1V7ML

Human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
b'QVVLTQSPGIMSASPGEKVTITCSASSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGSGTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal TN1 Fab Light Chain
publication title Structure of the receptor-binding domain of human thrombopoietin determined by complexation with a neutralizing antibody fragment
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/cytokine
total genus 44
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1v7mL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1v7mL01
3MCKB 3DX8B 5KS9F 1S9KC 4UQ2A 3U7AA 3NABL 2NY4B 3HC0A 4EI5B 4BFIB 3TO4A 1K9TA 4LHQB 4HV8A 3L3HB 4ZFZA 4MLSA 3OGCB 1FRGH 1DQMH 3ZT5A 1OCWL 4D9LH 1U8KA 4S1QL 3RWGB 4PJEA 3HI5L 3DXAD 3FZUC 3EJZD 4F9LC 5DR5H 1U6AH 5JPMB 1WFOA 2B0SL 2Z91B 1D5IL 4XNYH 1GC1L 4V2BA 2MPAL 4Y88A 5I1GL 4XP5H 1OGAE 3DUUA 1JGUH 5D2LE 3EO0B 4MNGB 4PY8J 4DUWA 2V17L 3E6HA 1U8LB 3J7HA 2VLKA 3S5LG 4HCRA 5KSAA 3NCYS 2LV4A 5F72S 3HZKB 3ME0A 4TUOB 3TPKA 35C8H 4JPIB 4U6XB 3TYFA 1FZOB 1DL7H 4JKWA 4FS0A 5KANG 4LSQL 1ZA6A 4BFBD 4JDVB 4PS4L 2X70A 1TTGA 3O6KL 2J8UE 5DI8B 2XWJB 5EOQL 4Y1AA 4PJHE 2ESVE 3T0EC 4ZFOB 3RUGE 4YHNB 3BMVA 4PJGE 5I1CL 5I74B 1XGYL 3WIFB 2Z8VC 3CU7A 3D39E 3UTSE 1LNUA 5EZIL 3RY4A 4MA3B 2CLVB 5T3XD 3BPOC 4HWBA 3OWEA 5JOPD 1PKOA 5ALCH 1EFXA 1K4CB 3ZYJA 4QRRE 2FB4L 3GSUB 5KAQG 1XF4B 3QEUB 4M00A 2H8PB 4OFVA 4D94A 5C0BD 4HMCA 5FXCH 3X3FH 2FECI 2WIMA 5GGRB 2J5LB 5K33A 3LPGA 3GI8L 3VWJD 4WI7A 1F2XK 3BVNB 1I7RB 3FRPG 3GMOA 3AGVA 3NIGE 4IDJH 4WFGE 3D0LA 5GGTH 1A22B 4J3VA 5INCA 3SCMD 5C8JB 1FNHA 1KIPA 3FHQA 1Q8MA 1LO5A 3U9UA 1FRGL 1DQML 5F9WC 5HHMD 4MZ3A 4D9LL 3W0WE 3QG6A 3V6FB 1UCTA 3TO4C 2H1PH 4HH8A 1KTLB 5J11C 1UZ6F 5DJCB 5DR5L 2NQCA 4GLRI 1U6AL 2AABH 5C08B 4AK1A 1N6QH 4F2MB 4XNYL 1EUTA 3VXSA 4PJBF 3IKCB 2N1KA 3M07A 5D72H 3VJ6B 4XP5L 1JWMB 4NQDD 3WS3B 1JGUL 2Z8SA 5ISZE 1RV6X 1PKQE 2P43B 4EVNA 4ZG1A 2UYLB 2J8UF 3LN4A 4BZYA 4LLDB 4NHCH 4XVTH 1QSFD 5DJDA 1NMCB 4ZS6C 7CGTA 5I19H 35C8L 1J5OH 1NAMA 4OAWA 5IV2B 2ITCB 4NO3B 4Y4FB 1DL7L 4L3CA 2YPLD 1WBZA 1FHGA 4PRIA 1UQSA 5C0DA 1UT9A 5CBEA 4FZ8H 3X12B 1JWUA 1RJYB 2XTJD 3ARDB 4OIIH 2KBGA 3PG2A 3BH8B 1QR4A 5CJXA 3QRFM 4X7CC 2CLZA 2ZSWA 4XPAH 1ZA3A 5MENB 3C60B 3QNYB 2HKFH 3FT4B 3OG6B 2I9LB 2DWEA 4NKOB 3REWB 4B7LA 4IRZH 4KI5F 3NGBB 1U8HB 3SE4A 1UWXH 5ALCL 3CC5B 4M7KL 2ADIA 1S5HB 4O58H 4MNHB 3WEXA 4WI4A 2NX5B 4RFNB 3FTGB 2ZUTA 4E9LA 4ZD3H 4FQPA 4BQBA 2Y6SD 1L9MA 3IDMB 2X4PB 4F37K 3UJIH 3X3FL 1F3DH 3H8NA 3WFCH 1OTUD 4X0KA 4BKLA 4YFLF 2JF1A 3PGCA 3SEPA 5J1AB 4IDJL 4WWKD 5F97E 3BKCH 5GGTL 3ALWA 4U1SB 4CDHA 1MCEA 4OUUA 4XNZC 3ELAT 2YZ8A 1U8JB 2H32B 4NO0A 1X5AA 4CADB 2BMKB 2VH5H 2PW1B 1RUKH 4X4XA 3EYQD 1HKLH 4I3SH 3D2UD 4ODWB 5I1KH 3F7YA 3C5ZB 5T1DH 3WFHB 4P4RB 4YUEH 1OP5K 4EZMA 4GH7B 1FNEB 2PYEE 2R39A 4UINH 2EDEA 3ZKXB 2H1PL 4DCQA 1BAFH 2JLLA 1A4KA 3RWEB 1N6QL 2AABL 1QYGH 4PJEF 4MXQD 1QACA 1Z9OA 3I02A 5D72L 3NZ8A 3Q6FB 4LAJH 3DUHA 3ARTA 4PJDA 1MFBH 4JLRA 1CFVH 5HHPB 3CFDB 1KXQE 1MWAH 4XVTL 4NHCL 4M1GH 1MI5B 1IL1A 3HAEB 5I19L 2CUMA 4DW2H 1J5OL 4IOFD 1WUNT 5GISH 1D9KB 3GSOB 1NBVH 2G9HB 5A2LH 4OKVB 2QQQA 3VFSB 4FZ8L 4L8BA 5IP4A 3TBTB 4OIIL 4OLXH 3MRNB 1H3GA 3X11A 3FN3A 5F7LB 4P23A 3R1GH 3K2MC 5LG1A 3RHWF 2IANA 1B9ZA 2V2XA 2Q86B 1KYOK 1R6VA 5J8OA 2EEDA 5KG9B 4XPAL 1QP1A 1XMWA 2HKFL 1UVQA 2QSVA 3GIVA 1KLUA 5CJXC 3HKFA 1TJGH 4WHYH 3HS0A 4MAYD 5CS7A 5FK9B 4OD2A 1KIRA 1O0VA 4JFEA 4FTVA 4XWOD 3R4DA 4ORZC 4QXWA 4L29B 2BNQE 4YR6A 3B2VH 3QI9D 4IRZL 4XX1G 2P46B 1S7QA 1HH6B 1MY7A 5DK3A 4O58L 1AGDA 3RX8A 4ZD3L 4KHTL 1EGJH 2AK4D 3RL1B 4DOHB 5ELIA 3SE4C 2JJWA 3UJIL 5AZEH 3AAZA 3WFCL 2FEDC 5F7UA 3FO2B 5J57B 3QIUC 2GKIA 3C9NA 1EERB 3P73B 1XF1A 1FPTH 1JVKA 3QFJA 5F1SA 3BKCL 3FO1A 2OZ4H 1BZ7B 5T3ZH 3Q0HA 4JG1H 4M1CC 5MEPB 3OKEB 3NFPB 3HAEG 4L8DB 2FLRT 2VH5L 1RUKL 1HKLL 4I3SL 5I1KL 5KVGH 1BFTA 5T1DL 4YUEL 1IGCH 4JRYA 5T3ZE 1JUFB 4HGKC 2MKWA 1FNGB 2YK1H 4UINL 1L0YA 2UWEA 1EEYA 4X4ME 1BAFL 4NNYA 5EZLA 4GW4A 1R3KA 4HUWB 1QYGL 4V1DE 2ICEA 3JV0A 3S36H 1XF5A 4LGSB 5JHDE 3TCXA 5HYJE 1YMHB 4A6YA 5J12B 2HVKB 5B8CA 1MFBL 4P2RD 5CEXA 1CFVL 2VR5A 1CLYH 4UUJA 4TTDC 3O3UN 2EXYD 4H5SB 1J8HD 4WHDA 1MWAL 1E28A 1HN1A 5C07B 3D3VE 2YBRB 4M1GL 5T1LA 3DMMB 3IDXH 4DW2L 3BIBX 5GISL 4M62H 3NACH 4NRXB 1NBVL 1AI1H 4JO1H 2Y07H 5E99H 4F7EA 2RGSA 2C3XA 5GIRB 1KTDA 1BX2A 1EA9C 4PB9H 3SKNB 5CEZD 4OLXL 2O93L 1KPUB 5EFIB 5ETUB 4I9WD 3R1GL 3VFRA 2BVTA 2KZ1B 3BP6B 5JXED 4F8TA 4PRPB 4M7ZC 5T33H 1MAML 4UBDD 1P4LB 5AG9A 1KOAA 3I75A 4KDWA 1TJGL 1UKQA 3QIWD 4DKDC 5JW3H 1NEZA 4XNXH 1X4YA 1AGEA 1RIVH 1TFHA 3B2VL 3WKNA 2P24B 1JMZA 1RJLB 3MRIA 4PRNB 1I1CA 3B5HA 4ZAKA 2H3NA 3T8XA 1IARB 3CSYA 4YK4B 3G04A 4CVUA 4D8PB 3EYFB 3MV8A 4LHJB 1EGJL 1NFDF 5ESQA 1WIUA 5AZEL 3KGRA 3G5XB 1NGYA 3A6BH 4MDIA 1DVFA 5D70H 2AXGA 1FPTL 1T5XA 1R0AH 2OZ4L 5T3ZL 1A1NA 3QDGA 4JG1L 4ZUWB 5F70A 1H8SA 5FO9B 4M8QB 1ZHBB 5E6ZA 2JTDA 3N06B 4C56B 1KB9J 3MRKB 4JN1H 2EKSB 1KEMH 3K8KA 2BY0A 4RRPA 2DF3A 3VFVB 4ODUA 5KVGL 5IFHH 1IGCL 3ULUC 2HMID 4NKDA 3RBSA 1UM4H 