 2VXTH 3FOMA 5CEXB 1B0GB 5FOBB 1XGQB 1W72H 2VLRE 3Q6FB 5GIRA 2YPKB 4NRZB 3WN5C 1R3LB 5DWUL 2PCPB 1QLEH 5EUOF 5E24E 2OZ4A 1HXYA 1DZBA 1IAIL 4RCAA 1BJ1H 5DC4B 1I1FB 3WCYA 4R3SB 2E8YA 3STZB 4KK8C 1JHKL 4XRCA 3FFCA 4OCSH 2CK2A 4HGWA 4L3EB 5F7NC 1P6FA 4L8SB 1LE9B 5J6GB 5LBSH 3TJEL 1TZHA 3TNMB 1FFPA 3HNVL 3P3YA 2JCCA 4YHOL 4P2QE 1HXMB 3QSKB 5F6IB 3GMMA 5GGVY 3WIHA 1FG2A 4Q58C 3BGMA 2VXQL 2A6KB 4S2SA 1SEBA 3VI3F 2EDOA 4UOW0 3I6LE 4Y4FA 1F11A 2WWKO 1S7UA 3RBGA 4DZBA 2GJJA 4WU7A 5INCA 1JIBA 3CXHJ 4PRNA 4XWGH 4GW5B 3QXDB 4FXKA 3RPIB 2EDLA 5IFJB 1A1MA 3L3IB 3DVGB 4KI5F 1TQBC 1E4XI 1P4IH 1UH3A 3HUJB 3OJ2C 4M5ZH 5AEAA 3GHBH 2DLFH 1YEFL 4Q2ZA 2DYPB 1HSAB 3AB0B 3RHWK 5TDNB 1IGYA 4M7LT 1RK1B 2JELL 5JHDD 3OBAA 3JVGA 1AHWB 1JTTA 5DD5H 3BUTA 3C2SA 4NQVB 4BFIA 2WP3O 1BFVL 1NMAH 1HHHB 2Y06L 1A0QH 3WKMH 1CS6A 2DTML 3EOTH 4G7YH 4WFGE 2P45B 1FC2D 2D03H 3SDXB 1A3LH 2NXZD 2W9DL 2YD1A 3RGVA 1T5WA 3OR6A 2HJKB 5C0AD 3CFCH 4Y5YC 4PPTA 4P5KA 2A9NL 1XR9A 1HXYB 2DTSA 3VFRB 3VXNB 3R1GH 1FDLH 3QPXH 4BZ2L 3PGCA 3ILQC 4I0PD 1I9JL 3BIKA 3HI5L 4NNYA 5DJ6A 4L1HA 2ATPA 1FFPB 4JFYA 4XH2A 4JFHD 5D93B 4PJHB 1EBPA 1RUAH 2JCCB 3D9AH 5DZOA 4E5XB 4MXWL 3GMMB 5F93C 5FGCB 2WIMA 1J0IA 3RI5F 2R0WH 2IANA 2NY6B 1EA9C 5F9AC 3Q48A 4IOFC 2WQRA 2VTFA 3NH7H 4DZBB 5ID0A 1JYNA 4XNXH 4Z95L 1IZKA 2Q87A 1EHAA 2R23B 5DO2C 4M7KL 1T7XA 1U8QB 4WUUA 4MDIA 5CEYA 4XVUD 1AQKL 2QHRH 2GY7B 3RX8A 4OT1H 2UZIH 3O6FC 3T3PF 1A1MB 1FHGA 5IR1A 3NIDE 2D3VA 5KBNC 4BKLA 1M71B 4WNQA 3WJJA 2AJ3A 4OZIB 1VFAA 1CXKA 4RISL 1DUYA 1KLUA 3FT3A 4NQDD 5DJYA 5KVGL 1IAII 2CSPA 2F53A 5IOPA 4YHLL 1IQDA 3BIAX 4KRMB 3VXSD 3VXMD 1HN1A 2X89A 4UT9H 1PKOA 1NAKH 2FIKB 3ZE0F 5IWLC 2J8UF 4HV8A 4ZFFA 3TZVD 4XAWH 1QRNA 4DW2L 4F57L 