2ZOKB

Crystal structure of h-2db in complex with jhmv epitope s510
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zokB00
5DEZA 5F9WC 1GVIA 2Y5EA 3X3GH 4Z7UA 4JFXB 1U36A 3ELAT 4LK4A 1ORQA 3VXSB 4FXLA 1NAMH 1BQLH 1MNUL 3QDMA 2HWZL 4GW4A 4MJ6A 5BO1H 1YUHB 3FQRB 3V5KB 5MEQA 2XQBH 4HUVB 1FFOA 5I2IA 3PL6B 5F6HJ 2FECI 1I3GL 4Y4FB 2IQAA 2ATPB 5DXWA 5CJBA 4I13B 4CW1B 1VADA 1QKZL 4GBXD 2H6PA 3DIFB 2DWDB 4KVCH 1H3XA 1N59A 2PXYB 3I84A 4CN4A 5ALCL 3C60D 4NRYA 3P4NB 3VFVA 4JDVB 3BE1L 3AU1A 3MJ9A 5HJ3A 5GS3A 4OGYL 4JQIL 4MNQD 3CFJA 3OKNA 1G9MH 2GQHA 5DZNA 4HDIB 5KW9L 3NN8B 3DVGA 3T0BA 2HLFD 2XWJA 4P99A 5L9DH 3AREC 4NNYB 5LGJA 2WIIB 1ZHBA 2Q6WA 2X9WA 1SBSH 1XGUA 2HRLA 2Z92A 5FHBL 1PZ5A 3MRIB 3TBYB 3FKUS 3VXSE 5IFAH 1GIGH 1A6UH 4YZFF 1HEZB 3QWRA 4RMSA 5CHNB 4PRHA 1C5DB 3QDAA 3QCTL 1KCSH 1AQDB 1EXUB 3M17A 2EDYA 1O5DT 1UZ8B 2X09A 1W0VA 5GRVL 4M4RA 1I1AB 4GKNB 5MHSE 1P7KB 3CIQA 4LFHG 5JO5B 4PJ7B 2W65B 4OD1L 5DRWB 5HHNB 1XGPA 2DQTH 5KVGL 1MFCH 4NPYB 4NM8H 4PG2C 4HH9B 1LE9B 5F9OH 5F3HA 5LVEA 1LMKA 1Q9WA 5A3ID 3L3OA 1UKTA 2J8OA 3OXRB 4P3CL 1ITBB 4RISH 1EO8H 4XZUA 3PABA 3RKPA 3HFMH 5C0GB 3FAWA 3PDOA 1U58A 4J4PD 2AJ3A 4TUKH 5FYLL 5JHDB 5CIPA 5BS0B 5IBUG 1A7RH 5TDOB 3UPRB 1OTSD 4KQ3H 1RU9L 2P5WA 1XMWA 2APWA 3ZT6A 3L7FB 3D0LB 4FQ1L 4OZFH 4XX1G 4DZ8B 4NRZB 2IAMC 3CUPA 4P3DB 1A3RL 2Y25A 1ZGLP 1KPUA 4RMTA 2HT3C 3FN3A 5IBLD 1BM3L 2W0KA 4NO0B 4POUB 4JLRB 1T5WB 1CG9A 5CCKH 5EOCL 2ZUYA 2MQ0A 4PJ7E 3PWPD 1OGTB 3HB3C 2XXMB 4KJPC 5C0CA 3L3IA 3A6OA 4JY6B 1JHKH 4IS6B 1AXSB 1CD1A 1MWAL 4IMKA 1NGYA 2X89D 1CL7L 1QLEL 4FQXB 3F12B 2NXZC 3G6AA 8CGTA 5EU6D 5DVKA 1H5BB 1EEQA 4J3TA 3TM6A 4F58L 1FYTA 2A6KA 4D3CL 4ORGB 3T77A 5INDB 3JV6A 3GGWA 1RUPL 5JHDE 1UFUA 1MJ7L 5BS0E 1V5JA 2FJGA 4XWOD 1RZKC 2FD6H 1J8HD 4L9LC 3ESVF 1IZJA 1WT5A 4X83A 4LRIC 1R3JB 2ZJSH 5DFTA 1JPSH 2CUMA 4PLKD 5GZOC 5T33L 3PWVB 2WNGA 3GKWL 4GBXB 4H25A 3EJYC 2R69H 3LDBC 4MA1B 2VB5A 4AIXA 2C3VA 3U0PB 1GAFL 5LGHH 1T4KB 3B9KA 4HWUA 4QTHB 4MNQB 1FRGH 3RX7A 4EJ1C 2H2SD 4K3EH 5IJKA 1JGLH 5ELIA 3KPRD 2XTJD 3QHZL 1T7ZA 4XHJC 4WI6A 4I2XB 4MD0A 1SEBA 1RJLA 4HK0A 3BPNC 4J8RA 4M4PA 4LQFH 1KJVA 2R2EB 1ZHKA 5BOPA 5EOQL 4WFED 5D5MF 5EUKA 5KSUB 4POZC 4L3CA 5DD5L 1Z3GH 3MV8A 5ETUA 5I16A 3FRUB 2BK8A 4N90E 4PJ7F 4S2SB 4S10A 5EZIL 4PJXB 1G7MB 1DBAH 1DBJL 4KKLD 1VPOH 1F3JA 1T1YA 4MA7H 2WBWB 1EEZA 3L7EA 1AR2A 1TJGL 1II4E 4FQPA 1PY9A 5DQ9B 1IGJA 2DJ4A 3VGAB 2R1XA 1T66D 4WHYH 2GJ6D 5TE7H 5KTEH 1F6LL 4P2RB 4O58L 1GGUA 4HQQH 3RKDD 3QIUA 1MWAA 4GLRI 4M7ZC 3GM8A 3V5DB 1G6RA 5IVNA 5LKNA 1K8DB 4MNQE 3LN4A 1TFHA 1I7ZA 1PFCA 3CMOL 1MCWM 4PR5A 1XZ0A 4I2XE 1EGJL 1JRHH 4RBPH 1LK3L 4P2CG 5DRNB 5JXED 2YK1L 2VE6A 4Q6YA 2B8OT 3EFFB 3ARQA 3QDJD 4F2MB 5B39B 2WBJA 4HX1A 1N6QL 1BZ9B 1JJUA 4KXZH 3FCTA 1UEYA 1E4XI 4LSVL 2FRGP 2R1WB 4M7LH 4N5ED 1H3UA 9CGTA 4U1GC 4PJXE 4OGXL 1S9WB 3OKDB 1G7HA 2FLBT 4M6ML 1L4IA 4BH7A 3E6HB 4OJFL 3FFDA 2IADB 4LEOA 4Y5VA 3TYGH 3V5HA 2B1AH 1A5FL 3CPLB 2FGZA 4P2RE 1OSPH 4U1NA 5TQ0H 1CXKA 1WVZA 1NMCC 4NGHH 1UA6L 5BZDB 4MNHB 2CUHA 3IFLH 1VCAA 3CX5K 1CD0A 3MOQA 3EKCA 1S7QB 5EU6B 5D96B 3D2UD 2LFGA 3BMWA 4E41D 1KOAA 5GQBA 1OM3L 4H1LH 5D6DC 3MREA 2DQHH 1TZIA 1GGIH 3OSKA 2HTLC 1IFHL 3SO5A 3ULVD 3QO0B 4HJJH 2Z31D 5IF0B 4DK6A 1J7VR 5F8QC 1D6EB 4IMKC 3HE7B 4KROB 1J8HB 4NQUA 5IVXA 3QI9A 4ZFZA 1S5IL 4MMXC 3LQAL 4NSKB 3VFWA 4I3SH 4I0PA 2Q86B 1S9XA 2HTKD 4OZGF 4QYOB 1HSAA 5DD0H 1R3IH 3QCVL 4XPBL 1QNZH 4OT1L 3UC0L 5HYSG 4EI5A 1FH5H 3DOSA 3RWHA 4S0TD 5IK3A 3ARGA 3MGTB 3QNZA 3HRZB 4Z77B 1NCBL 4HWZA 3UX9B 1KPVA 1CICA 4Y8DC 1WT5C 1RZ7H 2J3SA 3ALXA 1XGTA 1BJMA 3P4MA 4XNZC 1NMBL 1B4RA 1INEH 1QLRB 2NTSP 1ZWIA 4KY1H 3P11H 3JV5A 3LMJH 3WJJA 2H2PD 4ELKB 1WZLA 3OPZL 3QNXA 3U4BH 4YXKH 5HDQL 1RZJL 5EU6E 3S6CA 5DRZA 4DVBB 4PJIB 4NN6C 3I85A 2QSQA 1SVCP 2FSEA 5F7WC 2I9LA 1SJVA 4OSUH 4LBEB 3DARA 1MCKA 3T2OA 3B9KC 1F02I 3O2VL 1J8HE 5LAXB 5IJKC 1CBVL 4AY0A 2BXZA 3K2MC 3QO1B 3EYFA 4XPFH 1EEYB 3UPCA 3TZVA 2HJKB 4MJ4A 3E8UL 3ARXA 5AYQA 3R4DA 3VFPA 1I9JL 1KFAH 2QKIA 1XGYL 5HVHB 4IIQA 4KI1A 1FFNA 1H3PL 2GJ6B 4YLQT 4ZO7A 5DMIH 2NLJB 2DQIL 4Z7VA 3TWCL 4XNXH 4NNPH 1ZHLA 2P7TA 5AAMA 5HXMA 3W9DA 4YPGA 3O4OC 5I1AA 2V2XB 1U41A 3UTPD 1E6JL 4JFYA 1JYVA 1S78C 5IUSA 1ZANH 3CXDL 4MVBC 2XWBB 3DNKA 4PJIE 4X9GA 5C92A 4DUXA 4KHXH 1VENA 1RZKH 1OF2A 5IB3B 4ODXA 1ADQL 3LPGA 2ADGA 3QIUC 3QDJB 1MHHB 1JI1A 1OLZA 2W91A 3O6ML 2VERN 3KXFA 4XCFL 4OV6F 3LS4H 5BQ7A 1OQOA 3P0GB 3TO4D 2AGJL 1S7VB 5TE4L 4NM4H 4ZUUB 5C08D 4R7NA 4G6AD 4M00A 1W0YT 3MOAH 3QIWA 4HXBH 3BVNB 1MCOL 3GJFH 3LRHA 5DK0A 5KVDL 3OR7A 5HY9B 3NCJL 5GIRA 2WBJC 2J4WL 3H42L 4M02A 2AK4B 2GJ6E 4MNGA 4LCWA 3TBTA 3QUXD 1TZGH 1G0DA 2RIKA 4CRPA 4BA8A 4KJQC 3ULSB 4LLMB 1AQKH 2YZ1A 4PREB 4HD9A 4N0FA 5B3JE 1JHTB 4Y5VC 4F3FB 5T3ZL 4WWID 4LVOC 5CBAA 5HYSA 1OAQL 1L7TL 2QHRL 4E41B 4MCYA 2VZ3A 3MLRL 4IMLB 5SWQA 3MLSH 4MS8D 3G5XB 1DL7L 4NQVB 4HKBA 1DBML 4WUUD 2Z31B 5E8OB 3QDJE 1KACB 5E7BA 5LQBH 4JHAH 3QQ4A 3VGDA 1ZGLB 5CWSA 3KPLB 1AD9B 3KYNA 1A7OL 4V2CB 2BRQA 4LVHB 3BDYL 4PBVC 2HMIC 