2A74B 4LVOB 1A2YA 3MUY1 1IAKA 2YK1L 2WINB 1NDMB 3ZL4H 3ZMRA 2BRQA 3ARBD 4PJIA 2LTQB 3QQ4B 4U1KB 5HDLA 3S36L 3E8UH 1PYWB 2ZUVA 1SBSH 3MBXH 4NT6B 2H26A 3RWCA 3UZEA 3LKRA 1G7PA 2NY4D 3FRUB 3PNWA 4EI5D 1CLYL 3PXJA 3VXPA 5D6CA 3H9SA 1BD2E 1R5VA 3BUTA 4P2OA 2GTWB 4IS6B 3C6SB 1JHTA 3WYRA 4Z6AT 2X4OA 4MA1C 4BZ1H 4XBPB 5D96C 3W81A 1CS6A 5B8CC 5F9DC 1QRNE 2GITB 4M62L 3NACL 2YC1B 4I18A 4JO1L 1AI1L 2IEPA 2R2BA 2Y07L 3NPSB 5E99L 5K9QG 4Z8FH 1LE5B 4GG6B 1MRDH 3FFCD 4X9IA 1NC2B 1RZ8A 4GAYA 5JW5B 2I5YH 4PB9L 3BPNC 4NO2B 1XT5A 3MJ9H 1XGUB 5HVFB 2ADGA 3RWJA 3O9WA 3VDBA 2XWTA 3NIDE 2B5IB 1NANH 1QTYT 2X4TA 4YBQD 2GTZA 3SDDC 4KK8C 5ICZB 3EW3B 1EO5A 3GB7A 4PLNC 5I8CA 3V4VH 2DQIH 4ELKB 3HLAA 3FFDA 1NJ9A 5JW3L 1U42A 3RWHB 4P2QB 2QSQA 3AVEA 4PD4K 4WUUD 5HGDA 3CX2A 4MAUH 4XNXL 5J7CC 3HR5B 3CU1A 1RIVL 2QADC 4GMTH 5CP7A 5FM4A 4HWZA 2J8OA 1VENA 2FWOB 1FL3A 5J9PA 1IQWH 4PGCA 2JJSA 4KMTH 4X9FA 3MRCA 1YPZB 1G9MC 1W72A 4ZAKC 5EUOA 5C71A 3A6BL 3T1FB 4PV8A 3G5VB 1U8QB 1CGUA 2R2EA 2PTTB 5D70L 4O2EB 3TIDB 1QKZH 1U8IB 1S7SB 4QOKB 3O2DH 1AO7B 3S7GA 4D0CB 4LLVA 4OBSA 3CDGA 3RL2B 5I75B 1PZUB 3O0RH 4JN1L 4PJCB 1HCFX 1KEML 3GRWH 1ADQA 1SYVB 5IFHL 3CXHJ 2X1XR 5AYQA 1UWGH 4F3FA 1UM4L 5EU4B 1JZ8A 1KXTB 2JKXA 3DVGB 4OZGA 2ARWA 3CVHB 3BP7A 3QEQE 1CFTB 1BFOB 1QO3A 5GS0H 2XI9A 2UWEF 1UEYA 3E8UL 1MHCB 3L7FA 1SBSL 1M7XA 3MBXL 4LSPH 3DWTA 3MBEC 2VB5A 4QXUH 5GS2H 5I1JH 2VWEE 5L88H 4HWNA 5BRZB 2E7MA 4X6DB 2HFGH 4BZ1L 1KLGA 1R5WB 3ULSA 4JY5H 3NIDF 4HW6A 4HJ0D 4LPWA 2KL6A 3IU3B 4X9HA 1C16A 1IRAY 4Z8FL 1MRDL 3SO3C 3I6KB 4P2OC 2W38A 5C08D 2I5YL 3D5OF 1RUPH 4C59B 4YBLC 3EJYC 3MJ9L 1TVBB 3AS3A 3TFKD 5BV7H 4PYGA 3P4OB 3PHOB 2DLTA 2PNDA 4GUPB 3UPCA 4MMZC 3E2HC 4JO3H 3BZEA 4WIQA 2WBJA 1NGXA 4R7DA 3ET9F 3QH3B 5CZKA 4X6CA 4CNIB 2R1YB 3V4VL 2DQIL 1R5IB 3K0WA 1K5NA 3O9WC 3ARQA 3MNVA 4Y4FD 3MRBB 1JNLH 3E0GA 4MAUL 5CJQH 2FSEA 1BECA 1PX3A 5D1ZA 4NNXB 5L8LB 4GMTL 5HHOA 3ARDD 3JWDH 1W0WB 2PCPA 4RCAA 4XXDA 4NJAH 4X6EA 3TM6A 4GKNA 4D9RD 4PRAA 5C3TA 4HIJA 4LOUC 2Q76B 5DJ6A 4S1DD 3DTXA 1J86A 1IQWL 5H2BB 4HUMB 1VGKB 4KMTL 4P9HH 5T1KA 5MEND 3C60D 2BDNH 4NQCA 2J2ZA 3B8YA 5EULV 3DIFB 1FZJA 4OIAA 2VERN 3ZTNH 3FONB 4FXKA 4MA7H 4LRIA 2JJSC 4OGXH 3HE6C 1QKZL 4LLUA 1ZHKB 2BVEA 3ES6A 3F5WA 3LEXA 3O2DL 5DUBA 2EO1A 1SJVA 3SDAB 3O0RL 4HIHB 3SKOB 1U3HC 2BVUA 3GRWL 4QRTB 3RVTD 2BC4A 2NX5D 5ANMA 2FH8A 2PTUA 4X80H 1IGYA 5KN5B 1H5BA 1UWGL 3V7MA 3CFJA 1O7SA 2ERJC 3RY5A 1MPAH 5GS0L 4R7NB 2VO5A 4ZPTB 4AYFA 4LSPL 3KPLA 4XPGH 4Y16D 1VEOA 4PJIF 4QXUL 4YZFE 3CFKB 1ZHLA 4PLJC 5FYLH 5I1JL 3VFTB 4RDQG 5L88L 1RIUH 3HUJE 4ZDHB 5HGAA 2G5BA 5CD5D 2HFGL 3THMH 3C5ZD 5SWQB 1MCCA 4JY5L 3MJ7A 3W5NA 2DB8A 1E4XH 4M5YH 1H3UA 4R3SA 5JIHA 3AXLA 1YMMB 2D9QB 1I7ZB 5CGYD 5SWZE 2FYYB 1RUPL 5T3XE 1EXUB 3DI2B 5CSZB 1MFEH 2VDQH 5DZNA 1UC6A 4AEEA 2ED9A 5BV7L 4PFEA 4LNRB 4F7TB 3P4MA 1ED3B 4JO3L 3IVKB 5DQ9A 4E41B 1G7MA 4Y5YC 2NPLX 4UTAH 4WW2B 3WDHA 1MI5D 4H1LB 4OLEA 4OD3H 1D6EB 4ODVH 4TUJA 4RFEA 1D9KD 1CD9B 3QO1B 1KC5H 3QUKB 1IM3A 1A6WH 1JNLL 2AI0H 3WSQH 1JJUA 4KKBC 2EH8H 2HT4D 4ODXA 3BIKA 1XH3A 2OP4H 1TIUA 3JWDL 4NJAL 3C5SA 1YEFH 5EORH 2PKDA 3QT2A 1ZK9A 4Z77A 4WO4D 1CDHA 3HZVA 1KBGH 4QGTA 4JVUA 5B39A 4LCUA 4P9HL 5GRJH 4W70A 2BDNL 1P5VA 5E6IA 5IHBA 3BEWA 1X4ZA 3F8UB 4WEUD 2X7LB 3ZTNL 1I9IH 4MA7L 1GCFA 1PAMA 5CBAB 2OLDA 4OGXL 4OCRH 3OKDA 5H37G 4GRWH 2AQ1A 4Z7QE 5E9DA 3QXAA 2HN7B 4LRIC 1YZZA 2ADJB 4K07A 3LRGA 3S3SA 1WBYA 4X80L 2JJUA 1FZKA 1TMCB 4GRWE 5KSBB 1B0WA 2HT3D 2X09A 4HUXB 4F7PB 4ODBD 1H8OA 4Z76A 1MPAL 5IB4B 3QYCA 4RBPK 3QUMA 1YDPB 4G9FB 5DEZA 1KCSH 4F57H 1HXYB 4TN9A 4OZGF 2UZXB 3ZKMC 2FD6H 4XPGL 4J3SA 5IJKA 2XTJE 1MCIA 4JCMA 1MFCH 5L2KE 2R2CA 5FYLL 4C55A 4BQ9A 2NW2B 3QJFB 4H1LG 1RIUL 3QDAA 2IALB 2CQVA 3PWJA 3THML 1QLEH 4QNPF 1E4XL 3WNPA 4M5YL 2A6IB 4P4KD 2KDGA 4HK0A 1NFIB 1BFVH 3ZHKA 5D5ME 2ZCLH 4XNQB 1GZPA 3BN9D 5E8NA 2HLFD 4PBXA 2P8MB 4UNUA 3VWKB 4GXUM 2VABB 4WU5A 1MFEL 2VDQL 4LCYB 3L3OB 2FH6A 2GYSA 5JNYA 1GXEA 4QYOB 3R06A 2BNUB 3VI3E 5A1AA 4UTAL 3DHJA 1PEWA 2E7HA 2XY1A 4HGWB 1AXSB 3BWAA 4OD3L 4NQVB 4ODVL 2Z4QA 2R2HB 4X6CF 1KC5L 4X8JB 4DZ8B 5DD6B 1A6WL 2AI0L 3WSQL 2EH8L 2R4RL 3PXHA 2Z31C 4G7VH 1SJHB 2Z35A 4BQCA 4UAOC 2OP4L 1XGQB 2BVQB 1YNTB 3VGEA 4MMXC 1LDPH 5EORL 1HOCB 3MLXH 3GUTB 1RK0A 4DK3A 1KBGL 3X13B 3NN8A 5GZND 1XIWD 5GRJL 3EO9H 4PRPD 1WJ3A 2X4NB 3ARFB 5F7HA 4L8CA 3DX6A 2VKWA 1Z3GH 4GRMA 1I9IL 3TIEB 4X4YA 4OCRL 3FQWB 1T2JA 2BCKB 3JUZA 4H0IA 5D2LA 3S35X 2OS7A 4KTYA 2A0LD 4PJ5A 4BYHA 9CGTA 1NL0H 4EXKA 3CPLA 3TNMB 1F2QA 1QR1A 3CZFA 4HBQA 3C08H 1ZXQA 2BXZA 3TV3H 4WUKH 5DMJB 3X3GL 4RAHA 4JAMA 3BT2H 15C8H 5IB5A 1E4WH 4H26A 4FABH 3P0GB 3QWOA 1R24A 3V6ZB 4PJXB 1GC1C 5CJOH 5ADPH 3QDMB 2CDGB 1KCSL 5F9AC 4F57L 2DLGA 3FB5A 3VD3A 1F58H 2FD6L 1KUMA 4N8VB 3OTTA 4C83A 2R8SH 3L3KB 1MFCL 3QUXB 1WBXA 2WIIA 4PJHA 4G42A 5FF6A 3RUGA 4WY7H 1KNOA 3QQ9C 4YGVA 1NQBA 4HJGB 5IJKC 1N8ZB 3RTQA 1QLEL 3UTSA 3D39A 1UACH 3MUJA 3VFPA 5AD0B 3N1PC 1A6TA 1MFNA 1BFVL 2JCCB 2ZCLL 5DQJB 4U0RC 1DQJA 2GT9B 3PWNA 2H6PA 2EDOA 1FVEA 2IFGA 5FO8B 4F33B 3HR6A 3SQBA 4QRRA 4BELD 2UY6A 4H8WH 