1V7ML

Human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
QVVLTQSPGIMSASPGEKVTITCSASSSVSYMYWFQQKPGTSPKLWIYSTSNLASGVPARFRGSGSGTSYSLTISRMEAEDAATYYCQQRSGYPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cytokine
molecule keywords Monoclonal TN1 Fab Light Chain
publication title Structure of the receptor-binding domain of human thrombopoietin determined by complexation with a neutralizing antibody fragment
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1v7mL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1v7mL01
2ZOKA 1R3IL 3T0BA 1ES0A 1I9IL 2MOVA 3BPOB 1IM9B 4GW4A 2ADIB 3T4AB 1FRGL 1NFDB 2PNDA 3PDDA 1L7TL 1KCSL 4PP1D 2YD2A 3GBNL 5I9QC 1MIMH 5CSZB 5DJYB 5E8PA 4HPYH 2Q7YB 4X6DB 3IDMB 4G5ZH 4ZO8A 1BMGA 2Q3ZA 3ALWA 3O2WH 1J5OH 5JW5B 3I6GB 3B9VA 5DZOA 3VFNB 2BNQD 1KTDB 3ZE0F 2R1YB 1WWWX 4XMKL 2VABB 3QI9B 3S34H 1XGPA 3GMPA 3TT1L 1EJ6A 4PRNA 2DOCA 4N0YL 5DVOA 1G6RA 3MTRA 4HIXH 3NZ8A 1MVUB 5TE6L 1QPXA 3RZWA 3TO4A 1FC1A 3TIDA 1KUMA 5D7KE 1X7QB 4YWGH 1U8MB 1JV5B 1CYGA 1HDMA 2FX9L 3TA3B 4AG4H 4RAUB 1MHCB 1X5FA 5DI8B 1EO8L 2HVKB 2VDNH 4XH2B 1UB5B 1ZA6B 4NRYB 5TDPB 1U8KB 4Q6IB 4KQ3L 4Y16D 4YHYC 3HZKB 3O6FC 5E94B 3NOIA 1T0NB 4URTB 4P5TB 2NXZC 1QSEE 1IGFL 4HF5L 2FDBP 1LP9B 1WBZA 4U1NB 1D3CA 1FL5A 3DYOA 4B50A 4UV4L 1AR1C 5IHUH 1WZ1L 4ZPTA 4AEIL 5HHNB 1KNOB 3PHOA 4QYOB 3QXUA 5I8KL 2EXYC 4YAQA 3BQUC 2GAZB 1ONQB 4LCYB 4JM2F 1JYNA 2VSDA 5DVMA 4OGXH 4UQ2B 1MNUL 4PUBH 4F9PC 2VZ1A 1S5IL 3D25B 2YPKB 1X6NA 1HHJB 2LABA 1U3ZA 1FNAA 5DYOA 5IKCA 2Q6WA 2MCPH 5BS0B 1BP3B 4YDJA 1ORSB 3MRIB 3CLFL 4NQUA 1JHTB 1I8LC 4ZQKA 1B0RB 3LSOA 3I50H 1FVEB 3KNBA 3BKYL 4X6CE 4J4PA 3ARGB 4AQOA 1DUYB 2OTWA 1WZKA 1T89A 2DRUA 4R6UA 3MLYL 3HG1A 3BMVA 3VXOB 1U8LA 4L1DA 2DQHL 3O6ML 4XCYA 5GGRB 5E9DA 5F9OH 4YR6B 4U1KB 2XZQH 1HHGA 3UPRA 2Q76A 3KYAA 3S96A 4X7EC 3QEQB 4HLZG 1JFQH 3QJHB 1OOAA 2YMXH 1JNNH 4XCNB 4M61B 2DIJA 4PJCA 1D6VL 1KB5L 3RUGF 4WFGE 3RWJA 5JQ6L 2DQEH 4JFDA 5AG8A 4RZCA 3MV9E 4QHLA 3O0RL 1X44A 1LNUA 3OPZL 4OM0H 1J0JA 1KJMB 1AQKL 3IJSA 4PJBB 4XPGH 4YO0A 4NM4L 5KN5A 4Z7UA 5EN2B 3ARUA 1FGNH 5IBUB 5DD5H 3VFPB 4UAOB 4JRXA 5HGDA 4JO4H 2DKUA 1OARL 3VWJC 3MUGB 2C3VB 2A38A 4PLOB 3VXNB 3VGDA 1YNKH 4NQCB 1BOGA 4UMGA 4GMSH 1UZ8B 4LHUB 1ZGLM 2BDNH 1PDKA 1BJ1J 2BHZA 2GY5A 4PRBB 5CWSA 2QQNL 2K1MA 2OI9B 4YPGA 3TV3H 3QI9D 1JRHI 4G9DB 3QNYB 3CSYA 2LAAA 1KIRB 4J3VA 3BKJL 4OJFH 1INEH 1L6ZA 2E9IA 2HYMA 1DN0A 2CLRB 1INDH 2XZZA 5D7LD 4JKPL 1GJIA 2PTTB 3QG7H 5IVXB 4NQVB 3T04D 1ADQA 2Z8RA 5JIKA 1C5BL 1CR9H 2R4SL 4KK5D 1RJZB 1K4CA 5BW7C 1MJ7L 3C6SB 2HMIC 4V2BA 1XF3A 3NPSB 3ARZA 3OF6D 3LD8C 1A9EA 1SM3H 1INQB 4M6NH 4ZDHB 4RQQA 2YUXA 2JJSC 1REIA 3MJ9A 3OHXB 3A6CH 2IH3A 4M6MH 3QPXL 1CD9B 3F65A 1U3HB 3F58L 4HXBL 1GC1H 2PXYB 3MCLL 4F8TA 3CVHB 3NAAL 2VLMD 4E5XA 5J1TC 1NBZB 2HJLB 3Q3GB 4PP2A 3SKMA 4QXUH 2Z92B 4OZFA 5DQDL 3C2SA 3MA9H 5I1JL 3KPNA 4MJIA 4MQSB 4JO3L 3DXAD 4OZIA 1JMXA 1AKJB 2DB8A 3W5NA 1YUHA 1JWUB 3GSNB 4ZOBA 1D5ZB 4JR9H 4K7PY 4U1LB 5ITBH 3FO9B 2EECA 4ZFZA 3QXVA 3AVEA 4F7PB 5HHXH 1L7IL 4OZ4B 2E27H 1M7XA 1X5XA 2UYLB 1BGXH 2UZYB 3U7YL 2BY1A 3CK0H 4DN4L 3FOLB 4AEHH 1Y6KR 3ZE2F 2GSIB 2UY6A 4IRSD 2W60B 4ZOEA 4KVNL 3DRQA 3ARGD 4XPBL 2GY7B 4W70A 1MI5B 3S3SA 3DO3A 3BZ4A 4JFPB 1CIUA 3CLEL 2XPGA 2XKSA 3WDJA 3FOMA 5IT2L 1I3GH 4HWUA 1CZ8L 5EWIL 5H35B 2ZUSA 4KTYA 2VE6A 5KSAD 1EK3A 1VENA 3MJGX 3FO1A 1TETH 2HWZL 1IAIH 4PR5B 5ERWA 3RBSA 4XBPB 3EAKA 3F62A 4CVZB 1A6TB 3T3ME 4UUJA 1ROWA 1ED3A 3OB0H 3MLVH 4PGJA 5F88B 5T5FL 2X4SA 3SO3C 3VXUD 4KPHL 4X4YA 2UZXB 2UWEF 5JDJA 1YQVH 4U6YA 3HG1E 1T83C 1FFPB 2YWZA 3RPIB 2IALA 2EH8L 1KJ2H 1FZJA 1KT2B 2VXTH 3MUHL 3O8XC 3BN9C 3BP7A 5E9DE 5CAYB 4P2RD 4DFHA 1U8JB 4O02H 3P0VL 5B21A 5HHVL 3QIUC 3WN5C 3MLWL 1EBPA 4QXWA 3MGTA 2DLFH 1RVFH 4LKCA 1MWAB 1FZKB 2LU7A 3FQUA 4JY4A 4RMTA 1CL7L 2JK5B 4PJCE 5HYSG 4OI7A 3S6CA 2D7MA 4PGZA 3STLA 4JFDE 4XVJH 5KVFL 3D3VD 1KPRB 5ENWB 4Z76B 3L7EB 3QIWB 1A1MB 5FYJH 3CVHL 3TPKA 1J88A 2Z31C 4MWFB 4XB7A 2KQMA 3DURA 2IMMA 5DZLA 4QHMA 3U82B 4Z7UE 2Z31B 1M7IB 2IC2A 5FYLH 2JIXA 3FT4A 1VHPA 2YD9A 5SX5H 3CVIL 4JQXA 4JRXE 4GRWH 1F6LL 1ZLSL 1S5HA 2AXGA 3ES6B 3BISA 3TH3T 1MCJA 1HHKB 3QSKB 3VD3A 5CD5C 3O4LA 3TP4A 4G8EB 2H3NB 5E5MB 3VFGH 3GSNL 4G8IA 4YHZH 3OKMA 1DLFL 3GSVA 3N85H 3HNVL 1J1PL 4I5BA 4UDUA 5GZND 5C6TH 4ORGB 4RWHA 3RBGA 4Y7MA 4KJPC 4RISL 1MFCH 1A6UL 3LY6A 4LPVA 4YHPB 1GZQB 1ND0B 2J4WH 4MNGA 1DQMH 5JHLL 4I2XB 5C3LD 3O6KH 1SY6L 4RRPG 5EO9B 3VDCA 4Q97A 3VXSA 1GHFL 1NAMA 1S3KL 4I18A 4KRPB 4LEXH 1LO5B 2PXYD 3PF2A 4TSCL 5HJ3B 2WINB 1IQWH 3U6RB 1RZ7L 5IM7A 1D6EA 2WIIA 3RDTD 2V5SA 4OIIH 4NYLB 1IAIM 5DFVC 2VDKH 3U4BH 5HI5D 4PTUB 3NFNB 4Z7QF 4FNLL 4Y8AA 3O6LH 4XNZB 1U8HA 3LZFH 5AEAA 4WW2B 1AKJD 2I5YL 1XZ0A 3KWWA 3DIFA 3I6LD 3ISWA 4MGXA 4PJHF 1H3XA 3MRHB 3IKCB 4Y5XC 1DBML 1HQRA 3QHZL 1FLTX 1G7PB 2VWEC 4MJIE 3PV7A 5DK0A 3ULSA 1CG9B 1FZOA 5CEZE 4P4KB 4FFYL 4NKQB 3V52H 3O2DA 4MA3B 3GGWB 4XBEH 2CKBH 4OZIE 2J6EA 1V3JA 4Z95L 3WFZA 4PRPB 1F6AA 3MUJA 2FJGB 5ISZA 4BKLB 1KLGA 4O2EB 4MCZA 1DBKL 1G1YA 1LILA 1OGTA 3HPLB 4GAJL 4NRXA 2EXWD 4K55A 