1V7ML

Human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
QVVLTQSPGIMSASPGEKVTITCSASSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGSGTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal TN1 Fab Light Chain
publication title Structure of the receptor-binding domain of human thrombopoietin determined by complexation with a neutralizing antibody fragment
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/cytokine
total genus 44
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1v7mL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1v7mL01
2DM3A 2F54A 3BHBA 3L3DB 2YA0A 3PL6D 4OCRL 4MZ2A 1FZJB 3RNQB 5C2BL 3EJZD 5MENE 1KPRA 4I9WD 2LTQC 2OR9L 1DDHA 3KPSD 1I7ZB 5SX4I 1ADQH 5IB5B 4GRWE 4GW5A 3DVGA 5IBUG 5B38G 5J12B 4BZ1H 4YDVA 2OR7A 3TN0D 1W2KT 5IEHB 1U8NA 1OTTD 5K9QG 3HZMB 3UTZA 4PV8B 5D71L 5IP4A 4XCYA 1MCFA 3Q5OA 4X5XB 3LMJH 1VSCA 4OF8A 4RWHA 3SCMA 2DICA 4ALAL 5IEKA 4F8QA 1WWCA 4D9LL 4ZDHB 3GSNL 4K9EH 1C08B 1DE4B 4M6NH 1Y6NR 4N5ED 3V4VL 4X83A 2R2BB 4ODHL 3EYSL 4U6VL 4LCIH 3EO1B 4QXWA 2R1XB 3T2OA 2Z31A 1MRCH 2I07B 1PY4A 4X7FC 1I8LC 3C6LC 2G5BB 3MRNA 4R4FH 3U46A 4Z7VA 4W81A 1CE1L 4UMGA 4GG6A 1NGQL 4XVSL 4F7PB 5TF1H 3R8QA 2W65B 1OP3K 2VTFA 3RKDD 4X4YA 4PG9A 1NGZB 1G9NH 3IFNH 4R4BB 1OAUL 1KJMB 2R0LL 4JN1L 4NRYB 1N5YH 2MCPH 3STLB 1UXWB 3NACL 2XQYK 3QDMD 2EYSB 4KGJA 5AUMA 2ZJSL 3PIQA 1MHHA 1WC7A 3FOMB 3O2WH 2X9YA 3B9DA 5KTEL 3AREA 3RDTC 5FYLD 5GRUL 1TNMA 2QR0B 1FFPB 2BNRA 5HGDA 1XIWC 5GZOC 1QQDB 5F6IC 2B0SL 4CVZB 5K9JL 3O8XD 5J3HC 4ZFOB 1UH3A 4WO4A 4HBQA 1S7QB 2JK5B 1LK3H 1TVHA 3FFCA 3QDHA 1H5BB 3QUMH 5C0BA 1G7PA 1RZGB 2VDKH 4OLXL 4YGVB 4QRPE 4HS3A 3ARGB 2SEBB 1S9YB 3EW3B 4UBDC 1R3KA 1JNNL 4XPFH 4XPBL 2B20A 5DEZA 3SHSA 3CPLA 3UTOA 4LAQL 4NUJB 5D7LB 2W07A 3MV9E 5E8OB 5F9OH 3FQTB 3OB0H 2R0ZH 3ZKNC 4YX2H 5B22A 4LIQL 3D25B 4YLQT 4MVBD 2A6KB 5TDPA 1GGUA 4E5XA 4A6YB 1UENA 4ESKA 1JWMB 3T77A 2AV7B 4YWGL 3HE7A 2AGJH 4GXUN 3MUHL 3OJVC 1KJ2B 3FCTB 3C8HA 4M4PA 3BPLB 4H0IA 5DK2A 5KSUA 1IGFH 4CBPA 1DSFH 4NGHL 3P4OA 2XKSA 2NY3D 3KPMA 5MENA 3MV8B 4HLZH 4KRMB 5I76A 1ZHKB 3HI5H 1TTGA 4S1QL 4NQED 5DSCB 2Y07H 3V95A 2NMSA 4L4VE 2O61A 2Y4SA 1UM5H 2GYSA 4J4PC 4OCYH 5LBSL 2JELL 4HZLB 1HQ4B 4U3HA 3UPAA 2BMKA 2M26A 1BEYL 1NGPH 5AAWA 2HRPL 4ZUTA 1GGYA 2FYYB 1G6RH 4OCNC 4UAOC 3VXRD 4N0RA 5EZOL 1B6UA 1MEXH 1CD8A 4PRHB 1SJHA 1DUYB 5AZ2H 2YXMA 5C07A 3RZCA 2H3NA 4MAYB 4PJEF 4MQTB 5J1AB 3L3HB 2V9TA 3Q6GH 4JN2B 2P8PA 2QL1A 2R1YB 3LEXA 2Z8SA 1HINH 4HK3J 1G7QA 2QQKH 3VWKC 3A6BH 1KN2H 3QXTA 3U2SB 2EIEA 3QT2A 4OAWB 4L8CB 1S7TB 2PXYB 3RJQB 3LN9A 1X5KA 1JCKA 5T5NF 1BWMA 2B4CL 4OI7A 2G75B 4CDGC 5I16B 1X5HA 1AGDA 5I9QC 5J6GB 3U30B 2EC9T 5DD3H 5FYLH 35C8L 4WFFE 1CF8L 3QFDA 1C5CH 2NX5B 4XNXL 4XCEB 4FQ1L 4YK4C 5HGGS 3ZMRA 5IUSA 3NZHH 3PWNA 1J8HE 1NJ9A 3QWRD 1B4JH 4WTWA 3CVIH 4AM0A 1OSZA 1XCQA 3ZHDA 3D0VB 2NY4D 4GSDL 2YSSA 3RGVC 1ACZA 2DLFL 4I77L 4ZS7L 1WWBX 5C6PB 3QUYB 1JYVA 4O00A 4ZUWB 4K55A 2ZP0T 3BD3A 4NKIH 4K3GA 5E9DD 4U1IA 4OT1L 3N85H 3IU4L 3GSUB 4TUOA 4XAWH 4Z0BH 3EYOA 3TO4D 3VG0L 1NSNL 2P5WD 3PE9A 4RAHA 2WNGA 1U8IA 2AP2A 4PBVC 4V2BA 5GSVB 4PJ5D 4LNRA 5I19H 4Y8DC 5BV7L 3O4LE 4RGNB 4LDEB 2FNBA 1BQHB 4DW2L 2XG5A 4OV5A 3B9VA 3OL2A 5FDYA 5GHWH 2XKNA 1UG9A 1NANH 4R3SB 1CDCA 2NR6C 3GIZH 3PWVA 2I9LA 3M8OL 2OTUB 2XWBA 4F7TB 2ZUUA 5F96H 1IBGL 1QTYT 5CINH 4KJPC 3KYOA 5C0ND 4QTHA 1C1EL 4PJEB 1JGDA 3MV9A 3S36H 2AQ3A 3KYMA 1KCKA 3V5KA 1UCBL 5IHZB 5L7XH 4APQA 1P4IH 2FO4B 1WIPA 3IXTB 2FJFA 3L7FB 3MBED 4HFWA 2H8PB 5BVPL 1IFHL 3NIFE 4X99B 1RUPL 4P48A 1JPTH 3DRTA 1HE7A 3T8XA 1ZGLA 5B3JE 32C2B 1G9MH 3QDAA 1Q72L 1OY3B 1SBSL 4L1DA 2DMCA 1JFQL 4L4VA 5DJ0A 5MERB 2ESVD 4TSCL 2HT2D 2FH8A 4Q6IC 3MR9B 1V05A 3B2VH 3BH8A 1XMWA 3W5NA 1F4WL 2BRRH 1YDPA 3KLAB 1NGWA 1PLGL 2YD2A 3QUKA 5M95B 3MCKA 1EEZA 4L8SB 4U05A 1ZLSL 2KZWA 1MCDA 2BXZA 2OSLB 4QRUB 1GOHA 3GI8L 3QUZD 3QNYB 3KXFE 3KPRE 1B6DA 5C0CB 1J0HA 3RIFK 1FFOB 2F58H 4MQ7B 5HDOA 4BA8A 4LVNC 1NBVL 1QYGL 1A7PL 3ARTA 4PRIE 5A1AA 3BKJL 3S35L 1OT2A 3O45B 3W11C 4B7IA 5ID0A 1NCBL 1RD6A 1M05A 5JHLL 5DJXB 5MP6L 1IAOB 4NZJA 2FJHB 5EN2A 4BKLA 4MJ2A 5KOVC 3ZLQC 3P9WB 3WHE0 3P9MB 4WCYL 4KV5F 3QAZB 3UTPE 1LEGA 4TUJB 3MRIA 3QIWA 3TA3A 3OX8A 5EOCL 3EAKA 1T89C 4Y89A 1JMXA 3QUXB 2MPAL 3TIEA 1A7RH 3MRRB 1YMMB 1HSAB 1AFVH 2NY6C 2VR4A 3TVMB 1MREL 4AH2B 1T20A 2X7LA 4LBEB 2DQEH 5D7IE 4K71C 1F90H 1U2HA 4MS8C 4JAMB 4XBGA 3NN8A 4DFHA 4JJ5B 4ZTOH 1S8DA 2A9ML 1OD9A 2IPUG 3O4LA 4DN4L 3V7AE 4RQQB 3B4NA 3VDBA 4U1GC 3RKPA 5GS0H 2X10A 3DECA 3GO1H 2FZ3A 1LQSR 2ICEB 1UACH 3CH8A 5JW5A 2R1WB 3SE4C 1OGAE 2VDPL 1A1MA 1T22A 4Z5RA 5CLTA 4LOUD 3VXNA 2DQCH 3MGOB 1MUJA 4IOIA 3OKLA 3S36X 4RNRB 2BVPA 1PQZB 3D9AH 5EU6E 4N0UA 5AD0A 1SEBB 3S9DB 1N5AA 3QEUB 2IANE 3RY6A 4JFXA 2X70A 3HS0B 3O6MH 4KVNH 2DJ4A 4UINH 5GRXG 2FD6H 4K9EC 2APFA 4PY8I 2DQJH 4LVEA 2NNAA 1L6XA 4U1NB 5FYJH 3T3MF 3HRZB 1BVKB 3GMNB 3H9SB 1PZ5A 4HIEB 1K4DB 3EDKA 4PJHB 1GXEA 1T4KB 1FH5L 1J5OH 3TBTA 1NC4B 3O3EA 5A2FA 1D7FA 4JQXA 1G7HB 4LPTA 5FA3A 3WV0A 4DEPB 4KDVA 1JE6A 3D0LB 3QULA 3LAFA 4M43H 3KHQA 1ODAA 2R39A 4NUGH 