5CJOL

Crystal structure analysis of elbow-engineered-fab-bound human insulin degrading enzyme (ide) in complex with insulin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
209
structure length
190
Chain Sequence
MTQSPSSLSASVGDRVTITCRAVSSAVAWYQQKPGKAPKLLIYSSSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSPSFLITFGQGTKVEIKRTVAAPSVFIFPPSQLKTASVVCLLNNFYPREAKVQWKLQSGNSQESVTEQDSKDSTYSLSSTLKADYEKHCEVTHQGLSSPVTKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Insulin-degrading enzyme
total genus 28
structure length 190
sequence length 209
ec nomenclature
pdb deposition date 2015-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cjoL01
5MP6H 1VFBA 1CFVH 3QRFM 1CL7H 4KDTA 5IHUH 2FX7H 3QEGL 3S96A 1QBML 3ZHKA 2QADB 4HKXB 1F42A 3A6CH 5D96B 4QRQB 3F65A 4OZHA 3KPQB 1DEEA 4X7SH 3UYPA 2BFVH 5J9PA 1NBQA 4N5ED 2Z92A 3OAZH 2Y1VA 4TNWK 5FO7B 3HG1E 3VWJD 3QUML 2O5XL 4OCSL 4WV1C 1EJOL 1Z6JT 4WDIA 1G0YR 3EOYG 2AXFA 1RZIA 1PY9A 3P0YL 4I18A 4U05A 5ICXA 1CWVA 3DRTA 5FAAA 3GSUB 3MRBB 4G3YH 7FABH 3TCLB 2XNAA 3DO7B 3VXSA 3GFUA 4EVNB 4HS8H 4XP4H 5K9OB 5KVEH 1Y0LA 3LRGA 1XF4B 4N1HB 3T4AA 5HHPB 3H9HA 1AY1H 2QADD 3FHAA 3H6JA 2AJZA 1VEPA 3TJHD 1FYHB 4Q9RH 5D7SL 2IFFL 3AUVA 4CU7A 4BQ8A 2WUBH 1IGFL 1OAXL 4P57A 4C54A 1A3LL 1U2CA 4O2EA 3D0VA 1FRGL 5LGHH 4X6CA 4C56A 3D3VB 2C3VB 3REWA 1KLGA 1M05B 4EI5C 2Z4QA 4CADB 1QLEL 4KY1H 2NY3C 1OM3L 2ZUWA 2YWZA 3G6JE 5EWIH 4GH7B 1FVCB 1T66C 4Z7VE 4FQLL 3PGFL 5D7LA 5IEHA 4LVEA 3VE0B 2VLLA 4P2RA 3EGSA 2BY0A 3DYPA 2CKBL 1NLDL 1FNEB 3GBMH 2D3VA 2G60L 3CFEB 1FZMA 2W60A 1NDGB 5EOQH 4X9BA 2ERJB 4PY8J 1BVKA 2UWEB 3QUKA 3ZSTA 3QNZB 1NGPH 2HYMA 3ROLB 4OBSA 3QIBA 3RHWF 2HFEA 4NO2A 4M62H 3S35H 3ULVD 4OJFL 1BOGA 2DM3A 4MNQB 4EDXA 5CJQH 1MNUH 2DMKA 3LIZL 1SEQH 2R1YA 4U0RB 4ZO8A 3MRDB 2Z91B 5E08H 5SV3A 1WGOA 3C5ZA 4OB5L 3V5HA 1ZVYA 1KCKA 1YNLH 1XH3A 2V9TA 5F7UA 1ZVHA 2E7BA 5JIKA 4P2QE 4WHCA 1UM4H 2AJVL 1ZHLA 2F19L 3UYOD 3HN3A 4DGIH 2R9HC 1JP5A 5LAXB 4V1DE 5GS1B 3IRPX 2BSSB 4N90E 4YX2L 1PQZB 3RTQA 4HIIA 3HA0A 4G5ZL 3AC0A 2NX5D 4M00A 3QUMA 5I1CL 2HWZH 4QXGH 3RUGB 3CH1B 4XGZB 1T21A 2VQTA 5T1KD 1Z9OA 2X4UB 4R97B 5FECA 4OLXL 4G9FE 1ZHLB 2C9AA 5E8DL 5DUPH 4AG4H 1Y0LB 1UJ3B 3RZCC 5D5MF 3A6BH 3RY4A 3LEYL 2UZIL 5LBSH 2VR5A 2GTZB 1PEWA 1NC2A 2FH8A 1JNLH 4EDWL 5D2NE 3BYYA 3TBYA 1E6OL 1MCCA 3CLFL 1EK3A 2FBJH 1A47A 4IOSD 3WDIA 5F9DC 5HDOA 2VDOH 1DVFA 1TJHH 1CLOH 4Z78B 2OI9C 4DW2H 3HE7C 4PRPA 3STZA 2CMRH 2DKSA 4Q9CA 2W9DH 3O45B 3TWCL 3ECBA 2A6DA 3EYQD 4HWEH 3EJZC 3FB6B 2WBWB 1CBVH 5IBUB 2JB5L 4XP6H 4ZG1A 2ZJSH 4K3DL 4P2OC 4R4BB 2EE9A 1KUMA 1FNEA 1GAFH 2G5BB 3MRLA 3F58L 4P2QD 1NAKH 4L4VE 1MI5D 2EYRA 4QTIL 3MBED 1WBYB 2DLGA 4PJXB 5HVGB 1MAJA 2XY1A 1YEIL 4M6OH 1R0AL 3T0EC 2A74A 1GHFL 2R4RH 4JG1H 5D71L 4PGEA 3ARSA 4Y5XC 4RMWA 2ZKHH 2K9UA 5IIEA 4Y4HC 4XPGH 4ODTH 4J3OC 4GFTB 2H32A 4QT5B 4KQ3H 3VG9C 5F6IB 1BM3H 1RUKL 1MCHA 3FFCB 3O2DA 4U2YA 4JR9H 4IRJB 1RU9L 3U30B 1HINH 1N2RB 2CLZB 4KUZL 2ARJA 3GNML 3GSVB 3G9VA 3Q6GL 4Y2DB 1OTSC 2EYRB 3BE1L 3ILQD 4A6YL 1HQ4A 1OAUH 5MEQA 3ARFD 2D7OA 5E4EB 2D2OA 3GSOB 4XRCB 1LDSA 4ISVA 2Y36H 5EDXA 5BO1H 5J12C 5MI0C 5ITBL 2M8XA 5DD1L 4JPKH 3VXSB 3HMXH 4X7FC 1YC7A 1MVUA 4YIQB 2VE6B 4JFZL 4LPCA 3RP1A 3FO0L 1FZOB 5L8LB 2WBJD 3N85L 3L3OA 3OHXB 3VW3H 2AK1L 3ZYZA 4PRIB 4ONGH 1OQXA 4Z7UA 3MRKB 3ZT5A 3B9VA 3P30L 3VGGA 4BSWA 1LP9F 3N1PC 2AXFB 4NM8H 1NMCC 4IOFD 3EHBC 1MLBA 3OJMB 4NN6B 4XPFH 1WCBA 3DTXA 4RMUA 1VFOA 4FABL 2HVKB 2JJTA 4MNGE 3C6LA 1D6VH 4N9GB 2VR9A 4RBPH 4YDIL 3E6HA 1MAMH 5BVPH 1CK0L 4OZHB 4Q9QL 3HMWH 1QSED 2GTWA 4UNTA 3QCUL 3QUXA 3LQZB 4K23L 3TCXA 4POYA 4IDJH 1J1PH 1BQSA 2B5IB 4PRDB 5JXAL 3MCKB 3DVGA 4YFLI 3SY0B 1CIUA 2NY4B 1AD0B 4OD3H 3VWJC 5HHQB 1Q38A 2IBGA 4KKBC 1G7PA 4IOFC 2Y6SC 1PJ9A 3PWUA 2BSRA 5M7QA 3RJQB 1A3QA 3QUYB 1DFBH 3CU1A 3PWVB 4KTDH 5CZVH 1DQQB 3RX5A 3BUTA 2Q8AL 4OFIA 4PLJC 4YHNB 4JM2A 1INDH 4KK6D 3U7WH 3KYKH 5DK0B 1WBXB 3FQRB 1QYGH 3SDAB 2QKIA 4DKEH 3HI5H 4DAGH 5E2WL 4ZQKB 1OP5K 2R0ZH 2CQVA 1FYTB 1YY8A 3RAJH 3NIFE 3QZWG 1R3JB 1Q9OA 2W0LA 5F7HA 1FJ1B 3VWKA 1T83C 2VXQH 3FFDB 5IHUL 1KTKE 1X7QB 3INUH 3U9UB 2W9LA 5K93A 2HG5A 4QHNA 3T2NL 1J11A 1JPFB 4UU9B 3TA3A 3KPSD 1E4JA 1KJ2B 3WUWA 3HR5B 1FNSH 5CUSH 4EXKA 1F6LL 1JRHI 4H0IA 4Z8FH 1VGKB 1CICB 3O3BB 4NN5B 5JUEL 1DDHA 1CD9B 3B5TA 3ALWA 4ERSH 2ZCKL 2CO6B 4Z18A 2E7LC 2V5RA 1RZJH 2C3XA 2PYEE 1KLFA 3QDHA 1HH9B 4KMLB 1NCAL 3QEUA 4R3SA 3UTZA 1KT2B 5L7XL 4JREB 3BDXA 4LGRB 4U3XA 4GAGL 4R26H 5C2UB 5JHDB 5I1IL 3QIWD 4OBRA 5MERB 1VKXB 1LD9A 2F74B 4HZLA 5J1AA 1J0ZA 2J5LC 4JKPL 3DMMD 1NBYB 4ZTOH 3SJVD 1C16B 4GAJH 3AGVA 2WUBL 1GC1H 2QV2A 3K3QA 3K0WA 3TF7C 3LS4L 3QHTC 3RGVB 3KLHD 1OSZB 4OCWL 3GKWL 4YE4L 3VD5A 1S5IL 2M1KA 4PJHF 3PHSA 3ARDD 4WY7H 5DUML 3CGTA 2Q7NA 3DSNA 3V8CA 4LCCB 2E7HA 3CPLA 3UJIL 1FG2A 1HHIB 4FS0A 1JPTL 4ODHL 3U46B 2MSPA 4LLUB 2QBWA 3VFPB 2CJUH 2AGJL 5F97E 4G9DA 4Z7WE 4MQSB 4ZOAA 5I8CA 3DX8B 4PV8B 5C0EA 4N8CH 1RUPL 1RUAH 3EOAB 2R9HD 3VA6A 1E6JH 1FO0A 4HWBH 3VFRB 1VEOA 1RIVL 4QNPE 2Z8WC 4W68A 1MPAH 3RQ3A 3LDBC 2XZAH 5D8JL 4R4BA 5GS1C 4WWKD 1XGTA 2B2XH 4R4NC 1EH9A 