4L9LA

Crystal structure of a human valpha7.2/vbeta13.2 mait tcr in complex with bovine mr1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
198
structure length
196
Chain Sequence
NIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAPLDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords Beta-2-microglobulin, MHC class I-related protein
total genus 35
structure length 196
sequence length 198
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lA02
1QFWI 4Y89A 5E99H 1L7TL 1U8NB 2PW2A 1E0OB 1BREA 4RMTA 1HYSD 2YZ1A 1V3JA 5IMMA 3MR9A 5DK0B 1FNAA 5HYJA 1MCLA 5E2TH 2AJSL 1UFUA 4DEPB 1NUFA 1LO2L 1SJEA 4LKCB 4KKAD 1ZHBA 4GAJH 3S5LA 4Y1AD 3HCVB 5C0JA 4YBLB 1JYVA 4LCIH 4ZFGL 1P7QB 5I1DA 1LK2A 4LLUA 4Y16A 5IHBA 3CH8A 1SEQL 1KN4L 4OUUB 1G6RA 3DX8B 1U0QA 5MERA 1GAFH 1SMOA 2X4NA 4U1HB 5E4EC 4FQCL 1KIPB 1U8OA 4JQXA 2HG5A 4MJIA 1NGPL 4Z0XA 2AXGB 5F3HA 5EO0A 1KCUL 1KNOA 3LD8B 2V5MA 5DTFB 5C07D 3ZYIA 1L4IA 3FFCB 3X3GH 3DGGA 2DYPB 3E6FA 4P5MA 1XF3B 2PXYD 1NCAH 2XZCH 1X4XA 2X4QA 3X11B 5TQ0L 4NM4L 3VI4E 5D6DC 4LP5A 1E4XI 3QIWC 4ZS6C 2EDEA 3SDDD 3KPOB 1Y18A 5TDOA 1DQDH 4MJ6B 3GI9H 3LPFA 3TA3B 4J8RA 2R2EA 3HCVA 1HHHB 3LB6C 3HI1B 5K9QI 3WNMA 2IANA 5JQHC 1FZKB 2BJML 3TBYB 1UEMA 3B9KC 5CGMA 3RRQA 2HJLA 2F54E 4I0KA 2GIYA 1YN7B 4Q0XH 2HVJB 3PL6C 1OAZL 3HE6B 3B9KB 3D3VB 1KYOJ 4N68A 3TZVA 4Q6YA 1R24A 3WUWA 2NQCA 3A67L 1E28B 2ITDA 3IDXH 4ZOCA 2IALB 4U6YB 3ZSSA 3BZ4A 4QHUB 4ETQA 4K07A 4MXWL 5I8KL 1J5OL 4QTHA 1MVUB 1JF5A 4GMSL 3UBXA 5JXEC 3WO3B 2GSIA 3BYYA 4NIKB 4L4VB 1ODAA 1XT5A 4MA1C 3WSQL 5IMKB 5ALBL 1KB5A 3VU2A 5EU6D 3IDUA 1JRHH 4R9HA 3CIQA 3IDGB 2ENYA 3IFOB 1U36A 5HYQB 4XVUD 2CRYA 3Q3GA 1Y18B 3ILQD 1GRWA 4HEME 5HGHB 5BQ7B 2A6DA 2A83A 1D5IH 4LFHD 5KVMC 1XIWC 2AXFB 2X2YA 3VCLA 4LP4A 4LKXB 1WAAE 2XWJA 1MREH 4EUPH 5I2IA 5F6IC 5ISZB 4H88L 3DVGA 3R1GH 4U33A 2YKLL 4Y5XA 1HHKB 4O02L 4HGWA 4QTIH 4TSCL 2MQ3A 4NT6A 1R3HB 4HJ0D 3CFEA 4R8WH 2Q3ZA 3HMWL 4OM1L 4IRJA 4N0YH 4U31A 2YPVL 1X5YA 4U1SA 2NY5C 2W1NA 2HFFB 1PKQB 2VE6A 1RV6X 3FOLB 4LVNC 4C59B 2D9CA 1AQKL 3I6KB 4X6DF 4RZCB 2EEAA 1T7ZA 2UUDH 1FPTH 3VFUA 4M62H 2NXZD 4O58H 4KXZH 4TVSa 1JNJA 5MENA 4HG4J 1P4LA 1I85C 3P11H 1QLRA 5FUOL 1WF5A 3GNMH 4JN1H 3L7EB 3HI5H 3RWFB 2AXFA 3EFDH 5FYJD 1L6XA 1D5BA 3HG1D 2F58H 4JCMA 4DK3A 1A7NH 1I1AB 2DQIL 4MDIB 5HPMA 3MV7D 5JO5B 4J6RH 5EH1A 1JNLH 3JV5A 3Q3GB 4S1RL 2HKFH 3QG7H 3CFBA 4M43H 3S37L 1EO5A 4JREC 5T1KD 1EFXD 2BVPB 1O5DT 5KSAD 3KDMB 3RUGB 4E41A 5MHSE 1BOYA 3ZSTA 4HIHB 4G42A 3WNKA 4YFEA 2P8PA 5SWQA 4M4PA 3VE0B 4Z78B 3OB0H 3N85H 3CD4A 1X4YA 2WP3O 2R2HB 2BOCA 1KTLB 3T0EC 2UWEF 5KOVC 3ULVF 5IOPB 3B6SA 3T04D 1FRGH 5BRZD 2VXUL 3BKMH 2AEQH 3BAEL 4X4MA 3KLHC 1LNUA 4Y5VC 5D7LB 3MV8D 1MFDH 1XGTB 3MUHL 3UXFA 3T0DA 1VENA 3EGSA 2GJ6A 1VACA 5B4MD 2QQNL 4W6WB 2H9GB 1EDQA 2A74B 4AMKH 3K2MC 4M93B 4L4TE 4E0RA 3SPVA 3LHPH 2DBLH 5DMGD 1C08B 3SKOB 4LSQL 4KDVA 1Z5LA 1ZT4A 1R5VA 2ZG3A 1FAIL 2FD6L 3PNWB 4HH9A 4QXUH 4X5WB 3DURB 3HE7B 5HD8C 1CIUA 1HSAB 5HI5C 5HGDA 3RVVC 1RIHH 3WHE0 4Z7VA 3LZFL 4NZRL 2H1PL 1ED3A 1J05A 2DQEH 1WZMA 4HUUA 5TDOB 3V52L 2VL5A 3MLPA 1M71B 4P3WA 2DM4A 2K3TA 35C8H 3D1MC 2VNCA 1HH6A 4PREA 3GJFA 1IKNA 1BAFH 3LKPA 1MLCB 5ETUB 1HZHH 4AL8H 4U0RB 3DV6A 2B8OT 5L7XL 5C0RL 2CRMA 5LBSH 5L8LB 3V2AR 1NBYB 5IEKA 1WFOA 1CCZA 1H15A 4M6NH 3LDBC 3UC0H 3ARSA 1H3XA 2ICWA 2XWBA 4UMGA 1GVIA 3N9GL 4FMFA 4QHNA 4U6HB 4BM7A 2CSPA 2JIXD 5BVPH 2CLVA 5F96L 3NABL 1PYWA 2OI9B 3PNWA 4X5WA 5DRNB 3D69B 1E6OL 2C3WA 1CFNB 2V9TA 3CMOL 1C08A 4OF7A 3FONB 3MRCA 3BUYA 3M07A 1QEWB 1JL8A 2Z91B 3PL6B 3S36X 3C6LD 4Y88A 4XCFL 2YBRB 4UT7L 5I71B 8FABA 1NDMB 3AREA 4G6FD 2A73B 4XPGL 2F54B 3GUTB 3AXLB 3VRLF 1YYML 2PTTB 5DLMH 4WUUD 3TCXA 4L4TB 1WBZA 3IDNB 4YXHH 1G7HB 1N5AA 1CD1A 4EIGB 5IGXH 3VGGA 3IVKA 4HDIA 2CKBH 2MKLC 3NFSH 4GFTB 1FG9C 4JAMA 5GGTA 4LCCA 3QCVH 1M6OB 3CXHJ 1J1OH 3G6JF 2OL3A 4EZMA 2XKNB 3T1FA 3LKQB 2P4AB 5IUSA 4S2SA 5IESL 2ERJB 4UU9B 4GXVL 5KAQF 3DMMB 1A7BA 1Q94B 3O41B 4KVCL 2PCPB 5DVKA 3MLZL 1A5FH 3CCHB 4ALAH 4YHPA 1T2JA 2A9MH 1EVTC 3FQXA 4HAFA 3OKYA 3T0ED 5J7CC 2VITA 3S4SB 1VPOH 4XBPA 1NLBH 3MRGA 4NUJB 1H3PL 4CADB 4ZAKD 5DURB 4NPYB 3T4YB 1P4LB 2G60H 2NXYB 3L9RB 4AT6B 3UX9B 4YDVB 4HLJA 1QBML 1W0VA 4XP1H 2IWGA 2X4NB 1RJZA 1T22B 3CLEL 4KZEL 3DX8A 3U30C 2CR3A 5IW6A 1CICB 3T4YA 1YEDB 3BKYH 4CVXA 3BZEA 3TIEA 1LE5B 4UINH 5DUPH 5IB3B 5KAQG 2Y6SC 3B43A 2NY6C 2UVEA 1S7XB 4MAYD 1BF8A 4GAGL 3G6AA 1KFAL 2G5BA 3UROR 1ETZA 2WW8A 1MWAL 4MLIA 4R97B 3AMKA 3O9WC 