3T4AA 4K7FB 3QFJE 3MROA 3VCLA 1FIGL 2V2TB 5D7LD 5IR1B 1FE8L 2CDFA 4QF1B 4ZXBD 4OIAA 2KKQA 4XHJD 4I3SH 5K9KA 3HE6A 2IJ0C 5IBTH 1PW3A 3OJMB 3KLSA 2NYYC 2YD3A 4P3DA 2DWDB 3ARDB 4YHIA 1F97A 4Q7DA 3OHXA 1FAKT 4HHAB 3KPRA 3CMOH 3KPNB 3Q6FB 4IM8A 1ZVYA 1I3GL 3G5YB 3AMKA 4MZ3A 5JOFA 2RGSA 2EDDA 1IEAA 1VEPA 5GGSB 4X9GA 1BGXH 5D5MF 1CFVL 3VRLF 1MCSA 1MLCA 4JDZA 1H3PL 3BP6B 4PRIA 3RIAF 4PJ9C 3GNMH 1JV5A 1AGCB 3DURA 1OP3H 3BPCA 4Y7MA 3MV8D 1P9MC 1QBMH 1Q9WB 1CFSA 3BP7A 4MQXD 4HDIB 3BDYH 5DHVB 4G3YL 2EH8L 4BK5A 1QHOA 4WW1A 5HHOE 5DD6A 2GK2A 2V5TA 1P7QA 1S7RA 4K3EH 2OJEA 1LO2H 2HKHH 5EO1A 3PL6C 2JF1A 5TE7L 5KVDL 3IDGA 3MLUL 1CFNB 1KIRB 3EO0A 3SKNA 4FFZL 4PRHD 1H3UA 2Q6WA 2UZIH 3T0EE 2BSTA 4U6HA 2D7TH 3IYLW 1XGPA 4C83B 1NFDA 1EO7A 2VSCA 1FVDB 2FHFA 2RR3A 4UUJB 1GGBH 4O9HH 1J05A 5EU5B 2K3TA 5CIPA 3QXWA 3TYFA 2B5IC 4Y2DB 1FPTL 4AEIH 1QLFB 1RJCA 1ZTXH 4OM0L 1YEGL 1NAKH 2XG4A 3REVA 5IKCB 2Q8AH 3LKRB 1AO7D 5GS2D 3O6FB 4PRPA 1NQBA 1P69B 1S7SA 3DGGA 4RGMB 2NPLX 3TV3L 1NMBH 4N5EC 3D2UB 3G5XB 5J13B 3CZJA 4U1HB 2B39A 1OGAA 4F2MA 3VMPA 1HOCB 1CU4L 4NRZA 5EOCJ 5H2BA 1DJSA 4R97B 1ZVHA 3FFDA 4EZMA 1S7VA 2ZG3A 3MXVH 3WNNA 2CDEA 4YC2C 5EU6A 5HYSB 5F9WB 2HTKD 4RGOH 1V7MH 2LVCA 4WNQA 3K46A 4E0RA 1U36A 4OIIL 1EHLH 1JPGB 2IANA 1CVSC 3QUYD 1YQ2A 1KENL 1C12A 1LDPL 4P5MB 4NCC1 3FN0H 4M93C 3LQAC 5FK9B 4RIRB 2GTWA 3WMSA 2DLIA 1TJHH 3RKDC 5D5MB 3GMQA 5IQ7L 3TZVB 1DTUA 4KQ4L 3N1PC 4ONGL 4DUWA 5F1NA 2XA3A 5FB8A 4IJ3B 3ALWA 1KCVH 4RGND 3FQRA 5FYKH 3WJLA 5JW3L 3GJFB 2CRZA 4E9LA 4PTTA 2Z93A 2HFEA 4A6YH 2NZ9C 2XN9A 5FO7B 3UTQA 1DN2A 3P0YL 1ZHNA 1KCUH 3AFLA 1EBAA 2R23A 2HTLD 3O3DA 3O8XC 3K7UA 3LB6D 3GSVB 4LLMB 4OZ4A 3RWIA 1KJ2H 2CUIA 2F19H 3L5HA 4EBQH 5E1AA 3ZE2E 5EIIA 1S3KL 5DQJA 1JRHI 2VIRA 2Y5TA 1SEQH 3CUPA 3ARUA 3MLTA 5E4EB 4JFPB 4D8PA 3RWEA 5FCUH 4YHNB 1RMFL 3QHFL 1A6AA 5CKGA 5IV2A 3MODL 4LLWA 3QXVA 1M4KA 3CVHH 2AJ3A 2PETA 3K2UL 4XAKD 1ZK9A 1X7QA 3FB7A 3WD5H 1KCRL 4HSQA 5E2VH 1T0MB 4ZQKA 5IF0B 4KZDH 5I66B 2V9RA 1Z3GH 3K74B 2KPNA 4JREC 5DZLA 3W39B 5JLZA 2PYEB 5HVFB 4ENEC 1CL7I 2LU3A 5D70L 4MVBC 4OGXL 4W6YB 4LHQB 5FFLA 2A6DB 1KPRB 1ZS8B 4MNGB 3K1KC 4PGZA 2E27L 3S3JA 5LXGL 1YJDL 5DQDL 1ACYL 2CIKA 5HHOA 5DFVD 1MJJA 3G9AB 4M9PA 5DJ2A 4GW5B 5ADPH 4DOHE 2IAMB 3BX7C 2F5AL 4JFHE 3ZL4L 2NY3C 6FABL 1DVFA 2VXUL 4UU9A 1ZA3A 3LZFH 1IAIM 3FO0H 5D6DC 3ARWA 1I9IH 1CWVA 4WWKC 4Q9RL 3MLWH 3EOTH 5IEKB 3F7YA 5C0CD 5C08E 3RGHA 4Z7UE 1N0XL 5GPRA 3RBGA 4HJ0C 2YMXL 4D0DB 4I5BB 5C7XL 2G2RB 1S5IL 2ARWA 2X9XA 2OI9B 1CT8A 4W4NA 3QXDB 4OUUA 3V0AC 1NAMB 5E99H 5M7QA 2Z35B 1A7OL 5GJTL 1G9MC 2HA1A 4M7ZB 1I1FB 5TPWH 3RA7L 4F3FA 3EZJB 2OCFD 3H9HA 3M1BA 5FM8A 4M1CD 3TM6A 5I73B 2ZUQC 3JV5A 1EHNA 3O6KH 5EBMB 1PX3A 1DCLA 1T0NA 2Q86A 3F58H 2LAGB 5DRWA 1VGEL 3LOWA 4L8BB 1NGYA 5ICXA 3VFOB 5EU3A 5DC4B 4JPVL 2DQUH 5ALCH 4MHHG 5JQ6H 1A1NA 4C4KO 2ENYA 4Y16B 1JGLL 1MVUB 2WP3O 3TVMD 5E08L 3SDAA 4G43A 2VE6B 3V5DA 2FX7H 1U8HA 3QXUA 3U0TA 3QWQB 4XI5C 2D7OA 3X3FH 3PQYE 1Q9KA 4GRLB 4WTXA 2M2DA 4JGJA 3UYRL 2DQDL 3N1MC 3AREB 2DQTH 5GGVH 3LD8B 4FRWA 5E6YA 1I1YA 1D3CA 4X5LA 2OZ4L 1UEMA 4NZTL 5ETUB 5L2KB 2NY4C 3ZE0F 5ABDE 3PJSA 2LU7A 5DC0A 3OR6A 5L8KB 1ETZA 2VWEC 2X1PA 1T83C 3VGFA 3U7YL 3V6ZB 1S5HB 4DCQA 1E4JA 3VXUB 2CKBB 3BESR 3GMPB 2A6JA 1MCOL 1QRNE 1FDLL 4QRTB 4HS3B 4DAGL 1IAIL 1S9WA 4JFFD 4PY8J 3VA6A 5GXBB 2IH3B 2WIIB 4YBQD 2QSCL 4HKXA 1MF2H 1DBBL 3HNTH 4UV4L 4N68A 3QI9A 1I9EA 4JZNA 4JO1H 4D0CB 1CL7L 5TDPB 4X4ZA 3H3PL 1KNOB 1G7LA 3EYUL 3WXWH 3X12A 2GAZA 5C0NC 1WICA 1VFBA 4HPYL 1I8MA 1HSBB 3KJ4C 3H9SD 5C3LD 1KCSL 5E7BA 1AP2B 5E5RB 2H2PC 1BZ7B 5L2JB 1MCWW 1V3LA 4NNPL 5F1SA 5SWSE 1I1AA 5GS0C 2VKXA 4Q2ZB 2WW8A 1EUTA 1S9XA 4YUEH 1U8LB 4GG8A 4Z78A 5I76B 2X89D 5BOZG 2W92A 3N1QC 4O2FB 4UT9H 3L1OH 4KXZH 3SE9L 5HYEA 3OGOE 3B9KC 4LL9A 1BQSA 2BMKB 4ZTPL 5JXEA 3L3OB 4OSUL 3RNKA 5AYUH 5CEYA 5EG6C 2DQFB 4G8GE 4U1SB 5SWZE 4HF5L 3ARDD 1AE6H 4FQPA 2H3NB 4FG6D 2P8LA 3CXDH 3BZEA 1MFCL 2K7PA 2FB4H 5C92A 1ED3A 3LEXB 3INUL 4DKFL 1UZ6E 2VZUA 4FQJL 4YR6B 1ES0A 5L8LB 1NPUA 4S1RL 4ZD3H 3VGHA 2D7PA 5I8KH 2YPVL 5GS1A 5I1DB 1DP0A 4PLKD 1M71B 1QVOA 4EI5C 3ELAT 2ADIB 3IDIB 3GSNB 4XVTL 5D1ZB 4CMHC 1IRAY 3C9NA 1J1XL 4P4RB 5IW1A 4NNXA 4YHZL 4YO0A 5L6YL 1G7IB 2LAAA 3FO2B 2P49B 3PG2A 1LO5A 5DD1L 5FUCE 4Z6AT 1BD2A 4EXPX 4Z95L 4UIKL 3ROOA 3DX7A 2E7LA 2B8OT 1RU9H 4X98A 1LO0L 1YEEL 2C1PB 1NUDA 4M6MH 1ZLVK 1OAXH 2EC8A 4OLUH 4MWFA 2ZCLL 2VZOA 1FGNL 1T7WA 1YMHB 4AIXA 1T6VN 2PW1A 2OXGA 4WV1C 5EA0L 5J12C 5GQBA 5BO1L 1EZVX 4M3JA 2XIDA 2VOTA 3VWJA 4TNWF 4DQOL 4Y2DD 3A0OA 3U1SL 3GB7B 5J11B 3EYOB 4HUWA 3T3PE 1EEQA 1YEFL 1TJGH 2CDGA 5HDBE 4FZ8H 5I1LB 1E4XI 2A77L 1MIML 4U3CA 1AXSB 4HJGA 3PP4L 4YDJB 1AR1D 5CD3A 3O6FD 3MV01 2IC2A 5E8EA 3MLYH 3D2UD 3WIFA 4TRPL 3UAJC 1MWAB 3MFFA 4J3VA 3V79C 2VDMH 2EXYD 4D2NA 5E56A 1QRNA 2R0KL 4MXVF 2H26A 4QRPB 5MHSE 1WFTA 1FYTA 4RSVA 3JTSB 4H25A 1G7MB 1RZKL 2FBJH 3UBXI 1GGIL 3N06B 2XOTA 2BP3A 4TNVK 5AG8A 2DS4A 3T2NH 2FIRT 3JV0A 3TJEL 4PJIA 3V5KB 4M1GH 5HYFA 4BQCA 3TZVD 2IPUK 4YIQB 2YWZA 4UIMA 4JFDE 5FGBA 3QIUB 5CEZE 4DKDC 4CW1A 5I74C 4XCCL 