5CILL 5HYEA 1C8PA 4NQEA 3VFGL 1BFVL 1FL5A 2BRRL 2Q7NA 1UWEL 5HSFA 5J3HD 5CZXD 3NFPA 4G8IB 2HAZA 2AK4E 3MA7B 4PJIF 3UCRA 2A1WH 1NKRA 2G5RA 1PQZB 4UDUB 1F97A 5F8RC 1HCVA 3QI9C 5K9KA 3G5YB 2ERJC 4FQLH 2WQ8A 4KK6C 1ZA6B 1A9BB 1GGCL 1T1WA 5B38G 2JB6B 3L95A 4FFZH 4I0PC 4X98B 5E00B 3C2AL 1V7ML 4WVRA 4G8EB 1SHMA 5H37G 4JG1H 1R0AH 1IEBA 3LEXB 4KJWD 1OAYL 4WI5A 4RIRA 1D6VL 4OIIH 4EI5C 4E41E 1T1XA 3ARGC 3C6LD 4GS7C 4M6OH 1UJ3B 4PRID 4PGDA 1CICC 3KR3L 3ARDD 3SDXA 4HK3N 1UACL 3RBSA 3THML 1Z5LB 3GHEH 1RIHH 3NPSC 1DDHA 3I6KB 1NGQL 3WJJC 5GS0D 5DTFA 3W39A 1ZK9A 4XCNA 5GGTL 3GMQA 5FA4A 4IEFB 5CD5C 4RA3A 3UZEA 1MNUH 3OKOA 5DHYB 2HWZH 4JFPB 5C6TL 4R8WH 4QHLA 3CSYA 3SQBA 4U6YA 2NY1C 1E6OH 1LGVA 2D7TL 3FFCD 1I3GH 5B3JF 1QO3A 1FDLL 4LPXA 3BN9C 2EDWA 4Y0GA 4LKCA 2MCPH 5CGYC 2B4CL 3CLFL 3TZVC 1FAKT 4RAVA 1CFSA 1EEUA 1OQXA 5ALCH 1ES0A 2CK2A 3BE1H 4R26L 3RFZC 4LQ1A 3VXNA 3NCEB 4IIQC 4JQIH 1BOGA 2G75B 3U36A 1NKOA 2YD4A 3GI8L 2VLKD 3OKMA 4U1SB 1KENL 4KUCF 5I17B 5KW9H 2WWKT 4LSSH 1N6VA 4MA3A 3RP1A 3ZL4L 3TN0C 5FB8B 3D69A 5IMOA 4YDIL 1FL6A 2EEDA 3VWKA 4XB7A 4KK5D 5FHBH 4ZUSB 3SQOL 3HI1A 3TO4B 2XQYG 5FK9B 4HWNA 1IGYA 2DQGH 1JIBA 1ZA3A 5C08B 5DVLA 3T8XA 2BFVL 5MERB 4NO5A 2V9TA 4E0RB 4HFWA 4ODTL 5LBSL 2X1WL 3IKCA 4X6FA 2ZCKL 3C5SA 4JRWA 3QCTH 3RWDB 4EUPB 3VG0L 2OQJB 4MAYA 5AUMB 3MLPA 3QDGD 4MLSA 2DI7A 3LQAC 4GOSA 1TVHB 2LTQB 5D7JA 3L3HB 1JUFA 4BJLA 5CZVL 4OD1H 1NBZA 3FT2A 1CT8B 3QIWC 5KVGH 3RVTD 3GUTB 4NUGL 4PV8A 4RBPK 1NAMB 5C3LD 2JLLA 4MMZC 3UTPE 3RRQA 3O3AA 3W0WE 1D5BA 1P6FA 3M45A 2VR9A 4HW6A 4NJ9L 4QRPA 1F13A 1JPGA 2DL9A 4M7KH 4EDXB 3TJEL 1CE6B 1DQJB 4JANB 5B38A 5D1XC 3WDHA 4L5FL 4AH2B 4R90L 5GGTA 4LDLB 4M1DL 4M6AA 3FQXA 3EOTL 1A4JB 3DO3A 4HKJA 3K1KC 3P9WB 3ZMRA 3N0PB 2EDKA 4NCC2 5C08E 4NKQB 1RU9H 3ZO0A 1QA9B 5F1OB 1VFBB 3WIHL 4TTDD 4XPGH 1U8HB 5CEZL 1YEDB 3SKJL 4OUOA 4DVRL 3MJ8B 4F7PB 1A3RH 4R9HA 5F7MC 2Y36L 3IDGA 1BM3H 5E8NA 5E6ZA 3GIZH 3U9UB 5JW5A 2BY2A 2ADFL 1Z9OA 1A14H 5CBEB 3RL1B 2NYYD 4U1JA 4OLZL 5DVMA 5ERWA 1SY6L 3LKRA 1UYWL 3SKNA 4C59B 4JDZB 2MMXA 1JZ5A 3FTGB 1UVQA 3IAPA 1MWAH 3C6LB 3O8XA 2N7AA 1JL8A 1QLEH 3ARDB 2V5TA 2BDNL 4NC2B 2BSSA 5JTWA 3LKOA 3VFTA 4DFHA 4XCEA 4F9PA 3WIIL 3D85A 3TPKA 1QTYT 1PG7W 5BJTA 4D3CH 4WO4D 1YZZA 4PRDB 3SOBH 4XNMB 2Q3ZA 4NKDB 2XY2A 1RUPH 2KL6A 2XTLA 4CNIB 4Q2ZB 3G9AB 3B3IA 2XV6B 3MX0A 5IROA 5LCVL 3MQIA 3AB0B 1RJYA 1A6WH 3FFCB 3LKQA 2MQ3A 2LVCA 2N56A 3L3JA 2BY0A 1G84A 1MSPA 3MCLL 2DWEB 1ZMYA 3RZCA 5T33H 2ZUTA 1U0QA 2V2WB 3GKWH 2VABB 4BFIB 4MYWB 4L3ED 4R97C 2LU4A 2O5YL 3BP7A 3QEGL 3U4EA 1G7PA 5DJXA 2EYSA 2VRAA 4K23H 3BH8B 4N1HB 5EIQA 2NQCA 1WBYB 4M8QA 4OKDA 1DVFA 2VLKB 1SYSB 3RU8L 4OZFB 4JPWL 3QHZH 3RWFB 2NY5L 5EC2B 3LRSB 2IBGA 4X5XB 1HOCB 2EDXA 3A6CL 4PJDB 2NMSA 5FYJL 5FGCB 3IFPA 1TENA 4J3OC 5EOQH 5D7SH 3O6FA 1W72L 2FGWL 3LIZH 5DD5H 1HKLL 3BP6A 1I4FB 2VMFA 1EDQA 5B4MC 4P4RB 4YK4C 1EHLL 2BHYA 3H8NA 2VLMD 4DGVL 4AMKL 1CTNA 4Z0BL 3EOAB 3RY4A 3MRHA 1FN4A 4QTIL 1FPTH 1T20A 3QDGB 1N26A 3VWKC 4RAUB 1MEXL 2RBLA 2CK0L 3WLBB 3S4SG 3ZE1E 5J1SC 1XCTB 1SY6A 5HDBE 1N2RB 5HGDB 2EZ0C 4D9LL 4O58H 1I9RL 2X4QB 3T4YB 1K3IA 1RFDL 3KDMB 1TXKA 4LMQE 2RGSA 3O9WA 4YNYB 5GS2H 2VDRL 5AD0A 1QR4A 3DO7B 3GB7A 4MAYC 2VLKE 3PHQA 4MDJB 1J05A 4IRZL 4WEUD 4X8JA 3CMOH 2VQTA 1EHXA 3GMOB 2EDDA 2C7UA 3CFIC 3CH8A 5D7JC 3HR5B 4JO3L 4BFEA 4L8DA 5E8EB 1I3UA 3ZKMC 1LK3H 4DW2L 4PJDE 2YK1H 3NA9L 5IFJA 3BP4B 3GJFK 2AP2A 5FGCE 1RZGB 1T7WA 5FCSH 2F53D 1YPZA 4OZ4A 3X13B 1KCRL 4C4KO 2WUCH 1Z9SA 2O5XL 1NCCH 4FTVE 1E28A 2YBRB 3UTSD 5BVJA 5J6GA 5ID1B 3QDGE 3T1FB 2VDLL 4G9FA 1JZ2A 3OGCA 2Y72A 3U7AA 2NX5A 4XGZB 5DK3A 1QRKA 3P0YH 1DTUA 5DK2B 3STLA 4OZIB 3MRRA 2IAMD 3CC5B 4GKSB 1UA6H 4X80H 5GSVA 3FN0L 3RGHA 4RFEA 2D4DA 2PCPB 2Z8VC 1T0NB 4J23A 2KUTA 1Z9LA 2CR6A 3GMLA 1L6XA 2B4CC 2FO1A 3ZKSD 4NZRL 5I66A 3CDFA 2VXSL 4HUXA 2RFXB 4KJPD 3MZGB 1OM3H 4L9DA 1D5IL 2BCKB 1HHIB 1K8IA 4CN1A 5CP7A 1IFHH 5DD3H 2P8PA 2G9HA 4X0KB 2V6HA 1B0WA 4MX7A 3ZE1F 5HDBF 2E6PA 3O8XC 4DCQB 1IGTB 2NXZD 2EDHA 3PWNB 1S5IH 3LQAH 2W0FA 3T0EA 5F9WB 3ZTNH 4F9PC 4ORZC 4G9DA 4NO2B 4UQ3B 2CXKA 4K71C 5BXFB 4L8BB 1F42A 5I75C 4XPBH 4X7CC 1JN6B 1MY7A 4ZG1A 1A6TA 4L3EB 4XH2B 3UC0H 1BVKA 1E27A 3T0DA 1D5ZA 1NCBH 1LD9A 3QT2A 3F7YA 3OAYH 5IROC 4XC1L 5TQ2L 5M7QA 1NMBH 1L9NA 4OZIE 2P1YA 5EC1A 4WTXA 5DSCB 5GZOD 3RZCC 1Y18B 1QACA 2X4SB 3OPZH 4OQ1A 5DJ2B 5HDQH 3S4SA 3BZFA 3EJYD 3LS5L 3MO1B 2LU3A 5MP6L 4ODBD 1RK1A 3QDMD 4LIQE 3MUJA 2V2TB 4I5BB 4QT5A 1SEQL 4YFDB 5DEGA 3GSVB 3O2VH 2Z35A 4JO1L 4OI9A 1JZ4A 1DVFC 1KLUB 3SGDI 1CBVH 5D2LB 4U6XA 3GMMA 4XHJD 1GGBL 3AREB 5KVMC 5E6YA 1M1SA 1JGDA 3SE4A 3U30C 1UEMA 1FVDB 1I9JH 1XGYH 1ORSA 5ESQB 3DX7B 3B2UC 2YOCA 2ARJQ 2F8VA 2E8YA 4L3EE 5HYQB 3V0WH 4POZD 3O6FC 4H1LB 4DWHA 2ADJA 1F45A 4ETYA 3K80A 2DQIH 2EYRB 3MYJB 5ICZA 1G6VK 4LKXB 3ES6B 3TWCH 4M43L 2ZOLA 4TN9A 2EEAA 3BW9A 3BPOC 4MHHG 3HAEG 3KPQA 3QRFM 3HS0A 3BZEB 3QQ9C 4LNRA 3D5OF 4UT9L 3VXTB 1YEJL 1UXSA 1MFEH 2X4OA 5FF6A 4O2CA 5DF0A 2NY7L 3JUZA 4K3JL 3MSPA 2UVEA 2DQUH 1U8OB 5IEKB 2OP4L 3OF6A 