1MNUH 3EKCA 1AR1C 1JGDA 5BRZB 1IQDA 3PQYB 4N9GB 5F3BB 4JHWL 3D39D 3PGCB 4G8FA 1TZHA 5MP6L 2EDFA 3NIGE 1MELA 3MJ8B 3OKDB 4KRPC 3MXVH 1ZVYA 3PG2A 3N1PC 5ESVB 3S9DB 4WJ5B 4YFLI 2CDGB 3ULSA 3MNVB 4ODTH 4PJ9C 5F88A 1BWMA 3D85A 2APWA 3GNML 3MJ7B 1Q9KB 1FZOB 4HC1A 4JG0L 1RIVL 3HI5L 5DJCB 5D7IF 1JZ7A 4XPAH 3NOIA 4H20H 4OD3L 3MV9A 3GIVB 2FRGP 4FXKA 1T5WA 2Y72A 1N64L 1ZWIB 5H94B 5L8JB 4X0KB 1QA9A 1RULH 3UP1A 4PLKC 4Q97A 1RUAL 2YD4A 4M48H 1GZPA 5FKAA 5I0DA 2V9RA 2VH5L 4HPYL 4MHHI 4F7CB 1TETL 1GHFL 4LAQL 1W72H 4DKDC 4W6XB 2R0LH 3H42H 5F7EH 4M1DH 4L9LA 2DOCA 4K3JH 5HHMB 1TIUA 2Y5TA 3F7YB 3SKMB 4MAUH 1HYRC 1LO5A 1X5ZA 4BQ8A 1BWWA 1N2RB 3W5MA 1CI5A 2D4DA 4FG6C 4JRXA 4J3WA 3EFFB 4I0PB 5BO1H 4RMWA 3QXTA 5HVHC 1TVHA 1Q8MA 1OPGH 3MRRA 2UZYB 5CEZE 3GB7B 2P24B 2C3GA 2YN3A 5EBLB 3VGBA 2AABL 5I6XB 1IAKA 5SWSE 3EJZC 3PQYE 4PR5A 2VQUA 4QCIA 4XCEA 4BELD 2AQ3A 3KXFB 3ARXA 2VWEE 1YEJL 2X1PA 3DSFH 3WFBL 2HJFA 5D8JL 3MACL 3C8KA 3LKRA 1BVLA 4LSVH 3C09B 4KAQL 3HAEB 4BFBD 3VFTA 2AXGA 1YY8B 4P2RA 4ZNEA 3GSNL 1EFXB 3OWEA 1CL7L 3P3YA 5AWNL 2OK0L 5T1LD 3NFPB 2R56H 4A6YL 5GS1A 4WTZA 3QAZB 4Y16B 5C0RH 4P46A 1S7RB 1XMWA 4B7IA 3MRPB 3R4DA 5IB1B 3S3JA 3S3PA 4LBEB 4ZPTA 5HY9A 5HVWA 2C7UB 5FYKL 4NQEB 4YHOL 5EUKB 1DVFD 5I1CH 4M5ZH 2ZWLT 5KS9F 1QEWA 5TGBB 1GL4B 2P8PB 3C08L 1CXHA 3PHSA 1IBGL 5I0ZA 4OCWH 3TF7C 2PW2B 4IOFD 3NA9H 4WW2C 1CLCA 5ADOH 1TLKA 2H45A 3LKQA 1JPFA 3NABH 2HFGL 3FAWA 2ZOLB 3SCMB 5JXEA 5IJVB 3HZYB 2V6HA 1J1XL 2OZ4A 4YE4L 1IQWL 3KYOB 4GW4A 4NO3A 3T2NL 2L0DA 1SBSL 4FZ8L 1K5NA 5DJYB 2FO4B 2CJUH 5C0EA 1HHJA 5I1LB 4YGAB 1LHZA 2OJZH 1KEML 2ZOLA 4J3VA 5TPWH 5E95B 2FSEA 2VDQL 2EKSB 4S0TD 4LVOC 4WFFE 3MC0A 4G3YL 5CEZH 3PHQA 5D2NC 4ESKA 5FO7B 3B2VL 3U7YL 1B0RB 5F7LB 1QSFD 4OLWL 3PWLA 3QZWB 4KK5C 1KTDA 4YXHL 3SGDH 5H35A 4YGVB 2JJVA 4WFHD 4PJEA 3UTSB 1DP0A 1RK1A 3UTPD 1FNFA 2P48B 2R9HC 5GS0L 1CFTA 1CR9L 3C2SA 2X4PA 1A4KB 4YHYC 3G5VB 4ZG1A 1L0XA 5FGBC 5I1IL 1FNSH 1RJYB 3V9FA 4XCCH 4KVCH 4TOYL 3VD9A 4HH9B 1KCSH 1NJ9B 3O81A 1R3HA 4OAWA 4OLYH 2G75A 1SQ2N 3EHBD 3PV6B 2JIXB 3DSNA 1GOGA 3HAEA 4B41A 4LOUD 5DURD 5FCUH 1MY5A 5F7WC 4JVUA 3QHFL 2AEWA 3K8LA 3V8CA 3ULUD 4FFWC 2YD1A 5DFWH 5JOPD 4QRPA 3HC0A 2Z92A 3D87B 3VXQA 4V2CB 3RX5A 4V2BA 4RMSA 2C3VA 3M17A 1YPZF 4P4KC 3VGAB 1LE9A 5FYJH 1QSED 2VLJD 1QA9B 1YJDC 2C4FU 5GJSH 3GMPB 4JFHD 5A3ID 1TQCC 4QXTA 3V6OA 1J05B 5F8RC 3OZ9H 4HGMA 4JJHA 4QT5B 4LQFH 5T3ZL 4UINL 4PJHB 2WUCL 2NZ9D 1T83C 5HDBF 3BDYL 3MODH 2P5EB 5B8CC 2DM7A 4YPGB 4G8GA 2CPCA 4NJAH 1DE4B 4G9FB 3ULVL 3RTQB 2A6KB 1WBYA 3SGJA 5I17B 2LABA 1EGJA 4HBCL 1OWRM 2PTTA 1MWAH 3ARFA 3MV9E 3LH2H 1KEGL 5FA3A 2FX9L 3MCG1 1T7YA 1QQDA 2E6PA 4DTGL 4PY8I 4AEEA 4J3SA 2DBJA 2ZOKA 4CNIA 3IDIA 1V7ML 1BHGA 3ARBB 1KTLA 4LCIL 1BLNA 1SM3L 2B2XL 5DJZA 2DQGH 4OKVB 3OXRA 4HUWA 1MHHB 1WUNT 3VXOA 3OR7A 4APQD 1S7VB 5IVNA 4WCYL 2VQTA 1ACYH 1K6QL 1J88A 2E27L 1A3LL 4LF3A 4U3XA 5EORL 1EFQA 1TQBC 4OLZL 4TVPH 5IEHA 3X3FL 2QADC 1MEXH 3VFPA 4ACPA 1EO8H 2IPTL 2A6IB 5EBWA 3SKJH 5DRXA 4CVZA 3C60D 3JTTA 2KDGA 3ALPA 2V5RA 3O2DH 4YHYB 1I7UA 2ICWJ 3AREC 4HIIA 4Z7OE 5FYJE 1MJUH 5DWUL 2BK8A 4M6AA 4I4WA 4AK1A 3MRGB 4LLVB 1RAMA 5HDLA 2D7QA 3NN8A 4M61A 5JW4M 4EIZC 2R4SL 3FQXB 4N5ED 5IB5A 1S7XA 3ARGB 4FXGA 5CJBA 1L6ZA 5JW3H 4H26B 2HMID 3EO0A 3KNBB 4YK4B 5CZVH 4X99B 5INDA 3U0WL 5I19H 3MRFB 2Z93A 5J3HC 1UKQA 1GZQB 4PJAA 4JO2H 1ZT4B 2Z8VC 5T5NG 4JFPA 4NQSA 4HC1L 4PJGF 3QUXB 1OPGL 3QUZB 1DANT 2AEPL 3V4PH 5KS9E 3GJFH 2VLLA 3KS0H 15C8H 1CFQA 3L3JB 2APVA 3FQWB 6CGTA 3QDJD 3SDXF 1CDUA 2GJJA 4X8JB 4RIRB 1HDMA 5TDNB 4R0LB 3OHXB 4N0FB 3S35L 1QQDB 4HMDA 1I1RA 2JK5A 1NCCH 5DUMH 5DHVB 4WHCA 5I8OL 3GBNH 3SDCA 2LU4A 3ARDA 3SJVB 4F58L 3PWUB 4D2NA 2ICEB 2FH6A 4CN1A 5IMOA 3SE8L 1OM3L 3IT8D 3JWOL 4AQOA 3T09A 3OKLB 4QHNB 4U6HA 3IDMA 4YWGL 4P9HC 3KVQA 5BXFB 1BF2A 5I30L 1CD1B 3L3HB 4UTAL 4LCCC 4TUKH 3EDKA 4RWHA 1L9MA 1T4KB 3MLYL 1IBGH 2F5BL 3LS4H 4JO4L 1IT9L 4NQCB 3NA9L 4UIMA 1FFRA 5D72H 5HHVL 3ZTJH 8CGTA 1KBGL 3TT3H 1YN6A 2X4QB 3ULUL 1FNGA 5D1QC 5AAMA 4LLAA 5KVGL 3GJFB 4YE4H 4FZEH 4NHCH 2X05A 3T2NH 1WV7T 4CJ1A 2EECA 4I0PC 4E5XA 3BKJL 2AS5M 3QISA 3PIQA 1KEMH 5TPWL 3TPUA 3QFDA 3QIWB 1DL7L 5E9DE 3K81A 1G7QB 3BOVA 3F7RA 3FMGL 3VMNA 2R4RL 4JFFA 3I6GA 5D1ZD 2XTLA 3G5VA 1NH6A 5JUEH 2WMPA 3JV6B 4HKJA 4PJAE 1QZ1A 3QUYA 2QR0B 3OAZH 3SQBA 3MLSH 5IROA 2EC9T 4N9OB 1S9VA 2VLME 5EUOF 2VUOA 4LLDA 2H6PA 4JY5L 5BS0D 1PZUB 5DA0B 5I18H 4XC1L 2DQUH 3S36H 4HUXB 3GBLA 3U83A 4NQVA 2QSQA 4YO0A 2XKSA 5LQBH 3B9KD 