4L9LA

Crystal structure of a human valpha7.2/vbeta13.2 mait tcr in complex with bovine mr1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
198
structure length
196
Chain Sequence
NIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAPLDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 35
structure length 196
sequence length 198
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lA02
4X8JA 1OD9A 3WFCL 4KK5D 1T1YA 4EBQL 3GGWB 2VITB 1QG3A 5JHDA 4J8RB 3V52H 5L0QB 4FXKB 4CW1B 3MQIA 1IKFL 5IMMA 3S96B 3FO2A 4U0RB 5CILL 1WCBA 3ARPA 5ITFA 5C3TA 5KSUB 1KSRA 5HYFA 4JGMA 4RGMB 3MRGB 1I85C 1RHHA 3I3BA 4DVRL 1BF2A 4PJCB 3GRWA 4WI7A 1U3ZA 4LEOA 4P4RB 4HBCL 2J6EA 3JTSB 3JWDH 5BW7A 3IGAB 5DEGB 4IIQC 4GXVH 2ERJB 1KB5H 3MV9E 4E5XB 1ONQA 1VGKA 2HH0H 2B2XL 1UG9A 2O5YH 4PJEA 3RVTC 3EJYD 3RZCC 1KT2A 2LTQC 4FQCL 2XY1A 2R8SH 1N4XH 4ZQKA 2NY4B 4LCWB 4HWEH 4HUXB 3BKYL 3HUJA 2ZG1A 2OMBA 1R0AL 2W07A 1U8QA 1WZ1H 4A6YB 4UI2A 1XGQB 2QEJA 4QTHB 3C2SA 1QD0A 3I6GB 3GHEL 3PL6A 1LO0L 1IM3B 2IQ9H 4TVPE 3GSXB 1EZVX 4NRZB 3Q6GL 3HMXH 2XTLA 3KLDA 3ALPA 1B88A 5DS8A 1RUPH 2DJSA 3N1MC 1RZ8A 4C59B 4JG0L 4XCNA 3NN8A 5B22A 5F7MC 5JR1L 4D9RE 4KWUA 3JTTA 1GOFA 4OGZA 4P2RA 3OHXB 5GPRA 4NWUH 2OP4H 3O9WA 4NNPH 4NN7B 5CEZL 3I6KA 4MNGA 5HGDA 1IARB 1MF2L 4U7KA 5D5ME 1CTNA 2B4CL 4B41A 1BFOB 1MCSA 3IFPA 4Y5YB 4LVOB 4OI9A 4YAQA 3RKDC 4I77H 1VFAA 3EYUH 3EZ8A 4L9DA 1ACYH 4R97C 2EKSB 1F58H 5KZCB 5D2NB 5KVFH 4MB4A 2ZCHH 5GSRA 5J6GB 2PKDA 3TO2B 3ARDB 3BMVA 4PGBA 3UTPD 3ZO0A 1FDLL 3QI9B 3TZVC 1HQRB 4Z7UA 1P84J 1KF9B 5F8RC 3D87B 5GJTL 1QSFA 4U1JA 4LAJH 5EULV 4PRPD 1GSMA 1JGLH 4ZPVB 3DVFA 3L95B 3MACH 4LGSB 3AB0C 3VDCA 4FHBD 6FABL 1A7PL 4MJ2A 2Z93A 2HJLB 2CKBL 1TQCB 4TOYH 4OAWA 4DGIL 2XRAL 1XCTA 4U1LB 2EIDA 2JTDA 3BESR 5HDOA 1VFBA 3NH7L 1YJDL 5EIVA 3BP6B 3GMLA 3BVNB 5DUML 1LO5A 2R2BA 5E2UH 1CVRA 2HWZH 2JK5A 2M2DA 2WWKO 2VH5L 3MLZL 4DGYL 5HY9A 4FQQA 3ZKMC 5I16A 4V1DE 5E8EB 3D39B 4S2SA 4U3CA 1IM9B 1R5WB 4K7PY 4PS4H 1T7WA 4XPTH 1IEBB 5FOJA 2W0FA 2D7TH 5F7DB 1EHLH 2XFXB 4YK4B 5I9QC 4D2NA 4FQ2L 3STLB 1CLOH 4Y5VA 1CBVL 3QFDA 3OJDA 3GBML 5BVJA 3WNKA 3JWOH 4YBQD 3OKLB 4MSWA 3BQUA 2JJUA 4G8IB 3L5HA 4Z7QF 3CFBA 2BSRA 1LP9F 5ISZD 1BQLH 2W38A 4RMSA 3VXQB 2NTSP 3VDAA 5HYEA 1DBBH 3S37H 2Z31A 1EH9A 1B6UA 4M1GL 4LAQH 4XAWH 3MRIA 4MJIE 4M93C 3CZFB 5KVDL 2DQIL 3UJJL 4JN1H 4KVNH 3RL2A 3GGWA 4IJ3C 2W9EL 3ZT7A 3HG1D 4FXKA 4RA0C 2BNQD 3GSNL 1FN4B 1D5BA 1MY7A 5T33L 3S96A 4NQCA 4HX1A 4DKEH 1A6TA 2P44B 2DQHH 1BHGA 5BZWA 2DQTL 4PJBA 4NN5B 1L4IA 3MRGA 5ACZB 4PBVC 3RI5F 4MAUH 1ZV5A 4F9LA 4KAQL 5HHOB 2IFFL 2J8UB 2XN9E 4WO4C 3ULVL 4LMQE 3C8HA 4P4RA 4QTIH 3TT3H 5DEGA 2WAHA 1MAJA 2GJJA 3PJSA 5C0AB 5BS0B 4XCCH 1LNUB 4BM7A 5JOPE 1W0WA 4LP4A 2NY5L 3PNWB 5CKAA 4JPWL 4NZRH 5CGYC 4OTXH 4BSWB 5E24E 4LCWA 3MRKB 4YUEL 2DLHA 1KBGH 5DMIH 4A6YA 4YXHL 1XGQA 4PB0L 1U41A 2MPAH 1WZMA 3DXAE 3MBED 5J6HB 3GSXA 1G6RL 4G5ZL 3WDJA 2B4CC 2IH3B 2VXTH 4FQ1L 2ZOKB 2PNDA 2WWKT 2DM3A 3F12A 1J7VR 1LP9B 3V6OE 1QFOA 4H5SA 3OHXA 4HUUA 5SWSB 1ZT1B 3V4UL 5HHMD 1FBIH 2DQEH 1N64L 3K1DA 4U1KB 3HMWL 4P46D 1AO7B 4Y5YA 4JKKA 1CE1L 5HXMA 4M1DL 5EU7E 4YHKH 3O6KH 3FHQA 4XXCA 1OQOA 5HPMA 2CLZB 3VXOB 5D7SL 4JB9L 1R3LA 1A6ZB 3CZJA 1WCQA 5J6GA 1TZGL 4JHWL 35C8H 4S1DC 1HQRA 1UT9A 3ZHDA 3LDBB 1OQXA 2PCPB 3KHQA 4NNYA 1I1YB 1KTDB 3OL2A 4HG4J 4ZPVA 1KIRA 3L95A 1YJDC 2AJYH 1SVCP 2I27N 3KDMA 4H25B 4LVEA 3T1FA 1AY1H 4Y1AA 3FFDA 5DWUH 4XVSL 5DA0B 5KSAD 5L7XL 2A2QT 4PJDF 3RHWK 5GGUB 3VD5A 2VL5B 5E6YA 1HH9B 1F45A 4I0PA 4UINH 4F57H 3UZEA 1YECL 5CINL 3BVNA 3T1WA 1ZA3B 5CGTA 5CZXC 4XPHL 3K8MA 4H20L 4XMKL 4KY1L 2EDLA 4EI5C 4NKOA 2FEEL 5IOPA 4UBDC 1CLZH 2YK1H 4NKMA 1P4LA 4NHUA 2B4CH 4ZUVB 1R5WA 5AG8A 3O2DH 4LSTL 4ONHB 5FYJU 4PTUB 1C7SA 3LPGA 5FK9B 1QSEE 4WTZG 1K5NB 4BQBA 5IV2A 2YPLD 4LHUD 3STLA 3B8SA 4FQXA 3PWPB 1PBYA 1X5HA 1JV5A 1RUKH 3MJ7A 5F96L 4TSBL 4WI2A 5CMAA 3W5NA 4PLNC 2Q8BH 1KXVC 3A67L 4KRLB 3VXQA 1BAFH 2FJGA 5E00A 2VIRA 4KUZL 2J12B 4YDLC 4NM8H 5I19H 3HZVB 4Z7VB 5HYJB 1Z9LA 3AC0A 4WI9A 2E7HA 2J3SA 2NY6C 3BJ91 5T3ZE 2YD1A 4P2YA 2XRAH 5K9KA 4Y16C 4LLMA 4ZYKA 5FYKE 2P8MA 3BOVA 3O3EA 4ZO8A 3NH7H 3CX5J 5I1DB 1T83A 2XTJC 3VA6A 5KVGH 5DLML 3LQZA 1FIGL 3U2SA 4DKAA 3ULVC 5JXAH 3K7UA 5IESH 3MLXL 3TA3D 3VG9C 1AD0B 1A6VL 2BMKB 3QXAA 2Z35A 3GJEB 4NC0B 1KCUL 4K2UH 4PJAF 3ZKXB 3CDFA 2PO6B 2NW3B 4PD4K 2CIKB 1ETZA 2NY5C 1K4DA 3E3QC 5IJKC 4PJDB 4RX4A 1EEQA 1G9MH 1UQSB 4PIRF 1HYRC 4GMSH 2FDBP 4M6NL 1A4KB 5CGYD 5HBBA 2CO6B 1UZ8A 4JQVA 3OKMB 4OF6A 3UTQA 1CBVH 1TIUA 3GBMH 5ILTL 5BS0A 1S7TB 5HTSA 4Y4KD 3SY0A 5IP4A 2NYYD 3RWJA 2IAND 4OI7A 4Y4FB 1CFVL 2R1WB 2F5BH 4NQXA 3SE4A 4YH6A 3MRCB 4ODUB 2UZXB 3INUL 5CEZD 2FX9H 1MQKH 2FJFB 2NW2B 2VDRH 3VFGL 3HI6H 2R29L 4L8DB 3O4OB 1RULH 4LLUB 1DFBH 4GMTL 3TT1L 1EHNA 3DX9B 3EDDA 3M1BB 1F2QA 1XGYH 4MNQA 2ZOKA 4ZFGH 2OL3L 3SKMA 3RWGB 1NC4D 3ZYZA 2G9HB 1ZT1A 5EUOB 3CC5B 3C5SA 1J8HB 3LKNA 4JN2B 1AO7A 3AREB 1AE6L 3QIWD 2JCCF 4UV7H 3ARRA 2WQRA 5FHBL 2DIJA 5CEYA 1TJIL 3VXRE 5ESQA 1NFDE 1C08A 5HVWA 3VXOA 1EUTA 1FZMB 3WN5A 1XCQB 3QIBC 