5CJOL

Crystal structure analysis of elbow-engineered-fab-bound human insulin degrading enzyme (ide) in complex with insulin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
209
structure length
190
Chain Sequence
MTQSPSSLSASVGDRVTITCRAVSSAVAWYQQKPGKAPKLLIYSSSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSPSFLITFGQGTKVEIKRTVAAPSVFIFPPSQLKTASVVCLLNNFYPREAKVQWKLQSGNSQESVTEQDSKDSTYSLSSTLKADYEKHCEVTHQGLSSPVTKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Insulin-degrading enzyme
publication title Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 190
sequence length 209
ec nomenclature
pdb deposition date 2015-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoL01
1S9VA 3MLVL 4GH7B 5HVGB 3L95A 4LSVH 3ALWA 4Y5VA 1XF1A 1MNUH 3EFDL 3OGOE 1XGUB 3MLPA 2FJFA 4X6DB 3MUGA 3LQAH 1S7RB 2VISA 4RMSA 2XTJD 5DRNB 2B2XL 3SKJL 1PZ5B 4YHKH 3ZSSA 1ZEAL 3D87B 4G8EB 5C09D 1I9RH 3NZ8B 3MBXL 4BZ2L 5L2KA 1JF6A 2R1WB 3LSOA 5TGBB 3OAUL 2BY2A 5DD3H 2DBLL 1XGPB 1ZLVK 3X13A 7CGTA 4PJEF 3C6SB 3FONA 3LIZH 4HWBH 3V7AE 3ARBB 1T1ZA 2WIMA 1FNEB 2OJEA 1CK0H 2YK1H 4H0IA 5D2LF 4K7FB 3VXOB 1PKQA 3TVMD 1A6TA 2AERT 2YPKA 5EZLB 3SE3C 3PGCB 2ESVD 4PJFF 1A1MB 4GG6F 5EH1A 5GS3A 4U33A 3CFJA 3EYUL 4ZXBD 3WIIL 4L8CB 1NFIB 1RZJL 4G3YH 3N9GL 3CVHB 2XOTA 4IOSD 1CDUA 2HRLA 3QJHB 4LRNH 4HK0A 2AABL 1CFTB 2PO6B 4PD4J 5BVPL 4PJ9C 4R90H 1AE6L 3F8UB 4K9EH 4OFIA 3VXNA 2BMKA 4IEFB 3LPWA 5DJ0A 1QSEA 4KRPD 1XR8B 5F7KC 4FTVA 2DM2A 3DECA 4U49A 4V2CB 2APBA 4XPFH 4CADB 5JUEL 4YHYC 1FL3A 1A6UH 4QCIB 4FQ2H 2EXWD 2CD0A 4S10A 4Y5XA 1CXFA 1OCWL 4ZD3L 1H15B 4ODTH 4DWHA 4NQCD 3VXMA 4WWID 5C0IA 4MJ2A 1VKXB 5L2JB 2HJKA 1MRCH 5E94A 4XMLH 2DIBA 2AK4B 5ALBL 1H3TA 2NY6D 1II4E 1MHPH 4NJ9H 5F9JA 4I9WE 5I1LB 1VA9A 4YAQB 1T2JA 4P9HH 4PJ8A 4RISH 1JPGA 1KTLA 1Z3GL 3ZLQC 1T0NB 3QUXD 3Q6FA 1EJ6A 5T33L 3QAZC 1OVZA 3NABH 1WIUA 4LBEB 3MUY1 4U7SA 4YHZH 5FDWA 1WJ3A 3DGGA 4PJ7E 4U1JB 4ETQB 3LD8C 4GBXA 2YPLE 3NTCH 4OZFH 2OTUB 5EIQA 4XCFH 1G9ML 4X6CA 3HUJE 3H9HA 4I48B 4EIZC 3RIFK 5H2BA 1JFQL 1DVFD 4MA1B 4FFWD 5BCAA 2PW1A 1RJLA 2E3VA 3OKDB 1XIWD 3OB0H 4JG1L 4ZFOB 5KJRH 3C87A 4ZDHA 3TNMA 3NPSC 4OQTA 2CLZA 2C3HA 2P1YA 3JV4A 4FQXB 4U1MA 5CD5D 1ZT7B 1C12B 2HMIC 1I7ZA 1AXIB 3HI5L 3MUHL 5CWSA 4A2LA 2Y07L 4XB7A 1SY6A 2I60L 2YA0A 5CZXD 3MCLH 4P2OB 4YUEH 3MBEC 5GQBA 2ICEA 5C0GA 1FL6B 1CT8A 2HLAA 3SE8H 3F5WB 5I1DA 2V2XB 5BRZB 3QZWB 3QISA 1KIRB 1RJZA 2ZUQB 3QWRD 2I07B 3IRZA 1YUHA 4G8GD 1CLZH 5I1IL 3RPIB 4RZCA 1J05B 1CLCA 4L4TA 3UPRB 3G6JE 1AQDA 1MWAL 4GJTB 4JZJB 5JIKA 3QEQB 2R9HD 4H20L 2N7BA 1H3GA 2XACC 1VFMA 4G8FA 2JJUA 3CSGA 4PJGF 1BPVA 4O02L 2GJ6A 4OFYA 1FN4A 4KMLB 1OQXA 2PXYA 3GIZH 4XRCB 3W0WA 1G1CA 2YKLH 4XHQA 1M7DB 4JRXB 1AGFB 1GVIA 2BNUB 3U7AA 2NY1B 4K3EL 4J3XA 4XWOC 4CVUA 3DX9B 1M05A 1ZGLP 4MJIE 1VESA 1T83C 4XPAH 1I3RA 3RIAK 2DLTA 2CXGA 1I1AA 4WWKA 1JZ4A 1MJ7H 2HWZL 1G7HB 1J8HE 3CMOH 4ZODA 1MJJB 4KHTH 4OBSA 2AQ2A 4R0LC 2FL5B 1C16B 4FMFA 4R7DA 3BGAA 1HWHB 3SDXA 4DK3A 3HG1A 1CI5A 2XKSA 3H0TB 4OM0H 4Y88A 2X2YA 1V7NH 1BEYH 4PLNC 3R06A 5DK0A 3FB5B 4LHUB 1AGEA 1N3NB 1Y0LB 4QT5B 4AMKL 3MRNB 3MA9L 1S7TB 3MXWL 1HHGB 4IS6B 5AUMB 1A7OH 1HQ4A 3Q2CA 1CGVA 1P4LA 1K8DB 2FWOA 4QYOB 2D2OA 1F2XK 4PRHB 3QIBC 4OD3H 5C09A 5HGAA 1RQ5A 5KVDL 1A6ZB 3P4NA 4NZTL 3QFJD 5IB1B 1UJ3B 5HYJD 1MHEB 1NGZB 4OB5H 3LB6C 5CEXA 4Y89A 3T0EA 5E00B 3GHBL 4LLYB 3MJ7A 4CJ1A 3OB0K 2FECI 1JK8B 5EZJB 4OIBA 4OCXL 4FQHB 4XP9L 4YC2C 1F45A 3MMEB 1H8NA 4YBLC 3V5HA 3UYRL 4Y5YC 2QSQA 3G5ZA 3HC0B 1KB5A 3ZZ1A 3V7AG 2E9BA 3QDGD 4ZUWA 3V52L 5KVFH 1UXWB 3E0GA 4XPHH 3J7HA 2LVEA 2D31A 4U2ZA 3HNSL 4PG2C 4PJ7F 4Y8AA 2APFA 3BPNC 1N6QH 4MQ7B 4D3CH 1ODAA 2ERJB 2CDFA 1WIPA 4I5BA 2HH0L 5EFIA 3HUJF 1HHKB 1P7QA 4G6AD 4FOMA 4Z95H 1NMBH 2BCKA 2BJMH 3MLXL 4OFDA 4OZHE 1JPTL 3RBSA 5JPMB 4PJCE 2AQ3A 2OSLA 3LEVH 3VFMA 2XKNB 4BK4A 3VFVA 1TJHH 1CXLA 1CICC 3ZDXE 3BZEB 1PDKA 2NLJA 3P4MA 4Y16A 4G80B 2A9NL 3QI9D 2V9RA 2DQJL 4IHOA 1DCLA 3O6LL 5C9KA 2DL2A 1U8LA 3FQRA 35C8L 5GGVY 5FHBL 4GLRI 3P30L 1RY7B 4JDTL 5E5MA 2CUMA 3GNMH 1BOGB 2K7PA 3MLUL 2GAZA 3ULVL 5LG1A 3G6JF 2FH8A 2WBJC 3KXFA 4BSVB 5ADOL 1MLCA 4LCWD 1DLHB 2EDQA 4QXGL 4HUKB 1F4YH 2XN9B 3PWVA 3SGJA 3DWTA 3DMMC 3QFDA 1DVFA 5FM4A 3QDME 1OAZH 5C0EA 5IB5A 1DJSA 2PW2A 3I50H 2PYEE 4JFZL 1RJCA 4RDQF 4DKFL 3TJEL 3W9EB 4P3DA 2EE2A 5IV2A 2A6DB 3PL6B 3L3JA 5JW4N 3UTQB 1PKOA 2X05A 4HMDA 1C5CH 3WNNA 4MB3A 4DCQB 4E5XA 3MNWB 5GISL 3OWEA 1X5JA 5CZVH 1NJ9B 1S9VB 4YBQC 4DOHB 4QHMB 4Y5VB 2H6PA 3QO0A 4WUKH 3C60B 1IGIH 4U7MA 4Z77A 3ULUE 4L3AA 3MRKA 5FF6A 2FJFB 3MUGB 2VLJE 5I1CH 5GGTH 4NT6A 4NNYB 3U9PH 2UWEB 4LRIA 1Q0XH 1A6WL 4QLRA 3SOBL 3CXHJ 3FQUA 1AGCA 5L2KB 1FIGL 3A6OA 5EUKB 4DQOH 12E8L 4QF1B 5F7DB 2M26A 1QPPA 2GJZA 3X13B 3IDYB 4CW1B 4GO6B 3FONB 5EBLA 2C4FT 4F57L 1T1ZB 3LKQA 3L3GA 4M93B 3KHOA 1X5HA 2BY3A 4U7KA 1NUFA 4LEXL 1RK1A 2OQJB 1PKQB 3LN9A 3GSQA 2Y36L 2YPKB 2YUWA 4RDQG 4Y2OA 6FABH 1FO0L 2MNUA 1C7SA 5I8CA 4ODHL 4Y4KD 2CUHA 3CFJB 2BOCB 5IT2H 1MCLA 3S36H 3UP1A 3GSRB 5GS0L 5JA8B 1LEIA 3LRSA 4WY7H 1FRGH 5ECJE 1A8JH 2GK2A 4HK0B 4JKWA 1ACZA 5D6DC 3IJSB 5JQ6H 1KTKE 