3KYMB 4GKZA 4NNYA 4PGZA 1Z9OA 4P2CG 1FIGL 4M43L 3S37H 4BFIA 3BW9A 4DGIH 1KJ3H 3I9GH 3AMLA 4IIQC 2A6DB 4F3FA 2IJ0C 2FJHB 4HLZG 4HX1B 5ICXA 4Z7QF 1RIUH 1JGVL 1HSAA 4LHUA 2OX5A 3PE9A 3UJIH 4C57C 2ADFH 3IFOA 4YNYA 3EZ8A 5ERWB 3TN0A 2HTKC 5L0QC 4F2MB 1Z5LB 2NMSA 1D5MA 3TH2T 2FO1A 3FB7A 4X6EB 1WISA 3WFHA 5A2IH 1G0XA 3QHTC 4YIQA 2OP4H 3NCYP 3O3EA 3DHMA 5F7NC 3CPLA 1U8JA 3VJ6B 1J1PL 4DZBB 2IH1B 1KXVC 2NX5B 4ZUUA 2LE9A 1XEDA 3V5HA 5CP3A 3BDYH 4MX7A 3JBG7 1T5XA 3O8XD 5E08L 4I9WD 1UVQB 4HZAA 3T3PF 1HSBB 1H0DA 4ZO6A 3O9WA 3VFGH 3L3OB 4X9IA 3SGEI 1KPVA 5TE6H 3FB7B 4P9MH 3FONA 5SWSD 3WO4B 2IC2A 2FATL 1WTLA 2H1PH 5AZEH 2NXZB 1I9EA 4NQTA 1B6DA 5DR5L 4TSBL 2EH8H 3ARZA 1Z9LA 2FX7H 2YPKA 4DN3H 2ICWB 2XWBB 4H26A 5A1AA 1DQQA 2XFXB 2AVGA 3MFGB 3OTTA 3MRFA 1KJ2L 2OTUA 4G6ML 1AD0B 1YEIL 1MQ8A 1DUZA 3KPSE 4LVNB 2DQGL 1XFPA 4OSUH 4FQJH 2DYPD 4JFYB 5H8DA 4DCQB 3TO4B 3EFFA 4ZSOE 3QRGH 4OJFH 1X5IA 3BIKB 4Y1AE 3V6BR 4TVPL 2PR4H 3VFOB 3FB6A 4PJBB 4U1GC 2Q8AL 1U8LA 3KS0J 1U8OB 1BOGA 3RGVB 4BSWA 3DVIA 4XZUA 3MO1A 3MXWL 4QXGL 4J4PA 4MJIE 1MCEA 1NGXB 4N90D 5EUOB 2MQ0A 4HUVA 4Y4HC 2EDJA 2HP4A 3L3GA 2HT2D 2J1KA 5CCKH 4EI6A 5KG9A 3PDOA 1EJOL 5HGGS 4PRIB 1DEEA 4UNUA 3VXMA 3ULVE 4TPRH 5J57B 4U4BA 4JDVB 1JCKA 1MAML 1UM6H 1RUKH 4KRPD 5E56A 3T3ME 3SOBL 2PF6A 2DL2A 3EOAB 3SKOA 1HOCB 4J4PC 1Q0XH 1U8HA 3OKMA 1E4WL 1KELL 1BFVH 3BN3B 3GIVA 3VGDA 4PY8J 5CGYD 3RWGA 3WXVH 1UEYA 1IGML 4U7SA 4LRIA 1PEWA 1N6QH 1JUFB 4PYGA 3IGAB 1OL0A 5DVNA 1EEZB 4MA8H 3NAAL 4KZDL 4N5UA 4U1MA 4CW1A 2OBGA 3V4PL 2CK0H 3IFLH 3K4ZA 1HCFX 2EIBA 4WFHE 2R2HA 5I1GH 3HNTH 4YIQB 4FFVD 5IR1A 1K5NB 5DJYA 1ADQA 4F9LC 3EYVA 3WLWD 3MZGB 1JWUB 2BDNH 4J3UA 4HJGA 3HMXA 3W5NA 3N1QC 2MQCA 1WZ1L 1OB1B 4XMPH 4FQ1L 2ZSWB 4Z7UF 1RZ8A 4XX1E 3TYFA 5LCVH 3ZHKA 4QRSA 5C07B 2LAAA 2BSRA 3O2VH 1DBAL 5CUSL 4HZLA 3V8OA 3I6LD 4OZIA 4OQTH 4AG4H 4MD0A 1ZTXH 1F4WH 1M7DA 5ADPH 5FOBB 5J1AB 2OTWA 1QBMH 5T3ZD 5H2BB 2L4OA 4KPHL 3SQOH 4K7PH 3MFFA 4F15B 1NANH 3G9AB 4UUJB 4EQ2A 4UTAH 4MS8D 3CVIL 3QUYC 4HXAL 5AZ2L 3T65B 4ZFOB 3V7MA 5J9PB 3LS4L 1W0VB 5JHDB 5DC4B 4OUOA 1D6EB 1QTYT 2E6JA 1BIIB 1FL5B 5F9WB 3JV4A 2EEBA 1CLZH 4APQB 1CDHA 3ILPA 1MI5D 4H8WL 2EZ0C 3IDYC 1FZMB 4PLJD 1BFOA 4GRLC 3MOAL 4XVSL 2A38A 5D7SL 2BHYA 5E8OB 4N8VB 3IXTA 3MRQB 2WNGA 4YHIB 5E9DB 5GGTL 3VFWA 1C12A 4HUMB 4QY8B 1X3DA 3RZWA 5K59F 4IOSD 1MJ7L 3FFCA 3P30H 2ZCKH 3SE9H 3DETD 4O2CA 1VGEH 2ARJB 1ZA3A 4M61B 4JANA 4DFIA 1W72B 1MHCB 4NRYA 2AK1L 5EZOL 4CU6A 2BY0A 4GRLA 5FYKE 5AG8A 1FGVH 5FXCH 2K1MA 5C0EB 2XRAL 5TQ2L 3NH7L 2CKNA 4L9LB 2CUIA 3HAEG 3MLSL 5EULV 2DJ4A 3RWIB 3NCJL 4WDIB 5CWSB 3TYGH 3RVWD 1A21A 5L2JA 1DTUA 4PTUB 2P45B 1AKJB 1MFAH 5I1DB 3T77A 3MROB 3TT1L 4DOHE 1TNNA 3GSOB 4R3SA 2VLKD 3ME0A 4DW2H 5CZXD 2ZCLL 3V6ZA 1NDMA 3AREB 1F3JB 2NY6D 1JVKA 1B0GB 3BZFB 4IRZL 4NRZA 1RJCA 3HZKB 4HPYH 1OTTD 3ECBB 1LD9B 5F7DB 3P4NA 3VH8A 2GY7B 1QLEL 1XGRA 4FQHB 5A2LH 3CVHL 4B50A 4Z7VF 4RAVA 1YEHH 1WFNA 4R90L 2GW5A 3RVWC 5AEAA 1MJJA 1IEHA 3PWVB 4HUKB 1C7SA 3GRWH 4TVPD 4O2FA 5MI0B 3IU4H 4LSRL 1U95B 3U4EB 4GSDL 4KJYB 3K2UH 1S7SB 3QWOB 4X5XA 4XPTH 5BO1L 4KI5F 3G5YB 5DEZA 1DQMH 5HI3C 1MCWW 4U3HA 1R5WA 1G7IB 1S7QB 3KXFD 4GRLB 1GOFA 4P4RA 5D71H 3FOMA 5E6IB 5HHXH 3ZTNH 1IAKB 2KQMA 3V4UL 3QIWD 3RAJH 3CZFA 5F6HJ 1ZLSH 2MHAB 4JE4B 4EVNB 3WFBH 3KPRD 4QCIB 4XCEB 3MACH 4PRAA 4P9ML 1B9ZA 5IB5B 3BH9A 5CKGA 1FH5L 5D7JA 4F15C 4MNQD 4MNQB 1QFPA 4P23A 2EH8L 3EHBC 2MHAA 4ZUWB 4HS3A 4JM2F 5FB8B 3RUGF 2XG5A 2IAMC 2I9LA 2AXHA 4WEBH 4ZFGH 1NC2B 1KIQB 1S7TA 3FOMB 4NCC1 1KIUA 2EH7H 2D9QB 1CL7I 1VSCA 4I5BB 3QUKB 2UWEB 3MRHA 5E8PA 1UCTA 1ZANL 2VXVL 4ZFFB 1MCRA 1LMKA 5IROC 3BGMA 3X3GL 1K2DB 1NBZB 1AD9B 4WHYG 4YGVA 2X10A 2ADIB 5ILTH 5H94A 2HFGH 4OV5A 4QXGH 3IYLW 3PWLB 3GSNA 1OSPL 3U1SH 4U1JA 1T21B 5EZJA 4JFQB 2R1XA 4KQ3L 3WD5L 2OTPA 1NLDH 4V1DA 1A14L 2WQRA 4JZOB 3Q5OA 1KCRL 2ESVD 2VSCA 5F88B 1AO7E 3VXRB 1B0GA 1HHGA 5FECA 1OF2A 2C3XA 5EU6B 2I9TB 1T1ZA 1MCNA 1KJ2B 1BECA 3OQ3B 5C0BE 2FO4A 3O4LD 4Z8FL 3RIAK 3B2VH 1SYVB 4KMTL 3VFNA 1MVFA 4KY1H 3U36A 1T4KA 1HXYA 4OLWH 3EZJB 3U4EA 4HHAA 3K74B 1YUHA 3AFLA 1EHAA 3VXSA 4JHZA 5C92A 3Q1SH 1AGEA 3OAYK 2ZUTA 3ZDZF 3IDMB 3WV0A 4LNRB 3C60A 5D2NB 1WWBX 5GS2D 4L8SC 1L0YA 3ZDXE 1A4JB 4QF1A 4UV4L 5GS0H 2CK0L 3IFLL 1XGQB 1MH5A 4RFEA 5CS7A 1LO4L 2GTZB 4PJDB 3SKNA 4UDTA 2BNRA 3RGVC 3RKDC 3CX2A 1IFHL 3AS2A 4QY8A 1Q38A 3LN5B 1PYWB 3CFCH 4JB9H 5FCUL 4N8VA 5E5MA 5C3TA 4YHZH 3OGCA 4K23L 5IBTH 3C5ZB 2JF1A 4NQDE 4PBVC 1TENA 4N0CD 4PBXA 1D9KB 