5E6IA 1QLRB 2DQJH 4N9GB 2AV1B 1FYTB 3O3EA 1CE6B 2GJZB 1PD6A 3S88L 3QXAB 3OXRB 3TPUA 4PRHD 3AS2A 3QWOA 2UVEA 1MFBH 5LBSH 4O58H 4LSTH 3L6FB 4PJFB 3H3PL 1NMCB 2GHWB 3SKOB 4KUZL 1PG7H 1S9XA 3FKUS 3C08H 2HFFB 3MGOB 2BVQB 5I6XB 4RAHA 5F9JB 5EZJA 1G7HB 1A7QL 3C60A 4LSUH 3VFSB 4KI5C 1A5FH 2X4PB 2WQRA 4ZAKC 5SWZD 2FO4B 5IK3A 2R56L 5IP4A 4DOHE 5EUOB 4RMWA 4XMLH 5BO1L 3WNNA 2DQDL 3QDGE 5L2KB 3TBTA 4DGIH 4H1LB 1UXSB 2XWBA 3BAEL 3RWIA 1RZGA 5IMMB 4MDIA 5SV4A 2Z9TA 1UACL 3DV4B 1EDQA 2YD3A 4BZ2L 1FFNA 4UOJA 5GRXG 5EZIL 1Y0LA 3W9EB 4EVNB 3AAZB 4MJ5B 2AJUL 4UZGA 3SJVD 2NY1C 2J2ZA 4J3XA 1LGVA 3TC9A 4WHYG 3SE3A 2P7TB 4RGOH 2GJJA 2NY5H 3OAZH 2H6PB 2HRPL 5DRZB 5H8DA 1C12B 3S35X 3FQNA 1V5JA 5A43C 1YNLH 1ZGLB 3MRQB 4HK3N 5ECJE 4GKSB 3QH3A 4YX2H 1T04B 2FATH 2BOBB 3IXAB 3OAYH 3T2PA 5HHPA 5T3XH 4UINL 2XKNB 4JFXB 1MPAL 1A6AB 4LCWB 1NDGB 4ZUSA 3L5IA 1UCBH 3FT3A 4DVRL 5DJ8B 1S7WB 1H5BA 3H7BB 1SEQH 3EZ8A 5E2TH 1A1NB 2EYTB 3BVNA 4PJ9A 4ALAL 3O4LE 4GG6B 1JPFA 4M43H 4P2QD 4KRPD 4GAYB 3R0MA 2RR3A 4P2OB 1HSAB 4MMZC 5JXAH 1LEGA 1QP1A 1H3TA 1A6ZA 5E2WH 5E99H 3K0WA 1IC5L 2K7QA 5IW6A 4MNGE 1E4XI 1T21B 2ZNWA 4POZD 4NNYA 1ACZA 3FL7A 2YA1A 4ZYKB 3VXSE 5DUML 2V7HA 3VGBA 3NH7L 5IV2A 1D5IH 4R4FL 2FH6A 5FO8A 2EEAA 2H8PB 2ZP0T 4JPVL 5GSRA 3BKCL 2F5BH 4MQXD 5M7QA 4FQPA 2OR9H 4K71B 5FDWA 4FQLL 2I9TA 1WUNT 1T80A 2D7QA 4GW1B 1U8OB 4DUVA 4P59L 5A1AA 4LP5A 5J11C 4OKVB 2JKXA 2OSLA 2V7NA 3KJ6L 3JUZA 5J11B 2VDLH 1ZHKB 1A2YA 3IJYB 3GNML 4N0FA 4NN7C 4IOFC 3D39A 1X4YA 3WFCL 4L9DA 3WS3A 3REVB 3EO9H 3VI4F 5D9SB 1ULVA 3ZYIA 1YEDA 3PQYB 3K7UA 1E4WL 1IC1A 1TNNA 4G43A 5ANMA 3GSWB 2X1OA 1F2XK 2XOTA 4JQVC 3UBXG 3GBMH 3T4YB 3U36B 1KN4H 3ZKQD 3HNSH 3WO4C 4NT6A 1HE7A 1EX0A 1DBBH 3EJZC 3C5ZC 5ISZE 1H3PL 4CU8A 1E4KA 4LNVA 3OMZA 3G5XA 3BO8A 5MP6L 4Y5YB 4ODVL 4DGVL 5DD1L 1GGYA 3HE6A 2H26B 4JQIL 1IE5A 3FJTA 5KSVA 3RWFB 3VGFA 4DFIA 5KTEH 4ZTPH 2W9LA 4KQ4L 1NANH 2V5TA 4LOUC 5JHDD 3ULVH 3MFGB 2O5YH 2NY2D 2VXUL 3X11B 4JHWL 2IAMA 3UTTB 5FOJA 2A6KB 5B8CA 3HC4H 4OI9A 1S7XB 1DVFA 1YEHH 5GSVA 4I77L 2CLZA 3BEWA 3B9KA 5C07A 2E7LC 4ZG1A 3QO1A 4YBQC 1YN7B 3PHQB 4Y4FB 5IEKB 3QA3A 1EFXB 4EUPA 5ESVA 4FTVB 1I8KA 1Z3GH 5D2LF 2VL4A 3QXTA 5IMKA 5CHNA 2P49B 4YIQA 2DQIL 2DBLH 4JEGB 5C2BL 4OCWH 1H3GA 1NMBH 2ZG3A 3WLWD 4JRYA 5JLZB 3DSFL 5FA4B 3AREB 5ICYA 4JZNB 3WMSA 4F7TA 4G9FD 4PB9L 3GKZA 4QHUA 3D0VA 3FN0H 3GK8H 5TH2A 2EZ0C 3TBSB 3BDXA 1GL4B 4XP4L 3ARYA 4FP8L 4HWBA 4WUUD 1YNTA 4JDVB 2AKRA 2GFBA 5F7DB 5FGBA 1RJCA 5D1QD 3F7PC 1N5YH 1MFEH 1Z9MA 2HP4A 2X09A 3KYMB 4K3EL 1QBLL 4QT5A 3VJ6A 4KU1A 3DARA 1MCSA 1IGJA 2XQYK 3EDDA 4NGHL 5TJWK 4FQXD 3SEPA 3WFHB 3CZFB 4P2OD 1KGCE 3T65B 4MB5A 5MENA 5DHVA 2ADJA 2Y5TA 1O0VA 3QUXD 4JZJC 4HX1B 4JG0H 3BI9X 3S36L 3LS5L 2ZUQC 1IC4H 2EDOA 3MO1B 3PGFL 4BFIA 3FO2A 1BJ1H 3T0EA 2XTJD 3SDDB 1T03L 3LCYA 3BJ91 4MXWL 1NDMA 4Y4KD 5DUBB 1NEZA 3MCG1 4PJ8C 4H5SA 4Y4HD 2EO9A 3ULUD 5C0AB 4PJAB 2R2BA 3T0AA 1AXSB 4PJ8B 2FLBT 5CINH 1ZV5A 5F1NB 3PWPB 3UO1L 3MRRB 4YHIA 1HN1A 2I9LA 1MCOH 4XAKD 2VITB 3BJLA 4OSUL 4HH9B 4M1CD 5EOCJ 4N5ED 2J3SA 3RUGA 5TE4H 2QKIA 1BWMA 4DKEH 4QXTB 4PV9A 3VD9A 5FHAL 2MQ3A 4C56A 3INUH 1AIFB 5LGHL 3MRJA 4BQCA 4GG8B 2VAAA 3BIKA 3AXLA 1SYSA 5C0IA 3CCHB 3HUJB 1Z9SA 4NO0D 4L3ED 3QUMB 3GMMB 3LS4L 4UNUA 4B0MM 3V2AR 4MD0A 1ZWIA 3MA7A 2XTLA 1C7SA 3TJEH 2NYYD 2XQBH 3DROA 1RV6X 4X7SL 4UNVA 1CTOA 3D39E 3GSRB 2E6QA 3D2UA 3RA7L 3EYUH 4K7PL 3VG9B 2OP4H 4J23A 5ANME 3L7FA 1FH5H 1KPVB 2FBOJ 1TJGL 4NZUH 4ZS6D 2AEWA 4OF7A 5C08A 3RP1A 1P4BL 5EULV 1OSZB 1AO7A 1X9QA 3VFWB 1HI6B 4Y19D 4ZS7L 1NPUA 3EYVA 3MRDB 3NCBB 2ED9A 3S5LA 2EICA 1LEIB 1KOAA 4P2YA 3SHSA 3TZVA 5FV2A 5D6CB 4D3CL 2IANA 4EQ3A 2Q8AL 3ZE0E 2ESVA 3VD5A 4Y4FD 1EFXD 5I30H 3LRHA 5I19L 4LVEA 4WI2A 4PLJC 2FWOB 4MD5B 1E28A 3F5WB 5IUSA 3QO0A 4J12A 4JJHA 4P23C 4WO4A 2VIRA 5E08L 1EEYA 1R24A 4BSWA 3ARED 1JPTH 4F57L 2OXHA 5C07E 3MRBA 2JCCA 1JGUH 1I3RA 2AJVL 5BV7B 4BQBA 4F80A 1QHOA 4Q9RL 5B3JF 2VLLB 3U46A 1WAAF 1YEJL 1U0QA 4CNIB 2CDEA 3VFMA 43C9B 4KDTA 4MQ7A 3WXVH 5GRZA 1E27B 4MAYB 4XB8A 3MLTB 4JRYE 2PW2B 3MQIA 4QRSA 4WTWA 4JGUA 4LRIC 1S7TA 4DZ8A 3MV8D 4EN3D 4F2MB 5HXMA 3D85B 2YA0A 5HGAB 1ZMYA 4JGJA 1NGWB 3EDFA 1OGAA 2BZDA 2R15A 5L7XL 2V5RA 4YNYB 4J3UA 5J3HD 4X4ZA 5J6GA 3V95A 3WHE0 2EDYA 4UU9B 4LSQL 5EU7E 1N2RA 4RMRA 4XP6H 2DJSA 5D7JA 5C0BB 5IB2B 2GEEA 3SPVA 2DAVA 3TCXA 4MVBC 5T1MA 4DW2H 3ARRA 4E42A 4NIKB 4PG2A 4FN0A 3ARFD 1SBSH 4X7FC 1QO3A 4HKBA 1JI2A 4RNRA 4ODSL 4Z77A 3WFDL 3IJHB 2VDPH 1AE6H 3TVMB 1NGQL 4R7NA 7CGTA 4K9EH 2HG5B 5HHQA 5DFTA 3SCMC 4RBPK 1EZVX 1NFIA 1XGRA 1KJ3L 3K4ZA 5MENE 1TPXC 4N1HB 4LMQE 1MRCL 4DTGL 4D9RD 1EO7A 1RHHA 2ERJB 3PWPD 2EDJA 4ACPA 4BQ8A 1RZ8B 3LKPB 3LHPL 4G6AD 5K59F 2Y06L 4U6XB 3T0EE 4FQ2H 3LOWA 5C09B 4Z0BL 1E6JL 1PY4A 4FHBD 3FONB 2D4DA 3RGVC 1HNGA 4ODUA 4FFZH 2B5IB 3CXDL 3B83A 3V8CA 3P77B 1JF6A 4MXVF 3S8WA 5IROC 2RFXB 4WWKC 5C6PB 1I75A 2QHRH 2IBZX 3ALXA 2F9BT 2G9HA 2BY3A 3IU4H 3RUGE 5BXFB 4OD3H 4P9HH 4WWKB 4ZUTB 4J6RL 2CK2A 2Q7NA 4TUOB 1TIUA 4DGYL 4C56E 5FYJD 3TH2T 5D2NA 3NGBC 2F58H 1G0XA 3ET9F 2Q87A 3GB7A 1C08B 2YK1L 5IB1A 3OKDA 