1XF3B 5IB2A 5MEQA 3VXNB 2A6IA 3TESA 1JP5A 5TE7H 1OOAA 5DJ0B 3STZB 4HJJH 5C0AA 4FTVB 1U6AL 1ZVYA 2R0LH 3UJJL 3S4SA 3WFBH 2D7TH 4RCAA 5C0NC 1FL3B 5I1JL 5GSVA 1D5ZA 1CFBA 4JREB 4Y5XB 5J1SC 4UNUA 4OGYL 3CDCA 5DJXA 15C8L 4B5EA 5GRUH 4Z7UA 4J4PC 3VXMB 5C0IB 5JIIA 2A77L 4OZHF 2HJKB 5KVEL 3OGCA 3H3PH 5CSBA 5E94B 1MWAA 1QUNA 3G5YA 4P5TC 3RNQB 3UJIL 5F9JB 3ZDXF 2IGFL 5ISZA 1LP9B 1JPGB 1KTLB 2ZCHL 5IK3A 2R56H 5F6IC 4ZUSA 5FDWB 2VLLA 3DGGB 1AR1C 4LAQL 5JXAL 3H42L 4GBXB 4KPHL 2DQHH 3BMWA 4X6CB 5FUZH 2V5RA 5H2BB 3QDJE 4JKPH 4BK5A 2FRGP 3HAEA 1RJLB 1C7TA 1CFQA 1FG2B 1TETL 1I7RA 5IB4A 1S3KH 3TNMB 3X17A 5C0DA 5GRVL 1RFDL 4YX2L 4P5MB 3JV4B 4U1MB 3OZ9H 3Q5TA 3ARTA 3G08A 2BK8A 5E2WH 1I7ZB 4QTIL 1BVKB 3NFSL 2YC1B 5CWSB 5IFJA 5C0JA 43CAA 3ZDZF 2EE9A 4IIQC 3GMNA 1UJTA 4WO4A 5C0GB 2ICEB 4BQ9A 4WCYH 5I1DB 1TNNA 4M7KL 1IQWL 1D5XB 1YUHB 3RVUC 3SCMB 1MCPH 2CSPA 4OM1L 5D7SH 1I85A 4N8VA 4RZCB 3H9YA 5HBBA 2HFGL 4L4TB 4UDUA 3FFCA 2N7AA 5EDXA 4BKLA 1MJ8H 1IEAB 1BFVH 1Q94A 4Q9QL 3FB6B 2XTLA 4K7PL 2ZCLL 1UA6L 5DDHA 5DJAA 4X4YB 1FN4B 2C5DC 2PXYB 3W0WB 5I1HH 1F6FB 1YEEH 2NZ9D 5I66A 4ZTOH 5C2UB 4PB9L 4WI6A 4PRNB 4C56A 4LNRA 1OF2A 3BEWA 2YUVA 3IDIA 3U83A 2VXSL 1I1AB 1KLGB 4WWKB 4Y4HD 1RZ8A 3WO4B 5DGRA 4YQXH 4LARL 4R7DB 5GHWL 2DTMH 1UENA 1T21A 3HI6L 3HG1B 4M7LL 1JZ6A 4C83A 2V6HA 1CE1H 3T0AA 4XC1L 3B9DA 1AIFB 3HE6A 3ZSTA 1NGWA 3R06B 4DW2L 4W70A 4KKCD 3VJ6A 2LU7A 1FYTD 2ADFL 4F15B 4PTTB 3BSZH 5C70A 2W9LA 5C0CA 5TDPA 4L9LA 1L7TL 3MC0A 5ESVA 1RZKH 1EEUA 1HQ4B 4GXUN 3TN0C 3K46A 5TQ0L 2FWOB 4L8BA 4WV1B 4D9LL 2XTJB 1T2XA 3FKUS 1D5MA 4PUBH 1BZ7A 5HGAB 5C09B 3FQTA 3VCLA 1PLGL 3FO9B 4F3FB 5ANME 3UJTH 4JCLA 4WUUD 1PSKL 3P4NB 5HXMA 3QQ9C 5B8CB 4R3SA 5CEXB 2R8SH 3T0EB 4XCYA 3KS0J 2I9LA 3OR7A 4TSAL 4P46A 4YO0A 1HILA 3WKML 5CSGA 4YHOH 4MQSB 4NO5A 5AZ2L 2BZDA 2J88L 3BH8A 3UC0L 5ERWB 2VNCA 3G5ZB 4UU9A 5DLML 1UCBH 4LLUA 2GTZA 2ESVB 3S97C 1A4JA 1YZZA 1CGSH 5E9DD 3QPXL 1X5GA 3MV7E 4M4RA 2UYLA 3VG0L 2DQDL 3MGAA 1E6OH 4MXWL 1IKFL 1TJGL 3QUMH 4HIHA 4P2QA 5GGUA 2VDLH 3SGEH 1XH3B 4KUCD 4LK4A 1WT5A 4I5BB 3ZKXB 4IMLA 2PNDA 4LP5A 4KJYA 3L9RA 4YDKH 1OTTD 4QRQB 3QWQB 3OHXB 4KWUA 2C7UA 3WSQL 4XBEL 1GGUA 2OSLB 1GRWA 3QULA 4YHPA 1AGBA 3VFVB 1KN4H 4WHCA 2NLJB 4LNVA 3IF1B 4NQCB 5D71H 4GAFB 5C3TA 4EN3A 4FQJH 4Y16B 4ZUTA 5GZND 2ZG3A 3GRWL 3UEZA 4YE4H 1ZANL 4RBPH 2R0KH 4K3HA 3L7FA 4N0UE 2QJDA 4OD1H 5L8LB 1AXSA 2AJSL 1YPZA 1DEEA 3OAZH 3NZHH 5E6ID 4FQLH 4E42A 1VFUA 4ZSOE 5E99L 3IFOA 4JEGB 1BIIB 1KNOA 2GAZB 3AS3A 4HHAA 4I77H 3OPZH 5CINL 3ZT5A 1OAYL 4CGTA 3KXFB 4Y7MA 1NAML 1MLCB 5CIPA 1CFNA 5F8RC 4PS4H 1YEIH 5C2BH 1CIDA 3UPAA 2A6JB 3D18A 1PG7W 5DRXA 1DVFB 4RGMC 5C0EB 2ENYA 2W65A 3X3FL 5EWIH 2H9GB 1KEGL 1XIWB 1FO0A 1X7QA 1DZBA 4YFLI 2X4OA 5IB5B 1QR1A 2DYPA 1RAMA 1YYMH 4O51B 4DUXA 1UACH 3TYFB 4P3CL 4JQXA 5IV2B 3HC4H 1O5DT 1RI8A 3L3JB 4HBQA 4TPRH 1CVSC 1DP0A 4JR9H 3RRQA 4F7MA 4M8VA 1DBBH 4PRAA 1AGDA 1CR9H 3I2CH 3K1KC 5E4IA 4ZUVB 4LFHG 4OI7A 3T2NH 3V0VB 4FQIH 4J8RB 4FQCL 3QQ4A 4KMTL 4E0RA 4LKXA 1WCBA 2OMBA 1HWGB 2H6PB 3EO1A 5FAAA 3RKPA 3QO0B 5IROA 5HHPA 3BDYL 5F9OH 5FYKL 5FF6B 3BP5B 1RIHL 3EYVB 2MPAH 1GGTA 2WWKT 1NCWH 1G9NC 1G6VK 1P4BH 5D7LE 2ICWA 2Q6WA 3LS5H 4PGCA 4QHLA 2EH8H 3DRTA 3BYYA 2DD8H 3VRLE 3FQUB 1IAIM 2NY4D 5F1IA 3VFSB 2AJ3B 2DIJA 3WUWA 3HZYA 2GJZB 4FFZL 1JYWA 2P46B 2M2DA 1Q38A 4LIQE 1FYHB 3U4BH 3U9UA 3VMNA 3SKNB 5EBLB 3D39E 4LSPH 1I8KA 3LKQB 3L3GB 2BC4A 4R4ND 2E8ZA 2XWBA 1RK1B 4AM0A 4HIIA 3PHOA 4Q97A 2KH2B 5BMFH 3PABB 2JJTA 3TCLA 3CGTA 5I8CB 2E9JA 3WDIA 1FVCA 3NGBC 4KRLB 1FGNH 1HXYB 2F5AH 4NZJA 4M48H 1AY1L 1QLFA 5FOJA 4P4KD 3U7WL 4U3HA 3OJVC 4WEMB 3T3PE 3ZKQD 5KSUB 2NW3A 1LEIB 3LRSB 2AGJL 3CX5J 4RBPK 5I17B 5KS9B 3U36A 3L5IA 3TO4C 1B0GA 5IB2B 1NFDF 5MEQB 2A6IB 1LO2H 3PWUA 4OTXH 3QH3A 1KCVH 4MJ5B 2Q76B 3L7EA 4UB0H 5C0AB 5EPMA 4GUPA 4GRWH 5I1GL 3HZMA 5JQHC 4OUUA 3OAZK 2V9QA 4FFVC 5EO0B 1K8IB 3S4SB 3VXRE 2DMBA 4NQUA 3RNKB 2XZAH 4X7CC 4YNYB 1A3RH 5D6CB 5GSVB 1UYWL 4XXDA 4K07A 4JFFA 4NWUL 1PY4A 2J5LB 5DJXB 5DJZB 4WUUA 4M8QA 5JHDD 3BO8A 3LAFA 5GGSA 5HYJB 1W0WB 3OGCB 1ITBB 1MFBL 3G5YB 3RVVC 3GKWH 1K9TA 2DMKA 3SDCA 4UT6H 2FHFA 1TZGL 1QKZL 4Z0BH 1KFAL 1UEYA 5IK3B 4C57C 2BXZA 5D5MB 3S37X 2ZNXA 4ODWB 5H37H 3CSYA 4ZUSB 2VLLB 1PG7H 5C0RH 3IXTA 2YD6A 5FM8A 5IOPB 2AEPH 1L4IA 2NY7L 1KGCE 4X80L 4LASH 5T3ZL 4X4MA 1EFXA 4LPYA 5KN5A 1C5BH 4KKAD 5HDOA 5C0DB 2X6MA 2BY1A 3KPRE 1S7XB 1OM3L 3G08B 4WHDA 4RFOH 4NJAL 3RVXD 5KBNC 4WFFD 2L7JA 1IFHL 4UINH 2DDQH 1X3DA 3LV3A 4OF6A 3V5DA 4TOYH 5C0JB 1OGAD 1Z5LA 1S7VB 4V1DD 3GMNB 4KK9D 4WO4B 5ESQB 3FQWA 2NXZB 3ARWA 1A14L 1BZQK 2ZUVA 2AI0L 2GHWB 5DMKA 1G7PA 5EOQL 2I25N 2LAGB 3C9NA 4YXLH 4OCWH 4BFBD 1HSAA 5KG9A 3DSFH 5CJOL 5D2NC 4BFIA 3CUPB 2X9WA 5L9DL 4N8VB 2RCSL 3QI9B 4WHYG 3LS4L 3FFCB 2W9DL 4BKLB 1YYLL 1CLOH 3DOSA 2WWMC 5JNYA 3MLTA 2VSDA 1GC1L 4HS6B 1NGPL 4L4VA 1QFHA 2VDMH 4U1HA 4MNHA 1NAKL 5CILL 1B4JL 2BRRH 4ODVH 5T1MB 4LCWB 1A7QL 5I66B 4HWEH 1XCQA 4UMGA 1FAIH 4XAWH 5DD5H 4C56B 4LNRB 5LXGH 1OF2B 4NN7C 5HYEA 3BEWB 3WHE0 3RAJH 4TNWK 2Q1EA 4M5ZL 3F7QA 4HZLB 5SWQA 2DN7A 3HE7C 3EKCA 1RZ8B 3DGCR 1IAKA 3LKSA 