1T66D 4P9MH 2X9YA 3V5HA 2O5ZH 3ARZA 3GSRB 4XNMA 3MLRH 4DGIH 4Z9KB 5EU3A 1A9BB 1WV7T 4JRXD 1HI6A 4BZ2H 4QRQA 1IC7H 1X5XA 1AJ7H 1K3ZA 1FVCB 2LVEA 4G7VL 5FOJA 3QP3A 4LHUA 1ZHNA 4PJFA 1N3NA 2BY3A 2GI7A 3TN0A 2VYRE 5KSUA 4UV7H 4CVZB 3MLXL 2EZ0C 5KSVA 4LSSH 3MCLH 3EO9L 1LEGB 3VCLB 1AD0B 4OV5B 1UM5H 4TSBH 3C5JA 5BS0B 3S88H 2ZKHH 1Z3GL 4AL8H 3VFUB 2X89A 4KRLB 1Q9OA 4K7FA 4OSUH 5JMRA 3KLHD 5DO2C 4N8VG 5GSRB 3DJ9A 2CLRA 5ISZA 4N8CH 2HFEB 3RZCB 4D3CH 1X5GA 4OZHE 3UTPD 1NL0L 3KYMA 1H0DA 2FR4A 5DFVD 4BFEA 3C08L 4IJ3B 2Q3ZA 3TV3L 1IC5H 4KJYB 4WUKL 1GHFH 2VL5A 1BBJA 3BT2L 15C8L 2FJGA 4XXCC 2JJTA 1E4WL 3BGAA 4FABL 1IC4H 2W0FB 3RWDA 2X4SB 4K7PH 5ADPL 5CJOL 1U95A 2NLJB 2CKBA 3P4NB 1RY7B 4RIRA 2DBLH 4KUCF 3OR6A 3SGEH 1LDSA 4L4TB 2NTFA 3TA3B 1MHEA 1F58L 4QOKD 2RCSH 1AO7D 2R8SL 4MNQD 3CLFH 3H6JA 1NGWA 3HMXH 1SM3H 4FQXA 5FKAB 1X44A 1CL7I 1FFOA 1SJEA 4HG4K 4WY7L 3ZLQC 3QZWB 1FVDB 2D2OA 2H45A 3K1KC 5B4MD 1QSEA 2WWMD 3NA9H 1UACL 1FGNH 4KU1A 4ZXBB 3WL9A 4X6BA 2GAZB 4PRDA 3QIBA 4AM0A 1ONQA 1JZ5A 3WLBA 5H94A 1A7OH 1HWHB 4ETYA 5A16B 4ZS6D 1ACZA 3QEHB 2I26N 3CFBA 4PBWD 3RX5A 4ENEC 4H8WL 4P9ML 1K4DA 5BRZD 1OB1B 3QFDA 3T2PA 4BSVB 2O5ZL 4JO4H 3UBXB 3MLRL 4J3WA 4DGIL 4WTZA 12E8H 2CIKA 4YHIB 2EEBA 43CAA 4BZ2L 1MVUB 2NY1D 2I60H 3MREA 1IC7L 5I1LB 1AJ7L 3MGOB 1Z6JT 3KPRD 3MLZH 5MEQB 4LCWB 1BLNA 1RZKH 3OXRB 4MSWB 2Q6WB 3B3IB 4UV7L 3DSFH 4WGWB 4LSSL 3MCLL 4UOW1 1S7TB 2GJJA 3OSKA 3TN0C 5BW7C 3NAAL 1EEZB 4BK4A 1UM5L 1R3JB 4KPHL 4NQXA 4TSBL 3S88L 5TQ0H 2ZKHL 4AL8L 4YHYC 1H3PH 1JP5A 4OSUL 2DQUH 4Z78A 3KWWA 2VNCA 2R15A 4N8CL 2F9BT 4D3CL 1BMGA 5EDXA 3JTSB 5C6WH 5E95B 4Q74A 2B1AH 1KPVA 1BJ8A 1BEYH 1YUHA 3BZ4B 2BY2A 4D2NA 4DEPB 2H9GA 2AJUH 1IC5L 1GHFL 3Q6GH 2D0FA 5JPNB 5I76B 1YEJH 2XFXB 5E94A 1AKJB 1H8NA 1FL6B 1IC4L 1VFAA 1GGBH 1VEMA 2YD3A 4K7PL 2PO6A 3VRJA 2DM7A 4RMQA 2RJMA 2DBLL 3RY6A 4OGAC 5IBTH 3DROA 1T1ZA 3WNKA 3GJFB 4TVPH 2JJTC 1SVCP 2GW5A 5HPOA 2RCSL 3IF1A 4LQ1A 3VXUA 3CLFL 4WEMB 4ZNEE 3HMXL 1SM3L 3WXWH 2D03H 3UBXG 4MNGE 5C0CD 5FV2A 2DAVA 3VG9B 3B6SB 1I1AA 4TVPE 1ZS8A 3E6FB 4CU7A 3NA9L 4I3GA 2XN9E 1FGNL 4Q9BA 4FQXC 1KULA 3VH8B 5JOEA 4Z5RA 1QLFB 2PXYB 3SDCA 4F15C 4H25A 5EUKA 3GSQA 4K71C 4FFVD 3RVVC 1FN4B 1A7OL 2EDNA 1KEGH 2OJEA 3BO8A 4NM8H 1ZVSB 5GS1A 3W82A 3HCVB 4HX1A 4D0DB 5EOCJ 3P77A 3D48R 3G6JE 1FG2A 3QIBC 2F8OA 3HRZB 2VISA 5DK0B 3T3PF 4MJ6B 5FM5O 4CW1A 4JO4L 4O00A 4K3DH 5HYIA 4IHOB 3PDOB 4DVBB 2AEPH 4RFOH 12E8L 4QTIH 3L3IB 4WEBL 1YMMD 2A77H 2I60L 3CCHB 2MWCA 1U93A 5GGSB 4RGMC 4U1LB 2OK0H 1AGFB 1IFHH 1X9QA 3HZMA 4FXLA 3QJHB 4PJ9A 3MLZL 2D9CA 2CUIA 2BOBA 3WFBH 2FJFB 2VZ3A 1RZKL 4PJFF 5C92A 3M1BB 3DSFL 3RI5F 2XIDA 2OZ4A 3I50H 3T0XA 1OY3B 4E41D 3LKOB 1EO8H 4X4MA 3LV3B 4HKXA 1XR8B 2UVFA 2ZOKA 3K46A 4UQ3B 2CKNA 2V7HB 5TQ0L 5I2IA 3MRFB 3OHXA 1H3PL 2DQUL 2G2RB 2ICWA 5SWSA 5JHDA 2VQUA 1MJ7H 1P2CA 5TF0A 5EC1B 2YD1A 1CXFA 3L9RB 3O3BB 2IH1A 4HPOH 3PP3K 5K59F 2B1AL 4FFYH 1BEYL 4JFFB 1MCPH 5EIIB 2AJUL 1BQHA 3QIUD 3Q6GL 1IGJB 2AJ3B 1YEJL 3ZTJH 3GMRB 1OD7A 2IADA 5FEBA 4J6RH 1EBAA 1GGBL 3QA3B 3X17A 3ZE2F 4PBVC 5IBTL 4DKAA 4TVPL 5C08E 1T0NB 4H20H 3MRJB 3BDYH 5DHVB 1AGCB 1F3RB 3WXWL 2D03L 4S2SA 1A6AA 3A6CH 1UB6B 2A1WH 4M7LH 5IMMA 3RY6C 3HNSH 3JV4A 4I48A 5KBNC 4YEFA 1WTGT 3L95A 2J8HA 1ZVHA 3STZB 1TPXB 4TTDD 4PRHA 4ZQKB 4G9FD 1I1AC 5JW4Q 4JG0H 5B38A 3MNZB 1KEGL 3U48A 4NM8L 2VDKH 3GSNA 4GBXC 3SDCC 1HHIA 5I8EB 4HIEB 1WC7B 3L3JA 3U46B 5DJ2A 4K3DL 4KMQA 1WCBA 2AEPL 3BW9B 3DRTB 4RFOL 3ZHLA 1FIEA 3C09C 4QTIL 3IAPA 5GS1C 1U92B 2A77L 3K8MA 3MFGB 3LRSA 2J6EH 2ZCHH 3L3DA 1G7HB 2N7BA 3FAWA 3MOAH 3QEGH 5B21A 2OK0L 1IFHL 1YN7A 5C0AB 2AJVH 4J3XA 5F1IA 4RBPH 3V0AC 3WFBL 4LSDA 4N0RA 3SE3C 4WU7B 2WAHA 1WZKA 4P5KB 3I50L 3RIFF 1IAII 4QY8B 3TVMA 1EO8L 4Y5VC 4POYA 1W0VB 4LDEB 5KS9B 1C5DB 1HWGB 2K7QA 3LZFH 1JPTH 3P40A 2H32H 4JFXA 3CLEH 1CI5A 5IR1B 2DQCH 4MQXC 1MJ7L 3KYAA 1I85A 3JTTB 3MRLB 5LQBH 3O6FB 4PP1C 4HPOL 5D7KD 1I1FB 2VLRB 4FFYL 2NY3C 4ONHA 1YY8A 5IHUH 1LEIA 1MCPL 2VKXA 4XX1E 1MLCB 5E8PA 2FEEI 1EH9A 4J6RL 4YDKH 4NUGH 3KYKH 3B83A 3RVUC 3EGSB 4NQSB 4NQEA 4MJIA 4Y19B 3QBTB 4J3OC 1CICA 4WV1B 1T21A 1NUNB 4P3DA 4H20L 3ULUD 3BDYL 5FA3A 1CG9B 3PL6A 5KJRH 3A0OA 5KZCD 2W9LA 4BUHA 4YNYA 3A6CL 2A1WL 4M7LL 2EC9T 1I8KB 1NBYB 3T0DA 3KPNB 3LSOB 1YQVH 3HNSL 4P57B 1LO3H 1I1YB 2Y7QA 3VXTA 3IJYA 1CD1B 3LD8B 4S0TD 1MI5E 5DK2B 3OXSB 2F74B 4Z7UA 2VAAA 3U9PH 3N9GH 5D7JA 1EV2E 3GSWB 2E9IA 5D1XB 5E8OA 3QDMD 4GRLA 4KJQD 2GCYA 3O4LB 3CK0H 4JG0L 1JV5A 5IF0A 4UDUA 4LBEA 1S9YA 2VDKL 3SJVD 1FYTB 4PP2A 2BX5A 3E3QE 3QUXD 1C1EH 5GGUA 1IKNA 5FDWB 4U0QB 4X7TB 5DTFB 2F54B 3G5ZA 1YEGH 1JPFA 1OF2B 3O11A 3RDTB 4OLZH 4H88H 1CLZH 1S9WA 1ZE3C 1J1OH 1ZWIA 4PY7A 5DRNB 3K4ZA 1IQDA 1PY4A 2C7UA 2ICCA 3S4SA 1LP9F 2AVGA 4L4VB 4DUVA 1OVZA 3U0TB 1ND0A 2QKIA 4X5XB 5HSFA 3ILPB 4MHHG 5ICYA 4IRJA 2J6EL 2ZCHL 3MOAL 1FE8H 2P5WA 3QEGL 3SDDD 3UYRH 1AHWB 4KK8D 4QRSA 2AJVL 1IM9A 5F3BB 3VGAC 2APTA 1A9EA 3GMQA 1JYVA 4G8EB 1T5WA 3BDXA 3TZVC 3O2DA 4JFHD 5K9KA 5HI4C 4TOYH 4IRSB 3QEQA 5TQ2H 2BOCB 1RSFA 3LZFL 4DOHE 1JPTL 2EECA 3QUYB 1HXMB 3CLEL 5IHZA 1RZFH 2DQCL 4WI3A 