2GTZB 5I15L 5KN5B 4U1MB 5C9KA 2EIZB 1UEYA 1U58A 4UT9H 5F7YC 1FYTD 1MI5D 3DECA 1D9KA 4YHPB 3AMKA 4UT7L 4ODSH 1F11A 5FXCH 5I30H 4YDJB 1I1YA 2FH8A 3KJ4C 3GMMB 1RJZA 3JV0A 4JPWH 2CUHA 4HFWB 2FATL 4PB9H 4GRLD 4M1CD 4NZDA 1NCDH 5IF0B 4I0CC 1MELA 3PQYD 4P49A 5IEHA 4LEXL 2VN4A 1LDPL 3OAUL 1DN2A 5FYJL 5E2WH 2R2HA 3AS1A 3QUMA 4R96B 3TJHC 4C56B 3V5HA 1CG9A 1G6RH 4MA7L 3SDYH 4EI5D 3RWIA 5DVNA 2VABB 2VQUA 2YKLL 1ZGLB 4X0KA 3CIQA 5L8JB 4L4VE 1NGWA 4W68A 4FQ1H 3NBNA 4H1LA 3TBWA 1SM3H 2EDRA 1ZA3A 5CBAA 4JHAH 4JO2L 5TQ2H 4ZUTA 4R8WL 4WFGD 1N0XH 4PUBL 3UTSD 3LHPL 5E03A 3MROA 1WBYB 3MRQB 2EDWA 2HTKC 1DP0A 3EGSB 3VGGA 3HMWH 3HAEG 1I3UA 3N0PB 4JRXE 4ZUVA 4ONHA 1N8ZA 1BFSA 5DEFB 4M4RA 4IS6B 3VXMD 2YD3A 3O2WL 4XP5H 3TIDB 1K4CB 4MXWL 1JHKL 3BX7C 3GRWL 3DMMC 5GGSB 1RK0A 2FEEI 1NBVH 3T65A 3SGJA 1KIUA 3PGFH 2X4QA 5C7XL 1TZGH 4Y4HD 4FFWD 2ZZUT 3WBDA 2J6EL 3P0VL 4XNZB 4B0MM 2NY6D 1OF2A 3A0OA 2OXHA 4L8BA 5F1OB 3IDMA 3DX7B 1NCBL 5A3ID 4JFPB 3VXSD 5FCUL 4KKAC 3SKOB 3SDCC 3ARQA 4Z8FH 1QVOB 5FYLL 3TNMA 3C60C 3WUZA 3PHSA 4LKXB 2X4NB 3QZWB 4OSUH 3SCMC 4K7FA 2CRMA 5I1DA 3HPJA 2VAJA 3HI5L 5EWIL 3LN4A 2AJUH 4MDJB 3WNPA 1OSZA 2VXVL 4OZGB 4U1NA 5HGBB 4ZAKA 2DAVA 3L3IA 4M7JH 3E6FB 2BMKA 3GJEA 3FB7A 3LS5L 3QUZB 4LIQE 1ZT7B 1RZ7L 2XWBB 4RGNB 3NFSL 4QKXB 5GZOD 2P5WD 4PJDA 1CICB 2RHEA 5HI5D 2Y72A 1E28B 1AGCB 4M6AA 5IT2L 1RJLB 3BP5B 4G7VH 4NQEB 4RGOL 3V4PH 1IQDA 4N90E 3T3PE 3UROR 1J87A 2FSEB 5K59E 4XMLH 1MRCH 4YHML 4ETQB 2R9HD 4Y4FA 5C09E 5J7CC 1SYVA 2MJWA 4KI5C 3AROA 4PJCE 3UTTB 1BQUA 1X44A 4ODUA 5AUMA 5I8CA 3NPZB 2O5ZL 2NW2A 3VRIA 1N6QL 3T2OA 4PV8A 1SJXA 1S5IL 1IEAB 4FQLH 1S7VB 1FL5A 4AEHH 3GNMH 1VPOL 4UOJA 1U8LB 1KN2H 2P46B 1A7QL 3DX9A 3M1BA 2DLFH 4LCIL 1HKLH 4JY6B 5DD5H 3HPLB 4Q6IB 4KKLC 5F9OH 3F58L 1D5IL 3RWGA 4G6KH 5C8JA 1P2CB 3KNBB 5HGAA 3A6BH 1HXMB 3L3JB 4S1RL 2ITCB 1G0DA 2VLKD 2NY3B 3AREA 1A7NL 3DTXA 1I3RB 5IVZB 3NIFE 4XTRC 1AD9A 1MCBA 1T21B 3PXJA 3NCFB 2LE9A 4U31A 5F71A 4XI5D 5D4QA 5EC1A 2GTZA 2AV1A 5KN5A 4U1MA 3C5ZD 2JIXA 1S7WA 2G60L 4OLXL 4YDJA 4PJ9C 1YC8A 3GMMA 5KSVB 3JVGC 4KMLB 1T2XA 3O41B 2D7QA 4F7PB 3NAAH 2YPVL 1XF3B 4M3JA 4HFWA 5EO1A 4GBXA 1UFUA 4PJAA 3INUH 1RZJL 1A6PA 3MRJA 4MWFA 5D2NE 4JFQA 1FE8L 5IFAH 4EDWL 4ZO6A 4OF3A 1J5OH 3M8OL 3RTQD 5ADOL 1VEMA 3BRFA 1X5XA 3REVB 4OLUH 4OB5H 3GIZH 1ZGLA 3C5JA 5TE6H 3MC0A 1LEKB 3A6CL 4G6ML 4ZSOB 1I75A 1JYWA 3MRQA 1DEDA 5ETUB 4YHNA 4EZMA 1AQDA 1NFIB 1AIFB 1GGCL 2IBBA 2OR7A 5BW7C 2BY3A 4PREA 3ET9F 5JW5B 3WIIL 4HKZB 5ACLA 5I66B 4IS6A 1JNLL 1GPOL 3TWCH 25C8L 3S34H 2BSSB 5GGSA 5SWQB 1QZ1A 4PRID 3Q5OA 4LBEB 4YPJA 5ABDE 5CP7B 4YHIB 5F7FA 4KKAD 1AGBA 2JLLA 3D39E 4O58L 4GG8B 2HT3D 4L3AA 3RWHA 3VFMB 2VDNL 1N3NB 4R90L 3PL6C 4NZUL 2GK2A 5CD5D 5C0CE 1QR1B 1UADC 2FATH 2JCCA 3F6IA 2ORBH 4OZHE 4M6MH 2R15A 3CGTA 1ZE3C 4PY8I 4A6YL 1KACB 2QQNL 1W8NA 4HJJL 5IEKB 3ILQC 1MHHA 1RIUL 1EFQA 3O9WC 4X7FC 1FRGH 4NQSB 1ADQH 5DD6B 4YHLH 3VXTA 2J7LA 1IBGL 3TBSB 2DQUH 3IFNH 4PLJC 4Q9QL 3CMOH 2EYTA 4R8WH 2WUCL 5HGBA 1XGPB 4HEME 2BNRB 3G6AB 2QADC 43C9A 2EC9U 3NGBB 3QUZA 4UUJA 1NC2D 1XIWB 4N0YH 4S1QL 2MQ3A 3H9HB 3JUYA 1ZLUK 2PW2B 1L6ZA 4WWKA 4G3YL 5GRYA 1NLBL 4J4PD 4L1DA 4HKJB 4Q6YA 5EU5B 4RIRB 1IRAY 3WFBH 2A0LC 2HJKA 4ETQA 1LHZA 5MP6H 3T0EE 4ZOBA 4E41E 3ZLQC 2DLIA 3CFDA 4GLRI 5DHYB 3UTTA 5BRZB 5HHOE 3MLVL 4HV8B 2EH8H 3S4SB 3FRPG 2J8UE 3QQNA 3QHZH 3DUSA 3B6SB 4KJYA 4ZUUA 4OFIA 3D2UD 4XT1C 3L5WA 3PUCA 4XRCA 3TN0B 5EOCJ 1ITCA 4NHCH 3WFEH 5F21B 5FFLA 1IEAA 3LKRA 4F15C 4OLVH 1A4JA 1FVDB 4QHKI 3V8CA 4MMXC 2FX8H 1YNLH 2AK4B 4LRNL 3LS4H 5EUKB 3I02A 4JY6A 3HPLA 3BMWA 4F33B 1U3YA 2MOVA 3IDYC 4QRPB 2IMMA 2W60A 2DL2A 2CSPA 2FR4A 1INEH 1P2CA 1BJ1J 3KNBA 5IB5A 2DTMH 3L3JA 4J3XA 2VXVH 4H0GA 5DJ2B 2ITCA 3QEQB 4PG2A 2DOCA 4BQ6A 4GUPA 1U3HB 1DBMH 1ZLSL 5EZLB 3P9WB 1SBBA 1PZ5B 2DLGA 2X41A 5J8OA 1TZHA 4XXDB 1JRHL 4Y5VC 1RZ7H 2AAVA 5GZND 5IVZA 4GLRH 3NFSH 1SEQL 5TF1H 3OJMB 1L7TH 3BQUC 3T4YB 1VEOA 3WD5L 3QG7H 1LP9E 5GGQL 3VA2C 3D1MC 1RZJC 4JPVH 5SWSE 5JHLH 5E4EB 1K8DB 4KDVA 1PQZB 1IGMH 3BEVB 5B4MD 1OGAB 4Y5XB 5I1GH 3CFCH 1CFNA 1IAOA 5EU6B 1TCRB 2Z31C 5KSVA 4MLSA 1N5YL 3P73B 1XF3A 3IAGC 1RU9H 3V6OA 5A2IH 4OUOA 2LVCA 1LO3H 2H2PC 4AZ8A 1T6VN 3VI3F 3ULUH 1N6QH 5FECA 3OR6B 3ARBD 4ONFH 4WFFD 1PG7X 5T1LB 2IEPA 1ZHBB 4CL7A 4AIZA 3WJLA 3G9VA 1KIPB 5IHUL 1A7QH 1P7KB 4M03A 3I2CH 1U8NB 2X4PA 1AXTL 5HHNA 1U8JA 3L7EB 4PJ5D 2JE8A 4UV4H 1D5IH 1L9MA 4F9LC 3E1F1 3RGVA 2Z8VC 3OXSA 1AIFA 2AXHA 1XF2B 1RUAH 2AJXL 1P1ZA 1A7NH 2CDGA 2VDLH 3Q6FB 3I3DA 4HKZA 4I5BB 1NSNL 4R26L 3K46A 3TPKA 4HUNB 4OIAA 3GUTB 1WVZA 4Q0XL 4H0HB 2LAAA 5FO7B 1BGXH 1RZKL 2NZ9D 4KK9D 2NY4C 3QQ9D 4HDIA 3BE1H 5CP7A 3GMOB 2D03H 1JHLH 32C2A 4XBEL 3KWWB 2DN7A 5I8KL 4P5TA 2YUZA 4HK0A 4B7LA 1N3NA 2QHRH 5M94B 3TO4B 2R69H 2F53E 3VRLF 1QR1A 1J1OL 3U0TA 4P2RD 4PJIF 1UEMA 2X10A 3PWPE 4X6DF 2YD5A 4D9LL 2H32A 2GY7B 4CADB 4AM0A 1ZHKB 3TCXA 1I8LA 5A2FA 1LD9A 4Y19D 1NJ9B 1T66D 4FTVD 4NN7C 1KLGB 2WINB 3L6FA 4NQSA 3UBXG 1N5AA 4PTTA 2GKIA 5MEPB 5I1AB 4Y5YC 5DMYA 3D0VB 1IC4H 4Z7VE 5HYJE 3LSOB 5KS9B 2BNRA 1A1OB 4XXCC 3QRGL 