4PRHB 3F7QA 2Y6SD 5FF6B 2EO9A 1PSKH 5ANME 5L88H 4KK8D 4RRPG 5KVDH 1QHOA 4ZUWA 1NL0L 1Z2KA 1GH7A 2H26B 1MHCA 4NRYB 4PR5B 3DVNA 3QEQA 2IPUG 5E8NA 4MD5A 2DLFL 1FAKT 4CADA 1SJHB 1P4IH 5ITBL 1KV3A 1IAIM 4ELKA 4JFFE 3PWNA 3QCUH 1RZGB 1OP9A 4F7PB 5LGHH 1F6LL 2PO6B 4ZDHA 1TMCB 5FK9B 1C12B 5HHNA 3BJ91 3AU1B 4NJAL 5JOPE 1XGUB 4JPIA 4KJPD 4LU5L 4Y0GA 2XKNA 5IHZB 2PYFA 5H37H 1KB5B 1OY3B 3D2UD 4HLZH 4Z7NF 1NMBL 4N0YL 1WBXB 5KSAB 3PDGA 3CSYA 1FNLA 1XGYH 4Z7VE 2ORBH 3QQ4B 3QWOA 1KPUA 2J12B 4I9WE 4X5XB 2I27N 3D6GA 3AY4A 2V17H 5F7FA 4JGMA 3P30L 4EN3B 1X5KA 4G9FE 3RJDA 1FIEA 3DRTA 3WHE1 4ENEC 5C2BL 5SWZD 3ZKXB 5D2NE 3HUJB 5DJAB 1KB9K 1HHGB 4E41E 3QIBC 1QLFA 4Z7WB 1UWEL 4MX7B 2W59A 5EU5A 4F37K 2XY1A 5FUZH 2ZUVA 3OXRB 4NYLA 2RBLA 2Y1VA 2D3VA 3R8QA 3TYGL 5DHYB 2EIZB 1BGXH 4HQQL 4FQHA 4L5FL 3HR6A 1VB9A 1A1OB 3F58L 4RFOH 4QGTA 1I8KB 1U8HB 3KGRA 4L8DB 3W2DL 2NY0C 5JPMB 1K4CB 1PZ5B 5D1QA 2G2RA 2YK1L 1ULVA 5J0BA 5DJAA 4OBSA 2NY0B 3TVMD 4I18C 3KPOA 4JVPA 5DJ0B 4D9QE 2EDBA 4JRYA 1NFIA 2O26U 2B4CH 1BQHG 5DD1H 4L8SA 1D5BB 1KYOK 4KJQD 4HD9A 1EEQA 4PJXE 3CDGB 3QNYA 1GIGH 1MHPL 4ZO8A 2O5XL 5FGBA 1U93B 2AEQL 4K9EL 3BAEH 1JWSB 3ARWA 5MENB 3QR2A 1CF8H 1ZVSA 4Y8AA 2QL1A 2J88H 4LARH 4U6VL 4JO2L 4RZCA 5FM5M 2ZUQB 4YHIA 4Y4KC 1DQML 3VXTA 2BVEA 1AD9A 4EBQL 2P24A 4PJ7F 3KPSD 5I74C 2IG2H 4KJPC 2BSTB 3WKMH 4JY6B 1XCTB 1B88A 2EDNA 2XZAH 5E2VL 4UILH 3U0PB 1DQQB 1PFCA 2Q76B 4O5LL 4P59L 3ZYZA 3MLVL 3HR5B 5DHXB 1QKZH 4Y16D 5GRYA 2HTLC 3VFRB 4L8BB 3L9RA 2BHUA 1J0IA 1MRCH 2MFNA 3QFJE 4NZTH 4P48A 5J6GA 1P5VA 4HMEA 2E9WA 4BZ2H 4N90E 5CLTA 3QQ9D 1F4XL 3OSKA 1IGTA 35C8L 2F9BT 3VFMA 5IOPA 3EYSL 5C07A 4GRMB 1NCDH 4ELMB 2VITB 4CRPA 4MD0B 4GS7C 3ZT7A 4K7FA 4Z7WE 5DT1H 4ZQKA 5B39G 4DWHA 1BQHA 4HJGB 5DA4A 4JQVA 3T0EE 4FQIL 1A6AB 2ARJQ 2UYLA 4MA3A 5HHVH 4OZFH 3MROA 5L8KB 4HV8B 4OCXL 3MX0A 4LGSB 1TJIH 3W9DA 5L2JB 1V05A 2PN5A 1RZ7L 3VXRD 4GW4B 4F3FB 1FLRL 1N0XH 2R0WH 3C5SB 1F4AA 4OZGB 5IJVA 5FA4B 1ZAGA 4NNYB 1QHPA 4ZUTA 2V2XB 3QEGL 43C9A 3QDGD 5TFSH 3X13A 4Z8FH 3NCCB 5K93A 1HXMB 3FQWA 2XZQH 1A3QA 1NGQL 2VLMD 1YEFL 4NRZB 2P5WB 4NJ9L 4P5TC 1M05B 3LDBB 3GJFK 3V6OE 12E8L 1A6TA 2NLJB 1KXTB 4KKCD 1Q72H 2J5LC 1D9KD 3P40A 4JFPB 4NQSB 1A6UL 5HYIA 4IRJB 2DQTL 1PKQA 3B9AA 1QRND 3ALWA 1H8NA 4R26L 2AJ3A 1NMAL 2RFXA 3PDOB 4I2XA 1WT5C 1WIPA 3S36L 5I6XC 3NZHH 1BP3B 3TNMB 3VXMD 2MPAH 5E8EB 4MQ7A 1Q0YH 3PWPA 4G6KH 1RZKC 5GZOD 2EE9A 1WAAA 3LKNB 5J6HB 4RGMB 5DI8B 3E6FB 2E7LA 1CE6A 2V2WB 3IJYB 4HUXA 3QUMH 4HJ0C 1WZKA 4LRNL 4N0CC 5CEXA 3UZEA 4PRPE 1YQVH 4KROC 2VXTL 2AJVH 2QADD 1J0KA 5CZKA 5T1KB 4J3OC 2RIKA 4KHTL 5ID0B 5BS0E 5E6IC 4CN4A 4XP1L 2AEIT 4NDMA 4PJEE 1KTKE 1UM5H 2R0KH 4G7VH 3TJHD 5DQ9A 4QHKJ 5DRZB 4JFZH 4P2OD 1RU9H 1T1WB 4MHHG 3RI5F 4OGAD 2HTLD 4F7MB 1T03H 4KJWC 3FT2B 4Y5VB 5B21A 5GRJL 5KANG 3C9NA 2NTFA 1FJ1B 3RY6C 3FN0H 1IGCL 5KS9B 4JO1L 3WNNA 3HS0A 1L7TH 2ZP0T 1IL1A 1MNUL 5GHWH 4JJ5B 1UC6A 2FATH 2GAZB 5AZEL 1UVQA 1N4XL 2MCG1 5MEND 5J13C 1MCPL 5IVZB 4Z76B 2YR3A 1T66D 5I75C 4PGCB 2WM0A 1TQCB 1UB6A 2UVFA 1A7PH 1JJUA 3LEYL 1XGRB 2J6EL 3GBMH 2CIIB 1G1CA 3T8XB 3U9PL 3OPZH 5GXBB 1Z9SA 2A6KA 2APTA 1FJ1A 2C5DC 5ESAA 1DBJH 3KPLA 3M1BB 1KN4H 4L9DA 4CMHB 5DRNA 3CK0L 2A6JB 4RAUB 3RTQC 3MJ7A 5JZ7D 3QCTL 5AG9A 5T1KA 4Z6AT 2YN5A 4OJFL 1JHLL 5C0FB 3KYKH 1P7HL 4RISL 4NDMB 3UTSE 4JO3H 2VISB 3Q2CA 4QLRA 3BQUA 1LEGA 5C08B 1T6WA 1HNFA 2Y07H 3SE3A 5IVXB 4FXGB 2B7DT 3U6RA 3IGAA 2CDEB 4POUB 4XHJD 2DDQH 5EIIA 3IF1B 3QEHB 3PGCA 3IXAB 4NM4H 2W92A 4YO0B 2Z9TA 2Z8SA 5D7JC 1JGDB 5BRZA 5CCKL 1JZ4A 2BVTA 4HBQA 4JKLA 4RNRA 5F7UA 4U05A 4R4NC 4OLEA 4WU7A 3EJYD 4H1LG 1GSMA 2CKBA 3SOBH 5GGQL 2AXJA 2J4WH 4X6FA 1OAUL 4OZHE 5EO9B 3LS5H 3PDDA 3I02B 4WWKD 5CIPA 3LKSB 3U82B 3HE7D 4PV9B 1CF8L 1S9XA 3L5IA 4Y19D 4WU7B 1LILA 1CGTA 2BY1A 4JPWH 3W11C 4R96B 5CP7A 1KACB 3CJJA 4DQOH 1JZ8A 1FORH 5GZNC 4X6FB 3OKNB 4HUWB 4YFDB 4NUGH 5DGRA 2RGSA 3RWEB 5BVJA 1YEEH 3N06B 3Q6GH 5DUBB 3VD7A 3TNNA 2J8OA 3X13B 2K7QA 4HKXA 5FOBA 2PYED 3MYZA 4NFCA 1WZ1H 1ZHKB 3RTQD 4FQXD 4JKMA 4Y4FA 3B5TA 3DROA 3F6IA 4FMKA 2F15A 5KOMC 3BH8A 2PUQT 2KZ1B 3EYUL 1JK8B 5E94B 5JLZB 3DUSA 4G42B 4XH2A 4AIZB 1C5DB 5I73B 3F5WA 4ZUSB 1QRNE 3EDDA 3H9ZA 3QAZC 4RA3A 3L3KA 5E00B 1AGFB 5BW7A 3K0WA 5MEPB 5HI4C 4LK4A 3MOQA 4XPHH 1GJIA 2A6JA 4XP5L 3VG9C 1KPVB 2V7HB 4NGHH 1G9MH 1E4KC 5A40E 5JHDD 4LAJH 3Q5YA 4HK0A 2A77L 4X80L 3VA6A 2BZDA 3CDFA 4CMMA 5EUKA 4OV5B 2VXSH 2YRLA 3N50A 1CN4A 2XWTA 3I50H 3HPJB 5HHOA 4OCWL 1E28A 4GBXB 4X7DC 5EBMB 4G8EA 