3HZKB 5E8OA 1I3RA 1T0PB 4OM0H 5C0JA 5IT2L 4HIHA 2FO1A 4X4ZA 4M6NH 5IV2A 5HI4D 5CWSB 1F00I 2F5BH 4L9LA 5GS0D 1QFWL 5ABDE 3MZTA 3EOTH 5HGBA 1L0QA 5KW9H 3NCJH 4XPAH 1OTUD 3O3UN 4BFIA 1B0WA 4D9RD 1GGBL 4CW1B 1DBAH 5EN2B 3P4OA 4D9LH 1PKOA 1NH6A 2B1HL 4J3VA 3VXRD 4NOBA 1FFNB 5FB8B 2YS4A 5HBBA 4CMMA 2HWZL 4D0BB 1JZ5A 4RAVA 1CZ8H 1KJ3L 5CHNB 5HYJB 5EFIB 3AS3A 1DR9A 4Y2DC 5FECB 3ZKXC 4ZFOL 1LK3L 1A14L 4H8WH 2VC2H 1AI1H 3EDKA 4PJFF 5BRZB 5DGRA 1MEXL 4MS8C 3S35X 3KPPB 1ZA6B 3MUJA 4LHUA 2X4TA 1VENA 5LBSL 3PIQB 1W0WB 1DCLA 3QEHA 3E2HC 3TBSB 2R0KL 4HEPG 5J1TC 3WUZA 3U36A 1KG0B 3BKJH 4Y5XB 4AIZB 3OX8B 1OB1B 1BD2B 3FRPA 5CSZA 4JHAH 3KPNA 3V4UL 1QSFB 1QBLH 2KQNA 5E94A 2YD8A 4JKMA 2CMRL 2Q20A 4GW4A 3B9DA 1EO5A 4GJTB 4NO0B 5F1IA 1DANT 3GI8L 4HXBH 5E6ZA 4YQXH 3LN4B 4OD1H 3S4SB 2R4SH 2P45B 2YPVL 2HMID 4HFWB 4AEHL 1FNLA 4G7VL 2FH6A 1UB6A 4JFOA 5ELIA 4DVBA 3FKUS 4JO4L 3WNLA 3B2UD 5A2FA 1EFXA 1U8NA 4QXTA 2XQYK 4OF8A 5DJZB 5IHBA 2BZDA 4NJ9L 4J8RB 4NHUA 3CFEA 4L8DB 2NPLX 2DQCL 4XPGL 4OF7A 1AHWB 5BV7L 3D2UD 3MA9H 5HI3C 3BYTA 5BCAA 1CFVL 3O6KL 1JTOA 1WFNA 1KCUL 4Y2DD 5H94B 5DRNB 4DCQA 3DETC 3RWHB 1HNGA 3A6CL 1I8IA 1IM9D 1D5BA 3DIFA 4TQEH 5ID0B 1OF2A 5DMYA 3IFLL 1UACL 3O8XD 1MCPH 3EYVB 4WNQA 4X7CC 3KR3H 1NL0L 4PJGE 5EBLB 4QRUA 4OM1H 1WAAF 1UADC 4ORZC 2GQHA 2NXZB 4Y19A 2W0FA 5DRZB 5DJYA 2R69H 2FJHB 1NCCL 5I1HL 1YN7B 4M02A 2G5BA 4P4KB 4P9HH 3R06A 3VFOA 4LEOA 1BVLB 4XNZB 4PG2C 4ENEC 3ZL4L 2FSEA 3VXTA 2IBZX 4PB0H 4Z7VA 3FT4A 4KJPD 1UH3A 2P7TB 1HQRA 5HHPA 1C5BL 1KXTB 3U48A 1Q9LA 3OR6B 4G8IB 2GYSA 4HBQA 6FABL 1BZ9A 3TO2A 5L0QB 1CFBA 3O2WH 1D5IL 5C6PB 1KIPB 3P9MA 1IL1A 4GKNB 3DRTB 5IBLC 4YDIH 2NY6B 3TBYB 2PCPB 5AAWA 3QNXB 5BS0B 4ZYKA 1PKQE 4K3GA 4XBPA 3RVTD 2RAMA 4QXUH 4U1SA 2OP4H 3W11C 3ULVF 3GIVA 4G6JH 5JORA 3KLHC 3HG1A 4U7SA 4JFXA 3HG1B 4OZGF 5EA0L 1U8IA 5A16A 3MXWH 4R90L 4GW5A 1FAIL 1VFAA 4UAOB 5TH2B 3T2PA 4UZGA 5EWIL 1Y6NR 1CXKA 3BH8A 4HK0A 2AK4B 2O26U 4JFYB 3PL6B 3REVA 4LEXH 1I1AB 2Q8AH 3GSNA 1E28A 1A9EB 2RCSH 5FYJH 2F5AL 3R0NA 3MGOA 1JPST 3D9AH 2YD2A 4V1DA 4NRYB 4UTBL 3PHQA 4CVWA 1T04A 1U92B 4MXQC 5I18L 3WFDL 2L7UA 3I84A 5EOQL 1ZHNB 2EC9U 3DVNA 4M7KL 1TVDA 1VACB 1XH3B 2OZ4H 2F8VA 2WWKT 4YDLB 5EOCJ 4XNYL 2R2EB 4P23B 4M62L 1OWWA 1UXWA 3S35L 4OFYD 4R4ND 1X5KA 4OJFH 4Y4HA 2CIIB 1KJ2H 1TCRA 4YHZL 4K7PL 3L95A 5IHZA 2H2SD 3RHWK 4ZDHA 3ROLA 5FA4A 4GXVL 3TA3D 3Q3GB 4PTUA 4GMSL 2F53E 2VNCA 3KDMB 5FKPB 5HHMB 4U1MA 4JFEE 3GMOA 3MRMA 3DARA 2BDNH 3G6JB 4ONHA 1AE6L 3ARDA 1C08B 3BD3A 3MFGB 3QQNA 2FBOJ 3UP1A 1IC7L 3EGSB 3BVNB 5IMMA 5D6CB 4EIGB 1A6WH 1GGTA 2E7LA 3H7LA 1HIML 4QXGL 4K3EL 2HT3D 1U8OA 1B9ZA 3MRRA 4MQ7B 5IKCB 5ACZB 3CIQA 3WFCH 2YHGA 3WO4B 4WFHE 2DQEH 5EORH 4PYGA 1ND0B 2NXZC 4K3JH 5E6IB 3UJJL 4KH2A 3NA9L 3T1WA 3OGCB 3I75B 4U33A 3NIGF 3STBA 4PJBB 4PLJD 3L9RA 2XRAH 4EDWH 3C6SB 2WSKA 3MJ7B 3NZ8B 5B8CC 1MHEA 4XP1H 1EEUA 5DVOA 3R1GL 4ZXBA 4X4XA 2DYPA 4TPRL 2AJUH 1IC4L 4R7DB 1B88A 4EI6B 1JE6A 5T1KA 4DW2L 1Q1JL 1J18A 4KKNA 1H3PH 4POUB 5FF6A 2K7QA 4GSDH 4QKXB 3DBXA 3CFIC 4EVNA 2OR7A 3OKEB 4YBHA 4AMKL 2P42B 4JN1L 1JCKA 3RTQD 2W65A 4X5XB 4PGBA 1KG0A 4V1DB 3H9SA 1M71B 4JM2C 2JJUA 1AXIB 5I71B 5ICXB 5MEPB 2NY1B 3B9KC 3OKLA 5IVXE 1KEGL 3PL6A 3P73B 1IJ9A 5BZDA 4LOUC 1CD1B 3CSPA 4HJ0D 3MLWH 5DVLA 5F7NC 3KPLA 1BBJA 1YEIH 3ILQC 1QLFA 1RZKH 4EQ3A 4L4TD 5H2BB 4HWZB 5DRXA 2K1MA 2H6PB 4XAWH 5KJRH 1ZTXL 4ALAH 4KKCC 1QFPA 4R7NA 3GJFA 4LDEB 4JDTL 5KVDH 3QIBC 3OZ9L 5ISZA 2I9LA 1HCFX 2HTKC 2W1NA 1AIFB 2OJEB 2PW2A 3UBXI 2DICA 3PDOB 4Z7WF 3ULVE 4A6YH 2GJ6A 3P4MA 5C07B 1G0XA 5IJKA 2EXWC 1U8HB 1Z3GH 4X5WB 3S9DB 5CWSA 3ZDYF 2AEPH 5HHOA 3TLRA 3FQUA 3R0MA 2HFGL 5IR1B 3QXAA 4Y88A 5A1AA 3X14A 5HHNA 3MOAL 1BFTA 2NXYD 3F7YA 3LHPH 4XNUH 3WIFA 3RWCA 5T3XE 5IP4A 3QDGA 4Z7OF 3T1FB 3RNQB 1CD8A 4L4VB 4NWUL 4OGXL 5E95B 3QULB 1UYWH 1HYSD 1KGCE 3VXMB 5FYKH 5K33A 3T0EB 3GSWB 1FE8H 3H9SE 2FZ3B 4H88L 4UV7L 3B83A 4MMZC 5CJXA 3W0WE 2VL5B 4HJGB 4K07A 1OGAB 4UDUA 1AD9B 3TJEH 2FGZA 3GJFB 3C8HA 3LKPB 4R7NB 1X4XA 5DRXB 4QTHB 3IXTB 3LQAL 3I6KB 1FNHA 4LCWB 4XAKE 1P4IL 3ARFA 2LU4A 1E4KA 3HMWL 4OZ4A 1RJLB 4MD4A 1IGYA 3N50A 1JHKH 3SDYH 1J1PL 3AXLA 5BVJB 3DSFL 1IKFL 3QI9B 2AEIT 1GGCH 1T4KB 5FDYA 4M1DL 2YPVH 4M6AA 3VXSE 2PETA 3OKEA 5CEYB 4RX4D 1S7TA 1U8NB 1PG7H 4XNQA 1L6ZA 4L8CA 4YHPB 5HJ3B 5DYOA 5HDQH 2AXGB 1DL7L 3KXFB 1XR8A 4P2OA 1UCBH 1UKQA 4PRIE 5JOEA 4MAUH 3WFBL 3CFBB 2WP3O 3CLEL 5AG8A 3RBSA 3HI5L 3CJJA 4GT7A 4DKFL 3ZE2F 3UAJC 5DD6B 4R3SB 4JFEA 1YJDL 4F7TA 4OF6A 5JW4Q 5MHSD 3D6GA 4HC1A 5CEYA 3C09B 3TZVB 4B53A 4YEEA 3LSOA 4U6HA 3INUL 5L2KB 3IXAA 1R3LB 1KOAA 2VXTH 4NQEB 5AD0A 1QO3B 4LKXB 1REIA 4JFDE 4OZ4B 2YBRB 2DQHL 2ZUSA 2VR4A 4J6RH 3SDXF 3OB0K 4L4TE 5D5MA 1NC4B 4RGNB 43CAB 1QLEH 4KY1L 1OM3H 4PRHB 2ZG1A 43CAA 3ARXA 5GISH 4CMMB 3QIBD 5IUSA 2H26A 2I9TB 3HLAB 3IDMB 1Q9OB 5DLMH 1IEBB 1NCAH 3L7FB 2OYPA 1RFDH 3KHOA 1NFIB 4ODXB 1P4BH 2WW8A 1A6UL 2P8LA 4LSVL 4WI8A 4YFDB 1MIMH 1JNJA 1QRNB 4Y19D 5DEFA 3U4EB 4NCC2 5EC1A 2VZOA 2P48B 1RJZA 1JPGB 1MFAL 1SEBB 3H0TA 4LHUD 5IK3A 1XGYH 1A6ZB 5B4MD 3ZE1F 1VESA 2R29H 1KJMA 4RBPK 1XGTB 1VPOL 3NFSL 2BHUA 