3QCVL 1IGYA 3HAEA 3B3IB 3NGBB 3RWGB 3EFFB 3KXFB 5GGQL 1J18A 2Z4QB 5H37H 1F00I 4Z6AT 5EO0A 5FB8B 1XMWA 4X99B 3MX0A 1KFAH 2ADGA 3DX7B 3MYZA 2X41A 3DWTA 2F74B 1MFDH 4NPYA 3ME0A 4MHHI 2QADB 4PJBF 1F5WA 5I2IA 4YGVB 2YBRB 3GJEB 4OLWH 5K93A 2Q1EA 1N6QH 5TF1H 4ODXB 5JOEA 5GS0C 3DMMB 3WHXB 2HFEB 3GMLA 4NZTH 2EE3A 2C1PA 5C08E 1QUNA 2FEDC 3VH8A 2EDHA 1AO7E 3L3DB 2D3VA 5HYFA 1OPGH 3HZMB 4OFIA 4LSPL 4ZUUA 2YZ1A 1DL7L 1U95A 3B6SB 5F1OB 5HGBB 3THMH 5M94B 3DO7B 3OJ2C 3FN3A 3IAGC 3V9FA 1A3LL 2VLKD 1TJIH 4JFYA 2C5DC 4HUKB 2W65A 1PFCA 3WCYA 3M17A 2IANE 1JZ6A 1MUJB 1UA6L 1IJ9A 4WJ5A 2ESVE 4JLRB 3V4VL 4AT6B 4F15B 3P9MB 3QQ9D 2NPLX 4KDVA 3VMPA 1WF5A 3BH8B 5IBTH 5IB4B 3MRLA 1KBGL 3BP4A 3IRZA 1HOCB 4MAYD 3EZJB 3I02A 2WWMD 4PJHA 3GSXB 15C8H 4HC1A 25C8L 5D7IF 3MREA 2JCCE 2VSCA 2Z91B 5F1SA 1H3VA 3IDGA 3JTTB 1NSNH 2EDWA 4MYWB 4OCSH 2EYRA 2H2PD 2VJXA 4KJQD 2XG4A 3SOBH 1EHLL 1UYWH 4YDIH 1U8NA 3OKLA 1LK3L 4WI8A 4JGMA 1BLNB 3VFOA 2DQUL 1ITCA 1FL6B 5TGBB 1OGAE 4PY7A 3L5XL 2ADFL 1TTUA 4HULB 1DDHB 4H0IA 1HCVA 3CD4A 4KZEL 4OD1L 1IL1A 3I9GL 1WIPA 5DJ0B 1VFAA 5FYKU 5IMOB 3ZE2E 3TVMD 4CN1A 1BIHA 1CU4L 4P3DB 5DQJA 1BVLB 4LQFH 2A6IB 2CO6B 4OGAD 5F70A 3TJHD 3C2AH 4G6FD 3OZ9L 5DDHA 2H32H 1MIEL 1AGEB 4KK5C 1CS6A 1RUQL 2FGWL 4BELD 1KB9K 4NKIH 3DVIA 3I6KB 3V6BR 4WUKL 1LMKA 2NY6B 1QOKA 4EKXA 3TN0C 4FQ1L 5T1LB 2NW2A 5IBUG 2CDFA 2DJUA 1GOFA 2UVFA 3ROOA 4R97C 4YXHL 1C1EH 2PCPA 4XPFL 4HUUA 3UJTL 1ZXQA 4OFPA 1E6OL 1AD0B 5GS0L 1MLBA 1EJOH 2R2HB 5EU6D 2N7BA 3MLZH 2FRGP 2PYFB 1CDHA 4HS8L 5JMOC 4FFWD 4FA8A 4GQ9L 2CH8A 4M1GH 1I4FA 1CFVH 3MRGB 2OJEB 4NHCL 4FABH 3P30H 1OTUD 3RZCB 4LU5L 1JGDB 2WBJB 4R96B 3CFDB 3C6LB 4MX7A 1Q9LB 3LV3B 3T0XA 4HS3B 4ENEC 5JA8B 3TYGH 3QQ4A 2VQTA 3CFEA 3V4UL 1I1FA 2FL5B 4OT1L 5GIRA 3UBXI 4Z7VF 2QTEA 1IZKA 5D2NE 3MMEB 5ID0B 4LFHG 1K8IA 4L8DB 2GJ6B 3MLRL 3CAFA 2MNUA 4WIQA 3MBEA 4IRSC 1UJ3B 1XF2B 3R1GL 4XXCC 5KSBF 2H1PL 3HB3D 3LN5B 2HT3D 2ARJQ 2AV7A 4YBLC 2DD8L 5K9JH 3E8UL 1NAMH 4CDHA 1FIGH 1FN4A 4YC2B 5E4EC 2VDRH 4K3GA 4X8JA 5KSAC 1JHKL 5F7FA 2A77H 3TT3L 2EDDA 1G0DA 2AXFA 4M7JH 5EU5A 4NZRH 2R1WB 3HFML 2NY3C 2V2TB 3T8XA 5A3ID 4CRPA 5EC2A 5TDNB 3ARDB 1RK0B 3H9YA 4H8WC 3ARWA 4KVCL 3BE1H 4WEMB 1NUNB 3U4EB 5HYJB 4G8GA 1S9VB 4KAQL 4X98B 5FGCE 3NN8A 5C86A 1KEML 4ZOCA 5D1XA 4UOW0 5H94B 1NCCL 5F9WC 5K9OA 4UQ3B 1CICA 5D6DC 2FHBA 3NA4A 4TN9A 4AENA 4MXQD 1QFUL 1YJDH 3O2DH 3Q6GH 4H26A 1ERNA 3QT2A 2J6EH 5EBWA 4WTZA 5INDB 5HHOB 2FYYB 4OGYL 5ETUA 4L1HA 1CK0H 2O5ZL 5IVNA 3T1WA 1ES0B 4PJHE 2AEIT 4OGZA 2MJWA 3W0WB 2BNUA 5AZ2H 2HTKD 1KCUH 3H8NA 4K7FA 4K94L 1XIWC 3GI8L 3SDCD 2YWYA 4JDTH 3QNZA 4XNUH 5I8EB 1I1YA 2PYEA 4OV6F 5M95B 1BEYH 1XIWB 2YKLH 3U0PA 2VLRA 5ESQA 1GZPA 1NLBH 5IMLA 2BJML 1R0AL 3QXDA 3CMOH 1WIOA 5HDQL 5E4IA 5IB3A 5D7KD 1NJ9B 1FG2B 1A14L 2CIIA 4EBQL 1JHLL 3B2UD 1NGPL 1BIIA 3WS6A 3NTCL 3P9LB 1TZIB 1Q0XL 3MRNB 3UMTA 4XAWL 1EO5A 3TEUA 4FOMA 3JUYA 2VO5A 1J11A 1G6RB 4UBDD 1RUAH 3VRJA 3NCYS 2XA8L 3NZ8B 4KI1A 3D6GA 3U7WL 4Y89A 5KVGL 1CBVH 4A6YH 3DX6B 4HUXB 5I1AB 3P0GB 1QSED 4KH2A 5E1AA 4PRDA 3C5SA 4X5WB 5DSCB 4L29A 4Y2DC 5I18L 2ATPA 3JWDC 1CXIA 3RDTC 4APQA 4ELMB 1KCKA 4NN5C 4RA0C 3HLAA 3MBXL 4XPTL 4Y2DB 5B3NA 5AD0B 1KC5L 1NCUA 2BVPA 5HI5C 4ODHH 5D2LA 2IQ9L 5C8JB 3FN9A 1J0KA 2IMNA 4NN5B 2JELL 1MHHA 2P1YA 4LSVL 3L5JA 4MAUH 3ZKSD 4Z0XB 4PJFF 5I8CA 3RZCD 1HH9A 1A4JB 4KKCD 3Q1SH 3TBVB 5AAWA 3VU2A 5IOPB 1TLKA 2FGZA 4NQSB 4R0LB 1KCVH 1KEGH 1ACYL 3LDBB 5ABDE 3O2VH 1JGLL 2CDGB 4PRAA 5IHZA 4M48L 5DJAA 2O5XH 4KI5F 3GHEH 3QRGH 4IOIB 3HA0A 4PY8I 4QXGH 5EU3B 5EOCH 1I7ZA 3SE4C 3X14B 4PJ5A 5IKCB 5DYOB 1HIML 2EXWC 1CVSC 3HE7C 1E4XH 2AP2A 4O4YH 3FFDB 1I7TB 1BD2A 3HE7B 5LGJA 2EKSB 2DMCA 4A2MA 3SGEI 4U1GB 1OP5K 2OQJA 3OGCA 1W0VA 3N1PC 2AJYH 3GHBH 1FFOA 1Q72H 4TNWF 4PBXA 3EYQD 4R8WL 1X5KA 5D93C 4GUPA 3WFEL 3PL6D 4Q6YA 4KTEH 4QY8B 1TCRA 5FYKL 5CIPA 5D93B 4WFGD 3B5TA 4JAMB 3MV9D 3ZDZF 2BXYA 1RJYB 5FK9B 2CXKA 4HT1L 3WKML 1A9BB 4XMPL 4IRJA 4U3HA 1W8NA 1UWGL 1QBAA 1RULL 2KPNA 2VXSL 5EOQH 4PB0L 1S7QB 1TVHA 2HT4C 4GOSA 2AXHA 5D8JL 1JYXA 1JPSH 3LQZA 3RWJB 4JFDB 4C54A 1CXKA 5I1CH 3TNNA 1B3JA 1U93A 4G8GE 1CN4A 1FNHA 4J8RB 2R8SH 1CF8H 1YY9C 3T08A 3FQTA 2NNAB 5C1MB 3C9NA 4XPHL 3AROA 1J1OL 5E7BA 3HKFA 4KZDH 3QJFA 4JRXB 2CUMA 3JWDL 1EERB 4NSKB 1FNSL 4OLXL 4U6VL 5GS1A 3ZYJA 5J06A 1BOGB 3MXVH 4I0PA 2BRRL 4ZPVA 1BFOA 1CFNB 3VI4E 1TNMA 3ECBA 5CWSB 4BQ9A 4ZFOL 2I07B 3KPMB 1IQDB 2CUHA 3CFIC 5ELIA 2DKMA 2PYEE 1X5JA 2OXGA 1ZLVK 1WVZA 4YHOH 1I1AC 5IBLD 2VLRE 2BC4A 3WO3B 1NGXA 3OKEA 1I1AB 3TO4D 4GKNA 1K4CB 2OX5A 4F7MB 4UTAL 1IM9A 2ADIA 3T4AA 1NFDA 5T1KB 4EUPH 4RQQB 4M5YL 5DO2D 1II4E 1QBML 3JWOC 1KTKE 4NBXB 2FD6H 4KHTH 4KJYB 1J8KA 1OP9A 1N6UA 5CSZA 4GBXB 3PWJB 2Q7YA 4X6DA 4YEFA 3IDMA 4OQ1A 4Q2ZB 4JPKH 2O61B 1U2CA 3I6GA 1F8TH 4PJIB 1JTOA 3P4NB 3VFNA 3WIFB 1KTDA 2R1YA 5GRJH 2VABA 3UTSB 4MJIB 4KMLB 4TVPH 4HWBH 2L0DA 2ARJB 1IT9H 1WAAA 3PWUB 2R0KH 3HC3H 1UM5L 3ZE1F 2VQUA 2X1WL 5D2LE 1P7QB 2E6PA 4HLJA 3A6OA 3BP5B 4G6JL 1YUHB 2CK0L 1MVUA 4JHZA 1T7YA 1J05B 3WJJC 5HVHB 4XT1C 2IPKB 1U8MA 1JV5A 3TA3A 3VGGA 4R4ND 4NFCA 4RAUA 3GIZL 