4RGNB 4RGND 4TNVF 1AHWC 4ETQB 5DQDH 5F21B 1EAPA 4OCXH 1KG0A 2PXYB 4HWNA 3E1F1 1DFBH 4PJ5A 3NIFF 3WN5B 4LQ1A 5BZWB 2NR6D 3MJ9L 4O2EA 5DRZA 2HJLB 4ORZC 1BVLB 4X7FC 4IDLA 3QIBA 1U8MA 2Q8BL 2I60L 3LN9A 3JVGC 2VXQH 4OLUH 3F12B 3E2HC 2ZCKL 4OFVA 4QT5A 5EO9A 2R8SL 4KWUA 3VXPB 3UTZA 4Y8DC 3OB0K 3CFEB 1YEFH 5GSVB 5J56B 2ZNWA 3VI4F 5FUOH 1DBKH 4Y4HD 1MCQA 1LQSR 3WS3B 3BGAA 4G7YL 4I4WB 1NEZB 5E1HB 4ZTPL 4MD5B 1T1YB 5ESQB 4GKSA 5HYSG 1MLCA 4NFDA 3DHJA 2M2DA 4DW2L 3GIZL 4DKFL 1EHLL 1TJHH 4WO4D 4S10A 4XWGH 5LVEA 4WGVB 3HLAB 4XVTH 4GQ9L 3VGFA 1ACZA 3VWJD 4L3AA 4CJ0A 4EOWH 1P7QA 3P9MA 5E1AB 2BOBA 5BV7C 1DANU 4OFPA 5TH2A 3DECA 2ZCHL 1ORQB 4L1DA 2GTWA 1F5WA 1M7IA 3QIBB 5ACMA 3T2OA 4RWYH 4NNPL 2AJVL 1CXLA 4OFYA 3MR9B 4R8WL 3QUMA 4H0HB 4PJEB 3UTSA 4P46C 5D1XD 2FX8H 4NYLB 4M7JH 3SJVD 4H1LB 4ODUA 3IS0X 3CFIC 3V6FA 1CBVH 1CDCA 4PJ7B 3SE4A 5KANI 2XOTA 3MRLB 1WICA 4ONHA 5M7QA 4FFZL 2A2QT 4NKMA 5A2FA 2WUCH 3G6JA 5M95B 2FHFA 1FPTL 4JFDA 2VIRB 1P5UA 5D71L 2GUOB 1MLBB 1CE1H 2DD8H 4CMMB 1IGCH 3NFPA 4G8GB 1JF1B 4PG2A 3CFJA 1I1AC 4XTRD 1DQJA 4FS0A 5EPMA 4Z7UE 2W9DH 3PHOA 2FX9H 4HPOH 1MCOH 3TV3H 3FQUA 3KDMA 3RUGA 1QNZH 3HA0A 43CAB 2I25N 2E7MA 4FTVD 1D5ZA 1K8DB 4DTGH 1S7WB 1INDL 3MLTB 5GIRA 1V7MH 4KK5D 2YEZB 3N1FC 2E6QA 1F90H 2GCYB 4Q9QH 4L1HA 5L7XH 1IM9B 1ORSB 3D3VD 3SEPA 1RZGA 3PF2A 4QRPB 4ZPVB 2Q7NA 4XNZB 5C07E 1AGCA 4AIXA 4IS6A 5CINH 2VQ1B 1FZMA 1PY9A 2NY6B 1UKTA 5DUBA 2VDKL 4JEGB 3KYKL 4G9FD 1N2RA 3OV6A 3ZL4H 4M6NL 4XXCA 1EJ6A 2DQJH 1BIHA 1PG7H 3QFJA 1BJMA 5BV7B 5BVPL 5ILTL 4DN4H 1WJ3A 2GHWB 1NSNH 1S9YA 2OZ4L 3IAPA 4YHLH 1NGWA 2KL6A 2Y5EA 4L4VD 3C5JA 4Z95L 2QQNH 3EDFA 4QRRE 1S5IL 4QRQB 2BFVH 1WCBB 3INUL 1VA9A 3O6KL 3FFDA 4X98A 4BZ1H 5C09E 4YHPB 3NA4A 2DLTA 5K9JH 2YSSB 5K9KA 4RCAA 1I8IB 4P2OC 3WMSA 1DUYA 3WXWL 5HHQA 3MRRB 2E7HA 3HZMA 4XPGH 4DUVA 1FZJB 1T0NB 1TFHA 1PKQE 3ARVA 3LZFH 4FQQA 3S34L 3TIDA 5I19L 1EHNA 5I71C 1ZVSB 4IDJH 3RIFF 4B7LA 3O11B 1P2CA 3HN3A 1HXYB 2EXYD 2DQFA 4OGAC 5TE4L 5DRXB 4DQOL 2CKBL 1IC7L 3K1KC 5BQ7A 1SYVA 2KQNA 5D1QD 1IGJB 3U46B 3PP3K 4NUGL 4LHQB 4TUJA 4LPYA 2VIRA 2EIEA 3T0WA 5DJ0A 1PY4A 4IEFB 2NY5H 2XNAA 1T04B 2AJUH 3DGCR 4OZHF 3FB8A 1A5FL 2GEEA 1TDQA 4P9HL 2EYSA 2R1YA 4IHOA 3BUTA 1S7UB 4YLQT 4LVHB 5E5RB 3EAKA 1T5WB 1H3PH 3SDCB 2QBWA 1DVFA 3D5OF 5K9KB 5EZLB 1FE8H 1ZK9A 3DLQR 3SE8H 4Z76A 3BZ4B 3I75A 4QHLB 4FOMA 4FP8L 1K2DA 1NBZA 1PSKL 4ODVH 3L5WA 1IL1B 1DQLH 3QP3A 1XCQB 4Z7WA 1G9ML 3NIDF 3ARFB 4LPUA 1AQDB 3H3PH 3V4VH 4BJLA 3PABB 4WJ5A 2B1HH 5GGVH 5J6GB 2WINA 4JQIH 2VSDA 1O0VA 3EUUA 3KJ6H 5DZNA 3MUGA 4JO4H 2ATKA 2GSGA 5C0BD 3C5ZD 3GSWA 4M7KL 5FUCC 5T1DL 3QCUL 1ZGLB 1GGBL 3QDJE 1T0MA 4Y1AB 1T1WA 4AT6A 4J23A 5EU4B 4NOFA 4GAGH 3ARGD 4PY7A 3RDTD 2I07B 4YZFE 3TIDB 1B6UA 2WK2A 2ENSA 4FRWA 1BQLH 2IQAA 4QOKD 4F7PA 4L3CB 2AQ2A 4AY0A 2PYFB 1H3WM 2JCCF 4XP4H 5GQBA 1PJ9A 4OD2B 3RP1A 1CD9B 1REIA 2V17L 4H25B 4GXVH 5E8OA 1YZZA 5LJYH 3CX5J 4OZGF 1G1YA 2DAVA 2N7AA 1R5WB 5D7KD 1LWRA 1BJ1H 2FDBP 1E27B 3QB7C 5C2BH 2C1OB 2Z4QB 5LWYH 1TJGH 3ZKNC 5E6IA 3EJJX 3VWKD 1UWEH 5ELIA 2VLKB 3VD4A 3SKMA 3DWTA 1NLBL 2E5EA 4D0BB 1H0DB 3CVHA 2WIMA 4HQQH 3MUJA 4M6OL 9CGTA 2R2CA 5D96C 1JPFB 1I1YB 1MFBH 3PGFH 3WKNA 3OG4B 3RWDB 3L7FB 3RUGE 4QHLA 1QR1A 3G04A 5L6YH 1QSEB 5EOCJ 5KVEH 4RMVA 3WEXA 4NP4L 1RUPH 4DGIL 4JG1H 1YJDL 2X1XR 1Z0NA 3QO1A 1LD9A 1JNHA 1HXMA 4ODWA 2R1WA 5D2NA 1YDPA 4BH8B 3MJGX 1HI6B 4LCYB 4X6BB 4G80A 1DBMH 5TF1H 1AGEB 4BKLB 2R0LL 3QO0B 1A1MA 3GKWH 2Z35A 4NBZB 3KR3L 4AIZA 3RY4A 4K3JL 4R7NA 5KSAC 4UT9L 1JK8A 4MDIA 2QHRL 4FTVE 3MRBB 3ULSB 4Z7UB 5HDQH 2DICA 1FP5A 5F3BA 2E9BA 3HNVL 4MJID 4YDKL 4TNWF 4YUEL 1AO7A 3HTLX 4RGOL 2ZKHH 4G43B 2DM2A 2XA3A 3TESA 4LLDB 5HJ3B 2BP3A 4S1DD 3IU3A 3LY6A 1XH3A 3FFDB 5GSRB 2W9DL 4QGYA 1AGDA 5C0NC 3NPZB 1MCOL 4XNYH 3RWJA 2YSSA 3TV3L 3T1WA 4I0PA 3H9SD 2NCMA 5TDPB 1SY6L 2FH8A 3VGHA 5E8NB 5E2TL 4JFXA 2OM5A 3A0OA 3CVHB 3I02A 3IKCB 3TVMC 1OTSD 1EGJH 4JLRB 4TSAH 5A16A 1VFBB 4BFEA 2YUWA 1CDIA 4NQDA 3V6OC 3LIZH 1KJ2H 3KPQB 1UWGL 1G7PB 1GAFL 4NN5C 2CK2A 3RHWK 1NCDL 3NPSB 1GHFH 4LAQH 5J12B 2VLRD 4WHYH 1G9NH 3L3IA 1NGPH 5C0ND 5CSZB 1UH2A 1NC2D 1WLHA 4ODXB 2LVEA 2BSRB 4X9HA 3BWAA 4TUOA 4NQED 1TVHB 2C3HA 3X14A 4XHJC 1QO3B 3FRUB 1BX2A 5F1NA 4KK9C 1INEL 3VH8G 3QDMD 3HNSH 2IH3B 3W0WA 1JWSA 4QRUB 3FB8B 5LGJA 3SGJC 2BCKA 3BEVA 2Y5TB 3C60B 4A6YA 3KHQA 5L9DH 1PAMA 4DGYL 3O6FA 1WBZB 4RRPA 1GGIL 1RUKL 3A6BH 1JTOA 1XF4A 4JFDB 2XIDA 1YEJH 4JCLA 1MPAH 2KKQA 1KELH 1X5JA 4BQBA 2CDFB 5B38G 5I8CA 4QRTB 