1DSFL 1U8IA 4JY5H 3ULUD 3DVGA 5CJ5A 5CUSH 3W2DL 4PJXE 3MUGA 4MX7B 4XP6L 3QDAA 5BVPL 1IT9L 2BXZA 1EFXB 1WT5A 1JPSL 4CN4A 5EU5A 2ZUWA 2VYRE 1E27B 2VSDA 2PYFB 4F80A 1A5FH 1CXKA 3MLPA 1XR9A 5JPMB 5KTEL 3GMNA 5DJ8A 3U30B 1TQCC 5DI8B 3OG6B 5SV4A 5CHNB 2GFBA 4ZOEA 5FHAH 4YJZL 4N5UA 1I3GL 3QUXB 3QNZB 3GKWL 4I0PC 1ZEAL 3BIKB 2R0ZH 3NIGE 4HJGB 4OUUA 1M05B 3P11L 1MWAA 2QQNH 5DYOB 1YMMD 3GO1H 4L9LA 2HT4C 3QUML 1W72A 1CD1A 1HXYA 2WNGA 3N9GL 3HE7B 1BFVL 1P9MA 4J6RH 3UYRH 2JB5L 5DJ2A 3QEQA 1IAKB 4B5EA 5IMKB 4X5XA 1PZ5A 4RNRA 2OTWA 4FQXC 4XXDA 1BFTA 1BIHA 2X9WA 1M7IB 3UJIL 5TE7H 3OZ9L 1T5XB 1P5UA 3QPXH 1BZ9B 3P77A 4OZ4A 1BEYL 4DEPB 3EOBB 3CK0H 3V5DB 3LRHA 3NCJH 1K8DA 5EUOE 1NLBH 3QFJA 1J8HE 1OGAA 4MQTB 2UUDH 4D0BB 5ADPL 1I4FB 4HK3J 4NZTH 2GSGB 3RQ3A 1DQQB 2EC8A 1MUJA 4AY0A 1X9QA 2P5EA 4NQCD 3WXVL 2C5DC 3LB6C 2ADJB 2GUOA 1ZHBA 4GXUM 3QUYA 1DN0B 1T83C 4LLQA 3HB3C 5GGVH 3HRZA 4X8XA 1RUQH 4LRNH 5ESVB 3W39B 4JFZL 1GGBL 5T1KD 5E9DB 3IFLL 3RL1B 4NN5C 4QRSB 1TDQA 2GY5A 3CSYB 5IKCB 5T5FL 4X98A 4RFOH 1L7IL 1MAMH 1RZKC 2DICA 1KJVA 4MHHI 3B9KD 3O6ML 4OCYL 1K2DA 1BZ7A 2X1WL 4C56E 1Q9OA 3WKNA 5MENA 4JQVC 1QR4A 2CRZA 1Y6MR 2QBWA 5FUCE 5IVNA 4JDVA 4I5BA 4EI6A 4XP4L 1JN6B 1CS6A 3NABH 1T2QL 2VC2H 4RDQF 1QRNB 2ZNXA 4OQTH 5H35A 5F70A 4ZXBA 5CIPB 2JELH 3GMOA 1JZ2A 2BSED 3U46B 1OARH 1DVFA 1FG2B 3KWWA 4QXUL 4W6XB 4J3WA 3RVUD 3QDMB 1DZBA 2XT1B 5TDNA 3O3DA 3EOTH 3I6LD 4J1UB 5TGBB 2BVTA 4TQEL 5GS0H 1NLDL 1EMTH 2ADIB 2XIDA 4IRSD 4X4ME 2CKNA 4WUUB 3LEVH 2AXGB 5FO9A 3T08A 3MCLH 4NWTH 2H6PB 1A02N 3Q48A 4FQIL 2VZOA 1BD2A 4FQHA 4FP8H 4PD4J 1KLGA 4HFUL 5I1AA 5I73C 4NCC2 3ULSA 3LSOA 4Z7OF 1FNSH 2A74A 3C08L 1OAUH 2K7QA 5D93C 3WN5C 5D6CB 4KK6D 2XICA 4Y7MA 5DQDH 3O0RL 4M61B 4UIKL 1MRDL 5I6XB 1D9KC 4HPYH 4GAJH 1Q94A 5FKPA 4PLKD 2IG2H 4Y1AD 4RMTA 4DUVA 3CNKA 4Q0XH 3CUPA 3R8BB 3ZMRA 1QO3B 4X7DC 4OZGE 2VLRE 2AEPL 3DHMA 3MODH 1J05B 3D25A 1MH5B 1Q0XL 2ATKB 2B5IB 4JHBA 4EIZC 1JZ5A 1GYAA 4U6VL 5MEOB 3BP7B 5JPMA 4NO0B 1FNGB 4RGNE 4I0PD 3DX8B 3ZYOA 4L3CB 4P9MH 4PRHE 2QQLH 5DI8A 3E6HA 3BISA 1OLLA 1JWUA 2R4RH 5IVOA 1IGCH 1RIHL 1MCJA 1MJUL 4XNYL 3QNZA 4NQEE 3U7WL 2E9JA 2FBJH 1GHFL 2E7BA 4I18A 1CD0A 2AEQH 3T77B 3MLUL 4NC1C 3MFFB 4RZCA 4XBPA 5D7LE 3BIKA 1NCCL 1M05A 4OCMC 3LKQB 1MPAH 3KPSE 1C5CL 2XQYK 5DRWA 3BGFC 3F7VB 1IMHC 3G5VB 4YIQB 3LPWA 1IGIL 1ZWIB 1MHPH 3L3HA 3G5ZA 3THMH 5TQ0H 5A43C 1KEGL 4PJIA 1DSFH 2X6MA 2D0HA 1AGDA 4X6DA 3ZHLA 2EDXA 5GS0D 4M6OL 3WUWG 3W2DH 3G5YB 1FH5L 3SGJC 4MNHA 3LPFA 3MZTA 2GW5A 3AXLB 4GG6B 4MJ6B 1RZFL 2ARJA 2I5YH 4FG6C 4LSQH 1P7QB 4WFEE 1Q9KB 4GRWH 5B38G 4OKVA 3P0YL 2RCSL 4AT6B 1I4FA 4L3ED 3ARZA 2IH1A 2GSGA 2H1PL 1SBSH 1DQQA 4MA1B 2XQBH 3EKCA 3X12A 1DQLL 5D7JD 3QA3B 5I18H 3X3GL 1DN0A 3R4DA 3MA9H 1PD6A 2G5BA 3M17B 3P11H 5ESVA 3W39A 4UAOB 2YRZA 3T8XA 3EO0B 1MREH 1EAPB 4MGXA 4J7RA 4ZAKC 5LQBH 5DO2C 3QUMH 3RL1A 3VD4A 5HHVL 3ZKXC 4M8VA 4QRSA 3CSYA 4HIJB 3NFPB 4X6EA 4OJFL 4NOBA 3MRFB 4F7CA 2ZCKH 4LP5A 4OLWH 2VQ1A 4YHOL 1HWHB 4QRQA 3ZTJG 1RVFL 4Q97A 1LVEA 2HG5B 3UJIH 4OLZH 1KPUB 4LFHG 1P4IH 4Y4FC 4WGVB 2PW1B 4ZSOE 3P4MB 5D70L 1U95B 4KRPB 5CIPA 2F54B 4GT7A 4ZTPH 3U46A 3QQ4A 5I74B 1FG2A 4MQ7A 1CU4H 4MNQD 3WFHB 3QDMA 1CGWA 4M8QA 4WW2F 1I7RB 4YDIL 1JCKA 1AGFB 4YQXL 2YSSB 3DURB 5E6IB 2VZ3A 4G43B 3VXUB 5BXFA 3WIHA 2DM2A 4WUUA 1FNAA 3CFJB 4K9EH 3BDYL 1YYLL 1RUML 2V5TA 3OR7A 3PV7A 4BK5A 5KANI 3TC9A 2P49B 1JZ8A 3NZHH 4YE4H 1YNTB 4F7EA 5DVOA 1WGOA 3AREC 4N0UA 4P4KD 3C9NA 5M7QA 2QKIB 3GJFA 1QLRA 3BW9A 3MV7D 4IRJD 1D9KD 4I0KA 5B39G 3W5MA 3DO7A 1QEWB 5E1HB 3O6MH 1LDSA 2EDYA 4EN3B 1I7TB 2EH7L 3MV8B 4DUWA 5IFJA 1FO0A 5BMFH 1AP2B 1VHPA 3RWCA 1FGNL 4OZHA 3MLSL 4FS0A 1QO3A 2WLYA 2VNCA 1UJ3A 4GBXC 1P53A 2WMPA 2LQRA 4LSUL 1ZSDB 4M5YH 3BD5A 1FJ1B 3VFTA 1WWBX 4QXUH 1UWXH 1AQKL 3DX8A 4L3CA 3CLFL 3TJEH 1PG7L 2IPUG 4PJ7B 5JQ6L 2GEEA 5L6YH 2PTUA 3WFDL 1F4XH 2DKUA 3DGGB 3FT4B 5HGGS 4ODXB 3BRDA 3MFFA 3LEYH 3ARFB 3O4LA 4K3JH 1LO2L 1NCUA 3KVQA 4QHNB 1HHIB 3QCVL 1RHFA 1ZTXH 5BRZE 4MS8C 4XB7A 2EEBA 2A6KA 1S9VB 2VXUH 4WW2B 1X5KA 4TPRL 3RHWF 4ZD3L 3EJZC 2ESVA 2W65A 4YX2L 3T0EA 4WFHE 1YN6A 3QQ3A 2PN5A 3MNVA 2OI9B 4HIEB 2AK4E 4Q9RL 3BKJL 1A7OH 4XNXH 4OZFB 3ECBB 1OAQH 5F89B 1RD6A 4G6JL 4TUOB 4QRPE 5F1IA 3AXLA 4QNPE 2ZOLA 1XF5A 3KXFD 3GSOB 4XNQB 5HI3C 1G7HA 3U83A 4JVPA 3D9AL 3BXNB 1R5IB 3MXVL 4JFXA 1SEBA 4DZBB 5B21A 1NFKA 4QRRA 5DJYA 5I71B 4U6VH 1SHMA 4TVPH 1JGUL 3U36B 4LLWA 4IMKA 3VFVA 1Z0NA 4JM4L 1YPZE 2KZ1B 4KROB 4QCIB 5E8NB 2EZ0D 1G7QB 3SPVA 3ZHKA 4ZAKD 3SDDD 3QA3A 1M71B 1H8NA 1B9ZA 4OIIH 1JFQL 1W0VB 2XKNB 3PWNB 1KB9K 1F90H 2CIIB 4G9DA 5EU6E 1F3JA 4I48A 4LARH 1NMBL 4PR5A 2GK0A 1A3LH 1ZT4B 4S10A 2YN3A 4PY7B 3SGKA 2Y7QB 3NACL 3QUZC 2A9MH 1QHOA 1FP5A 3FRUA 2FWOB 3SDAA 1EBPA 2UUDK 5EFIA 3SOBH 3ZE2F 2C3HA 3MRFA 1PKQA 2F9BT 2FBOJ 2V2TA 2UYLB 4KRMB 5HVHC 3UPCA 1AKJA 2HTLD 4AIXA 2UVEA 2HG5A 4JFYB 1KEMH 5FGCE 4EQ3A 1KPUA 3O2VL 3RJDA 2WUBH 2X4OA 1I8MA 1RZGA 4L4TB 4DKFH 5EORL 3DYOA 4EUPB 12E8H 1PLGL 1MIML 4LCUB 3MBXH 3KYKH 3STZA 1I7ZB 4RAVA 3OKYA 1J0HA 2BY0A 1A1NA 1EHXA 2WBJB 2H1PH 4AG4L 