4KROC 1XF4A 1A9EA 1CDIA 5EU7E 1RZKH 4NJAH 3WSQL 2AEPL 4JM4H 3TT3H 5A2JH 2IADA 2DL9A 2CIIB 3F7VA 5JQ6L 3JWDL 2OQJB 4AT6B 3BGFB 4GRLD 4YXHH 4IRSD 2ADIB 4NZRH 3WFHB 5ADPL 4V1DA 1UB6A 3D0VA 4Q6IC 3ARDA 5HTSA 4DKDC 3BP7A 1N0LA 1JNJA 4FZ8H 4Y19D 2F54D 5SX4I 2ADGB 3T2OA 1DSFL 3IDMA 3UYRH 4G8FA 2JCCF 3RWIB 3QEUA 4G42B 4HS8L 3LKSA 1UWGL 4PJAE 5DZNA 5DJ6B 2ATPB 2E6JA 5FK9A 1IAKA 3MLSH 5IHUH 2SEBA 1I4FB 1AD0B 3CVIH 5DRNA 4AIXA 3L95B 4APQC 2H45A 3QNXA 4HQQH 3UTOA 1YPZB 4FFWD 4JFFE 3O3BA 4L8CB 1INQA 4JFEE 5EOCL 5LWYL 3ROOA 1U8IA 4DOHB 2ESVD 5IT2L 4NZUH 5CEYB 4PJ5E 3DPBA 1WBXB 1YJDL 3W9DB 4JPVH 2XN9A 2CO7B 2ZCKL 3I6GA 3S7GA 4BKLB 4MQXD 1VFAB 5J11C 1GAFH 3FT3B 1Q8MA 4HLZH 2F53B 1DBAL 1UB5B 4P57A 5KW9L 4UAOB 5ANMA 2W60B 1AFVL 4F37K 3MRRB 4XBEH 5L88L 1GGYA 4YXKH 4KRLB 3KXFA 3U4AA 2PO6B 3GHEL 3MNVA 4XMPH 4L1DA 1QRNB 1K2DA 4UNVA 1XF4B 2ZNXA 4R4BB 2PW1A 4E41E 3U82B 2BRRH 1OAYL 3CLFL 5SX5K 1NCUA 5JMOC 2NY3C 3HRPA 1F6FB 1S7QB 2CKBL 1UM4H 4ORGB 3GBLA 2R2BB 3MRPB 1JPFB 4PJXE 3IU4L 1KN4L 4HXBH 2FX7H 1SJXA 4V1DB 3D0VB 4RMVA 3M8OL 3FZUC 3BXNB 3L5XH 4XPFL 2HLFD 2MHAA 5GS2H 3DRTA 4JHWH 5DFVC 3NZHL 1OB1A 1JZ8A 3VW3H 1UVQB 4EI6B 3DV4A 1LO4L 1SMOA 1MFEL 5MEOA 3TBWB 3IDMB 3NTCH 3I50L 5FYKL 4G8FB 2A6DA 4HIIA 1QSFB 3BEVA 4WU5A 4N8CL 4WO4C 1IAKB 3MLXH 2VISA 4W4OA 1G6RH 1NUFA 1F8TL 5DRNB 1T7YA 1P69B 3MV8E 5DJCB 2FR4B 1JJUA 3O3BB 3UO1H 5IJVB 4WY7H 1INQB 1LO2H 4PBWD 1PKQE 5JUEL 2GTZB 3RA7H 2JLLA 4LLQB 1YYMH 2DDQH 1DBJH 3DYOA 3UZEA 3VFGH 5EU7C 3TJHD 5I1CL 4TULL 3SKJH 2FB4L 4K23H 2JF1A 3IETA 4KJPC 4Z7UA 4J8RA 5FA4A 3DBXB 4DTGH 3IJHA 1F4WL 2R2HB 1OD9A 1ZVSB 3H9SE 4IRZH 2LABA 4JB9H 5EULV 3EDFA 4S11A 1HHGA 1J1OL 4K7PH 3VI4E 3K74B 3QIWB 1NCWL 4L8BA 2HFFB 5ANMB 3ZKSD 