3HZYA 4XP6H 2I9TA 1RZIB 1QYGL 4PIRF 2DWEA 1F8TL 1IEBA 3ZO0A 1DVFC 4H1LA 4ODUB 3PGDA 3BP7A 4OCRH 3IDXL 5BMFL 5JW4N 1SVZA 1CXIA 4RAVB 4PJ7A 5FV1L 2MJWA 5IB4A 1U8KB 1I9IH 3HE6C 5DEGB 1FN4B 3ARDD 1X9QA 4KKBD 3P9WB 1J5OH 1ZT1A 1HIMH 3VXNA 1F6AB 1P4BL 4O51B 1YNLH 3SGDI 1L0QA 1A9EB 2BMKB 3DXAB 3F5WB 4PJXF 4UB0H 1E6JH 1AXSB 4WFGE 1LDPH 1HILA 3RWIA 5ESVA 4MD4B 1CD8A 5ICZB 2R69L 4D0BA 1FDLH 5ALBH 1WIUA 5JIHA 3EYOA 4O9HH 3K46A 1FE8L 3ULVC 3ARRA 1T89A 2BSED 4FNLH 4LMQE 4FFYH 4LSSL 3DVGB 2P1YA 4UDUB 4HJJL 3WDJA 4QRRB 1UYWL 4RDQG 3QXVA 4Y16C 5BS0B 2P46B 1GGCH 3VFUB 1IM9A 4D0DA 1U42A 1MREL 2XN9D 1X5AA 4W68A 2Q86B 4LLUB 3UTZB 5IBLC 5D6CA 4HBCH 4Q7DA 1ZHBB 3S5LB 1DZBA 3HMWH 4OM1H 5I1JL 1ZV5A 4JFFD 4J2XA 4JKWA 1N3NA 5EC1A 4XC3L 3V7AE 3MTRA 1JMZA 1DQJB 5EPMB 4HSQA 4PRID 3ROOA 2A9NL 1U3HC 3MGTB 4PUBH 1EPFA 3V95A 3MLWH 1OVZA 1CLYH 3T8XA 5JHDA 3TO4D 4TOYH 2NZIA 2NXZC 4ZUTB 43C9B 2XWTB 4GXUN 5IW3A 4QRTA 4OCYL 1DBJL 1MUJA 2D4FA 2GCYA 2MKWA 5FA3B 4FQ2H 1J12A 3V6FB 1EZVX 1SJXA 2XG4A 1I3VA 3EFDL 4XMLH 1RZKH 3O6FC 2FHCA 5IQ7H 4LHUB 5JHLH 1JZ2A 5GJSL 3B5HA 1CIDA 4S1RH 5HHMD 5ITFB 4N8VG 2D7NA 3WFCH 3CFJB 3T2QA 4I3RH 2EDKA 1ZE3C 2UV3A 1RMFL 4NKMB 5DJDA 1DBML 5TF1L 4KVNH 2AJZA 5HI3D 3BGFB 3GHEH 4HK3J 3VWKC 2HA1A 5D4QA 3L1OH 1A6PA 4ZD3L 4XX1G 1ROWA 2DKUA 1T1YA 5JW3L 4ZNEE 4K71B 1Y0LB 2JELL 1R3JA 5JMRA 1C5BH 4KTDH 3D9AL 4HKJB 5F1IB 1MFDL 3CDYA 3EJZD 4WI7A 3O9WD 4HUUB 3L3DB 4XPTL 5E8EA 1KIPA 1PG7X 2WQ8A 4KXZI 3I6GB 3HG1E 2GTWB 2E3VA 3BXNB 4WO4A 5CFHA 1NMCB 5SWSA 1LK3H 2B0SH 3L3GB 3EO9L 4OZHA 1C5CH 3U0PA 1SM3H 1I3GH 1H15B 1A4KA 1XCTA 1MIML 1CLOH 4U1SB 2H8PB 3QSKB 4Y2OA 1RHHA 3E6HA 3BXNA 4WO4B 4OZFB 5T3XL 1CZ8H 1RK0A 4M7LL 3QHZH 3CC5B 1OP5K 2DIBA 2HVKB 4PS4L 5DK0A 5HYJB 5D1XA 1G0DA 2X4TB 5DUML 4UUJA 3V0VB 1GPOH 1I7RB 1FO0H 1A3RH 2YD6A 4UI2A 3OF6A 5FHBL 3FN3A 5IFHH 1T7VA 4U3CA 4TSAL 1U8QB 2FJGB 3DUUA 1XR9A 4R6UA 4PD4K 2VL5B 1INQB 1JRHI 3GSXA 2GJZA 3B3IB 3GZKA 3P4LA 5MERB 1ZLWK 4YWGH 1G9NL 4E41B 3DXAA 1BD2B 3ZE1F 5J06A 2WWMC 2R23B 4LCYA 2OL3B 5DD0H 1CG9A 1IT9H 1MJ8L 3U0WH 5GS1C 2QEJA 3LQAC 5CJQH 3DUHA 3QXAB 4K8RD 2V9QA 5DHVA 3BE1H 5E0QA 3TCLA 4F57H 2CMRL 1QR1B 3CMOH 5HGBA 2LAGB 2DWEB 2A1WH 4AEIH 1CT8B 1QSZA 3P0GB 5EU6E 2NX5A 3REVA 2CLZA 3T0EA 1RZIA 4JVWA 3AUVA 4GLRH 3TCLB 5KJRL 2D0FA 4PJGE 1U92A 5CILH 3RWEA 5BVJB 1AC6A 1NCWH 3TZVB 4Y5VA 2EYRB 4KMTH 3W9DB 1FV1A 5DLML 4XP6L 1RZFL 1SBBA 3S98A 4QNPF 5FDWA 2P5EA 2DJUA 5HXMA 5IGXL 1S9XB 2MNUA 1C16B 2XT1B 3DX6B 3EO1A 4OFKA 2MTPA 5C1MB 5GS0C 1E4XH 3FT4A 5EA0H 4RBPK 2R23A 4UV4H 4UT6H 4JKKA 2BC4B 1OM3H 5GRVK 3QUXC 1VHPA 3OG6B 4WWKB 1F4YH 2YHGA 1XR9B 3MO1B 4BH7A 3LV3A 4NKDB 1BOGB 2XPGA 5JORB 4PJFE 4K94C 2NW2B 4GW5B 3MA9H 1EBPA 2QADB 4HH8A 4N0RA 3SGKC 4TTDD 5E5UB 1FFNB 2HVKA 5GRUL 4XBGA 5F70A 3ZT5A 4P0DA 4MQ7B 1A47A 4NKDA 3O3UN 1K8IB 1MWAA 3CAFA 2HFEA 5ANMB 4YXKL 2APXA 2ADFL 2RFXB 3JV6A 3MRDB 4BZYA 1ND0B 1H5BB 1MAJA 3STZB 4FNLL 5CD3A 1VFBA 3U4BL 5DJ8A 1OAXH 4WI4A 5DZLA 2FIKB 3SO3C 2FX8L 5GRXG 4NHCL 3NPSC 3WUZA 2NR6C 3BT2L 5L2KA 2NY1D 3O45A 1MHHA 4LGPB 3WJJC 1N6UA 1ZVHA 4M93C 1F3DJ 4XHQA 3OKKA 2DLFH 1K4CA 2XN9E 1MF2L 2IAMB 1HINL 25C8L 1S7VA 1VESA 4ODBD 5DSCA 1TQBB 4ZS7H 2VLKE 3FO1B 3QDGB 2V5SA 4Q2ZB 5IG7A 3FO2B 1S7UA 2N56A 4G5ZL 1D5XA 3FT3A 2GYSA 5DMYA 1AR2A 2XI9A 4P5KA 5I8CB 1BQUA 3B9EA 3V5DB 1G6VK 5TE6L 1U58B 4JDTL 4TNVK 1OP5H 2YD8A 4XC3H 5DQJA 2ORBL 4GLRI 3VFVB 3G08A 4GRLD 4JY5H 4PD4J 1QOKA 4JHWH 4PUBL 3RDTC 2HT2C 5GS2H 3O6FB 2DQUL 3OKDA 4PJDE 3SY0B 1ONQB 1XF4B 5F9AC 4OI9A 2HLFD 2P7TB 1UM4L 5TJWK 3H7BB 4G6MH 3S88L 2YC1A 5C0AE 1HWHB 4ODTL 1JPTL 1ZLUH 1N59A 2DKMA 1NPUA 1YMME 3P0YH 4FQCH 2OJEB 2W0PA 3I2CH 1YPZB 4J1UB 1JV5B 4PGCA 2VDKH 1G6RH 3ZZ1A 4QOKA 1AE6H 1YMHB 5I66A 3VFMB 4N0FA 2HH0L 4BK4A 3VFSA 2OSLB 1PG7L 1V7NH 2BNUA 4GUPB 1QFWL 2C3VB 3M17B 3RWCA 4P5KB 1NGWB 5CJOH 3UYPA 2X4TA 4XVJH 1RUAH 2YK1H 5DEFB 1NKOA 2UUDK 2IFGA 2X89A 3H3KA 4X8JA 2H2PD 4U6XB 1C7TA 2C26A 3U0TB 2PO6C 5FGRA 3GI9L 1ZT7A 1MAMH 3RL1B 2DIAA 2FCBA 5JW5A 1MY7A 4M1DL 3MLUH 1CGVA 1QR4A 3CNKA 3LKSA 2O5XH 3KXFA 1CICC 5CMAB 2JELH 2XN9B 3OAUL 3MNZA 2AQ1A 4HUVB 1U3HB 4Q0XL 2J88L 4LARL 4U6VH 1BZ9B 5DVLA 2EDLA 5DHVH 5TE4H 3NFNA 3RVUD 1I1CA 5CEXB 3VA2C 4R4ND 3CH1A 3UYRH 2PO6D 1WITA 3JSSA 5DI8A 3OJDB 2VLRE 3VXUB 1J8HA 2GFBB 3DX7A 3HMXH 3QDAA 4OLXH 1UCBL 1R3LB 4KMLB 2GITA 4WENB 5GGRY 1CZ8L 3TFKD 5E70A 4NO3B 4FABL 1CXKA 2LQRA 3BFOA 4X4ME 3DARA 4APQC 2XFXA 4UTBH 3TBTA 4LVOB 1PZ5A 5HHPA 1KTRL 4E42A 4LCWA 5AWNH 1F4XH 2OK0H 