2OYPA 3G5VB 3ARXA 1T21B 1N5YH 3V6ZB 4C83B 3KJ6L 4KXZI 3H9SD 1UWGL 3LKPA 3MNZB 3ZKMD 1NGWB 1RJYA 4Z7VB 1S9WA 1U93A 4KFZC 2VXQL 3ZTNL 1JZ7A 2VR9A 5C0CB 1TFHA 5TDPB 2BDNH 3DLQR 2YD3A 5JOEA 1DFBL 2Z93A 5ESVB 1FZKA 1UADC 5FGBA 1U58A 4PJBB 1QSVA 4QRRD 4I13B 4NO0A 1HZHL 2HYMA 1D5MB 5SX4I 1K85A 1BZ7B 5ALCH 3RWIB 3FQTB 1E4XL 4M6NH 3VCLB 2DQUH 4JPVH 2VJXA 3GRWA 5D7IA 1KTRL 2JJWA 5IM7A 1J5OH 2LU4A 4R3SB 1QFWI 2F54A 4XCYB 2I9LB 3OR7B 1Q1JH 2DRUA 3KYNB 3ROLA 1VADA 3BE1H 4P46B 4YO0B 3DVGA 1ZK9A 4ONFH 1ZA3B 1A1OB 2EICA 4NO5B 5CJ8A 2AJZB 1OAUL 1H8OA 1VEOA 3BH8B 5I8EB 2W92A 3IDGA 1NAMA 4K2UH 4UU9B 4WFHD 4I18B 1EV2E 4Y19E 5EC1B 3M07A 4F8TA 1A4JB 4Y4KB 5CJQH 4PV8A 4JO2H 2B5IC 3LOWA 1ZLSH 3JWOH 5FYLL 4MAYC 2FJHA 2R0ZH 4RFNC 4HIHB 5GGUB 2W1NA 4FQ1L 4RMVA 4MLSA 1I9IH 5JOPD 3A6CL 3CK0H 3INUL 2IADB 4IMLB 1F4WL 1YMMD 1RIVH 1A7PH 3FZUC 4IBLT 1ROWA 4KMQA 4YFLF 1MCEA 1JGDA 3E2HC 2X1PA 3DYPA 4HV8A 2C7UB 3TBVA 2X44D 4XPGH 1U92A 1S9KC 4YHPB 4NSKA 1KCLA 3GSWB 2B0SL 3QHFH 5E8PA 5INDA 4GS7B 2VDKH 4WI8A 1QG3A 2WWKO 3QUKA 1OW0A 1JHTA 5TF1L 3V5KB 5JXED 5JW3H 3QPQD 4WGWB 5DQDL 2EC9T 1AH1A 3AXLA 3KHQA 3L7FB 4HGWA 4E41A 1BM3H 2VYRE 1EK3A 4AEHH 1QLEL 1AXSB 4Z5RB 5JHLL 4KHXH 4QRPD 1DEEB 1F3DJ 3UTSE 5C0BE 3MRGA 4EUPG 4E42B 3CFEA 2AV7B 1F58H 1KNOB 2E7LA 4HHAB 4NN6B 1JRHH 1AHWC 4KUZL 3QXDA 5CIPB 4K23L 1E28A 5F6HI 2I27N 1IE5A 3D18B 1FGVH 2VTFA 3I6LD 5DRXB 1J10A 3BGFB 2EO1A 3D6GA 1QR1B 2X4OB 3QIWD 2DYPB 4GMSH 4JG0L 4TULL 3U1SL 3ROOA 5KVGL 4MZ2A 2D9CA 2O61A 2P24A 3O8XD 4NQDE 3ARGA 3C5ZA 4R96A 3N1PC 3M1BB 4PRAB 1EEQA 1LE5A 1AGDB 1NGYB 5T3XH 1OAXL 1T0MA 2YWZA 3MV8E 4YFDB 5I1EH 3QQ4B 1EEYA 1XGTB 3B6SA 2ZG2A 1YA5A 1FVEA 2FIKA 4PJHA 4X6DF 1WCBB 4E0RB 2FDBP 1QSFA 1NBVH 5HHPB 4WW2F 4IJ3C 2OP4H 4O5LL 3TZVA 4N5ED 2C1OA 3MACL 1EO8H 3NIFF 3U0WL 2AS5M 2ICWB 2Q6WB 4PGCB 4QHLB 4RMWA 4BZ1H 4CMHB 4XCEA 1WWBX 4PJDB 4Z76B 3KWWB 2VITA 4P4RB 3LKRA 1MRDH 3WUWB 3HZYB 4X9FA 2YD7A 4Y2DC 2L0DA 4ZAKD 5CP7A 3O4OC 4OF7A 4JANA 4JRWA 4MJ6B 4MQXC 1CG9A 2E27H 3ARFD 5AWNH 2Q87A 1WTLA 3KLHD 4ZOEA 3NCBB 3BAEL 4NYLA 4AM0B 2FX8L 1ZA6B 5E8DH 1B6DA 4HT1L 3AM8A 3TCLB 1EEZB 2YUZA 4KK6D 4XMPL 1T03L 4NGHL 5IBUG 5IBLD 4HPYL 5AAMA 4PPTA 4HLZG 1J1XL 3LQAC 3QCTH 4JVUA 5F9WB 1A1NA 1QRNA 4JFED 3NBNA 3GSOB 1MPAH 4NRXA 1A6PA 1FYTB 1UZ8A 3D2UD 4YGVA 3U36B 2X89A 3QUZC 1BIHA 3PUCA 1WLHA 3I02A 5D1QD 3PWUB 1R5IB 3QH3B 3WIFA 3BPOC 3L7EB 3WCYA 2NY6C 3CDGA 3MRJA 1BVZA 4OUUB 4MA3A 1N0XH 4QRRA 4PD4K 5I8OH 3OKEA 1MQKH 2FATL 1GAFH 4HAGA 4LDOB 5J1AB 1DQJA 3QUXC 4ZQKA 4XXDB 4KDTC 4N0CC 3E8UH 1SEQL 3S96B 4S1RL 3GBML 5FGRA 4WUUB 3BO8B 1KCSH 2H32A 5DMGD 2PCPB 3WJLC 1S7SB 1INQA 2DQFB 1RURH 1SM3H 5CEZE 3HI5H 3VXQB 4YDLC 5D93C 1I8LA 2Y07H 3SDCB 4MXVE 1ADQL 3VE0A 2O26U 1U42A 3SDYL 1SJVA 3SJVD 1MFAH 4JAMB 1CXKA 5TQ2H 4RAVA 4LQ1A 2CO6B 2CJUH 4ZTPH 1MCBA 1T1WA 4K9EC 3H7BA 3BZFA 3WLWD 1A0QL 4NDMA 1MCQA 1IGFH 1MWAH 4MA7L 5KAQF 4KAQH 5F21B 4XPBH 1DSFL 4PJEA 5CZXC 5CCKH 3ARED 4L5FH 1I8MA 3VXSA 1HH6A 1EFXB 1R0AL 5J06A 3LKOA 4JHWL 3TFKC 1RSFA 5D2LA 2GJJA 4LPCA 3HC3L 4RMRA 4GXVH 1YNKH 4PJFA 4I9WD 3MLSL 3AB0B 2FJGA 4U6VL 4GG6A 2FR4A 2AP2A 3KR3H 1DQLL 3V5DB 2F19H 1BBJA 3VI3E 3EDFA 4XP4H 1Z5LB 2A73A 4GXUM 3O3DA 1YMHA 4HFUL 4OCRL 4EDWL 1IC1A 5DMKB 4ODXA 5J1TC 3CFBA 1G7PB 2V5YA 1J87A 2YR3A 2YPLD 3C9NB 1PX4A 5F7MC 3A6BL 4U0QB 5KG9B 5I76A 4M61A 4BFIB 4BH7A 4YHLL 4QTHA 1R24A 4F9PA 5T5NG 2ICES 4MCZA 4F2MA 3LMJL 1CQKA 5DUBA 5IHZA 1D6VL 2X1QA 5FDYA 1EVUA 4D0CA 2DKMA 4PLJD 3MLTB 5E6IB 3QG6A 1WVZA 5T1LA 3SE4A 3CFKA 3GSNL 3WFHA 4DGIH 4J3WA 2F58H 1LMKA 5KAQG 2AK1H 3VRIA 3NCJH 3QJFA 3QXVA 5I30L 1P69B 4NQSB 4TN9A 1JPST 4JHBA 2O5YL 5AEAA 4GAGL 4UV4L 3MRMB 2EIEA 1B2WL 1HIML 3IFPA 2NY2D 5SWQB 1LO0L 3S6CA 3QUMB 4OLUH 3U82B 3LKSB 4PRDA 3QEGL 1WK0A 1ED3A 4HS8L 3OF6D 3FB8A 4KK8D 4X6EA 4JO4L 1A7RL 2UWEE 3P0YH 3GMMB 4GRLD 4LLAA 1RJYB 1S9WB 1U93B 5DQ9A 5GGSY 2MSPA 3O6ML 1VGEH 1R3HA 5DURB 1E4WL 4NQVA 2Z93B 1NLBH 2AXHA 2W0FA 4K7PY 1FZKB 2WINA 5MHSD 2XA8L 5D2NE 1P5UA 5DUML 4OV6F 4NO0B 4MJID 5EO9B 1JIBA 1XF4A 5CJ5A 1BWWA 1G0DA 3MFGB 4XCCH 2ADJA 2GSIA 2Q7YA 1J8HD 4XT1C 3MO1B 1MAMH 1ZHBA 3I9GH 3KJ4B 3OV6A 1JUFA 5ID1A 2EZ0C 1F4XL 2IPTL 3GSXA 5B3JE 2F54B 1GPOL 5FO9B 5D8JL 4ZNEE 3RZWA 5I1AA 2EIZA 3ROLB 1VADB 3W2DH 5L0QB 3DVGB 2FEDD 3RFZC 1UB6A 2F53D 4OI8A 3VWKA 4U1GB 2MTPA 1YNLL 3ARZA 4G5ZL 4JM4H 1NAMB 1ZT1A 1T0PB 4I3GA 2A83B 3T08A 5F93C 4PV8B 1QBLH 5EBWA 4R8WH 4MMXC 5KSBE 4NNXA 2OZ4H 3OJDB 3DVNA 3HKFA 4D9QD 3V4PL 2GK0A 4OIIH 2X9XA 2K1MA 4K55A 3WNPA 4POZC 5IFHL 3MV9D 1JGDB 2DMCA 1CDYA 4XVUD 3I84A 2Q86A 4HV8B 2X70B 1LP9E 1NUGA 5C0FB 1ZXQA 2G2RA 1JV5B 3B83A 4HWZA 5LJYH 5T5FH 2Y5TB 4JFOA 4WNQB 2VLMD 5JHDB 1VEPA 4N68A 2X42A 2EDTA 1Q9KB 3VI3F 1JHTB 4IM8A 3QIUD 4ZFZB 1FE8L 4YPJA 2NXYC 1NCCL 3AXLB 1OWRM 3KPTA 4PGZA 1I3GL 1NUNB 4K94L 4XP6H 4E41B 3K4DA 5F7WC 4D2NA 3TF7C 2IAND 1B0WA 5JTWA 1DBKH 3IDJA 1CE6A 4XVJL 2DLHA 3BIBX 3W39A 1QQDA 4GRMA 1INEH 3CFEB 5FCUH 4Z8FL 3I6KA 3L3OA 3F7VB 3QXDB 4JM2C 3JV6A 4OAWA 1BFOA 2ARJA 4OT1L 1E28B 2HKHH 3K0WA 1X5IA 2KKQA 2ZZUT 1UWEL 4R97B 4YDVA 3SDDD 5I0ZA 4AYFA 2WUBH 3EW3B 4Z6AT 1YJDH 