2NY2D 2BHZA 3KPQA 4O5LH 4NQXA 1C16A 1JN6A 4OD3L 4ODVL 1I3UA 2ZZUT 5SWSA 5DMJB 3ARVA 4PJAF 5KN5B 1U91A 3TYGL 4LPYA 1FLRL 1FZMA 5DT1H 4JG0H 4R2GD 3VRIA 2G5RA 1GPOL 3CC5A 1KG0B 4EN3B 1G7JA 4HXAH 4KPHL 5JZ7C 2YN3A 1I4FB 1BOGA 4XC1L 4WHYG 1H5BC 3E1F1 4QEGA 3EDFA 3REWA 4G8GA 4JG1H 4F37F 3R1GL 1OAKL 3MV11 4JO4L 1ERNA 3ARGC 2OLDA 2A38A 1RUML 4FZEL 3SGDI 1SYSB 1UKTA 1X5GA 4K23H 4XVUD 4R0LA 1HILB 2XWJA 3HR6A 2A9NH 1YY8A 2UWEE 4GAJL 5F21B 5GZND 4WHDA 4LARL 4G6FD 4C57C 3VJ6A 1IC5H 1FV1A 3NIFF 1CK0L 1H15A 1YN7B 3LN5B 2KQMA 3ROLB 1T5XB 1TVDA 5DUBB 3X3GH 1QKZL 3KPOB 1MQKL 1GGCH 5MEQA 5B3JF 5JMOC 3PGCA 1JNJA 4NBXB 3I6KB 3AU1B 5DJAB 2IAMD 5C0DB 3GMLA 4OZFB 2VL5A 3EOAA 3AAZA 4PP1D 2EO1A 4NQDD 1I1CA 1RZ7L 2QTEA 1J8HB 3S37L 4CUCA 4LSTL 5CILH 1KPUB 4LSQL 2H32H 5CEXB 4MA8H 3P3YA 1U3ZA 4KRPB 1ORQA 1HNGA 1P5UA 3DTXB 1E4XL 3RTQB 1SHMA 2EDWA 2IFFH 3FAWA 2VC2L 4QXGH 4BZYA 2QKIA 1DQLH 1ZHBB 4Y1AE 4O02H 3EDJA 4OF7A 4PJCF 1MRFL 1CFQA 4PJBE 4MAYC 1GHFL 4O4YH 1MHEA 4PJAB 3B8SA 1E4KC 1QACA 3WLWC 1BQUA 2HH0L 3ALPA 3D5OF 1ZHLB 1W72B 3HI1B 1FVCB 3VFWA 5CP7A 4MNQE 2FLBT 3SDCB 2PXYC 1CN4A 5I1CH 1T22B 2WZPD 5BV7B 2BSSB 1F4XH 3BH9A 1EA9C 3GJFH 3QQ3B 1BZ9A 1GIGL 3QDJE 3O6LL 3ARSA 1D6VL 1TVBA 3U30C 4Y16D 3LS5H 5D2NB 4MX7A 3GZKA 1AHWA 4KROD 5GGQL 2GSGB 1T3FB 2X05A 4DKEH 4GRLD 5CZVH 3QPXL 3VD5A 3QO0A 1AC0A 2AJVH 3X17A 1JPSH 5C0AB 4OQTH 5D7IF 4D9QD 4NSKA 2VR5A 4JFDA 3V5HA 1UB6B 2MCG1 2HTKC 5L2KD 4WI9A 3O11B 2C3GA 2VDOH 3IFOA 2YD1A 1F2QA 2EYTB 1JNLH 3NFPB 4X6DE 3DSNA 3QUYC 4JQVC 3EFDH 5BVJA 1ONQA 1MAJA 2JIXD 4N8CL 1RUKL 5FA3B 1AGBA 5I1AA 4WDIB 1WSST 5GJSH 3QULB 2KBGA 1U8QA 3BRGC 3PWLA 3RPIB 4PG2A 3T4AB 2B1HL 1VGKB 4YBLB 1VFUA 4GXVL 4KQ3L 1JHKH 3ETBF 1R0AL 2CGRH 3C8KB 2YPLB 4M9OA 3NFSH 1YEIH 1JTPA 3CXHK 3HE6B 4R90H 2HN7B 4OJFL 3QRGL 3WJJA 4KJQD 4TYUA 3BSZH 2DJUA 4N9GB 5JXAL 3OHXB 3KXFB 1BBJA 3BP4B 4PJCB 1G0DA 5FOJA 2YPKA 4IMLB 3WIHA 2UWEA 3HUJE 3VG9B 3ARFC 25C8L 4FXGA 4M61B 4RWYL 3DX8A 4JZJA 5FM5M 2I9TA 4Q9BA 4PRIB 3AMLA 1JV5B 4YHML 5D1QA 5KS9E 2GKIA 3MNVB 4XXCC 1EFXA 4X7SH 4NYLA 2O5ZH 4WW1B 5IM7B 3BWAB 1NH6A 4H26A 1NAMH 1X5IA 1I7RA 4FQLH 2J88H 5JPMA 2K1MA 2HRLA 2OJEB 1CXKA 5DVNA 5T1DH 1QBAA 1BIIA 2DQIH 3I6LD 4AL8H 2VZSA 5DFVC 2DQHL 5D7IB 2GJ6B 1BMGA 3D1MC 3O81A 4UNTA 3Q1SL 4GOSA 4S0SD 5BRZA 4Y1AA 4G42A 4L8SC 2ID5A 1XGUA 4PJBA 3IDUA 4LQFH 1MRDL 5JDSB 1WCQA 2JTDA 3UJJL 4JGUA 3PGDA 1T1XB 5C0EB 3DYPA 3O3BB 4LCUA 1U95A 2I5YL 4F58H 2W9EL 2HWZL 4MNQA 5DDHB 1P2CA 3IF1A 3IAGC 1V3MA 4RRPA 2Y06L 4QOKB 2XA8L 1PZUB 3JVGA 4OFDA 3WFZA 3HFMH 4PJFE 3D3VD 4Z8FL 3BPNB 5JOEA 3KLHD 2BOBB 1EGJH 3QDJA 5SV4A 1S7VB 4YDKH 5EU6B 4P23A 1E4WL 4P9MH 2DTMH 5IT2H 2EO9A 3QAZC 4G9FE 4UDTA 4J2XA 5K59F 5I18L 5C0JB 3QUXC 5E7FA 3SPVA 3ARYA 1XAUA 4YFLI 4Y4HA 5E6IA 1NFKA 5FCSH 2AAVA 5CD5D 4MB4A 3WNLA 3FL7A 3ULVF 3TVMC 4KI5E 4Z7WE 3IU3B 3KNBA 3GSQA 1LEIA 1GC1L 2VXQL 1K4CB 5C0FA 5FA4A 2E9WA 4LGSB 2DKSA 3RDTA 5CCKL 4DTGL 1XFPA 5FHAH 3MYJA 1XIWA 3C5JA 2R23B 4Q97A 1X44A 3LRSA 2YEZB 1CR9L 1F6FB 2ZPKH 4M6OL 1CBVL 3MO1B 3QFJB 4ZPVB 4PGEB 4LHUD 4JO3H 5FDWA 5E1AB 4I0KA 5F72S 2J6EH 2RJMA 3FQUA 4UTBH 4NWUL 3E6FB 1Z0MA 3HR5B 4HMEA 3IS0X 4G8IB 4H0GA 3ZT5A 4W6XB 1UM6L 4GRWH 3X14B 1TJIL 5GRZA 1FORH 2D31A 1WBYA 5IB2A 4WUKL 4URTB 3CFCH 1TQCB 1A9BA 1X7QB 3FB7B 3HUJA 3NGBC 4WI5A 4OZHA 3WL9A 1DQQA 2OR9H 2VR9A 4YBQC 5EBWA 3NCJL 2B1AL 1WZKA 2YD9A 4NDMB 1JHTB 1AKJA 2D0FA 4M48H 3VD3A 3H7BA 4YBHA 3MRJA 5KS9A 4RX4A 2IPTL 4QCIA 4H5SA 1ZLVH 3EIFA 1A6TB 2H6PB 5E94B 5D71H 4LSUL 4G7VH 1MI5E 4EN3D 1IGJB 4K3JH 1FSKB 4ALAH 4F9LA 3WYRA 3GSNH 2AXJA 2F8OA 4DEPC 1AY1L 3DXAE 4HWBA 1QBBA 2IGFL 3F62A 3V4VH 3QEHA 1YQVH 4UTAH 2PCPB 4OGAD 4TSAL 3T0EB 4U7SA 4CNIA 5IVNA 4U6VH 1A7QL 1OGTB 1F3RB 4YEEA 1LE9B 2AJSL 1NL0H 1OAZH 1NFIA 5EOQL 4MD0A 3CLEL 4YHPB 4POUB 1K2DA 1BFVL 2DL9A 5DMIL 3DSFH 3ARDC 2FECL 1RPQA 4AEHH 1NGQH 2X4PB 1OSPL 4R7NA 2ZSVA 4E41E 4F3FB 3H9HB 2Q3AA 4JN1H 3TBYA 3TWCH 2JB6A 4J3SA 4C56B 4NO0B 4MDJB 1T0NB 4PD4K 3HAEA 4PJFA 1Q94B 4AMKH 5I30L 3FN3A 4KJYB 1FNAA 3DETD 5H35A 4JM2F 4HS8H 1YNLH 4KAQL 4LLYB 4NJAL 1QR1B 3MNWB 4KRPD 4HIJA 5DEFA 4G9FA 1MWAH 2YRLA 3D85B 1S9VB 3RTQD 1D5XB 3BUTA 1QRKA 1PVHA 1Q0YH 3OKDA 1IQWH 2OP4H 2EE9A 4ZO8A 4GRMA 4Z7UF 3U0WL 4KHXL 4TULL 4GJTB 3KHOA 4K07A 3I02B 1EX0A 1HWHB 4YDIH 5DK0A 4P49A 1ZEAL 1IAKB 5HI4C 1T2XA 4HJJL 1W0WB 3TT1H 1ETZB 3CLFH 5F1IB 4LAQH 4DCQB 3AM8C 3SDCD 4Y5VC 4Y2DC 5IK3B 3DV4B 4HCRA 3PV7A 1L7TH 5LQBL 1FC2D 1KLUB 5HPMA 4XT1C 4IRJB 3NA4A 5I8CA 3B2UD 3M17B 3STZB 3OKEB 1XH3A 1S9WB 1DQMH 5DJ8B 2BY0A 4UNVA 1FZOB 4L8DA 3WEXA 3FQXB 1GYAA 1HXYA 4ZOBA 5SX4H 1A4JB 2DL2A 1F6LL 3QIBB 4RFOH 4FQXB 2IQAB 4M8QA 1RULL 1SM3H 5C0AD 3WNPA 3S88H 1VACB 1JPFA 1NGXB 5DWUL 5F9WC 2AI0H 4KKAD 3SE3C 3BDXA 4ZFZA 2GAZB 5HDLA 1VENA 5DXWA 5HHPB 5GGTL 2DYPA 4LKCB 4JHAL 3MACH 4HKZB 2EE2A 5CWSB 1CE6A 1GAFH 1MCEA 4WY7L 5C0IA 4J23A 5INCA 5DI8B 1BEYH 2CK2A 3QCVL 5FUOL 4GKSB 3IFLL 4GG8B 4Z78B 3BUYB 4G7YL 4WHTA 4KDTC 1EPFA 1OP5H 5BXFA 1MIEH 5KSBF 3ISWA 4LLQA 3NPZB 2IG2L 1MI5A 1KXVC 2AXFB 5ESQA 3WNMA 2P47B 4HULB 1II4E 1XZ0B 3TNNA 5EZJA 4JM2B 2X4QB 