2DYPD 1ETZB 4MJ2A 4PTUB 1OAXH 1KXQE 3MNVB 3MREB 3VFWA 2I07B 5EBGA 1U8JA 5HGHA 5IB4A 2H32B 2VDOL 4PGCA 4FQ1H 4X99A 5CAYB 4OI8A 3L5IA 5CMAA 2J6EA 5K9OB 3PP3K 4PB9H 4KMLB 1CICC 3CXHK 1UYWL 5CZKA 2Y07L 5I1GH 3U7AA 3WNLA 5J12B 1UH2A 4M1GL 3FMGL 3MOQA 4EI5C 2E9WA 5D7JC 3BFOA 3O4LA 3VXOB 1NCTA 3UP1A 2F5BL 1OM3H 3DV4B 4YGVB 1T83A 2PTUA 4JPWH 5I1IH 3SGKA 1M6OA 4RAUB 4OQ1A 4QTHB 3WNPA 2AI0H 5EU4A 1OAQH 4LLWB 3T0AA 2VISB 4R8WH 1IKFL 1B88A 3EYQC 2OJEA 2NY6D 4FG6C 2DJUA 1WSST 3BD5A 4LQFH 4XP4H 5F9OH 4M6NL 4OIAA 2ITCB 4ETYA 1T6VN 2DMCA 3SO5A 2MWCA 2Y9RT 3WO4C 4Z7VA 5IB3B 2FYYA 3ARFB 3IETB 2J4WL 2VDLH 4Z7UB 5FA4B 5E9DA 2XZAH 3ZKMC 3HRZB 3LEXA 2NR6D 4LKXB 3WNNA 4XNQA 5IW3A 5C70A 3QFJB 3QHZH 3QQ3B 3BKML 1AQDA 2XACC 1FO0L 4YE4H 3T8XA 4DUVA 1NLDH 1U58B 2BZDA 5FKPB 5F97E 4CDHA 5C07E 3RY6A 4FQQB 4LCYA 4G6KL 5FUZL 5B3JE 5GISL 3VFWB 3GUTB 3T4YA 3GMPA 3VXUE 5FYLL 4RMQA 1YEJH 4RMUA 4X9GA 5C2UB 1KC5H 5CSZB 5F9JA 1I9EA 3LIZL 3CVHB 3O9WA 4JG0H 3OB0K 4H0IA 3QIUA 4UV7L 1SYVB 5KSBA 4WWKA 4AQOA 5BVPL 3FT2A 4WFED 1JN6A 3CGTA 3VFNA 2XXMB 2QSCH 1HE7A 1CN4A 3HMWL 4HSQA 5DVMA 3CDGB 2E7CA 5EBLB 1MHCA 1T1WA 1QHPA 1GGCL 3UTSE 3GNMH 3HMXA 4NGHH 4PJBB 3DETD 5EU4B 4KDVA 1CYGA 2VDQL 5FYJH 3WUWB 2DD8H 4QHNA 1PBYA 3CFKA 1Q9WA 4P4RA 3RIAK 1BZ7A 1I8LC 2VJXA 3PWPE 5HY9B 3MRGB 2FEEI 4I5BB 4BQBA 3KNBA 3BYYA 5GGVH 4ESKA 2KL6A 1RZFH 4X6FA 1OGAA 4Z7UF 1BVZA 3D18B 1W0VB 3F12A 4JRWA 3CMGA 2WZPD 2IEPA 3C09C 2FJFB 2W38A 1I8MA 4PBXA 3ZE1F 4Z7VB 4HFWA 2FYYB 3GB7B 5HGDA 1IFHH 2FBOJ 4PRIB 4KPHL 3V5HB 3NIGF 1WICA 3M07A 4P2RE 4HG4J 3QPQC 5DYOB 2F9BT 2DI9A 2F53D 5DQJB 3WLWC 1F4YH 4CU7A 4UIKL 3ZSTA 1AQDB 2DIAA 1UJ3A 2D7OA 1XGUA 3HAEA 5DK2B 5FM5O 2OK0L 4GMTL 2PO6D 4CVZA 4HJ0C 2NY5C 3N06B 1XIWA 