4ZDHB 1ADQH 4PRHD 5DWUH 2FJHB 1DLHB 2IPKA 4PYHA 4ZOEA 3O9WC 2VDPL 2DLHA 3O6MH 4ONFH 2F53B 1JTTA 3BWAB 5D2LE 2AGJH 5IIEA 2VLME 2I07B 4UT7L 2H26B 2NY6C 4KRLB 1J5OL 4KMQA 3UTSB 4OZIF 5C9JA 5HHQB 1EBPA 1NPUA 4PP2B 2GSGA 1N5YH 4HS6B 5KVDH 4NQCD 3NCJH 4PRAA 3H42H 1G7JB 2OXHA 3TH3T 1FVEA 1PG7L 2PN5A 1RVFL 4I9WE 3U7YL 2AXGA 4R96A 2IAMB 1LP9A 3CVHA 1QLFB 3R1GL 4GW1A 3NABL 4KJYB 5SV3A 1B4JH 3VA2C 5T3ZH 4PD4K 3VE0A 1L7TH 2QHRH 4HUKB 4QXGL 1YEFL 4JG0L 2FH8A 3MLRH 4UV4H 2NTFB 2P5WD 3OZ9L 4G6FD 4QGTA 5GISH 3DX8B 1GHFL 4YO0B 3O45A 1RUAH 3JTSA 4YQXL 3RA7L 1IRAY 4OM0H 4YHIA 2F53E 2NXZB 4O02H 1KB5B 2NY5C 3I3DA 4XNQA 2ZPKL 4P48A 3QIBD 3HZMA 4W70A 3BDYH 3FRPG 3NA4A 4U6TA 3S3PA 3UTSE 1TVBA 5CILH 3VFGH 2EXWC 5C0CD 2A73A 2BRRH 3SGJA 3NAAL 4TUJA 2X1PA 5AEAA 4L9LB 2X4TB 1CDGA 1X7QB 4EIZC 3V4UL 1UM4L 4XPHL 2J2ZA 3T0EC 3W82A 1X6LA 4ZUWA 5GGSA 3RPIB 1AGCA 4HWBL 4F57L 1OAYH 1ORQB 4QWWC 1KF9B 1XF4A 1E4XH 1XF3A 2VLRA 3LDBB 1MCLA 4CGTA 3QDMB 4GW4B 4MJ6B 3KR3H 5MEQB 1FFOB 2D9QB 1UACH 2GUOA 5I2IB 4HMEA 3HAEA 4KI5C 2IQAB 1AR1C 2XG5A 2YWZA 4AEIL 4FP8L 3M1BA 1FV1A 3VD5A 1VADB 5GGTH 5H37H 3CX2A 2VLJA 5K9QI 4IOIA 4L29A 1N59B 3BPNB 5IG7A 3QXDB 2ZZUT 5DJ6A 4NRYB 5I1IL 3QPXL 1P6AB 1FDLH 3AU1B 5HJ3B 1FAIL 3B9KD 5C0DA 3O3BA 3CFJB 3OKNB 5E2VL 4P5TA 3ZT7A 3DVGB 2DQDL 2B4CH 2XWJB 5I19L 4TVPL 4HXAL 5EU4A 4PY8J 2E8ZA 5LGJB 1ZHBB 2Q6WB 3SE4C 1QSFA 1XGUB 3S3JA 2EE6A 4Z7UE 2XZQL 2Z92B 4N9GA 5FUZL 1AD0A 3RTQA 4O2EA 5I15L 3QSKB 1DBKH 2Q87A 4TUOB 3MV8D 3HZVA 2X1XR 1F4YL 3QDME 4ZSOA 1KENH 4JVPA 1MHPH 4PRHB 4LLYA 4M7ZB 3ZL4H 3M17B 4YDIH 1HHJA 2XIDA 1WJ3A 1W0VB 4RSVA 3U83A 1S78D 3MGOA 1Z9MA 2ORBH 4OBSA 4MVBD 1AIFA 3A6BL 4FOMA 2BFVH 3QFDA 3WV0A 4ODTH 1XGPB 5LBSH 3EO9L 2ZCKH 3QIUD 4RRPG 3VG0H 5F3HB 2DLFL 4WY7L 1Q9WB 4WI3A 4PLJC 3L3OB 4D8PA 2E9WA 1V7NL 4Z7NE 4U1GB 3FRPA 3PABB 4HWBA 5CZVH 3RVWD 4DUWA 5I1LB 1KPRA 3PDOB 1U58B 2AJ3B 5CIPB 1BHGA 4QXTA 1ZEAL 2P5WB 4G6FB 3T3ME 4PRHE 4HV8A 3TJEH 3HC4H 3WKNA 3E6FA 1QFUL 5T3XD 4KJQD 1NMCB 3L3DA 3CUPB 2F5BH 4L5FH 4LSQL 1D7FA 4R90H 1KPUB 1QP1A 4M1DH 4OLXL 5DJZA 2VZTA 3EOTH 1CG9B 3GMPB 4AEHL 3MLVL 4H88L 1CDCA 4R0LA 3WIHH 2Y1VA 5H2BA 5C0CB 5CEZH 4J1UA 4YHOH 3L3IB 2E27L 1MAML 4Z7UF 3SKJH 4DVRH 1NUFA 1YQVL 4ENEC 5A43C 1CD1B 1NGYB 2DS4A 3HNTL 1JVKA 5KN5B 3G6AB 1CFTA 3L5HA 2A9NL 4YBLC 3REVA 4BYHA 3SN6N 3HPJA 4CJ1A 4PJGF 2BVUA 4Z9KB 1FYTB 2HMID 4I77L 1SY6H 1U8MA 2A6KB 4P5MA 5IT2H 5DUBA 3T77B 1UYWH 3EYSH 1QBAA 3JV6B 3GGWB 5FA3A 1KEGL 3H7LA 4ZO9A 3SGJC 3NMEA 5I1JL 2FJGB 2P8MA 4YUEL 5EO0A 1RUQL 3HE6A 2P5WE 2BDNH 3D1MC 2ZSWA 1JTPA 4XNZB 3SE8H 4KK6D 4G3YL 2IALA 1BMGA 3Q5TA 4I0PD 5DVOA 4WFGD 3LQZA 1A8JH 1NUNB 1LDPL 5A40E 2I9TA 3WHXA 4H25B 4Z7NF 1IAKA 3NFSH 4NN6B 4EI5D 3ARGD 2C3VB 1M05A 3WL9A 5GS2D 1FIGH 1LO5A 3OAYK 3LH2L 5C0CE 3NZHH 1ZT7A 4YHLL 1JZ3A 2A6DA 1RZ8A 3MCLH 2VL5A 2APXA 3B9KB 5FM5O 4U05A 3T3MF 4I18A 4ODSL 1DLFL 5CD5D 2O5YH 4FQ2H 2ZKHL 3QEGH 1H3VA 1SEBB 1FYTE 1RJLB 4HK0B 4J8RB 2NY1D 1KJVB 3OR6B 1ZTXL 3MRBA 3QP3A 4RRPA 4FXGA 1S7UA 2SEBA 2XT1B 2YS4A 3BN9D 4XXDA 2FL5A 3P30H 5EUKB 5I73C 4L3CB 2EH7L 2XN9A 3IU4L 3MV8B 4XTRC 5ETUB 5I16B 2CDFA 4H0GA 1JFQH 1U8NA 2VXQL 5CGYD 2NY5H 4P5TC 3WNPA 3TZVD 4TNWK 1F3JB 1YEHL 1T1YB 4FFYL 3A6CH 1NEZG 1EEZB 1TNNA 3L7EB 4LLVA 1TQBB 5FYJH 3O4OB 4S1SL 5E56A 4JKPL 1FLRL 5GHWL 3NFNA 1IGJB 2AI0L 3MLXH 5J12C 2R1XB 4TTGA 5IBUB 4UQ2A 2FGWH 4XHQA 3O3UN 1HKLH 2KQNA 3DBXA 1EHLH 5J0BA 3TGXA 4HFUL 3QIUB 3I2CL 3RVXC 5DJYA 5SWZD 3TN0D 1G6RB 4QTIH 3B83A 2EE3A 1MEXH 5FM5M 1I7ZB 5HD8C 1JNHA 4WV1A 4PR5B 2DIJA 4D9LH 5GGQH 3TH4T 1I9RH 1L0XA 1U9KA 1RFDH 1FNSL 5DUPL 5JMOC 2VE6B 1X4XA 1WAAA 2B5IC 1AXTL 3GSQA 2VDRH 2WBJB 4HX1B 1KYOJ 3KXFD 5A1AA 5C0JA 2B2XL 3FCTB 3MV8E 5JIHA 4GG6A 1AGDA 2OTWA 3I3BA 3O6KL 4IRZH 2W60A 4LOUC 5E2UL 5EIIA 2DF3A 1YNLL 4JO3H 1G7HB 1CGUA 1QUNA 4BH7B 4DW2H 5HGHA 4LEOB 1TJHL 1NDMA 4Y5VB 4LVOB 3V5HB 5ADPL 3B9EA 5AAWA 4RQQA 2YD2A 5JORA 4LCWD 3AY4A 2O26U 3F65A 4U1NB 1KCRH 1KNOA 1C12A 4XX1E 3V0AC 4JPKH 2EC9U 3HC0A 4LCIH 5D1XD 4RNRA 2P48B 4GRWB 4QEGA 2VDLH 4HG4K 4PBXA 1IGFL 1FNEA 2QQLH 4NDMA 1LEGA 5CJQL 4WI4A 1RZFL 4NHCL 3MREB 4R0LC 1FGNL 1TZIB 2DIBA 5T1KA 2X6MA 5HPMA 2VAJA 3D18A 3FN0H 4U0RC 3T2PA 5FOJA 2XWTB 3BRGC 5IVXB 1KLFA 3QJHA 2ERJB 4ZFZB 3VFWB 2VXSH 5EBLA 4I0PB 5T3XE 3VG9C 1S9XB 3DVFA 4JN1H 1D5IH 3G9VA 1G0YR 2APBA 4NQED 5EN2A 1HSAB 4GW5A 5ACMA 4YBQC 1PKOA 2VSDA 4APQA 1W8OA 5BCAA 3V6OA 4EI5B 3RWHB 5IK3B 3ARGB 4GS7B 3QNZB 4HWZB 1KPVB 1CICB 5A16A 4JM2A 4FQQA 1CXIA 1QSEA 2WP3T 3HE6C 1XGTB 3P4MB 3R8BB 1ZOXA 4G42A 2W92A 2EDQA 4LGPB 1ZWIB 3NPSB 2BX5A 4M7JL 5JR1L 4GRWE 3P2TA 3BXNA 5DRZB 2Q1EA 1GCFA 2FSEB 2I9LB 1OD9A 2Y6SC 2NY1B 5CAYB 4XC1H 2YA0A 4XAWH 1KIPB 5TQ2H 2HT4C 5DVNA 1ITCA 2DM7A 1C7SA 4G6ML 3CVHH 1JK8A 1MQKL 1OWWA 3EYFB 3EGSA 4NWUH 3LS5H 4Q9BA 5IVXE 5MP6H 1PVHA 4I18C 25C8L 2Z8RA 3TZVB 3V7MA 2QLVB 1IEAA 4WFGE 3BWUC 5DC4B 3BAEL 5J7CC 3VFPB 2WK2A 3QG7L 1A7NL 4IIQB 4RMQA 1SEQH 1BFOA 1ED3B 2E7LC 3UTQA 4Z7VB 3C8HA 5J6HA 4ZS6C 2YXMA 1GGBH 3CFCH 1BBJA 3EYOA 1NANI 3VFRB 2P7TB 