1MHCA 3GEWB 4WU7B 2HVKA 1P9MA 5GISH 3KPQB 1UB5A 1ZA6A 2DM7A 4NRYA 5TDPA 4J4PD 1CWVA 1U8KA 3KAAA 3DRQB 4Q6IA 5B39B 4P3CH 1WIUA 3HZKA 5E94A 3W82A 1IILE 1T0NA 5DD0L 5DHVH 4NDMA 4P5TA 4NCDA 2B2XL 5TQ0H 4XVTL 4F7EA 5C0FB 3O6FA 3FOMB 4HGWB 3VG0H 2VOTA 4PJ5E 3W9DB 4U33A 1YEIH 3HG1D 2V17H 1V3LA 4CN6A 4U1IB 2HKHH 3HR5B 3PWLB 4PY8J 1BD2E 5E9DD 2BCKB 5DHYB 1IC7H 1IKFH 1KNOA 5ERWB 5HHNA 4LASH 4QYOA 2IBGA 4DOHB 2NY2C 2GAZA 1ONQA 1JWMB 4WU5B 4LCYA 1K8DA 1MCWM 4UUJB 2FB4L 2P45B 1BBDH 2X4SB 5I8OL 1SMOA 2VQ1B 3ARBB 4CVUA 5CCKL 3PDOB 3D25A 4DK3A 2YPKA 1HHJA 8FABB 5BS0A 5TE7H 1FZJB 3VRIA 2PETA 5I1EL 3MRIA 4F9PA 4OLUH 5I1KH 3BP7B 4JFDD 1JHTA 5CGTA 1YECL 4J7RA 2VB5A 1BVKA 1I8LA 1XH3A 1LHZA 4UT7L 2Y36L 2VR5A 5CD3B 4WFFD 1DUYA 2Y23A 1OTSC 4JY4B 3WLWC 2IBBA 4WNQB 4C55A 1S8DB 1WITA 1HKLL 4JRXD 4YE4H 1V7MH 4EIZC 2ID5A 2E8ZA 3JWOL 4ZNEA 5GGRA 4PD4K 3L3HB 4YR6A 4U1KA 3PNWB 4U49A 1TJHL 3S3JA 3QDJB 4G3YL 3VGEA 1A64A 3QEQA 2X4UB 1XGYH 3HCVB 4XCNA 1U42A 4M61A 4MZ3A 1HYSD 1MRFL 5D1QC 3OB8A 2EDNA 2VXQL 1GSMA 3I3DA 4TUKH 4NWUL 3ZT5A 3RIAK 5EORL 3TYFB 1YYLH 1IGCL 4G8IB 1P53A 2XRAL 1MCKA 4FQXC 5DEFB 1HHIB 4UDUB 1JYVA 1Q9OB 1CQYA 4PJBA 3NFSL 3QDHA 1F58L 2F5AL 5EN2A 4WV1C 4RWYL 2CD0A 4U7KA 4M8VA 4Q9QH 5EU4B 3GJFK 3VFPA 4Z5RA 3MUGA 3QG6A 4BYHA 1YC7A 5DA0B 3VXNA 4NQCA 5DRXA 1J87A 1JZ2A 1RZFH 4Z7NF 3O11A 4LVHC 5K9QI 2XTJC 1K3ZA 4LHUA 1QQDB 5GZOD 4Y4HC 1VEPA 4HPYL 4S11A 1NFDE 4LPUA 4R7DA 4K2UH 2NY0B 4G5ZL 4MJID 3O2WL 1N5AB 1J5OL 4G9DA 3QNYA 5CEZD 4KGLA 1NCNA 3E1F1 1KIRA 5DK3A 2ZKHH 3DSNA 2CLRA 5DFWH 4M1CC 4X6DE 3S34L 2NLJB 4LL9A 2PTTA 3KWWB 4N5EC 2DF3A 1K4DB 3DOSA 4NQVA 5JW4M 4OQTH 5HHMB 4U1SB 4R2GD 3SE8H 5D7IA 3C6SA 4HIXL 1AFVH 1U36A 1INQA 4ZDHA 3Q5YA 3ULSB 4NO2B 5B3JE 2B1HH 5T5NF 5JDSB 1WAAE 4YWGL 3EO0A 4XCFH 3D0LB 4JG1H 2JJSA 3S35H 4NJ9H 1U3HA 4AG4L 2WUBL 3QRFM 1TXKA 2PXYA 3CVHA 4JFOA 4MCZB 4JZOB 4TUJA 4OI8A 1NBZA 2VDNL 2HJLA 3Q3GA 1FE8H 1OGTB 1PX3A 1IAOA 3G9AB 4HDIB 3GUTB 5J56B 1CL7I 4NNXB 3T2OA 4R90H 3PP4H 5FYJU 2BHYA 3TPUB 3V4PH 1HILB 4HJJH 3RVXD 5E70A 2C4FT 4ZS6C 5TPWH 4X9BA 2Z8VC 3DVFA 3S98A 3BPNC 3GSNA 5F6IC 5JXEC 1D5ZA 4P9MH 4U1LA 3ZHDA 1QTYT 3FO9A 3BPNB 4F7PA 2R1XB 3ARBD 2DI8A 1UM4H 4OZ4A 4AIOA 5TQ2H 1EEQA 2UYLA 2DQCH 3T3PF 2PR4H 3C60B 1SY6A 4OFDA 1I9RH 3FOLA 4PUBL 1NC4B 3JV0A 4OCYH 4XXDB 2GSIA 2MCPL 2W60A 3GM0A 1FQ9C 4U3CA 3O45B 1MI5A 3I50L 3LPWA 2YHGA 4M3KB 4JFPA 1F3DH 1U8IB 2BY2A 2HVJA 1N3NB 1BFVH 1FFNB 1U92B 2AEPH 3BKML 4PGCB 1OLZA 4WHDA 3RU8H 4CMHC 5BS0E 1Y0LB 5LQBL 5H35A 2BNRA 35C8L 3O4OB 5C0CB 4CMHB 2NTFB 4I9WE 2DL9A 2X89A 4PR5A 2DQGH 3U79A 4XBPA 1MJ8H 3HAEH 4CVZA 1A6TA 1U8QB 5F9OL 5SV3A 4IRZL 1OSPH 5F88A 2XZQL 3E6FB 5F7EL 2JIXD 4MXVE 3FQWA 4WW1B 4EN3C 5LJYH 3RY4A 1T0MA 2W9EH 1FFPA 2JJTC 1JGVH 3LKRB 2XG5A 1JFQL 2YMXL 4CAGA 1JNNL 1KT2A 1D5BB 4ZNEE 3O4LD 3RX5A 3E6HB 5AG9A 2XFXA 5J3HC 4JCMA 4Z7WF 1U8JA 4Q9BA 3QEQE 5ITFB 2YPVH 1MWAA 3RVWC 1KTRL 3FT3B 1IEHA 4OM0L 2JK5A 4TTDD 4XPGL 5CLWA 3U1SH 1BQHG 3VXSD 3CX5K 1FGNL 3U0TB 1T4KB 4HS6A 1M1SA 1KPRA 3L7EA 3QIWA 1I9EA 1A1MA 1DQDH 2DDQH 3GM8A 1A7NH 2I27N 4MWFA 1OAXH 4BFGA 4PJBE 1S7SA 2VERN 2FX7H 1FZMA 5A40E 2Q3AA 2Z31A 1CTNA 1M7IA 2F54A 4GMSL 2NY0D 3MLUH 4AYFA 3QPQD 4NNYB 5CJQH 3ES6A 2OTUB 1HHKA 4FZ8H 1WICA 4L9LC 2V7HB 5F1KC 3TBYB 4NQCE 5KSUB 3G5VB 5E5MA 5FO8B 3L3JB 4L9LB 2AEQH 4HC1H 4DUWA 4RDQG 4ORGA 4C57C 1JYWA 5FDWB 1INDL 1VDGA 3QG7L 4YHPA 1GZQA 2E9WA 3SKUD 3V6ZB 3U0WH 1J1XH 4QRTB 2YSSB 3IF1B 4I2XA 2CGRH 1TTFA 5EO9A 4NRZB 4D9LH 1B0GB 1SM3L 2RQ8A 4EDWL 1A2YB 4M6NL 1N6VA 1JMZA 1L0XA 2A6JB 1RUKL 3P3YA 5ISZD 4NQXA 5F7WC 4JPWH 5HJ3A 5CJOH 5BVPL 1RZJH 3A6CL 1OQXA 5FM5M 2VDQH 2MQCA 3U6RA 4IS6B 2J8UF 5L9DH 5E6ID 4G43B 4NYLA 5A16B 2ZJSH 3NFNA 5F7LB 3E2HC 2Y5EA 5IGXH 4QXUL 1N4XH 4N0UB 1JJUA 4F8QA 3O3DB 3MA9L 1NKOA 3BWAB 4G6MH 4WW2A 1PX4A 2AGJH 3G5XB 1QRNB 3BO8B 4KKAD 4XHQA 4LGRB 4AIZB 3MRHA 3OKNA 3IKCA 3WHE1 1IEBB 3HE6B 2ICCA 3H9ZA 4S2SB 5CUSH 4Y5XA 5I16B 1G7PA 1FBIH 4XP5H 3QUKB 5ITBL 4F37K 1CG9A 1ZA3B 3C60D 5HHXL 4P4KA 2E27L 5FCUH 4MA3A 5IESH 3GGWA 3GBLA 2ICEB 4FQJH 3MZTA 4PRPA 4P46B 1RIHH 1BGXL 2FJGA 3I6LE 4BKLA 1VCAA 3CK0L 4TSAH 5JZ7D 3ELAT 1M4KA 4AEHL 1DVFB 4LLVB 2FO1A 3B9KB 2AW2A 3ARXA 4JKLA 4Q9CA 2Z93A 1QLRA 4I4WB 4N9GA 4S1DD 2AV1A 5GGUB 1S9YB 1FFQA 1FYTA 5A2IH 4N1CA 1CE6A 2GJZA 4JE4B 1I8KB 3OXRA 1NCWL 3QUYC 5F9AC 4LLWB 1QA9B 3WNOA 1NEUA 1I3GL 4NQEB 1DEEB 1HINH 1T6WA 3ETBF 3P73B 3QUYB 3L6FA 1NCDH 3OJDB 4PJFA 1MI5E 3FHQA 3SKOA 3PJSB 1I7UB 3HI1A 3H7LA 3D0VB 5I15H 5J13C 3MGOA 5SWSB 2BVQA 5FECB 3TCLB 3MLVL 5F9JA 2BNRE 2F8XC 3N1MC 1FYHB 1YNTB 3VFSA 2EEDA 2X4PA 4Q0XL 1YQVL 2FO4A 5K33A 1CCZA 4BK5A 2A83A 1VKXB 2OS7A 5EUOA 1KJ2L 1KGCD 2VXTL 5DMJB 4JM2B 3RKDD 4LLAA 4G80B 1OAUH 5L2KA 4H1LA 1UXSA 1HXYB 3FCTB 4JJ5A 3CFBB 5IMMA 2VZTA 3DV4A 2DIAA 2DLFL 5AYUH 1RVFL 2RHEA 1M6OA 4PJ9D 3W9EA 3FB5A 4EVNA 2CRZA 2D7PA 3AAZA 4XWGH 2IADB 4TSBL 1FNFA 5KW9H 2FR4B 1VGEL 1WCBB 1YMHB 4XVJL 1VFBB 3B9EA 4BK4A 5TDOB 2P7TA 2WLYA 3JV6B 5FYJL 2D0FA 1QFWH 4OUUA 1EGJL 1TENA 2H6PA 1BZ7A 3FO0H 5DRZA 1C12A 4P5KA 4N8VG 3A67L 4DVBB 5DEZA 3TJHC 4BQ6A 