3S88H 3MA7A 4HUVA 5MHSE 1WC7B 2O5ZH 4RGNC 1P6FA 9CGTA 1YNLL 1YN6A 3CUPA 3NH7H 1O0VA 3KXFA 3QCVH 4P2OB 1B0GB 4Z5RA 5SWZA 5J6GB 2GTWB 2YN5A 3ZDYE 3FTGB 5KAQF 1TZHA 2EYTB 4H5SA 1KENH 4K2UL 3O2VL 1CICD 2PYEB 4FFYL 2RCSL 3S37L 2A83B 4N9GA 2J1KA 3JZ7A 1HYSC 2CK2A 3O4OC 1NGWA 4X6CF 4Q6IA 1IEAA 1N6QL 4HC1L 1HILB 2VRAA 3C09C 1MLBB 5CZXD 3TZVC 1U8QB 5JHDE 3WUWG 3GZKA 3LY6A 4N8CL 3SO5A 2AXHA 4Y5VB 2CDGA 4YGAB 3I6KA 1VB9A 2E7CA 1S9XA 2DQFB 4X0KA 2NY4C 4XC1H 5E7FA 1G1CA 4OLYL 3PGCB 2V2XA 2AVGA 3WFZA 5I6XB 3V7AE 5C0FA 5IFJA 3CK0H 4LHJB 4NP4L 3IF1B 5D7IB 5IGXH 2YEZA 1SY6L 2I60H 4XXDB 4EIZC 1GIGL 2P7TA 3LRHA 4DUWA 5I2IA 5JNYA 2ICWB 4R7DA 1CVSC 4ZAKC 2FBJL 2F5BL 2JK5B 3ARED 3MBEA 4IDLA 4LEOB 2LAGB 5IB5A 1WUNT 4L4VA 4HKJA 3HZVB 4R0LA 3BD5A 5B3NA 1LWRA 4W4OA 1AFVH 5CSGA 3MV9B 2NYYD 3IGAA 5C71A 3IETA 3PP3K 1LO2H 5JOFA 5DHYB 4LAQH 1KIQA 1QG3A 4DVRL 4XMLH 2Z35B 5FGCE 3MBXH 3FCTA 4JFFD 3MRRB 2VLKB 4MQ7A 3QAZB 1UENA 1LEKB 1KN2L 1HNFA 2Q1EA 1S7UA 4M61B 5J7CC 3VFNB 4H8WL 2WWKO 2GT9B 5E03A 3PHOA 4LDOB 5FHBL 1OAZL 3BVNA 1S7VB 1GHFH 2R4RL 3O3DA 4K3JL 4PV9B 4YAQB 5D71H 5DSCB 1T0NB 4RA0C 3L7EB 1K9TA 1YUHB 4JPIB 3B9KD 1IAIH 1YEJH 3HC3H 2CXKA 1IGIH 1BM3L 2ERJC 1IEHA 1OD9A 5FKPA 4HX1B 4M7ZB 5CGMA 3NZHH 3T09A 4O4YL 1QBAA 4TOYL 4NM4L 4G8GA 1HINL 1FJ1A 3VWKB 3DX6B 3CFKB 4NGHH 4OZGB 4P23C 2AJXL 1S3KH 3WHE0 4RSVA 4M8QA 3ARVA 3C8DA 4F15B 5CLWA 2IBZY 4P23A 3QG7L 1XZ0B 3THML 3U4BH 4OT1L 4AEHH 1G7JB 1XGPA 3MJ9H 1X5IA 3WLBB 2J5LB 5DO2D 3LSOB 4IIQA 2DQIH 4X8JA 2VZ1A 1QHOA 2Z31A 3PWVA 2ADGA 4YR6B 4F57L 2VDPH 3ZKNC 3FB7B 3PXJA 1QQDB 1O5DT 3N85H 3NGBC 1U8LA 3PL6C 4OCRH 5SX5K 3PHQB 3VMNA 4QXWA 2VDRH 3TO4A 4N5EC 3TC9A 4F15C 3L9RB 1OTSD 3ABZA 4M8QB 2X4TB 3MJ6A 5JMOC 1K2DA 3GMQA 4FQIL 4XPFL 4HUKB 2X41A 4XZUA 2YWYA 3LZFH 3VWKC 4GG6B 2V7NB 4U1GB 1T3FA 3BZFB 2ITDA 5JZ7C 1BD2E 3RPKA 1A3RL 2IPTL 4UIKH 1UACH 1U8OB 4JCMA 3H3PL 3HRZA 3QI9A 2X7LB 3BP4A 5D2LA 5L9DL 4PG9A 3GSQB 4QRTB 5DA0B 3JBG7 4XB8A 5F9OH 1RY7B 2AEPL 1UJ3C 4RFNB 5KSAD 2EEAA 4NJAL 5I9QB 2R69L 4JPWH 2XTJC 5BMFH 1NCCH 1U95B 1MHHB 3C5ZC 1FZOA 4KI5D 4P9HL 2CLVA 1GXEA 1R3KA 3CD4A 3MRMB 2OSLA 3QEQE 5IOPA 3MYJB 3QT2A 2HFEB 1A7NH 2NTFB 4U6XB 1T22A 2MFNA 3WFEL 1KEML 5CS7A 3ETBF 3WDJA 5GJTH 2W60B 1T5WB 4R4FL 3QUXD 1P4LB 1KPUA 1SBSH 4JY5H 4KI5E 4LPTA 4XVTH 2F9BT 4JY4A 1T7XA 3H8NA 1KPUB 1T7VA 3RAJL 2A2QT 3BUYB 3EYFA 5KVFL 5TQ2L 4NZTL 1HEZB 5IQ7H 4JJHA 4PJCE 5D1QB 1WFUA 3T2NH 1FNGB 1CFSA 1FZJB 4DQOL 3RL2A 1S9KC 2YKLH 1YMMD 5IM7B 5LWYH 1OAKH 1S7SA 3IU3A 5EA0H 1FVDB 3GSNB 2J6EH 3MXWL 4R90H 5DRNA 3N1GC 1RI8A 1U3JA 2W92A 3BH8B 4HK0B 4NFCA 3QI9C 5DVMA 3BN3B 3EDEA 4WUUE 4AEIL 3QDMD 4TNVK 2X4PA 1BAFL 2A77L 4U1IA 5J57B 1BWMA 1O7VA 2VO5A 1M7IA 2X4SB 5K9OA 4PJFE 4DKFH 4E41E 4MJIB 4ODSH 2EYSB 2MOVA 3GMQB 3VFUA 1HN1A 2SEBB 4FTVE 5D2NB 5DZLA 3MXVH 3RFZC 5IK3B 3EUUA 3AREA 3WIHL 1YEFL 3O2DH 1A6VL 1Z5LB 1BLNA 3BWAB 3BN9D 1WAAE 4Y16C 2NZ9D 2EDTA 4MD0B 3WJLA 5I8KH 3QCTH 5A2IH 5I1GL 1FZKB 3MNVB 5DHXB 1ZT1B 2D7TH 4AIXA 4KRPC 1P7KB 1CICC 1AGDB 1A1MA 4RAHA 3G08A 3VD3A 3RU8H 3BT2H 1MWAB 4Q2ZA 43C9A 2R56L 3L3KB 5I8OH 1NSNH 1RFDL 1Z9SA 3TA3B 4YDKH 4GKSB 4KDTC 4Z7UF 1OGTA 3VFVA 5JPNA 5ACZA 3CX2A 3QR2A 4O5LH 1ZXQA 5F7LB 1NPUA 2GJ6E 3GB7A 1LEGA 4MJID 1U8JA 3UCRA 4RIRB 1Q94B 4HWBL 2LVEA 5HGAA 3UJJH 1QKZL 3DROB 1AQDB 3GJEB 4NRXA 3EJYD 4GG8B 5CIPH 5D8JH 1AHWA 3RKDD 4Z77B 2Q87A 2XRAL 4NNYB 5F9WB 3P2TA 1VPOH 3NFSH 2YUVA 5LKNA 1A2YB 1MCBA 3BOVA 3SJVB 4Z7OE 3E6FB 4P3CH 4PJ7A 3ORJA 4JO1H 4DZBB 1H5BB 4NO5B 1Q1JH 2F53B 5E5UB 4DJMA 5C0ND 1D9KD 4JFEB 2XA8L 5IWLA 3EOTL 1F6AA 1XIWD 3QUYC 4RMVA 5FUCC 4DK6A 3L5IA 1TCRB 1ZLVK 2QQKL 2XWBB 4LVOC 5IB5B 4FFYH 3S37H 3G5VA 4GRLA 3DUUA 3GO1H 3VWJB 1OLZA 5KTEH 1ACYH 5F7DA 4TVSa 2R39A 2D7PA 2B1HH 2EECA 4GUPB 4E42A 5DFTA 3HE6B 2AXGA 5D7LB 5I17B 2V17H 4XCCH 3B2VL 1V7ML 3GBNH 4M1GH 3RIFK 5B8CB 4PJHA 3TIEB 4CADA 2P5EA 5C0DA 2A9NL 3PWPD 3UDWC 1S9XB 2YZ8A 1NGQH 1P7QD 5E8PB 1DSFL 3HNVH 4OLUH 2I07B 4LF3A 2NY7L 4Y5VA 3GI9H 3CVHB 2ADFL 3O41A 5E7BA 2FYYB 3IFPA 2DQUL 4ODBD 3MRKA 5F7EL 3TBWB 3ALPA 5GGUA 5FUZH 4ZTPL 4LCWA 4N0UB 4N90D 1G7LA 3V7MA 5D1XD 2C3WA 35C8H 1HWHB 3WS6C 2GITA 4O00A 5IHLB 3H9HB 3V4UH 3MLZL 1I9JH 1XF4A 4RA3A 1YQ2A 3LEXB 1RZ8A 2G75B 5F89B 3FO1B 4NQCB 3WS3B 2HFGH 1YYML 4DKAA 4AM0B 5J1AB 1DBBL 5IVXB 4JVPA 1F4YH 2MQ3A 3IKKA 3SKMA 2YRPA 4NPYB 4RWYH 5E2UH 3QDGB 4KVNH 1EXUB 3E1F1 5L6YH 2CLZA 4LLDA 1S78D 3CXDL 4BJLA 5CD5C 1LO5B 5EG6C 5DR5L 1FE8L 1I1CA 3FQUB 1UGNA 1FYTE 4GRLD 2VXUL 3W2DH 3OF6A 3T8XB 4QT5A 5F6IC 3IFOB 4MXWL 3NACL 1J5OL 1CVRA 5I8EB 2IADB 4PGEB 3AU1B 5FYLL 3O3BA 2VQUA 1KCUH 3PV7A 3S96B 1BFSA 1QVOA 1J9CT 2EO9A 3N06B 2F8OA 2Z8RA 2R2HA 4KK6C 1TPXC 4Q0XH 15C8H 2FATH 3DSFH 3A67H 4JFDA 3FB6A 4OLVL 4Y4FB 5JW5A 1LE9B 1E4WH 5EBMA 2BNRE 3S36H 1HHHA 2VLRA 4KKAD 3O45A 5IW1A 2DDQL 1V8HA 3OB0H 4JM2D 4QY8A 5H94A 3STLB 3NPSC 4HK3N 3QWQB 3PWJB 4EN3A 5EUOB 4S1DC 1NGXA 1YYLH 4KKBD 4M48H 3ZYOA 3N9GL 1DQDH 4EN3D 1JPSL 2EDNA 4Q58C 3MLYH 1MHCB 1DQTA 3H9SB 4YHNA 3ARUA 4XI5D 4U6HB 2XT1B 2ADIA 3CVHL 1UZ6E 2LU3A 2FX8L 4FQCH 1NBZA 5DD6A 1D5IH 5E8EA 2ENSA 5JQ6H 4AH2B 