1XCQB 3HPLA 2DKSA 1A3QA 3TVMC 4NRZB 3V0VA 5LQBL 5DJZB 5DRZA 3QRGH 4IOIA 2VXVH 2FDBP 2FO1A 1NMAH 1XGRB 3BEVB 4HMEA 5IHUL 1YJDH 4XGZB 1B0RB 4MCYB 4PRBA 1I85C 3DV4A 5BZDA 4WFEE 4PJBB 2GFBB 1X7QA 1CFNB 5BS0D 3H7BA 4YDKL 4NUGL 3KYKL 4JRWA 1D5XB 3KPSE 1T3FA 4L5FL 1G6VK 1BM3H 2J8UB 2C1PA 1CBVH 1P9MC 2BSRA 3LKQB 4QTHA 3RZCD 5C09A 5KJRL 4HH9A 1HSBB 4OFYA 3FQUB 4N90D 3VD4A 1MFAH 5IROC 4PJGB 4C4KT 2LABA 1CICC 1YQVL 4F7MA 1DEDA 1LO2H 1LO3L 5C07E 3PL6C 1HNFA 4AZ8A 5JMOC 5F88A 4QWWC 1B0GA 3MBED 3U9PL 5EIVA 1G9EA 2XACC 2G75A 3G5YA 2JELH 1KTRL 3MROB 5JLZA 4LLYA 3CK0L 3LKNB 2LAAA 4I5BA 3TA3D 3ZDYF 1D5ZA 4P5TB 3UTTB 5IEKB 4G8GB 1C1EL 5D7JC 4RAVB 4B53A 4KV5E 3DUSA 1YEGL 4GRLC 4QHNB 1SY6L 2VDOH 4OLZL 4OFIA 4H88L 1CLZL 5IJVB 4GKSA 1J1OL 1PVHA 1MAJA 2ZPKH 4ACPA 4NUJB 3DXAA 1IKNC 3I6GB 3RKDC 3UMTA 1EZVX 1DQTA 1ZGLM 1FE8L 1NBZB 3UYRL 1T22B 1NUFA 3MRHB 3QCVH 2UZIH 3PABB 4BH7A 1FL5B 4HFWB 4MB4A 3P11H 1DN0B 4G3YH 5TDPB 5D6DA 3VXNB 4M9OA 1TZGH 4UU9A 4NOFA 4IRJC 1Z5LA 3W0WB 2QHRH 4TOYL 1ITCA 1G9NH 5TQ2L 3HI1B 3AREB 5FOBA 4LRNH 3FB8B 1KB5H 3OGOE 1RZFL 3H3KA 1KIQA 3EO1A 4JDZB 4UQ2B 4EIZC 5C0ND 4ELME 4X5WA 2ED8A 1ZOXA 1F4YH 2ATPB 3QRGL 4NC0B 2L7JA 2VXVL 5EA0H 3GFUA 1JBJA 4JFZH 1NMAL 2BHZA 4LCWD 1WFNA 1YJDL 4C56E 3QUZB 4NSKA 1U8KB 5HDBE 2A6JA 3MV9E 3HE6D 3ZE1F 2VWEC 2AJZA 2GIYA 3P9LB 3GJEA 3W2DH 2ADFH 1WLHA 3DUUB 3ZDXF 1U3HD 4S10A 1BM3L 1CBVL 4DN4H 3QSKB 5DJ0A 3RAJH 3E6HB 2VLKB 3VXOA 3SGDH 5KSAB 1PX4A 1MFAL 5C0BA 1NGQH 5F6IB 4KV5F 1LO2L 3BP4B 5JTWA 1U3YA 4HKJA 4MD4B 1AKJD 2VUYA 1CE6A 2D3VA 3VWJA 2W9DH 5I66A 3EDKA 4PLJD 1AD9A 4I2XA 1ZA6B 2JELL 5I1HH 1GGCH 3GSXA 5E8EB 4GG6E 3SCMA 4XBGA 5CLWA 1LHZA 4X8XA 1VCAA 4Z7WA 5JUEH 1M71A 2VDOL 4AQ1B 3AU1A 3BHBB 3K7UA 5ADOH 1LNUB 5F9OH 1FH5H 2R69H 4O2FB 2I24N 2F53D 4P2QE 2PXYD 2CO7B 1X5YA 4KI1A 2DICA 4NQDA 5HJ3B 3KS0H 2CGRH 3QCVL 2UZIL 4JANB 3VFGH 4AT6A 3EJZC 4PYHA 4RISH 3P11L 2EDJA 4G3YL 2A83A 4P9HC 1TZGL 4G6FD 2PYEB 5EOTA 4HUVB 1QSFA 2WBWB 3SDXA 3MR9B 1OM3H 4KKBD 2QHRL 4V2CB 4U4BA 3VMOA 2ZOLA 1G9NL 2NW3A 4QT5B 5M94B 3C6LB 4G8FA 4KH2A 4LRNL 4ZFFA 3GMOB 2YPLA 1KB5L 5D6DC 4CKVX 3D0LB 5INCB 3U30B 1M6OB 1KIPB 3OJDA 4M6OH 4QOKE 5EA0L 3P30H 1JRHH 1AO7E 4JFZL 4JN2A 1ZMYA 4HXBH 4JQVA 4HZLB 2QJDA 4AENA 5JZ7C 3CVHH 5E00A 1M7DA 1EMTH 2C9AA 4PJCE 5BQ7A 1CXKA 4D9QE 2GJZA 4HS3B 4X99B 3WIHA 3OQ3B 3SY0B 1MWAB 3BH9A 1T7WA 3W2DL 5MHSE 1E27A 1P1ZB 1ZGLA 2ADFL 5E2WH 3LEVH 3O6LH 3VXRB 4NZJA 4DN4L 1MQ8A 2VZOA 4TNWF 4EI6A 5CD3A 3RAJL 4OZIF 5JHLH 2APWA 1OGTA 1RHHB 4X6FA 3T65B 2K1MA 3U6RB 2OXGA 2FBJH 1SBBA 3L6FB 4G9DA 1CR9H 1YNKH 5DJDB 1Q94B 2EDBA 3DYOA 4QHKJ 4XAKE 4JFFD 1NGQL 4FOMA 1C7SA 1NAMB 2GK0A 1AP2B 1FLRH 4OAWB 2BXYA 4R97C 1PG7X 2E8ZA 3F7PC 3LQZA 4GXVH 1WBZB 4X6DE 4PRIB 1KTKE 5C0DB 1OSPH 4UOW0 5CBEB 2W9DL 1JWUB 1MCWW 2BNQB 1VACA 2XZZA 4J8RB 4WWKA 5I1HL 2HJFB 1FDLH 1DJSA 3BYTA 3O8XB 4K55A 2O5XH 2NYYC 4OF6A 3VWJC 1UZ8B 4U33A 2ZSWB 3D69B 4KROB 2EDYA 4ERSH 1K8IA 5DMIH 1ZA3B 2FZ3A 5E1AA 3D2UA 5MI0C 5JUEL 1A4JA 3GJFK 5LBSH 3PP3H 5D93C 3K80A 3SCMC 3TJEH 5EC2A 5IG7B 5BOZG 5ADOL 3TBVA 4MX7A 3IFPA 5F9OL 1FH5L 2DWEB 3I3BA 2R69L 5FAAA 4BSWA 4KTDH 3IDJA 1EFQA 3LVEA 2FX9H 4NFDA 5CP3H 2VQTA 5D7SH 2CGRL 4QHKI 1NFDB 1MRCH 4RMUA 3VFGL 4X7DC 2QBWA 4RISL 3S37H 3O3DB 4I0PB 1T04A 4NHUA 2R1WA 1ETZB 5K9JH 4XWGH 1PLGH 1OM3L 4ZUTA 2Z31D 5D7LD 3UTQA 4KWUA 4CN6A 3GMPA 3HRPA 2NZ9D 4V1DB 3W5MA 1XZ0A 5HYJB 3NCYP 2ENSA 5JW4M 1NGPH 2OX5A 4LIQH 3H9YA 5HDOA 4NO0B 4Q6IA 5C0AD 2Z92B 1TTUA 4M6OL 3P30L 2ATKB 1JRHL 4X4XB 1JPGB 1TCRA 3F7YB 4HXBL 2P4AB 5I8OH 5DS8A 2XTJC 4X7FC 3CVHL 1EMTL 4LIQE 4LVHC 4TSAH 5DVMA 5C6TL 3RIAK 4MAYA 1A4KB 3GBMH 2YWYA 2XWBB 5DYOA 3SGKA 1IMHC 3MRQA 2PW2A 3I02B 4MD0A 5H37H 4MCZA 3LEVL 5E2WL 5EBLB 4ZFGH 3O6LL 4NWTH 4YXLH 4JLRB 2APBA 5JHLL 3O6FD 1DR9A 3VXMD 1TQCB 1QFPA 2FBJL 2V2TB 3CFIC 1T1WA 1CR9L 1YNKL 4XPBH 5HVGB 1IL1B 5JIPA 3RA7H 2QLVB 2EYRA 2AK4A 5BO1H 1FLRL 3MJ8B 3AMLA 3BGMA 4HUUA 3L1OH 1OSPL 2VUOA 5ESVA 4BM7A 3X11B 1YMME 1FDLL 1LK2A 4Y19D 2RFXA 4P23B 1IGTB 1CU4H 1NCWH 4OT1H 4H1LH 4PR5A 5DD3H 5IW1A 4ERSL 5DMIL 3F6IA 3K2UH 4L9LA 3Q5TA 1E6OH 4WWKC 1MCHA 3MYJA 5LBSL 1KJ2A 4M03A 3VFOA 4AJ0A 1KLUB 3TJEL 3HS0B 4Z7WF 4E41E 3RU8H 4GAGH 3M17A 3MRPA 3O45A 1G1YA 1KIRB 3I9GH 1I3RA 5DC0A 4JFEB 4FTVB 3EYQC 2E8YA 4WTWA 4HKBB 4KTDL 4YHOH 1CCZA 3K74B 5D1XD 5AUMA 1X3DA 2FX9L 2NXYC 5D7SL 4P2RA 1MRCL 3F12A 3BIAX 1AGDB 1U2HA 3JXAA 3QNZB 4GG8A 3S37L 3MO1A 4OZFA 1J8HA 4MXQC 1DLHA 3TYGH 8FABB 4FMKA 3RDTD 5K9JL 1WISA 1MHHA 4XWGL 1PLGL 1H15A 3AAZB 1BVKB 1T4KB 2EDLA 3MA7A 3KXFB 5CHNA 1TQBB 3SDXF 3C9NB 5IFJB 2YR3A 5I15H 1FIGH 3FO1B 1IEAB 1MCWM 2IFFH 2HJLA 2EZ0D 2YSSA 1NGPL 4LIQL 1GAFH 4IOFC 3IGAB 1WIPA 3L5HA 3KDMB 1Q9LA 5JXEA 5I8OL 2Y25A 4XRCA 4NN6C 1BBDH 4YFDB 4TNVF 5JA9A 1TXKA 4OCYH 4Q6IC 3S9DB 3KR3H 2X4QB 4TSAL 4P46C 2P48B 1OAUH 3QIWA 4IRSD 5EZLB 3GKZA 3GBML 4GW4B 3UYPA 1R3KB 5KSBE 3QISA 1XF5B 1HKFA 3QUYD 4A6YB 1OGAD 4YXLL 2VN4A 4NWTL 4Q97A 4ZFGL 5CEXB 1OOAA 5CZXC 4UUJB 3VI4F 4ZNCD 4MAYC 3T0VA 3X14A 3H0TA 3SGKC 5DRXB 3EOBA 4OM0H 2CUHA 4XPBL 4HIIA 4NN5C 3RA7L 2GSIB 3QI9C 3PIQB 