3MV9D 1EXUB 1NUNB 3LEXB 5F7EH 3VXUA 3GKZA 1HHGB 2IPTH 5CJOH 4OF0A 5B3JE 3LH2H 3TNNA 1PSKL 4G6FD 2ZJSL 4KVCH 3OKEB 3FZUC 4G8FA 2YRLA 5AYUL 3WE6A 2IC2A 3LD8C 2N7BA 4YFDB 1QA9A 3L1OH 1MFAH 4JO3H 1HWGB 4P5MB 3GMPB 1BQHB 2DI8A 2Y36H 4O02L 3OKDB 4BH8B 1YNTA 2FO1A 4PG2C 2QQKL 1DEEA 3UXFA 1MWAL 3SJVA 3X14A 4TVPD 2OXGA 1F4WH 2VLJE 1ZA6B 2A9NL 1W72L 2FD6L 1NAMA 3BPNC 2JIXD 4OJFH 1F6AB 4YXLH 5F1SA 3RWDA 1ZVYA 5T5NG 2CH8A 4EN3A 4AEIH 4D9RD 2R1XB 4X7SL 4NQUA 4YHOH 2I07B 4PGEA 3JV4A 3RAJH 1JE6A 5DD1H 5HJ3A 2I60H 2R0KL 3UDWA 4LMQI 2KL6A 4FXGB 4MXQC 2P24B 1WSST 3BZDA 3TH3T 5KS9E 2FB4H 3HRPA 4UOW0 3DO3A 1VCAA 3U4AA 1WZKA 4RMWA 5CD3B 4G80B 1YEJH 3SKJH 3VMPA 4YHZH 5AYQA 4FABL 2DBJA 1KN4H 3HC0B 4LOUC 3WJLC 5K9JH 3VGAC 2A73B 4MQXC 4KMQA 4XPAH 3CFKB 1FV1A 4ONOA 3IJYA 3ES6B 1WICA 2C1OB 3MJ8A 3HFML 3GI8L 1E6JH 5E2VH 1T6WA 4QHNA 4KV5E 5I0DA 1OPGH 2DS4A 3BYTA 4QY8B 4IRZL 1V3JA 1HOCA 1SQ2N 4HF5L 4Y89A 4OCSL 3KLHC 3RGVC 2PR4H 3V6ZA 2GSIA 1S9VA 5DTFA 4AL8H 3MRNA 1PEZA 5IBLC 2NY7L 2VAAB 5I2IA 4LPWA 5ICZB 3F5WB 2BNUB 2VDPH 2N1KA 4U1IB 2CRIA 1ZGLM 1INQB 4OZFA 4HUWA 4LF3A 2YPKA 5DHVB 5F89A 1H3UA 1QFWL 5FDWB 5DJ6A 1EO8L 3P30H 1ACZA 4V1DD 3O6FA 4P5TC 2ARWA 4WDIB 2X2YA 2E5EA 2D4DA 2VXQL 4FZ8L 2BRRL 2PTVA 3QB7C 4TSAL 1OCWL 1U8KB 2VKXA 2Z92B 3VCLB 1OP3H 4GKZB 3S3PA 3VGDA 3R0MA 4QF1B 3RX7A 3U9UB 3RDTA 5E8NA 3T3MF 1G7QA 3H8NA 4Y2DB 1I8LC 4ZFZA 4ZFOB 4CAGA 3P4NA 5DJXA 4LSSH 3MRMB 4WI8A 1JF1B 3VFSA 2A77L 1FSKB 4XZUA 5GRUL 1ZT4A 2VLME 1GH7A 4JFDE 4MJID 3FO9B 4K3EL 1YQ2A 4POZC 4WWKD 2IALA 1FGVH 1HHKA 2AJ3A 5DMGC 5FF6B 5I1KL 1BM3H 4ZD3H 3SO3B 1VERA 2MMXA 3X13A 1NMCC 2UYLA 4HJ0C 2O5XH 1WT5C 2NY2D 1CE6B 4NUJA 2IADB 5I75B 4Q9RH 2FIKB 5E9DE 5AWNL 1N6UA 4APQD 4JAMB 1YEHL 4C83B 3AMLA 4NUGH 4LDLB 2Y6SD 4I3SL 4L4TA 1A2YB 5ESAB 4G8EB 4OLEA 2YD7A 3KPPA 4HXAH 4LCUA 3MJ9A 2RQ8A 3QO0B 4QYOB 2XN9D 2WBJA 8FABB 3T0DA 4YGAB 2J5LC 3LEXA 4UILL 4UIMB 4HS8H 1QRNE 1HHGA 3PDGA 2FECI 4JM4H 1ORQA 5JOPD 4NGHH 2AK1H 4YWGL 3ALXA 4L9LC 4Z95H 1NGPH 3U1SH 3I50L 4MB3A 3GMPA 1P9MC 1YUHB 3L5XH 3BH9B 4LIQL 3PDDA 3WO4B 1X4XA 4BH8A 1J1XH 4HGKC 1SJVA 4V2BA 3DI3B 3DXAD 1H3VA 5EBWA 1HKFA 2BOBA 5KAQG 5CJQH 4XVJL 4K7PH 5GRVK 4IIQB 4X7CC 3HR5A 2DI9A 3QWOB 2Y1VA 1F6AA 5CAYB 3UC0L 3OJVC 1CFQB 2LTQB 3ELAT 1HILB 4N5ED 2WK2A 3WNOA 2BSTB 3U4BH 3KLAA 3O2VH 3MLTA 1KC5L 4FXGA 1I9RH 2P24A 4JFFA 3N85H 2J88L 5ERWB 2V5SA 1TETH 1CK0H 2A83A 4AQOA 3DUUB 3I85A 1KCSL 4UB0H 5T3ZH 2X4SB 4J3TA 4FZEH 5FYKH 3SKUD 3QUYC 3MBEB 4GS7C 5IB4B 1RJYB 1VACB 4UQ3B 2EIBA 2OR8A 2A73A 1JZ7A 1TJHL 3ES6A 3KLHD 2JJSA 1KCLA 3RX8A 4TNVK 3K74B 2VL4A 2ZUYA 3UJTL 5IBLD 4QY8A 1NMAL 2DIBA 3QDGA 3U4EB 4GAYB 7FABL 1CLYL 2HFFA 3CLEH 5C07E 4XBGB 4HWBA 4M7LH 5HHMB 1Y6KR 4R97B 2ATPA 3ZL4L 5LCVL 2R4SH 3RY4A 1M1SA 1CR9H 4U1SB 1UVQA 3CVHB 3K3QA 3F5WA 2BNUA 5F88B 3MMEA 2FD6H 5FUZL 3HE6D 1FVEA 4KZEH 2H9GB 6CGTA 3ARVA 4U1IA 5E8DL 3RGHA 2CK0L 2YA0A 1QNZL 1UWXK 1OM3L 4XCEB 4ZXBC 4JVWA 4KFZC 1A6UH 1G84A 2BVOB 4I3RH 1UA6L 5FDWA 5DR5L 5DUBB 1R3KB 1UM4H 1YEFL 4MB5A 5IIEA 2V7HA 3B3IB 1DVFC 4YC2B 3AB0B 2ICWJ 1Z6JT 3BHBB 4B50A 4KK8C 1FG9C 4GRMB 4KDWA 5E99H 3TO4C 4I2XA 1FLRH 5IG7B 4PRPA 4Q9BA 1QSED 3C8KA 3GZKA 4H0IA 1D5XA 5BQ7B 4EOWL 1KELL 4DK3A 5FKAB 5J06A 4BZ1L 4GKZA 3P9LB 1QFWI 1MCPL 1IE5A 3KPLB 3B2UD 3FN9A 1U93B 3RNKA 4GG6E 4UTBH 1YA5A 5IMLA 3JWNC 4GKSA 4ZFOA 1KB5A 5DFVC 2W9DH 2X40A 3WIHL 3MR9B 2VB5A 1KJ2B 1KYOK 3GI8H 5IVXB 5DMGD 3W11C 1V7NL 3FB5B 5CSGA 1BBDH 2R0LH 5DUPL 5D9SB 1WAAF 1A9EB 1MNUH 3LIZH 3JV5A 4WHYG 4I4WA 1Z3GL 3MRRA 5T3ZD 5E8PA 4ZDHB 1N2RB 4R6UA 3BDXA 2D4FA 5FF6A 5FYKD 4P23A 1B6DA 3BZFA 3HMXA 2AKRB 2L0DA 4C4KO 3V7AG 5GHWL 1BJMA 1UZ6E 4MDIB 3T0BA 3K80A 1G7IA 1LK2B 4JAMA 1WC7B 5B38B 1D6VH 3R8QA 1CXIA 4O2FB 4P3DA 3DIFB 2NNAB 1FO0L 5ISZA 1J88A 3U30C 3KR3L 4R4FH 3EIFA 3VFPA 1OWWA 3QEHB 4MJ5A 4QYOA 1YYML 2BRRH 4XWOD 1F00I 5I1CH 4I18C 1TVHA 4UIMA 2ZUSA 3RA7L 4XHJD 1I1FA 5D8JH 3MOBL 2F54E 1I9JL 3HG1A 1QUNA 3L3DB 1RFDH 1OT2A 2BNQA 4X6FA 2ZWLT 2BC4A 2A77H 4P57A 1U8MA 2WV3A 2YWZA 3PDOA 4RAUB 3TA3B 2SEBB 1A1MB 4WO4B 5D7KE 4OGXH 1H3PH 2OSLB 2I24N 4XVUD 5GGRB 2ZSWA 4LASL 2EYRA 1CCZA 4H8WL 4C57C 2E27L 2NTFA 4XH2A 1JUFA 1HNFA 3KJ6H 1FFQA 3MLWL 4XCYB 1JMZA 1HILA 1FVCB 4KHTL 2VDQL 2P5ED 1P84K 3Q3GB 5IW6A 2IANB 4OFKA 4G9FE 3QUYD 1C16A 4TVSa 1S78D 2Q76A 5ERWA 3QXTA 4R2GD 3VXRD 1V05A 1R3JB 3RVWD 4LU5L 2X4SA 5K9OB 3MV8E 2E9IA 4JZOB 4ONGL 4LLYB 5D96C 3IDNA 2X5PA 3CVIH 1JMXA 3IRPX 4UILH 4CDHA 4PGCB 2D31A 1PG7W 2M8XA 1MVUB 3GI9L 5A16B 4MMZC 4PY8J 4MD0B 4WWID 1JNNL 3HZYB 1LK3L 1YEGL 1IGJA 3LRSA 2ZCLL 4ELKB 4FFYH 5EOCL 4GAYA 3QNYA 2OM5A 4JRYB 4LIQH 2NX5A 4PJ7E 4R4BB 1E4JA 3EOAB 4P46A 2ICEB 4U1SA 2C1PB 3RJQB 5C2BH 4OLYL 5IFHH 4C4KT 2H9GA 2KH2B 5HDBE 4Z5RB 3WHXA 4L4VD 2CKBB 4H88L 3HC4H 2B0SH 1ZKAA 1C5DB 2FRGP 2YMXL 3IKCA 2BVOA 4Z9KB 5EH1A 3DSNA 4ZS7L 1FYTB 1MI5B 5MERA 3ZTNH 3VXPB 1ZS8B 4JRXD 1U3JA 2QL1A 1KOAA 4NC2B 1EX0A 1NH6A 1ZMYA 3RPKA 1FAKT 4GRLB 4X6BB 1A9BB 1CGVA 5BQ7A 1BD2D 1PZUB 5DQJA 2FZ3A 2PTTB 2AJSL 3OQ3B 5DFVD 3MRHB 3GMQB 2OR9L 1Q1JL 5KSAA 3GBLA 3CH1A 3PQYB 