1OP3H 1R3IH 2HN7A 3HNSL 4NQVB 4DKDC 5IQ9A 5ESVA 2ICWI 2VDML 1BJMA 4LVOB 4FZEH 2XQBH 2R2BB 3MV9D 1MFCL 3NABH 1VADA 1RK1A 1K5NA 3LKNA 5GS2D 1N8ZA 3UTZB 4ZFGH 4PRAB 3R8QA 4TUOA 2AV7A 5C0GB 3Q1SH 4ZS7H 3ARGA 2YXMA 4H25A 4WEUD 2JB6B 4MS8D 3VFGH 3VI3E 5M94B 5H37G 1RULL 4BSJA 3FQXB 3LEVH 5DD5L 4I3SL 4ZFFA 4NWTH 4PJEF 2AXJA 1CICA 4DUVA 1IGYB 1YEKH 4P2RE 2FB4L 2X4OB 3EW3B 3EIFA 1K3IA 2VABB 3K7UA 4GRWB 2QSQA 3IXTA 3OHXA 4U49A 5I9QC 1CCZA 2OLDA 2G9HA 2AKRA 1MRDH 2IGFL 1MIML 2WZPD 5I16A 2V9QA 3JWNC 4ZMAT 1BEYH 4IRSC 1K8IA 2OZ4L 3K8LA 4ZDHB 3TVMD 4ZUVA 3PWPB 4NQEE 1U42A 4CVUA 2CUMA 1YEEL 5TF1H 1NEZA 4JM4L 4XTRC 3UTSA 1FH5L 1UWEH 4MJ5A 4U7KA 4HPOH 1KCVH 4GG8A 3RWIA 4HGMA 1QFUH 1HKLH 3PG2A 5C08B 3PF2A 4L4TB 4XCEA 4KXZI 2IAMD 2O61A 4NN7B 1I85A 2PTUA 1NGZB 4N9OB 1U8HA 4X5WA 4H20L 2CPCA 1AE6H 5FXCH 1YPZE 4HG4K 2OJZH 4WEBH 1MWAH 1MAKA 1YDPB 1H15A 5IIEB 3VGHA 4G42B 3L3KA 1AGBA 1WTGT 1VGEL 1A6WL 4P46D 3AS0A 1CXIA 2GAZB 3FT3B 4YDVB 2BVQA 3B6SA 1OAQH 4LRNH 5DMGC 2BNQE 5HSFA 5GHWL 1VFAB 2IC2A 4TULH 5A16B 4BQ9A 3LS5L 4G9FA 2H6PA 3V79C 1CDJA 4QHUA 2V2TB 2E9BA 3HCVB 4FRWA 3AREB 4ZYKB 2V7HA 3DJ9A 3MRBA 3T65A 5D2NA 4NPYA 5TE4L 3RRQA 3ULUL 4X80H 1WJ3A 4OKVA 5IVXA 3EJYC 4TNVF 4OZIA 3RGVA 4PGBB 3MLSH 1K4DA 2VDLH 3F8UB 4PYHA 3W9EA 5T3XD 3DV6B 1QA9B 8FABB 1KC5H 2H3NA 4CRPA 4W81A 1UWXH 4PBVC 1LO3L 3Q5YA 4M4RA 1BECA 2WIIA 2D9QB 1X4ZA 4JN2B 3MBXL 4P2YA 4OFDA 1ZLWK 3EO1A 4DGVH 3RUGA 4F37K 3QHZL 3O3EB 3I75A 2QSCL 3GKZA 4LF3B 4APQB 1LO0L 4DTGH 3OKOA 1AGFB 1KFAL 3EYVA 4ZAKB 3RL2B 5KSUB 1I9RL 4UQ2A 3DECA 1FNGA 4Y5YC 3OZ9H 1NGZA 5D1ZA 1C5DA 5BQ7B 1P9MA 4JO1L 4P5MA 4XCEB 5ILTH 4PJGB 4UQ3B 3L3DA 3LMJL 3PDGA 2XFXB 4HJJH 4LQ1A 2DTML 1W72B 3ARZA 4KZDL 1ZOXA 2C1PA 3QG6B 4FQ1L 4TRPH 1UC6A 5JXEA 1F8TH 3EDJA 1P4LA 5F1KC 4ONOA 3EOBA 4GW1A 1Z3GL 5EIIA 1A6TA 5FK9A 4JQXA 5I1EL 3I50L 4OAWA 2F53A 1XGRA 3ZO0A 3SKOB 4LVNB 3U6RB 3FZUC 5EIIB 4P5TC 2H1PH 32C2A 4BZ1L 4KKLC 3MOBH 3BRGC 2CIIA 1TQCB 4RMTA 5E0QA 1U6AL 3FQRA 4Y4HB 5MEND 4FQXB 1DN2A 1Q0YL 4WI3A 2CGRH 3VE0A 5C09B 1NGQL 3G6AA 1F97A 4H88H 1VERA 4UV7H 3RWFB 1IM9A 2XTJB 5B3JF 4MNQE 3QO1A 2J8HA 1PKQB 1FSKB 1WT5C 2EIEA 3WDHA 4ZAKA 4HIEB 4LCIH 1WCQA 4GKSA 2OTUA 3K81A 1TFHA 3OKOB 4LARH 4XNMA 2D7MA 3BQUB 4FN0A 1MUJB 5DRWA 3X11A 4UT6L 5T3ZL 5HYFA 1I1AA 3AREC 3SGKA 2DB8A 5GZOC 5F9OL 1MH5B 4E0RB 3QUXB 4MA8H 1RURL 2BY1A 4X9FA 1E27B 1MCOL 2CKNA 5DRWB 3FQNB 4J12A 5IQ9B 2JKXA 4UOJA 5DFVC 5F8RC 4MD0A 5C08D 1ORQB 5JORB 5E99H 3S34L 3JUZA 1M7DB 3BWAA 4DN4H 3RWGA 4KTEL 3RZCB 1YMMA 3MZGB 1G6VK 4K94L 1U93A 4MAUL 3BDBA 1CTNA 4ZNEE 1KCRL 5HGDB 1WAAA 2BJML 1A9BA 2X1XR 2EICA 4YWGL 3OJDB 1SBSL 1IZJA 2GI7A 1UH4A 4MXWH 4BQ6A 4FQHB 3T65B 3NACH 2PTVA 3D48R 3TESA 4LKCA 1YJDH 2RIKA 2DLEA 2BMKB 4F7CA 2VDNL 3GDBA 3SCMD 1CL7L 3V0AC 4HW6A 4XCYB 3QI9D 1EPFA 4LLVA 5FO7A 3VG0L 1U2HA 4XNZC 4TUKH 4LSTH 3JVGA 1YA5A 2ZCLH 4LOUD 4HGWA 5BOZG 4X7SL 5FUCE 2YC1A 4GW1B 3KHQA 3PNWB 4G6MH 4OLVH 2VXVH 3SHSA 3D39D 2BVQB 5DJYB 3T3ME 2BVUA 4U7MA 4KPHL 5JHLL 1FFOB 1D6EB 2YUZA 3MLVL 1NAMB 4LNRA 1DUZA 3TO4D 5CJ8A 3MROA 3RGHA 4QRUB 4RX4A 4GXUN 1LEKA 4JRXB 2B5IC 3MR9A 4Y8AA 4PJXE 4YEFA 2ZSVB 4ZUUB 3E8UL 3BMWA 1KIQB 3MTRA 4LPUA 2ADJA 1AR2A 3IETB 3NPZB 1ED3B 3CVHH 4JRXD 3IU4H 1P4BL 5HI4C 4OLWL 1TVHA 4MVBD 5HI5C 5I66A 4APQC 3CX5K 4MWFB 3QFDB 3HNSH 1NEZB 1TETL 3GJFK 5BRZD 4X98B 3PWPA 1YZZA 2EXYC 3HI1A 4L1HA 4P4RB 3O6ML 4JRYE 1U8MA 4PJDF 2YEZB 2YPKB 4JO2H 4CDHA 4L3EE 3NABL 3K1KC 1VHPA 2XN9D 5EZJB 4BH8A 3F62A 5DWUL 4YBQC 1A3LH 4CNIA 5I15H 4X6EA 2DQGH 5JOPE 3T2QA 3D18A 2EDOA 3GBLA 4OF0A 5C0CE 4N0UA 4UT9H 4TSCH 2NY2C 3O0RH 5CEZE 5JHDA 1UZ6F 5KVMC 4RFNC 2OM5A 4NZUH 2AJ3B 3BKCL 4ZO9A 4KI5C 4FQLH 3TA3C 4GMTL 1KENL 3BT2L 4K2UH 4IRZL 2BERA 5IVXF 3BP4B 3OL2A 2R56H 2HJKA 2FEDC 3FQXA 5CSZB 4NQCD 3OQ3B 1N6UA 1FL3A 1BZQK 4H26A 4MA3A 4PJFB 1HZHH 1ACZA 3FQWB 3GBML 4MJIE 1MRDL 3SDXA 1JWUB 3D85B 4L1DA 4O51A 2GSGA 5C0AE 2CXGA 3FT3A 5F3BB 4EUPH 3EFFA 3PP4H 1KPRB 4OSUL 5B39G 4XC1L 1UM6L 4OZHE 4PJDB 2J88H 3QJFA 1FSKC 1PKQA 2EIDA 1TZIA 3KLAA 5HI5D 5C07E 5CCKH 3IYLW 3S4SG 1WK0A 1GJIA 4PP2B 3UZVB 4AQ1B 1ZGLP 4YC2C 3LD8C 3OR7A 2DM2A 1ZLUK 1WIOA 4BFIB 1G9NH 4G3YL 2EO1A 3K2UH 1BOGB 1HCVA 1MCSA 1MWAL 2DJ4A 3DVIA 1KTLB 1XGUB 3K1DA 4O2FB 4YX2H 2Y6SD 1RZKC 1U8JB 2VDKH 4ODWB 2AEQL 4D9QE 1XMWA 1EO8L 3VCLB 1EAJA 2R2CA 2YD9A 4MQXC 2NY1D 3W5MA 3G5YA 1AD0A 3LS5H 4XWOD 4Z0BH 1LNUA 4U1HA 5DUPL 4AG4L 1DSFH 5IEHB 2ADFH 3LQZA 3DXAA 5TQ0H 5EUKB 4O9HL 5EBGA 2IADA 4JG0H 3SJVE 5JIPA 5CMAA 4UQ2B 4RRPG 1G9MH 5IB2A 4X80L 3QFJD 4L5FL 1CGTA 3FO2B 4LPVA 4O4YH 5DHVA 4DGYH 1WSST 4WEMB 1VADB 1XCQB 2R23A 3ARWA 3P4NA 3RGVC 2GIYA 1EXUA 4FG6C 4PGZA 5E4IA 5C9JB 3IDUA 1GGIL 3P11L 3DYOA 2B8OT 4OQTL 5FYJE 4CDGC 3KXFE 4YO0B 1OSZA 4K55A 1HI6A 3MJ9L 3TNNA 3D18B 5JNYB 4KVNL 5EOTA 1JYNA 4HD9A 4RGND 5EOCH 1Z0MA 3GGWB 1CL7I 1P2CB 1V3KA 1ITBB 5T5NG 2Y9RT 4X98A 1H0DA 2Y72A 1OAYH 4M5ZL 1MHCA 3FZUD 2DQFA 5E08L 1LVEA 4FQIH 2XYCA 4Y2DA 3IJSA 2GJZA 4PJAA 4IMLB 4AT6B 4Y4KD 1EX0A 3TPKA 1X44A 5L2KD 5EZLB 2G2RA 5IFHH 2AJVH 1C12A 4KZDH 3QUXC 3NPSB 4WW2C 4X5LA 3O4LB 4KMTL 1AC6A 1AXSB 