1ZGLA 3MRQA 3V0VB 4GKSA 5J12C 4K23H 5FYLL 1T04A 3IDYB 4UTBH 2BOBA 3IXAA 5I0ZA 1CDYA 5J12B 1H8NA 3FB8B 4H5SB 2XKNA 4JFXA 4XHJD 1A6AA 4JPIB 4LCWA 1NDGA 2R2BB 5JUEH 2F54E 4YHZL 5GGSB 3IT8D 3N85L 5DJ8A 1S7WA 3H7BA 3CPLB 1A7RH 1S7VB 3LPFA 1A1NA 3BOVA 1KXQE 3RUGB 2EYTA 2CR6A 4GG6A 1MFCL 3LRGA 2G60H 1DQML 2GYSA 1QBBA 4GAYA 3O6KL 1HSAA 1ZANH 4FFWC 2XT1B 4NC1C 3D39D 1MCIA 4FZEH 1SEBB 3MZGB 3LQAH 4LEXL 2QQQA 1OTUC 1SYSB 3HPJB 1WTLA 1IQWL 4I2XE 1T21A 4IDJH 4ZUWB 2NY5C 4ZYKA 2DBJA 3K8LA 2UZIH 4OV5B 4OIIL 5DUPH 4MD0B 4WGVB 2VDKL 3U4BL 2A9ML 3IDUA 1LE9B 5B38G 5KZCB 2DLEA 5CZKA 1OCWH 3LZFL 4M7LH 2MFNA 3BGFB 5IVZB 3HE6D 2K9UA 2NY7H 4M9PA 4GW1A 1U8OA 1MVFA 1VPOL 3HB3C 2HA1A 4OKVA 4G42A 1DTUA 3IXTA 2XY1A 3EYVB 2IAMD 5ALBH 3UX9B 3IJYA 2IG2H 3V52L 3TIEB 3VXPA 1DVFD 3REVA 2CKBL 5D9SA 5GS3A 4WI9A 4Y0GA 3B9KD 1F3RB 4X7CC 3PQYA 1KN2H 3Q0HA 5C07D 1A8JH 2ESVB 3IDXH 2I24N 3WDHA 3GSWA 4MNHB 5FKAB 4AK1A 3U36A 2DQJL 1WFTA 1E28B 2LTQC 3SKJH 4LAQH 3QO0B 1EXUB 4PRPE 3TLRA 2BVOB 3CFKB 4G6KH 3E3QC 1EEYB 4JRYD 1N7ML 2V2XB 4BSWB 1OAYH 3D9AH 3C5JB 4Y5YA 3C5ZA 1MFBL 1NBVH 2H26A 4O58L 4M7LT 4LSTL 3NABH 1FYTE 5F7NC 3RWFA 5HVFB 5L8LB 3G6DH 4TQEH 2LVCA 1PG7L 3VFMB 3C08L 3X11A 1AHWC 3UTTA 3NIGE 2I26N 3SGEH 4PS4L 4PJFE 4LSUL 1S7XA 2B7DT 2OMNA 4ZNCD 3FZUD 4QCIB 4XMLL 5EOTA 1YN7A 3PHQA 2MSPA 4Y4FA 5IEKA 1J8HB 1EFXA 1XGQB 2HT2D 4QLRA 1L7TH 4FTVA 3ZYOA 5J6GB 3SE9H 5J8OA 5GRUH 4DGIL 1YN6A 5EPMA 5FOBB 4WCYL 1FC2D 3IFOB 5D7JB 4UT6H 1UKTA 4EI5B 5EUOE 1NAKH 1UGNA 5L8KB 5JLZA 1N8ZB 5T1MB 5FA4A 5L2KE 4JZNA 5MEND 1PG7W 1F3JB 5FF6B 1B9ZA 1H9VA 3SDAC 1BOYA 5ALCH 5DURB 4XMKH 2HKFH 5CIPH 1L9NA 3DX8B 4RNRB 3TBSA 3UTZB 3DGCR 2NY5L 3T0ED 4YJZL 3O9WC 4JDVA 4N0YH 2DM3A 4JHBA 1YNLL 5F7DA 3ULVC 4XVUD 4YX2L 2H45A 5HDBF 4UBDC 2FATL 5CGYC 1VACB 5T3XL 1MAMH 4ZUVB 2FX9H 2UWEB 3KYMA 3ZDYE 3ZMRA 4X83A 3TFKD 3D1MC 2KH2B 5GJSL 2XKUA 3JTSB 2JB5H 3IKKA 3U83A 3WFHA 4NUGH 2HJFB 2RIKA 4OCRH 4C56D 4MJ6A 1SHMA 2C4XA 5E2TL 3CZFA 1H0DB 5BZDB 5MEQB 3T65A 3O41B 4LCWE 2YS4A 3LKSA 5IJKC 1DANT 3EYSH 4HX1A 4MZ2A 3LEXA 4KKCC 1AQDB 1FSKC 2WP3O 4W4OC 1OWRM 3MO1A 5E99L 4GG6E 1LEKB 3QZWB 3O81A 4I3GA 4TNVF 4UOW1 3SDDA 3WUZA 1F13A 4M4RA 4HJ0C 3MUY1 5DUBA 3EOTL 3MRPB 4ZTOH 3D2UD 3OKDB 3LMJH 4LGPB 5C0AA 4PJAA 5IR1B 1AXSA 1D5IL 4PJ8A 3MJ7B 5F1NA 1LE5B 2Y72A 1TQCC 3MRRA 2DWEB 4HAGA 5C08D 1S5IH 3HZYB 5C0NC 3V0WH 2OR9L 2VITA 2VXVH 1AO7D 4PRIB 4HH9A 2X1XR 2APXA 2VZUA 3CLFH 4QXTA 2R0WH 4DKDC 3BKYH 5DJ6B 2ED8A 1CT8B 1AIFA 2ICES 3ULUE 5DT1L 3TZVD 2VDLL 1FNGB 4LPYA 1OW0C 2Y6SD 2IAND 5DLMH 4GG8A 2ESVD 3WUWA 5DVKA 3CCHA 5ACMA 5DQ9B 3EO9L 3HUJA 5MEOB 3EYQC 1X5AA 3GSOB 1GGIH 4ZUUB 1I9JH 3GMMA 3E0GA 2F8OA 1RIVH 3BX7C 3PL6C 3NCFB 2EDEA 1T20B 5D70L 4QHNA 3GBML 4WO4D 5IWLA 1KN4L 1O5DT 4JFYB 3GSRA 3DUSB 2QQKH 3HNSL 4GJTB 2D03L 1P7HL 3PQYE 2Z8WC 4RBPH 1CDJA 2ARWA 3ZZ1A 3MNWB 1OSZA 3VFWA 1HI6A 2OR7A 3QDMB 2P24B 3RNKB 5HY9B 4ZTPL 1YMMA 1ZS8B 3QAZC 1LEIA 3NIFF 1F90H 3EO1A 3I02B 5DD6B 3ULVL 3AY4A 1X3DA 3QAZB 2AS5M 1KIUA 5D6CA 2ICWJ 2X70B 2GITB 2ZZUT 4GSDH 1QZ1A 3EFDH 3HC4L 2X05A 1I8IB 1SJEB 5F8QC 1MFAH 4JHAH 4H20H 1YEHL 1F4YH 3QFJB 2FWOA 1OAZH 4MD5A 1KCRH 3F5WA 5D7JD 3UTTE 3LKQA 3OWEA 4OB5H 1Z3GL 3EBAA 4MCYB 2ENYA 1PZUB 4P23A 3UXFA 5HGHB 1NMBL 2CLVB 5SX4I 3WDIA 3DUHA 2QQNH 1KELL 4QGYA 4FTVE 2VLLA 3ROLB 4IJ3B 1BPVA 1IL1B 3GMQA 4UIMB 3OV6A 4CNIA 1H3UA 3OSKA 4YBHA 3TWCH 4BH8B 3BKJH 4IM8A 3FN0L 3GK8L 4LF3B 1E27A 1YC8A 3EIFA 4MAYA 3MLTA 1H15B 2CRIA 2PW2A 5IBLC 1NCBH 3RIFK 4F2MA 1MCRA 3D85A 3C8DA 3CFJB 4YHNB 5HGAA 4LRIA 1MJ7H 2B1AH 1NGWA 2IPTL 3TO4C 3U9UA 3H0TB 4YNYA 1N5YL 1MFEL 4X0KB 1CFTB 4UU9A 5C0BA 5CZVL 5IB2A 3MV7B 3MCLH 3RWHB 4U0RB 2C1OB 3V5HB 4MS8D 2PO6B 3K81A 1V8HA 1MLBB 2P48B 1L0QA 5DA4A 4N8CL 1MCPH 1GGBH 5DQDH 4PD4J 1U2HA 2NTSP 4PLKD 5JQHC 1QPPA 4OIAA 5JIPA 1Q9KB 4DWHA 5CKAA 1B4JL 3IJHA 4JG0L 1C16B 4KV5F 1IC4L 1G6VK 2HTLC 4QHKJ 5H37G 2NZ9C 4KFZC 5IHLB 4IIQB 4KK6D 2WP3T 3QQ4B 3SGJC 3AM8A 3S4SB 1X6LA 2AJXH 2QHLA 1L7IH 1K9TA 2BMKB 2DLIA 1VERA 5I71B 1D9KB 3LKPA 4R4NC 5CINL 3U7YH 4U6XA 4DN4H 1CVRA 5C09A 3L3GB 3BZFB 1BZQK 4Y5VB 2X4OB 3FONA 4KVNH 3RY5A 5C0AE 4PJAE 5E0QA 5TE4L 4DKEL 3P77A 1FPTL 2UUDH 4LARH 1YZZA 3DUUB 2AV7B 2RFXA 3VDBA 1T89C 4LVNC 5EWIH 5IROA 3RI5K 4WWKA 4ZUTA 2NY4C 3BDYL 1FN4B 4LVNB 4OCNC 1EHNA 4GMTL 4TUOA 4S0TD 4OFKA 4OZFG 4X4MA 5CGMA 5FDYA 1C08A 1FLRH 2R29L 2J5LB 3B3IA 3RWGA 4K9EC 4EXKA 5GHWL 3EFFA 3KXFA 1WGOA 3TJEL 2XQBL 3C8KB 4KPHH 5EC2B 3QWRA 2Z4QA 1ZVHA 3ZO0A 3HUJE 1OHQA 5ILTL 2OP4L 4HJGA 5FB8A 4XRCB 4X99A 1FH5L 3DX7A 4NZUL 4N8PA 2F74A 4OM1H 4Z7NE 3O3BB 5HHVH 2YBRA 3RTQC 4ODXA 4F7CA 5IIEB 3DMMA 3WHXA 2HFEA 2C7UB 4AENB 1FDLH 5B39G 1IFHL 3L3DA 3WL9B 1LO4H 3HZMA 3ABZA 4V1DB 3B6SA 5HGBA 1EUUA 4ZSOA 4RFNB 4HFWB 1YMME 3P9WB 4NCC2 5ETUB 4P9HC 5I30L 1A21A 1V7NH 4LNRB 4C4KT 4HK0B 1TQBB 2CQVA 3CU1A 3H2WA 1QR4A 2ZUWA 5IW1B 1MUJA 4HK3J 4M00A 4MA7H 4JLRA 1A6WL 4OZGB 2GTZB 3CVIH 4AT6A 4HFUH 1HYSC 3P9MA 4UDTB 3J7HA 3D18B 3BH8A 1JGUL 5IB4A 1DUZB 1HOCA 1JL8A 3WIHH 5IMLB 2VC2L 3HNVH 5IB3B 1J1PH 3GSXA 4M6OH 3WXVL 2CIIB 4MA1B 4B5EA 1A6UH 3JTTA 