4O2CB 1P4BL 4LSDA 5I1EH 3W11D 4F2MB 1HSBB 4P3WA 4BH7B 5KSBE 3DHJA 2QSVA 4EI5B 1T22A 1AFVH 4PP1C 1KTLB 4PJ8D 4QHUB 3LKPB 5E70A 1NKRA 4M9PA 2G2RB 1MHEB 5HGHA 4MA3B 1ODAA 3FB5A 1NDGB 1XGUA 3ORJA 4LCCA 3PV6B 15C8L 3UTSB 5LKNA 2HT2C 1OAYL 2CGRL 1MVFA 2XXMB 1FZKB 1XZ0B 5TPWH 3R1GL 4PRNA 2DD8L 1QLEH 1MCCA 5FV2A 5I6XC 5GJSL 3NTCL 5FUOH 1L6XA 2YPLA 4LHUA 2DQDH 4M5ZH 5E8DH 4R9HA 1NAML 2OJZL 1OP3K 1X7QB 1YPZA 1UJ3C 4YEFA 2PYEB 3ZT5A 4WTXA 1UA6H 1P6AB 4LQFL 3VJ6A 3AGVA 3IJSA 4XX1G 4YDLB 4Y4HB 3QPQD 4MAYA 5ENWB 3TV3H 2VR4A 4CGTA 4NQTA 2NNAA 1T4KA 3BEWB 2NY6B 4X4XB 5GGVY 3QYCA 5GRZA 1NGZA 2FCBA 1L0XA 1H3GA 2APBA 3VXSB 4QLRA 4UU9B 1DCLA 3QNXA 4B53A 3DVNB 3T2NL 4N90D 5SWZB 2XTJB 5INDA 1K9TA 1XFPA 3KPOA 5H37H 2D0GA 4ODBD 3TGXA 3B5TA 3VG9B 4X5WB 3IU4H 5C09D 4EXKA 1I9IL 3OXRB 4JKPH 4HPOL 4H8WC 3MGAA 1V8HA 5C08A 1RV6X 3ISWA 4N0CC 4OCXL 4TRPL 3JSSA 1PDKA 3T0EC 5C0EA 4RAUA 2OK0L 2FJHA 4OCRH 1GAFL 5HHPB 3D18B 3GK8L 4OM1H 5ELIA 3SEPA 1DBAL 3BH8A 1KPVA 5EIIB 5J9PB 1JNHA 1G6RB 1BVLB 3QHFL 4KTDL 1VGEH 3LN5B 4MHHG 4Y4KA 5JPNB 4HC1H 5J3HC 1J18A 5D2LF 4BFIA 1HHHB 1I9EA 5ITBL 3NMEA 4IMKC 2K7PA 5EBMB 4RMQA 1R3JA 1V7ML 2CXGA 4FFVC 5FO8A 3OGCA 5ALCH 3O2DA 1YQVL 4OF7A 1UM6L 2VLJA 1T1ZB 3J7HA 4NDMA 4YGVB 4ODVL 5FIEA 5JA9A 5F3BB 1QSZA 1KENL 3AU1B 4PFEA 3QJFA 4KGJA 5F9AC 3HZYA 4N8VB 3SGKC 4IM8A 5H94B 1BBJA 3BO8B 1AR1D 1C8PA 1WUNT 1NC4A 1QBMH 3SDAC 4R4BA 3ARDD 2OQJB 4F58L 4R7DB 3EOAA 2VLKB 4X4ZA 3L3GA 4G8GE 3HCVB 4ODHL 3QIWA 3B43A 4UT6L 3ZKND 4LNRB 1U6AH 5GISH 4HLJA 2AP2A 3KJ4B 3GEWB 5T3XE 1C5DA 4QOKE 4KRPC 2ID5A 3FN0H 3C5ZB 4KHTH 1FYTA 1TJGL 2IBZX 5JDJA 1SVZA 1U8HB 4NQVB 1FZJB 5T1MB 2V2WB 2EICA 4U6HA 5C0ND 1JTOA 2L7JA 3FQXA 2OTUA 3VW3H 4GRLA 3DRTA 1KB9J 3FQTB 4K94L 3EFDL 5J12B 4LU5H 3MRHA 3MJ9L 3K4AA 4L29B 1M7DB 4FNLH 3UTPE 5CEXB 5I1LB 5FA4A 5F7HA 2O26U 3D39D 1TVBB 3CX5K 2N4IA 2OZ4H 1UWGL 1IM9D 2HT2D 3DROA 3IS1X 3V5KA 5D72L 1UB6B 4QHUA 2ZSVA 4XCFH 1MHEA 5C0CD 1I1AD 1T1WB 5D2LB 4MA3A 1QP1A 3O8XA 1NDGA 2J4WL 4QRUA 3ZSTA 3QEUA 4IOSD 1QFUL 1BOGB 1FFOA 4TULH 2FYYA 3QEGH 3C2AL 3DMMB 4EN3C 5DVKA 2HLFC 4YPGB 4DW2L 4Y8DC 1S7XB 1AXSA 4OD3H 5LGHL 1I8IB 3VXMA 3UDWC 4NQDB 1JF5A 1GZQA 2EXWD 3BZ4A 4FOMA 3QBTB 4Y4HA 3SDCB 4AENB 1IGFL 1RZIB 1EEYA 3L9RA 1C1EL 1JPTL 2GITB 2EDNA 3O4LD 3EHBC 2R1YA 4X4XA 5FA3B 1FAIL 3C60B 3FQNB 5F3HB 4N8CL 5MEQA 2V17L 5DA4A 1VESA 3QXDB 2Z8SA 3SCMB 2UY6A 2J1KA 4L5FL 4KKCC 1DQDH 3DVNA 4P2QE 4H1LG 1EO5A 4P2CG 4PBXA 2QSQA 4N0CD 5CBEA 1WEJL 5I8OH 5TH2A 3T0ED 1CXFA 2F19L 4E41D 1N7ML 1NUFA 5D1ZA 3N1PC 1LEIA 2BERA 2XWTB 3MLRH 4I9WE 4CMHC 2FO4B 5HHOD 3X3FL 4X6CF 1MCLA 5EZJB 5H8DA 1X4ZA 3H3BC 3V0VB 2H26A 4OBRA 5EOQH 2XI9A 1FNEB 5HHPA 5IB2A 2OI9C 4XPBH 4OZIF 5C0GB 2I9LB 2V2XA 3CX2A 4DN3L 4HWBL 4JR9L 4K55A 1NC2B 4OD2A 2P5WA 4YXKH 2X70A 3R06A 4G7YL 3AY4C 2GT9B 3ARXA 1JGVL 3L5JA 1OSPL 3IDGA 3O6FC 1BVLA 5IK3A 4K71B 4UMGA 1URLA 3ARGA 3MA7A 4HZAA 3RP1A 2R39A 4LQFH 3FL7A 5I71C 4PJGB 2WP3O 2OL3B 3WSQH 3BJLA 3V52L 3DPBA 4RMUA 3PIQA 4KI1A 3JV6B 5IJVA 2ED8A 1VKXA 4DZ8A 4KROC 3HNVH 3RDTC 3GFUA 4MCYB 3TP4A 3N06B 3JXAA 4PLOB 3IJHA 1T1ZA 5J1AB 3VWKA 3HUJF 3EYQC 4I13B 1D5ZB 5F3BA 4U2YA 3OB0H 1XR8B 2GJ6E 4HPOH 2NXZC 1T0PB 3JWDL 1AKJD 4YZFF 4ZFOL 3C6LD 4ISVA 3ZT6A 3QDJE 4GXVL 1UXWB 1KB5L 4XC3H 4EJ1C 4WI4A 1KCVL 3LKSA 1A14H 2HH0L 2O5YL 3UTZB 2AJVH 4R7DA 2R8SL 1N4XL 3DETD 4EXPX 1W2KT 3F8UB 3K4DA 4HWEL 4HWZB 4XNMA 3GK8H 2P7TB 4HXBH 1WZ1L 5A2LH 3C87A 3W0WA 2IQ9L 1H15A 3WLBB 1CDUA 4K94C 4X8JB 3HMXL 2WSKA 1Y6NR 3C6SA 1U8HA 1T1YB 5IW1A 3MRDB 1RUPL 4N9GB 1FZJA 4NQVA 5T1MA 2V2WA 1MJ8H 5JHDB 4D0DA 2WBJC 1IGYA 2UZYB 5HD8C 5IMMB 3V2AR 4Z7UF 4NWUL 3FO2B 3PE9A 2OP4L 4NCDA 3ULUF 4NNPL 2NCMA 1WCBB 5ITFB 3WNNA 1W8OA 1M7DA 1KNOB 3RTQA 3RUGF 3WL9A 1ZHLA 2OX5A 3MCKA 3CXDH 4I77L 1RHHB 1TVBA 3EYUL 5JQHC 4PRDA 2X05A 1ACYL 3AS3A 1RURH 1KG0A 1F58L 5I1JH 1YEIH 5KVFL 1GVIA 1MJ7H 2F53D 2ZCHL 1RY7B 5D2LA 1GC1C 2HLFD 2XA8H 1Q72H 1VGKB 1B3JA 2AS5M 1KPRA 4F58H 4ERSH 4PJEB 4NT6B 1KT2B 4OM0H 4OCNC 1QBBA 4ZQKB 1JGLL 4XNUH 3CJJA 3MACL 1X6NA 3HI1B 3HUJB 1F8TH 1NCNA 5IVXE 4Z7WF 2WP3T 4BFBD 3KAAA 5FGBA 1QKZH 3PL6B 4TOYL 3EFFB 5F44A 5HYJD 4GAGH 4BKLA 4F7MA 4PRIA 4ZNEA 2VWEC 3MCG1 1T3FA 2ICWA 4QHMA 1CD9B 5DS8B 2DMBA 4ZUSA 1RZ8B 4XCNB 4X4YB 5E2UL 3AVEA 1KXQE 2HWZL 1E4KC 4ELMF 1MCOH 3JTTB 3QXDA 4P2RB 3DUHA 3T4AA 5EU4B 2JJSC 1PY9A 1T0MA 3I6KB 4MNGB 4PS4L 3IFPB 4XPTL 4ZPTB 4OCWH 5DK2A 1MOEA 2D7TL 3VWJD 1EHLL 1TITA 3O3AA 1VFAB 2QADB 2PO6D 2YOCA 4Y19B 4FTVB 4CN1A 3BWAA 3JWOL 2ILLA 1EHAA 2J4WH 4Z7UB 3O6FD 1BQLL 1MCWM 2V5MA 5C0GA 3C2AH 2AVGA 1EJOH 4U1JB 1DBBL 3S37L 4DW2H 3H9SA 1HQ4A 4KJPD 1MFCH 4LAQL 4XAWL 5E0QA 4TN9A 5CJXA 1K6QH 4J4PA 2Z93B 1G9EA 1FL3A 4JN1L 4PJFF 1T2JA 5IQ9A 1DBJH 5BZDA 5HHQA 4IOIA 3VH8B 5JMRA 3JV6A 2BCKA 4NO3A 3GMLB 4OF8A 5DJAA 2E6PA 2DBLH 4DKEL 3QZWG 1LO5B 2R2BB 4IDLA 4ZOAA 3SE9H 3JWDC 2BJMH 2DQHL 3D2UA 3F7QA 4NNXA 2NXZD 5HY9B 3IDYB 4FQQB 3UPRB 5J1AA 3VXNA 4MAUL 2IANE 3NIDE 1OAZH 3U0WL 1G7JA 1WAAE 2F19H 3RNQA 2W0FB 2EC9T 1ULVA 3PGCA 5EBLA 1XR8A 4OQ1A 5HVGB 4QTIL 4S0TD 3TT3L 1ZANL 5DQ9A 