3TN0B 2QHLA 1P84K 1ZXQA 3W9DB 4YPGB 3UBXG 5I1AB 1Z6JT 3P9MA 3Q3GA 3QULA 4JFYB 2FH6A 5B4MD 2NPLX 1T89A 1P5UA 2C3HA 1OF2B 4ODXB 4M3JA 2ADGB 1VFOA 3EIFA 3KXFB 4H5SA 3VWKD 1I8MA 4JVWA 5KZCD 2NY7H 4K3JH 4WV1C 3UJJH 4R7NB 2E9BA 2Y7QA 4YFLI 5DK0B 4FQIL 3OR7B 3X17A 4Y16A 5FHAL 5GIRB 4WGVB 5I8KL 3HAEH 3DHJA 4LCWB 4MAYD 3TBTB 4KUZL 4Z7VE 5HGGS 4JY4A 1TCRA 1NCNA 4UT7H 2DRUA 1XGQA 3C08L 5D1XB 5CFHA 3ZKMD 4KTEL 3NN8A 4N0FB 3EO1B 4EOWH 5CBAB 5HYSB 1V3JA 3S88L 4MCYB 3QDHA 3G5VA 4YXHH 4G80A 3AY4C 4QRPD 2LAGB 5SWQB 1FYHB 2YD3A 2P42B 4HKBB 3U7YH 4N0CC 2KZWA 1CD9B 4X4XA 3R1GH 3QQ4B 1V3LA 4BK4A 3NABH 3G6DL 1VACA 3KXFE 5CWSB 5I0DA 1M71B 5DD1L 5J1TC 3KYNB 1EXUA 1MPAL 3PF2A 4CBPA 3IFOA 4RA0C 2LQRA 2HN7A 1DEDA 4FQJL 1ZLUH 1AO7A 1LO3H 4ZS7L 4UOJA 1YEFH 4JG0H 5A2FA 4PJ8A 1CE1L 4UDTA 2MKWA 3OZ9H 4NQEB 4O9HL 1SJEA 5EUOA 1GHFH 1QFPA 2OJEA 1FL5B 3GNML 2ZUQC 5IVOA 1R24A 1HE7A 4Y7MA 3NFPB 1BWMA 4YQXH 1KB9K 4HGKC 5TFSL 3E3QC 4LCWE 3MRLA 4YDJA 1LE9A 2ZPKH 3F58H 4GH7B 5K9KB 2YSSA 1ZVHA 2Q3AA 1T1WB 4MJIA 3L95B 4Y4HA 4UMGA 4LHUG 1JYNA 4YHYC 2M1KA 3OXRA 1IEBB 4APQC 2IH1A 4WI2A 1FSKC 3TPUA 5I1EH 4RIRB 3NAAH 1X5LA 3VH8G 1I9IH 2V5MA 3V6OC 1S7SA 2HFEA 3O8XD 3OKLA 4PGDB 4JM2C 3KVQA 1J88A 3SDXB 3V4UH 2HVJA 1UM4H 1QHPA 4HUUA 4XPHH 1EAPA 3D85D 1T6VN 4HULB 3OV6A 3UBXA 4HWBH 1DDHB 3DXAA 3S36L 4F57H 5DTFB 3W39B 4XCNB 3DURA 3GMQB 4R97B 4Z7VF 5FA4B 4PV9A 3P4LA 3QQ3B 1KTKE 4QHLB 3CSYB 3X11B 4NQEE 2KBGA 4DGIL 1HZHH 4KKAC 4MXQC 1QO3B 4AEIH 1HINL 1NFIA 3MBEA 4LCYA 3RZCD 5F7HA 4HSQA 4LKCB 3PUCA 3QUKA 4RAVB 5GJTL 1CFSB 2P45B 3VMNA 4LASL 5I1IH 1H5BA 5L6YL 3VXNB 3TIDA 1VA9A 2FHCA 3GHBL 1NFDA 1BOGB 3U36B 5DQJA 3EOYG 4YK4B 5FM4A 3OKMB 1FJ1A 3UMTA 5I30H 5E2VH 5I6XC 3SDXE 2DQDH 3HPLA 5F1NA 1CF8L 4TVPH 3KPTA 4JPVL 2R23A 1RURL 4MA3B 4JHWL 5IMOB 1R3JA 1FL6B 3MRMA 3VWKB 3D6GA 5FUZH 5KZCB 3HI1B 1F58L 5I15H 1IGYB 1ZA3B 4JFOA 3AS3A 4I3RL 3T8XB 1T89C 4NN5C 4NO5B 3VFNA 4HFWB 4XT1C 1FBIL 3IKCB 4X6FB 3C5SB 3UZVB 3WKMH 4PLOB 3C60A 1KCKA 3QQ9D 5HYIA 2JJWA 4MAYB 5EA0L 4I4WA 2BP3A 2BMKA 1N3NA 2VQ1A 4H0HB 4BZYA 3CFDB 3NCFB 5D7JB 1LE5B 1JUFB 3A6BH 2O61A 1NBZB 3FT2B 3STZA 4NZUL 5T3ZE 3EO9H 4PGEA 4PV8B 4I2XA 3O9WD 5IEHA 3O3AB 4TNWF 1D5BB 1AKJA 4LSPL 4P0DA 4Y16C 5HI5C 2DLFH 2R2EA 3IU3A 1H8OA 4QRPB 5J13C 4L4TA 3MRPA 2NY3C 1V7NH 1Z2KA 4XPTL 4LPTA 2YPKA 4Q7DA 3TV3H 1FG2A 4DOHB 4LHUA 4R4BB 3WLWC 1U8QA 1KUMA 2J5LC 3FQXB 4NFBA 2AK1L 1FO0L 2YD7A 4HKJB 3VH8A 1EHNA 1ZEAH 5DQ9A 3RX8A 2AEQL 5AZEL 1LILA 2DI8A 3V6BR 1WF5A 3RWJA 3OKYA 3X3FH 1QFUH 5FYKU 3MODL 1WFUA 2IBBA 4LSQH 3IDGB 5E8NB 3U7WL 2OTUA 5JW5B 4OQTA 5ILTL 4HJ0D 1I1YA 1K8DA 3SDXF 4U1JB 4H88H 5ERWB 2ZUVA 4PJ8C 3LKRB 2NX5D 3HLAA 4N5UA 3SKNB 1MAMH 1P4IL 1VKXA 3EDFA 1UVQB 1YQVH 4LP5A 4XP9L 4NC1C 3NCBB 7FABL 1F00I 3O8XB 4B7IA 1ZHNA 2WUBL 4IOFC 4QRPE 5MI0C 2A9NH 1BZ9A 1NC2A 5GXBB 4NQXA 2BSSB 1DQLL 1HDMB 3LKOB 3VFTB 4XCEB 1MCBA 3D85B 5C0RL 4K71B 5C7XL 4Y4HC 1P7QA 4DOHE 5BJTB 5TH2A 5HVWA 5I75B 5IP4A 5HPOA 3K4DA 3DUHA 3S98A 2WWKO 2CJUL 5D2NA 3VXQA 1A7QH 5I1JH 3ZDXF 3B3IB 3DSFL 3D48R 3ROLA 5IGXL 1RUQH 2PNDA 3KGRA 5L0QC 1RJYB 4NP4L 4NIKB 5DJAA 3LKQB 4G3YH 3L3JB 3T0ED 2ATKB 3PWPA 4DN3L 4ODVL 5IBTL 5C0IA 3RZCB 2P46B 3N1MC 1JWSA 5F93C 1XF5A 2FWOA 1OL0A 5HHMB 4QWWD 4MNHA 4UINL 1U3JA 2JTDA 4JCMA 1CFBA 3BP7B 2BNUA 5DGQA 2R29L 5CGTA 2VKWA 3U4EB 4KGLA 1S7QA 5EZOH 1G7PB 3HNVL 3UO1H 5DJXB 1NBQA 2EYSB 2EC9T 4YHLH 4KI5D 2PTVA 4XVTL 4M8QB 5CINL 3MBEC 2Y23A 1DVFB 4X9FA 3QO0A 4ZUVB 1HILA 1D6EA 4ODSH 1DLFH 1I8IA 2AJZA 2ZKHH 2DQJH 3U30B 1GZPA 1SQ2N 3OG6B 3PGCA 1FO0A 3MNZA 1ZTXH 4CDHA 5GGRA 3RL2A 3IFPB 4X7SL 2QQKH 4WTWA 3O6FB 1WWBX 4JZJB 3L3GA 3IU4H 3BP6B 3HCVA 1CK0L 4K9EC 2DJUA 3QZWB 1U92A 1QPXA 2VXQH 5DMKA 3BPOB 5EULV 2XYCA 3HZYB 3WFBL 4FFYH 3MRHB 1T20B 1FLRH 5GHWH 3U2SA 2VJXA 2AI0H 1FZOA 3BRDA 5HHME 2DYPA 2VR4A 4UTAH 4YC2C 3KPRA 4KDWA 4OCLC 4YEEA 4KVNL 1MJUH 5IW1A 4DVBA 4YDKH 3OAUL 3O9WB 3D39D 3I2CH 2P43B 5AD0B 4QOKA 3C60C 2Z8WC 1EA9C 3GB7B 3B9VA 3PHQB 4OI7A 1J05B 4X8JB 3ULVL 5EZJA 5F9JA 4GAJL 2C7UB 2NY6B 3O41A 4TNVK 4U31A 3T0XA 2D7OA 4L8DB 1LO0L 3OF6D 4QXWA 5DUPH 3TBVA 1DUZA 5IFJB 1QFWL 4B5EA 1AXTH 4GXVL 4HIJA 2FCBA 4OUUA 2B2XH 4PLJD 5KSAD 4OZ4B 3EFDL 5C86A 1E28B 1YNLH 5BVJB 2VDML 4HC1L 2W1NA 1TJHH 3IXTA 1ONQA 5ADPH 1BEYH 4KZDL 4G9FB 1EUTA 1KN2L 1ZAGA 4AL8L 3OGCB 4U1MA 1T2QL 5SX4I 4H8WL 1WICA 2NX5B 4K94L 4OGZA 3JTTA 4EKXA 3TIEA 2XWBA 3STLB 3MRRB 5GSVB 2X10A 4RFEB 1JGUL 5IB3A 2A0LC 5DJCA 4NJAH 1K85A 4HKZA 1IBGL 3GMLB 3MRQA 1IGFH 1J1XL 1S9KC 4NWTL 5E2WL 5I66B 5CJQH 4N68A 1OAUL 4HUXB 2DBLH 4DKDC 1RZFH 4AM0A 1K8IB 1M7XA 4HF5L 5E9DA 1CZ8L 1FGNH 1S7VA 5I18H 5CP7B 2P8PB 2G9HB 4FZEL 4MX7B 4LLUA 4ENED 4KTYA 1Q72L 5F70A 2HFFA 3RWCB 2QSCH 1YPZE 4X7EC 3ARYA 3WD5L 4JJHA 3KG5A 4K7PL 2W0FB 3SEPA 3T0EB 5GRUH 4G9DB 3V4PL 3ULUC 4NBYB 4PIRF 2OZ4L 4PRPD 4HWEL 1A6TB 2PF6A 2K1MA 3R8QA 1BVKB 3WUWG 4JAMA 5D2NC 1E27B 2DAVA 4YHPA 1D5ZB 2ZCHL 3MC0A 1LD9B 4G9FE 4ZUTA 3F7YB 5DR5L 5I1CL 3H7BA 2NX5E 2P44B 3D2UA 3F6LA 2DQCL 2J1KA 1FNAA 2P24A 5EC1B 3QRGH 1E4WH 4M7JH 