1J12A 3MRMB 1SY6H 3OR7B 4NC0B 4ODBD 4OZHF 1GHFH 1BLNA 1W72B 4D0DA 4ERSH 5GXBB 4L4VB 1FL6A 1RZ7H 4XCEB 5TGBA 2HJKA 4XP6L 5B4MC 2VISB 4NOFA 5ESAB 5E2VL 4JO2H 5GZOC 1DDHA 1S78D 2HLFC 4QRQB 3DPBA 4ZFFB 4ZXBB 4PJEF 2HH0H 2X4QB 5D2LB 1MAJA 3PIQB 5DJ0A 1IGTB 5IMOA 5C0BE 1WZMA 1AY1L 2I5YH 1BVLA 5EUKB 3RVUC 2YD6A 1NCTA 1AE6L 5I1GH 5HYQB 4K9EL 4R2GC 3QHZH 3MLXH 1AGEA 5IFAH 3ZT6A 3QEUB 5ACZA 2DLHA 1QNZH 3SBWA 5DR5H 3H3BC 5T1LA 2PKDA 1F4AA 5E24E 1JNLL 3DHJA 3MBED 1MWAH 3TN0A 4FQ2L 3OL2A 1I7ZB 3BSZH 5D5MF 3T0VA 1XR9B 3EJYD 5B22A 1AD0A 4N1EA 4PJ5B 1RMFH 2MHAB 2R2HA 3CX5J 3AS3A 4KROD 3RJQB 5LGJB 5C09E 4F3FB 1GPOH 1W0WB 2QHRL 3MRGA 2OJEA 4H0GA 4P9HL 1JGDA 2WBJA 3BEVB 3H3PH 3CFDA 3C6LA 3QUZC 4R96A 1Q9LA 1FFOB 1YPZF 2EIZB 3LV3A 3RVVC 4HS3A 3FFCB 3CGTA 2AQ1A 3QUZB 2JJVA 1MJJB 3R8BB 2WWKO 3FRUB 2R23B 4KKLC 2Y4SA 2FL5A 1IM3B 3O3UN 3T2NH 4ZODA 1XF1A 3BUTA 3UCRA 1MQKL 2H32B 4X4ME 2R56H 4G8GD 5ID0A 5DF0A 2OZ4A 2GJ6A 2Y25A 1Q9WB 1FVCB 2EIEA 5BO1H 4IBLT 1KFAL 1UJ3A 4MD4B 1XF2A 1CICD 4RMUA 3KXFE 4JY5H 2IQAB 3LN5A 4OLVL 5FIEA 5DEGB 1R3JB 4XXCA 1GGCH 5JOPD 4OLWL 1N6QL 4BZ2H 5TF1L 3DRTB 1X5IA 5FO7B 4DEPB 3LN4A 4NZTL 2B39A 3GKWH 4X6EB 5F97E 5DWUH 4EIGB 3ZKNC 3DV6B 2MWCA 4MSWB 1OPGL 3C9NB 4UB0H 4QRPA 4XX1G 3THML 4G8FA 2R1WA 2M26A 2V2TA 1KYOK 5FUCE 3UAJD 3VI3F 4GLRI 2HRPH 1HWHB 5TDNA 3ARDA 1TJIL 1RK0A 3KPOB 3L3KB 4LCCC 5D1ZB 4JQXC 2PYED 3JZ7A 4LCCB 3U4EA 4ZSOE 5JPNB 4DAGL 2VLRD 5HYJA 2OL3B 1JUFB 4LLDA 4U31A 4UINH 2ZCHL 4X98A 1G9NL 5IBTL 2NR6C 5CILH 5H94A 4QTHB 1HQ4B 4D8PB 2DQTH 4UQ3A 5FO9B 5DJCA 1LD9B 2BRQA 4RGMB 4NHUB 4U1HB 5E6ZA 1U58A 2FLRT 5JW4R 5I1HH 1NSNL 4NM8L 5INDA 4OCSL 5HHOA 2FYYA 3L95B 4HZLB 3WFBL 3BXNA 4I18C 4DCQB 4GKNB 1UYWL 4YDIL 1OP5H 3W0WA 3ZTNH 1IC5H 4M3JA 3KLAA 1T7ZA 3WXWH 3QWQB 4APQD 3IFLL 1RI8A 5I8EA 5EH1A 4HKJB 4FFVD 4ONFL 1XIWA 1W2KT 1MAKA 5I1DB 4NP4L 5I9QB 4GRWF 3KPRB 3DETC 1UEYA 4PJ7F 4BFBD 3BKCH 4K8RL 5EFIB 1N59B 1F4WH 4L8CA 1ZOXA 3DYMA 3PWVB 1NJ9A 1FG2A 3VFRB 3RVTD 1JVKA 3RWCB 4P59H 1G7QB 3BZEA 4TRPH 4ODTH 3P9LA 3C2AL 1KB5B 2W92A 1TZIA 3MRNA 1HKFA 1IGIL 3PG2A 4M8QB 4ONHB 4NKOB 1YJDC 3MV01 3GI9H 4NKIL 2OMBA 3DX6A 4HUXA 4YFEA 5I1AA 3STZB 3UROR 1E4WH 4G7VH 4PJ5D 4X5WA 5DSCA 3RHWF 5E6IC 4Z7OE 5KAQF 4NBZB 5EA0H 2E7CA 1QSZA 4ELMA 2B4CH 5F3BB 5I66B 1BD2D 1Y6NR 4Y2DA 3CXHK 4EOWL 5AD0A 1EJOL 1SYVB 5C8JA 1Z2KA 2W0FA 2X2YA 1YA5A 1BQLL 4NC2B 1H3PH 4W81A 4Z0XA 4NDMB 5J6HB 1A4JA 4F7EB 4ODVH 3TBVA 4YHYB 3O6FB 3ALPA 4HZAA 1CFVL 4KKAC 4M1GL 3CNKA 3JBG7 5IOPA 2NXZB 2IFGA 4FABL 3P30L 4NQSA 5D96C 3SY0B 2GQHA 3MCKB 4R0LA 5DRNB 1VFMA 3DX9B 4PG9B 5D96B 2OL3L 2VXUH 1XT5A 4RGNC 4XI5C 2CDGA 1UZ6F 5E8EB 4IOIA 1ZLVH 1K8DB 4RGNB 2WWKT 3BQUB 4IRJD 1CGVA 5EU3A 4I77H 5E2JA 3QXWA 5JZ7C 2VZVA 2CUIA 4M5ZL 1BF2A 3X14A 3VRIB 4A6YB 3ZDXF 4WFEE 2JJUA 3FFDA 2AK4A 1I7TA 3M07A 4KMQA 3HE7A 2EKSA 1BVKB 1KACB 1XH3B 5C2BH 2GJ6E 1PQZA 4EI6A 1FIGL 3BRDA 5F44A 1A6VL 3SE3C 4M7KH 4PB9H 3QR2A 2A77L 3TNMB 12E8H 4QY8A 3JV5A 3S97C 4NZRL 3P4MB 4GKZB 4JAMA 3RFZC 1RJYA 5FK9A 4X9IA 4I0PD 3ULUH 4QRPE 3MV11 1IAKB 1A9BA 1RQ5A 2P46B 1DBAH 2VUOA 3AMLA 4EDXB 3RKDC 5GRVL 1S7QA 3SO5A 4K3EH 3C87A 4IDLA 2E3VA 4N68A 1H5BC 4NGHH 3RAJH 5HYJE 2P8LB 4PJ9C 1TFHA 1R5VB 1YJDL 4QRRA 4J8RA 4EUPG 3O2DL 4K3HA 4X8XA 3Q6GL 4M1DH 3RNQB 2NNAA 4QF1A 5C0DB 4XC3H 4OF8A 1IM9D 4QRUB 1P2CB 4U1JB 4E41A 1NL0H 1OD9A 1CK0L 1CGYA 2BXZA 4Z5RB 2KQNA 3QG6B 2Y1VA 4AZ8A 3I2CH 4NFBA 3AGVA 4N90E 4NSKA 5L0QC 5AZ2L 3IB4A 1JZ3A 5DRXB 3VWJB 3QFDB 3S37H 1KCUL 1T03H 5HHOE 5ID1A 3O11B 2A2QT 3KPRD 4JDTL 1CFNA 1BEYL 4XPAH 5E5RB 2YKLL 3W0WE 3P11H 4R7DB 4GW5B 4HKZB 5FGRA 2I07A 3PXHA 1NLBL 3KPMA 1CGSH 1IQDA 6FABL 3OJVC 3SDXF 3UZEA 5FYKE 4KTDH 1T2XA 2VRAA 2M8XA 1CXHA 5FHAH 3FMGH 1I1AA 4EQ2A 1B6DA 3CDFA 3K74B 5LGHH 2X40A 2FBJH 5D7IB 3PE9A 4LIQH 4YEEA 1RUAL 3TA3D 4F7MA 1TCMA 5T1KA 1CBVL 4A6YL 2XN9B 3U30C 5EO1B 3LD8B 3EYFA 3EO0B 4KJYA 4HUVB 3LS4H 4GBXA 4OLEA 3PWJA 3X13A 1JE6A 4JFOB 4TUJB 4Q2ZA 4P5TD 2O61A 4ODHL 1IAOB 3K8MA 4PJIA 2QLVB 1PKOA 3O6FD 5FGSA 3P4NA 3WIFA 4OCMC 4XC1H 4MAUL 4O2CB 1NEZG 3UTSA 3X12B 3NBNA 3Q1SL 4ELME 2ARJA 1JZ8A 2ITDB 3PWUA 2GUOB 3KR3H 2LAGB 4ZS7H 1P7QA 3SKNA 3VWKC 3BP5A 5IHBA 1KEGL 2IAMC 3O2VL 2EXYD 1J05A 3MACL 2IPKA 4ONGH 2O5XL 2H9GB 2DL2A 3QRGL 5BS0D 5CSGA 5EOCL 1YEKH 3GMRB 1TMCB 4YK4C 4WU7A 5T1DH 2ILLA 4YUEH 3GJFH 4DN3L 5FKPB 3KPQA 4I9WD 4YK4B 5J1AB 3WE6B 1QSFB 1E4XL 5B39A 3D69B 4KY1H 1NQBA 4N0CD 5C0FA 2HVJB 4HGWA 4OF5A 1JGEA 4QEGA 1OL0A 3W9DA 1WC7A 2C26A 2AJVH 4U1IA 3HR5A 3PWLA 4X6BB 4HIIB 2BNRB 1Q72L 3BUYA 2BCKA 5DHYA 1GRWA 4FQIH 4FG6C 4KTEL 2GKIA 5LWYH 1JWMA 4WU5A 5EU7C 3QEQD 2W91A 2C4FU 2BOCB 3ULVF 3L3OB 4M62H 1MQ8A 5GS2D 1DQQB 3BPCB 2VQ1A 2P5EB 3ARBA 3FQWB 3GSQB 1R3HA 1T0MB 4POUB 3PDOA 1R6VA 3S5LG 3SO3B 8FABA 4BZ1H 5BRZB 4J3OC 1C5DB 4Q7DA 5EOQL 2XFXB 2HT2C 4NQDB 3DI2B 4Z7VB 4LSQH 3O8XB 1JPSL 5KJRL 5CD3A 4JKMA 3QIUB 3WN5B 5KSBB 4WNQA 2Y07L 2R8SL 1S8DA 1CF8L 4FXGB 4KK9C 1IKNA 5EZOH 3MFFA 3QUMH 4KZDL 4D9QE 4X5XB 4HS6B 2AJSH 4ODSH 4NQCD 3L3HA 4IEFB 3D87B 3VWJD 3WFDH 4HBQA 2YXMA 3PNWA 4QRRE 3T0EC 3QDJA 1NKRA 4LHUD 3ZTJG 