1IM9D 1MLBA 2GITA 4U6TA 3RY5A 3MA7A 3CSPA 3ROOB 1YEGL 1CVRA 2ED9A 3B2VL 2O61B 2FECL 2P24B 1H3PL 5HI3D 4R96B 1DBAH 1V3JA 1OGAB 2G60L 4RA0C 1JGVL 3CJJA 4V1DB 1OSPL 5ICXA 1JGUH 1T0MB 2H2PC 1EEYB 3FQXA 4K71B 4Z78B 4PJ7A 4S0TD 3PP3H 2FIKB 1FVEB 3O3UN 3JBG7 4PJHB 3D3VE 4R7NB 4PREB 1QSFB 4NN5C 3MJ8A 2UWEF 3TZVB 2VDRL 4NM8L 2C1OB 3HUJA 5FUCC 5A3IC 3CD4A 1MEXL 3QDMD 4Y4FD 4YHML 4PIRF 3DX8A 1HYRC 2UZIH 2XPGA 5HHOD 4XCEB 3B8SA 2PYED 5DMJB 1I1CA 5BO1L 3WJJA 1RK0B 3NAAL 4DGVL 4MD0B 3BH9A 5CZKA 1IGCL 2FB4H 4H8WH 4KDWA 5LAXB 3CH1B 5CP7B 4I0PA 3VWJA 1ADQA 4JANB 4LSSL 3SO3B 1UH3A 5I1JH 3EHBC 4CVZA 5C92A 4M1GH 1UT9A 7FABH 3NIDF 3TCXA 4ZPTA 2YD8A 2FBJL 1FBIH 1VB9A 2NYYD 4XH2A 5B3JF 2VZ3A 3ULUD 2Q20A 4FQQA 4K3JH 4DUVA 3U48A 4M1DL 3G6JA 1G7MA 3PQYE 4DEPC 4DN4H 1DE4B 2A9MH 2X4SA 3DO3A 1WUNT 3LZFH 4NRXB 4BSWA 4YGVB 1UQSA 4P23D 3I6GA 4PTUB 1FSKC 1JNHA 4LAQH 3RY6C 1U8QB 3WIFB 3MRJB 4MA3B 5D1XD 1LNUA 1IZKA 4UUJA 4XB8A 4QRRB 4CDHA 5BV7B 3OKEB 1MFEH 1D3CA 1NCTA 5IEHA 1DQJB 4W6XB 5SWSE 3BQUC 4ZQKB 4PJXB 1MRFL 4U1SA 5I6XC 5DFTA 1J8HA 3RWDA 1NBYA 1NFKA 2A6KA 2ESVE 1INQB 2YD1A 3ARVA 4ZO9A 4QTIH 3HPJB 3OXRB 4WHTA 4JPWL 1LP9F 3WS3B 4W4OC 3WEXA 4Q6IA 3V0AC 1ACYL 1T1YA 4ORGA 4GAJL 1TQBB 3F7YB 4I1NB 2DJ4A 3BFOA 3MOAL 3N85H 3GSNA 3GUTA 1RVFL 3H7BB 4X6CF 4EKXA 4NDMB 2KL6A 1QFUH 4YDJA 1I1YA 5ESAB 4G42A 1HINH 3PP3K 3VXSB 4X4ZA 1FNSH 1HH6B 4ETYA 2ZCLH 3S35X 3LKOB 4EQ2A 1CTOA 5GSRA 1VHPA 3E3QC 1YMMB 3L3IA 3D85A 4WDIA 5LBSL 1IT9L 2FR4B 1HQRB 4QRSA 1BBJB 2B4CC 3MRQB 4NC1C 1FCCA 4L29B 4HK3N 3O3DB 1YMHB 4GQ9H 5EUOE 4KV5F 4ODXB 3CFBB 5HI4C 4P9ML 3DO7A 3NACL 5F3HA 3BDXA 4M61B 1JYVA 4BH7B 2NY0C 3WNLA 4HFWA 1R24B 1CLYH 1WBZA 5I75C 4MCZB 1FV1A 4F2MB 3KYKH 5DUBB 5BW7C 1I1FA 5DWUH 3IDXL 5IHZB 1D9KA 2VXVL 4D0CB 1DLFH 4FA8A 4S1QL 2CUIA 4U2YA 1MFDH 3QG6B 1P9MC 4PJ9D 4HKBA 4LFHD 5E4EB 1XGQA 4Y4HC 1NEZG 1L7TH 2EKSA 3WV0A 4X9IA 4AENA 1I7TA 5T1LB 1YY9C 3CFKB 5C1MB 1YEJL 1K6QL 4OZHA 5DFVC 4JKLA 3C08L 3DUUB 3VRIB 4KH2A 4PJCA 1V7ML 4ZFGL 1QO3A 2VN7A 5CKAA 2QQKL 1F00I 3CDFA 5HYSG 3IFPB 3VXUD 3QIWB 2YRZA 5DO2C 3RWFA 4NKIH 4G8GE 2WQRA 5GS2D 3FT3A 1QVOA 4KQ3L 2OJZH 4PRDB 1ED3B 4IRJC 3FB8B 3MRPA 4H25A 2JJSA 2BRQA 4GSDH 1WBYA 5AZ2H 2RIKA 1P2CA 1V5JA 4HKXA 5DQ9B 1BQLH 1R3LA 2VH5H 4I2XB 4U05A 3UBXG 4KQ4L 2GTWA 2VZTA 1R3HB 3RGVD 3WXWL 4NQVB 5HDLA 3MRDA 4LVNB 5DRZA 1FORH 2ZUQC 1FH5L 3RU8L 2W0FB 4OZGE 2WINB 1R3IL 5KZCD 4HJGA 1IAOA 2IH3A 4MXWH 3T8XB 1BVLA 3T0WA 1XF4B 4JZJC 3M8OH 5DA0B 3WBDA 2ADJB 2GSIB 2Q7YB 1ZHBB 5ID1B 4DGYL 1DQMH 4I3RH 3B9EA 5F72S 3SO5A 1YECH 3QEUA 2HMID 2EIZB 4JY5H 2Z31A 5TE6L 1TZIA 3V4VH 4RGNC 2AJYH 1IKNC 3VU2A 4ACPA 4F33B 5I15H 4U6HB 3MBED 3VWKB 2QV2A 1HI6A 5AZEL 3RZCA 3N06B 5KS9E 5EU5A 1GZQB 3JTSA 2HJLA 5FB8B 1K5NA 1MCRA 2VLJA 1IC5L 2R39A 3IU4H 4HUMB 5CJXC 4JFEB 2BSTA 2PTTA 3DVNB 3RIFF 1UM6H 3IKCA 3UPCA 3CVIH 1OAYH 4I3SL 3G6DL 3QFJE 2EXYC 5FA4A 5EU3A 5BS0A 2FD6L 1QBMH 1OSZB 4WTZG 1KEML 2Q86B 4ONHB 2RR3A 4B53A 2G2RB 5J0BA 4HWZB 4JFDD 1S7UA 5EOCJ 3QDGE 2OLDA 4ZFFB 3L5WA 4NKOA 3MV7D 1EX0A 4IOFC 4FZ8L 5EUOF 1L9NA 3H2WA 1X5XA 3IDJB 4BYHA 3SJVB 4GOSA 1QQDB 4L8SA 2VXTH 5CP3H 5JORB 2QQLL 1QBAA 3I6KB 4ODUA 5GIRB 3L3OB 4LSUL 5IEKB 1RIHH 5C71A 3JV6B 2ARJB 3TYGL 2OTPA 1K4CA 5C07E 3SDAA 3AREB 2ZOLA 2D0FA 5FKAA 3QIBD 2ATPA 3JUZA 1MLBB 1Z9LA 1SYVA 3GB7A 3O2DL 4PB0L 4A6YH 3PXHA 1F90L 4FG6C 3MA7B 4LPTA 2ERJC 2ZPKH 5ITFA 1VACB 4P59L 3LB6D 3RIAF 5ADPL 3WHE1 5FO7A 4LIQL 3R0NA 4S11A 1G6RH 3VFTB 3V6OE 5ICXB 4JB9L 2NY4C 1CYGA 2JIXD 4XNUH 5ITBL 2IAMA 3SE3A 4EI5C 4TSCL 4PJ7B 1VFBA 1NKRA 3TWCL 4KVNH 2YPLB 3FCTA 5DR5H 4LOUC 5DD6B 2QSTA 2QQNH 4LCWE 2APXA 2J1KA 4CN6A 5IB3A 1TVBA 3V4UL 3QDJA 1KIPB 3FOMA 1H0DA 2O5XL 3CZFA 3F65A 3NCFB 3QNZA 4Z7OE 1DL7L 2D7MA 5IR1A 4U3CA 2X4TA 3VGAC 4FP8L 5HPMA 3QA3A 4OZGF 4WU5B 2F5BL 2XY1A 2AJUL 3BH9B 3DIFA 3HRZB 2YD5A 3O6KH 4R4BA 2D7OA 4PGDA 3AS0A 5J12B 2DTSA 3VMOA 4J6RH 4I0PB 1JPFA 3O3BA 3ZDYE 4P4KC 3MOBH 1WISA 2CK0H 4DZBA 4XP5L 3SBWC 4KI5C 1TPXC 3NIGE 5I71C 4NQEA 1HEZA 2NY2B 1CICD 5DQJB 2X4PA 3VFUA 4JZNA 1MREH 3MGOA 4FQQB 4Q58C 2VDOH 1CD9B 5GRJH 4JQVC 5I16A 1BBDL 1MCOH 2NPLX 4XBPA 5D7LD 4NFBA 4ZS7H 2BSSA 4PJBE 1G7MB 2ZJSL 3IFNL 2HT2C 5JPNA 3PL6C 5KS9F 4UIMB 4LVOC 2X4SB 4DK6A 2ID5A 1UQSB 4M3KB 4H5SA 4HAFA 1Q0YL 2WBJD 3T77B 2IQ9L 5IBTL 4Y5VC 4ZO7A 3CFDA 2NY7H 3KYOA 3CX5K 4X80H 4F37F 1AKJA 1FQ9C 5KW9H 1S5IH 5FUCE 3DMMD 4MJIB 1X5LA 1KB9J 1ZAGA 2DQTL 3F6IA 5IEHB 3VFOA 3HMXL 3K8KA 1C1EH 1T04A 2DQIL 4U1SB 1J8HB 25C8L 1MFNA 2A6KB 4OZFG 1QNZL 3BKMH 3ILQC 4WI2A 3F6LA 3HCVA 3WEXB 5C6TH 5EZOL 5D5MF 1DN0B 1KELL 5F70A 1CZ8L 1Y6MR 4ORGB 5I1KH 3RUGB 3BKYL 4LVHC 4YBQD 2Z92A 3GSNB 3GUTB 3RVXC 3O11B 5CJOH 1F6AA 5D7JD 2R4SL 1QRKA 4YDJB 4LSRH 5F1NA 3GSUA 1EO7A 3KLAA 3NCEB 4HXBL 3F58L 3GK8H 2O93L 2LQRA 5ANMA 2A38A 1A7NH 4HXAL 5TJWK 1MFCH 1NLDH 1KG0A 1FZJB 3FMGH 3ZMRA 1J1OH 1L9MA 4P57A 3L3IB 5IQ7L 4Q9RH 1UWXH 4OLYL 3OR6A 4QRSB 3OKYA 3MV9B 3WFCH 5F7HA 2DQGH 2W60A 1S7QA 3RL1B 4OFVA 3OG4B 3WE6B 3DO7B 2R15A 5T1DH 1FDLH 3QIUB 3ZYZA 3LH2L 3BKJL 4I0CC 2GSGA 3EGSA 3P4OB 4HFWB 4HLZH 5HHVL 2N4IA 2V7HA 4LCCC 3X3GL 1FV1B 