5JR1H 1H3TA 1ZT4A 5GRZA 4UI2A 1S3KL 2VLRD 2APFA 5FYJE 1RK1B 3G04A 2OR8A 3DYOA 1PGRB 4M8VA 4HIHA 4KTDL 5IMKA 1W0WA 4QT5B 3GI9L 3CFKA 5DEGB 1QZ1A 3QCUL 2Z35B 4XP5L 1XF2A 4G6MH 5DRXA 5DQDL 1HHHB 4BQBA 1MQKH 4U6XB 3GMMB 2VLJD 2RJMA 3T0EE 5CSZA 1JGDB 2EH8L 4Q74A 4ONHA 1BJ8A 2R0ZL 1I9EA 3BAEH 4ZD3L 5HYFA 3G5YA 1ORSB 1ZA6A 3QG7H 1A7NH 4O5LL 5IB1A 1P2CA 3CCHB 4ZOBA 5I0ZA 2BVQA 4XTRD 2ADJB 1WWCA 3UYOD 5ICZB 2RB8A 4LLDA 2OJZH 2ZOLB 4M5YH 4P5TD 1M7DB 3BW9B 1AHWA 4KI5E 3HS0B 3O0RL 4LNRB 1P84J 3VRIA 1QSFD 2X4OB 1N8ZA 5I8EA 1Z5LA 5FF6B 4O2CB 1YPZF 1ACYH 2VLLA 4HJGA 1AY1H 3S7GA 4ZOCA 1ETZA 2XTJC 4U3HA 4TSCL 3WEXA 2BXYA 4OZHF 5IW3A 4HBCH 4NKOA 3BN3B 3IDNA 2IPKB 4EBQL 4JO4H 3RVXD 4M62H 1PDKA 1LO2H 4YHNB 5HD8D 5IIEB 2GTWA 5EU7C 4RGOL 4ONOA 5C9JB 4P23A 2GW5A 5C6WH 4HUNB 4KKLC 4ELMA 2GSGB 3HN3A 5F89A 3MV9D 4FQIH 4PRAB 5I8KH 2DTML 1FVEB 4KUZH 3KHOA 4LOUD 1ZT1A 2G75A 1U2CA 2AXGB 4R96B 3GDBA 4K07A 4EEEA 1A6UL 1LP9B 3QJFA 4D9QD 2GY7B 3BQUA 4TSAH 3CVHB 2ZUSA 4HEME 1E4JA 4HZLA 5A2LH 2C3XA 4XP1L 4JY5H 1TQCC 3WUWA 3VE0B 1Y0LA 2D03L 1WIOA 1K2DA 3I50H 3TO4A 2ICWI 2WIMA 3RJDA 3VWJA 5GS0L 1WZ1L 3O45B 1Q9KA 3EUUA 3T04D 4E0RA 3JTSB 1G7QA 2A83B 2DQTL 3G6DH 4YHIB 5F7KC 3RUGA 5DD1H 4PJBF 4YBLB 3RWDA 2P5EA 4XNQB 5F9OL 1MPAH 4WTZG 3HZMB 4FQJH 4R4FL 4U6HA 3QUXA 1CE1H 4KI5F 4LP4A 1TVBB 4OZFG 5FYKD 4O9HH 4A6YA 3MV7D 4PRPB 3RHWK 4E42A 3GNMH 4UOW0 3E0GA 3HFML 4TUJB 1KB9J 3H9HB 5TFSH 4JPIA 3VI4F 2IH3A 4N1CA 3WN5A 3EJZD 1A7RL 4CU8A 3ZYIA 5HDLA 2OSLA 5JQ6H 1LP9E 4ZUWB 5GGSB 2AQ2A 1AGCB 2UVFA 3NPZB 5C0BD 4WUUA 4XP6H 1KXQE 3K7UA 4U3XA 1XF4B 1XF3B 2VLRB 1MRDH 3NZ8A 1J86A 4BQCA 1MF2L 3HE6D 1R3KA 2GUOB 3ARPA 3HAEB 5E5UB 1MUJA 3CSPA 1T22A 4Z0XA 3M1BB 1FV1B 3S36H 3ULVC 1LEKA 1WCQA 1FC1A 2VLJB 4IOIB 4L29B 3B5TA 5IG7B 3WE6A 2Y6SD 5DJ6B 1FVCA 1WUNT 4DGIH 1NDGA 5FFLA 1EPFA 4PJEA 2HT4D 1P1ZA 4CU7A 4U1IA 5I73B 2J7LA 4DKAA 1CDBA 5C0DB 3O3BB 1Y6KR 5HDOA 4P5TB 5CJ5A 4BQ9A 1JWMB 4OQTH 4PRIA 2BVPA 5EU4B 3ARDA 3BRFA 1CTOA 1OAZL 1QSFB 4LASH 3OXSA 1CDJA 5J12B 2F5AH 3AVEA 4N9GB 1AD0B 5T1LD 4O2EB 4Y8AA 3GHBH 2VLRE 4H8WC 2XN9D 3UROR 3HZVB 5DI8A 4ZSOB 4ZS6D 2WBKA 4LLYB 1FP5A 1BWWA 1CF8H 4JPVH 1AHWC 3LD8C 1RURH 4JHWH 2UZYB 4NKIL 5I8OL 1HHJB 2B20A 1IKNA 3FFCA 3ULUH 1X6NA 5LGHL 4LRNL 5T5NG 3WXVL 4FFVC 1F58H 2XG4A 3MGOB 2CLRA 2VN7A 3S9DB 2VLJE 3V6ZA 4ZOAA 1U93A 4I3RH 2DQFA 1JGLL 3QFDB 1LP9F 1NC4A 5JOEA 3ABZA 5IM7A 1FBIH 2B5IB 3MACH 1CIDA 1OTTD 1HKFA 5FGRA 5C6PB 3V9FA 5AG8A 1J0YA 4D8PB 1ND0A 3Q1SL 4PUBL 1WBYA 4WTZA 3VFUA 5EU5A 2MSPA 2VC2L 4CVWA 5JXAL 1Z3GL 3UJTL 4WCYH 5ICXA 4NZUH 1QSFE 1KPRB 2XFXA 3G5ZA 1DBAL 4P23C 4X5XA 4RFNC 4LSPH 4MA7L 4CL7A 4QXTB 2JB5L 5J9PA 4V1DA 4LIQL 3P73A 4ZSOE 4XPTH 4J7RA 2IMMA 4HV8B 3E6FB 1X5GA 2FHBA 2YUZA 3L3DB 3EYQC 3BQUC 3N1GC 5DJZB 4HS3A 1QPPA 5F7DA 2AK1H 1FO0H 1KN4L 4GRLD 3WO3B 1EBAA 5DT1L 1DN2A 4R0LB 1TJIL 3WXWL 5H2BB 3IDJA 4J1UB 3VWJC 5HGDA 4TNVF 5C3TA 3ARZA 4U0RB 1NCWL 1RV6X 1YYML 2L7JA 4UAOC 1WEJL 1CFTB 1S7XA 3REVB 4OKVA 5DA0B 3HPJB 3VG9B 5ITFA 4W6WB 1U8MB 3QUXC 4P5MB 1KBGL 4KAQH 4GRMA 1CLZL 1P4IH 2LVEA 1FNFA 5FA3B 2AV7A 5T1KD 4BKLB 4XP9H 5E8EA 2CQVA 2P8MB 1DANT 3BP4A 1IM9A 1TMCB 5EO0B 3HE6B 2ID5A 3WN5C 2ZSWB 5F21B 1PKQA 2IALB 5C0RH 1OSPL 5C7XH 1BGXH 3LQZB 3MRNB 2XKNA 5TQ0L 4G7YL 2DLEA 2BSRA 5EBMA 2I9TB 1IGCL 4QRQA 3WHXB 4APQD 2CJUH 1YC8A 2VZUA 1IAKB 3IJYA 1RJCA 2LV4A 2BSED 3DSFH 5KG9A 4FXKA 4Y19A 5IQ7L 1M05B 4BFGA 1QSED 2Y07H 1LO5B 4JFFD 1FCGA 4PG9A 4ZNEA 1ZT7B 2IQ9L 4DN3H 4KKCC 2A6DB 1VHPA 1OB1A 4ODVH 1NGZA 2VL5B 3B9DA 2DQHL 1BQSA 1GGIL 5DK2A 4JZNB 1R3LA 4HJJL 4UINH 4F8QA 1CLCA 4TVPE 4I18B 2R9HC 3QUML 2PCPA 1CFVL 1FNHA 2UZIL 3HNVH 4RFOL 3MLTA 3MRBB 4MXQD 3ALWA 5T1LB 4XVTH 4FXGB 1S7UB 2SEBB 5H35A 2FL5B 4WO4A 2XN9B 2YPLD 3MCG1 4KJWC 1JYWA 4OCSH 1U8NB 4UBDD 3RDTA 1CI5A 4E9LA 2FBOJ 1EAJA 1WIPA 3MJ6A 4CKVX 4E5XA 4LLVB 2C4FT 1T7XA 3NFNB 5GGSY 4UQ2B 3S37H 5BXFA 4LSDA 1UH3A 4M48H 5GS0C 4XH2A 4F8TA 3ARBA 3RWEA 3MXWL 1QOKA 4W6YB 3WFBH 4AQOA 3Q48A 5DJYB 1IKNC 2GY5A 1JNHB 4WV1B 1B88A 2FEEL 3ZE2E 5JHLL 5L7XL 2R1YA 4LHQB 4OF5A 1AGBA 1H3WM 3GSQB 3DRTA 3RX5A 1A6PA 4EI6A 3DMMD 1MJJA 1KFAL 5C0JB 2XN9E 4GG6B 2OTWB 2W60B 3ULVH 4ZTOH 4GAJH 5EIIB 4OD2A 4FMFA 3WNOA 1J10A 5FIEA 1LO0H 3O2WH 1MCDA 5HGHB 1KB5L 1NDMB 1JE6A 2FYYA 4GXVH 3KPPA 4RQQB 4Y16D 5HI5D 3SDYH 1ZKAA 4IJ3C 3CD4A 5JORB 1INQB 2NY3D 1KNOB 3EFDH 4KC3B 1C12B 2OBGA 2MQCA 3HC0B 1SJHA 2EYRA 2EDBA 4PTTA 2VDMH 4X4MA 1RZKL 3UTTA 1A3LL 4RNRB 3WLWD 5K9OA 4P4KA 3QUMA 3VFOA 4WENB 4F80A 3S96A 1FNEB 4GSDL 4KZDH 4NDMB 1KN2H 5BV7C 4AL8H 1AJ7L 1T2QH 1G9NC 4LLWB 4H8WH 5H8DA 3FOLA 1YNKL 2ZUQB 1WAAE 5T1KB 4L1HA 5HPMB 3D18B 3SGKA 3MOAL 5CS7A 1J12A 1JGUH 4H20H 3MUY1 3BZDA 2FJHA 4GG6E 2K7QA 3QJHB 1J1XH 2YEZA 4OFYD 4NWTH 5E2WH 3GZKA 1OAUH 5EBLB 1AO7D 3PG2A 4YHYB 4P57A 4JFQA 4PJ8D 5E4IA 1CZ8H 1RHHA 1D5XA 5EN2B 4GW5B 4CJ0A 4APQB 4K3HA 1FSKB 3BPLC 1OVZA 4FZEH 1T83A 1AQKL 2C9AA 1Q72H 3FQUA 3H9YA 3ZE2F 1Z0MA 5A16B 4JM2B 4FQQB 1QSEB 4JFFB 2CD0A 3WYRA 4K7PH 1G7JA 3MJ9L 4WW1A 4DJMA 3O11A 3SE3A 4G42B 