1S7SB 4JB9L 5GRWA 1FZMB 4WFFE 3NA9H 4HUWB 2X4UA 4JKKA 4XVUC 3HCVA 2A74A 2BVEA 1MRCH 2F54B 3MXVL 4MNQB 3KG5A 4FRWA 4HCRA 4X6CF 4E41E 4YPJA 3G04B 3LHPH 4V2CB 3VA6A 2Y06H 1HSBB 3M8OL 3BP6B 3G9VA 3TYFA 3F6LA 5EIVA 1NC2A 2BK8A 5DEFA 1HHIA 3AFLA 4JFHE 1Q9OA 1A7PH 4BUGA 4YHOL 1T66C 2ZUUA 1Y6MR 3B2VH 3CFCH 4LFHD 1EHXA 2B0SH 2LVEA 5EU4A 5SX4H 3IU3B 1T3FB 1U3HD 3WJLC 3Q2CA 4NQXB 4F58H 3NIFE 1GGUA 2FD6L 3AB0C 2DYPA 4KHTL 4KKBD 1QQDA 5T33L 3WNKA 2X9XA 5GGQH 5BV7H 1MCWW 5JW3L 4OF3A 1MHEA 1OQOA 4P57A 1N5AA 4P0DA 2YOCA 4LLUA 4PBWD 4R9HA 3VRLE 1MCEA 3WLBB 1KIPB 3OX8B 1UB6A 4TVPL 2NLJA 4HWBL 1EFQA 1K4DA 1IT9L 2OCFD 3HC3L 1IAMA 1N0XH 2FCBA 3OKNB 4U1SA 1CDGA 1I7RB 3QEHB 4PJIE 2A6DB 2YD1A 2EDTA 4Y5XB 2ICWA 5F3HB 3BDBA 3UTSE 3FTGB 1A3RL 1DFBH 2Y6SC 4NO2A 1WT5A 5JDSA 2G2RB 5F7MC 3D0LA 4OZHA 1NCAH 2VLJB 2G5RA 3G6AB 4OLYH 1A3LH 4JZOA 1MI5D 2MPAL 3QZWG 4Y8DC 5GISL 4WO4C 4JY6B 4HDIA 2Z93B 3GUTA 1GCFA 4NNXA 4YH6A 2J7LA 1UA6H 5CZXC 5HYSB 4P3CL 3V4VH 4PJXB 1NGZB 5TQ0L 1EEUA 1UXWB 1FORL 4CKVX 2BNRD 3HAEG 1HILA 1G9MH 4NO5B 4YQXL 4PJEA 4MHHG 3VG0L 1JNJA 4KJWC 1EZVY 1YEIL 2V17L 2X89D 3VDAA 4M6AA 1MREL 1XCTB 4KDTC 3V6OC 2D4FA 2ZG2A 4B7LA 3HI1B 1IC7L 2CPCA 1IKFL 4LASL 5JXEA 2R1XA 2GK0B 1QR1B 1HH6B 1OAKH 3KJ4C 3VW3H 3MRCB 1EHLH 2P8MB 5AUMB 3PWNA 5CP7B 1CLCA 1NC4A 3KJ4B 1HYRC 2YD8A 4KV5E 2A83B 2G75A 4XXDA 3I84A 3BN9D 4DUXA 3K8KA 4ZAKB 4OLUL 4XGZB 3VH8G 4HWEH 3O45A 5E95B 1LVEA 4O51B 1F4XH 2IBZY 1U8IA 4JJ5B 4QOKB 2ADFH 1BAFH 1N3NA 4ETYA 1U92A 4EXPX 4PGCA 1M6OB 3FB5B 5E6YA 5C0CA 3JV4B 2NTFA 3QIWD 1RZKH 2WANA 4XBGB 1CU4H 4CW1B 3VXRB 1U8QA 4KK8D 2NY1B 2Z31D 2ZCKH 3JVGA 1YPZA 2XXMB 4OF6A 3E6FA 2F54D 4OUUB 1BZ7B 4WW1A 4Z8FH 3OZ9H 2K3TA 4P5KB 1I8MB 1EA9C 3LKRA 3S9DB 1XGYL 4FQHB 5DJDB 1D5BA 3AU1B 1OT1A 4R4BA 3E6HA 3NFPA 3QCUH 4MJ2A 5CD5D 3QDJE 4TUKL 4FQ1H 4KMTL 3QISA 5ITFA 5CJ8A 3B5HA 4XPFH 4YFLI 3UJTH 1OTTD 4KWUA 4H88L 3T3MF 4FQCH 3H9SB 3FB7B 2BFVH 2VL5A 4HAFA 3U0TA 1T4KA 1G7JB 4HS8H 5ADOL 4DKFH 1YEGL 4L3CB 5LG1A 1WWAX 3EHBC 3KLSA 5D2NC 1CE1H 5IQ7H 1RZFL 3X3GH 1FAKT 3LEVH 2MKLC 2V9RA 1MRDL 2OTUA 5DFVD 5C71A 4NNPH 1AGBB 2J1KA 3TBYA 4K2UL 4RFOH 4OT1H 4HGKC 1EAPB 5KSUA 3G5VA 4PJCF 3L3JA 4L9LA 1PYWB 1SJHB 4RCAA 1KJ2A 2ZKHL 1AI1L 3KPSB 3OJMB 1HHHA 4NOBA 2DJ4A 3V6ZA 4OQTL 2YSSA 3IF1A 4QRTA 3FQRB 3KLHC 2V5MA 4GXVH 3SE8L 4P4KD 4Z7UF 1BFSA 3K2UH 4G42B 4NRZA 4CMMB 3IXTB 1B0GA 3WV0A 4PRPD 5I76B 2A6JA 1JHKH 2B1HL 5DTFB 5HHME 4U6TA 4XCFL 3VXPB 4LSDA 4JG1L 4IS6A 5F89B 2KDGA 4NJ9L 4Q58C 3S35L 4AIXA 4NN7B 4OZGF 1CLYH 4RX4A 1FYTD 5A16A 4MQTB 5LXGL 1EGJA 1JF5A 1FJ1B 3F7VA 1WWCA 4L8SC 1SVZA 4LLYB 4N0UA 4OZHE 4HEME 3S4SG 3O3DA 4L8SB 3PP4L 3SGKA 3BWAA 3WO4B 2HN7B 3V4PL 4HJJL 1QRNA 1EBAA 5TPWL 3C5ZB 4AIZA 2XWJB 2I60H 1IEBA 1NCCH 3MNVA 3KVQA 4S2SA 5KVMC 5I16A 3P4OB 4P9ML 1PBYA 3QUKA 4XX1E 1ZA3A 4PJEE 1UM4L 1UKQA 3ZKXC 5TQ2L 1MH5B 2DQCL 1ZKAA 4PV8B 2ICEA 4XNMA 4GAFB 4KI5D 4P46A 4U05A 1CD0A 1MFNA 2O5ZH 5F9DC 1I9RL 5L2KD 4LLVA 3BRGC 3V7AG 4OCYL 3SQOL 3T1FB 2UV3A 1RZJC 1RK1A 4I4WA 3D48R 5GGUA 1S9YA 3BYTA 4L4TA 5EOTB 1JZ5A 1UWXH 5F72S 3K46A 4K94H 1YN6B 1IARB 3QIBC 4PJDF 5EPMB 3N1FC 3OKOB 4RAVB 3BRFA 4LLWA 4OF0A 3VFTB 1QA9A 2Z35B 2MMXA 4NQEA 2AEPL 1DEEA 3P73A 3QIBB 4TOYH 3QUYA 3OJDA 5LCVL 1CD8A 2RBLA 1I7UA 3PJSA 4OBSA 1WQVT 2APFA 2X4RB 2DQGL 1CD1B 5SWSA 4GS7C 1MJ8L 5FECA 4K3JH 3TCLA 1JHLH 1K6QH 1OSPL 1MHPL 2BSED 5C0CE 5IB5B 3TH4T 3STBA 2W9EL 2OZ4H 1JGVL 1VKXA 1ETZA 1LDSA 4JFFB 3EOAB 2XA8H 3SDYH 3KHOA 4JM2A 4LCWD 4G80A 4AH2B 4WTZG 3B8SA 1HXYA 3FCTA 3CFBA 4NO3B 1U41A 4GLRH 5TFSH 1ZLUK 1J9CT 2YPVL 3H9SD 1JNHB 4LLMB 3VGAC 5J57B 1EVUA 2QV2A 1RIUL 2IADA 5ICXA 2FR4A 4MJ6B 3WKNA 4KRLB 2KZ1B 3KLDA 2JELH 1WCBA 4HXAH 5J0BA 1YMHA 2EDLA 2KKQA 3LKSB 4JFQB 3Q5OA 4OAWB 5E8NB 4ZMAT 1VFBA 5TDOA 1UFUA 5KVDH 3JV6A 1DQDL 1CFBA 3HI6L 4FXLA 2ZSVB 3LEXB 4OBRA 1NGYB 1OAXL 3UBXB 4DVBA 2FX7L 1ZHLB 1KTLB 4JZJB 3V0VA 1DQJA 4GO6B 2ZUQB 1GXEA 5EBMB 1TVBB 5CJXA 4XTRD 5GGRY 1K2DB 3FB8A 3HTLX 4LMQI 4FZ8L 4DQOH 4JPIA 4HUNB 3VD7A 3WSQH 3MBEC 5GGSA 1MF2H 3VI3E 3EJYC 2EDQA 3CPLA 1S7VA 2BSRB 3U0WL 1J1XL 2CGRL 4GRLC 2UY7A 1FP5A 32C2A 3P4LA 5C0GB 3KPPB 4D9LL 1SEBA 3PQYD 2YN3A 4IOFD 1TZHB 3WUWB 3HPJA 4JPWL 2B20A 2NXYC 2VDQL 4ZUWA 5EC1B 3LRSB 2DTML 5DGRA 5L9DL 4OV5A 3ZL4H 2JLLA 4QHNB 5F8RC 2ZJSL 1ZTXH 1DE4B 4YHLH 1LE9A 5IGXL 4HT1H 3F12A 3EJZD 2AJ3A 3C5ZD 5IVZA 3BPLC 4EEEA 4G6ML 3NIDF 1RULH 5D1XC 3WIIL 2AGJL 4GH7B 1CICC 1O7SA 4S1SH 2ITCB 3BPLB 1MY7A 5D8JH 3MOBL 4N0UE 5CUSL 1G6RH 4LOUD 5FYLE 1FBIL 4XP5L 3P2TA 3NZHH 1YMMB 4M7ZC 3UTTD 3EO1B 4GRWE 2NW3A 1QRNE 1C7TA 3TIEA 5IESL 3Q5TA 1RIHL 3VD4A 3LQAC 4FTVD 3UAJC 4MNHA 4ZOAA 5FKAA 3Q6FB 4YBQD 3OR6B 5IG7B 5JIIA 5CKGA 1EXUA 1FNSH 2BVOA 3LKQB 4XNYL 3CFKA 2D31B 4MLIA 4LBEB 2V2XA 1NLDL 3C5JA 5EDXA 4P23B 3RWDA 4WI4A 2WIMA 1HINL 1P4IH 5C0EB 4L4TE 4NN6C 1T1WB 1NCDL 5IW3A 3GRWA 5GGVH 3GMQB 2YPLB 2EZ0D 2FX8H 3WS6C 7FABH 5I74C 4NQEE 2IFFL 5I75C 3L5HA 5T3ZL 5FUOL 4HPOH 1VEOA 2QR0B 4QCIA 3U9UB 2AK1H 4AMKH 3EOBB 5SWSE 2GK2A 5D7SL 4PGBB 1IGMH 4TULL 1J8HA 1XGQA 5JIHA 1QVOB 1EH9A 2CMRL 3BIBX 1QYGH 3BGAA 5FOBA 