4QEGA 5CEZE 4WI6A 4Y5VB 3WS3B 3OJDB 5BVJB 4XCCL 3FOLB 1R24A 4P23C 3SO3C 4NZRL 3CFBB 2BSRB 4OTXL 3Q0HA 3HZKA 1TFHA 4HK3N 3QWRD 3QG6A 1KBGL 2ZUTA 1WV7T 2P7TA 3I75A 4YBQC 2MWCA 3G08A 2MPAL 2Z31B 2ED9A 1KJMA 3ZE1F 3MRIB 1AR2A 3CDGB 1BIIA 4JRYE 3WLBA 1IL1A 4TUJB 3ZDXF 4GW5A 4X6CA 1ADQA 5F9JB 5LG1A 3EAKA 3MRDA 4N9GA 3RL2B 2VXTL 5F9WC 4C56D 2GAZA 3L3KA 4Z77A 2WIMA 4HLZG 1JPST 2UVFA 1D5BB 5BV7H 4OZIA 4WV1B 4NQCB 4HX1B 1KYOJ 1A6TB 1FBIL 3ARBA 2DQEL 2GJZA 3LQAH 3O6LH 4LPVA 1KNOA 5BZWB 1JPFA 4Q9CA 1GIGH 4PJBB 1MI5E 1WIOA 3ZDZE 4YHKL 3O6KL 3WO4C 5L8KB 3P40A 3V7MA 5D71H 1NGQL 2NY1C 3RVXC 4FQJH 4RBPH 2WIIA 5ALBH 4AIOA 5T1KB 2BX5A 5INCB 4P9HH 1T7XA 5HDQH 4PJ5A 35C8L 5TE4H 3PJSB 1ZOXA 4QHLA 4HH9A 1KCVH 3V0WH 3PQYE 4WEBH 1J0YA 1W0WB 1JTPA 3B9KB 3CD4A 4NT6A 4JFFD 4WENB 4K23H 2AJYL 1EK3A 3HI1A 5ID0A 5E94A 5ICYA 4PV9B 3ZDYE 2FL5A 2XV6B 5CFHA 1AY1L 3H9YA 2X42A 5DWUL 2X4RB 3NCCB 4JKWA 3EFFA 3UTSE 1EV2E 3OKKB 3B9AA 4RISH 1RPQA 3ROOB 2V7NB 4HQQL 1J9CT 4UINL 4MXVE 4F57L 5EPMA 3EZJB 3F12B 4NO2A 3RBSA 1NDMA 3MBEC 3IETA 4X4YA 3NCBB 1JVKA 3QDGD 4H5SB 5I17B 4HUUB 3B2VL 5EU4A 2UV3A 1SYSB 1CLZL 4JLRB 5E08H 4LPUA 1KCRH 2MHAA 2YK1L 3JWOC 1OP9A 2PYEE 4WU7B 2VLRD 4N9OB 4JFEA 2OYPA 3O2DL 5IQ7H 3OB8A 4ZPTA 4LDOB 3IYLW 1F3DJ 2X9XA 4TTDD 1WZLA 2K9UA 2VZTA 4Y19A 4RGND 4FTVA 4EEEA 5HPMB 4PRHD 1CICD 3AAZB 1R3LB 4P46C 3U7AA 4U1HA 3VXSE 3VFUA 1MCEA 2M26A 4NQED 1MCWW 1RUKL 1C7TA 5SWZE 5ID1A 2XTJE 5JW3H 3SQBA 2Q8BL 1CFBA 4NNYB 3ULVE 5D7LD 5JUEH 1BAFL 2VQTA 3RUGA 3PG2A 1KIRB 5JW4N 1FNFA 3KPSD 4NM8L 5I19L 3KDMB 4YC2C 4KQ4L 2APWA 3T1FB 4Y1AB 3FFDB 4EVNB 2Q8AH 5MI0C 4YDKH 3E3QE 2AERT 2HVKA 4M48L 3GIVB 1Z9OA 2P8PA 5DD3H 3CCHA 3DV6A 1QOKA 2IAMD 3VH8A 4I0PB 1R5VA 4C55A 1T7VA 5KSAC 5KVGL 4R0LA 1BJ8A 1CGUA 5JXAL 2Y07H 5IESL 5DF0A 1R6VA 1N59B 4NKOB 3WMSA 2YZ8A 5IOPB 5CZVL 3FO1A 2HFGH 5LAXA 3UPRA 4K2UL 4NKMB 1P4LB 4WFED 5EZIH 1FL6B 4GW4B 4NHUB 4Z7WA 3TBTA 1I1CA 1XGTB 4KPHH 2HFEA 1YMMA 1G9ML 4LCCC 4P23D 4GMSL 2KQNA 3P4LA 1M7XA 5LJYH 5IV2B 1YN7A 4FQXB 3WS3A 3IU3B 3UYPA 3LV3A 3SDXF 1S9WA 1C5BH 3FOLA 1WK0A 4LLVA 1JV5B 4ELMA 3MJ7B 3MPCA 2JJTA 5CMAB 2F5BL 1G0YR 1MLBA 2FX9L 1MQKL 2FJGB 3MXWH 5CJ8A 2VDRL 2VIRB 5E00B 1QYGH 4LLDA 3HI6L 3G6JE 5DFTA 4OGYH 3DX6A 3CDGA 1H3WM 1RULL 4TUJA 3S4SG 1DFBL 3ARYA 1EBAA 4P3CH 5F9JA 1KTKE 1IFHH 4GRWF 5K9KB 4YO0B 1XGYL 5HSFA 4LLMB 4ZYKB 2P8MB 1ED3A 1JF6A 3OB0K 3O3EB 4L3EB 3REWA 4ZFGL 5JZ7D 3LQZB 4WV1A 4KHXH 3U2SB 1OW0A 1AJ7H 5L2KA 2NY1D 3RVXD 4WNQA 2FHFA 5IBTH 2H8PA 1SJHA 3QXAB 4JEGB 3BRGC 2Z35B 1A0QL 4UV7L 4IOFD 4E0RA 3FFCA 1MSPA 4NBXB 3S5LA 2DKMA 4KTEH 1ETZB 4PYGA 1K4DB 4PJFA 1EEZB 3ARWA 3U0WH 3TA3C 1XH3A 5FV1L 1ZK9A 4R3SA 1J1PH 5T1KA 1RJCA 3U6RA 4Z7NF 1M6OA 3O3UN 1ZANH 4JM2A 1UZ8B 4JCMA 5INCA 2C7UA 3UTQB 4UT9L 1DQMH 3ILPA 4L8CA 4ODSL 5D7IF 3SY0B 3RWJB 5I30L 3B9KA 3U9PH 5B8CA 3E0GA 1T04A 4NQXB 4F7TA 4IEFB 4PB9L 4EKXA 1OB1B 4ZO9A 5ACMA 4PV9A 1NCDL 1U8PA 4ZFFA 4JZJA 4Y4KC 2NYYC 2RJMA 1YEKH 3S36H 2X4RA 2Z4QA 4UQ2A 1KFAH 2XZQH 1MFDH 5E2WL 1JPGA 1EZVY 1S9YA 3OKKA 4XPFH 3SDYL 3ROOA 2IMNA 3SDXB 1NAKH 4OV6F 2V7NA 4MNQB 3UMTA 3SE3A 2OJEA 1NBYA 2EDQA 1WF5A 1SM3L 3ARUA 4JHAL 4HAGA 5TQ2L 1N0XL 3SKMB 3Q1SH 5I17A 4HKXA 2X1OA 4NQDE 1SYSA 2NX5D 4JLRA 3U7YH 5L8LB 3C5SB 1HZHH 4WU7A 1S7UB 3LKNB 4IRSA 3OGOE 3BP4A 2V5RA 5I73B 5CEYB 1JGEA 5ESQB 4NRYB 1NGQH 2G5RA 4XP5L 1C08B 5D93B 3WN5B 1XIWD 3AAZA 4P4KB 1NBVL 5L9DH 3PGFL 2ZNWA 3E2HC 1A21A 3QIWC 1AH1A 4M9OA 2UWEE 3MNZA 1U58B 1D9KB 3ESVF 4GO6B 5LGJA 3EYOA 1F11B 3HKFA 4TNVF 1RJZB 4PJHF 2BDNH 3ZKQD 2HRPH 2OTPA 3CSPA 3WKMH 1JBJA 1T7YA 2ADFH 4XP9H 4Z8FL 4WGWB 4EVNA 1F4HA 5MHSE 3AS0A 3GIVA 5IEHB 1JGDB 1HN1A 3DRQA 3MRLA 2R2HB 2CDFA 3QUMB 2O61A 4WFHD 4OSUL 4GRLC 1CG9B 3V5HB 4M1CC 1IAIL 3RWIB 4X0KB 3P3YA 2X1PA 5IWLA 4HQQH 2AK4D 5D7IB 1QBLH 4LSRH 1GCFA 1NGWB 4K3HA 5L88H 1G9MC 4H1LB 3TBWB 4QXGH 5GXBB 2AJUL 4FXLA 4QRPD 5CBAB 4QXTA 2IGFH 4ZUTB 3FONA 1N59A 4MCZA 4M7JL 3EBAA 4KI5E 3MROB 3CPLA 4JO4H 3B2VH 2MKLC 4FFZH 4D9QE 3IAPA 1JWSA 3BGFB 3LY6A 4NBZB 1FL6A 4GW4A 2GTWB 1U3HD 1XGTA 4OQTA 4PJGE 2HN7A 3O8XC 1N8ZB 1Y0LA 2GCYB 1SMAA 4G7VL 5LBSH 2VUOA 3V4PL 4J2XA 1UACH 3IU3A 5C0RH 5ANMA 4XMLL 1RK0B 1MRCL 4Q58C 3T65B 1B0GB 2X4QB 3UAJD 4GQPH 3KPRE 4MAYD 5J11C 5EB9A 4HT1H 4KMTH 1OF2B 4L8BB 3KYOB 3IDMB 5E8OB 4J3UA 5A2KH 1LE5B 3BKCH 4Y4HC 4FFWC 5C0IA 3KXFB 4FN0A 4KQ4H 1L0QA 4FQLL 4AEHL 3GNML 5T1LD 3TNMB 1KLUB 4M48H 3H2WA 1KN2L 2DLFL 4J3SA 4YO0A 1HKLL 5AZ2H 5A3IC 5DD5L 3W82A 4L3EA 2A6JA 5AZEH 4K7FB 3KYNA 3WXWH 5F9OL 5C08D 5EG6C 3QDJA 2YA1A 3HPJB 3SHSA 4UTAH 1MEXH 1U9KA 4G6KL 5FYJE 2QSTA 3LN4B 3A6BL 5DMJB 1OSZB 5IBUB 2X9YA 3TCLA 4U1NB 2CQVA 1DLHA 5D7JA 4ZAKB 3SDDB 3X11A 1RSFA 3L3IB 1T1XB 5CZVH 2YRPA 3FB7B 3ZSSA 3F7PC 3K81A 1GOGA 4Y8AA 3D3VA 4M7KH 1EEZA 5JHDE 5D5MF 4CU6A 1UM5H 4NCC1 1O5DT 2ZUXA 5C0BE 4K8RH 1IQDB 3QH3A 3BPOC 5DD0L 5GZOC 5EO9B 2CJUH 2AV7A 3WIFB 5HI5C 3D0LB 3BPCA 3RU8H 3NAAL 5DRXA 1SYVB 5DT1H 1OB1A 5FM5O 3ARGC 5AUMB 5I8CB 3VRIB 3FAXA 5DGRA 3CH8A 1RI8A 2BHZA 4QGYA 5IFAL 4PV8B 1J5OL 2GYSA 2R9HC 1XF1A 2BP3A 1MCIA 3PWVA 