5JW4R 2E7CA 5BO1L 4JZNA 2E27H 5CIPA 5JR1H 4PG2A 4R4FH 3LDBC 3ISWA 5IMKA 2BNRE 3L1OL 3TT1H 3TPUB 1JGEA 2C3HA 3B9KC 4CN1A 1XGPB 1BX2B 4FQLH 4XAWH 3BPLB 4PGBA 4F9PA 1F13A 1R3IH 1ZT4A 3KLAB 1S7WB 3VGFA 3D25A 1CU4L 1NCWL 1QVOA 4OQ1A 4OT1L 5DD3L 2PYFB 1HHGA 2ESVD 3K2UL 1E6OL 1A6UH 3I75B 4LPTA 3Q48A 3TBYA 4R9HA 3PWLB 3RU8L 1P7KA 4JKKA 2ICWJ 4GAGL 1FCCA 4PTTA 3I9GL 3ARBA 2AERT 2MJWA 2DN7A 5I1AA 4L9LC 4W68A 5F7DA 2KQMA 1X5LA 4L8SA 4YHOL 4XMPH 1MH5B 3CXHK 2H3NB 4PGDA 2CDFA 3T8XB 3QWQB 4EI5A 3G04B 3RKPA 1DQQA 3RNKA 3T3MF 4P5TD 3UTTD 5D7KE 3L3HA 4G8GD 2EIDA 3TYGL 2V5SA 4NQUA 5AZ2H 2R0KH 2HRLA 4YAQB 3T04D 2I25N 3RWGA 4JCLA 4MDIB 1DVFB 1UJTA 2EXYC 2AXGB 2YA0A 2NNAA 5J6HB 3FFCA 5I15L 4GLRH 1FIGL 4WFGD 2IFFL 1JE6A 2Z91A 3FB7B 1GAFL 5DMGD 2Z93A 2AJSH 3FRPA 3RNQB 4KXZI 1PD6A 4ODUB 2E9WA 1CD0A 3CSPA 3CGTA 4L1DA 1BBDL 5TH2B 4MZ2A 4TUOA 1Y6MR 3DX7A 3W0WD 4OCYL 3KR3L 4YHPA 4HAFA 1OAUL 3BFOA 2NY5H 4WUUA 3ARED 4PJIB 2XT1B 1IVLA 1JNNH 2RHEA 1ROWA 2DQEH 5DSCA 4ZO7A 2K9UA 5JW4N 4PJXE 4UBDC 3MCG1 4NGHH 5TDOA 3PNWB 1GGUA 3QDME 1T7VA 3EYOB 3MLVH 4HS6B 3QIWC 4JDVA 1YEHH 4MWFB 2ZUQC 1R5VB 5ITBH 5IB1B 4WFHE 5HI3C 4OM0L 2X4OB 4YDVB 1VADA 4ZFOA 3QUZD 3MTRA 2E27L 4YHNA 1AE6H 4I18B 5BV7B 5JR1L 4R4FL 3ZT7A 4KK5C 3JUYA 3TT1L 3WNOA 5IEHB 1RZ8B 1IGFH 5L2JA 1CFQB 4FQLL 4XAWL 5B3JE 2NCMA 1R3IL 4MA3A 1JPST 3DV6B 3SE9H 2ADGB 4PG2C 3ETBF 3RWJB 4LPVA 3OB0K 1K4CA 4WFFD 4MQSB 3NCCB 4ZOAA 5KSAD 4F9PC 3GB7B 3GSUA 1A6UL 3V6OA 5I8CB 4WI2A 3W11D 4JFHE 5GJTH 3RVVD 5HGDB 3LHPH 2FECL 2C1OB 2OBGA 1ZT1A 4HGMA 4JGJA 3BVNA 1I7RA 5CP7B 4XMPL 4HWZB 4U6HA 3BYYA 4RRPG 5HVHB 1INEH 1U3JA 5SX5K 1TNNA 5C8JA 3ARBC 5F93C 4PGCB 4L8SC 4JFDB 4LEOB 3GMLB 1W72B 2XZCH 5AZ2L 2X44D 2R0KL 2DIJA 2NY4C 4ZOCA 4EI5C 4PV8B 3V6FA 3DGCR 5J3HC 2R2EB 3H2WA 3PQYA 2OXHA 1YEKH 5D9SA 5BS0E 5DJCA 1WIOA 5C08A 4KKLC 5IB2B 4U1IB 3VJ6A 1NDGA 1JWMA 2AJSL 1YA5A 3WS3A 2AEQH 5KVMC 4NKQB 1X5ZA 2AQ3A 5F1OB 3DSNA 4RMVA 2PYED 3RPKA 3Q2CA 5IBUG 4OZGB 4KFZC 1MCQA 5ENWA 2P1YA 1QO3B 2NY5L 3T08A 4NO3A 3C6LD 4Y4FA 3WN5B 4YBQC 1JNNL 4P3CH 1FJ1B 1JF6A 2DQEL 5SWZB 4L9DA 3X12A 3ARDA 1FO0B 4NGHL 3O4OB 4J3UA 4YIQA 3WO4C 1MCBA 3L5XH 3MLVL 5B3JF 4L4TE 1YEHL 1Q72H 4HF5H 4N0UB 5HD8C 5ITBL 3MZGB 4J12A 5CILH 3ULSB 1WICA 2PTVA 5MENA 4HPYH 1UXWB 3C60A 2HKHH 1AE6L 2L4OA 5J4MA 1IGFL 1A1MA 2I9LA 4RWYH 3SE9L 1SJXA 1C7TA 4H0HB 3VXRD 5I74C 5IWLC 3TO2A 2IBZY 3CC5A 3BZEB 1Q9WA 2WBJB 2CK2A 1A0QH 1KPRB 1S5HA 4X6CB 3TF7C 4MNHA 2NX5A 1WK0A 2DM4A 1OP3K 3S37X 1MCOH 5EU7E 5DC4B 5GJTL 3KPOA 3LHPL 3IDMA 3MNVB 4RGNB 5FYJH 4DGYH 4JFOB 4ZYKA 4GBXD 5D1ZB 2BNQD 5HHOB 4E42B 4GO6B 5J1AA 2RBLA 2OTUA 2PCPB 2VOTA 4XXDB 4X6EB 1INEL 4Y16A 3PHSA 4HIJB 4R0LB 3O8XD 4WI8A 2UY7A 5DJ6B 3UEZA 1JHLH 1DUYA 2J5LC 3DTXB 5FYJE 4CADA 5E7BA 2LU4A 3RHWK 2PW1A 4KROD 4LCWE 3EDFA 3VE0B 5F9JA 4NQCB 3C5ZA 2XZCL 1FP5A 2ZNWA 4YDJB 4R8WL 4P3WA 3EIFA 1RJZA 1YEKL 2DQTH 4DFIA 4Y5XB 2P7TB 3RWEA 1GZQA 1UWXK 4R96A 2BVOA 3ES6B 3F5WB 3LEXB 5DUBB 4HJ0C 4ZUVA 5L2KB 5T5FH 3Q6FA 3WDIA 4L3AA 3TBSA 1T6VN 2AEQL 1CGXA 1I4FA 3IYLW 2BC4B 3U1SH 3ZSSA 2VLJB 1H5BB 4I0PD 1TJIH 5T3ZD 1MI5A 3HAEA 3OAYH 1D9KA 3GSOA 4P3CL 5J89A 4OKVA 4V1DD 3VFSA 4KZDH 3KPLB 1BWWA 4E0RA 3TBTA 5HYJD 1NMCC 2EO9A 3MRNA 3L5XL 2IQAB 5C0JB 2V5RA 1Q72L 1X5JA 2VZVA 1EPFA 4Y4FC 5HGAB 2G5BB 4WO4A 2Q86A 4OCXH 3D3VD 5CILL 5K93A 2E7BA 3ARDC 4HPYL 2HKHL 1CGVA 5EN2A 3AB0B 1MCRA 4WRLA 5CFHA 1AQKH 4NPYA 3F7VB 4AG4H 2NTSP 1I9JH 3OAZH 4YJZL 5FK9A 4YPJA 1NGZB 4GAJH 5L8KB 4RWYL 4WVRA 1F11A 4L29A 3C60C 5L8JB 1L4IA 2E7LC 3P4MB 4QRPE 2X1OA 1HH6A 1A0QL 2VXTH 1Y18A 3IFLH 1MCOL 5I0DA 3NGBC 4RFEB 3RL1A 3DETC 5EO9B 2ORBH 2F15A 4M6MH 4JZJA 5FYJL 2XA8H 4DGYL 3FO2A 3RVTC 1KGCD 2BSSB 4RFNC 3I84A 3P73A 5I6XB 3QNXB 5LGKA 2KUTA 5IW6B 5D7IE 5E4EB 3EUUA 1YC8A 2R1XB 2IPUG 1JHLL 1A14H 3OKEA 5MEPA 1N5AA 1FFPB 4OD1H 5B39B 4LMQI 4TRPH 5E6IB 5T1MA 1HILA 4Y16C 3BEWB 5CEYB 5E6YA 1UADC 4P4KA 5AAWA 5FHAH 1EIBA 1F97A 1H3WM 4ZOEA 3OKDB 4HUWA 3TBWB 4ISVB 3C5ZC 4F7CB 2VZUA 3N1QC 3DO7B 1JI1A 3MGTB 3CDYA 3TZVD 5ICXA 5T5FL 1YMHA 5LGJB 3QXAB 1JF1A 5ACZA 3ZKXC 1L7TH 5CGYC 2V2WB 3U1SL 4H5SA 2H41A 3MNWB 1TJIL 3G08B 2ZUYA 2YBRA 2P5EA 1CXIA 4UNTA 3V8CA 4J3TA 2XNAB 3KXFD 3QUMB 3V0WH 5DHVH 3HE7B 1MF2H 2IQ9H 4KZDL 5GIRA 5EU5B 1KPUA 1F90H 1D9KC 4JQIH 1AR1C 4G80B 4DWHA 1BD2D 2HT4C 4OCXL 3UROR 1XIWA 4PRPA 4APQD 3GBNH 3WHE1 3E3QC 1QRND 1P4LA 4HK0B 2ZZUT 1AQKL 1RURH 1RZGA 4JKMA 4AG4L 1I9JL 1JI2A 4GAJL 1GZPB 3TGXA 2VLME 3ULVH 2PR4H 1E4JA 5B39G 4PRNA 5JNYB 1PZ5B 5T5NF 5IB3A 4HC1H 4LDOB 3RVWD 4D8PA 2VXTL 3ULVE 1UB5A 3W39A 3IFLL 3BWAB 2X4UB 4Y4HA 2VMFA 2DI7A 4FQJH 5JIIA 1HDMA 5HHQB 2Z4QB 4NC2B 2ORBL 4M6ML 1KCRH 2AQ2A 5DD5H 1YEDA 3Q1SH 2XA8L 1A21A 1KYOJ 4LQFH 1MHPH 2HT3C 4ODHH 1N7MH 5B22A 4M8QA 1ZHBA 4J4PD 5HTSA 1A14L 5KOVC 1QBMH 4OD1L 5H35B 2EKSA 3BRDA 5FGRA 3RKDD 4TRPL 4L8CB 2MKLC 3DX6B 1NFKA 2G5RA 2MCG1 4M1DH 5A2FA 4ZPVB 2WINA 1TZIB 5FHAL 2CSPA 3BKMH 4X4YB 1P84K 4UIMA 2HT2C 1U91A 5KS9E 3QQ4A 2OR7A 4PJ5B 4RAUB 1MCSA 2A9NH 3CIQA 3NCJH 2DOCA 4NT6A 1QR1B 2DWDB 1L7TL 1WZMA 4L3EB 5DLMH 4EDXA 3BUYA 4JAMB 1QSVA 3BN9C 