3O6LH 4MJID 4Y4HD 1WV7T 4TTDC 2YD9A 1IVLA 1J87A 2IMNA 4HWEH 2HFTA 4AG4L 5J4MA 5LQBL 5F96L 3TF7C 4R3SA 2NNAA 2ZCHH 4NYLA 5JUEL 5I1CH 1EMTH 5FGBA 2DQCH 1CGWA 1WCBA 4AQ1B 2VQUA 2FX7H 1DP0A 2JK5A 3DX8A 5HI3C 3E3QE 4BM7A 3RHWF 1CLOL 1JK8B 1EO7A 3EGSB 1UH4A 1S3KH 3QAZC 4ZQKA 2A1WL 3QPQC 3BYTA 5HYJA 1IEAB 3QBTB 4KTDH 3JWOL 4FQLL 5KSBB 3H9SD 1HWGB 3GI9H 3GBML 1BFOB 3B5HA 3V6OE 4WO4C 1KJ2B 5E2TL 4ZPVA 2XY1A 4Y88A 4G8GA 3UTQB 3ILPA 5DQDH 5I6XB 5J6HB 1QSEE 4JFFE 4B0MM 5F9AC 1C16A 3RDTC 1BBJB 3EYOB 4QRRA 1WAAF 4M6OL 2EH8H 1U8IA 1ZLSL 2R0ZH 1NFKA 3RI5K 4ZD3H 3P9MB 1WSST 3Q3GB 3QULB 4O5LH 4A6YH 4J3SA 4GG6F 2C3GA 3RPIA 3Q6FA 3GHEL 1RIHL 3MXVL 5KANI 3WFCH 2ICCA 4NN5B 1JF1A 4JRYA 3ARBC 1EO5A 1HXYA 3TA3A 3O0RH 2GIYA 1QBLL 4R8WL 3GSOA 4H5SB 1E6OL 5DMGC 1I8MB 3TCXA 2GTZA 5D5MA 4EVNA 1AE6H 3PWLA 3VD7A 3GSNL 1BECA 1IAIL 2Y7QB 5JIPA 4TSCH 5ESVA 1I1FA 3CMGA 3U82B 1BQUA 2MCPL 1TLKA 4EBQH 2MKLC 5KSBE 4ZFFA 1KJ3L 1TTUA 2PKDA 3QXDA 4Y16B 4HK3J 5J13B 3PDDA 2NY3B 5EOCJ 4JY4B 1TCRB 2YN3A 2R2HA 1XGQB 3PXJA 3QXAA 4W68A 1E0OB 1MCCA 4RGOH 3BT2H 3AMLA 3MCKB 2J5LB 4LSSL 4DZBA 3PP4H 2AABL 1AKJD 4WI9A 2GCYA 5DHVA 4LVEA 3ARUA 3EDEA 1U8JA 4ZAKA 2DTMH 3G5VB 3BO8A 3CZFA 4G80B 4JGJA 5IESH 4L4TD 3SJVA 2BSTA 2DQGL 3VMPA 4TUOA 4HLJA 4X4XB 2KKQA 3F5WA 4LHUD 1RK0A 4X6CA 3LQMA 1VACB 4Z7QE 4P4KC 4XP1H 2GI7A 3DVIA 3L5JA 3MV01 4JM2F 1EK3A 2D03H 3IFOB 5D6CA 2EIDA 2HN7B 1AO7B 4PJ8B 2X9YA 3FQNA 1VEPA 4UDTB 2IFFL 5D1QC 1QFWI 5E2JA 1SJEB 5GS0H 5EUOB 1WZ1H 2OJEB 1VGEL 4JO2L 1R24B 1IEHA 1OTUD 1TCMA 1R3HA 3SGKC 2A0LD 3MRLB 5MI0B 4NQCA 2QQQA 5F72S 4YDJB 2NXYC 2BZDA 3GJEA 2YSSB 4R4FH 4C55A 5GGVL 1QRNA 3CFEA 4MJIB 4Y4HB 2HH0L 3U1SL 43C9A 4M7KL 5DMJB 1BJ1J 2IH1B 3TPUB 1T83C 3DVNA 4XBPA 1S7SB 2BVOA 5DS8A 5I1LA 3MNWA 2HFEB 3TH2T 1X5AA 4M3KB 2DM3A 3OKLB 5L0QB 5DJ0B 4RX4A 1NC2D 2HVJB 4HUUB 1EAPB 3QNYA 3SE3C 4M1CC 1EV2E 4BZ1H 4Y2DD 3ULUD 1P7QD 4XPGL 4MXWL 3UBXB 3DXAB 4YHKL 4GKOA 4JVUA 3DURB 5CSBA 3GSNA 4YXLL 2XI9A 4PV9B 3ARRA 2IEPA 4S1QH 1AO7E 5JLZA 4DKEL 3GIZL 1MF2H 4D0BA 1C1EL 1CD8A 3GMPA 3P9LA 3QIBA 1A14L 5FGBC 4YGAB 5EUOE 5D6DA 4OZGA 4WFFD 4NC1E 1NFIB 3MBEB 1HIML 4LCYB 1ROWA 1OHQA 1PY4A 2ZNWA 3W11C 4XBEH 1OT1A 4I48A 2EE2A 5KN5A 3QUKB 1G6RL 4MJIE 1N5AA 3BSZL 3JXAA 4OM1L 3SDAA 1RULL 4Z7QF 3TIDB 1KXVC 3GO1L 1NFDB 2JELL 4JN2A 5DQJB 4HIXL 4BELD 2VZVA 3SOBL 3BPCA 1D5MA 4BUGA 1FJ1B 4NHUA 3GMNA 2YA1A 3HPLB 1YNTA 5F1NB 3VI3E 2YD1A 5IB2A 2R23B 4GKZA 4GT7A 1OAZH 3AS2A 1A6WL 3IDMB 3MRMB 1FNLA 1EJOL 4OLEA 3DXAE 2J6EA 3SHSA 5T3XL 4YC2B 4YX2L 4JFOB 3NCYP 2D3VA 4LHJB 3VFNB 3MMEA 4YBHA 1FG9C 2DJSA 3C60B 3TA3C 3GK8H 3QUZA 3ZHDA 4NKIH 5I8OH 2H1PH 4I3GA 4I4WB 4K23L 2BMKB 4LRNH 1N3NB 2VQ1B 3WXVH 3GMRA 3KPNB 2DYPD 1DR9A 4NO3A 3UJIH 2O61B 3ME0A 5LWYL 1NGWA 5CP3A 3VW3H 1OY3B 3STZB 4PGEB 5IEHB 4NT6A 4FQHA 1AKJB 1KCUL 4QOKD 5GS1A 1NFDE 3OR6A 2X42A 3IU3B 3OB0H 4ODUA 4OAWA 4L4TB 3MRPB 4DKFH 3Q1SH 4PUBH 1CVRA 1ULVA 5D7SL 3LIZL 2YPKB 5E1AA 2VC2H 5JXAH 3UJTH 5EUOF 1FG2B 4LHUB 3H0TB 1U8QB 3MGAA 4BUHA 3VH8B 1CDUA 4N8VA 5IHZA 1FPTL 2JB5H 5L2JB 4LIQH 4ZAKC 5CKAA 5C71A 4DQOL 3ARFA 3RWJB 2ED7A 4HS8L 2DOCA 2BY1A 4X4YA 3LPWA 4UNTA 1CVSC 12E8L 1NBYA 5IHBA 2OTUB 4P49A 2OK0H 1KEML 1JGVH 2I5YL 1KN4H 4LGSB 1IQWL 1I1YB 3L1OH 2XKSA 3U48A 5DT1H 2C26A 2PO6A 1XH3B 3LHPL 3VI3F 3JWOC 4JM4L 1TJIH 3WXWH 3FHAA 1CS6A 3HLAB 1VKXB 4P2YA 4Z76A 1NCWH 1F2XK 2FECL 1YEEH 1YYMH 3EO0A 3LB6C 1ZHNB 1CDHA 4L4TE 1WEJH 1NC2B 1YJDL 4NQXB 4QXUL 3IKKA 3MFGB 2MTPA 1P7QB 1KBGH 5TH2B 5E9DD 2W9LA 2WUCL 1CLZH 4NN7C 1NCCL 3JBG7 1IAOA 4QCIA 2J8UB 4R4NC 3S34L 1LQSR 2GKIA 5D2NB 3VXQB 4IRJA 2NY0C 2E7MA 1JHLH 3ROLB 2NW2A 3NH7L 4X5WA 4EN3A 3UP1A 4LPCA 5AZ2L 3LEVL 5DJAB 4X6BA 3PWPB 2EO9A 1KIQA 3DX9A 3FAXA 3AC0A 3WNKA 4FS0A 4XI5D 2PYFA 5C0IB 3KLSA 1NFDF 2QADC 2R2CA 4G7YH 3P0YL 1JWSB 1IGCH 1MREH 1K6QH 2R56H 1PEZA 1XF5B 2FWOB 4X80L 2XOTA 3O4LA 3D25A 2GJZA 1C5CL 2BNUB 3T4AA 2FJFA 5IQ7H 5FOBA 2Q8AL 3QIBC 15C8H 3PHSA 3TJHC 2IQ9H 3UPAA 1BD2A 5IMMA 2BNQD 2CRIA 5DD3L 4LMQI 4BZ2L 5JIIA 3V79C 1HILB 3QUMH 1I8IB 1NAKL 2AJZB 2F9BT 1O7SA 3JZ7A 4PJFA 5KOVC 1CFVH 3M07A 3U6RA 4YEFA 2UZIH 2XWTA 4RDQG 4RFOH 3ULUE 1GZPB 3DGCR 3REWB 3SDAC 3PGCB 1FO0B 3MNZB 2C1PA 1UGNA 5GGRB 3RL2B 3ZTNL 5D2NE 3L3GB 1BX2A 3HCVB 2A77L 3OB8A 4G8FA 1VGKA 3DV6A 5HHPA 1YN6A 1U92B 3C5ZA 2H3NA 5DMKB 3PWPE 4WFFE 5I76A 1P9MA 2FB4H 3U2SB 1FZOB 1PYWA 3PIQA 3T0AA 4JZOA 2DYPB 1CQYA 4EXPX 2GEEA 3KPRB 2XTJB 1F5WA 1U8LA 4AEEA 1OPGH 2GSIA 4MB4A 5IW1B 5SV4A 3MXWH 3TT1L 4PJXF 3MPCA 1HNFA 4JKLA 4QOKB 2XZCH 3EDDA 3QUZC 1VEMA 1KIPA 1CXLA 2WINA 3LZFL 3QFJA 4ZO6A 1HYSC 2FDBP 3JUYA 1RHFA 4FFVD 5BRZD 5EZJB 5F9JB 3P40A 1Q8MA 3O41B 5JHLH 5EFIA 1LWRA 2D7NA 3BHBA 5L7XH 5AG9A 1M6OA 3FONA 2M26A 3F7RA 3TBVB 2IPUG 1DUZB 5KVFL 1DQDH 4KMTL 4HIJB 5I8CA 1QQDA 5GS1C 3RI5F 2ARJA 4OUUB 3IDYC 2P8LA 4HPYH 2OI9B 1ZVSA 1OCWL 3V0WL 1ED3A 4OLYL 1OGAA 1FFQA 1KB5H 4P23D 3IXTB 1ONQB 1TQCB 2EXYD 4U6VL 5SWZA 3TN0A 3VFRA 3R0NA 4D2NA 1TQBC 1MFEL 5ALBL 4U1MB 3KPRE 2XTJE 32C2A 3ULUF 1A6VL 3JTTB 2W9EL 1UQSA 3TIEB 2DQUL 