3R06A 5EO0B 2R4RH 2YPLD 2ZG1A 2FLRT 1B2WL 4JVWA 4OF6A 4R7DB 3NAAL 4X7CC 3RHWF 5JNYA 1CDBA 1DLHB 1QO3B 4XPAH 1CD1A 5HHNB 3S5LG 2ZCHH 4YNYA 5C08B 3CFEA 4Z7UB 4Q6IA 5AZEL 4HIXL 2XKUA 1MCQA 4F57L 1DBKH 3GRWA 35C8H 4LCWE 5T3XL 1DBMH 4C58B 2Z4QA 4JFZH 4K3HA 3VFRB 2GK0A 1QVOB 4GBXA 5IMLA 2NW3A 1A5FH 2C7UB 4YPGA 4E41A 5KOMC 1MFAH 3HPLA 4O2CA 3OKMA 4RFEB 3C9NB 5DQ9A 1QSEB 5IW1B 3WHXA 1REIA 1FL3A 1YEHL 4QTIH 4XXDB 3MOQA 3HAEG 1IL1A 1LO5B 4QT5B 3AS3A 5C0GA 4PRDB 3RWHA 4ZO9A 3ZKMD 1M6OB 1GCFA 4OLVL 3HI6H 3ORJA 5IHLB 3ULUL 4KZEH 1INDL 1W72H 3ZHKA 2OK0L 2ATPA 4MWFB 2GJ6D 5I8OL 5BV7H 5E0QA 3PQYB 2A1WH 5ITFB 3WFEH 4WU7A 3SE8H 4PP1C 1T89A 1XF3B 3ARZA 3E8UH 1ORSA 2XPGB 3OXSA 4I9WE 2FRGP 4K94L 1WAAA 4XC3L 3KPSE 1NEUA 4J3OC 1D9KB 3SCMC 4FNLH 4OLWL 3VXSE 1L7IL 5FO8B 4PJ7F 2FR4B 5BJTB 5KSBB 5ANME 4C4KT 1MJUL 2NLJA 2WP3T 4GQ9H 5E8PA 2J8OA 3MLXL 4LGRB 4L1HA 4QOKD 2BNUA 4NC1C 5J8OA 1NMAL 3GSOA 2H26B 2UY7A 4KK9C 4JDVA 2Z31C 5IHUH 4YHOH 2VZTA 3ZE1E 1IT9L 4Q9CA 5I73C 3VDCA 4L3EB 3GKWL 1E6JL 4N0FB 2Y6SC 3R4DA 4QXUL 5EOTA 2FHCA 4TTDD 3DROA 1FNGA 3SE4A 3TC9A 2XTJD 3AVEA 3TBSA 1UQSA 2AS5M 1IVLA 1VFMA 3MRLB 2ZUTA 3LKNA 3ZDYE 2FX9L 3WE6A 4Y16C 3NCBB 3UJTH 3IGAB 3H8NA 2QQLH 3PABA 3RQ3A 1UEYA 1BBDH 3U4AA 3VGDA 3P11H 1F13A 4GRLC 5I1HL 1CICA 2VABB 5SWSB 5IMMA 2MJWA 3AREC 1D6EB 5DUML 3LD8C 3QQNA 5HDBF 5DHYB 4QHMB 1FZMB 4TN9A 1PLGH 1UCTA 5EUKA 4DGYL 1UWXK 2R4SL 3RUGF 3TCLA 3GI8H 4KKCD 3QDME 2BVYA 2F8VA 3MREA 3WKML 2W0KA 3I6GA 1TXKA 3E6HA 4Y19A 4LSRL 5I17A 12E8H 5DZOA 1I7TB 3D18B 5SWZB 1A7PH 1OTUD 3D87B 3SDYL 3S34L 1SJVA 5IB1A 4Y5YA 1HZHL 4R0LB 5IB3B 5JHLH 1CG9A 3GGWA 2APVA 4QYOB 4LFHD 1KFAH 1K9TA 3H0TA 1FBIH 2XZAH 1T7XA 2VDLL 1JHLH 1KN4H 3TEUA 1KULA 4PJ7B 2DLHA 3UDWA 1JF1A 3EO9L 2YWYA 4OZGE 4ZUUA 4JFEE 3O3AB 3CU7A 4RA0C 5MEQB 1KGCD 5E8NA 2LABA 1FLTX 1F00I 3HE7C 4BSVA 2W0FB 3LDBB 1RVFH 4K2UL 1TTUA 1YUHA 4P3CH 1QLRA 2GSIA 4TPRL 1RJYA 2DWEB 4FA8A 1YY9D 2VLRB 2CXGA 1JGUL 2WQ8A 3QUMA 3ZTNH 5TH2A 4GXUM 2AEQL 4PB9L 1NCCH 2YRPA 4UB0L 3RY5A 3S4SB 3QDGB 3PDOB 3ULVD 1AD0B 3PL6A 1PYWA 2IPKB 2XQBH 3U48A 3LIZL 4LF3A 5FO9B 2BHUA 4NKDB 3CZFB 4XNMB 1VKXB 3IDNB 3KPSA 3RZCC 4NQEE 2R2EB 5ESAA 2Z91B 2XICA 4OFPA 4ZO6A 1PY9A 5ECJE 4IDJH 4IS6A 5ANMA 2IALB 3NPSB 3RUGB 4C56D 3VXRE 4NO0D 3BKCH 5FKPB 4F33A 1NDGA 3BH9B 1WGOA 2DLEA 3CFJA 1QNZH 2PO6D 4NQCD 4OD2B 5D1ZC 5F3HB 4QHUB 3L5WB 4K7PY 2IMNA 5IG7B 3L5XH 2D2OA 2AABL 5JHDB 3D6GA 2CUHA 3KDMB 4LVHB 4YXKH 1K3IA 1CXEA 3EJYC 3KLHC 1FL5A 1RK0B 4MA7L 1Y0LB 1KTDA 4PTUB 1G6RA 5ICZA 4HUXB 2EDXA 2XT1B 1D5BA 4I0CC 4TSBL 5JPNB 5DMKA 2HMID 4G6ML 5I8EB 1ZVSA 5BVJB 4J3WA 2K7QA 1WZLA 5HGHA 1KIPA 5HHMB 1O0VA 2Y72A 5CD5C 3MJ8A 5HYIA 4IRJD 3BIKB 4U1LB 1NBYB 3G6JF 1UWEL 3G5VA 5I71B 2VWEE 5K9OA 1TQBB 2GJJA 1ND0B 2LFGA 3CDFA 3MRQB 3QIBD 2GCYA 4FQXD 3NCCB 5DRXB 3V0VB 4NBYB 4HG4K 3O8XA 2VQUA 2P5WE 3UZEA 4UT6H 2BX5A 2ORBL 4JFOB 4PJ5E 2WUCH 1ZT4A 2HFGL 2YPKB 2UWEB 2EH8H 4P9HL 3WNKA 4FXGB 3V52H 3V2AR 5EUOE 4D3CL 4KY1L 4P46B 1YNKL 4OCXH 4OZGA 4X6DF 2Q8BL 1FRGL 1F4YH 3R8BB 5MI0C 5JO5B 3HZYA 2BY1A 3QIUC 4PJXF 1V3JA 1YN6A 4FQCL 4IRSB 3ULVH 5ENWB 4PJGF 1VDGA 5A3ID 4H26B 4Y5XB 1OTSD 2HJKA 2H1PL 4LRNH 1I7RB 2ED7A 2YUVA 4JM2D 1EXUA 4JZOB 4LSPH 5GGUA 2OM5A 5CSGA 2FGWL 1IGIL 3EBAA 4FFWD 5DD5L 4WEUD 1C7SA 4RZCA 5LGKA 2VDNL 4ETQB 2XZQL 4K7PL 1T1YB 1MSPA 4ZS6D 3I50L 3MRPB 1A14H 3MBXH 4G42B 5HI5D 3BO8A 4NQEA 4P4KD 3EYQC 3KWWA 4WU5A 2H2SC 2ESVE 3IDJB 4WWKA 5CJXA 5HVWA 2DM7A 3MLVL 4N1CA 4XCFH 4PJ8B 1R3IL 3T0DA 2CPCA 2Z9TA 3ZDXF 1QSED 2UVFA 2ERJC 3OKKA 4JPKL 2V7NA 2VDRH 1L9NA 2DM2A 1P2CB 3ES6A 3VXRA 4XZUB 1LK2A 3B83A 2P44B 4IHOA 4M03A 4OM1L 5BZDA 4GUPA 1TFHA 2R69L 3BOVA 3RVUD 2EKSA 4XPGH 1EV2E 3SKOA 2ZUVA 5D1XB 4P23B 4KTEH 1KIQA 4X4XB 4KQ4H 3UBXB 1GC1C 1DR9A 1FNEB 3TA3C 3PQYD 1BFOB 1KIUA 3VXPA 4I2XE 4LLUB 4UDTB 5CBAB 2NY5L 2NXZB 4MB5A 1F11B 2NY7H 1DLFH 3Q48A 5I0ZA 4QY8A 3SPVB 4JDTH 1NEZA 5C9JA 3ZDZF 3DETC 4NN6C 3VMOA 2EYRA 1DN0B 5T3ZL 1D9KD 1LILA 3L95A 5DR5H 4X6DB 9CGTA 5EPMB 5DTFA 3GSQB 3O0RH 3RTQC 1GGTA 1MVFA 1AI1H 4PJGB 1MAKA 5DLML 1M7DA 2NY0C 3HMWL 3QWRA 4MJ5B 3H42H 3C5JB 5EC1A 1ZV5A 3DRQB 1R5IA 3H3BC 5MEOB 1BVLA 3CDCA 3MODH 4NFCA 3MLRH 1KBGL 5F7KC 1MAMH 4L3ED 1U8JA 5FDWB 2FEDD 3DIFA 4AYFA 2VQ1B 4RMUA 2H9GA 3FQUB 2EIBA 5E9DA 4TVPL 3IDXL 3MRGB 3PGFL 1P4LA 3TO4A 1IGTB 2O26U 2P5WA 5EORH 3GSWA 3B2UC 4GH7B 1EVTC 3JUZA 3HZVB 5D2NC 3C60B 3QJHB 4OLZH 1A7NL 2E27H 3F5WA 1P4BL 2X40A 1N3NA 2VQTA 5DQDH 1V7NL 4Z0XB 1OF2A 4H8WL 5EUOA 5GSRA 5D2LE 4M62L 1K6QH 2X4TB 1RIHL 3MA7A 3HCVA 5F6HI 2FGZA 2ZUXA 4Z7WF 2QSTA 1JWSA 1U42A 3MV7B 2F53E 1JF6A 3TGXA 4KKAC 3QQ9D 1RZIB 4JANA 4NQVA 1MCJA 5EO9A 3SQBA 1JYXA 1N0XH 3DUUB 3K8MA 4QHLA 1RUAH 2X4SB 1U3JA 1S5IH 2DM4A 3MBEA 4TOYL 1T2QL 3S5LB 2FEEL 4HUMB 4YBLC 3PWUB 1A7OH 5EWIL 4PLJD 2HT3D 2VXVH 1VPOL 2IADB 5EFIB 2CJUL 1NFIB 5EC2A 4ELKB 4MA3A 1R3LB 2BVQA 5AG9A 4L29B 4G8EB 3HE6C 1QFOA 1XR8B 2YRZA 5CJQL 2NXYC 2NCMA 1TDQA 2ESVA 3MUGA 4ODXA 1YNTB 2X4NA 1RHHA 1TCRB 1IC4H 3HN3A 1NC2B 4JPVH 3L9RB 5T1KB 3RU8H 3G9VA 3FQNB 4MNHB 1JGLH 5D7LE 3UTSA 4F7MB 2GITA 5TE6L 3FZUD 5I1KL 