5DD0H 3ARYA 1MELA 5GSRB 2BC4A 4CUCA 3F6IA 3RVWD 1D3CA 3M8OL 1TPXB 4G43B 4JPWL 4RQQA 4HF5H 3ULUC 3D39E 1EMTL 2FWOB 5T5NF 3QXWA 2YN3A 5D1ZD 5IF0A 2J8UE 3FO0H 2N7BA 1JPSH 3SDCA 1T5WA 1OD7A 1QSEB 1U6AH 2MPAH 4LLMA 1F6AB 1RK0B 1U9KA 2FEEL 4YHML 3V6FB 3WFEH 4NN7C 1YEGH 1A6AB 1F3DH 4N68A 3VMPA 4L4TA 5D5ME 1R3JA 5EC1B 2FX8H 4FQCL 3BKML 1KCSL 2VISB 4UILH 3VD4A 4CVXA 3MACL 5AZ2H 1AO7E 5T1LB 3W0WD 2VDMH 3VD7A 2J12B 3ZKXB 2ZUYA 4JM2B 5FO9A 1CK0H 4PP2A 1ZLUH 1DBKL 3MV8D 3WKML 3VGFA 4ZUVB 3QCUH 5L8JB 3GRWA 5CIPB 1EHAA 2X1OA 1AP2A 1TZIB 3KLAB 4YXLL 5CD5D 1RURH 2YKLL 5T1DL 3RJDA 3ZT6A 2H2PD 2F54B 1CDUA 4WV1B 5B21A 4GG6A 5J0BA 1SYSA 4WHYG 4KTYA 3U83A 1DFBL 3BPNB 1IAKB 4M6OL 2Y06H 1YEKL 2AJYL 4HBCL 3G6DL 4PJ7F 1BP3B 5T3ZD 5J8OA 4V1DD 1BQHA 5KS9F 5D96C 5BRZE 1WWWX 4OCLC 5C0DB 4HV8B 5DI8B 2APVA 4YWGH 5D7JA 2NLJB 3EKCA 5I71C 4NSKA 1N3NA 1F5WA 5KZCB 2VDNH 4MJ2A 2VXQL 4PP1C 3VG0H 1EHLH 1NANH 3MRDA 2BFVL 3BWUC 4M5YH 1NCNA 3NCEB 3OXRB 2Y7QB 4LSTL 2ZCLL 1N0XH 3MJ7A 3DMMA 1H3VA 3MODH 1PLGH 1V7NH 1OPGL 4BH7B 2DD8H 5DJAA 4I13B 3B3IA 1NBZB 1VSCA 2Y23A 2NTSP 1U8MB 1H5BA 3MV9E 1QTYT 1PZ5A 4LK4A 2DAVA 2AK1H 1T89C 4XRCA 2WWMC 3QNYA 5T3XH 4U1IB 5HVHC 2X9XA 1CGSL 6CGTA 4RISH 3U7YH 4NN6C 1YUHA 4JPIA 4NO3B 1J88A 2VLLB 4P2RB 5D6CA 4XT1C 3O3DB 2GSIB 4LSQH 3MLTB 2H2PC 2DJUA 4GRWE 2XACC 3RNKA 4FABH 4DK3A 1CTOA 4GAGH 5E5RB 3B9AA 1ZGLA 4KJWD 4N0RA 5EU3A 2HJFB 1IAOA 2MKLC 1MAML 2M26A 5JIIA 5T1LD 1D9KA 5EO9B 2APBA 5ERWB 1MIEL 4X6CB 5HPMA 3IGAB 4JZJB 2VKWA 3O8XC 2BY2A 4FHBD 1T5XB 2KZWA 1I7TA 1UEMA 4ONFL 5DWUH 4YPGA 4PJ5B 2F58H 2PO6D 4EUPB 1WBZB 4P2QB 1I3VA 1P6AB 4KJQC 5C08E 4WW2B 2EC9T 4ZO6A 5FOBA 2W91A 5HHOB 4HT1L 4O58H 1T22B 5DA4A 4ORGA 3N0PB 1QA9A 8FABA 2H9GB 1XAUA 1LO3H 2EDRA 4IRZH 3EO9L 3EO0A 1RUMH 4M4PA 2G60H 2P5WD 1OTUC 5E2WH 5KTEL 1NEUA 3RUGE 1ACYL 1OARH 1A9BB 4IRSD 4YH6A 3L3IB 3PUCA 5TF0A 4LSPH 4AM0A 1R5VA 4XTRD 3QDGD 3K2MC 4I2XA 3UXFA 1RZGB 1RZ7L 1JWSB 3QUZD 3B2VH 1T2JA 3RZCA 1RUPH 5GJSH 4FTVD 3U2SA 3OG4B 4KVCL 4X7TB 5L88H 2X7LA 3CMGA 3C60D 1SEQL 2CH8A 2GITB 4UAOC 1UM6H 2H32H 1G7LB 2A73A 3JSSA 4X7TA 4MNQD 3UC0H 3VRJB 5IT2H 4Z8FL 2DQUH 1BQUA 5C0BD 2J8OA 4FZ8H 2DTSA 4WFED 4D8PA 4GQ9H 4P3WA 3JV4A 5IBTH 1HK6A 3IU3B 4JQIL 4FQ1H 1FL5B 2KPNA 1IE5A 1PG7W 4X5XA 1XF1A 3KYMB 1GZPB 3RIAF 3ARBB 4G5ZH 4U0RC 4D9LL 3BP5B 3CDCA 2DQDL 1K4CA 3UTOA 2NW3B 3RIAK 5FGSA 5C08A 3UROR 4W70A 4GUPA 2N7AA 3RWIB 4N1CA 2QQNH 3CSYB 4LP5A 3WJLC 4FOMA 3VWJA 3FO9A 2HMIC 1AHWC 3R06B 3AAZB 3TT3H 5F21B 2P1YA 3WEXB 1I8MB 4M1CD 2VC2L 2HFTA 3BW9A 1NCBH 2Z0BA 2VLJB 1IGJA 2AJSH 3FFCE 1ND0A 3W2DL 2EDBA 2NTFA 3LS4H 2F8XC 4X8XA 1ZHBB 4JFED 5CILL 1AC0A 3GEWB 2Z9TA 1HHGB 1R3KB 1FFPA 4JG0L 4PJCB 1I9EA 5I76A 4Z77A 5DDHB 5F7KC 1N5YH 4MXVF 5I1LB 4OIBA 3IRZA 3V0VA 5IESL 2FNBA 5MENA 3AY4C 2HJLA 5E2VH 3QXTA 3MMEA 4Q0XL 2DM4A 3GI8H 1CN4A 1MCOH 2BOCB 3HRZB 4XMKL 4BFBD 1MREH 2VDQH 1FYTD 1ZHBA 4NYLB 4E5XA 1S7WB 1JZ3A 4G7VH 2HFFA 1RUAL 4MA7H 3Q5TA 2EDFA 3EYSH 3P0VH 2X70A 3ES6A 4U1JB 2Q8BL 4F3FA 2ZKHL 1I1YB 1ZSDA 4KTEH 4LCUA 3U30C 4OGAD 2R15A 5D2LF 3MNVA 4I0CC 3QISA 1FPTH 5DS8A 4X4YA 4EBQH 1UXWB 1CR9H 3CSYA 4NHCH 4NUGL 5GS0C 3NCBB 5GGSA 1BJ8A 3CZFA 5HXMA 4GLRH 3OKNA 4KUZH 3BRDA 1CLYH 3O6KH 5F71A 2ESVE 5JQ6L 3NGBB 3QH3A 4JZJC 3ZYJA 3KYNA 1C5CH 5D2NC 1Q0XH 5BV7B 1KIRA 2D4DA 2NY2B 4I8DA 5E9DA 2HT4C 4I4WA 1MCPL 3SE8L 2ZOLB 1PGRB 1DBAL 4XVJL 5DUBA 4S1DD 4LIQH 4UT7H 4PRBA 1ZAGA 4V2BA 5ITBH 3MV7E 2CDFA 3HCVA 4QY8B 1UWXK 3OAYH 1IEAB 5EBMB 5DO2C 3GSXB 2BRRH 1FL6A 1ZEAH 3F12A 3B8YA 2EH8L 4LVNC 4LBEA 1KPVA 4JFQA 3KPOB 5EZOL 1EJ6A 3UJTL 3I02B 4KDVA 5E00A 3WIIL 3EYQC 4W6XB 5F7FA 2Y07H 1OOAA 5AYUL 2MPAL 1XF2B 4FP8L 3HPLA 2B4CC 2Y5TA 1MRFH 1T0NA 1B0GA 4Y1AB 3C9NB 5FYLD 5IB4B 4CMHB 4JAMB 1S7SB 3BKJL 2IGFH 3FOLA 3E3QC 3RNQA 5CEXA 2CO7B 4HUWB 1A0QH 4B50A 2JCCB 5IFAL 4AQOA 2EZ0D 2D9CA 1CDBA 1PAMA 1Q9LB 1NMBL 5FOBB 2O61B 4RAUB 2XA3A 4GBXB 1CFNA 3VXOB 1YPZA 1CGWA 3BUYA 5DMIH 3OKDB 1W72H 1UCTA 4G6JL 5CBAA 4TTDD 4G6KH 5T1DH 1YECL 2E6QA 1YN7A 4LPYA 1H5BC 2PYFB 4JY6B 2EC8A 5IBLD 4ODXA 1RHHA 1NMCB 5CJOL 1BF2A 4G43A 3FMGH 2W0FB 3ME0A 3H9SD 3L7FA 1FO0B 5TGBB 1GH7A 2IG2H 4JPVH 4NZUL 4ELKB 4HS3A 3IF1A 1KIUA 4G6AD 4TNWF 1GZQA 4MHHG 1INDL 1T1XA 3TGXA 5I8CB 5D7LE 4LEXL 5DJDA 5JQHC 4I5BA 4HULB 1W0VB 4P5KB 3VXME 5CFHA 3JWOH 4OV5B 5CP7B 4URTB 1G7QB 1NGYA 4NUJA 4R2GB 3W0WB 1EZVX 3BSZL 3MLTA 2HAZA 1G9MC 5BZDB 3K4ZA 4S1RH 4XC3H 2I07A 4TULL 4M93C 2ZOLA 3GHEL 3PP4L 1C8PA 3ARGC 4PRPD 4PRNA 5DJ8B 4HUUB 4JRYB 3RL1B 2JF1A 2OTPA 3TIEA 4QGYA 4TUJA 1LILA 3QRGL 1OPGH 1DEDA 1ETZA 5D1QD 4BZ2L 1EFXB 5C0CB 1K5NB 3LKNB 4DVBB 4Y16D 5I1HH 3MUGA 1QPPA 5DK3A 1TVBA 1MI5A 1UQSB 1LK2B 1UVQB 4GAYB 2YD7A 2Y7QA 3BN9C 2V5MA 4N8VA 4J3SA 1MCKA 1RZJL 3SE3A 1CXEA 4MVBC 1C5BH 3P4NB 2R23B 4F3FB 1KELH 2AQ1A 4PS4L 5HYEA 2QTEA 1D9KC 4F37F 4DN3H 2PO6C 3MNZA 4NO5A 4KC3B 2PNDA 2E9IA 1CF8H 1JHTA 1QOKA 3O81A 5DFWH 3OX8A 5J06A 3EYUH 1ZKAA 3GMNA 2KKQA 2EE2A 5C0AB 5EUKA 3BO8A 5L2JA 3PIQA 4CAGA 3TYFA 3IDIA 2MKWA 5HY9B 4UDTA 3RGVD 1IEBA 1GC1L 2CD0A 4PJDE 1FN4A 3ZHLA 7CGTA 5HVHB 3CFCH 3QUZC 4JEGB 3W9DA 5HVWA 2VZUA 1GOHA 