3ARFC 1AGEA 3L5IA 1CFQA 4JB9H 3LKNB 3EYQD 4QOKE 1A3LH 4WHDA 4YWGL 3BQUD 3K4ZA 4O2FA 5DJCB 5DWUL 4HKZB 5FAAA 2X44D 4UB0H 3MRQB 4FQCL 4GSDH 1EERB 4WFEE 4ONFL 2GITA 5EU7E 1AJ7H 2PO6C 4AM0B 1F6AA 2CPCA 5E9DB 5GRXG 1YNKH 1JPTL 5E94A 3VWJD 2ICEA 3RVWC 4YFEA 4J2XA 4LLUB 4F37K 3M8OH 1MLBA 1K4CA 1UKSA 3U9PL 3AUVA 2HFFB 2UZXB 1N5YL 3MRJA 2P5ED 3LSOA 2DLTA 1WTLA 3F7VA 4FHBD 4QF1A 5D1XA 4JAMB 4YHPB 4IRJC 1B4JL 4ZUTB 3TYFA 3EO1A 4Y2OA 3IXAB 3H7BB 1CGTA 5F7YC 4EN3C 3D2UB 4XCCL 1AGFA 3MJ9H 1JRHI 4UV4L 2P24B 1RZIA 4F7CA 2X40A 5GISL 1BZ7A 3RVUC 3G6JB 1KTDB 1ZT4B 3ARVA 2MHAA 2VUOA 1GOFA 4AG4H 1RUAL 5F96H 4OM0L 2ITDA 2H32A 1HHKA 5JUEH 2R0KL 3NTCH 4O02L 1M71A 1S5HA 3G04B 5DHVH 2NR6C 2F58L 1BLNA 4HIHB 5E9DE 5A2IH 5IMKB 4KKCD 4MWFA 1TTFA 1W0WB 3CFKB 5C09A 4QRUA 3IETA 1XF2B 3RNKA 1CLOH 5DRXB 2Z9TA 6FABH 4LEXH 3FB8A 2R9HD 3TBSA 3ZKNC 3QR2A 5CMAA 5CSZB 3MFFA 4ONHB 2DLGA 3JWOH 2CIIA 1JZ8A 4TVSa 3S35L 1U91A 5IB1B 5GZND 1P2CB 3GBMH 5AWNL 3AFLA 2BVQB 2NZ9C 1FQ9C 5E2TH 3RVVC 3HI6H 4LLDB 4WEMB 1F8TL 1E4XL 4O51A 5JW4M 3MLWH 3C5ZC 3DJ9A 3VA6A 1AHWB 3LD8B 5FO7A 2OM5A 1ZLSH 2DBJA 3VRIB 3KS0J 4KZEL 3V7AE 3CJJA 1P9MC 3ULVE 4OTXL 1N8ZB 5I8EB 2DKSA 2YHGA 2VLLB 4HJGB 3LCYA 3MXVH 2OLDA 1UCTA 1ETZB 3WEXB 1P4LA 2IWGA 2QL1A 2WMPA 4HT1L 2CKBA 4NKOB 2BC4A 3IDNB 2JIXA 3QQ3A 5CIPH 5EB9A 4KRMB 1QBLH 1LO4L 3X11A 1YJDC 5F1SA 4ZFOA 3SDCA 5L8JB 5EO9A 2GTWB 3FB7B 1HH6A 3GSNH 1IAIH 4J3XA 5F1IA 1NC4D 1DQTA 4P23B 3BI9X 1U3YA 1MVUA 5F89B 4ELMB 1KJ3H 4Z6AT 4RFNB 2Z91A 5CEYA 3PWJA 4U2YA 3UXFA 5I71C 3BGAA 3OB0K 5L8KB 1AI1L 1QFOA 2VISB 5HHVH 1ZT1B 4AENA 4Y5YA 1DBKL 5JDSA 2PR4H 3NIGE 3QJFB 3BQUB 1MHPL 2ZUUA 2CIKA 1YDPA 4HZLB 3TT3L 3WUWB 2AABH 4JKMA 3VCLB 2FEEI 1Y0LB 4PJ9D 1GGYA 2NY2C 4V1DD 1K2DB 3BEWA 2ORBL 3VWJB 3IDUA 4HGWA 1JZ7A 1Q9KB 1RAMA 1G7QB 1K9TA 4Z7OE 5IMLA 4UAOB 1A1OB 3RUGB 5E08H 2P5EB 1TPXC 5EPMA 4F15C 3ZZ1A 4U6HB 2J6EH 3QUXB 4RWHA 2IFFH 3CFDA 4A6YB 1LE5A 3MV11 4E42B 1VGEH 4JO2H 2ARWA 3ULVF 4ELME 4M61B 5JW3L 3E1F1 5C0AA 4JPIB 2IH3B 3JV4A 3WN5B 3T1WA 4HCRL 5GGVH 2FLRT 2OSLB 1MCNA 4QHKI 2HH0H 3U1SH 5ISZA 3QZWG 2I26N 4UV7L 3KLAB 4WUUB 3D3VD 5JZ7C 3HC4L 1L0QA 3MR9A 5CP3H 2MCG1 4DAGL 2F5BL 5D7IA 4R4BA 3NZ8B 1KV3A 2A6IA 1IM9D 2CDGB 1NSNH 1EFXD 4IM8A 5C07D 3LN9A 5L88H 5JOFA 1R3KB 4EIGB 1LDSA 4GAFB 3V4VL 4BK5A 3QYCA 1MUJB 3KAAA 4OLWH 1MCPH 1T22B 4MXWH 4Z0XB 4YHOL 4YHKH 2ZCLL 3RUGE 4QHMA 3U0TA 1LEKB 2P5EE 4YXLH 4OLVH 2F19L 4R7DA 3NIGF 4DKEH 3WE6B 4Y19D 1C1EH 1FVCB 1NDGB 4PJEB 1EX0A 3K8LA 3O81A 1P1ZB 3TO2A 3RAJL 4U1IB 2BVEA 1HIMH 5IT2L 2DMBA 3EYSL 2EEBA 5HI3D 5H94A 2QJDA 4X7DC 4XCYA 4D0DA 3QPQD 4PRIB 2BVPB 1G6RH 3BSZH 4OM1H 4PJ5A 3SE8L 1RULH 4Z7OF 3OXSB 4UIKL 1HDMA 2VO5A 4WUUE 1RSFA 2VAAA 3QEQD 4ZXBA 3GO1H 3VD9A 2QTEA 4BQ6A 2JELH 4MJ2A 1EZVY 4HIXH 2EICA 5GSRA 1IL1A 3BIBX 1RQ5A 4UU9A 5DI8B 2Y5TA 3NFSL 3O3DA 3RDTD 5D93C 3Q0HA 4TOYH 1GC1L 4ELMF 1FIGL 4IBLT 5DGRA 5K9JH 3MRCA 1EJOH 3NZHL 2ATKA 4HIEA 1CU4H 2CLRB 4OD3L 5T3XH 3TNNB 4YX2H 3V6ZB 1U93B 3OAZH 2DQFB 4ERSL 3GBNL 1NC4B 5JOPD 1A47A 5IM7B 3DUUA 3ARBD 4FQ2L 1S9VA 3BJLA 2JJTA 3VXRA 4PJEE 1G9EA 2E5EA 1OP9A 5HHOD 3ZDYE 5IW6A 3VRJA 4H0IA 5DMGD 3JWNC 5FCUL 4HCRA 1ND0B 1PLGH 3P30L 3VFUB 5EU5B 3SDCC 1ZS8A 5FDWA 3LV3A 5LWYH 1BFTA 4F7EA 4PRIE 5ICXB 4ZUVA 5EDXA 1JFQL 1N64L 5C2BH 2XFXB 4GRWH 4OGAC 3G5ZB 8FABA 1DEEA 1KIUA 4MJ5A 1KCUH 3IAGC 4IJ3B 4JDTH 4F33A 3BDXA 5J9PB 4V1DB 5GGUA 3MLXL 2V5RA 3P73B 2DM2A 4JZJA 2F15A 4P9ML 4Y5YC 4M5ZL 4NBZB 1OARL 3QZWA 1FC2D 5EBWA 3FFCE 4X6DA 4HS3B 3HZYA 4U2ZA 5GPRA 1PZUB 1BVLA 5F7DB 3ZSSA 3O3EA 5BV7B 1IMHC 3K0WA 1GSMA 2VL4A 4DQOH 3IDJB 3N1FC 1Q38A 1MFAL 4ODHH 4HS8H 4QHUA 3EDKA 5GGQL 3UTTD 12E8H 3RNQA 4P4KD 1G9MC 1KEMH 2I5YH 4HKXA 3BP5A 4N9OB 5JW4R 4F7TA 1S7XB 4TQEL 4OKVB 5KOMC 1KYOK 1IQWH 2ZG2A 3DETC 3WNMA 4K7PY 5ITFB 3TCLB 3LHPH 1Y6MR 4JM4H 2AJXL 5D1QD 3FT4B 3UYPA 4KK9C 4GRMB 3D3VB 4XRCA 3BFOA 3BPLB 3BUYA 2AV7B 3LPFA 1ZLVH 4Y5XA 1EHAA 3MNVA 1NCAL 2HKFH 2UY7A 4LDOB 1IM9B 4V1DE 1EFXB 2NXYD 3BKYL 1YJDH 4QXUH 1BQHG 1PKQB 4PJEF 5DYOB 2XKNB 3ZDYF 5ID0A 2BSRB 4FN0A 5EBMB 4QRQB 4JPKL 3S34H 4LCIL 3CDYA 2QV2A 3IJYB 1PX3A 2X70A 5KG9B 4FXKB 4Y19B 3NH7H 1YEGL 3VXPA 4PG9B 5AZ2H 2QQLL 3LEVH 3F7QA 3RWIA 5C8JA 1OB1B 4M1CD 1NGZB 4JHBA 4JRXA 1OW0A 4BSWA 3FT3B 1R3LB 3C8DA 3QAZB 2OTPA 4F37F 1C5CH 4N0RA 1HQRA 4UNVA 3Q2CA 1YEIL 4OF3A 5AYUH 5T1DL 3VXMA 2Q8AH 3MUGB 3MLTB 3FZUC 4D9RD 4JN1L 5H35B 4WO4B 1LHZA 2Y9RT 3GM0A 3CLEH 2E7HA 2FBJL 4BZ2H 5MHSD 2Z0BA 3W11D 1NAKH 3RDTB 1CWVA 1PKQE 3RWCA 2JJSA 3UYRL 5HYJD 4E5XB 4TPRH 1F2QA 3WFHA 5DJDA 2AEIT 4ZXBC 4B53A 4XVSL 5TDNA 3PP3H 2A77H 4ZMAT 4G8GD 4Y19E 3IGAA 3OKEA 1PG7X 3ARBB 3RWEB 4ZNEE 3F62A 1IAMA 4QRRD 1X9QA 1AP2A 3ECBA 5C0EA 5HHOB 1INDH 1BIIA 3IDIA 5F3BA 4XAWL 4PJDF 5DC0A 4MQXC 1FCCA 1QR1B 1CL7I 1JBJA 1CXFA 2WSKA 1J0KA 3CVHL 2R1YB 3QG6A 3OX8B 1AGBB 4LLQB 4NWUL 3TT1H 4JRYD 3K2UH 3DRTB 2JJTC 3TA3D 2FX8L 4EI6B 1U8KA 1MJJB 3LZFH 4LNVA 4LCCA 1P7HL 4Z95L 4U7SA 4OD2B 1I3RA 1MH5A 4U7MA 2B7DT 1KJMA 1XAUA 1HHHA 1XIWA 3ZYZA 5KVFH 3VXUA 3CFCL 4KMTH 