1U9KA 2R29H 1KTLA 3BZ4A 2A2QT 1CXFA 3UYRH 5FKAB 4FABL 2DQDH 2VLRD 3S98A 3VRJA 1M1SA 3SDDD 3QUZA 5H94B 2HAZA 5CMAB 3W9DB 4WFED 3QNZB 1B0RA 4AEEA 1WZ1H 2YK1H 3WFHB 3CFBB 3L3DA 4I2XA 3QDGD 3D39B 2DOCA 3QH3B 4KVCH 2BSRA 3RNQA 5F7DB 3ZKMC 1NEZG 3KYKH 5E4IA 3MV8E 4XWOC 1JRHH 4CN4A 3OR7B 1FNFA 4XVJL 3L6FB 3B6SB 2XZZA 3SKUD 5E8DL 4ZNEE 1I7ZA 1UWXH 4Z7WB 2Y9RT 4KHTH 5IOPB 5IB5A 1U3YA 2OL3B 3HG1B 1CGUA 1FYHB 2YKLH 3Q2CA 5IEHA 3HZMA 3QG7H 4PV8A 4YFDB 4YFEA 1XGYH 1N59B 2VB5A 1MY7A 3C5ZB 4I3RL 1CD9B 1CL7H 3JWOC 5KW9L 1U8PB 3EYUH 1YYLL 4ZDHA 1C08A 1OD7A 1DE4A 2Y7QB 5JHDD 3BFOA 3RWGB 2R2BA 5CZXD 1FVEB 2YUXA 5DYOB 5KJRL 1FCGA 3BPNC 4BZ2L 4NNPH 3EO1A 2J8UF 3NCYP 1JPFB 4P5TB 5CEZD 2WWMC 1J12A 3OJDB 4FP8H 3FOLB 2I07A 4G6AC 4NZDA 4RMQA 4YFLF 1UGNA 3GBML 2G5BA 1AO7E 3SKJH 2CLZB 3RP1A 4K8RH 4AY0A 5F7LB 5HD8D 5I1JH 4F7PA 1DBJL 2W65A 4OSUH 2VXSH 1NGZA 2A83B 5HHMD 2VLJD 2KDGA 1G1CA 4R4BA 1KJMA 3Q0HA 2GTZB 4YE4H 4NRYA 1LGVA 3STLA 5C1MB 1UXWA 5ESQB 2EYSA 4PRNB 3LPFA 2WANA 3FOMA 3IJHB 5EZJB 4I3GA 3OXRB 1BF8A 4FHBD 1UZ8B 2QR0A 1FFPA 1QHPA 3DXAB 4CVZA 1CQYA 4LSDA 1HKLH 5GRJH 4ZFOA 2OYPA 4RGNE 4X9BA 4U6TA 1S7QA 2JK5A 4YHKH 3ZZ1A 1P6AB 1NCAH 3LV3B 4HWNA 5LGJB 1H5BA 3BYTA 3BVNB 2BNRD 1T03H 3FT3B 1AJ7L 2Z4QB 1EEUA 1RZGA 5LAXB 2VLMD 2FHBA 4YGVA 2SEBA 1S9YA 5ISZB 4IRSD 5IMLB 5JQHC 1T04B 4E41B 2YZ8A 4UIKH 3N9GL 4OD1H 3NZ8B 1LO0H 1DL7L 3MRHB 2J12B 1UM4H 1QFWI 5TDNB 1KF9B 2YC1B 4NUJA 5D7LA 3UC0L 1I7UB 4PJEE 5E8OA 1ZMYA 3OAUH 3QHZL 4JRYB 5KG9B 1FGNH 3FQTA 2PR4L 1FCCA 4X9HA 2AK1L 5BO1H 5T5FL 5EA0H 3D25A 5E70A 2A6KA 2CRMA 3AB0B 1A6UH 4A6YA 4UQ2B 1KLGB 4CAGA 2DLTA 4XAKE 4XP5L 2AV7A 1UJ3B 3KVQA 2V2XB 4G6JL 4XWGL 5I15H 1FSKC 3FCTA 1QP1A 4AT6B 1MIMH 4ODWB 1FNSH 2C26A 4LKXB 1DVFC 1J0YA 3MV8A 4CVXB 4ONHA 1ZHKA 4KTDL 2EDEA 5FHBL 2V17H 3SO3C 4ZNEA 3VFUB 3T0EC 5DUPH 4JR9H 5TE4L 4H0HB 5JR1L 4GAGL 3U7AA 4PJ8D 2EIDA 3MJ9A 3TCXA 1IGMH 1A2YB 1WV7T 1PJ9A 3ULVC 2HVKB 2BVOB 5CEZH 2FSEB 2FYYA 2F5BL 2NLJB 2AK4E 1JZ3A 1LD9B 1F4AA 4PRHA 1AQKH 5L0QB 1DUYA 5ILTH 3DMMB 4MAYA 1IC7L 5J1AA 3L3HA 4HWBL 5E03A 4ZODA 1U3HB 1E4KA 2R1YA 4GW4B 3Q3GB 4JDVB 3V6BR 2BDNH 1RAMA 5C0CE 3U2SA 4K3DH 5EOTB 1F45A 2Z0BA 1HIML 2NXZD 4OAWA 4L8CA 1S7TA 1FNGB 4JHWH 1IM3B 3DUSB 4G6KL 2IBBA 3WFCL 2IQ9H 2G75A 2D03H 4ONFL 2DQGL 5I16A 5J6GA 3SDAC 2VXTL 1CDUA 5DD0H 2QJDA 3GHBL 1CICB 2X2YA 4XCEA 5IMMB 4HAFA 1ZAGA 4XC1H 3WIHH 5I75C 2UY6A 4ZSOE 5CJBA 4ODSH 3D0VA 4RISH 4KDWA 4JO4H 1H9VA 4LU5L 5C0RL 2Q7NA 3QUYA 4UDUA 3PDDA 4ZUWA 2ADJB 3PXHA 2Q7YB 2VERN 1F58L 1GZQB 2HFFB 4RBPK 3GSUA 4O2EB 4IRJC 5GSVA 4FFVD 3C60D 1BQHA 1AXIB 1LE5B 5EZLB 3WFDH 4YHLL 2J5LC 1JNHA 3QI9C 4LCWB 4FQXC 1UC6A 2DMKA 4R3SA 5HI3C 2XYCA 2L0DA 4F7TA 1GJIA 3MV7D 3CK0H 4HCRL 1LP9F 1GH7A 4EOWH 3ECBB 1P7KB 4FQ2L 4HKBB 4PYHA 4JFFE 2CK0L 3BXNB 2C5DC 2RBLA 4CJ1A 4LSQH 4PJEA 4BSVB 5IW3A 5JA9A 3U7WL 1A6VH 4NPYB 3MXWH 5DVLA 3FT2B 1XF2B 2Z8VC 1E4XH 1XCTB 4OTXL 3MLPA 1HN1A 5IHZA 3VDAA 1V3KA 4HMDA 2XZCL 3NTCL 2FO4A 3L7FA 3T0VA 3FB5B 2H8PA 4XXCA 1EJOL 5A3IC 1WT5C 4X99A 3EYVB 1OLLA 1OTSC 4XRCB 1CLYH 3H9SE 1C5BH 4JM2C 1NUNB 5JXEC 3LEYH 3DI3B 1MJ8H 32C2A 1WTGT 1FGVH 2HH0H 1XGRB 4APQD 1YZZA 4KV5E 5DF0A 1J1OL 4OFVA 5MERA 1R5VB 5ESAB 4LCCB 4MDIB 4HT1H 3MR9A 4U6XB 2R56H 3VXSB 1NC2D 4E42B 1PEWA 4R8WL 3N1GC 3VFVB 5ANMB 4R9HA 3TN0B 3GK8H 1MCKA 2C1OB 4L8SA 1KB5B 5DGRA 2OJZL 5GRVL 1T66C 5IFJB 3SKMA 4F33B 4XBEL 4MAUL 2OSLA 4QRUA 1J1PH 3DO7B 1RFDL 3VXTB 3CFJB 4LCYB 1FO0L 5C0CA 2VZ3A 4YZFE 3VFNB 4I0PD 1FFOA 4MQ7A 1K8DA 3THMH 2ZOLA 3D39D 3CSBA 2AJZB 4OGZA 1JZ8A 1R3HA 4U1KB 3O45A 5LWYL 1A4KB 5IVZB 1FL5B 2E7LC 2DTSA 5J1TC 5DJXA 2FJHA 5D7JB 2LQRA 2B7DT 4ZAKB 4H1LB 3MFGB 2M8XA 3HG1D 2ZOKB 4TUJA 1LP9B 3SGDH 4NWTL 2DI9A 4GMTL 3VWJC 2XXCB 3HNSH 3JV4B 5A16B 1BQLH 3BKYL 3BMVA 1YMMA 5FM5O 2DIAA 3C5ZD 7FABL 4OJFH 1UH4A 1HSAA 3TVMA 3V6FB 4Y4FB 2DD8L 4AH2A 4LBEA 2X1QA 3F6IA 3QDMB 3QIWD 2XFXA 4OB5L 1JGVL 4JAMA 4PRAB 4QWWD 3V0WH 4JJ5A 4P3WA 4JPWH 1F3DJ 3SOBH 1RURL 1SJEB 1DZBA 4P5TD 3AS1A 1AGFB 2I27N 1KEMH 4RQQA 4JKPL 1BQHG 3EOBB 2JE8A 4X6CF 4KKBC 4ODUB 1HYSD 5HJ3B 2ICEA 2AQ1A 1IKNA 2R1WA 4P59H 3WIIH 3MGOA 3U0PB 2NTFB 5ALBH 1B88A 3TIDB 2JKXA 4JFEB 4RNRA 1PQZA 3QEQE 1U8OB 2HVJB 4JKLA 4XB8A 5ACZB 1P1ZB 1SEBA 1I9JH 4WI3A 3QEUA 2ZKHH 1IGYB 3G5ZA 3IS1X 5H8DA 3HS0A 1Z6JT 2X1XR 1ADQL 3GMMB 1KYOK 3DXAD 2BOCB 3IFPA 2ZUWA 3VRLE 2H45A 4BZ1L 4U1NA 1PG7H 3HRZA 1KOAA 4R26L 3GMNA 5T5NG 3K81A 3H9SA 1MRDH 1K4DA 1UADC 1T4KA 1V8HA 2ED8A 1T6WA 2AJXH 5SV3A 3LMJL 1Z5LB 1G7HA 4AIZB 2X89A 2E9BA 3D0LA 4K8RC 4NQEB 4EJ1C 4EQ2A 2UUDH 4K9EL 2YHGA 5ISZD 1J11A 4M6NL 4K7FA 4R0LC 3UPCA 1AGEB 4JJHA 2V2TA 1JWUB 5IR1A 4LCIL 4QF1A 5F7HA 4JRYD 1MCWM 3LKOB 4IDLA 4IHOB 2ZCKL 2ICES 1MRCL 3QXAA 4LK4A 3ARDA 4RDQF 2OL3H 4R4FL 1DQDH 5FUZH 3KPNA 1MJ7H 3BEVA 1EAPB 3Q6FA 4S10A 3LS4H 4UT7H 3G5YA 3MGTB 4QHNB 3RY4A 3B5TA 1QEWB 4ZYKB 5TF1L 5GGSA 3OV6A 3FZUC 3IFNL 1ITBB 3BP6A 2LE9A 5FUCC 1AGCA 4X6CB 3QISA 4NQUA 1N5YL 2MCPL 4JY6B 3IVKA 4XP6H 1Q9WA 4PLOB 1NEZB 2ITDA 5HY9B 5DHVA 4MNGE 3L7EB 4KWUA 3O2WL 4NM8H 3L95B 1A3LL 2V2WB 1IKFH 1NBQA 3HNVH 2VLKB 1X5JA 1CFNA 