4KKLD 4HX1A 3KVQA 2NW2B 3S98A 4XP1L 5CEZH 3ULUE 4JHWH 5I73B 4L5FH 1GZQB 4UMGA 4ELMF 3RA7H 2JELH 1IQWH 4Z95L 4ELKA 2XZQL 3UJIH 1FV1A 4G6FD 2DTMH 2AABH 3RVUD 3S7GA 2J7LA 4IS6A 1I8MA 3NTCL 2FRGP 1CLZH 4JY6A 2AGJH 4JQVC 3FCTB 3VXOA 4P46A 5DJ6A 5HHNB 5CEZD 4HKZA 2NQCA 3TFKC 3V6OC 1ROWA 5FM5O 3MNZB 3D39A 1P1ZA 2WUCL 5GJSL 4RFOH 5HHMD 4UOW0 4XHJD 4KGLA 2XZAL 1RZKL 1T04B 1U92A 2DS4A 4ZUWA 2SEBA 2R1WB 3UX9B 3QWOA 3WIHA 3T0WA 3ZDXE 1B3JA 4M8VA 2ATKA 5KVDL 2AV1B 3HPLB 5FO8A 2AP2A 3VRJA 4XWGL 1QFWH 3NFPA 4GQ9L 3T2OA 5KW9L 2BDNL 4XNXL 5CP3H 4KMQA 5F93C 5KN5B 4PJ9D 2FDBP 3F12B 1RIUH 3PJSA 2ED7A 3ESVF 2DMCA 2VIRB 5E56A 2DQTH 3OWEA 5EU7C 4ZOEA 4YXKL 5EIQA 4AT6A 2CKBA 2AJ3A 5TE6L 3GMLA 3VH8G 4UIMA 5E6IC 1YEDB 3W0WA 1JFQL 5DUBB 3MO1A 2VIRA 1NGYB 4NUJB 2ICCA 3FT2B 2QQNL 2VQ1B 1M71A 3RVTC 3V4PL 1AI1L 2A83A 3RVUC 4XX1G 1SM3L 2DQEL 1OGAA 4OZFH 4E9LA 3GGWA 4JZNB 4KK9C 4PGDB 3KPMA 1AKJA 3M07A 4JZOA 4Y4FC 4PJHE 2FEEI 2OTWB 3VDBA 2DIBA 2VXSL 1MRCL 2PO6B 1HXYB 3NAAH 3GM8A 4IMKC 2HKFL 1KCSH 5CILH 1A4KB 3QHFH 4P4KA 4QHLA 3VFOB 4I3RL 5CBAB 1I7TB 3MJ8A 4JREC 1RZFL 4JKLA 3JXAA 1KT2A 4YHLH 4CBPA 3VFMB 3KJ6H 2Y5EA 3DRQB 4Z7QE 1HOCA 4LLQA 2DLHA 2FX9L 2JCCA 2VH5L 4WNQB 4P46B 5D93C 3SJVA 2HKHL 2JLLA 2OSLB 4M6MH 1N4XH 2VXVL 4LASH 4M1DH 5C2BL 2UZXB 5SWSA 2YA1A 3B2UC 4LSRL 5FGCB 1TQBC 4ZPVA 5JHLH 4HMEA 1FGVH 1YNKH 1WBYA 1TTGA 5F44A 3GSQA 4QRTA 1KLUB 2Q6WA 1UKSA 2BNRD 2UUDK 2XY2A 2YC1B 1BGXH 3E8UH 3KPOA 3JTSB 5F1OB 4FFVC 3WBDA 4Y4KA 5D5MB 3EBAA 1X7QA 3T0XA 1MHPL 5D72H 1FP5A 4X6DB 4D0CB 5IBUG 1AQKH 5ECJE 1NC4D 4JKKA 4K9EH 4ZODA 1U3HA 5EU6A 4EOWL 1AO7B 4L8SA 5DC9B 2OZ4A 1ZMYA 3MUZ1 3SCMA 4C56E 2H8PA 4L9DA 3IVKA 2W0KA 3CXHJ 2B4CL 1X5FA 5JPMB 4Z9KB 3IDYC 4X6BB 3D0LB 3MLUL 3U1SL 3MOAH 3G6JF 1OHQA 5DD3H 5BZWA 1L7TH 3L6FB 3TNMA 1U58A 4NWUH 4UT9L 5F6HI 4X4XB 1QRND 2ICEA 1UYWL 5T3XL 1AXTL 3SKJH 1INQA 4XGZA 2QJDA 3SDCC 3QUMB 3MUGB 2I5YL 1I1YA 1HHJB 3KPPA 4P59H 4HIIB 5BRZA 2OX5A 4CMHC 5TDPA 4O51B 2DYPD 3V6ZA 5GS1A 2OL3A 4OI7A 2W38A 3E6HB 1A6UH 3DGCR 4KKAC 3U4AA 5K9JH 1OVZA 4P4KC 4RNRA 3VWKD 5GS0L 3NIGE 1IM9B 3U2SB 3BPLB 4BZYA 4TSAH 3V0WL 2PCPA 1BF8A 1MFAH 1FVDA 1XGYL 5I76B 2YMXH 1W72L 5IM7A 2P8PB 4HIJA 4PJAF 3QEQD 5HHME 1TJGL 2MMXA 4OQ1A 4NQED 3IS1X 4NKMB 4AENA 4Q74A 5CCKL 2KQMA 3HE7A 4LLQB 4DOHE 1PG7L 5EZJA 4BH8B 1FAKT 1NEZG 5DHYA 3FMGL 3DWTA 1T2QH 4Q6IC 5C07D 1A6AA 4YUEH 3DHJA 5KANI 2YD5A 2ZPKL 2VZVA 5LCVH 4HQQH 1GRWA 3RWEB 3QULA 3MRCB 3WFDH 2DWEB 1Y18B 3FONA 2C1PB 4OIAA 2BP3A 4RQQB 2JK5A 3LQAC 3VXUE 4QO1A 4JZJA 1TIUA 3EOAA 4OGYH 5ERWA 1KCLA 1FGNL 5HYSB 1NFDF 3VMOA 4NQDE 3T3PE 3LQMA 1CT8A 1KJ2L 2FLBT 1KLGB 1OLLA 4Z0BL 3G9AB 3D3VA 4NKIL 2XG4A 4LCYB 4PJCF 5CKGA 4YHYB 3HNTL 5JTWA 4P57B 4Z7NE 3CK0L 3QRGH 3O3EA 4J6RL 4MAYC 3IJSB 2I60L 4PG9B 5FV1L 3P0YH 4F58H 3PNWA 4MAYA 2LAAA 4LBEB 4YJZL 2A6DB 2E9JA 2X4QA 1SVZA 5FYJU 1TZHB 2EYTA 1XF3A 4PTTA 1ZANL 3MGTB 4GRWH 1WISA 2P24A 4WUUB 5FO8B 3B3IB 3DV6A 1J8HA 1RZGA 5KVEL 4ZS6D 4FXLA 5J3HD 1JHLH 3BPOB 5KS9E 4QRPD 4FQJH 1F58L 25C8L 1JGLL 3IDGA 1T1WB 5B4MC 3NIFF 2E27L 3NA9H 4KJWC 4UTAH 5E24E 2FR4A 1OAZH 3HE6C 5DEFB 3U4EA 1OB1A 1IAIL 1YEJL 1A6PA 2AJUL 5DFVD 1P7QB 2O5ZL 2H8PB 5JO5A 4PJ8B 3KPQA 1DBJL 3CH1A 5FCUL 3CC5B 4WFHD 1BJ1J 5I1KH 1DZBA 5DJ2B 4NM4H 4Y19B 5GZOD 4MB5A 3PE9A 3PXHA 2XZQH 1FC2D 3PGFH 3VDCA 1MUJA 1JRHH 5LAXA 3WNNA 1JBJA 4W6YB 3VXRE 5DD0L 4WFEE 2V2WB 3MV7D 2WWMD 3RX8A 3C8KB 1MREL 1U91B 2D7NA 4W6WB 4OT1H 3GSRB 5FB8A 3ULVC 1CLCA 4Y2OA 3BP7A 1A7OH 1KTLA 1XGUA 3MRNA 4P23D 3T0EE 1BMGA 1EMTH 3H7BA 1WVZA 4F2MB 3TP4A 2WIMA 2KH2B 1MJJA 4WI5A 2WBJC 3MUHL 3I2CH 3IXAB 2VISA 4LMQI 4WU5A 2VLJE 4L9LB 4ZS6C 4XPTL 3S97C 5J13C 3KPSB 3C2AH 1ERNA 5C0AD 1IAIM 1CFQB 1DBMH 5FA4B 1IBGL 2ITCA 3QNZA 4LCWE 3C5SA 1J0JA 2IH3A 3LKSB 3VRIB 4IEFB 4HMDA 3MACH 1T66D 3MC0A 4O2CA 1DQJA 2AK4D 1UM4L 3DMMB 1A4KA 2YD4A 4QHLB 5CJXC 1N5AA 3S4SA 3SE8H 3SGDH 4XVJH 1AFVL 3VG9B 3WLWC 2JJVA 4PJGA 1KB5B 1PSKL 1EVTC 1B2WH 2DRUA 1T7WA 1R5WA 3FQWA 4P99A 1S9YA 3O8XB 4S1SH 5DT1H 4WJ5B 3VFPA 1T4KA 2EXWD 3BHBA 4H25B 4PRNB 1FL5A 4BUGA 5EZOH 3UJTH 2HA1A 5FM8A 1HHIA 5FHBH 4X7DC 1JF6A 1LP9E 4XMPH 4MD4B 5EPMB 1S7XA 4NQUA 3X17A 2IALA 3E2HB 4PJ5D 3LVEA 3AS1A 1OP3K 4AEFA 1Q9KB 2Q3ZA 3NAAL 3IT8D 1H0DB 4J1UA 4FXKA 4TOYH 5GRVL 1AD9A 5LQBH 4MCZB 1TJHL 2ESVB 3G5ZB 1XF5B 1J1OL 1QP1A 4XXCC 5TQ2H 1Y6KR 1NMBH 3W9EB 2VLJD 3E0GA 5BS0A 2HLFD 5FO9B 5KVGH 1P5VA 3L5JA 4NKDA 5CZXC 3TZVD 2FL5B 3KNBB 4MNHB 4YO0A 4UV4H 1G6RA 4DQOH 2YUWA 1HSAB 4HUXA 5ADOL 3WXVH 4ZUWB 1KTDB 1S8DA 3BPCB 4OIIL 3WIFB 3VXQA 4I18B 3F7YB 4NZRH 3HZMA 4IRJA 3QEUB 3BFOA 1ORSB 3OR6A 3KPRB 4Y4FD 2DOCA 4MX7B 2HVJB 3MFFA 4GBXD 3WFBH 3QDGE 3HAEG 1D5XB 5C0CD 3WO3B 4NT6B 1BAFH 2A77H 4Q7DA 3VFTA 1D6EA 2PR4H 2UWEF 1LE5A 5MP6L 4YDVA 2J3SA 3QA3A 3UTPD 1FV1B 3BESR 4WWKA 1IVLA 3HR5A 1V3LA 4WW1A 4F7EA 2VXTL 3QIWC 5J11B 4Y1AD 3I3DA 1AXSA 3HS0A 1V3MA 4CL7A 4DWHA 4UB0L 3MFFB 2B4CH 3TH4T 3UYRL 3HKFA 3MXVL 5T1MB 4ZD3H 1NDMA 3STZB 1JGDA 2Y36L 2YBRA 4BZ2H 2PXYD 4P3DB 4ZQKA 4IRSA 3OKLB 4RWHA 4J3XA 3EFDL 3OJDA 4HLJA 1U3ZA 2QQLL 1E4XH 4BQBA 4FMKA 1KIRB 3L3GA 3HUJE 1U93B 4QWWD 