2ZUWA 5DT1L 4G6AD 4GXVH 1TJIH 3T4YB 4M1DL 3FQTA 1IL1A 3QNZB 5JDSA 5FXCH 1ZXQA 5M94B 4DZ8A 3F8UB 1LMKA 2UVEA 4PS4H 4WEMB 3QG7L 2IFGA 2R0KH 3QUMA 4Q97A 4QOKA 1N6UA 3P30L 4G6JL 1P6AB 2HT2D 5E8EA 4ZFOL 2BERA 1JN6B 2MJWA 4LARL 2BSSA 3MRKB 4J3XA 1FBIL 1SJHA 4XNMB 3GMOB 1QSFD 3MA9H 1MI5A 4C4KT 4OSUH 2C1PB 2K1MA 4K8RD 4RZCB 3UPRA 4Q9QL 3V8OA 2JJWA 1CT8A 4JFOA 5EBMA 4KTEH 4QHNB 3CFKB 2XY1A 1Q9WB 1BIHA 3UTPE 2GTWA 1J8HB 4HHAA 4P4RB 5BMFH 4ELMB 1G9MC 4HWUA 3ULUF 1D5IL 2MFNA 3KNBB 4ZYKB 3D0LA 4KVNH 1JGUH 3UYOD 4Z7VF 4WIQA 4TUJB 3ARPA 4PJGB 3WN5A 3OF6D 3KPLA 4QO1A 4K71B 1MPAL 1T66C 5B38A 3AREA 1I8MB 1SJEB 4XMLL 3QDGA 3I85A 3HNTL 1D6VH 1ZLSH 1KJVB 4JQVC 1J1PL 4N0RA 1G9NL 1QFWL 3LQAH 4HIXH 3EO9H 3HAEG 4I9WE 3D39A 2WBJD 1MCBA 3QIWD 4AMKL 4PJFE 1P9MC 4S1SL 4ERSL 4NQXA 2R2CA 1BX2A 3K2UL 5K9QG 1INDL 3UZVB 2DICA 2NY1C 3E2HC 2J3SA 3SE4C 3K1DA 3S35X 2QQKL 3O41A 3C5ZC 2IMNA 3FQTB 1IL1B 1NSNH 2VXVH 3PGDA 5JDSB 3V4VL 5CZXD 3EJYD 5FECB 3ZO0A 3U36B 3GBNH 3FB8A 5F72S 4XNUH 1FPTH 1F6AB 1GGBL 1ZHKB 4I18C 1K4DA 5KSBF 2XTJB 4OCXH 3TWCH 5HI3C 1IEAA 4Y1AE 4NQSA 4X5XB 4MAYA 3S37H 1J0HA 3IFPA 2ORBH 4OCMC 4R97B 4POYA 2QQQA 1YEEH 3BDYL 2BSSB 1QBML 4NQCA 5FM5M 4JN1H 2AV1A 4LCUB 5HJ3A 1KG0B 1YEDB 4IHOA 1WZLA 4B5EA 3SKMA 4RNRA 5J89A 3P0VL 4XPBH 3LN5B 4DN3L 1T0NA 3RNKA 4OQTA 3GI9L 5B39A 4JAMA 5AYUL 3K7UA 2VWEE 1NFKA 4HHAB 2HH0H 2O61B 3BZ4A 5MERA 4AEHH 1BEYH 1JVKA 5B38G 4P9MH 2ZKHL 2HKHL 3ULSB 4HLJA 3FFDA 1MIEL 5EU5A 3O6ML 3ARFD 5L2KB 4HC1H 4GW4A 4LIQL 2F5AH 2YOCA 1CF8L 3DMMC 3L3KA 4OM0H 2NY7L 1QSEE 2YPLA 3QFJD 2HMIC 1CDCA 4FQJL 4FXGA 4ZPVA 4ODBD 1UQSA 3ZDZE 5ACZA 1WWCA 3UTTE 4D0BA 1BX2B 3WL9B 1RU9H 3KYKL 4K8RH 4YC2B 1Q9KA 3WBDA 3B6SA 4PJ7E 4JLRB 1A6PA 2N56A 2PN5A 