1KIRA 4S11A 4NQDE 2R9HC 1A3RL 2VJXA 3DMMD 1LK3L 4M6AA 4ERSH 3BQUB 3C2AL 5IROA 1U3HD 4C83A 4N8PA 3QUML 4UUJA 1FVDA 3KS0J 3ULSB 1U8JB 4YQXH 2VDKL 2VRAA 3JZ7A 5EU5A 1CDJA 3NPSC 3CU1A 4Z7NF 4Y2DA 4XPFL 1QLFA 1BM3H 4UV7H 2P5WB 3GSWB 2O5XL 4PJ5B 2IPTH 4N5UA 5F9OL 1P6FA 3UJIH 2R0ZL 4YX2L 3LKRA 3F5WB 1N3NB 1E0OB 3O6FA 4F15B 4LSUH 3D2UA 2P43B 3G5XA 3ZO0A 1FG2B 4U1HA 1OAYH 1HOCA 5CZXC 1K85A 5HGAB 1SY6H 4WVRA 1YEKH 3CAFA 2AGJL 3BT2H 2DLGA 5HYSA 1AC6A 2GJZB 3SE3A 1IGFL 1DSFL 3MQIA 4TSAH 3DVNB 4PRPD 3HI5L 4P2QB 7CGTA 4KMTH 2Y07L 1PG7X 2LV4A 5FK9A 3UTTB 1AQDB 4RIRA 1UM5L 3C09B 5EOQH 1QFHA 2VNCA 4OCYL 5D5MA 3TZVA 4D9QE 3HKFA 5IBLD 5JORB 4U33A 4KDTA 4F7CB 3UEZA 2COQA 1NGPL 3PUCA 3UZVB 5JUEH 2EDNA 2HJLB 1G6RL 4GT7A 1KACB 4PG2C 4WW2F 1TLKA 3FONB 3GJFA 4LNVA 1KT2B 1X5ZA 4U0RB 5DMYA 2J4WH 1HYRC 1TQBC 3DVFA 4Y4KB 1CLOH 5AZ2L 5FO7A 4HLJA 4LCWD 3Q6GL 3I3EA 3LH2H 3WDJA 1BJ1H 2QHRH 3TJHD 3VW3H 3LQAL 2QQKL 3DBXA 2KZ1B 4LLMA 3A6BL 3GSVA 4QRSA 1NLDH 2ESVB 5D2LF 5LCVH 4OQTA 1N4XL 5T3XD 2A74B 2XN9D 1I1RA 4P46C 4JFPA 3EYFB 1JYNA 3P0VH 4YHNA 3U6RB 3BE1H 4GO6B 4X6FB 5D1QC 5FYLL 5IESH 4XMKL 4IRZH 4IRSC 2FH6A 3MLZH 3U0WH 4TULH 4QKXB 1C5CL 1B0RB 3CFKB 3CSYB 3O4OC 4XX1G 5D9SB 3MRDB 4Y5XC 3BEWB 5IF0A 3NZHL 5I66A 3Q5YA 1CDYA 1GL4B 4I2XB 1B4JL 1U2CA 4R4ND 3CVIL 3WUZA 3W39A 2PYEA 2BSRB 3F7RA 3ULUD 3CDYA 5CGYC 2A6DA 1QSFB 1KV3A 3CMGA 4GMSH 4ZOEA 1ZS8A 4MNGA 1JTTA 2X44D 1Z9LA 4NKIL 4F8TA 3N85L 3VXSD 4XAWL 4CN6A 1LNUB 3C5SB 2IAMA 3TP4A 4DVRH 2GY5A 5FGCB 5IVOA 1T1ZB 4PY7B 4RBPH 2DDQH 3SQOH 3ARBD 4NQDA 4P2OD 5I19L 3TFKD 2XRAL 4XNZC 2P48B 3I6LE 3O2VH 2JJUA 5E2UH 3P30H 2DMBA 3K0WA 4GFTB 5GHWL 3MOAH 4PJ8C 2W38A 4PJDF 4MXQC 5ADOH 5D7SL 4D0DA 2F8XC 4I5BA 2MHAB 5IJVB 1OPGH 2ZUSA 1G0XA 2G2RA 3MLSH 3ZE0E 5BZWB 5F96L 4WW2B 3RVXD 3QXDA 5CINL 1F5WA 1WEJH 1NAMA 2X1WL 3JVGC 1DUZB 5B39G 5KSAB 4YXHH 2GIYA 2Z35A 4HK0B 3T1FB 1RZFH 5D1XC 4MGXA 1I1FA 4P23C 5FUOH 3IFLH 3S36L 5D7JD 4X8JA 4ZAKD 1QFUH 2JCCF 5L7XL 1P4IL 5D2LB 5EBMA 1TZHB 2NXZC 3RI5F 2D0HA 2ITCB 3QR2A 5HHQB 5DJYB 1H0DA 4L8BA 2F53B 4Y4HC 3D3VE 5E6IC 5E5MB 5HYSG 3VFOA 1B2WH 3BN9D 1JPTL 3UO1H 4EDWL 1Q9OB 1D5IH 4Y16A 1MVUA 2DI7A 3PHOA 4Y4FD 2V9QA 1G9ML 5CZKA 2VE6A 2NY1B 2HYMA 5D96C 3CX5K 4NT6B 3VFTB 3HA0A 2CMRH 4LDLB 4GRLA 5AZEH 4PV9B 4PB0H 3RVVD 1QBLH 2FATH 3OKOB 1NKOA 1HHGB 3B2VL 5ETUA 5L2KA 4NM4H 3WO4B 3AGVA 3MUJA 3P0GB 4FN0A 4BFEA 1EGJA 2EZ0D 2EH7H 5LG1A 3V6ZA 1IARB 1S5HA 3JWDH 3VXUA 2JIXA 2CKBA 1FNLA 5T1MB 3GMPA 5DVOA 4QRTA 2F58L 4FFVC 4WEBH 4JFED 3ILQD 1CGVA 2IH3A 2W9LA 2WIIA 4CVUA 4ZXBB 3B8YA 4PJDB 4D0CA 2DN7A 2VZVA 4NNYB 1MPAH 3E3QE 4FXKB 5DS8A 1KNOA 5BW7A 5E2WH 1Y6MR 4ORGB 4PGCA 2QADD 2MKLC 5KZCD 1HSBA 1A7RL 1KB5H 3PWJB 1AP2A 4OCSL 1BZ7A 4J1UB 5L2JA 2VL4A 5BCAA 1A0QH 4F9LC 1L7IH 4Q2ZA 1O7SA 2KL6A 2VAAB 1AFVL 2JCCB 1U8LA 2Y36H 1RUQH 1CIDA 2W9DH 4ONHB 2Q20A 2DQEL 2J6EA 1NBZB 1MJUH 4O2FA 3EHBD 5IVXE 1F90L 3H9ZA 3SGEI 2MSPA 4ISVB 1RQ5A 2IMMA 3B43A 4NHUB 4ZTOL 2R8SH 2BY3A 4HUNB 3L3OA 1FFQA 5CJOH 4KK6D 1X4ZA 1U58A 3V8OA 2DQFA 5FGSA 5BMFH 5GS0L 1NCUA 4U1SA 2L7JA 2RIKA 3ALXA 1Q8MA 3LHPH 1UACL 4NFBA 3G08A 3HC4H 4HKJA 2BSED 4YR6A 3I84A 5EU7C 5J7CC 3DWTA 3U4EA 1RIVH 1A9EB 3SGKC 1DQTA 2NQCA 3D9AL 5EZIH 2ZUYA 3VE0B 2LTQB 5I1DA 4DN3H 1M71A 1K8IB 1OM3L 3DPBA 4HPOL 3BRDA 2ADIA 3IDIA 3GSNA 5D1ZA 2HLFC 2WLYA 3E0GA 2Z92B 3UMTA 1KB9K 3O6ML 1AO7B 4KVNL 4P4RA 4UINL 4MXVE 1QPXA 3X11B 5HTSA 2DQJL 5I1GH 4HXBH 1A6WH 1G7IA 5IHBA 3FO2A 2AKRA 1HHHB 4QNPF 2VLKD 4D0BB 5FYJL 2VLLB 3NFNA 3D3VA 2PYFA 3MZGB 4X5WB 1UXSB 2C1PA 2OQJB 1HH9B 4KI5C 4RAVB 1J5OL 3BQUD 4BQ9A 1YMHA 4DUVA 3SDYH 2GY7B 4RMSA 4UDUB 3IAPA 3V4PH 3QBTB 3VGBA 5CKAA 5D93B 3K3QA 4M43L 1BD2D 4Y2OA 4NUGL 4MD4B 3S96B 4L4JA 3GB7A 2VDLH 4I3SL 2X6MA 5I1LA 4PJAE 5CUSH 5IBTL 1AXSA 4YDJA 2E6JA 3WFBL 5E2TH 3RAJH 1JNHB 4M7LT 5KSVB 1DBAL 3CMOL 1CGWA 1MWAA 3UP1A 5HVHB 4UI2A 4QRPA 1BGXL 3QCUH 4DZ8B 4XP9H 1XR9B 3GNML 5D2NE 4BUGA 1JGUH 3JTSA 1U93B 1G7MA 3IJSB 1WFOA 3MRMB 2DKMA 5JMRA 1QBML 1HYSC 1U0QA 1EO8H 2AEQH 4P2QD 3BDYL 3OZ9H 4UB0H 5JW4Q 3UTTD 2C9AA 5F6IB 5C0AE 4YIQA 3PWPE 4K3EL 3QIUA 2X4RB 5ERWA 4KTYA 4JHBA 4Y8AA 5DO2C 1CGSH 1LO2L 2HKHL 1TZGH 2VH5L 4NQSB 3T0WA 3MUY1 1I3RB 2EXWD 4Y4KD 3BRFA 1RIUH 2UZIL 1CDHA 1P84K 2D7TL 3U36B 5KVFH 5KN5A 4WGWB 2FWOB 4W4OC 4KFZC 4EUPB 1GGBL 4O9HL 2ICWJ 1KG0A 2WWKO 4NOFA 1YECH 3O2DL 4M7KL 4LEOB 1CZ8H 4EN3A 4O51B 4TQEH 1BZQK 4AEIL 1O5DT 4YH6A 5DRZB 3LQZB 1I4FA 3AXLB 1OB1B 2YN5A 1ZTXL 5F1KC 4WI2A 2YPLE 1NAKL 2AK4B 3ZSSA 4H20L 3BPOB 1I85A 2Q8AL 3VFGH 3SKMB 2CIIB 3B3IB 4OUOA 5CP3A 4GBXC 4X6BB 1SYSA 3PDGA 4F7EB 3VXOA 4PJCE 1HILA 1CXHA 2VUOA 2YD8A 5EIQA 5F7MC 4PP2B 1A22B 1K8DB 5DJZB 2ZOLB 2N7AA 3MXVL 3TH3T 4N8VG 5TGBB 1V7ML 5DVKA 1R3HB 1YN7A 1VERA 3LN5A 1S7UB 3AB0C 1EHLL 3MMEB 1QSFD 3ROLA 2OS7A 1T5XA 4MXWH 5DUBA 5C6TH 3RWDB 4XNYH 3KPOA 4NZRH 1UJ3C 3QEGH 5L88L 3AY4C 1TJHL 3AU1A 3I6KA 4OFIA 5DJAA 5C0DA 4LP5A 5DJ6B 1J10A 4OZFA 4OZIF 1TETH 2Y23A 2BY2A 1J8HA 4JQIH 1KCVL 2VISB 5FYKL 3T4YA 3GIVB 5T3ZD 4ZSOB 4LSSH 4XTRD 1KPUA 4HWEH 2EDLA 2I60H 5CEXA 4A6YL 3GHEH 2UZYB 3VWKB 5IMKB 1KCUL 