5E1HB 3L5JA 1I1FB 5TPWH 2BNRD 4YK4B 1EXUA 2B1HL 3ZTNH 5JIHA 2XZQL 5LQBH 4KROC 1MCHA 4PJ8C 4HKBB 3KPRD 1XGQB 4AENB 1WZ1H 5DD1L 4PLKD 2R2EB 2DWEA 4UQ3A 1T2QL 1DBML 3I85A 4OZHB 4Z7OF 4PJCB 1TTGA 4N0YL 5C0ND 4NKMA 3BT2L 3HLAA 4UZGA 3SDDB 2VC2H 3GI9H 2ICCA 5FYJU 1E4XH 2WLYA 5L6YL 1IM9B 3EJZC 4KGLA 1BJ1H 1OGTA 4F7PA 5M7QA 3G9AB 4OLVH 4PR5A 5EORL 4YXKL 1QVOB 1XFPA 3MRFB 1U2CA 4P5TD 3NIGF 3CU7A 4Z7VF 5HVHB 4CU8A 1WBYB 2DJSA 1AP2B 1P2CB 4MWFA 4C4KT 4PJDE 4NC1E 4ZSOA 4RGOL 4QOKE 1LQSR 1R3LB 2JIXA 2CKBH 3EOAA 3VW3H 4Y5YA 1QTYT 4EDXA 4PJBF 2X4RA 3X12A 2H26B 1AR1D 2X41A 3HB3C 2ORBH 5DRZB 2HFFB 5BXFA 1E0OB 4PRPA 5HHNA 3QUYD 2BERA 3QDMB 4HJGB 1NC2D 5FYLH 3EO0B 3U7YL 2IH3B 5EU7E 1ZTXL 4XHJC 1BVLB 2PYEB 4G6JL 3B8YA 3BDBA 2BVOB 2G5BA 3VH8B 2NR6C 1KTDB 1YEFL 2DBJA 3UTPD 3SGEI 3DROA 1WWWX 1TZIB 4YIQB 4AG4L 4PFEA 5LGHH 4MQTB 1FPTL 1W0VA 4RRPG 3RZCB 1HI6B 1FYTE 1W72H 4NUJA 1UWXK 4LSTL 5CHNA 2GUOB 1JWUA 4OLWL 3W9DB 1KLUB 5EU5B 1KPRB 3RVUD 5FOBB 4AY0A 1DUZA 3GMLB 1I1AC 3JTSB 5JLZA 2VLJB 4QRUA 3WS6C 3TT1H 2F8OA 2DOCA 1EPFA 1ZHLA 2ADGB 5IFAL 4W68A 2HTKD 3O2DA 4RQQA 4MD4A 3HPLA 3WIHL 5EO1A 2BSTB 1KJ3H 2PTTB 3IKCB 1NGQH 3QHZL 1A6VH 1B3JA 1W2KT 4ELKA 3O4LE 5DI8A 3D39A 4HUUA 3O41A 1A47A 3GJFH 2VDQH 1PW3A 2YA2A 1JCKA 3OQ3B 1U41A 4LF3A 5EOTB 5DT1L 5CGYC 1S7UB 4MS8C 3PWPE 3THMH 5MEPA 4D0DA 4PBXA 4UOW0 1TJIH 3T2PA 4P2YA 4NKOB 2VIRA 5E9DE 3W11C 1IBGH 1KJVB 2B1AL 4RGNE 3JWOC 3N0PB 4TRPL 4JO3L 5I74B 4FXGA 5CMAA 1IARB 4X99A 3SEPA 4CRPA 3MTRA 4NOFA 4JY4A 2AEQH 3NOIA 3KPNA 2OCFD 1N5AA 2UZYB 4PG9A 5F1SA 4O5LH 4YDIH 3VXRA 3HHRB 1KCUL 4QKXB 3GEWB 3TN0D 3MLZH 4LLDB 2HG5A 4CU7A 5FKAB 4YFEA 2LABA 4F7EB 3ARPA 2JB5L 1EBAA 1JWSB 1E27B 1SYVB 1CDBA 2GQHA 1FNFA 3WFDH 4EUPA 3QQ9D 1QFWL 2CIIB 1X4YA 1D5IL 4LCIH 5FO7B 4YXHL 1WSST 3KPSE 3MXVL 1AJ7H 5KSVB 3UTSD 3EYSL 3QG7H 4R26L 3SE9L 2IAMB 5LKNA 1WWAX 2XQBL 4M1CC 3S7GA 4DVRH 2OL3H 1Z9OA 4KJPC 4UIKL 3UO1L 1YY8A 4AT6A 4ZAKC 1A6AA 3QCVL 1H3XA 4OLXL 2Q7NA 1SYSA 1KLFA 1BF2A 1J1XH 4PJDF 3FOMB 3ARFC 3HMXA 1SMAA 1F8TL 2LTQC 5E0QA 3QNZB 2EC9U 1P53A 5IR1B 2X4TB 4M62L 3G04A 3GDBA 5D6DA 5HPMB 1T4KB 4PJ9B 3KPRA 4OJFL 4F7TA 1H3WM 4R4BB 1NCBL 3V9FA 3M17A 4HC1H 4PGDB 4O4YH 3O6FA 4NQDD 4NFDA 5HYFA 1JPFB 3O3BB 2AXFA 3T4YB 3DRQA 1NL0H 1KN2H 2VDPH 4X8JB 1BGXH 3MV8D 4DZBB 3DX7A 4S1DC 5D9SB 3SGJC 1B4RA 2WNGA 1SEQH 1EERB 4F8QA 3GBMH 2FX9L 5D1QC 3VXUB 3KDMB 4AL8L 3CMGA 3VFUB 3VFNB 4J4PA 4UTBL 1WFTA 3MGOB 1EHLH 3GJFK 1G9NH 4WEBL 1OPGL 2K7QA 5CEZL 4XBPB 4OV5B 2BSSB 1KXQE 2OI9C 2VZOA 5K93A 5SWZD 1OAKL 3SDYH 1LO4L 1OLZA 1FLRH 2HP4A 4XVSL 3QAZB 5F7EL 3P9MB 4H5SB 1KACB 2GIYA 3LD8B 4KTEL 3B3IB 1NEUA 3KYOB 1BD2E 2SEBB 1P7HL 1DSFH 1AKJB 1MELA 5KZCB 1CFSA 2I5YL 5C8JA 3ARDA 4Y1AA 2YUXA 3VFOB 1EHNA 1UGNA 3O9WA 1T04B 3FO1B 4LRIC 2BVYA 3VRJB 4G6KL 5AYUL 4X8XA 3TIEA 1XGUA 1CBVL 2E6QA 3O2WL 1CU4L 1NSNL 2EO9A 4DAGL 4BFEA 4KZEH 5I19L 5DRNA 4WW2A 3DI2B 3HCVB 2AJVL 2EH7H 1FNHA 3EO9L 4G8EA 4IIQA 4JRYD 3VD9A 5LGKA 1J0HA 5EZIH 3CX2A 3MBEB 3VXTA 1Q72H 2AEWA 3C8HA 4Q74A 4JCMA 3DXAE 3AY4A 2Z92B 5EA0L 3D25A 4RWYL 1RMFL 5TDNB 1JPSL 1BWMA 5B39G 3AFLA 1BX2A 1F6AB 3MV01 3GSUB 1G9MC 3VXOA 4KUCF 1OQOA 5EZLA 5ANMB 3PGCA 3L1OH 1RULL 1Y18B 2GCYA 3K1DA 1A1MA 1LK3L 4MDJA 4PJ5D 5J56B 5JHDE 4HG4J 3UTTD 2Z8RA 2HRPH 3HZKA 5MP6L 1VGKA 5CGMA 4L8CA 1NFIA 3OR6B 3OKMB 4LEOA 1S7QB 4K8RL 2DF3A 2PO6A 1U3HA 3WXVL 1UM5H 1CL7H 1GL4B 5B38G 2H1PL 1VPOH 3N1QC 2JTDA 1XR8A 4Y19A 3AU1A 3HS0A 4HCRL 5IW1A 5C7XH 2W9EL 4HS8H 4OF0A 4WI7A 3HMWL 4R0LB 1FFRA 3WD5L 4CADA 3ARRA 3TM6A 1YC7A 3MV7B 2V7HB 4RAHA 3VDCA 1H15A 1EXUB 5IWLA 2V2TB 1JGEB 5DJYB 4KRNA 3PIQA 5GJTL 1T7ZA 4HBCH 1CDHA 1JTPA 5L2JA 1E4WH 5DHXB 2DWEB 1P7KB 4UQ3B 4W6YB 5D1ZC 4WFFE 1UVQA 4FFVD 4MHHG 2AEIT 5F7YC 2D7NA 3S35L 4C59B 3ZE0E 1OGAE 4GRWE 4XCNB 4GRLC 4KK5C 3HLAB 4V1DE 3SKUD 3QIBB 2QL1A 2NY5L 2RAMA 2J8UE 1JHLL 5E8EB 4ETQA 4U1JA 4K7PX 5ICYB 2YRLA 1OGTB 4F7PB 2OTUA 4PR5B 2JF1A 1GPOH 3WYRA 4N0UB 5EN2B 4I48A 3RVVD 4AQOA 4DN3H 1QSEE 1QHOA 3OKDA 3WIHA 1MVFA 1VENA 2IMNA 4MWFB 5C0BA 3C5SB 4YC2B 1RUPH 4GQPH 3T65A 3LHPL 4UILL 1A3LH 4ZSOB 1OTSC 2JIXB 4G43B 5DD0L 1EAPA 4FQXA 4Y5YB 4EDXB 1ZT7A 2RBLA 2X4RB 3X12B 4HEPG 1C12A 4NWTL 3P0VH 4UAOC 4OZ4B 5BXFB 3GFUA 2EDKA 5MEND 1FFNA 1QACA 1I85C 1ZSDA 1FL6A 4UQ2A 1J0JA 2RHEA 1GGBL 2V2XA 1GYAA 2O5ZH 2R4RL 1LE9A 4YLQT 3BPNB 5DVOA 2G5BB 5D4QA 1QFOA 3RPIA 1J05A 3UPRA 1ZKAA 1IC4H 2I26N 3RGHA 3QEQA 5TE4L 3H9SE 3MV8A 4UT7L 1W0VB 1BOYA 4WJ5A 2IBZY 4X0KB 3OMZA 1CICB 3IAGC 2R29L 5CHNB 1JWUB 4FABH 4JRXA 1DUZB 4WTXA 1AGFA 4TQEL 2NMSA 4A6YB 2B39A 5D7LB 1LDPH 4F9LA 1F2QA 1ZHLB 4YGAB 2WWMD 3O3EB 2Y06H 4RQQB 4MD4B 3HPLB 3HE6C 4J12A 4PJIB 3ABZA 1G7HA 5CGTA 4IDJL 1MJJA 2AXJA 2FL5A 2HAZA 1XEDA 5JW5B 2ZKHL 1JHKH 2WBJB 4NNPL 4L9LC 5DI8B 4HUUB 3O41B 1UWEH 4XP1H 1EAJA 5T1KA 1JRHI 2AKRA 1KENH 4TVPH 1Y0LA 5F97E 3MRNA 1KCRL 4EVNA 1S7TA 1QEWA 2J4WL 1GJIA 3HE7D 2NY3D 5AUMA 2HVJA 5MEPB 1X5ZA 4D0DB 4WFHE 2Y1VA 3E6HA 3HFML 1QA9A 3FRPG 4QYOA 2VIRB 1T7VA 4HH8A 1JGVH 1A5FL 2H3NB 4YJZL 3C8DA 3MCKB 1A6ZA 3ZKSD 4LSQH 3WLBB 1IMHC 4FXGB 3VD5A 4X99B 1BQHG 5DHVH 5IB1A 1UJ3A 4JY4B 5JOPE 