3PGDB 3D1MC 4WTXA 4YK4C 4CVUA 1GGUA 4O4YL 3FB8B 3HC4L 3WFEH 3M1BA 1MLBA 4POZC 2OBGA 5F1IA 2X9YA 3O6FA 1JL8A 2VSDA 1GOFA 1E4JA 3RUGB 1IEAB 2VLRA 4J1UB 1EGJH 4NQSB 4QXGL 1JWUB 4WGVB 5GSVB 4QRQB 5IW6A 4RGOL 3PDDA 3IFPB 4F3FA 5A3IC 5JOFA 5K93A 1X5AA 3HZYA 4Q6YA 4M62L 4LAQL 4NQCB 4YZFE 3OKLA 2VAAA 5HJ3B 5IWLA 1XF5A 4U31A 1QFWI 4X0KB 5B39G 1CDYA 2V7HB 4CU8A 3EAKA 2BJML 1LO3H 3RRQA 3MRJA 3RNKB 2HG5A 4XGZB 4M7LL 5E6IB 5JOPE 1BJ8A 1RJZA 2H32H 1N5AB 2X09A 2DL2A 4P2QA 4KKBC 3BZ4B 5CD3A 3H3PH 2FJGB 4QXTB 3QQ9C 4ZO7A 4Q6IA 2BY0A 3RVTC 3DYPA 3PP4L 2NYYD 2AXGA 2CLVB 4Y5YB 1MFAL 3EFDL 3FFDB 4GG6B 3MOBH 3WEXA 1X7QA 3MA7B 1A7QL 4LLVA 3I2CL 4AL8L 5MHSD 3RJQB 3IF1A 4P23C 1TZGL 4PRID 4Y2DD 3ORJA 1MRDH 4GW4B 1YMHA 3VGDA 3UPAA 2LAGB 3CFIC 1PG7X 3L3KB 3O2DA 2A77H 4ETQB 3O2VH 3JZ7A 4LMQI 4OBSA 1OP3H 4LSDA 4MDJA 3MLRH 1NFDE 2BCKA 4YHIA 3NGBC 4ZPVB 1UQSB 3QWRD 2V6HA 3RWDB 2NXYB 3KPQB 1QBLL 3H9ZA 5GRZA 4GRMA 1NCNA 4D0BB 4APQA 5E2TL 2B1HH 4JGUA 3ZYJA 2V2WA 4HIEB 2JK5A 4ODXB 3T0VA 1CVSC 1A1OB 4FQHA 3B6SB 3MBEC 3IXTA 4LCCB 5T3XE 2VL4A 3F7RA 5I15L 2CXKA 3RPKA 3J7HA 4FABH 2PW2A 3ZDYE 5IMKB 3NACL 1P7KB 1KB5A 2GAZA 1D3CA 1MJUH 4HAFA 2WK2A 5F1IB 2AJUL 2VWEC 3O6FB 5HHVL 1FFRA 4M03A 2FATH 1ZLWH 4PV8A 4FFZL 4IIQC 5EO0B 2VLRB 5E4EB 4GOSA 5D7SH 3HA0A 1PG7H 1IJ9A 2Q3ZA 5JIIA 2I5YL 1J1XH 1MHPH 8FABA 2WINA 4OGYH 3N1PC 3D69A 4JR9L 3EYOA 3OXRB 5T3ZE 3MBXL 4J3VA 4MHHG 3HG1B 3UTQA 3VGEA 1IGFL 2BSTA 1DVFA 1UZ6E 1Y0LB 1A6UL 4OCRH 4GAGH 2YBRA 3PWUB 1J8HD 4KQ3H 3QNYA 3MUGA 4P2QB 5CD3B 1NBQA 3KLHD 2Q1EA 2H8PA 3TBTB 2AXHA 4ZUSA 2R4SH 1KYOJ 1FYTE 2DS4A 3BH8A 3CVHH 4U1KB 5BZDB 5T5FL 4N0CD 1BBDL 1YMHB 5E03A 5JR1L 2YXFA 1U8OA 3MV7E 5FF6B 2MNUA 1A3QA 3SDDC 1U41A 3QEQE 2BCKB 2AJZA 