4XXCA 3TYGL 1AJ7H 3PWNA 5GS3A 1CG9B 3OKKA 1KEMH 2X1QA 1DQQA 4HUNB 2IEPA 5DJZA 5TJWK 3TBTB 4LSVH 4BH7A 1OSPL 4XVTL 1NSNL 3OXSA 1UB6B 5KSAB 2UVFA 5LG1A 2GK0A 5FDWA 4Z76B 1D5ZA 5DS8B 3ESUF 1RIHH 2LABA 4PR5A 1KXQE 5E70A 1DJSA 4S0SD 4LCUB 2Z93B 5DMKB 3IFPB 1A8JH 1ZT4A 1MJUH 4XNQB 2XI9A 3OJVC 1QSFA 5LGHL 1MLCA 3P9WB 4IHOB 3CFCL 2VITB 4YBQD 2I25N 1WIPA 3S5LA 3QEHB 4R96A 3QZWA 4J3UA 3ZE0E 1I4FB 4U2ZA 4Z0XB 1XGQB 3ARTA 2P5WE 4JDZB 2HJLB 5E2TH 3BKYL 5C09A 1U0QA 5IBTL 3ZE2E 4LQFH 2E6JA 1ZLVH 3UMTA 4RDQG 3NTCH 1SYSB 3QUZA 3RZCD 3G5YB 1G7QA 1C08A 3RKDC 4M7ZC 1X3DA 5LCVL 4O2CB 1MQKL 4AH2A 2WP3T 3DURA 2DIAA 4NC1C 4HJGA 5C6TH 4LSDA 4NKOB 2CSPA 1CDHA 3BW9B 1FYTA 4OGYL 3GBNL 1FGNH 2A9MH 3WXWH 5TE7H 2C26A 2KUTA 4I48A 5FV2A 3TT3L 5T1LA 4H1LB 1JWMA 3T0DA 1CGYA 3RWCB 1WV7T 1N2RA 2UV3A 4FQ2H 2NY7H 2PW1B 2UVEA 4OI9A 5BQ7A 3P4LA 4ZAKD 2HTLC 4J4PA 2QADC 5DZNA 5C0JB 1I7UB 4OZGE 4MXQD 2R0WL 1F13A 3H3BC 2F19H 2ZCKH 1G7PB 3O6FD 4JLRB 5DVKA 1TLKA 3JV5A 3BAEH 3PDOA 5AZEH 3U7AA 2F54E 5SX4I 5JIHA 3BDYH 4XBEL 1YY9C 4JFFB 5I8OL 1BZ7B 2B20A 1LE5B 4UINH 2J6EA 5TH2A 1ZT1A 3JWDH 3MRLB 5GSRA 4WI4A 2VDQL 4GW5B 3RIFF 2DKMA 1KN2H 3DUSB 4H26B 4MA3B 3I02A 1EDQA 3RUGF 3HMXA 3DV4A 1V5JA 3IJYB 3QDJD 5E5MA 5DMJB 4KI1A 1F58H 2FHCA 3TPUB 4HWZA 3X13A 1J0YA 1HSBB 2G2RB 2NNAB 5IB3B 4Y5VC 2Q8BH 3NA4A 2H3NB 2XNAB 4LCCA 1WWBX 1F90H 5TFSL 3DO7A 1JWSA 4KJQD 4MB4A 2APTA 4PJ9B 1CR9L 3F5WA 2X9YA 4GG6E 4X83A 1OW0A 3WS6A 3LKRA 1XIWC 3JUYA 4QRRE 4QCIA 3OF6D 2ZUTA 4MJIA 4ORGB 3GSNL 5FYJD 1X6NA 3TM6A 1CE6B 5FA3B 4LPWA 3T77B 1Q0XL 1FNFA 5ESAB 1MCJA 3OKMA 3T04D 2FX9H 4HWEL 4IOIA 4I0PA 1P53A 2X4PB 4MWFA 3MRFA 5INCA 5MEQB 3CZJA 1E27A 5HGHA 5C9JA 5C2BH 2FYYA 4LU5H 4LGSB 2OR9L 1WITA 4IIQC 2PKDA 1A02N 4HS6A 2EH8H 1RIVH 1U3YA 4XBGA 4QHKJ 2ZSVA 1CDCA 5HYSA 4PJHB 4KQ3L 3HNVL 4FP8H 3TN0D 3PGDB 2NY5C 1YNTA 3C2AL 4L3ED 1ONQB 2EDJA 5FUZL 1LMKA 1QLRA 2CIKA 4N5UA 1FORL 1BFOA 1RPQA 1S7RB 5IFAH 1SQ2N 2FD6H 3C2SA 2IQAA 1IGMH 5A2LH 3U6RA 5I0ZA 4G8EB 4U0QB 1BQLL 1KB5H 4WI6A 1I1FA 3WN5C 3OG6B 4ZFGL 2RFXB 2BMKA 3MLUH 3U1SH 4JPKL 5SWQA 2B39A 4NKMA 2MCG1 4V2CB 3WL9B 4EI5A 3L3JB 4P49A 5HHXH 1HE7A 3B8SA 3VW3L 3FO9B 5CSBA 1QLRB 3LEVL 1A14H 1S9WA 5JMRA 4IRJD 1T6VN 5JA8B 1I7RB 1F6FB 2O5YH 4NZDA 3VFWB 4AY0A 1A7BA 2HRLA 1F11A 4ZO7A 1M1SA 4HV8A 1TZGH 1EV2E 1D6VL 1J86A 5C09E 2EEDA 2X4UA 5FYLH 1T3FB 3MBEC 2V7NA 5K9JL 4P0DA 1JJUA 3QIWA 3JV4B 4KHXL 5LQBL 3REVB 4S1RL 4Q9QH 3VA2C 2DI7A 2IWGA 1K2DB 1AGDA 3FQTB 4J23A 4S10A 2IJ0C 3HFMH 3GUTB 5TPWL 5FDWB 1U8IB 4ZPTA 5LWYL 2HN7B 4PJIF 3BD4A 1FH5H 1UWEL 4OZIE 1E4WL 2BVPB 3NFNB 3TBTA 3WXVL 2HJKB 2O5XH 4OCSH 3GIVB 1EJOH 1XR9A 1QFUL 5HD8C 4AZ8A 4RMRA 1CYGA 2VSDA 5B38B 3MRIB 3NCYP 5GRJL 4XP9H 1EFXD 3L3HA 2D31B 4G8GE 4J7RA 1FCGA 3CH8A 2EE3A 2UUDH 3E3QE 1M4KA 2DQCH 32C2B 5HPOA 2VJXA 4Y89A 1RZIB 3JVGC 3CFKA 3MLXH 2RQ8A 3MA9L 1VGEH 4M7JH 5IB3A 3DLQR 2AI0H 2X9WA 4OAWB 4KV5E 2YPKA 2UWEA 3WV0A 1RSFA 3WNPA 4S2SB 1F2QA 5EB9A 4TQEL 1EVUA 3QFDA 3OSKA 2ZZUT 4R2GD 2VSCA 1KYOJ 3I3EA 2FWOA 1KLUA 1HQ4B 3DOSA 3N1QC 4YHKL 1YEFH 4BK5A 1A6VH 4NKIH 5KOVC 4WTXA 3QA3B 1ED3A 3G5XB 5HPMB 1FVCA 1I85C 4PV8A 1ZT7B 4OZIF 5JUEH 3IFNH 2LU7A 3EYOA 4XH2B 5BXFB 2IAND 4HCRA 2D7TL 5CINL 4JVUA 3VGEA 1VA9A 3P0GB 1IQWL 4Z95H 3RU8L 4A6YB 2VDLL 4PJEB 3TYGH 3MV9A 1AJ7L 3CPLB 1CQKA 4JRXE 2GSIA 2NZ9C 5L7XH 1NLDH 4OGZA 1TTUA 2IQ9L 4OCYH 3ZTJH 3T0BA 4MNHA 1CFTA 2FO4B 4H8WC 4IOIB 4HGWB 4GQPH 4DGVL 4TVPD 1JGLH 4XXDA 3PWLB 4QOKE 2YD6A 1CE6A 4B5EA 4NKOA 2BOBB 2DI9A 5D7IA 2EDWA 4OLEA 3HE7B 5I16B 5TF1L 3MYJA 3H42L 3QP3A 2OP4L 4MGXA 4OLZH 4K71C 1KFAH 1BX2A 4TN9A 2WBJA 4IJ3B 3GKWH 2VWEC 3CCHA 2CDGB 3MSPA 4YE4H 5IMKA 1P84K 1NJ9B 5FCUH 2V7HB 1FAIH 5EPMA 4TVPH 5F1IB 2XA8H 5ILTL 2QLVB 2X4RB 3TVMA 3X13B 3MV7B 3LN9A 2X89D 2L4OA 4NQCE 1ORQA 3W82A 2Z92B 5F1SA 4LSUH 5I18H 5T5FL 1ES0B 2DWDB 2NXYB 4HKXA 4HUMB 5I1EH 2R8SH 3LKQB 1A7OL 5GHWH 5KS9B 4D9RE 1CDGA 1LNUB 4ZNEA 1A21A 3MA7B 3V4PH 1EGJH 5CKAA 4HUVB 1MPAL 4OLXH 2EH7L 2NR6C 3MOBL 5DEGA 2EDEA 1YY9D 1EEYA 4HHAA 4G80B 1NLBH 1KNOA 3WLWD 3SDCD 2BNRA 2UZIH 3FJTA 2CGRL 2ITCB 3BIKB 4YPJA 2D0GA 2E8YA 3RI5F 2JCCE 5CLTA 3E6FA 4F9LA 5FYKD 3C5ZB 5JPMA 1XZ0A 3RI5K 3QHFL 5FGBC 2XTJD 3IVKB 1WBXA 3L3JA 5E6ID 1XCTB 3MLSL 4CVXB 3WNKA 1PG7X 1S7QB 4QF1B 3C60C 2C1OB 1DQMH 2APWA 3BAEL 4OZGA 3WMSA 5FKAA 2FJGB 3KJ6L 2UYLB 2HTKD 3TBVB 4ESKA 5IV2B 3GIZL 3GSRA 3HHRB 3HR6A 2BNRB 5FK9B 3BXNA 3SDAD 3LV3A 4M6ML 1U91A 1F4YL 3QJFB 2BSRB 4S1SL 5DT1L 1AR1C 3HE6D 1ZGLM 3EDDA 5IF0B 3WHXA 2GUOB 3CXDH 5CGTA 4PRDA 3S34H 2VMFA 1MWAA 5GGRY 1FVEA 5EORL 3HPJA 1LO0H 2DJSA 5EBWA 4C57C 3PGDA 4NBYB 3OMZA 1JWUA 3LKOB 4K94H 1HDMA 3VFTB 4OZFG 1WT5A 1R3LA 3IFOA 2BCKB 2JB6A 3C6LB 3L5XH 2EDHA 4S1QL 5ICYB 3V5DB 3VFMA 4Z7NF 5I0DA 2D0FA 3BZEA 1OAUL 3CDGA 4TUKL 4APQD 5KVGL 4YQXL 5BW7A 2J4WL 5ESVB 3WN5A 1JYWA 2GK0B 4NKDB 5FGRA 1XR8B 2EYSA 3LPGA 4OIIH 5DYOB 5FA3A 3T77A 1KEGH 5GRZA 1QEWB 1KTRL 4M48L 4KPHH 3HI1B 3L3GB 1LP9A 3HE7D 3IKCA 2IH1B 5DJ8A 2D7QA 2GK2A 2YD1A 5IEKA 4L8SC 2QR0A 2YSSA 2I5YH 1UM5H 5L0QC 1XCQA 4L3CA 5CGYD 1U8QA 1NANI 4QHUB 1NDMB 3WSQL 3QAZC 2R1XA 2DBLH 4JDVA 