2GJ6E 2JJSA 1I9RH 3DTXA 3RTQA 4OBRA 2XFXB 4AG4L 4CKVX 5INDB 1KJ2L 4P9HH 1VFAB 1ZHBA 2YD6A 2C3HA 3WSQH 5L0QC 3NCFB 4MJ4A 5KSAD 4EBQL 1AD9B 2X09A 4KY1H 4YZFF 5LGHH 3OKNA 3BZDA 4OCWH 1SEQL 3GSXB 2FJGB 5I9QB 3TO2B 1U3HC 4PJAA 2CLVB 3NVQA 5GGVY 4U1JB 3X13B 1J88A 2OTWA 4FQCH 1L4IA 4MD5B 2Q87A 4FQIH 5GGRB 4TVPD 1ZHLA 4HGMA 1W72A 3HI1A 1FVCA 1Q1JH 3CVHL 4YK4B 3SDCA 3HC0B 5JIIA 3WDHA 4Q0XH 3WD5L 3HB3D 1FN4B 4QOKE 3FN9A 1JVKA 1RK1B 5E2VL 2BSSA 3QQ3A 2F53D 1N26A 4KZDL 1Z3GL 3RGVB 5D2NA 4JFFB 2C4FU 3P73B 4OQ1A 1JUFB 1S7XB 2NY1D 2GSGA 1T3FA 3JXAA 3G5ZB 1CICC 4WI7A 4L9LA 4NQTA 5C0AA 2CRYA 2XTJE 3IFPB 1UB6A 5ADPL 1M7XA 4QRQB 3O11A 1IC1A 2EYTA 3NFPA 5D4QA 3LZFL 5I6XB 3FO0L 2B2XH 1I9IL 2EDTA 3BP5B 1IGCH 1HCFX 4RA3A 1BFSA 3JTTB 3MLWL 3EOTL 3VI4E 4JPKH 3L3JA 1DFBH 5IBLC 3VXMB 4WDIA 3EKCA 1MLBB 4OZIB 4ODTH 5F89B 1TZIB 3RPIA 2R69H 4Y5YC 2IBGA 1VGKA 1F42A 1G9NC 1TTFA 5E99L 3C8KA 2YPLA 5HHVH 4I48B 1S78C 1B0GB 1T21B 4IOFC 5KVGH 1FZKB 5TPWL 2HN7A 2QBWA 3TJHC 1YC7A 1IEBB 3TPUB 3UDWC 3QXAB 4G80B 2NY5H 4N9GA 1EEYB 2EEDA 3KXFA 3BP4A 2F9BT 4KK8D 5FF6B 4PJCA 2GQHA 3BEVB 3O6KL 4IMKA 4Z77B 4IMLA 1ULVA 2X4UB 3F58L 1V5JA 3RX5A 2VKWA 4M61A 3ZTJH 5JQ6L 4HGWA 2DQUL 5ALCL 5HYQB 3TBVB 1FJ1B 5TQ0H 2J7LA 3IVKB 1FO0B 3QCTL 2ITDB 3JWDC 3MNVA 4FMFA 5DLMH 4HX1B 3X3FL 3HMWH 3S6CA 1Q0XH 3MRKB 5IM7A 1KGCE 3BWAA 2DQTL 5GGVL 5J6HB 1FG9C 1Z9OA 3FHAA 4OZFG 3UPRB 4NCC2 3EJZC 2E7CA 3IDMA 43C9B 2M1KA 1INEH 1CGYA 5K59E 4TVPH 5EBLA 4ELMF 2ICCA 4HIHB 4LCCC 3PGFH 2YS4A 3IKCB 5D7IA 4MB3A 4WFGD 1MFDH 2GJ6A 2YR3A 1MFBL 4N9OB 5HYJE 3DHJA 3TN0C 3ULVE 1OTTC 5EH1A 3GFUA 3EDEA 2MQ0A 5B39B 3R0MA 3EGSB 3O3UN 5JDSA 3HNTL 4NO5B 1T1XA 4JO1L 5C0EA 4X9FA 4A2MA 3O3BA 5JIKA 3MX0A 5DDHA 1IAMA 3WXWL 4QOKA 4C56E 2RFXB 4D94A 3UXFA 4PGJA 2BOBA 5SWQB 3QEQB 4K7PX 2NY6B 4ZAKC 4NQCE 5IGXH 2CLRB 3L3GB 4FTVE 4UT9L 4EI6B 3L1OL 5C0JA 4Q58C 3ZSTA 4JO2H 3RWFB 1OARH 4NKOA 4LHJB 4Y4FC 3IU3A 1XGTB 5AYUL 2NY2B 3C6LD 2BJMH 1C5DB 3QJFB 3BAEH 4QRRB 2ATKA 1K4CA 1MY5A 1AE6L 4L3CB 3CXDL 2FB4L 1I75A 3H2WA 4Y0GA 1QZ1A 5CBEB 3NCMA 1U8MB 5EULV 3DBXB 2YEZA 4R2GB 3RRQA 4QRSB 1N64H 2BNQB 2FIKB 2MQ3A 3MO1A 3QFJA 4ZPVA 1ZT7B 4ZD3L 4PGEA 3KYNA 4NIKB 5I8KL 4XMPH 2L4OA 5F7WC 5F93C 3E6FA 3HR5A 4LASH 4BK4A 2PNDA 4G8IA 3RIAK 1XIWD 5K9QI 3X14A 2X5PA 1URLA 3MJ9H 3SN6N 1IAII 1MHPH 3ILQC 1HHKB 3GJFK 1KLFA 2XTLA 4YGAB 5HGBB 4NDMA 3GUTB 1JHTA 4G6FB 3RWCB 3RWJB 4XH2A 1RU9L 2GUOB 1OAXL 4XBPA 5L8JB 4OLUL 3ARPA 3DX6B 1JP5A 4NKMB 3OPZH 4HQQH 3T0XA 1A6TA 4UBDD 2H6PA 4XP4H 5E94A 2Y1VA 2ADFH 1N2RB 1IGJA 1NCWH 2CQVA 1DEEB 5F9DC 5KW9H 4U49A 3ZKND 1X4XA 1TJGL 4JY4B 2AK4D 4NQDB 4FZ8L 4BUHA 4M5YL 3RL1B 4V2CB 4P2RB 5GS2H 2PCPA 3T0EA 4BELD 3TT3H 2P8MB 5F9JB 2F74B 4JLRB 5CJXC 4BZ2H 1PGRB 1HHIB 1OGTA 1LVEA 1WZMA 1U6AH 1LE9A 2VDML 4XNUH 4PJ9B 4KK6C 4YHPA 4I18B 4LVOB 3WO3B 4CGTA 4HH8A 2JJVA 2FBJL 3V7AG 1CI5A 2QSQA 2X4PA 1UYWH 4J4PD 4PPTA 4X8JB 3W2DH 3K8LA 3T2NL 3EFFA 4M1GL 3K1DA 1QSEE 4C56A 4NO0A 4MDJA 3KR3H 1Q94A 1H0DB 4KJYA 4J8RB 4O5LL 4WI8A 4LLYA 1QR1A 4X6EB 3MNWA 3PHOB 4TVSa 5TDOA 3VWKD 5T33H 2E3VA 4X7DC 3D85A 4KROB 1S9VA 1D5XA 5DT1L 1WUNT 4JG0L 5IQ9B 1A1OB 5ID1B 4UQ3B 4JRWA 1MFEH 1T5WA 2YD5A 3P77A 1UWGH 5ITBH 4GW1B 3I02A 1IAKA 2P7TB 5E5UB 1W0WA 15C8H 4JG1L 5F1IA 1EO5A 5AWNH 4GKOA 3I2CH 5KSBE 1CLZH 3VXQB 4K23L 5IK3A 3DV4A 2JIXB 2YBRB 1KLUA 4F9PC 3TO4C 1BAFH 2A9NL 1TCMA 4IRJA 3RGVD 3M17A 5E1HB 3STZA 3OKEA 2R2HB 5DJ8A 3RL2B 2WUBH 3T0BA 1FZOA 3A67H 2IBZY 4L3EE 4XP5H 4F15C 3FQXA 4NJ9H 4WTZA 4EUPH 1A4JA 2PUQT 3X3GL 1LO3H 3QIBA 4FQXA 3MCG1 2IQAA 1X6NA 1VACA 2FCBA 1NGXA 5SX5K 2VO5A 5DS8B 4BSWB 1S7WB 4G9DB 2V5RA 4PGCB 3V8CA 2WMPA 5HHPA 3OGCB 4LKCA 2D9QB 3IETB 4HKZA 5GIRB 5CWSA 4LFHG 3V4UL 4ZFGH 3CDGA 4KI1A 2AV1B 3SJVB 1VEOA 5CILL 5DI8A 4GKNB 2NR6D 4RMWA 4LRIC 4MA8L 1YEDB 4GKSA 4PR5B 4B0MM 3VXMD 3BUYA 3MBEC 2IFFL 4BYHA 4KJPD 3O41B 4NN7B 2AXFA 1DQLL 4MJIB 1IC7H 1WT5A 4O02L 5HHXH 4XHQA 1XZ0A 1WF5A 4Y4KC 4JM2A 2X4QA 1ZT1B 5EO0A 4MA1C 1H8NA 4HWUA 3MGAA 4O4YL 4OIBA 4PYGA 5MEPB 4FQQB 1IZKA 1U58B 4R7DA 3VD7A 1F3DH 1DLHA 1QO3A 2BZDA 1QUNA 3U9PL 3RX8A 3ZKSD 2MQCA 4ZUSA 5HHNA 3OF6D 2HT2C 5C08A 3G08B 3SGJC 4Z7UA 5I1CL 4HKJB 3BWUC 1F4XL 3HMXL 3K4AA 4UILH 1H3VA 2E6QA 2EKJA 3U4EB 1FFNB 4X0KB 1NCDH 4N8VB 3NA9H 3LS5L 3MJ7B 3GHBH 2CO6B 2GI7A 4P4KA 4PJ7E 3VFRA 4ETYA 1QD0A 1E28B 2A73B 3FO1B 3QUZC 2C7UA 4DKEL 2P46B 4I13B 5CHNB 4XPTH 2OTPA 5CZVL 4G8FB 3PP3K 4RFEA 2AJVL 1JPSL 1QSEA 5IFAL 4XXDA 5IVXF 2AKRB 4HWZB 3A6CH 1Q9LB 2VDOL 4QT5A 3NFNB 1JNLL 4PRDA 3D3VB 1M6OA 2PYFB 4LLDB 4N0YH 4YXLL 2VLRE 5IFHH 5EU4B 3MRFB 4N1EA 5I1IL 4A2LA 2WSKA 1JI1A 5F8QC 4WFEE 1YPZF 3SDXE 2E8YA 3BGMB 5H37G 3PQYA 2G9HB 5GJSL 5ITFA 3QDGE 4YJZL 3QYCA 3FO9A 1RZJH 3L3IB 2F15A 4KC3B 1FFRA 1CTNA 1XF3A 1QFWH 2XPGA 1FNHA 4OFYD 3V7MA 4XTRC 4HS6B 3SEPA 1JHKL 4X4ME 1IM9B 1ZKAA 2CGRL 1D9KA 3MNZA 4PS4H 3NFSL 3ZYJA 1YEIL 4BJLA 4POZD 1OAQH 4MCYB 4R90L 1JZ6A 1MOEA 5FO8A 2RCSL 2ZUQB 2P5EB 2FR4A 5BJTA 1QOKA 5KSBA 3BSZL 4WW2C 4YAQB 3ILPB 3RUGE 4KUCD 2BHYA 3GJEB 3U4BH 1ZWIB 4LSVH 3QEQD 4TUKH 4OBSA 2NY6D 5CGTA 3F12B 3NTCH 4LHUB 3B9AA 4L3EA 