1LK3H 2VLRE 2HLFC 1AQDB 3C6SA 4JJ5A 5FDYA 1LO0H 4UNVA 3LQMA 3QWOB 5J12C 2YXMA 4JRXA 5BJTB 4FZEH 5C2BH 1FGVH 1AXTH 2YC1A 3PWVB 3V0WL 2YRLA 1LE5A 3FB5B 4WWID 1MF2L 4XP9H 2IQ9L 1ZGLP 2FHCA 3VMPA 2MOVA 2JIXD 2EYTA 4C83B 5JW5A 3DMMC 3QQ3B 3FCTB 2WIIB 1F90L 3KPTA 4ZO9A 4ZUUA 1XGUA 3MUGB 5FF6B 2APXA 4JQIL 1K3IA 4W6YB 5GS0D 5EH1A 3I3EA 4YGVB 3RTQB 2BSTB 5ICZA 3VGDA 3GBNL 3BPCB 4ELKA 3KYOB 2YPVH 2VXQH 1RURL 1J0ZA 1UXSB 2KPNA 2NMSA 1DQJB 5GZNC 1HEZB 1XIWC 3U36B 3ULVL 4MS8D 2I9TA 4XP6H 2PR4L 3EDDA 3P0VH 3O4LE 5GRUH 4HC1L 1YNLH 1MCJA 1FYTE 4XNMB 1T83C 1S8DB 2F54E 3MLUH 3O81A 4FQJL 1HI6B 2DI9A 3VRLF 1YPZA 1CQKA 5IOPB 1KCRL 2MQCA 5DD5L 4QRQB 3Q1SL 4YK4C 2XYCA 4LQFL 5I1DA 2AP2A 4JM2B 2PTTA 4L4VE 1DTUA 2ZSVA 3D85B 1N3NB 4PJFB 5BVJA 1MHPL 4QOKA 5GGVH 4ODHL 1AO7A 1N7ML 4MDJB 4D0CA 4MNQA 2CK0H 3B2UC 3RL2A 4XCYB 5A3ID 5GRVL 5GSVB 1QBML 4FG6D 3BWUC 2DQGH 4G8IA 4KC3B 4OJFH 3IKKA 1G9NC 1SYVA 1V7NH 4M1DL 1YC7A 2ED7A 4K7FB 5EU4A 1FBIH 3DVGA 2XZAH 3BKML 1CFTA 1BFOA 5CWSA 3MYZA 4OLYH 5GRYA 2IF7A 2NY0B 2A9NL 1MHCA 3KYMB 3NCJL 1H0DB 4LVOC 3WS6A 2GSGA 4C57C 3GNMH 3BOVA 5DLML 2VL5B 1MREH 2LTQC 5BRZA 1LK3L 1J8KA 3OB0H 4JFDD 3ZDZF 3ZKND 1R3LA 4O2CB 1LO0L 1JIBA 3O2VH 2XN9B 3RWDB 1A7NH 1UZ6E 3MUZ1 1K8DA 4G7YH 4N0CD 4PGEB 2CKBB 4FZEL 5C2BL 1FGVL 1AXTL 3U4EB 1T66C 4RIRB 3Q5YA 4PJBE 4XP9L 2J88H 4LFHG 1T1YB 1T7ZA 3MV01 3OBAA 4HEME 4PG9B 5C0EB 5JZ7D 3OKKB 3PJSA 1IEHA 3KPRA 4LVEA 7FABH 1TVBA 4DK6A 1SJEB 3NPSC 3P4OA 3G6JB 3QDJB 5SX5H 3EOAB 5IVXF 1X5IA 1QSEB 3OKOB 3QH3A 4CNIA 2R1YA 5EO1A 3DGGA 2YPVL 4X6BB 3SKMB 2VXQL 1R5IA 4FQQA 5FYLD 1ODAA 4FQIH 4UTBL 3VRIB 4IIQB 3ROOA 3MRBA 1YEEH 2B5IC 3CUPB 2ZG2A 1NSNH 5SWZD 1MJ8H 4XP6L 3T0EE 2BVPA 4NNXA 1UH2A 1W0WA 2VE6A 2P8LB 3CFBB 3NFNA 3P0VL 4BJLA 3V52H 3KLHC 4M7KH 5GRUL 1YNLL 2Q76A 5GS3A 1N5YH 3UTTE 4P99A 2BFVH 4G8GE 5H2BA 1VGKA 3MLUL 4X9GA 2CIKB 5DDHA 43C9A 5AG8A 3DIFA 3MA9H 5DFVC 2A9MH 2LAGB 2NYYD 4MXVE 4KI5E 2HLAA 2DYPB 4WJ5B 4LLQB 5GGVL 1BJ1J 1ZHKA 4GW1B 3IS1X 4MA8H 2CK0L 4HIHA 5C0CA 1HSAB 1XEDA 2DQGL 3SKOA 4PJAA 1NC4D 4OJFL 4DQOH 1J87A 4NQXB 1VKXA 1V7NL 3IU4H 3ARWA 3KWWB 1FBIL 3MGAA 2DDQH 2XZAL 5I75C 4RGND 2R23A 4JFQA 3VFMA 1S9VB 4R7NA 4YO0B 4OLYL 5B4MC 2WWMC 3QCTH 1VPOH 5HGBA 3ILQC 3WE6B 4OUOA 5J13B 1YUHB 3CFKA 1DCLA 3GNML 2H9GB 4QLRA 3VFTA 1MREL 1S7RB 2EE6A 4ZO8A 4ZDHA 2DIAA 3FOMB 1L0QA 4N9GA 3O2VL 1J11A 3WS6C 1A7NL 2X4RA 4M93B 4G7YL 2PO6B 3VRJB 4PJEE 1OP3H 4LAQH 2X40A 1YMMA 4PJ7A 1EBPA 4TULL 3SGEI 3DROB 4HCRH 2J88L 1H3XA 3IF1B 2FYYA 3VXUB 5L2KD 1N0XH 1ITBB 1EXUA 1S7VA 1CT8A 5E5MA 5CSZA 7FABL 2XTLA 5L0QB 2NY1C 4XPTH 4Q9RH 4WTZG 1OWWA 2VLKE 3B9AA 4WFFE 4OQTA 1TVHB 3IVKA 1ZS8B 4E41A 3AS1A 2VLJD 1A3LL 4WW2A 4Q58C 2SEBB 4OZ4B 4NDMA 4H1LA 4Z5RB 4W4NA 1J18A 4I0KA 3MJGX 5GJSH 4FQIL 1YEEL 5C70A 4LL9A 1NSNL 5LKNA 1UYWH 3FN9A 1MJ8L 4HULB 4MXVF 2FHFA 2N56A 3V52L 4HX1B 5LAXB 4POZD 1FG2B 2FATH 1LP9B 2VISB 1SEBA 1N5YL 2BFVL 3QIUA 4CW1B 4KHTH 3LH2H 4HWBH 5LVEA 2IH3B 1ORQB 4R2GB 2OL3A 5KANI 4JPWH 2XKUA 3MA9L 3ZTJG 3TCLB 2X7LA 2A9ML 1DBJH 1RVFH 1YPZF 3PV7A 4PJ9B 2YPKB 1V3MA 2NY2B 5F1NA 4QF1B 4UT6H 4MA8L 1KCLA 1OTSC 4U1MA 2ADJA 1GL4B 4DQOL 4YLQT 2ZOKB 3IU4L 1KJVB 3LPWA 2P49B 2NXYD 5EO0A 4YHZH 2ICWB 4F7PA 3SDAC 5C0GB 2DDQL 5GRZA 3JV6B 1CDCA 4GFTB 4G9FA 4LLMA 2IH1B 1BFSA 2WLZA 3QCTL 1VPOL 2YD2A 5HI5C 3QPQD 4KJPD 1BQHB 3F7QA 2NW2A 4NQTA 3QJFA 2VR4A 4XC1H 4FFVC 3RGVB 4ZO6A 2IALA 4LSUH 2FRGP 4FFWD 5I17B 2A6IA 4LAQL 1B6DA 4HCRL 3ESVF 2HJKB 1LILA 5DMKB 5DUMH 2X05A 5BCAA 3VXSE 2P8MA 3C8KB 1N0XL 2VABA 4S2SB 3U4AA 1NAMH 3VXRE 4LCYA 1CDYA 1JN6B 4P46D 4XPTL 4Q9RL 3EJJX 2Z8RA 5GGVY 4N1EA 1MAMH 4KUCD 4LP5A 4NQVA 5CZXD 4PRHB 4GAFB 2R2HA 1LE9A 5GJSL 2IPUK 4DZ8A 1WITA 4PRIE 4Z0BH 5EZJA 3ZHDA 3HE7D 2WP3O 1UYWL 4WW2C 4XT1C 3GSNB 4QGYA 4CMHB 3ZYZA 3WV0A 1DLFH 5F8RC 1YNTA 1HHIB 1JF5A 2FATL 3B9KD 3X13A 4NFBA 3LH2L 4HWBL 3KPMB 4JPWL 3ARPA 3LRSB 1DBJL 1RVFL 2MHAB 1INQA 1EAPA 3FQWA 1I1RA 2VITB 1BQHG 2QR0A 1MEXH 4UT6L 3MPCA 4Y2DB 1NFDE 4UDTA 4KHXH 2AXJA 1J1PH 1QFWM 2IPTH 4PJAF 1KT2A 2IPKA 2HYMA 3DI3B 4YHZL 3I6LD 2FNBA 3KPSB 5M7QA 3OF6D 2DQJH 2V6HA 2FCBA 4PJXA 4QRUB 1IKFH 2CDGA 2R0WH 3QDMA 4HT1H 4JDTH 2WZPD 3RJQB 5E2JA 3REVA 3GDBA 2EXWD 1IAIM 3PWPB 3T77A 1HH9A 4N8VA 3KLSA 4ONHB 3SJVA 2XQYG 3L3KA 3UPAA 3QUXA 4WENB 3RWFA 1MCKA 4XC1L 5E8PB 1Y6KR 5INDB 4HJGA 1QZ1A 3QAZB 5ABDE 4LSUL 2CRIA 4EUPA 1BHGA 3UYOD 1BZQK 5AD0A 4NQEB 4MJIB 1CICB 2DM2A 2JCCA 4QHMA 5DQJA 4P3DB 5TE6L 5DUML 3SDDA 2AKRA 3VFNB 4PJ5D 5FA3B 3LN9A 4PJ7F 5GZOC 5FO8A 3BZFA 4YNYB 4N5ED 1NAML 3DURA 3F62A 2WP3T 4Y7MA 4X7EC 4KY1H 1RJCA 4L3ED 4RQQB 2AS5M 3LB6D 4JY4B 5IMOB 1K85A 2Y7QB 3IJYB 4I13B 3VWKC 3GSRA 2ARJQ 2CD0A 1CTNA 2VAAB 1A9BA 4WW2F 1NMBH 5E8OB 2GCYB 3SGJA 4Z0BL 1JV5B 4TQEH 2VQ1A 4U3CA 5HI3D 1KGCE 1FVCA 3F65A 4UDUB 5IF0B 4PP2B 5TE4H 5E56A 3SO5A 1DLFL 1ES0B 1Y0LB 2Y06H 1EDQA 2YN3A 3O11B 4JFPA 4CVZA 4KK5D 2IANE 3JSSA 4BQ8A 5C0FB 4NC1E 3HC3H 3UTZA 2FO4B 3FT3B 1ZWIB 3S4SB 2HAZA 1LEGA 3VCLA 1AD0A 4OV5A 4B41A 5BS0A 1XAUA 4HDIB 3CH1B 1J10A 4GS7B 2P5WB 4U49A 4ELMB 4M7JH 5GSRA 4JFEE 4FTVE 4QRSB 5C6PB 1IM9B 1OTTD 