4L1DA 4JFHE 4HIXH 3ULVC 1N5AB 2DKUA 4LLYA 5E00A 3LEXA 4AEEA 4IRZL 3T3ME 3VXRB 1MJUH 5EZJA 5DJ6B 3QDHA 3MMEA 2HG5B 3DBXB 3L3DA 2APVA 4RMQA 3VD4A 1RUAL 1UXSA 1T5XA 3TJHC 4EUPB 3ZE0F 5JZ7D 3FN3A 2YPVL 4N0FB 1Z9SA 1WT5C 5E95B 5E8NB 4Y4FC 3SGKC 4LSSH 5GJSH 2J8UF 1BQUA 3MSPA 4PJHF 4QRPE 1JGLH 1HOCB 1L7IL 1CGWA 4QO1A 4TVPD 3TT3H 4OKVB 3FN9A 1HHKA 3JVGA 1NANH 2Q8AL 1AFVL 1YY8B 3CFCL 4G8IA 4EN3C 1AD9A 5JPMA 1EMTL 1SYSB 4KTDL 3I6LE 4GLRH 1OARH 3RY4A 2BNRB 2NYYC 1OP3K 3BZEA 5DJ2B 3BP6A 3G04B 4N1HB 4P2RD 1YJDC 4HGKC 3TO4A 1J9CT 1N64L 3KPRB 3S5LG 2BNQD 4F7TB 5HI5C 1IGML 3S34L 3FZUD 1T5WA 5E2TL 2Y23A 4BJLA 2AJXL 4ONGL 4MD5A 2FNBA 3O0RL 5HYIA 4I2XE 5EBMA 4H88L 5IHUH 1CF8L 3DYOA 4Z7WE 1DLHA 1G1YA 5GGQH 1MF2H 5I0DA 3GM8A 4P5TB 5HDQL 1HHIA 4JQXC 4U0RC 1UM4L 2W0LA 3FN0H 3U0TA 5GS0C 2D4FA 4X6BA 1CD0A 3OXSA 4HJ0C 1KOAA 1WTGT 4HUWB 3W9EA 4QXUH 5F6IB 4RX4D 2NNAA 5DYOA 4M6ML 3FRUB 4LSVL 1CCZA 4PJXF 4YPGB 4DCQA 3REVA 1MNUL 2Y72A 3JV5A 1CFSB 5C8JB 3ARDB 2WM0A 2GI7A 2YBRA 4YZFE 3LQAL 3P0GB 1JZ3A 5H37G 3O9WB 4MAUH 4QHMA 4CMHC 4HCRA 4YHKL 3C60A 4NHCH 3MRCA 3T0VA 1I9RL 3TIEB 3AAZA 3K4AA 1VSCA 3PQYD 4U4BA 4WW2B 4NNYA 2UWEA 4WRLA 4JLRA 5DD3L 4IIQB 3LEYH 5ACZB 5KSAA 5F9DC 1LO5A 3LIZL 3HNVH 4NC2B 4HWBL 4JFEE 4MNQD 3VXTB 4EBQL 4HWNA 2QADB 4QF1A 5F7DA 1CK0L 2YK1L 3KPQB 4HIEB 1URLA 1AO7D 3D25B 5T3XE 5DEZA 1J0YA 1BX2B 2EDWA 3RDTC 1QFPA 4CW1A 5D2NA 4OCSL 4LU5L 2VLRD 2J12B 3EOYG 4PBWD 4IRSD 3BISA 3S37H 4H1LH 5SWSD 1AXTH 2OQJA 4YH6A 2HLFC 1L6ZA 3SKMB 4G3YL 3MLRH 3T3MF 2GCYB 4R2GD 43C9B 4MDJB 1LILA 4LRNL 3TPUA 4NM4H 4YHIB 4ZNEA 3HZKB 5DVNA 2BOCA 4R90L 4Y2DD 2F74B 4UNVA 1VGKB 4POUB 2FX7H 2H45A 4J3OC 3GSRA 1MI5D 4MQXD 4LEOB 4J1UA 5HY9A 1DANU 4XPFL 2OK0H 3SJVE 1U3HB 3IJSA 3EZJB 1XF3A 1A6UL 2EDLA 2P5EE 4FQ2L 1QYGH 1S9YA 3STZA 3HE7A 2VB5A 2X09A 4Y19B 3AU1B 3HS0B 5IW1B 4ODTL 4JFQB 4ISVA 1MRCL 5KSBA 1R6VA 4XMLL 1O7VA 4W6WB 4H0HB 2EC8A 1MHPL 2R23A 4NJ9L 4MMZC 2BP3A 3AS2A 3PIQB 2QQQA 3QUZD 4P9HL 3N50A 1HHHA 4RISL 3WXWH 1W72B 3RNQA 3NABL 1R3IH 1UVQB 4YHZL 3TN0B 5H94B 1JNNH 3NTCL 1LP9A 1T22B 2W38A 1A02N 4M03A 5BZWA 1X5KA 4NOBA 4N0CD 1XMWA 3ZHLA 2MQ0A 3RGVC 5EOCH 2I9TB 3MQIA 5KJRL 1NEZA 1GSMA 2YOCA 2CRZA 4OZIE 2MOVA 4NHUA 3ESVF 3UTSB 1FG2A 5C0BB 3MYJA 2BVEA 1MUJB 3T65B 2D7PA 3GJFB 1EAPB 5E2UH 2ADIA 4P5MA 5HHMD 1D7FA 5HYSA 2GY5A 3MCLL 4YUEL 3MPCA 2XA3A 1SJEB 1YQ2A 3SE8L 1OD9A 1BVKA 4ZS6C 1H3VA 2YC1A 1V3LA 5EIVA 1S9XB 1FFNB 1Z0NA 3ET9F 1QP1A 4NRZB 1INDH 3SGDH 1ZSDB 4UQ2B 1J0KA 4MAYA 5FA3A 4L3CB 1LE9B 3TFKD 5BJTA 3BOVA 1D5XA 1JVKA 3JWNC 3SCMA 1CS6A 4TNVK 2CRYA 3B2UC 5K9QI 3WNKA 5ISZE 5FECA 3ZTJH 2ARJQ 4NQDB 5D96C 4KC3B 4UNTA 1DUYA 1IEAA 1V8HA 2YKLL 4AK1A 3FB6A 3MV8B 1P4IH 3BKCH 4WJ5B 4X4YA 3C6LA 3NFPB 3D3VA 3ZL4H 4M6OH 4XPAL 4G6FD 4K3GA 1UFUA 1MY7A 1MJ7L 1QOKA 5MHSE 4X4XA 4PRNA 2VUOA 3CMOL 3BYTA 2OR7A 4KHTL 5SWZB 3OKOA 1S78D 1J0ZA 1MAJA 4OM0L 1KLGA 1SBSH 2WBKA 1IC7H 1V7NL 1BEYL 1BMGA 2H41A 1AHWA 1ORSA 2OL3B 4KJQC 4N9OB 2DLFH 1AIFA 4WIQA 2HA1A 4TUKH 4CL7A 4XC3L 3ZKNC 4M7ZC 5FGBC 5T1KB 2AKRB 1A7OL 2F53E 3RUGE 4PTTA 4PB0H 5LWYL 3WO3B 4EVNB 1QEWB 5I8KH 1F90H 4NPYB 4OD3L 2HVJB 4NIKB 2FLBT 1N6UA 3PQYA 3E6HB 1QA9B 4WV1A 1W0YT 3VGEA 4OB5L 4M7JH 4JRYB 1TQCC 3FO9A 4F3FA 4WTZA 5ITBH 1HNGA 2CQVA 2DLIA 4LKCB 4TSCH 4JE4B 4D9QE 3TWCH 5B8CA 3FB7A 5DZLA 2ZOKA 2OXHA 5DZNA 3LEXB 3T2QA 1HSBB 1JJUA 1LD9B 5JR1H 3CLFH 4MNGE 2O5XH 3MV9E 5SWSA 5KVFL 4ORZC 1DL7H 3L3DB 3TVMA 5ERWA 1E4JA 4O9HH 2JK5A 1UXSB 3UDWA 1PJ9A 1T5XB 3L5XH 2ESVA 2VLME 1YQVH 2EZ0D 4LLQA 3UTTB 1N6QL 1BFSA 2R0WH 4D3CL 4ZXBA 5IJKC 2APTA 1S8DA 5MI0C 3JWDL 3BZ4A 3HRPA 4Z95L 1NMBL 2IANE 3EYOA 2BJML 5FYJH 4G9FD 3V0WH 1XH3A 5DEFA 4JVWA 3IFLH 4NP4H 3LEVL 4OZIF 2YRPA 1G7IB 1TJHL 3EUUA 1JZ2A 1HCVA 4G8IB 3P3YA 5ICZA 1MCDA 1AD9B 5C07D 3NGBB 4QRQA 3OHXA 2OR8A 3CFIC 1Z9MA 1ONQB 4XBGA 3AMLA 1DBJH 3ARYA 3IF1A 4NQCA 3BP6B 2X9YA 1Q0YH 3TO4B 5EU6D 2WANA 4POZD 2E7LC 3GNML 1T5WB 3A0OA 4HIJB 4KDVA 4HWBA 1FHGA 3D69A 3E6FA 1F4YL 5DUPH 3QUXA 2JELH 5EUOA 3SQOL 4MD5B 3BN9C 3HTLX 1BIIA 1JTTA 1QBBA 2Z8WC 5EBMB 1OAZL 1YEHH 1QNZH 5CUSH 4P2QE 3I50L 1EO5A 2NXYD 2XIDA 4NZUH 5A2FA 4JHAH 2A6JA 3EYQC 1HHIB 2P47B 2D3VA 5JIPA 5I73C 1RHHB 4LL9A 2H9GA 1XIWA 3ARGC 3U0TB 3C5ZC 4X6BB 5HHOE 4DTGH 4F58H 5EB9A 4O51A 2CMRH 3OXSB 3REWA 1C5CL 5HPOA 3TGXA 5FYJD 3TYFA 3BGMA 3EZ8A 2Y25A 2NNAB 5DYOB 4UTAH 1EJOH 4F80A 1OTUC 5IGXH 3SPVB 3Q6GL 5CZVL 2R4SH 4K71C 5A16B 3PXJA 4HKZA 5J6GA 4JM2D 2W07A 3VD3A 1W8OA 3NH7H 4WUKL 3REVB 4UV7H 3HI1B 2D9QB 1IGIL 3TZVC 4MLIA 4ZUVA 3V0VA 5C3LD 4J8RA 3R4DA 2YBRB 4HPOH 4M4PA 3VA6A 4HXAH 4R9HA 5I1CL 5GGTL 2P42B 5F8QC 3U9PL 3BJ91 1Q0XL 3QWRA 4G8GA 2QR0B 3MRCB 5D7JC 1A9BA 1YPZE 3FQNA 3BP5A 3K8LA 3EYVA 3AAZB 4NZRL 2AW2A 4KKNA 1KT2B 4DQOL 4L8DA 3B9VA 1WBXB 3RUGF 2ZCKH 4JLRB 2Y7QA 5KSAB 1LO5B 4UOW1 3F7RA 2H2PD 2AJ3A 3VFSA 1XF5A 1XGRA 3V6FB 3IXAA 4JDVA 4LCYB 4OZGA 3MRIB 4X7DC 5D2NB 4DZ8B 3SKNA 3AM8C 4MVBC 5FGCE 4YWGH 5A3ID 3MJGX 4OZFA 2JJVA 4ERSH 3IJYA 4NBXB 4DFIA 2NZIA 5AG8A 2VDNH 4OSUH 2BVPA 5IT2L 4L3ED 2XZQH 3S36L 3PABA 1FRGL 3TPUB 3NCYP 4HULB 5IESH 1HXYA 3MLYH 5JQ6L 5KSUA 3BT2H 4J1UB 