4APQC 3PXJA 4PP1C 1F97A 2CIKB 3IFOA 1UZ6E 2A1WH 3BGMB 4EI5A 5AYUL 3LKOB 3RRQA 3VMNA 4BA8A 1N8ZA 4XWGL 1F3JA 2R2CA 5FF6A 4WFHE 1NMAH 3DX8A 1T1ZB 3ZDXE 1HXMB 3IVKB 4NFDA 3RVTC 1YY8B 1QFWL 3UTZA 1EMTH 3SDDD 2ORBH 3AMKA 2BNQB 1JI1A 1DP0A 4K23L 3LAFA 5DD3H 5C0AD 4UTBL 2D0HA 2X9YA 4PJ8D 1VACA 3SCMB 1E0OB 4ZUVA 1TPXB 3QULB 1QG3A 2UWEA 2SEBB 4H0HB 4P5MB 1WFUA 3KPLB 3JTSA 3HI5L 1QEWB 2HJFA 5C92A 2E9JA 5A2KH 1NANI 1XF5B 4Z7WB 1A7RL 1H0DA 5BZDA 5MEQA 1WTGT 3HMXL 3IFPB 3O41A 5KS9B 4HV8B 4F9LA 5AAMA 4PBVC 2G60L 4Y16C 3RGVB 5HD8D 2BSSB 1AGCB 1AQDA 4Y16B 4FZEL 3HNTH 3R06B 1JRHH 1DQTA 1LEKA 3QZWA 4W4OA 3RJDA 4L5FH 1OY3B 2PTUA 4IDJL 3RY6A 4R3SB 3MRPA 1BWWA 5JNYB 2UZIL 4YHML 3I3EA 4YDVB 2HAZA 5DUPL 4J2XA 3GFUA 4NC1E 5IR1A 3MJ7A 4CBPA 1KSRA 1Z0NA 1VEMA 4U3XA 1LE5A 2P5WA 4IRJC 2DWEA 3HZYA 2F19H 3KYNB 4HJGB 4PRIA 3T09A 2DIBA 1FCGA 3Q48A 1YMMD 2FZ3B 1ADQH 1SJXA 2GSGA 5DJ6A 2XZCH 3TO2B 1CT8A 1LO3H 4I13B 4W4NA 1FNGA 5ALBL 4F7CB 1H3WM 2YXFA 4BFEA 2EYSA 2IG2L 5T3XE 3QHFH 2A73B 4X4XB 4JREC 3MJ9H 1OW0A 5DQ9A 5MEOA 2AERT 3GSOA 1P69B 1KN2L 4JREB 5ADPH 3IDXL 5C7XH 4ZSOB 4HIEB 1XGTB 3VE0B 1T20A 1MLCB 4LEOB 1CDUA 1RFDH 3GO1H 3IGAB 2Y9RT 2V5YA 3DUSA 3EKCA 4I0PC 4P23D 4LAQL 3SKJL 2J8UB 4BJLA 3H9HA 4OZFH 4G6KL 3R4DA 1OAYL 3D9AL 1UH4A 5CEZH 2HFGH 2IJ0C 3ARSA 3MNWA 1NBVL 5IFHL 2J12B 3QDMA 2P24A 3AC0A 3RNKA 5HY9A 2OYPA 5DS8B 3HMWH 1ZS8A 4TQEL 1AGDB 1ZSDA 5DD6A 5E00B 2EE6A 3D85D 4LVOC 3E3QE 1FO0B 3N50A 3MSPA 2F5AH 5K9KB 2X70A 2GITA 4LVOB 3BPOC 1DZBA 1I8IA 1SJEA 5LAXB 3QFJA 3OG4B 5C0BD 1J86A 1A4KA 4D0DB 3SE9L 1VFUA 2UUDK 5GRUL 2X4TB 3KYKH 2HJKB 1X5HA 2ZG1A 4MCYA 2AQ2A 4UT6L 4MVBD 5GGTL 5HGHA 1NAKL 2CLVA 5MEPA 1J8HE 4YHKH 2X7LA 3ROLA 2G5BA 5CBEA 3B9DA 4UIMA 5CSBA 3QI9C 4AJ0A 2V6HA 1LDPL 4BH8A 5ALCL 2E5EA 4LF3A 2HKFL 1H15A 5CEYB 1S7RA 4LSSL 3CFJA 5D7LB 4YHNA 3SCMD 1FNEB 1IBGH 4YXLH 1X4XA 3H0TA 3TA3C 4YDKL 5ACZB 5K9QG 1MAML 4X0KA 2NCMA 1A0QL 1HEZB 1CFTA 3UTPD 4LP4A 5C09D 2WLZA 3KS0J 4KXZI 1LQSR 2WUBH 3CC5B 3MV7A 1P9MC 3RWHA 4I8DA 2C1OA 3TN0B 2GI7A 3V5HA 4LHJB 2JB5L 2PO6A 3ULVE 4NUGL 1BHGA 1ZVSB 4Q6IC 4R97B 4OCRL 3BHBB 3RGVD 2YD5A 3WNLA 4U1MB 4P5TC 2UWEE 5F1IB 4LHUG 3WBDA 1Q9KA 4WWKD 4JM4H 3EYSL 4OFYA 3VCLB 1C16A 3HC0B 1MJUH 4QNPF 3NMEA 5DMYA 2R0ZH 1VB9A 3TF7C 1AXIB 1RHFA 3DXAB 3MNZB 4IIQA 4HCRH 3KXFD 3S4SA 3QWRD 2BMKA 4ZTOL 4LAJH 2EDKA 3ZKMD 3LMJL 3SGJA 1D9KA 1Q0YH 1NUDA 5L6YL 3TESA 3PGDB 4KHXH 4W68A 3L3GA 3BZFA 5E8OB 4Y5VA 3V0WL 2X4OA 8CGTA 2VXVL 2QADD 1FO0L 4TYUA 1SMAA 3DMMD 2HLAA 3ARGC 2R0WL 4IRSB 4OFVA 2P5WE 4OCXH 3BESR 4OLZH 3DUUA 4N0CC 4MA8H 5GS0D 3LKNB 3BKMH 4PRIE 4UIKL 5LQBH 5DLML 3LN4B 4EJ1C 2FEDD 1F3DJ 35C8H 1PGRB 4NWTL 4YBLB 2W0LA 3CSPA 5E4EB 1GGIL 3QB7C 1I9JL 4QRPB 1HNFA 3VFVB 5KSAB 4G8FB 1RIVL 4NKMB 1WBYB 3DVGB 4IRZH 1OAQL 5F7EH 1D7FA 3C8KA 5C0RH 5CMAB 2NY3B 3KPTA 3UC0L 2QQKL 3UTQB 4XRCA 3V79C 3VXUB 3LN9A 4I3RH 4XNQB 3K80A 2VR9A 4LLDB 1DCLA 1NFKA 1I85A 2DS4A 3O3BA 4HD9A 1G7MB 3MOAL 2OJZH 3MODH 5DJCB 5IIEA 4P2RB 1F2QA 2C7UA 1F90L 5F9WB 3RTQA 4Z7QE 1LO0L 4AQ1B 2QL1A 5JOFB 2IWGA 1G0YR 1VA9A 2FJHA 1U58B 3WL9A 4UAOC 4V1DA 2MCG1 3LH2H 3QDME 4GSDL 1WJ3A 3EFDL 4HFWA 4PJGB 1MFAL 4JHAL 3BXNB 1I1CA 2ZUYA 4H20L 1VFOA 1F4YL 1TZGH 1CGXA 2QSVA 2X4NB 1OAZL 4LNRA 4HK0A 3D3VB 1KCRL 4ELKB 4BM7A 3U2SB 5IW1A 2W9DH 4N9OB 4XVSH 4OZGA 3KLAB 3MR9B 4OB5L 2GTZA 1CQKA 3F7YB 4UDTA 2OI9C 3QFJE 1P1ZB 43CAA 1A1OB 1M71B 3D18A 3IETA 5L2JB 2XACC 2QSCH 1DUZA 4HIHA 3UJJH 2VDOH 2ZUXA 3TWCL 4L8CB 1UM6H 5CBAB 5EIQA 1FV1B 4MJ4A 5GZNC 3V5KA 1NCBL 1OWWA 3CMGA 1XCQB 2OK0L 3MXWH 5EIIB 3BZEB 3NPSC 4NJAL 3MRMA 1P6FA 2B1AL 3OR7A 3U48A 2NY6D 5E2UL 5T1LD 4EDWH 1W72A 2CKNA 1RUKH 5CEXB 3G08A 1U3HC 4L4VA 3TN0D 5BVPH 2PXYC 4XCEA 4L3AA 2VISA 2NX5A 5ESAA 3LB6D 4KKBC 4PJXF 4WY7H 4BSVB 2ATKB 4QRQA 5KOVC 4ZFFA 1X5LA 4ZXBA 2X4QA 2R69L 2JCCF 4PJDA 3RDTB 4CUCA 3PIQA 1MEXH 2W0FB 1IGTA 1MCPL 2BSTB 4RMSA 1GGBL 3CZJA 3MV7E 2AQ3A 1UEMA 2WBJD 3C6LD 3MRFA 5EUKA 1R3KB 1AC0A 5HYQA 3NPZB 4JN1H 3RQ3A 4ZFOB 4ENED 4C58B 4H8WL 4I3SH 4WFED 1QKZH 3QEUA 2R2EA 2AJXL 2FECL 4ZO7A 1QFOA 4CJ0A 2W0PA 4WWID 3TBWB 2V2WB 1ZT1B 4RSVA 1CGUA 2GJ6D 1BZ9B 4J1UB 4X80L 4G7YL 3L1OH 3EGSB 1XR9A 2YR3A 2XZAL 1D5MB 1Z5LB 2MHAA 1A7OL 1ZLWH 3BH9B 5HI4D 1PW3A 1PAMA 2AK4B 1TTGA 2WUCL 1NCWH 2L4OA 4LARL 4C59B 4F3FA 1DQLH 1W0WA 4O2FB 6CGTA 4UV7H 2DMBA 1PQZB 1DEDA 4R26H 4EI6B 4MDJB 4QRPD 4PRHB 5FUZH 1PZ5B 3BEVA 4JKWA 2EIZA 5H2BB 4ZFGH 3FFCA 2GTWB 3QUZA 3KDMB 1MJJA 3ARDD 3FRUA 1OF2B 1FLRL 1WEJH 2NY3D 2R23A 3RWEB 2Z0BA 2A0LD 1IM3A 3QDGA 3V7AE 4WHCA 2WBWB 4Q0XH 5HYJD 2H32A 4GRMB 1Q9WA 1FVCA 3ESUF 4MD4A 5SWZB 4OM1L 1M05B 3NCEB 2IQAA 2YD4A 1ZGLP 1JWSB 5DEGA 1R3JA 4JANB 1HZHH 1UVQB 4BH7A 3DRTA 1MELA 5FO7A 3W2DL 4XP9L 4N90D 5JO5A 4HQQH 1FDLL 3SN6N 4HWNA 4AEFA 4X6EA 2EC9T 4TSBH 1KCLA 5HHOD 1RUPH 4QRRB 3DV6A 1VGEH 3QIWC 4MSWA 1LO4L 4HBCH 4QF1B 1WFNA 3W0WD 1P4LB 1XFPA 4LPWA 4E41B 4KK8C 1ZVYA 1EGJH 3FQXA 3SJVB 5JOPE 3KPOA 1V7NL 3A67H 2LFGA 3L3KA 5D1ZA 1WK0A 5FYKD 4V1DE 4MA7L 4LCCA 1XIWD 5JPNA 5ID1B 2ZSWB 1JF1A 4TNWK 4HFUL 2OL3A 1JUFA 1UJTA 4KUCF 4LSRH 2E7HA 4QTHA 5D72H