4MA8H 2VLJD 43CAA 5SV3A 1BZQK 1FL5B 3LMJL 4OLUL 4OB5L 3GIZL 4PJEE 3SDXA 3HN3A 3QT2A 4RBPK 1H8SA 2XZZA 2HA1A 5TE6L 4PGZA 4M43H 4CDGC 5FYLE 2KZWA 3B9VA 1SY6H 5C8JB 5HGAB 3SQOH 3FKUS 4G6FB 1S7UA 1WIUA 4CVXB 4H26B 1IC5H 4HCRH 1A0QH 3DTXB 4LQ1A 2GQHA 4X7TA 4BFEA 1JIBA 1AD9B 4DGVH 4NRYA 3TWCL 3S34L 3NA4A 2EEDA 3OAZH 4P4KA 2CDEA 5EC1B 4P2RE 2AV1B 1YEEH 1ZVHA 3MV7A 4IRJA 1Q0YH 2IWGA 3FMGH 4MNGE 1PW3A 1OAXH 2JIXB 1S7WB 4X9GA 1MAKA 4R4NC 4QT5A 4XI5C 3QCUH 2AJZA 5EO1B 1U2HA 4GBXB 3C5ZC 4PJAB 2ORBL 2VDOH 3MRJB 5DJZB 1PY4A 4M6ML 4JFQB 4MWFB 2C4XA 4JKMA 1OTUD 4OD1H 3P2TA 3NZ8A 1JGDA 5TDPB 3LVEA 3O3BA 4Z7UE 3PP3H 4K8RD 5J12C 1FFNA 5DZNA 1QSFE 3C5JB 1FRGL 4RQQA 1U0QA 1ADQL 5D7IA 5E2TH 2XWJA 5EZOH 4YHLL 3V7AE 3RTQC 3HS0B 2DQUL 2X89D 3IFNL 3O8XD 2QSCH 1NL0H 3CMOL 3W81A 3HE7D 3B5GA 1NBQA 3ZE0E 4MZ3A 4YHNB 1AQDB 1I8KA 2GTWA 3VG0H 2HRLA 1IAII 1YEDB 2JB6A 4N0YL 4ENED 4PREB 2GCYA 4F3FA 5KG9A 2VN7A 1T03H 5AD0B 2ENYA 5GRXG 2DTSA 3ZYJA 3WFBL 5C71A 1XAUA 1B0GA 4M4PA 5MP6L 1UH2A 5DRNA 1AGBB 5JORA 1D6EA 3RWHB 3U0PA 5CLWA 3KYOA 5FGBC 2EH8L 3PP4L 5E8OA 5I8EB 3QHZL 3HAEH 1LE5A 3DARA 2VLMD 5GRWA 4JFDD 1ZLWH 2JCCB 2FHCA 5JOFA 5KVMC 3KXFA 4NHCL 1E4XH 3WFEL 1MHCB 3ABZA 3FCTA 2E7CA 2HT3C 4OLVL 3G04B 4TSCH 1KLUA 2ZG2A 2FX8L 1YNLL 2NLJA 4RAHA 5CD5C 3LS4L 1IILE 5D1ZD 2P1YA 5DURD 3JZ7A 1IAIH 1MHHB 4RDQG 3DJ9A 4YR6A 4NYLB 1INEL 4WCYH 3VXTB 4Z78B 2WW8A 4PJHA 2DTML 5E9DD 1NEZB 4ZTOH 2YUVA 3CFEA 2EYTB 2QV2A 3SDDA 1PEWA 1DBML 1T1XA 43C9B 1S9KC 2G75B 4O5LH 4UUJB 2DQJH 1PGRB 1U2CA 5CLTA 5TF1L 4LHQB 1L7TL 4A2MA 3QG7L 3LOWA 5DZOA 4TUKH 4MJIB 3WV0A 2W59A 2ICWI 5JHLL 2WBWB 4JPVL 5HVHB 4NQCE 4WWKB 4NJAH 1QRND 3ARGD 1HSAB 3K0WA 1IGML 4LCYA 5EO9A 5I1GL 3CFCL 1WFOA 2HJKB 3LZFH 4ALAH 2F5AH 3F65A 3WIFA 3D0LA 3IFOA 4K3DH 4PJBE 4W81A 2APVA 1J0ZA 3IB4A 3MYJA 3CFDB 1RU9L 5CJXC 3PABB 4K71C 4HS6B 4J4PC 1LO3L 4RWHA 3ULUL 2VR5A 3DUSB 4JFHE 4KJYB 4ONFL 4ZUUB 2LU3A 2WWMD 2B1HH 2CMRL 3L5WB 1FORH 4XRCB 5C0DA 3LKRB 4KKBD 3VWKD 2HLAB 1A4JB 4Z76B 1X6LA 4LVHC 3VFWA 3I02B 2XN9B 2PXYD 3I2CL 1S9XA 4LCWE 4HZLA 3FN3A 5EBGA 2W60B 3LD8B 2RR3A 3MV9A 4UV4L 2FR4B 5BCAA 5IB5B 1Q9LB 1P7HL 4GUPB 1V3LA 1RUAL 1E4WH 4H26A 4CVXA 2E7MA 3MNWB 2FGWH 1OP5H 1TZHB 2VDLL 4PG9A 2Z8WC 3BPNB 2YEZA 4LPCA 2LU7A 1H0DA 5D1QA 4R4ND 3W0WD 1BGXL 1FCGA 1PX4A 3BE1L 2XPGB 5GZNC 3K1KC 3IF1A 2D03L 5DD0H 1JHLL 2RFXA 4FRWA 1XF4A 4NFDA 1CFNB 1U91A 1IAOB 2QHRL 1D5MB 4MVBD 2R69L 4KZDH 4XMPH 4I8DA 2E7LA 3O11A 5B4MC 2MKWA 5C07D 1S7RA 5DJZA 4X5LA 5FECB 3WDIA 3H6JA 5D5MA 3NFNA 3TM6A 5TDPA 4Q2ZA 1CT8B 4AIZB 1AI1H 1QPXA 3LMJH 3ME0A 4NKDB 1J10A 3VGAB 5TFSH 2MQ0A 3ARBC 3EDFA 1ZHNA 3QJHB 5BJTB 4N1CA 5F1NB 2X4PB 5HHNB 1U8JB 3HS0A 1CDIA 2VDKH 1IC4L 4B7IA 4XX1E 1WWAX 4JY5L 2Y06H 1O7SA 3RGVB 2V9TA 4JZNA 5GGTH 3WEXA 3V6BR 3OXSB 5CUSL 3DBXA 4D8PB 4TNWK 1P1ZB 1YEDA 2CDGB 3TH2T 3BD4A 1CD8A 5EU3A 2AGJH 2L7UA 5AD0A 2A6IB 5CCKH 4KJQD 2DJUA 3BKML 4RMVA 2BVEA 4Z6AT 4FMFA 4HDIB 1G7LA 5FEBA 4JDZA 1A5FL 4LSVH 3HE6B 1P7QD 32C2B 3GSUA 4P5TB 4UNVA 4HK0B 1HHJB 4O9HH 5I8EA 2NZ9C 4CVZB 4KK9C 3RY6A 3QQ9C 5HYSA 2WM0A 3U0TB 5FHAL 3BAEH 4NJ9H 2DL9A 3MOAH 1MHCA 1HIML 3IDJA 2Q7YA 4V1DA 3G04A 4OV5A 3QWQB 4NN6C 3FOMB 2R0ZL 2H32B 3T2PA 1GL4B 1HH6A 4AM0B 3GO1L 5JNYB 1LD9B 5D1XD 2DYPD 3L6FB 1UWEH 1N5AB 4PTTB 4NYLA 4S11A 5C2UB 2R56H 3EYVA 4J6RL 4GSDH 4Z78A 5I76A 3UYRL 2UZIL 1NEZA 4NRXA 3OAYH 1T66C 4WU5B 1U8IB 3DVGB 3BN9C 2G75A 4TYUA 3VGHA 3TBVA 1Q9WA 1FYHB 1B90A 2W0KA 5TE7L 3OPZH 3QPXL 3MUGB 3C09C 1I3VA 3H9SD 2YD4A 3CK0L 4MJIA 1J11A 1NMCB 1HCFX 3NCJL 3ULUC 1K8IA 1A3RH 1NFDF 1HSAA 4OZFG 5FB8B 2R23A 2KPNA 2I26N 2X7LA 3QIBA 1Y18B 4WJ5A 4NZTL 1XR9B 3RVVD 5C0FA 3PABA 4HS6A 3GMNB 3QIUD 2DQFB 3TIEA 5DJ8B 3EUUA 1RMFH 3PP4H 2GFBB 5E6ID 4APQA 3GBNH 4XVTH 4RWYH 5C0AE 1E0OB 2D7OA 5BS0E 2B7DT 5GGVL 2HLAA 4Z76A 2J5LB 3S88H 4R0LC 1I7UA 5C0JB 1RUQL 4OUUB 4UDUA 1MWAB 2XN9A 4L9LB 4XPGH 4AEFA 1W72B 3ROLB 1CD1B 1HXYB 1DE4A 4RFOL 1MAML 1F6FB 1Q9LA 3TFKD 4G9FD 1M4KA 4X5XB 3MNWA 4RNRB 2OTWB 1G9NH 5JLZA 3MYZA 4NSKB 4WEMB 3V4VH 4MNQE 3NABL 2VC2L 3P77B 4Z7QE 4XP1H 3MV8D 4OQTL 4OZ4B 3DXAA 2JJTC 3T0WA 4MYWB 3F7RA 5T1DH 4EQ2A 3H42L 2XPGA 2JELL 1CIUA 3QFJB 1OARL 4RFNC 1YC7A 3NCYP 1AO7E 4YHYC 4UZGA 2D0FA 5IGXH 4CMMA 1D5MA 1JZ4A 4EUPG 2CUIA 3EOTL 3QO1A 5CP3H 4P2OD 2EYSB 1MUJB 3UTOA 2P5EB 1UENA 3TVMD 5GS0L 1YDPB 1CZ8L 3M07A 3QISA 3NPSC 1EMTL 1WJ3A 2XACC 2CMRH 2GUOB 1FNHA 3LEVL 3O81A 2BK8A 1CT8A 3QUYB 3MCLL 4NWTL 4GS7B 1T7ZA 3BYYA 4LLQB 5KVEH 3OG4B 3HRZB 4NKDA 4R2GB 4WV1C 3EO9H 5LWYH 1NFDB 1OW0C 4FP8L 3GSRA 1QBAA 3NVQA 3QJHA 3D85D 5BJTA 5F1NA 2FX7H 1CDHA 1INDH 4Q74A 4ODWA 4EDXA 1BQHG 1VADA 1EEUA 1FNSL 4X9HA 4Z0BH 4X98B 3MUY1 1OAUL 1KJVB 3W9EA 4BUGA 1U8OB 4Z7NE 4HBQA 2VXSH 1K2DB 1BZ7B 3MX0A 5DQDL 4D8PA 3RZWA 1UXSA 1Q9OB 1WISA 4JM2C 5MENB 4AH2A 2L4OA 4IHOA 4P59H 3DVIA 4JDVB 5C6WH 4EI6B 4HPYL 5H2BA 4GAJL 4NC1E 2A6IA 2IG2L 4KQ3H 3B9KC 1WIPA 1BP3B 5H35B 4ZXBB 5B8CC 5HI4D 1GZPB 3MODL 4LPYA 4WW1B 1AXIB 5A40E 3HE6A 3PP3K 4JZJC 5KJRH 1DVFB 3T3PF 4JPKH 4L4VB 5CSZA 4CU7A 3HNTH 4P9ML 1HHJA 5K59F 1XGRA 2QQLL 