4WI6A 1EFXB 4LLDA 3FQUB 1CDUA 3IFLH 7FABL 5CUSL 5E00B 1CU4L 2DWDA 1JV5A 4GRMB 4K2UH 1KLGA 4CJ0A 3RP1A 2BRQA 3MODL 3SKUD 5D1XB 2C4FT 4KZEH 3LEVL 1NCCL 4K9EL 5C0EB 1LVEA 2DQDL 2NW3A 4NP4H 4XHJC 3IDYC 3FN0L 5HI5D 2HFGL 3MRBA 4EQ3A 3QUXA 2GAZB 3JSSA 1NAML 3O2WH 1MRCL 2XTJD 4S1DD 3V0WL 3QULB 4U1NA 4PV8B 1PVHA 4QRPE 5ESVB 5TF1H 1OTTD 3QUZC 4PRAA 5J11B 1MFCH 3ZDXE 4YXLL 5GGRY 1F90L 4ZODA 4R96B 4HPYH 3S88H 2FBJL 2WINB 2HRPH 2PKDA 3T1WA 1ZEAH 4IM8A 3IJSA 5DR5H 4LCWE 3FCTB 1RAMA 4NM8H 3UTQB 2BSTB 3WS3A 2Z92A 2VLJE 3FN3A 4NO3A 3R06B 4OB5L 4OTXH 3S36H 4MX7A 1R3IH 3UPCA 5GRYA 1SEQL 1E4XH 2R69L 2YBRB 1A5FH 3ARXA 3CLEL 4R0LB 4RGMC 1HILA 1CICA 3FQXB 1MY7A 3PWLA 3IU3A 1ZANL 2EDKA 4JKPL 4JM2C 4ZUSB 1FNAA 1KTRL 3NABL 4EI5A 4JFEA 5D7JA 2EDEA 4NQUA 3GSXA 4R2GB 1RZ8A 3JWOH 3W2DL 5L2KD 4XCFL 3WHE1 1N6QH 2IBZY 4O5LH 3STLA 2I60H 4D9RD 1X4YA 4KMTL 3Q6GH 4PJ5A 1G0DA 1U8OB 1HIMH 3RI5K 3C8DA 1Q94A 3F7PC 3F7YB 4GJTB 4BH7A 3C60C 1S9VA 4BH8A 4FFYH 4WO4B 5HHME 1EJ6A 3U1SL 1H15B 4NUGH 4H8WH 5GGRB 2OP4L 4OF8A 2DWDB 4M9PA 4NN6B 1KLGB 4WFFE 1R24A 4Z7WE 5EA0H 3P9LB 3KWWA 2R0LH 3DUSB 2VO5A 5GQBA 4FQIH 4D2NA 4KHXL 1ZLVH 3WDJA 3KHQA 3U48A 4HF5H 4X4YA 5FEBA 4LHQB 5D7KD 2PR4L 3K8KA 2NW3B 3MZGB 3VFSA 3VGBA 5EC1A 2GI7A 1FCGA 2YPVH 1YN7B 4E41A 3LZFL 3ZHKA 1KLFA 1BQHA 3ECBB 1BFOA 4WTWA 4WV1C 5LXGL 3DHJA 3KPSE 4UINH 2VLLA 3B9KD 1Z9MA 4G8EB 1CFTA 4WEUD 3CUPA 4I2XE 4M9OA 5FM4A 1I3VA 1VPOH 4LRNL 3FAXA 5IFHL 3CSYB 3IFNH 3KPOA 5DUPL 4K3EH 4NQCD 5A2KH 1FCCA 2NY4C 3OKNB 1S9YB 4FTVB 4JFDE 5C92A 5I16B 5D4QA 4YQXH 1CVRA 3IJSB 3PL6A 4HW6A 3OZ9L 4YPGB 2IGFL 3ZE2E 4P0DA 4LPCA 5EZOL 5M7QA 4L9DA 2PYFA 2QQLL 4PJAB 5E6ID 4K94L 3Q1SH 4L4VE 4PRPB 4MX7B 1RMFH 5KJRL 4LSSL 5IESH 3TBYB 5DWUH 5I1LA 