3ARFC 2HFEA 3RZCA 5FA4B 1MEXL 1K6QH 3DNKA 3GMQB 4A2MA 3AMKA 4NM4H 2IG2H 1KB5B 4K9EH 1T5WB 1N64H 2HTLD 3JWOC 4LKCB 5D2NB 4KHXL 1U8NA 3MV9B 5K9KB 2X9WA 1J1PL 4KJYA 5FGBA 4XMKL 1WF5A 4Y8AA 2IPTL 3MXWH 3MBEA 2W0FA 5IHZB 1JGDB 2DQJL 1OAYH 2X4SA 3KXFE 3WHE0 3S35H 4KKNA 3P4NA 2NLJA 2VXSH 4M61B 1IKFL 1I7TB 2R0WL 4HT1L 4JM2D 4JDTL 2C4FU 4JFYB 3V0VB 2W07A 3D85D 5DRZB 3QFJE 3TA3A 1U8PB 1RK1B 5D1QB 2EDTA 5I18H 5IHLB 1OP9A 3HB3D 5FKAA 5J3HD 1VFUA 3BGFB 4KJQC 3DV4B 1D5MA 4PJDF 2N7AA 3MLTA 4HLZG 3QZWA 4KKLD 3RPIB 2NY5C 1X7QB 4A6YH 1RIHH 1FVDA 2WNGA 3KHOA 3KJ6H 5I73B 3BQUB 3QUXC 2UWEE 4YDLB 4OZIB 1OAKH 2GAZA 5EBMB 2C1PB 1QFHA 5F6HJ 4QTHB 5C09B 5D71L 3C2AH 1KV3A 2NY0D 3D1MC 1KN2H 5IQ9A 5A16A 1CN4A 1S9XA 4O02H 3QEHA 3S4SG 3RGHA 4KY1L 4UB0H 3IAGC 5MEOA 1U58B 1QEWA 1OB1A 4TVPD 5TGBA 5F8QC 4BSVA 4KRNA 4I3RH 5I9QB 2XN9D 3BKJH 3G5YB 1NMBL 4YHIA 3MC0A 5JLZB 1YY9D 3QULA 4LLYB 2JK5A 3MV7B 5HD8D 3V5KA 4I5BB 4TQEL 1D5ZB 3MGOA 4ESKA 4Y4KB 5TE4L 4AIZB 5MEQA 2X2YA 4DAGH 2Y06L 4LCWA 2CR6A 4KUZH 4M3JA 4MSWA 3SGJC 1DP0A 3B3IA 3QDJD 5EZOH 3HC3L 1RQ5A 4GKSB 3O41A 3HE6A 3DXAB 3NCMA 4HS8H 5F6HI 1G7QA 3UTOA 5HY9B 1F42A 1CDIA 1Q1JH 4S11A 1F02I 4K3JH 4M7JL 4KDTC 4RA3A 1U3HA 5HYSB 2ITDA 1JHKH 1XR9A 2AEWA 3AY4A 5EOCH 3JTSA 1DQDH 4BH7B 3L5WA 1K6QL 4NM4L 5GXBB 2IG2L 4K9EL 4BH8B 1N64L 1WAAA 1CYGA 1WQVT 4UU9B 3ULUF 3BZ4A 1RZIA 3MV8E 4XHJD 25C8H 1UJ3B 4OLWH 3RZCC 3CFEA 3IFOB 5JPNA 1CVSC 1BREA 1AKJA 3MXWL 3ZYIA 3SKJH 1A7PL 1FL6A 1G7IB 1OAYL 4JZOB 3S35L 3P9MA 4QO1A 4IJ3C 2OM5A 5DVOA 2VXSL 3BP5B 3FB6B 3KPQA 5FGBC 2DYPD 4OCMC 3GJFA 5FYKH 3EDEA 3QDGE 3DOSA 1QLRB 4QXGL 5I18L 3I2CH 3EYVB 2Y5TB 2GUOB 3RI5K 2A6JB 2D31B 1PQZB 5E1HB 2RIKA 1LMKA 1C5CL 3TA3C 3B6SA 1HHHB 2AJZB 1T0MB 4A6YL 1RIHL 5FYKE 3E6FA 2DQFA 3KJ6L 2YUWA 1CLOH 1YEIH 3VH8A 2X6MA 1OAKL 2PETA 2V9RA 3T4YA 4PGJA 1QLFA 2F53A 2PXYA 4PJIE 3H9HA 2XKNB 5DJ0B 4Y5YA 1FN4A 3C2AL 4JE4B 3R8BB 5I71B 1KN2L 4POUB 1LQSR 4O02L 2GY7B 4N0FB 1RULH 1G7JB 1J0JA 4Z7NE 4UB0L 5C0BB 3HCVA 4D0DA 5JORA 1MCDA 1MFDH 4NRYB 1T0PB 4HKJB 3B4NA 4MJ6A 5TJWK 4I3RL 2J12B 4DVBA 3BKJL 4CVWA 3KYNA 4N1CA 5HYSG 1AD9B 2R29H 1RI8A 3L3IA 4M3KB 3GSXB 5EU7C 3FJTA 1SVZA 3CCHA 4XBGB 5DXWA 1AGFA 4CN4A 4Z7VA 5F21B 4Z7WB 4DAGL 1BPVA 4XHQA 2FJFA 1M71B 1GOHA 2CMRH 4KUZL 5HHMB 5EZOL 3AU1B 5C0NC 4PUBH 2XV6B 3LKOA 1VFBA 3LV3A 4HS8L 5K9QI 2IMNA 4MJ4A 4ALAH 1Q1JL 3MRFA 1D6VH 2G2RA 4K3JL 3NVQA 4NQDB 3UP1A 4I4WA 1JHKL 5EC1A 4AT6B 4MB5A 1UH3A 5EOCL 1DQDL 4EQ2A 4ONOA 3O3BA 1TCMA 1W72H 3DETD 3ZO0A 4WNQA 4L4JA 2XXCB 4PREB 5EOTB 1QSFB 2CIIB 3SDXB 4JFFA 1U41A 5FECB 5EIIA 3GSVB 25C8L 3B43A 4OLWL 3AY4C 3BXNB 4JFDE 2AJ3A 3QXDA 3GMRA 2YPLB 4R2GD 4NN7B 3SKJL 1B4RA 5EUOE 3HC4H 4KKCD 5E03A 4Q9CA 1C8PA 4B5EA 3OJVC 3QPXH 4DEPC 4JKLA 2LFGA 5C0IB 1AY1H 1JWSB 1QNZH 1ADQH 1QUNA 3N1GC 5FYKL 1JGVH 2AJYH 1T0NA 2NY2D 4Q9QL 4DKEH 3MRJA 3WIIH 5E2UH 1AGCA 3CVIH 4AENB 3I2CL 4YE4H 3WFEH 1UB6A 4OCWH 1VEPA 2GJZB 3RIFK 4M6AA 5ESAB 2CDEA 3T4AA 4Z7NF 1Q38A 3BH9B 1FO0H 1XGTB 1TZHB 1CLOL 1YEIL 3STZA 4OZGE 1BIIA 5FYLE 1ZSDB 4KMLB 5JOFA 1K2DB 4ZQKA 3VG9C 4EI6B 4EQ3A 5CD3B 1T2QH 1G6RA 3I85A 5ID1A 2EDKA 3MNZA 3BSZH 3SGDI 4G9DB 4IMLB 4M5ZH 1RU9H 1RULL 2PXYC 5E5RB 4QNPE 4N0UE 1MFDL 3NIFF 3RGVD 4HIEA 1BQLH 1WC7A 2Z31A 1I3GH 3U46A 5D7LA 3DRTA 2R29L 1HHJB 1AR1D 3PE9A 1MRFH 3D87B 4FQCH 5M95B 2R4RH 5A2IH 5C0AA 4U1NA 3MLWH 1FV1A 2FZ3B 3D2UB 1A4JB 2W0KA 2CMRL 1ZLVK 4WU7A 4P5KA 1NBQA 4FN0A 4PUBL 1G84A 1D5BB 5E0QA 2Y1VA 4X6CE 3V6BR 1W0VA 4ALAL 5KS9A 3U7WH 3IDJB 3IDGA 2IBZX 1D6VL 3HPJA 2DQHH 3D18A 4RGNE 3W9DA 3FT2B 5IR1A 5EUOF 3VD5A 1N59A 5DJAB 2ZUSA 1BVZA 3JTTA 5HHOE 1GJIA 1MSPA 3O6FA 4RMRA 1V3KA 3VXMA 1W72L 1OARH 1B88A 1I1FA 4NHUB 4CMMB 3HZYB 1JTPA 4ZUTB 4U1JA 5E2TH 3CAFA 2VDPH 1WAAF 2XKSA 3X3GH 3WHXA 3UTQB 4M43H 1MLCA 3GMPB 4GW5B 1WZ1H 4NQCE 2FEEL 1N4XH 4FHBD 4IMKC 4KK6C 1TETH 3HC4L 4JEGB 4UZGA 1XZ0B 2MQ3A 5F3HB 4Q7DA 3QPXL 3EGSA 1AY1L 1NCDH 1QNZL 2QSCH 4Y19A 3RVXC 1ADQL 5ITFA 3O3EB 1JGVL 2AJYL 1JRHI 4DKEL 3WIIL 1U8OB 5E2UL 2B20A 3CVIL 1RZJH 5DS8B 2HWZH 4YE4L 3WFEL 3CH8A 4Y2DD 2J3SA 4OCWL 3N1MC 1I8KA 1NBYA 2HT2D 3SHSA 3LSOA 4M6NH 5CKGA 4WFED 5L9DH 2IJ0C 1EVUA 2D7TH 3R0NA 2BNRB 4P57A 1T7XA 1CDBA 2VLJE 1I1YA 2IGFH 3K4AA 5DYOB 1CD1A 1FO0L 1CDUA 5DK2A 2F74A 3KPSD 4MCZB 2OR9H 4LGRB 5D1XA 1CXLA 1T2QL 3QWRD 3L3GA 4DFHA 2DQDH 4PIRF 3IAQA 5SX4H 3K81A 5E08H 3PWPD 1GSMA 3BSZL 1T1WB 2DD8H 4M5ZL 1RU9L 1TPXC 1A6ZB 4HMDA 5FDWA 2EYRB 4LKXA 3OKLA 3RDTA 3GHBH 4Z7OF 1BQLL 3BGMB 4HAGA 5C07D 1EJ6A 1I3GL 1FSKB 1ZT7A 2EKJA 3DMMD 5F7KC 4P2CG 4WI9A 3FQXB 3U0TA 2ZWLT 1LK2B 5GQBA 1MRFL 2RFXB 4FQCL 1QSZA 2ZCKH 1F4HA 5IW1B 5F3BA 3VXQB 3MLWL 3J8F7 2NZ9C 3BJLA 1CGWA 3MYJB 1KJ2B 3FQTA 4Z7VF 5BZWB 3VFOB 1WZLA 2QQKH 1I3RB 4IRSA 1MCLA 2N4IA 3LQAC 2BOCA 2Q8BH 3U7WL 3UO1H 2E6QA 3D6GA 1Q9KB 2XQYK 1BOYA 5AUMB 2DQHL 3QUYA 1HXMA 1AXIB 4CUCA 4PV9B 1XCQA 2D4FA 1OGAA 5CMAA 5J1SC 4WHTA 4XXCA 1MOEA 4OZFB 1J8HB 1OARL 1IJ9A 1DLHB 4ORGA 3WUWB 3MRMA 4MQ7A 4XB8A 2NY6B 1H15B 1PGRB 4XGZA 5E2TL 3R8QA 1B0RA 1CXEA 2VDPL 1F45A 2VIRA 4MCYA 4NBXB 4M43L 5EIQA 3O6FC 1A7BA 1WZ1L 1FAIH 5E7FA 