4ORGA 5TDNB 1LE9A 4U1GC 3O3DB 4CVZA 2AQ2A 5GGSY 2R4RL 1IGCL 2J2ZA 1ROWA 3H7BA 4M00A 3W9DB 2FBJL 4LKCA 3UBXI 2APFA 2AEQL 1LO4H 3QXUA 3RVUC 3SE3C 3FOMA 1BVKA 3MFGB 3VFOA 3IDIA 4JFED 4S1SH 5FO9B 5C92A 5JNYA 1QSEA 2A38A 1MPAL 4ACPA 2E8YA 4HHAB 1F4YH 1BD2B 2A1WH 4FQHB 4N8PA 3FT3B 3BN9D 1IAMA 4IRSC 2X4TB 2CRYA 3ULSB 1MHPL 1R3HA 3TYGH 3THML 2A74B 1Q38A 2F58H 3PWJA 3QXVA 5TQ0L 4WU5A 1AHWA 2BFVH 4PJ8B 4O2EA 4HGWB 5EO0A 2C26A 1A6AA 1ZLWK 1Q94B 5FKPB 4U6XA 2I5YL 4LSQL 3NIFF 1YZZA 5CGMA 3CUPB 4KK6C 5FB8A 1MCRA 3BKMH 5DSCA 1CWVA 5T3XH 3D25B 4W4OA 3KPQA 1Y18A 1PJ9A 3BD3A 3L7FB 5JXEA 4PLKC 4F8QA 1SBSL 5CS7A 2DQFA 3HNSH 4PJDE 2XQBL 4PJ9A 3BPLC 1F6LL 1MIEH 1X5LA 3E6HB 2R0WH 1B2WH 4OFYA 1JWUB 5JIIA 4RFEA 1X5JA 5I18L 3F6LA 1HEZA 3PWLA 2W9LA 1HIMH 4I18B 1FHGA 5IWLC 3MA9L 4RZCB 1TZIA 1VDGA 1JZ6A 5C0JA 4XBPB 4WUKH 5DHVH 1B4JH 1MREL 3EYSH 5LQBL 2CXKA 1E6OH 2BVYA 1IGTA 4HUMB 4BA8A 5DRWB 5E5MA 3ROLA 3BIAX 1JWMA 5C0BA 4ODTH 4QRTA 1YMHA 4LGRB 2UZIH 3RIAK 5IR1A 2JKXA 3L3HB 1OGTA 3G5ZB 4NP4H 5C09B 5HYQA 2ZCKL 4PJIB 1RIVH 4OLWL 4X9BA 1AGDB 4X6DB 4NSKA 2EE3A 1TNNA 1JZ3A 4OLZL 3B8YA 4MNHB 3NA9H 1RQ5A 1P4IL 2IF7A 1V3MA 4YFLI 3Q2CA 2LFGA 3BT2H 2ARJB 4RRPA 5GRVL 4ZTPL 1W0YT 5GS0C 1MFBH 4IDJH 1OTTD 2ZKHH 5IHBA 1LGVA 2ZPKH 1CU4L 2Z0BA 4OKVB 3HZMA 3I9GH 2IH1B 2YD2A 2P8LA 2EYSA 1FIEA 4QO1A 1YDPA 2HKHH 5L2KD 3X12B 3KLSA 4O4YH 1UGNA 3H9ZA 4G8GD 3P9MA 4XGZB 5D96B 5JOEA 4K9EL 3HA0A 1G7PA 1OP5K 3FFCD 3HC3L 3VXRA 1NFDA 2G5BB 4OZHF 3NZHL 4YE4L 2IPKB 4NKIH 3T0XA 3BFOA 5D7JC 2HFTA 5T3XD 3T8XB 2Q7NA 4QOKD 1IKNA 5GS1A 3WLWC 4PJAE 4JM2D 1MLCA 1NPUA 2XZCH 3KYMA 5JDSB 2X1QA 4X6EB 1U8OA 5I1HH 4JO1H 3P4OA 4F7CB 1T20A 1OT1A 2VQ1B 4QRQB 2VSCA 5BMFL 5EDXA 1N6VA 3GMRA 5EC2A 2W1NA 5FOBA 1QACA 5J13C 1MFEH 4X80H 3SE4C 1GZPA 3H42H 2IQAB 4HUKB 1LEGA 4WW1A 4M5YL 5AEAA 3QQ4B 1GGIH 5IB1A 4MQ7B 3RPIB 4L4VA 2XYCA 3TJEL 3UCRA 4M8QB 5BO1H 5L6YL 1F2XK 3T09A 1NCWH 1F4XL 4BZ2H 5BXFB 1IC7L 3W9DA 2HKFH 1YY8A 1CZ8H 4GW1B 2QQQA 2DQGH 1WFUA 3LEYL 3OKOB 4JRXA 1A7BA 2J8UF 4Y2DD 2Q86A 2ICES 1A47A 4K3JL 1CGSH 1ZTXL 3OR7B 4HHAA 5KW9H 2RGSA 4HMDA 2DB8A 3FT3A 5DK0A 4F7EB 2VXUL 4N0UB 2X4TA 3G6DH 3DSFH 2JCCE 3KPTA 3C9NB 2ED7A 3T0VA 3GJFB 5EA0H 1QLRB 2H3NA 3BW9B 1HINL 3MUZ1 3ARSA 5CWSB 2AABH 3DO7B 4JQIH 2YXMA 5JO5B 3OMZA 1C12A 2HP4A 1CL7I 4PJ8A 4M02A 4NM4L 1A7OL 1OAKH 4P4KC 4HGWA 4XNXL 5C0CB 5C6TL 1I1AB 1OAQL 1UYWH 5IFJB 3V6FA 1FO0B 4IRJC 4P2QD 3RWCB 4OZHB 1S7QB 3GB7A 1EAJA 3M45A 2VZUA 3UX9B 1UJ3B 3H3PL 4JE4B 3L7FA 4TVPL 4XC1H 1FPTH 3VFTB 4I9WD 5F6IB 2BZDA 2Z91A 3LKOA 3EYFB 1WFNA 3CVHH 3OAYK 3ESUF 3HTLX 4OIIL 5J1TC 3NCYS 1R3IH 1F90L 3O4LB 2VITA 3K2UH 4L4JA 4LARL 4J8RA 5HHXH 3F62A 1CL7H 2EDTA 4CW1A 1A3LL 3UTTE 3WCYA 1OWRM 2NXYC 2A9ML 4DUXA 4U49A 2A6KB 5KSUA 4DQOH 2ZUUA 2W0LA 3SOBL 3MLYH 4K3GA 3T0EB 2ESVB 2W65B 2MQCA 4E41B 1YN6B 3QQ3B 5C09A 1TNMA 4PJCA 2C3XA 4YDVB 3MNVB 2IFGA 1BPVA 2BY2A 1KEML 3RVTD 5JTWA 3RZCD 3JTSA 4JG1H 5F1IB 3H3KA 3IGAA 2WUBL 2ZOLB 4LHUG 1XF5B 5GRJL 2DWEB 2MCPH 4E5XA 1DL7H 3PHQB 4DKFL 1G7HB 4FA8A 2COQA 12E8L 1KJ2H 3MBXL 3KYKL 4DN4H 3QCTH 4JFXB 1SEBB 3EDKA 3S35H 4LVNC 3FB6B 4QRRB 3IDXH 4K9EC 5DJYB 2GJ6D 4HUXA 2KDGA 4HIIB 3FQWB 3QDJD 2PETA 4LLWB 5F7EL 3VFVB 4QTHA 2IPTL 5CJOL 3J8F7 3LH2L 3I6GA 2BVPB 1IM3A 4KVCL 3SPVB 3FO0H 4NRZA 4XGZA 3WLWD 3WFCH 3L1OL 1MFAL 4JO3L 4DTGL 4G9DB 4EBQH 1DR9A 1F3JB 2Y36L 2I9TB 2F15A 4I48B 3D3VD 2IPKA 2EDFA 2EZ0C 4PR5B 2GK0B 5DC4B 2VJXA 3SDDC 4L1HA 3N1GC 3RKDD 1IKFH 1F4WL 1VSCA 5GS3A 5CILH 3FRUB 5JDSA 3SDAB 1BFOA 4YXLL 5EFIB 2AQ3A 1PKQB 4LPXA 4OF5A 2V2TB 4AEIL 4Z7VF 3TZVD 4DVRH 1AKJB 3RAJL 3C6LB 5DD1L 2EKSA 3I84A 5D2NA 1VB9A 2I60L 4DWHA 4HBCH 3TO2A 3ARDA 5DDHB 4PJXF 2X4OB 1I8MB 1RZGB 3QI9A 5F7WC 2FB4L 2HTLC 2IQAA 2B2XH 3STZB 4RAVB 1YEJL 4FQCH 3RPIA 3SKJL 3B9EA 4YHZL 4YBLC 1KN4L 3BKYH 1A1NB 3V9FA 1R0AH 2N7AA 5K9JL 3VGFA 3ZTJH 4XPAL 4U4BA 2RB8A 2HJLA 3TNNB 3GHEH 4GW1A 1LO0H 3OKOA 4U1LA 4G8FB 1E6JL 5E2VL 3Q6GH 3WE6B 2CK2A 2GIYA 1OPGL 1QHPA 1QA9B 3BP6A 3HC3H 3ZKMD 4JG0H 1AC6A 2D7MA 2PR4L 1ZAGA 4HGMA 5JR1H 1DEEB 3NIGF 4AL8L 3SJVB 3X14B 4CBPA 5HYIA 5FYKU 1OY3B 1K85A 5E8EA 1NAMB 5CEZH 3D39A 1MF2H 2VDPL 5CWSA 3WFZA 1IM9A 5D1QC 1CQKA 5JO5A 3RWDB 1IEBA 5F7DA 2F53B 4HC1A 5C0CA 1I1AA 2XFXA 3BUYB 4PGEB 1WWWX 3JV4B 1CIDA 1HYSC 3P30L 3CFIC 5HJ3B 1S7QA 3Q5TA 3OKLA 4U0QB 4IBLT 4G8IA 1FDLH 2BNRE 1G1YA 2E7LC 5F97E 5GJTH 1SJEB 5EUOF 1U42A 3EJJX 1J8KA 2ZP0T 2NY0C 3EYFA 3AFLA 1ZLUH 4JGJA 1DUZB 3CZFA 6FABH 1A7PH 1FV1B 1IC7H 3CXHK 2DKSA 3IJYB 2CKBH 2NXYD 4DGIH 2DMKA 4LSSL 2AEWA 1GGYA 3MJ8B 4PJXB 4OGAC 1YJDH 1TPXC 1HOCB 1FN4A 4EIGB 1KULA 2EXYC 2EKJA 5DUMH 3V6ZB 2GSIB 4CMHB 5AAMA 1FGVL 5DTFB 3MRNB 4WO4D 3VD9A 2VH5H 3MLZH 4DGYH 1BM3L 5I2IB 3WNMA 5F8QC 4E41A 3VWJB 1HINH 1F02I 2O5XL 4FMKA 5ACZA 2CR3A 4YDVA 5HHOA 2CO7B 4NM4H 2J8UA 3KPMB 4POUB 4LFHD 4KJWC 4HUWB 4LF3B 2YPKB 5C6TH 2XY2A 4FQ2H 5DJ6B 4NUGL 2DWEA 5C0AA 3BZEB 2EO1A 3PHQA 4ZG1A 4OFPA 3O6FB 1LNUA 4HXAL 5J0BA 3QEQE 3RY6C 3PNWA 3H3PH 2BVUA 1NQBA 5DK3A 3FB6A 4BSWA 3MRKA 1JK8B 1X5ZA 5DVMA 2C4FU 5EIQA 4HIIA 3FQWA 5JIHA 4X83A