3EHBD 5HY9B 4XTRC 4HWUA 2R0LL 3WFBL 2D7TL 2YA1A 1NMAH 3QCUH 5I17A 5KS9A 4TTDC 5L8KB 1S9YB 4MJ5A 4PLKC 2Q76A 3C2AL 3HE7B 3MRRB 2D0GA 2IJ0C 3CAFA 3TH4T 5EO0A 1K8IA 5GRUL 1GHFH 4X7SH 3RNKA 4YNYA 2VO5A 5D6CA 3IJHA 4ISVB 3CVHH 3H3PL 5KSBB 3RA7H 3RL2B 5DJZA 2R23B 3CLEH 4G9DB 2A0LC 3AVEA 4WVRA 2J6EH 1GC1C 5ACLA 3V7MA 1T80A 3QFJA 5HYJA 1HHHB 4PJCF 1W0WA 2Z35B 1OB1B 2E7HA 3BPCA 2B4CH 1I75A 1QD0A 1BHGA 1NCUA 2EDRA 3VGBA 3IRPX 2DQHL 5D5MA 3BQUD 5BZWB 4ODWA 4GMTH 2QTEA 5FUZL 1TMCB 3LQZB 1KBGH 3TV3H 1IGTB 1H5BC 3QDGA 3KNBA 2XZCH 5IOPA 1S3KL 4FNLH 3V79C 1NEZB 2H2SC 4ONOA 4X7TA 3QUYC 2HVKA 3OZ9L 1YDPB 2YZ8A 2XXCB 2YMXH 4QHKI 5ID0B 4NHUB 5E2WL 3HNTH 5CKGA 3MYJB 4XVTH 1B9ZA 2HN7B 4PYHA 4Z7NE 2DS4A 1G0XA 2ADIB 2ZG1A 5HYSB 1S7XA 4JFFE 4WCYL 1PBYA 2VZUA 3V6BR 1S7VA 1MCPL 2B5IB 5ESQA 2ICWJ 3TBYB 4X6FA 4F9PC 3ZO0A 4HQQH 3K80A 2A1WH 5GZOC 4MAYB 2F9BT 5FA3B 2E7MA 4RFNB 4XNMB 1CFVL 5BJTB 3VXUE 3RWCB 1RZ7L 1MJ8L 1BFVL 3V2AR 3CUPA 5ETUA 5FECB 3UBXB 3QI9A 5DHVB 3EJJX 3SE4C 1R5WA 4EOWH 3V6OA 1DUYB 2NTSP 5K9QG 2HTKC 3E2HB 4PY8J 5DJCA 1YEEL 3MODH 4QOKD 5DXWA 4HS6A 4ZTOL 4F7CA 3ULUF 5F7UA 4R6UA 5E56A 4N9GA 4AEIH 3C6LB 4NUGH 1JNLH 3D3VB 2GFBA 5HI4D 3A67H 4OGAC 1FC2D 4X4ME 2MCPH 5T1MA 4LCWA 1FJ1B 2QHRL 2NY0D 4X4XB 4N8CH 5IKCB 1R3KA 4YQXL 3OKOB 2DTML 2EEAA 3BP4B 4HZLA 2R69H 1CE1L 1RUMH 2RGSA 5FM5O 1J8KA 2CH8A 1YY9D 3G5VA 2P44B 3FO0H 1GGIH 1KCUH 3WFEH 1AHWB 1ORSB 3BSZL 3V6ZA 3ES6B 4JM2A 5DFVD 3U2SB 1BJMA 1HDMB 4LVNC 3I3BA 1ITCA 3MNZA 1RZKL 4CDGC 3VH8G 4Z7VA 2EIBA 3ZYIA 1G7LA 2YSSA 5GGVH 1PQZA 4RFEB 3LDBC 5DO2D 4PUBL 1ZOXA 1UH4A 1RD6A 1HHJA 5E2VH 3UJTL 4PJBA 1KJ2H 1RZIA 3PQYB 4L4VE 3P11H 4IRJD 4YXHH 3NA4A 4CAGA 2R8SL 1TIUA 1TCRB 4JY6B 4R26H 3RWIA 3Q5YA 4RIRA 3PP4H 4BQCA 4P2OD 2VABA 1M7XA 4YHOL 3MUZ1 1AO7B 3G5XB 3WHXA 2E6JA 3O4LD 3FB7B 2ZOKB 3K8MA 3KYNA 4IJ3B 5LCVH 5GPRA 2VXUL 1ULVA 4K3DH 2P5WD 1ZA3A 1A1OA 3MJ9H 5SWSB 4UT9H 2AJZA 4XWGH 1CGSL 1X5YA 3TVMB 5CEYA 5I8EA 1EHXA 3PWPD 2JK5B 4PRIE 4S1SH 4JFDE 3UZVB 3U4AA 3ZE1E 1E6OL 4I18A 5EC1A 3QUML 4LLQB 4Y4KA 2VDLL 1MH5A 1GOHA 4KZDH 3ZE2E 1RIUH 1N4XH 4Y2DB 3HR5A 4ZXBB 4UOJA 5MERB 3O4OB 1S8DB 1RZFL 4RGND 1GGCH 3BZ4B 1QFWM 2CR3A 1U8HA 1FVDB 5HGDB 3ZYOA 3EYOB 3MREB 3GBNH 4LPUA 4M43H 4YDKL 3GO1H 5DEFB 5A1AA 2IG2H 2CPCA 2IADA 1R3JA 4KRPB 1FAKT 4OLZH 1KN4L 1OPGH 4GW4B 1LO3H 5ICZB 5D71L 4JVPA 2RB8A 4FQJL 1JZ8A 4Z7NF 3G6AB 4YE4L 1FNAA 4XBGB 5GGTA 2R0KL 4JN1H 3GSWA 2YEZB 4OD1L 2HKFH 4XXCA 4LHUD 3QUZB 3V5KA 3BW9B 3GSVA 1HH9A 4FQLL 2EXYD 3BPOB 1EGJL 3C09C 2BXYA 2NY6B 3KPSD 1FNLA 4I77L 3OPZL 1BJ8A 1F5WA 5K9KB 3PWLB 4Z5RA 1CDIA 3KVQA 1HNFA 3D69B 3E6FB 5EUOB 3QUXB 4PS4L 1YEIL 3QR2A 5C2BL 1E6JH 2AV7A 4H1LB 2NTFA 3D5OF 5CJBA 2C9AA 1IAIH 1YYML 4JFYA 5I19H 4LVEA 4YDLB 5D93B 3IKKA 1UACL 5FV1L 5GS1C 1LK2B 4IOFD 3GIVA 1J88A 3GM0A 3HC4L 5L88H 1WZMA 4M9OA 1RUQH 5IVXB 2Q8BH 2IH1B 1BF8A 4TPRL 4JR9L 1I9JH 1KPVA 1DBBL 3REWB 1T66C 5HHMB 3BGMB 1CR9L 3I2CL 3T2NL 4FQIL 3D0VB 3PWNB 3RTQC 3BZDA 4HKZB 5J6GB 4EIGB 3GI8H 2WIIA 3IETB 3M1BA 3QWOA 3QXUA 4CVXA 5F9OL 1NGYA 2BOBB 2CXKA 4NBZB 2FO1A 4TSBL 4EI6A 1LEGA 1NCWL 2VLKD 1LGVA 1XGTA 4Y0GA 5LGJB 1P4BL 4PJAE 5IW3A 5E5RB 3LS5L 4G8GB 5JDJA 2EH8L 4FG6D 2NX5E 1A9BB 2DD8L 3FQNB 1DQDH 5C6WH 4ALAH 1NGXB 4L8DB 1J1PH 3VWJC 1RUKL 4PJDA 4Z76A 2Y7QB 4QOKA 4C58B 3U4BL 3KWWA 4ZOCA 5E6YA 4P4RA 2YXMA 4LSPL 4PJIE 1XF5B 1XGRB 4KI1A 4EI5D 4D94A 3IXAB 4JDVB 2V17H 4G6FB 4OZGB 1BD2D 4CKVX 4LOUD 4JGUA 3T4AA 3DSNA 3I75A 4MJ6A 4OZFB 3IJYB 3QRGL 3S88L 4JPKH 4NZDA 5BW7A 1FGNL 2BVPB 2F5AL 4M48L 1A3QA 1AQKH 1ZA6A 2CGRH 3GMQA 2EYTA 1NMCC 4Y4HA 1EEZA 4X5XA 4HX1A 4IMKC 1NCNA 4O58L 1LO2L 4OTXL 2PETA 3S35H 5B39A 3PJSA 3IAPA 2XN9D 3GSOA 3ZE1F 4ODSL 1ZT4B 2XYCA 2NY5H 4KI5D 1FYTA 3DXAD 1J0IA 5TF0A 4M6AA 2XZAL 5IIEA 1R5IA 1A3RL 4M5YH 3V8OA 1CDJA 3FOLA 1FIEA 1NBZA 3AMKA 1Z0MA 4IRJA 5HHXL 4FFYH 3RP1A 3VFGH 2HT2D 2DQEH 4TTGA 5J1AA 2FO4B 3IJHB 3PL6D 1MHHA 2DI8A 4BM7A 3GKWL 2YS4A 3S96A 5JOFB 3CNKA 4U3XA 4Q6IC 2WUCL 5DD0H 4UT6L 2J7LA 1WICA 3QFJB 2PCPA 4D8PA 1KC5H 1A22B 1S7SA 2IEPA 2DQFA 4Z0BL 1FNGA 3O4LA 5K59E 3VXQA 5B38A 3VG9B 5GRYA 4FXKB 3TBWA 3BPCB 3EYFA 2PYFB 5C0RL 2XFXB 4KJWC 4XNXH 2ITDB 2RFXA 4JAMA 2AEPL 4GAYA 1F42A 4QGYA 3QDGB 1QRNE 5L2KD 4J2XA 3KNBB 1GXEA 4ZPVB 1C5BL 2EEBA 4X7TB 5E9DA 2HVKB 1HKFA 3ILQD 1MIEH 5BQ7A 2X4UB 5TE4H 4RFOL 1IKNA 1M71A 2PR4L 4UINL 4CN1A 2DDQL 2BNRE 4TOYL 2HT3D 1QR4A 1G84A 5J9PB 1I4FA 4PP2B 4O2CB 4XNZB 5JMRA 5C07B 1TITA 2IBZX 4YXLL 5BV7L 3DSFL 2HTLC 3B9KC 4R4FH 5CJXA 4X6FB 4OCYH 2RQ8A 1D9KC 4OQTH 4YK4C 1CLOL 3PDGA 1IGJA 5FYKU 5EU6B 4Q0XH 2PN5A 5ETUB 3W5NA 4JO1H 4MXQC 1IL1A 1R5WB 2VDML 2G5RA 1QSED 4FTVD 1AC6A 1SY6H 5DJCB 2BRRL 5E6IA 3GMOA 4HWEL 4F7CB 4PP1C 5HGBB 2XWJB 2J4WH 1FAIL 4N9GB 5DD5L 1QZ1A 5LXGL 2GFBB 3MROA 3RAJL 5A2LH 3C5JB 3VXMD 4PGEA 2NXYB 5L7XL 2Z8VC 4NQSA 3VRLF 2B7DT 1R3KB 1LWRA 2HT4C 3MRMA 1OT2A 4PJIF 4WFEE 2JJSC 3D0LA 4P0DA 4PJFE 3PGFH 1N5YL 4GG6E 1OY3B 5D7KE 4KROD 1QPXA 2NY3C 3NA9H 4PJ8D 3QUMA 3H6JA 3ZT7A 3P73A 2IFFH 2VZ1A 3IVKB 3QO1A 3UTPE 4JM2B 5EIIA 3B4NA 2QSCH 2BDNL 1CGYA 5D70L 2P8LB 4GBXD 5J3HC 3GMMA 4LPXA 1H9VA 