5LCVL 1YEKL 5HYEA 8FABB 1I75A 4LF3B 2WUBH 3O6LL 3F65A 2P49B 1MVUA 1WWCA 4P2QB 4FQXB 3UBXB 3BD3A 1S8DA 2YMXH 1EAJA 5HY9B 1QSFA 2ZJSH 5C0AA 2HT4D 3SQOL 1CQKA 1CVRA 2H3NA 4TTGA 5DT1L 5KTEL 3GMMA 3KJ6L 5IM7B 1RFDH 5GGSA 4V1DD 4M7KH 1E4WH 5ADOL 4D9RD 3TO2A 4I0PD 4AH2A 1CWVA 4PJGB 4LEOB 3G5ZA 2WWKO 4YDJB 2D7MA 5CWSA 3WXVL 4U1NB 2W07A 2VDNL 3TA3D 3LEXB 1P9MA 4Y19B 3C8DA 3QPQC 2JLLA 3CSYB 4M8QA 3KPMB 1JNNH 4HS6A 4JDZB 3UPRB 1EK3A 4AEIL 3HPLA 4G8GE 2R0WL 3RVUC 4M00A 1JGLH 1B2WL 1QFUL 1J8HE 2N1KA 2VLRA 4QRPD 1CFSB 3M45A 3D2UB 3ETBF 5F97E 5D7JB 1C1EH 1XGUA 4JPIB 4GMSH 1TJGL 4O58L 1JTPA 4QXTB 2RCSL 2DMCA 4NJ9H 1BVKA 3VG0L 4ZS6D 3LQMA 2WBKA 2VLRB 1CTNA 1DJSA 3NH7H 2EDWA 2J6EA 3BYTA 2DQTH 3O2VL 1SY6A 3QDMA 1AY1H 1IGIH 2QTEA 3A6CH 1I7TA 4EEEA 4F9PA 1DEDA 2ADJB 2QJDA 4JFHE 1TXKA 1Q9WA 1FL5A 1X5XA 2DQIH 3B9VA 4Z0XB 1S9KC 1Q1JH 5HI4D 4FHBD 5T3ZE 3O6FD 5DD6B 2HKFL 3QXUA 1D5IL 1IM3A 1AI1L 2YUXA 2O5ZL 3QDMB 4Q74A 4ELME 2NNAA 2VDRL 4K71C 1LNUB 2CXGA 1JWMA 1NAKL 2ADGA 4DEPC 5C6PB 3OKOA 3QUML 4H88H 7FABL 4YFLF 4UBDD 3GMLB 1GZPB 3WIFB 5IWLC 2WZPD 5FKPA 4YXKH 4WI8A 3N85L 2Z31A 4TSCH 2BNRE 2O61A 1FQ9C 3ELAT 3TO4C 4CL7A 1N5YL 1RI8A 4D0CA 1R5IA 4R2GC 4XNXH 3WIHH 1GCFA 5F89B 1UM5L 2R0KL 5HDQL 1QRKA 1B4RA 4GT7A 2FEEL 3KLAB 3CMGA 1F4HA 3U36B 1A6ZA 2DRUA 5AYUL 1MJ7H 2IBGA 1IAIL 3GMQA 1JPGA 5AYQA 3V5KA 1AKJA 2DBLL 2Z31C 1IKFH 1ZHKA 1MCKA 5I17A 3ZTNL 5E2WL 4KGLA 4N9GA 3P11L 3TC9A 2HMIC 3LMJL 1UKSA 5CGYC 5GHWL 4D0CB 2FJFB 1I8KA 3BPLC 5M94B 1G7MB 1ETZB 3LQZB 2IF7A 3NGBC 2F19L 1BX2B 4CDGC 3EYQD 3RPKA 2MOVA 2BNQD 3JZ7A 3UPCA 2DKSA 4WFEE 1V5JA 3FOLA 3WHXB 4WEBL 4X7TB 4XGZB 2OR9L 1QBLH 4JDVA 4MAYB 4KI5E 3LIZL 2OL3H 3BISA 3RU8L 3CK0H 2XN9A 2UY7A 1EO7A 4LMQI 5ID1B 2YXMA 5T3XD 3P0YL 4P46B 1JWMB 2P8MB 5J1SC 2VWEC 5FM8A 1K6QH 1AC0A 1EUTA 1A9BA 3BEWB 3TVMA 1NCBL 1NGYA 3MRIB 3S7GA 5D2LB 5IEKB 5EC1B 1WT5A 3GDBA 1IZKA 2LFGA 4H25A 4KHXL 2JJWA 5FAAA 1XF1A 2NY3D 5C6WH 2JB5L 3MLRH 3QEHA 3K2UL 5D7IB 3RVXD 4WNQB 2VQ1A 4HS3B 2OR8A 5FK9A 2FEDD 1AXTL 4AMKL 1OQOA 4BH7B 4X99A 5EDXA 1YA5A 4G6FB 1CK0L 1UB5B 5JPNB 4PP1C 2BC4A 3CSGA 1MAKA 3V4UH 4PGEA 1EA9C 4XI5D 1AO7B 3VXRE 4UU9A 4D9RE 3OAUH 1KIRA 2X4SB 2DQDL 5DGQA 3KG5A 4OIBA 4GG6E 1FH5H 1LO5B 4U1LA 1KB5L 4TRPH 3ESUF 4MD4A 2O93L 1UACH 1BAFL 5D7LA 4JFEA 1IEAA 1EVUA 4WI3A 1KLGB 2E8ZA 5LBSL 2EH7L 2IADB 1JBJA 5GGVY 5IHUL 5I8EB 5C71A 1ZT1B 2J8UF 2P43B 4OKVA 3WNOA 4HCRL 4JGJA 4HZLB 3S35H 3IJHB 3MSPA 2OXGA 1KULA 2A9ML 1RPQA 2OJEA 2Z8WC 1NCCL 1FZKA 2X09A 1QSFB 3MCKB 1VPOL 1T04A 3RI5K 4JFEE 5IBTL 1VGKB 4N0UB 3V0AC 4OCMC 1NC4A 3RVTD 4FTVB 4EI5D 2B5IC 5FM4A 4OZGE 3DMMD 1BJ8A 1UJ3B 5HPMB 3ZHDA 4HKZB 5D1ZA 5LAXB 4EN3A 1A14H 1ZKAA 2IGFL 5K9QG 5DRWA 5KTEH 3VXRA 2BX5A 2H2SD 4X7SL 3I50L 1P4IL 3TA3C 4FQPA 2JJTA 4P5TD 2DQFB 4RMRA 3H0TA 3SDYH 3VXME 3IJYA 5D72L 5I1HH 2ZUQC 4NRXA 4KY1L 4YC2C 3LSOB 5F1NB 2GT9A 5GISH 2VAAB 2VDNH 3QDGA 4Q2ZA 5IG7B 2VDLH 3X14B 4GJTB 3OX8A 4WRLA 4NCDA 2AI0H 1NMBH 3GK8H 4I2XB 3O4OC 3BMWA 3OKOB 5HYJD 4Q9RH 2V2TB 2ADGB 1C8PA 3MJ9H 3BKJH 1KPRA 1ZT7B 1ZLUK 2I60H 1CLYL 1T0MB 4Y1AA 4N1CA 3CUPA 2VLJE 4U6XA 4LASL 4E0RB 1D6EA 3MXVL 1QP1A 4ZSOA 2R4RH 2DB8A 3PIQB 4MNHA 4DAGL 1CDGA 5E4EB 5AUMA 3JWDL 4PRHA 5JUEL 5HD8D 4F9LA 5KSBA 4Z77A 5FO9B 1IGYA 1T7WA 4C4KT 5I1AA 4ZTPH 3VDBA 4YBLC 3HPJA 5HHOB 1P69B 4L8CB 2B1AH 1MIEL 2ZUXA 3SJVE 3CLFH 1ZHLA 2X4PB 4UV7H 4WHDA 3EYQC 2FGWH 4RFOL 4ZXBA 4HK0B 5JHLL 4GBXA 1A8JH 3B6SB 3P4NB 1NL0H 1KLFA 7CGTA 1T2XA 4PJFF 5GIRB 1LP9B 1A6VH 1OAKH 1I8MA 1RULL 1S8DB 1AI1H 2X4UA 3Q0HA 3VE0A 3T1FB 2J8UA 3LQZA 2Q7YA 1ZXQA 3SDDA 2VH5H 4F80A 1F11A 2NW3B 4HF5H 5ERWA 3TN0B 4M3JA 4LIQL 1OW0A 1SJVA 2X40A 3H42L 3DRQA 1S3KL 4QNPE 4YDJA 1JHKL 1J0ZA 1N26A 4XAKD 5D7LE 5JIKA 3O9WB 4ZO7A 4MAUL 2AGJH 5BOZG 3IDNA 2G5RA 3UO1L 3HZVA 2EE2A 4OGZA 3GMMB 4NQCE 5GRZA 4YEFA 2W9LA 4LLQB 4LSDA 1G84A 1PW3A 3FQNA 1R24B 1HI6A 5C0AB 1I7RA 2KH2B 2IG2L 5FOJA 5JIPA 1RUML 4U1JB 3R06A 1JTTA 1IKFL 4OF3A 1CE1L 2DD8L 4MNGA 5GS0D 4X6CA 4X83A 4PLOB 1NFKA 4OZFA 2QQKL 4JY4B 3BGMB 1RIVH 4MNQE 2W60A 1TZIA 3FJTA 5DJ8B 4MJ6A 4H20L 4LNVA 2DTSA 5L2KD 3QZWG 5FHBH 4LCUA 4C56D 3OX8B 3QUKA 4UQ3A 3ISWA 5CJXC 1OQXA 3EDEA 1PX4A 4M48L 4JM4H 1YYLL 1OCWL 2VLJB 2CDEA 1T2QL 2A83B 4ONGH 5CINL 1F3DH 1AGCB 3VGAC 3J7HA 3W82A 2IAMD 4K8RL 5KVFL 2C1PA 4BQ6A 5DJDB 3QUYB 2F5AL 2YEZA 4L29A 5C0GA 1EERB 4L4JA 4IOIB 3FRPA 3HKFA 4ODSH 5EN2B 2JB5H 1G7JA 1JGEB 1OTUC 1WCQA 2ZG1A 1VGKA 4N0UA 3D0VB 3ZKND 4XVUC 3DURA 3HE7A 1GXEA 4FZ8H 4LPCA 2A74A 