1FNGB 1PD6A 2FYYB 3KPPB 3N1PC 3FOMA 3FL7A 4HUMB 2E7CA 4OIAA 3PJSA 5J8OA 2AKRA 4KKBC 3RWGA 2A38A 1TTGA 5JOPE 1OCWH 3CCHA 4AT6A 4OLYH 1BQHA 4JZJC 5JPMA 3OKKA 1SJHB 4PTTB 3MTRA 3UTTB 5K9OB 1BF8A 4P4KB 3QUMB 1M7DA 3D39A 3VFOB 2EIZA 4U6VH 1FZKA 2ICWB 5JHDD 3S96B 5BS0D 5D72L 4JFEA 4ZAKD 5ALBH 5D1QB 1WWWX 3FOLB 1A6VH 3VMOA 2W9EH 3SJVD 2I27N 3UJJL 1KCVL 3B8SA 2BY3A 4YWGH 4LPUA 1WWAX 2V7HA 4NO0D 1YQ2A 2NXYB 4FQCH 4U3CA 1F90L 2YEZB 5DZLA 3KYOA 3UDWA 5KSAA 4HZAA 4P57B 1J0IA 4JFQB 4YHNA 1RHHB 1MLCB 1D5XB 1JPTH 1ZSDA 2HYMA 2AEPL 4LSUH 5T5NF 3TNMA 2CKBH 4Y5XC 3LB6D 3DPBA 3U9PH 1U95A 3FQUB 2A74B 5K59E 1QHOA 4ZPTA 1P4BL 2P4AB 4YHZH 4EOWL 3U4AA 1GC1C 3OJMB 3H9ZA 4WW1B 2XZAL 3RJQB 3O11B 4YXHL 1QRND 1R5IB 4OCRL 4X4ME 3VFSA 3UTTE 3SY0A 2UYLA 4R4ND 5TDPA 3B5GA 4R3SB 4BSJA 2NNAB 1UKQA 2NY0D 4NYLB 3DROA 3GJFA 3QHFH 4N90D 4X8XA 1KC5L 4HJ0C 3C5JA 4RX4D 4XCCH 4PJGA 1LO3L 1WCBB 3MROA 3QWOA 1A21A 4MB3A 3LOWA 2QQNH 5K33A 2WWMC 3ROOA 1F4AA 2QADD 2JK5B 1OW0C 1GJIA 2W59A 3PWUA 4JR9L 2A83A 3HZKA 2R0KH 4ZQKB 5HYJB 1WBZA 2LABA 2F58H 4X9HA 3F58L 3TJHD 2CLZA 1A3QA 5CKGA 4GLRH 4KWUA 4PRPA 2OXGA 4ZPVB 4G8GB 3I02A 3ILPB 2D9CA 1CGYA 5I1EL 1C7TA 5DO2C 1I9IL 1C16B 2JKXA 3WJLA 4QRRB 1VB9A 2V5SA 3H9HA 3VGGA 1U8IB 2JJSC 4R6UA 3SDAD 2X5PA 3S35H 3MBXL 3I3EA 5AWNH 3Q6FB 1MCQA 3C6SA 1SYVA 5CLWA 2OL3A 2BERA 1F8TH 1JF1B 2JE8A 3CU1A 4JRYB 5D2LF 2E9JA 4LGRB 1BFSA 3WBDA 1HXYB 4GQPH 3TA3B 4D9RE 1IGIL 35C8H 3GSOB 2XRAL 3SKMA 5FEBA 1MFDH 4KZEH 3GSUA 5KAQG 1HZHL 5K59F 2DICA 4OTXH 3KPSA 2GTZB 5FV2A 5LG1A 5D5MB 4EVNB 3L5WA 3PWLB 5DUML 4XPAH 2VH5L 4P2RD 5HYJE 3OAZK 5ESVB 1I1FB 1MHEA 4HT1H 2YR3A 4P59L 4ZFFB 3OHXA 3T0WA 1IC4L 1LO4H 3QUZD 5FYKL 1K3ZA 1HYSD 1M4KA 3QUYA 1PX4A 4G8GE 3WNLA 1BPVA 4LCCC 2R2HB 5DFWH 4QRRE 3QXAB 4YDVA 1WFTA 5I30L 1XIWC 4WWKA 4NRXA 1JWMA 2R39A 4DZBB 4EQ3A 1UM6L 1YYLH 4OCXL 1CXEA 2GCYB 3K3QA 5DHVB 2KZ1B 5D7LA 1U8JB 4ZAKB 4PYGA 3BO8B 3CZFB 3ILQC 1AI1H 1P5VA 3SJVB 2BSTB 4JRYE 3ZT5A 3P0VL 4ZO8A 4XVUC 1NBVL 1KULA 1FHGA 3F5WB 1RK0B 4X6CB 1T04A 3K46A 5K93A 3WKML 3TT3H 4S0SD 4N0UA 3DX6B 5D5ME 1M7IA 5D6CB 2VDNL 5E0QA 4OCMC 4Z78A 3FQNB 2B0SL 5KSVA 4PFEA 3W2DL 2VNCA 5F7EL 3ARFD 2NW3A 3GSXA 1R3HB 1T3FA 1UG9A 3HMWL 3MV9A 4NQCB 1IKFH 4G6JL 2EC8A 3GJEB 3UDWC 1QRNB 3CFEB 4DK3A 5KSAC 2PO6D 3ZYJA 1NGXA 4WUKL 4BQ8A 43C9B 4NN7B 4M1GL 3TV3L 3SBWA 5IHLB 5GRWA 3ETBF 1LEIA 4C54A 5JW3H 1QYGL 1X4YA 3DVNB 4XBPB 2NY0B 2BVOB 1UZ6E 5DS8B 3MNWB 1ZLVK 5ICYA 3KJ6L 1MCEA 3HE7D 4KROD 4RMVA 4Q9QL 1KG0A 1XR9A 3HR6A 5IWLA 4D94A 43CAA 1MQ8A 1Q94A 2ZOKA 1MCFA 3SJVE 4HCRH 3WNNA 3QNYB 5JW4N 2CUIA 2QADB 3BD5A 4X6CE 4UV7H 3LY6A 3X3FL 3WO4C 4DAGH 3A0OA 3GSNB 2DB8A 1G1YA 4IRJD 2FNBA 5JLZB 2R4RH 4PGJA 4D0BB 4EN3D 3P9LB 3QIBB 3V4VH 1JWUA 4OZGB 3IVKA 3MV7A 1IARB 1GPOH 4LSTL 3RVUD 2ZCLH 4NQCE 1J1OL 2OCFD 4XWGL 4I48B 2ZG3A 2F19H 4KFZC 3O4LD 2I60H 3N9GL 1MCWW 4H26A 1QRNE 1N5AB 2NR6D 3SDAB 3EYVA 4GXUM 5DDHA 3RAJH 3T08A 1BD2D 4JN2B 5C0BA 1F3DJ 1ODAA 3BPCB 1D5MB 4HIIB 4NHUB 3GMNB 4BKLA 1WGOA 3ZKND 1A7QL 1B0RA 4HMDA 1YNTB 2UV3A 3WJLC 5IB2B 3OJDA 4GKZB 3DGGA 3KWWA 1W2KT 2ICWJ 5J1AA 4UIKH 1C5BL 1FGVL 3BUTA 4ODWA 1T80A 3TVMA 3MRNA 1QVOA 2NZ9D 2V9QA 4S1RL 2F54A 3RVVD 5LGKA 3PP3K 3SCMA 3K8KA 5D4QA 3MMEB 3C5ZD 4CUCA 1GC1H 1RMFL 1I7TA 3QUZB 4OZGE 1A2YA 5EZOL 3UO1L 4B50A 4KRPC 1UZ6F 3C8KA 4JHZA 3B4NA 1PEWA 2WM0A 3KNBA 4MCZB 1YA5A 3GMRB 4OD3H 4RZCA 4NO3B 4P9HC 2DTSA 2PYEA 4JZNA 4ERSH 3GBNH 1NGWB 1VESA 3I6GA 4XC3L 5D71L 4X6CF 5ITBL 1H0DA 4MDIA 2DQJL 5E6IA 1X3DA 4NT6B 4FQHB 5GS1B 4OFKA 3IDYB 1PAMA 1NGPL 3MOBL 4ODUB 5FCUH 3QFJD 4OAWB 5T1LA 2QQKL 3QUYC 1NMAH 4OB5L 2E7LA 5E1AB 3BKMH 3JVGA 1MIEH 5EORH 4KUCD 1MCRA 1N64H 3MJ7A 3U46A 4WWKC 2HKHH 3LAFA 4MA8H 4ZFGL 1K5NA 3UZQA 1WBXA 3RQ3A 4N8VB 5IHZB 2D0FA 2YXFA 5CD3A 2AK4D 1IE5A 4Z8FL 5KJRH 3ARFB 4P9MH 4UTAL 1OGAD 4M5ZH 1OARH 4X4YB 2HT2C 1FFRA 1MJUL 1I85A 1BBDL 1NBYB 4WU7A 1OAXL 4YDKL 2AJYL 3UTOA 1UB6A 5K9QG 2IPUK 3NCMA 3W5MA 5E8PA 2NY2D 2PO6B 5FUOL 1Q9OA 2VDQH 1MFAH 4WNQA 4RMWA 1EJ6A 4JFDA 4Z76B 4YAQA 3EO0B 3EJJX 1CYGA 1UWXH 1NUDA 2RAMA 2F8XC 4TQEH 4Q58C 4CMHC 2D0GA 1EUUA 4FABH 2AJXH 1I7UA 2X7LA 3VJ6A 3L6FA 4QCIB 1IAOB 2OYPA 3SBWC 5E95B 1S8DA 1B6DA 3LKPA 2E6QA 1DUYA 1NCAH 2VOTA 4IRJB 3L9RA 2AAVA 1BOYA 2NW2B 4X5WB 4EN3B 3BKYH 4GRLA 1BEYL 5IWLC 4JFZL 3EHBC 4X6BB 2VSCA 4AK1A 1KIQB 1INQA 3DX9B 3HKFA 4O00A 5HTSA 5ESAA 1KJ2L 2PYFB 3K74B 5JZ7D 2YRPA 1ACZA 1BP3B 3O4LB 1EGJA 2GJZB 3D25B 4NJAL 3T4AB 2FJFB 1YEGH 5FOBB 1CGXA 3EW3B 2OR7A 2X4NA 5IFHH 2DBLL 2ZSVA 1BD2B 4LLWA 5IMMB 1RUKL 4PGCB 2G5BA 5I18L 1GH7A 2EIEA 1I75A 1PBYA 5JNYA 2AQ3A 3J7HA 2HRPL 4PJFB 4WI7A 4G43A 1YEIH 2GFBB 3U6RB 2QSCL 5T1DH 3EJZC 3MRKB 1N7ML 1UCBH 2CLVA 2C1PB 1P53A 5J57B 2B39A 4G5ZH 3CAFA 5GRUL 4C57C 1U6AL 4RMUA 1BX2B 5C09D 2PETA 1YMHA 2IG2H 4OBRA 4G8FB 2FBJH 1VGKB 3DV6B 5HHPB 1YN6B 4ALAL 2KH2B 3FQTA 3C5ZB 2H3NB 2EDFA 3PV6A 1V3MA 4CVXA 1TVDA 4GUPA 1QSZA 3UYRH 5DLML 3KLHD 4JFFA 5I76B 3MRGA 3EDJA 2XZZA 2VR5A 3T2QA 2ENYA 3W0WD 4XVSH 1PYWB 3PIQB 4JZOB 3QRGL 2Z8SA 3TVMC 1E4WL 1UC6A