1N4XL 4PJBA 1TETL 3AFLA 1CFNA 2HJLB 2BY1A 1NCCH 1R3HB 2EDQA 3B2UD 3HN3A 1D5XA 3MRDA 3WKMH 3T1WA 1NCDL 2QSCL 2J8UA 3EYUH 3LKQA 1V8HA 1HSBA 1RUAH 1RZJL 3FQUA 2HWZL 4XRCB 2ESVA 4C56D 3QUMH 2GJ6B 4PJGA 3MV9D 1EJOH 4M6NL 4WV1C 4ZODA 5L9DL 1A6PA 3LPFA 4N0YH 2D7TL 1UM6L 2OQJA 2XOTA 2EH7H 3T0WA 4WGVB 2IGFL 4JREB 3KAAA 5CCKH 4QCIA 3N0PB 2OR9L 3IXTB 1A6VH 3MROA 1JYXA 4NKIH 3LKNA 3X14B 2DQDL 5E08L 5AAMA 3B9EA 4NCC2 3LD8C 4P5TA 4FMFA 2DD8L 4NBZB 3OKNB 5D1QD 3UTTA 2ZUXA 5IEKA 1EEQA 2LVCA 4G8GA 4RZCB 4RAVA 5F71A 4JZNB 4O9HH 5D1XC 5CIPB 3OKMB 5KTEH 4I0CC 3GHBL 3PDDA 5IJVA 1JGEB 1FAKT 4U1GB 5FYJU 3BQUD 4NUJA 4PGBB 2D7PA 1A64A 4ODTL 3RDTC 1OWRM 4OZFG 2C3GA 5MP6H 1KF9B 1NC2D 2ZCKL 3DHMA 1NBZA 3WUWG 1OLZA 1QVOB 5JQHC 4KVNH 1T22A 1QQDA 3MRHA 4YC2B 4QHUA 5BW7A 1AC6A 3PABA 2HH0H 1XF2A 2HG5B 3IDYB 3VXNA 3TBYB 2P45B 5GGTA 3W0WA 5DHYA 1AHWC 2QQKL 4TTGA 3NAAH 3WBDA 4K2UH 5I1AB 1CFSB 4KPHH 4U31A 3ARUA 3AREA 2Q8BL 3GMMA 3UO1L 3UPRA 4RSVA 3I6LE 3LCYA 5IK3A 4P2QD 2OJZL 1KN4H 3MV7D 2BP3A 4JDZA 4PGDB 2CDFB 4XCEA 1DQQB 3RNKB 4IRSC 2ATPA 3UC0H 4LVNB 1PKQA 4Y4KD 2EIZB 1QBAA 4TUKH 3QUYC 1NUDA 3QUZA 3P3YA 2A2QT 1WWBX 1FAIL 2VC2H 2NNAB 3FFCB 5HHNB 3P9LA 1MJJB 1NCCL 3EFFB 5A40E 5DA4A 3V5DA 2WQ8A 4RGOH 1FLTX 2Z93B 3WKML 4XCNB 5CZVH 5E4IA 3EYUL 4PJ5E 4OIBA 4AH2B 1RUAL 2FBOJ 3D0VB 3DX7B 3QUML 5J6GB 4YWGH 3BMWA 4L3EE 4YHPB 2VXUH 1EJOL 3WO4B 4D9QD 4N0YL 1FNSH 3CX5K 2EH7L 4WUUB 3BP4A 2ZUWA 4MD4A 4XH2A 5CCKL 5DSCB 5MHSD 1JGLH 2AXHA 3ILQD 3KJ4B 3KPPB 5TDOB 4FP8H 2VDRH 1A6VL 5DT1H 2DTSA 2CH8A 4LPYA 4NKIL 4JHBA 1F00I 1HHKA 5E8EA 2IAMB 4YX2H 2P42B 1QA9B 4AIXA 4ZUSA 2O61B 2F8VA 2XPGB 1VADB 3ZE0F 4XAKD 3V79C 1AIFB 4O9HL 1X6NA 3MSPA 5KTEL 4EN3B 1TJHH 2ARJA 1I75A 5DJ8B 3BHBA 3T2NH 4P5TC 2E9JA 5L2JB 4GT7A 4JY6B 4WDIB 4JB9H 1I8MA 4WEBH 4FXGB 4PY8I 4JKPH 4O2FA 3IXAB 2MFNA 3MFFB 5DURB 5MP6L 32C2A 2OTWB 4KVNL 4TNWK 5HJ3A 4XC3H 2A73A 3PP4H 4KI5C 5HGHA 4JANA 5EU6B 4JHAH 2HH0L 1QBLH 3T3PE 1VFMA 1XFPA 4IOSD 2ZJSH 1PY9A 2AEIT 4XPFH 4LCCB 4RNRB 2PYEA 4HUVA 3MLSH 5JDSA 2Y9RT 5DMGC 4O51A 4M8VA 3MR9A 1ZT1B 4K2UL 5JO5A 4QT5A 1E4KC 3C6LA 3LRHA 4U6HB 4AEIH 1KN4L 5CSGA 4LEXH 1TENA 1M6OA 2R4SH 2UVEA 4PJFE 3UC0L 4QEGA 3AREC 5IUSA 2EYSB 5D2LF 4TUKL 4BA8A 3LKPB 4MGXA 4HZLA 1MIMH 3OMZA 1C12B 2YZ1A 1I7UB 2QHLA 1W2KT 1FFNA 4HS3A 3PQYB 2VC2L 4X99A 3ABZA 5D9SB 5ERWB 3SY0A 1MWAA 2P8PA 1P1ZA 3QUZC 1OTSD 4RGOL 1NDGB 5K59E 5CZVL 3KNBB 3VXRA 3VFWB 5A43C 5LJYH 3V9FA 1RHHA 3T65A 3U6RA 5FHBH 3L6FA 1G0XA 3SDAD 2CKBH 3WMSA 2YUVA 1Q94A 4YWGL 2VXUL 2X5PA 2AV1B 1I8IB 5ENWB 4PJHF 1FNSL 1AP2A 3WNMA 5CGTA 3RUGF 5JXAH 4R4BB 4PJGF 1BP3B 4G6MH 3ZE2E 5KSAC 2DJ4A 5HI5D 3MZTA 1JGLL 3IDIB 4HFUH 5DD1H 4GBXA 1JYWA 5H8DA 2BNQA 3FO9B 4FP8L 3M45A 4J8RA 2VDRL 2VR9A 4YIQB 5DT1L 5F6IC 3W11C 2DLFH 1MVFA 2HJFA 4QRPB 4YX2L 4Z95H 3O8XA 5EPMA 5F96H 3S96B 1UZ8A 3Q3GB 3D69A 4ZMAT 3QDJE 5CJBA 5IIEB 1TJHL 1WEJH 3SPVA 3FL7A 3T2NL 5IG7A 1QSEE 4P49A 1A1MB 2X10A 5FKPA 4LPCA 4JB9L 1EGJA 1X4XA 4JKPL 3SE3A 4H0GA 1ZANH 5D7IB 4X4ZA 3TO2B 1QHPA 3NIGF 4N8PA 1ZLUH 3EOTH 1TLKA 1Q9WB 3IETA 4XC3L 3FQRB 3PP4L 3PUCA 4Y5VA 3GGWA 1NFDA 5I8KH 1UWEH 4FQHA 4JHAL 2DMBA 3MRGA 1QBLL 4RMWA 4U6YA 2ZJSL 3O3DA 4I0PA 4XPFL 4YPGB 2YEZB 4YQXH 1ETZA 3MLSL 1X5FA 3KPOB 1DUZA 4YEEA 1A1OB 3NTCH 3U0WH 4ZYKB 1B4JH 4V1DA 2NXZB 2OTUB 3SN6N 4AEIL 1JNJA 4Y16B 3MACH 5HYJA 2D0HA 4LEXL 3S3PA 1JZ3A 2R4SL 1DUYB 3M8OH 1N2RA 2Z92A 3AS2A 3IRPX 3C6LC 3W9EB 2ATKA 1JPGA 5F9JB 3D3VA 2YD6A 1MIML 2APVA 2HVJB 3U30C 3PHQA 4HLJA 5IVZA 4ETQB 3HG1B 3P9WB 1RJZB 2WQRA 1GZQB 1UKTA 4R96B 2BVOB 2XWBA 5ID0B 5AEAA 4ZUVB 3JWNC 1IAMA 3TBSB 5EBLA 4U7KA 3ARGB 1WTLA 3PV6A 1I4FB 1JTOA 1YN6A 5FHBL 2V2TA 2QQNH 2CKBL 2R9HC 2IWGA 4OF7A 1ZLVH 3MJ8A 2EE9A 5JXAL 2AXFB 5T5NG 4OF3A 4DVRH 1P7QB 3S97C 4G6ML 4E0RB 4HFUL 5DD1L 3U82B 2O5YH 1OLLA 4KJWC 4PJ8B 2DLFL 4K94H 4Z95L 1T20B 1PDKA 4LCIH 1BQSA 1IGTA 5A2KH 5F96L 4WO4B 2VDNH 3V4UH 3VXUE 2IMMA 2QL1A 4B0MM 1DANU 4JM4H 4MD5B 5EN2B 1PG7H 4TNVK 2GY5A 1WEJL 1NCAH 4YXKH 3O8XC 4NPYB 3PWUA 2V7NB 2BNRD 4E5XA 2FIKB 5IKCA 5GZOD 3DVNB 5A2JH 4K8RH 2AK1H 4KROC 2V5MA 1F11B 4LARH 4CGTA 4HKBA 5BXFB 1ZANL 2FHBA 4P5MB 1NKRA 3TZVA 1QFWI 3WNNA 3EOTL 3UAJD 4LF3A 3UBXI 2DM3A 3VWKD 5I8KL 1UWEL 5GRXG 1J9CT 4K7PY 3QNZA 1Y18B 3VW3H 8FABA 4YQXL 1LP9E 2F5BH 4JZJB 1BVKA 2KH2B 1T4KA 3NTCL 3KXFA 2AV7A 3U0WL 5HYQB 5IFJA 4AY0A 1B4JL 1ULVA 4I0PC 4RWHA 1S7XA 3MACL 1IEAA 1M05A 3O3AB 2CJUH 2OI9B 3BKYH 4KTEH 3M8OL 1N5AB 5CSBA 1F4XH 4KXZH 1BD2A 3IGAA 1CIUA 2L0DA 4U2YA 5HGGS 5T1MB 1HILB 3KDMA 4PLOB 3ROLA 3DRQB 4APQA 1SMAA 4MJ5B 1MUJA 2DBJA 4P4KB 1QRNA 1F8TH 2X4QA 4CVXB 5TFSH 4G6AD 2W60A 1RUQH 3ARFD 1P9MA 1P4BH 1AFVH 1HNGA 1KCKA 2DIBA 3GEWB 5SWSE 3BN3B 1DN2A 5DRWA 5ICXB 5E5UB 4WTXA 4L5FH 5IROA 1HQ4B 1JF1B 5ACZB 5EBWB 1ZLWK 2Y23A 1J7VR 1F4WH 3QHTC 4D0BA 3OB8A 3QG7H 2QQNL 5DRXA 3ZKQD 2P5EB 3SDYH 5J1TC 2GSIA 2NY6D 1ORSB 2FL5B 3PIQA 3MJ9A 2RB8A 2MSPA 2RR3A 3LKSA 4QHLB 4DVRL 4KRPB 1XF3A 1TQCC 1LEKB 3GBLA 2HTKD 3TPUA 3U2SB 4Q2ZB 2DL2A 2OSLB 1XGPA 1TVDA 2O5YL 1TTFA 4NO5A 3QO0B 2A6DA 3KLAA 1S7WA 4K94L 3FAXA 5IVXB 4LCIL 3TT3H 4J4PA