1ZA3A 6FABL 5EN2B 2W0PA 4HCRA 1XZ0A 1HILB 5CJBA 3MJGX 1IAIH 4Q74A 3MV8A 3BI9X 3QBTB 4JFFB 3IAGC 4Z77A 1WWBX 4RFOL 1NC2A 2VYRE 5D7JB 3OXSA 3QUMH 4CJ1A 1PKQA 3MLYL 5LJYH 1CI5A 3GSXB 5IROA 1FO0B 3TJEH 1JK8A 5I66A 2VABA 3NIDF 4LSRH 4M61B 5BV7L 2E7LC 4MWFB 1Q94B 5E94B 5HGAA 1C12A 4D0DB 1Q0YH 4Y16C 2WSKA 1BLNB 3C5SA 3H9SA 5D9SA 1F13A 3V52H 2NXYD 2YMXH 5DMKA 4JREC 2YN5A 4HKBA 2BVPA 1HNGA 1R24B 3MRNA 5AD0B 1K4CA 5ESQB 5FGBC 5BVJB 1CE1L 3GRWA 2V5MA 2EIZA 2OLDA 1RIVL 3EJJX 1BQHG 1YECH 1U93B 2HJFB 4E41B 12E8H 1X4XA 2CUHA 2F8XC 2H1PL 4LU5L 3O6FD 5I1JH 4YX2L 4PYGA 4HWBA 2VLRD 4PJCE 1MEXH 2VLLB 3PHQB 2GSGA 4PJXB 1CFTB 3NFNB 1OTUD 2EXWD 3HCVA 4EVNA 2EIBA 4LFHG 1H3PH 5IGXL 3KPOB 4JY6A 3TH2T 4KWUA 1GHFL 4XP6H 1BM3H 4P3DA 4BSWB 3EFFA 2Y06H 3DVFA 3HG1D 3RL2A 4JJ5B 3ELAT 1R0AH 4HIJA 3T2NH 3MRDA 4GFTB 4O2EA 2HVJB 5D2NE 1EH9A 1W8NA 3MRLA 3L3DA 2DBLL 5CWSA 3MV8B 4ZUTB 4CGTA 2RBLA 1U8HA 1XEDA 5D2LB 3ZLQC 3BAEL 1JHTA 3OXSB 4I4WA 1PKQB 5GGUA 3X14A 4YBQC 4UDUA 3PWNA 2CGRL 1MCOH 5I66B 4MVBD 2VABB 4JZJB 2FHBA 2OSLB 4EN3D 4PRHE 3ZKNC 2ZPKL 3Q3GA 4K3JL 4J7RA 5HGAB 1C12B 1HINH 1HI6B 4L4TE 4ZQKA 3MOAL 1IQWH 1EFXD 1D5MA 1CQKA 3HS0B 1L7IL 2P8LA 3ZSSA 3OKEB 5E1AA 4X6EA 4HKBB 2BVPB 1O0VA 1PJ9A 1M7XA 4M8QB 4OQTH 4JFQB 2O5XH 3VG9C 3FQNA 5D1XD 5DVKA 5I1AA 1UT9A 4C56E 5JW3L 5D7LE 5C07A 1QLRA 3GSRB 1T1XA 4XC3H 2XPGA 1YJDC 1P4BL 3VXUA 3WMSA 5TE4L 3B9VA 1OWRM 4PJXF 1KYOK 4TSAH 3L7EA 4PG2A 4TUKH 5FYKD 4JQVA 4GLRI 3E6FA 5DC0A 5CJQH 1FNFA 3MQIA 4U1IB 2AGJL 4AENB 5HHPB 2VLKE 2CXGA 3HCVB 4KAQL 3TO2B 5HBBA 5JTWA 3GKWL 3W5NA 4OFYD 3V6ZB 5IHZA 1P9MA 4UUJA 4NZTL 5A2LH 1IE5A 3MRIA 4JY6B 4OD2B 1CLOH 4JY5H 3N0PB 1EHLL 4KTDH 1FLRL 1BVLB 4H1LA 1IBGL 1OAZH 4P3DB 1HH9A 4NDMA 4PLKC 