2UZXB 1U3JA 1RUAH 4FMKA 4OCLC 1G7LB 2YSSB 4AIXA 5DMIL 4GW5B 1PQZB 3EJZD 5MEOA 3K7UA 1UKTA 4M6NL 2DQUL 3T3PF 1HHJB 1RZIB 1ZGLA 2FSEB 3WN5C 5EO9A 3EJYC 1J5OL 2EIDA 1UCTA 2Z31C 4RIRB 3BE1L 1NPUA 3MO1A 3BUYA 4HS3A 1PFCA 2VABB 1EGJA 5TDOA 1WF5A 3TEUA 3WHXB 5JZ7C 2J8HA 3D48R 5FO9A 4NN5B 1MCWW 1MCSA 3HB3D 1EIBA 3I3DA 4K2UL 2HFTA 5GRZA 1XZ0B 1TENA 3SY0B 3KPMA 5CJQL 4XHJD 3RI5F 4JO2L 5CEYB 2J3SA 4L3EB 5HGGS 4XMKH 1ZLSL 2BFVH 2BVQA 5FYLE 1BFTA 4QHNA 3ILPB 3PNWB 2IF7A 2NR6D 4X9GA 2R0ZL 1BQHA 2A83A 3DURB 5E08L 2GJ6D 4OFYD 1MH5B 2Z8SA 3HR5B 4HSQA 5KTEL 3CK0L 3W0WD 4P4KA 1RIVL 1A7PL 3NCCB 2AJXH 1U8HB 3EIFA 4ONGH 5JW4M 3OJDA 4G7YH 3SBWA 3UZQA 2VAAB 2C3WA 4JFHD 5F96H 1KB5H 4XPGL 1R3JB 2HFEA 1I1AD 5KVMC 3OJMB 3PV6A 3QHFL 1JF5A 4W4NA 2BSRB 2MJWA 2VDKL 5JW3L 4DEPB 2X70A 4PBVC 5C0FA 3HG1D 1JV5A 3KLSA 2CO7B 2WMPA 1BM3L 2Y5TA 2D03H 4XPTH 4AJ0A 4WNQA 4AEHL 5JHDA 1SBBA 1ZHKA 2CRIA 2F8VA 1Q9KA 4OGXH 5I74C 4L8SC 4ZFZA 1FSKB 3GSVB 1HH9B 1UEMA 1RU9H 2AXGB 4HUVA 1F58L 3V8CA 3VGFA 4PJGE 1JRHL 4MGXA 3MLVH 4KGJA 3BQUB 3SDAC 1FGVL 2NTFB 2K9UA 5I6XB 5CGYD 3EFDH 2UY6A 4MS8D 1H3UA 3F7VA 3RBGA 4I4WA 4GMSL 3S5LA 4LLMB 4JFYB 1MCCA 2B2XH 2AAVA 5JO5A 3SKJH 4B41A 3W11D 1ZEAH 3GIVB 1OLLA 3T0ED 3MBXH 4BZ2H 2MMXA 4EBQH 5JA9A 2WW8A 3OAUH 1KPVB 2WSKA 2DBLH 5T3XL 2Y5EA 2IAMC 5I1EL 4OCSH 4LU5H 4OD2B 1OGAA 5IHLB 2WIIB 3QWOB 1WFNA 1NBVL 4V1DA 4CVXB 4YR6B 4EEEA 2OP4L 2LV4A 4JKKA 4EI6B 1EO8L 1LEGB 2J8UA 4Z78A 1RPQA 1U8IA 3OX8A 1JMZA 1RV6X 4PREA 4R7NA 2KZ1B 4BZ1L 3Q48A 3EYUH 3TH3T 4APQC 3WIIH 4IRSC 1RZJH 5I9QC 1MRDL 1BAFL 3N9GH 1P7QD 5SWZE 4ZUUB 3BXNA 2CIKA 3PHQA 2AABH 5BVPH 4QOKB 1AE6H 4OKDA 1RK0A 4R2GC 3ZT6A 2ZUTA 4MD0A 2E27L 2YD2A 4M1CD 5AWNL 4DFHA 3H9ZA 4KJPD 4Q7DA 5LAXA 3FJTA 5JUEH 3CH1A 2X1OA 4JDZB 1CL7I 4Y16D 4LSDA 4QHUA 5E8DL 4XGZB 3T4AB 5SV3A 2NY0B 3I75B 2D4DA 3DHJA 2W91A 5I75B 4HMCA 4LCCA 1U3ZA 1OCWH 4NQXB 1PD6A 4ZD3H 1E4KC 3D1MC 3U0PA 8CGTA 3QCTL 3GMQB 2EYTB 2VRAA 4Y4HB 3DV6A 4X5XB 2KPNA 4HX1B 1JWMB 5ALBH 1MPAL 4Z18A 1PZUB 1CQYA 3KXFD 5B39B 1DE4A 3PJSB 3OKKB 3H9SA 1Z3GH 4JRYE 5FFLA 5T33H 4NRYA 4S1DD 5C08E 1N0XL 3CXDL 3EDEA 5I8OL 1ND0A 1MQKL 4PTUA 5T3XD 5IVNA 1GAFL 5IIEB 2L4OA 1U8QA 3VI4E 1F4AA 4H0GA 3E8UL 1G9MH 1N26A 3FOLB 4LDEB 1BP3B 4G7VL 5FCSH 1MCWM 2CKNA 1NBZB 1JFQH 4HZAA 2MKWA 4IRJB 1KCSL 5ENWA 4HUXA 1RURL 4JG1H 1MHHB 1SM3L 4PJXA 1JL8A 3C8KA 5HHQA 1C08A 3NFNA 4JGMA 4D8PB 1B6UA 4PJ5E 5CBEA 1MFAL 1FNGB 3O4LB 3UTTE 3HPJA 5TQ2L 2X10A 3OXRA 5B38B 3BWUC 1EA9C 1KV3A 3WS3A 3TBWB 3EYFB 2CJUL 4ZTPL 2I60H 4P5KA 5T5NF 3UMTA 4CBPA 3N1MC 4JQIL 2P5WB 4O2EB 1IGFL 2E9IA 2RFXB 3F7YA 1A21A 4KAQL 2P5ED 1U0QA 2MWCA 4XPBL 3EDKA 4GAYB 5CCKL 4L5FL 3PWPB 4DVBB 5J6HA 1GZPA 5I1IH 5ESAA 5E9DB 3VXPA 2ZSVB 4H20H 1V05A 2A74A 4GXVL 4L9DA 5BQ7B 2XWTA 4RGNB 4HK3J 1YNKL 5DF0A 1M71B 5FXCH 4O02H 3KR3L 1BLNA 2F19L 4XP4L 1NDMB 1YMMA 1I4FB 4ENEC 4X98B 4K3EH 1KUMA 1HQRA 3WS6A 3IDMA 4HDIB 3MRQA 1KJ2B 4L29A 3HAEH 3PDOA 2CDGA 2HWZH 3IDNA 1VFOA 5JXEA 2DM4A 4LLVB 1IGJB 3WL9A 4LPVA 1IL1B 4PLOB 3TH2T 3KPSB 3NCYS 5K33A 5C0AD 2DLGA 1KCKA 4XC3H 4DGIL 1S78C 5E7BA 3SQBA 4QRPA 2PF6A 2WZPD 2F58L 2AK1L 3NCJL 3GMOB 5LWYH 4AMKH 5AD0A 2MHAA 3MA9H 1EFQA 3MXWH 3NMEA 1UKQA 1F97A 1FP5A 3MROB 2EDHA 4LGRB 3DUUA 3DNKA 4PGEB 5MENE 3TA3C 5CBAA 4OLUL 2DM7A 4E9LA 3TP4A 3NN8B 5KVDH 3D0LB 3BD4A 5IG7B 4NZTH 3QIWA 4YEEA 1MIML 5ISZD 5K9OA 3P0YL 3VMPA 1U95A 3P73B 3GHBH 2VZVA 4L1HA 5D1ZD 3O8XA 3QO1B 4OCXH 1VGEL 5EIIB 3UBXI 4XP9H 1NLBL 2XRAL 4KK5D 1IQDA 3UYRH 4OQ1A 2VLKB 4I2XA 1I3VA 2X4QB 1IILE 4Z7WA 2VSCA 3V52H 3DARA 1TNMA 5MEOB 3DPBA 1FL5A 1DN2A 4XCCL 4F37K 1MAML 2E8YA 2MQCA 3I9GL 1ZGLB 4JFPB 3JWDH 3HNSH 4PGBA 3T8XA 1IAMA 4QWWC 3ARQA 3VI4F 2NY4B 2VN4A 3W2DL 1OTSD 4WO4D 1ZHNB 1KXTB 3MR9B 1KIQA 2HH0H 3BUYB 4HS3B 5DEGA 2NXZD 2QLVB 4EI5B 5CLWA 5TDOB 4GKZA 3DTXB 5IJVB 3MLXH 4ZAKA 1BD2B 3ZHDA 1JPTH 3VGHA 1D6EB 3JUYA 4JM4L 1XT5A 4WU7B 4UBDC 4F33A 4U6HA 3MOQA 3ARFA 1NANI 3KPMB 3FFCD 1QBLL 3S9DB 3KPLA 4R8WL 2IQAB 2BVQB 5IVOA 3VGAB 4QHNB 2A9NH 5FO8B 1GZQA 5BVJA 3LN4A 5FB8A 4MXVF 2OZ4L 1BQHB 2DQJH 3MJ6A 5HSFA 3O6LH 3B5GA 4KVCL 4OIIL 2OR9L 3FAXA 1MCIA 35C8H 4P4KB 5E1AB 5FHBH 3D9AL 1QSZA 3PWJB 1LEKB 4GG8A 4JFEA 3SQOH 3P30H 4JDTH 2V2WB 3D2UA 1TPXB 3DXAB 1X5AA 1XCTA 3JZ7A 3MLUH 3STBA 4C56D 5I71B 3ULVH 5D1QA 4JGJA 1AR2A 4CUCA 5ADOH 3STLB 3ZDZE 4QXGH 2HFEB 4J3SA 5T5FL 3PV6B 3SKOB 2EDXA 1OSZA 1L0YA 4ONHA 3FO2A 4LVOB 4JFZH 4XP6L 3GKZA 5HJ3A 4DKFH 3HE6D 3TJEH 2FGWL 1N0LA 1DBKL 1ZHKB 2R1XA 2DM3A 3Q6GH 4ZFFA 4HUVB 3L95B 5B4MC 1INEL 5C0CD 2XG4A 5FCUL 5GISH 3SJVA 3ECBA 1P1ZA 2HKHL 2VISB 5JORA 2P5EA 3L3KA 4TVPE 2R1YA 2DI7A 5GIRA 5IEKA 2WUBL 3ULUL 4NZRH 5I18L 1YJDL 5BZDA 3LSOB 4I4WB 3S5LB 3RWEA 1QHPA 5JO5B 3AREA 1A6WH 3F12A 3SOBH 2Z9TA 2B20A 3VA2C 1L0QA 5IW6A 4P46D 1FIGH 12E8H 2OJEB 1DBAL 5BS0E 4LVHB 4P2RE 2YD4A 3MZTA 1VACA 1JGUL 2BNQE 1NCDL 3ULVD 1A6TB 4IOIA 4FZEL 2LE9A 5CIPH 5TFSL 4F57H 1O0VA 3VFTA 4GRWB 4XAKD 4LEXH 4J23A 2Y36H 3T0XA 1FO0H 2J8UB 1NKOA 1U8IB 3OX8B 2YPLA 2VKXA 4G6ML 2UZIL 4ODHH 4P2QD 3TJHD 1T89C 5DD6A 4LMQI 5F71A 1T7XA 3U46A 2E9WA 1KIPA 4OZIA 2BMKB 4WFGD 1QSEB 2FB4L