3HS0B 1SYVB 3ZMRA 3IFLH 5CMAB 1EEZA 3DUSA 1U3HD 4JRXA 1S9YB 5EU6D 4WI2A 5D1QA 1H8NA 2X10A 2R2HB 3BH9A 5T3ZH 5ID1A 2FD6L 1IGFH 1OAXH 4K23H 1HEZA 3DXAB 5J6GA 4Z5RB 2VZ3A 3ZTNH 3VRLF 3DPBA 1YN6B 1RHHB 4L4VD 5HHOD 5F7DB 3ULSA 3SGJA 1VFBB 3BEWA 3VFGL 4GG6F 4N8PA 1DQJB 4PPTA 5CZVL 2BNUA 1G7HB 1JPGA 1SEBA 2VLRE 4MX7A 3D39B 3IAPA 3F7PC 5I6XC 4PJBF 2ZPKH 1UG9A 5DQ9B 4MAYD 4ZOBA 3L5WB 3BPOC 1YY8B 4PJ7B 2O5YL 2C1OA 1QSEE 4NC1E 2I26N 1DVFB 2BHZA 2BNQB 1J05A 1MY5A 1AO7D 4MJ5B 1JUFA 5D1XC 2EIZA 3C9NA 5JXEC 1NFIA 1BEYL 4WHYH 3PQYE 3DROA 5FFLA 3BRFA 1YMMB 4TTGA 4NQCA 3WS3A 2VKXA 5HGAB 5ISZB 2WQRA 1C7SA 4WTZG 3QXVA 3AMKA 5FCSH 5HGGS 5C86A 5ENWA 5C0RL 4JM4H 2OQJA 1BREA 4N8VG 4NQDD 4Y4KC 1IKFH 3PWUB 3BGFB 3QSKB 5ESQB 5HI3D 3K4AA 3SY0A 5I1AB 2NY3B 1MH5A 4WW2F 5DVNA 4X6FA 3QXDB 1CD1A 1QNZH 1DN0A 3KLSA 4GRMB 3CC5A 1XGQA 4JDZA 5MI0B 4ERSL 4H20H 4LLYA 3FN9A 1I3UA 2PXYB 4LQFL 3SDDB 3HUJB 3S3SA 2NY3D 3FB7A 3QH3B 3RY6A 1Z0NA 4PJXF 5IW6B 1ZANH 2Z31B 4QYOA 2NY0C 3SQBA 4CVZA 1OWRM 4FFWC 2FR4B 1FQ9C 3IU4L 3BJLA 5I1CH 3MLXL 4R26L 3RWFA 4NCDA 5SV4A 1XGPB 4EI6A 2AI0L 4FG6D 4MXVE 2QQQA 1EO8H 1NFDB 1FDLH 4NC0B 4EDXB 4JKPH 3SCMB 1QSFD 5H37H 1JVKA 5ITFA 2E27H 3BIBX 3O3AA 1S9VA 2O93L 3FOMB 2IH3B 3VRIA 5INDA 1JL8A 3M1BA 2P24B 3DX6A 2CUIA 1H3TA 3SGEI 3PWNB 2BNQD 4G8EA 4P4RA 5TE4H 4GXVH 2ZUQB 1A2YA 1V05A 4MDIB 4OCWH 1CDIA 1CLOL 1G1YA 3IFNL 1FIEA 1DBJH 4BFEA 1GVIA 1CE1L 1BHGA 3JWOC 4XWOC 1RJYB 2QSTA 4EN3B 1S78C 3CXHK 4UQ3A 1JPTH 1GSMA 4ZFZB 4XP6L 3QWRA 4NQTA 4F7PA 2G5RA 2VZSA 3MR9B 2GCYB 2DL9A 4HH9B 2FZ3A 1I7ZA 3HAEA 3OPZL 4LNVA 1J10A 3EYFB 3L5HA 1A1MB 5TFSH 4L8BB 3WEXA 3SO3B 2IAMA 2XTJE 5I8EA 3EO1B 3H42H 1P7QA 2QHRH 3FAWA 1OAYL 1DUYA 4M5ZH 4WFFE 1U3HC 1BWWA 4QRRA 3HTLX 1UT9A 4BK4A 5IROA 5DQDL 8CGTA 1YPZF 1RU9H 4OFYA 4Y4HD 5D6DC 5C0BE 3K8KA 3Q48A 3QDMA 5D2LE 1JZ4A 2D0HA 4J4PC 4PJ5E 4G8FB 5HDBF 3AB0C 3KYMA 3V6OA 3VXQB 4NNXA 4ODUA 1MCFA 2P8PA 5SWZE 5E8NB 3H3KA 4X0KB 3K2UL 1U95A 4EN3C 3OV6A 5GRXG 4DUXA 5IB4A 1E28B 3KNBA 3LPFA 1KJVA 5DJ0A 5HHOE 5BO1L 4BSVB 4G6FB 3D25B 3I50H 3O4LD 3GMLB 1WEJH 3WE6A 1IFHH 5B38A 4OKDA 2X4NB 1X5ZA 4AL8L 2A6IB 2YA2A 3MLWL 1XF3B 4PTTB 5HYQA 3WD5H 1BFVL 1SJHA 3FRUA 4C4KT 4EXPX 1IC5L 2PYEA 3UTPE 1SJHB 3FRUB 3QXUA 5DJXA 1TQBB 3LH2H 4GS7B 1OL0A 1J87A 4XMPL 1I3GL 4LVHB 2C7UB 4JDTH 3V6ZB 1MEXH 4XBPB 2A6JA 4Y7MA 1BZ7A 3RVWC 2AV1A 4NP4H 3CUPB 3CVHA 5E4EC 3RTQB 1KJVB 1DE4B 3DI2B 5DJ0B 2R0KH 3BKMH 4LCIL 5E9DB 1IC1A 4BFGA 1H15B 2ICEB 5AUMB 4D2NA 1HH6B 3BHBB 1K8DA 4KRPB 4CN6A 5EU5B 2BXYA 3L6FA 4IRJC 2GHWB 1A7RH 2HTLD 3TN0B 2X5PA 3O9WB 1IGML 3OAUH 2PTTA 2ZP0T 4EKXA 2AEWA 4LVHC 1JV5B 5JXAH 2ENYA 4G9FD 1CI5A 2H2SC 4ZUTB 1KB9J 3I6LD 3V7AG 5D7LD 2AW2A 4XMLL 4OQTH 5A2KH 5GIRB 2DWEA 2P8LB 5C7XH 4PJ5A 1FFRA 4EI5B 4HWBA 4MDJA 1ZSDB 4NO2B 5ANME 2DIJA 4ELME 3QIBB 3B5HA 1XIWB 2W07A 3WFHA 3NN8B 1R5IB 4X4MA 3VXUB 3G6DH 3RX7A 4MYWB 5E1AB 1Q9WA 4JANA 5F7MC 4P9MH 4NBZB 4HIJB 1D5BB 1MJJB 4DFIA 2CIKB 4JHBA 2VABA 2Q6WB 5D1XB 4DCQB 3RVXD 5J6HA 1G9EA 1IGCH 1MCEA 1FBIH 5F96H 4WIQA 2GFBB 1HHKB 5EO0A 1FC1A 4RGMB 4RNRB 4L3EB 1IM3A 1S3KL 1EHLL 4NDMA 3H2WA 4PD4K 3I6GB 4MDIA 3V52L 3JV6B 2GJJA 1JHTB 3B43A 1OQOA 4IHOA 2DL2A 5ETUB 4APQA 4Y16A 4P9HC 3OGOE 4Q2ZB 5D70L 5DJAB 2VUYA 4ZXBC 4JFOB 3EFDH 1P7KA 4JJ5B 4DFHA 3ZL4H 1ZA3B 1INQB 3CFBA 1XEDA 3UPRB 3TEUA 2VWEE 4I0PB 2X42A 4JN2A 3BX7C 2ZWLT 1YEGL 2WIIB 1JZ8A 1K4CB 4PRHD 4B0MM 4NSKB 1UKTA 4U1KB 1L9NA 4JFHE 1E4XI 1JGVH 2WQ8A 3KJ4B 1DLHB 4WGWB 1UA6H 3ZTJG 1K4DB 4WHDA 1LEIB 1WZKA 3LKRB 4I18C 1YC8A 4GKZB 3MO1B 3D2UB 1R6VA 2P5WA 1QD0A 1YEDA 3H3PH 1AO7A 4GAJL 4L8SB 5J89A 4PJ9A 4JM2F 1FLRH 3KS0J 4LCWD 1JGDB 2VN4A 2Q7YA 3ZDZE 1GPOH 4NNPL 1NGWB 3ZTNL 5J12B 2A73B 1GGUA 4Y19E 2P43B 2CR3A 3SCMC 4YGVA 1MFBH 1UZ8B 3MREA 3QFJE 4WY7L 4X9HA 1AP2B 2RHEA 1FO0L 1UFUA 3NCYS 3MGAA 5F6HJ 2AJYH 4HBCH 1E0OB 4ODHH 5EN2A 3VXMA 3D25A 4QRPA 5EC2A 1DTUA 1FCCA 4FMFA 3D9AL 3Q5OA 1MQKH 1PFCA 4MA1B 5ICZA 2KZ1B 3P9MB 1FIGH 1KJMB 1BVZA 4D3CL 3EO0B 3O6FB 3T8XA 2FHBA 5E2JA 1NFKA 1L0YA 4LSPL 5IVZB 1P1ZB 2X89A 5I75B 5IR1A 4PY8I 5IVZA 1J0HA 1JF5A 4XNYH 4LLDB 3O6FA 4KZEL 5KANG 1CQYA 5E8OB 4M5YL 2QHLA 3B9EA 4PRPE 1I1AC 3EAKA 4OM0L 4K7PH 4OCXL 1RD6A 5EZIH 4L8BA 3UC0L 3UBXB 4WWKC 1RZ8B 2BC4B 3LEXA 1AKJB 2DQJH 2VOTA 4JZOB 4PBWD 1QNZL 5GGVH 3SDDD 3F7VB 5IFJB 4JZNA 4U6XA 1J0IA 1NBVH 2OR8A 2BVOA 5F3HB 3DURB 4AEIH 1UZ8A 2OI9B 4M93B 3R4DA 1FL6B 5B39A 1GGBH 1TDQA 1G6RH 4PJEE 2B0SL 2YD3A 4ZFZA 2UY6A 5EZLA 1T1YB 1JYVA 1D5MA 4YFEA 2E7MA 4OD2B 4R2GC 5T5FH 5GGTH 4NO3A 3WNMA 1PW3A 3QZWB 2XZCL 1N0LA 4G8GD 1LK3H 1B90A 1R3HB 1FDLL 4XVSH 3MV8B 3RKPA 1H9VA 4OLYH 3O8XA 3ARDC 1MIEH 1RUQH 1GGYA 3UTTD 4KK5D 1T03L 1PX3A 5TQ0L 1C16A 5LXGL 3KGRA 1Q72H 2P5ED 1GIGH 4E42B 4H1LH 4L29A 5JDSA 2FIKB 1K6QL 1G9ML 1MHEB 1WZLA 5CD3A 5JDSB 2JJWA 5A40E 1IAII 1QBLL 3BZEB 2BRQA 3O4LE 1QQDA 3SE9H 3UPAA 4YHPA 5HJ3A 2FEDD 3MRGB 3VGAB 3D0LA 1CFQA 5ADPH 3NCMA 3GRWH 4H1LG 1B4JL 5IB2B 4HUUA 4JRYA 3RL1A 3U36B 4PLNC 1MFEL 4NNYA 4NDMB 3BQUD 5CJ5A 3HZYB 3AROA 2JIXB 3TIDB 2XKNA 2HH0H 1VFUA 3TT1L 2XICA 5KSBA 4GLRI 1T1YA 5I1AA 4RIRA 1QKZH 2Q76B 1KJ2A