2EH8H 1XT5A 2FHCA 3UTSA 2YEZB 3C5ZA 3MRDB 2BFVH 1EVTC 5HD8D 1FNGA 2ZJSL 2O93L 1ADQA 4RSVA 5DD0L 4I18A 3CU7A 2LV4A 3VXQA 1JHTB 4R2GD 3WD5H 1E6OL 4YEEA 5GGUB 2ZSVA 1OSZB 3FQWA 1CK0L 4L8DA 4UDUB 5DUBB 3BUYA 3S4SA 2Z31C 1FN4A 5KVEL 4MJ4A 1ZGLP 3FO1B 1YY8A 2V17L 4ZQKB 4WO4D 2H6PA 3I75A 1D5MB 4NM4H 4P2RA 1RIUL 1N7MH 3PQYB 1FJ1A 2BVEA 3CMOH 3HN3A 5EUKA 2IJ0C 4OD3L 3S5LA 2J8HA 1QSZA 1KPVA 4XXCC 5H8DA 5BRZE 5C07B 1I7UA 3HE6B 3VWKC 3ZKXC 2ZCKH 1CDGA 4QXWA 5CIPA 1R5IA 3WFDH 2ENSA 3P4NB 4NO2A 3TP4A 1MJ7L 2G2RA 3L7EB 1DANT 1L9MA 3INUL 3QCTH 4KJPD 5D2NC 3DSNA 3MRHA 3DMMA 1AFVH 3MZTA 4P3CH 4OF6A 4XP5L 2BVQB 5L88H 1BP3B 1TCRB 2BMKB 1DFBL 3V6OE 3O2DH 4FQLH 4H1LG 1S3KH 4UBDC 4UUJB 4JN2A 5HHOB 4JG1L 4XBPB 4FTVD 3VXRB 2PF6A 3RDTB 1OAYH 5IVOA 4G6MH 2QR0B 2ZUTA 1QQDA 1WBZB 2NY1B 4AEEA 3GJEA 2K7PA 3G5ZB 3MGOA 4KQ4L 1OAKL 4Z7OE 2AEQL 3BHBB 1RJYA 4PRPD 3UTSB 3C5ZB 1OP3K 5CGTA 4F8TA 4XPFH 3LSOA 4DUWA 2EYRB 3KLDA 1P7QA 2B5IB 1B90A 3ZTNL 5BZWA 4I18B 1PYWA 3PDOA 5C0JA 3O4OC 2VOTA 3JBG7 4JFFD 4JDTH 4NN7C 3EGSB 1FORH 5E70A 1MFEH 3PWPB 3VXQB 2UY7A 4DWHA 3S4SG 3ARQA 5FYKH 3BH9B 4KXZI 1XF1A 3T4AB 2DQTL 4ELKB 5DRZB 1KJ3H 1DQTA 2AAVA 4MZ2A 4ZO9A 3IDGA 4NFDA 1G6VK 4XCCL 5ISZB 3KR3H 1K8DB 3DV6A 4UV4L 3TBVA 3QJFB 1YY8B 1ZLWK 2P4AB 1HOCA 2H6PB 1EAJA 3I75B 3S5LG 3TT1H 5JUEH 1V3LA 1EIBA 3MRFB 3M17B 1Z9OA 4PJFA 5TDPB 3EYQD 3IGAB 1FSKB 4MCYA 5B3JF 3BD3A 4FG6D 1KPVB 4FNLL 5BOZG 3DURA 2FB4H 3TIDA 1I7UB 1CXEA 4FMKA 1ZT7B 1GIGL 4I1NB 1PEZA 1R5IB 5IBLC 4E41D 2FH8A 4OLZL 1EUUA 5A16A 4R4FL 4NO2B 1GGIL 2APXA 3RL1A 4P23A 3T04D 2CMRH 2QADB 1IGIL 1DN0A 2X42A 3MLUH 3ZKMD 1EV2E 4HKXB 3DMMB 4LHUA 3GBMH 3QCVL 4LK4A 1E4WL 1LP9E 1NKRA 2P8MB 5J8OA 4Y1AA 5E2VH 4NO0A 1DQMH 3BYTA 4HXAL </