4MS8D 4N0FA 4WTZG 5J4MA 2AW2A 5JHDE 2ICWB 1EHAA 3HRPA 5J0BA 4HAGA 4LOUC 2C4FT 2O5ZL 4M7LL 1NAML 1BF2A 2UZXB 3MRLA 5CLWA 4FQLL 1PSKH 5ERWB 3C08H 2J88L 3V6OE 3IGAA 1Q38A 2NY1C 2ADGB 3TH2T 3WUWB 2PTVA 3IXAB 5T1DL 3NABH 2DQIL 4QRRD 1T1WB 4AL8L 2VABA 1CVRA 1D6EA 4R8WH 4EIGB 5DHYA 4QHMA 5FXCH 1MH5B 3DO3A 5HHME 5IVXB 4FXLA 2VLJE 2BNQD 4X80H 1MCPH 4MAUH 3AC0A 1AH1A 3EOYG 1IMHC 3RVTD 3QRFM 4LQFL 5DHVH 1YPZB 4C59B 4FFYH 2I26N 1I7TA 3D18A 5SWZA 4N1HB 4OLYH 4QHKJ 1QA9B 4J3XA 5J9PB 4F58L 3KJ4B 3VXOB 5IB3A 1AXTH 2ARJB 5C8JB 1YEJH 3HFML 4CU7A 4ZXBC 1EGJL 4QYOA 4XHJC 4Y19D 4YDKL 5TFSH 4P9ML 2BNRE 4PJ7A 2DTML 2VLME 3KPLB 3O3AA 3B9KB 1FAIH 3BKYH 1RY7B 2UYLA 2W0FA 1J7VR 2AEPH 1UJTA 3BPLC 2W91A 2DWEA 4MQXC 2VLRA 4TNWK 3T4YB 3SDDA 4P2RD 2E9JA 1KCLA 2YD4A 1RURH 3GMRB 4UOW1 1OP5K 1TITA 5IB4B 3ZKQD 3S4SA 3QDGA 4PBXA 3PDOA 2PTTB 1AD0A 5L9DH 4PJ9D 5F7EH 2IPKA 2ZPKL 2QQNH 5DVMA 2GT9B 4LPCA 3CSGA 4LPWA 5FO9A 3D69B 5A43C 4X4MA 4NKDA 3CZFA 4XNMA 4ACPA 1VKXA 4JO3L 4EI5B 3IDNA 4HIIB 3OKNB 1A6ZB 4M1DH 2R2EA 4NHCH 2J6EL 2Z91A 4UTBL 3I9GH 2JB5L 2OTWB 3H9YA 1FORL 2IALA 3G6JE 3CFCL 3RUGA 1QSZA 3VMNA 5FKPA 1XF1A 2A6IB 5F8RC 1F8TH 1JGEB 4GKZA 4OD2A 5F3HA 4QHUA 2D7NA 4HBCH 4M48L 5F3BB 3L5WA 4WV1B 5IG7A 5F88B 4LLAA 2G60H 5I1EH 1SBBA 5JHDA 5KBNC 4R26H 1HEZA 5I2IB 3MA9H 3KDMA 4HUUB 2ZSWB 4KUZH 4L9LB 4CADB 5A2LH 5GISL 4G7VL 5C07E 3PWPB 1RK0A 4K3JL 1Y0LA 4PTUA 1ZLUK 3T2PA 3V6OA 2IFGA 4ZOCA 3J8F7 4HUXA 5HXMA 5JPNA 5I8EA 4PJXE 4UTAL 1YQVL 1ZGLM 5D93C 1XF4B 4PJGE 3HLAB 2Q76B 3LEVH 5D72H 3L3JB 4L4TB 1MCHA 2AEWA 1NL0L 1OAZL 2VLJA 4U1MB 1N7MH 4F37K 2ZCKH 3BIKA 4U1LA 1NBYA 4RGNC 1KEGH 2R0WL 3QSKB 3DSFL 4AEHL 1ND0A 4NP4H 3C6SB 3MRQA 1R5WB 5DRXA 5HVHC 1T7YA 2HTLC 3V0VA 3LB6C 1VADB 3LKSB 3GBNH 3TWCL 5I74B 4JFOA 2VDQH 2APTA 2WBJB 3G04B 1KJVB 3FB8B 1OCWH 4AMKL 2NZ9D 3SJVD 1A3LH 2WWKT 4P46A 4HGWB 3TPKA 4HFUH 1E6OH 4HS8L 4AQ1B 1YNLL 4LP4A 2HJFB 4ODBD 4JY5H 1EMTH 3ZDXE 1MWAL 3GDBA 3FB6A 5JO5A 3MV7E 4JFQB 4IRSA 3JSSA 1CCZA 3NCYS 1RJLB 5D8JH 5ENWA 1A3RH 1Q0YL 4MJID 1IQWL 1J87A 2OP4L 4Y5XA 3VI4F 3C2AH 2N4IA 1D5MB 2R15A 3CGTA 3S8WA 2BXYA 2YUZA 4YDIL 4JZOA 1PFCA 4HC1H 4JPIB 4OGYH 4V1DB 1CYGA 2ENSA 4MJ6B 3KJ6H 3IDMB 1FC1A 2QLVB 4QXTB 3ZT7A 3TT1L 3CLFL 4WUUB 5EBLB 3ARRA 4ETQA 3S4SG 1T1YA 1KJ3H 3ZDZE 2O5XH 1L7TL 3C2SA 5T1LB 1FIEA 3MRPA 4OF0A 5TQ2H 4ENED 3BPOC 1DQML 1D5ZB 3FQWB 3G6AB 4HEME 3VFSB 3MRBB 2HKFH 3IDJA 3PF2A 4W70A 4BFIB 4RFOL 3U82B 4PJ8A 2AXGB 4Z7OE 1SM3L 3S88L 1UA6H 4J6RH 4XP1H 5EU7E 3G6JA 2EIZB 1KELH 1QLEH 2AI0L 4XZUA 4DK6A 3DNKA 3N0PB 1RI8A 2FECI 5SX5H 4TTGA 3MACL 4L3AA 5DGQA 1K5NB 3F7VB 1U41A 3FMGH 4U2YA 4WWKD 1GAFL 5D1XA 1UT9A 4X4XA 3UBXA 3CVHB 1FNEA 4HJ0D 4M1CC 4HZAA 2CKBH 1NDMB 1ZANH 3OG6B 1BFOA 1MHCB 4LLUA 5CBAA 3D39E 3BZFB 5F7YC 1F11A 1MIEL 3NH7H 2KUTA 2XTJB 5M94B 4NKOB 1J0IA 4L5FH 4BM7A 5EIVA 1IM9D 1JI2A 3WDIA 1DN0A 2R4RL 3LQAH 1T0PB 4X6DA 5EPMA 4DGIH 4DUXA 1WFUA 1HXMB 4PJXA 3HG1E 2P5ED 4JM4H 4DKAA 2ATKB 4XPAL 5JIHA 4PJGA 4S0TD 2H41A 1YYMH 1N4XH 2ZCHL 3BW9B 2AJYH 4C55A 1CLCA 1WITA 4MJ5A 4JB9L 1I3VA 1EERB 3DRQA 1DBKL 3RIFF 5MEOA 4XMKH 5KAQF 1W0VB 4M4RA 3KYNB 1DBML 4XI5D 4JFZL 4D9RD 2VQ1A 3BKMH 1IKNC 1A5FL 3QQ4B 1CDGA 5C6WH 1MFAL 3MRGA 1WCBB 4MLIA 3ZKXB 1IGTA 4OCRH 2Z8RA 1RZJC 2P24B 5C2BH 3HZVA 3C60A 3QJHA 3PP3H 4QTIL 4RAUB 5BQ7B 4Z0XA 3TLRA 2XWTB 3HI6L 3LN4B 1IQDB 2X4TA 4KZEL 3HPJB 4XH2B 5A2IH 5FGRA 1W72L 4XBPB 2WAHA 3MV7A 4WEMB 3T1WA 1RZIA 4XGZB 1Y6KR 2A1WL 2XRAH 3WFEL 3SE8L 3B5HA 3MTRA 2IH1B 3E8UL 1CDIA 5I6XC 4M8VA 5D7SH 3DUUA 4D9LH 2X4SA 3LSOB 4FNLL 1HKFA 2VITA 2DF3A 1UB5A 4ODHH 2KH2B 3EYSH 2WINB 5DRNB 3WXVL 4N0UE 4MHHI 3S5LA 4HUVB 3ARFB 4GQ9L 2XNAB 3PWUA 4KJWD 2H2PD 4FQHB 5HYJB 2IADA 2HG5B 5EFIA 1E27B 4ELKA 1R3LA 4JFYB 4NRXB 1SMOA 5GS0D 3CFDA 4L29A 5D6CB 4G8EA 1XR8A 3DX9B 5IHUL 4OV6F 4YHOL 1CE1H 4I4WB 4NO2B 4FG6C 5CSZB 4XVSH 3QNXB 5ISZE 5IWLA 1YNTA 3B9KD 1TCRA 3RX7A 1NC2A 3L9RA 3BDBA 5T1KA 4EDWH 3EFFB 1OAUH 2R0LH 3FQNA 5C3TA 4MNHA 3E2HB 4EIZC 4F7MA 4JRYE 3NACH 3T0AA 3SGKA 3UJTL 1F6AB 2ZJSH 5C86A 3OAZH 5FKAA 3JV6A 2QQLL 4PLKC 5KTEH 1ROWA 3IRZA 3UYOD 1BBDL 5GRUH 1H3GA 3P11L 5H94A 2E7MA 2PO6B 4NQCB 5CMAA 3W9DA 3UBXG 3QNZA 2DRUA 3ZYIA 2B0SH 3W0WD 5K9JH 3EJJX 5TDOB 4I0PA 3WFHA 4R96B 3CFBA 3WLBB 3UTSD 4Z7QE 2J8UE 4FTVB 5FYJD 3D39A 3QH3A 1ZLWK 4PGDB 1DQJB 5F7DA 1T5WB 1JK8B 1HHJB 1UVQB 1PAMA 3P77B 3OR7A 5TF0A 3L6FA 3B6SA 4EI5D 4Z7WA 3TNMA 5IOPA 3OAYK 5IROC 1A3QA 5FOBB 4OLXH 12E8L 1RJZB 2OL3A 3HG1A 1JNNH 4XPBH 3KGRA 4W68A 1PKQB 5F70A 2QSVA 4BH7A 3Q5TA 1R3JB 2PW2B 3G6DL 4ZUVB 4PJHF 4EDXB 3GBLA 1N59A 3C5ZA 4LIQH 3WN5B 1Y18B 1KFAL 4POZC 5IJKA 1FBIL 2XZAL 5DURB 1U8PA 4PGBB 1JHLL 1KN4L 3CSPA 1AR1C 3O6FC 4RGMC 5IW6B 1XGQB 2Y7QA 4JKWA 4YWGH 5J13C 4DZBB 3RWGA 1T7ZA 4OCSH 1FVEA 4R97C 5DYOA 2PKDA 1NMCB 2EXYC 4Z76B 3PWPD 4NGHH 4P5TA 1RVFL 4S2SB 5DA0B 2EE6A 4U6YB 1X5YA 1ZSDB 3OJDA 4P3CL 3HC3L 1NFDE 3FOLA 4S1QH 3QG6B 1A7BA 3JWOL 2CLZA 3PV6B 3CDGB 5LBSH 2JELH 3DI2B 1GZPB 5CP3H 3UAJD 3ZTNL 4KRNA 3KPPA 4AK1A 3NIDF 2HRPH 1NCCL 3TZVC 2A83A 4L4TD 5EZOH 3N1FC 2GTZA 2BCKB 4XNQB 2NY2C 4IJ3C 2XQBL 4PRPE