4HT1L 2CJUL 4Y19A 3OKEB 5E2VH 3SDCC 2EICA 2LTQC 4FN0A 2R15A 1U3YA 1BMGA 3LCYA 4L4TA 5LKNA 4W4NA 1T5XB 2GAZA 2CIIA 1ZGLM 4CW1B 4TQEH 4D3CH 1T80A 1MRDL 2IADA 3LQAL 3QA3A 3X12A 1M7DB 1Z9MA 2DQDH 3HUJA 1K4DB 4IRSA 1VADB 3KPTA 5ICYB 1IAOA 1BQSA 3QI9A 4POZD 3FZUC 3RZCD 2X89D 3ROOB 3MBED 2D03H 3MBEB 4R26H 4Z0BH 1F4YL 2VTFA 2HJKB 1D5MB 4KV5E 4IOIA 3FT2A 4IRSC 4E42B 1KCSL 4J8RB 2GJZB 3B3IA 3SCMC 1UENA 2GY5A 1HE7A 3X11A 5AD0A 5C0GB 4EI5C 3KYMA 1XF3A 2HYMA 4K55A 4WW2B 3U46A 1SEBA 1OARH 1QACA 1YQVL 1U8LB 3QEQB 2DF3A 3L5XH 4XBGB 1PDKA 5HHOD 3FO9B 4DJMA 2FJGA 1ZA3B 3FFCD 4FP8H 1RZ7H 4XP9H 4ERSH 3CH1B 1IQWH 3GMRB 4UOW1 1DQLL 1FVDB 2AV7B 4GG8A 5KSBB 4KROD 5JOFB 4K7PL 3MV8A 4YHML 4B53A 1J86A 4NBXB 4YK4C 2AJ3B 1R6VA 2YD5A 1T1XA 3ROLB 3WJJA 4DFHA 4PV9A 2EZ0D 4Z7NE 5CEZL 5L2KB 3MRQA 3OGCB 4HWZB 2ZG2A 4W4OC 3SDYL 5BZDA 3MODL 1A6TB 4MGXA 4PJIB 5DDHA 4MZ2A 4JR9L 2UY6A 4P99A 3BESR 5IW1A 1HEZA 2X7LB 3TZVD 4BK5A 2EC8A 5SV3A 4GG8B 4NKQB 1P53A 1B3JA 4LLYB 1IGFL 2DQHL 4K94L 2I5YL 3CFDA 5E4IA 1AH1A 2NY4B 1TPXB 4QF1B 3VWJC 5I74B 4KMQA 5I2IB 2GQHA 4MAYC 5DC0A 2OYPA 3U9PH 4NQCD 3GEWB 1TZGL 3CDGA 4WHTB 2FSEB 3VFSB 3VCLB 1OP3H 3ZE2E 3WFEH 1VGEL 1O7SA 4IM8A 3SGKA 5KSUB 4UZGA 1BFSA 3GMQB 1MCSA 2VN7A 2GJ6E 5D70L 2WANA 3NCBB 5C3LD 1JYXA 4K3EL 1ZEAL 5IMKA 3QCTH 1UA6L 4Z7WF 5LXGH 1OT1A 1RURH 3VWJA 1A3LH 3GO1L 1MIEH 3W39B 3WFDL 1OGAB 2NW3A 2JCCB 3RQ3A 4KHTH 3RVXC 1MFBL 3PGFL 2IPTH 1EXUB 5ACZB 5C8JB 4NM8L 1DQTA 2DDQL 5C9JA 5GRWA 1HSBA 2EC9U 3IJHA 2W65A 2X70A 3AM8C 1BLNB 3O2DL 4JG1L 3OGOE 1YMMB 4OB5L 2NY2D 3KPRA 4LQFL 5T3ZH 5IFJA 5I8EA 1NDGB 5J1TC 5EU5B 4U1MB 1KB9J 1J0HA 1FL3B 3TFKC 3N1MC 3ZE0F 4K3HA 5CIPH 5IF0B 3QG6A 2R4SH 1CGWA 2CUMA 3GKWL 1OW0C 1AIFA 5GGQH 3RHWF 3PP3H 4IIQB 2XYCA 5KS9A 4L3EA 1L7IH 2NY3B 5GGUB 3LEVH 4NHUB 4WUUA 2HVJA 2IBBA 1IRAY 1N4XH 5L2KE 4P3CL 3K8MA 4PGDA 1G7JB 2NTFB 1D7FA 1UJTA 2C1OA 2Z4QA 2QHLA 1NUNB 4XAKE 2Q6WA 2Z93B 4HC1H 3FAXA 2V2TA 4MCZA 3HNVH 2J6EH 3KPSB 1KOAA 1CDBA 2HKHL 4HWZA 2CRZA 3KXFE 3T08A 4Q9CA 3BH9B 4MCYA 5JR1L 15C8L 1F3RB 2GT9B 4OTXL 4HIXH 3RAJL 5HVFB 2RB8A 3HMXL 4OLXL 1K8IA 1MWAB 4OD1H 4PP2A 4K3DL 5JDSB 4QRRA 3H0TB 4G6JH 3EYFA 4BSVB 1G9EA 2H26A 3O3BA 2VZVA 1CXFA 3NCFB 1YEKH 5DK2B 4NC1C 5E24E 4OUUA 1DBBL 2WUBL 3KAAA 3UJJL 1CFVL 5KW9H 4HWBA 1YYLH 1FLTX 3MRBA 5D1QB 5HPOA 2VKWA 3MRNA 4IBLT 2QLVB 4MQXD 4C83A 2BVOB 2Q6WB 3TZVC 3GJEB 5F1IA 4P4KD 3K1DA 2F5AH 4AJ0A 1SYSA 4ONFL 1RZJH 3O3DA 1KN2H 5JXAL 1CFBA 3R0MA 4WWKC 5FHAH 4LIQE 4NWTH 3ULUH 1FO0B 4LBEA 5DJXA 1N7MH 1A0QH 32C2B 4NZUL 4N8CH 1WVZA 1QLFB 3MUZ1 1RD6A 4HHAB 2H32A 4DGYH 5I9QC 1B2WH 1QFUH 3GSVB 4RGNE 3QEUB 3MJ8A 2VXQL 3QWRA 3W9EB 2KZWA 3RFZC 3EIFA 4TQEL 3O4LE 3O0RH 4O4YL 2R8SH 4PRNB 3DIFA 1J8HB 3S97C 2NPLX 1M4KA 4PJCF 5B4MC 2RAMA 3HAEH 1XF5B 1HH9A 3MNWA 1F11B 5HYSB 4YDIH 4DGVH 4R7DB 3QEQD 2FJHA 4ELKB 4MS8C 4CBPA 5T5FL 2MCPL 1U91B 2Y7QB 4OD2A 3G6AB 2VRAA 4XB8A 2D03L 3VXQB 2ZUYA 1I9IL 3RWDA 2YD7A 3L3IB 1ZMYA 4WHTA 3GSUB 5FYKU 4X6DE 3AGVA 1JFQH 4GQPH 1TJHL 2CD0A 4ODXA 2XQBL 5JW5B 1KNOB 2NNAB 1OTTC 4JN2B 2O5ZH 1WEJH 1FIGH 5IMLA 4WO4C 5IKCA 3DVNB 4R4BB 3QQ3A 4JB9L 4GS7B 2DN7A 7FABH 3F7YA 2JB6A 3ZMRA 3GMNA 5E8DL 2QR0A 1A7QH 1I3RB 2JIXA 3PV6A 3TT3L 5FF6A 1MCFA 3WE6A 3MYJB 1CTOA 4RWYL 5DDHB 1ZSDA 2NYYD 3C5ZA 3U9UB 4DVRL 4MSWA 1VCAA 1KGCD 4NOBA 5CIPB 5J1AA 5SWSB 1TNMA 2YPLD 3UZVB 4F8TA 4GMTH 1XH3B 3ARGA 5IJKA 5MHSD 4NNXA 3ULUE 4WI5A 3UPAA 4U1IB 1GGCL 3RWJB 3IFNH 4L3CA 1H3VA 5ITBH 1JI2A 2N4IA 1Y6MR 3C6LB 3IDIB 2FYYA 4HWBL 4P3DB 5I15L 3FQNB 4D8PA 3STBA 2P7TA 4PRNA 5F1KC 3LMJH 1JPGB 1NC4D 1WAAF 1XR8A 4UIMB 3UDWA 5J89A 3BQUB 1XGYL 1KJ2A 4M7ZC 4DOHB 3KWWB 2CIKA 4JM2D 4Z7UA 2K7PA 3VFNB 1KLUA 3MLWL 2YUVA 1U58A 2XA8H 5ACLA 4LLMA 3QULA 3AS0A 3KJ4C 4KRMB 4KTEL 3H9YA 3VXOB 5IM7A 4OF6A 4X7EC 5EWIL 1QBLL 4ZUVB 5F8QC 4P46D 2VB5A 4G80B 5C0IB 1MFCH 2Y25A 4XBEH 4FQ2L 3VD5A 5B38A 3U79A 1FZJA 5D70H 1QSEE 1IAOB 2W9EH 1TVBB 4WEUD 4XXDA 1L9NA 1RURL 5DHYA 4ZAKA 4OF5A 3JUYA 4X6DB 1OGAE 1RZKL 1F3JA 5IVZA 1IVLA 4MLSA 1CDJA 2X4OB 5TE7L 3GMLA 4MJ2A 2Q8AH 5IQ7L 3VD3A 3QA3B 3X12B 4F8QA 3EOTH 4XPBL 2CUHA 5I76B 1VEMA 4CVXB 3BZEB 1NSNL 5ISZE 4KHXH 4OCNC 4M02A 2OP4L 3TH3T 2B4CC 4XZUB 3MV7B 4PJFB 1LDSA 2DMKA 4U1LB 4PJHA 2F53D 3QUXA 4NC0B 3HR5A 5EOQL 4J3TA 5E08H 1A6WH 1IQDB 3PQYA 3UTQB 3LKPB 5GZND 3E3QC 1F58H 3C6SB 2BSTA 1RK1B 2VERN 5C2UB 2BJMH 3FTGA 3P77A 3BWAB 4HPOL 2IQAB 5GSVA 4IDJL 4ZXBD 4YR6B 3BSZH 3JXAA 3UTQA 1BFTA 3WS6A 5DR5H 4JKPH 4Y2DC 3PXHA 1LO2H 3D39A 4TULH 3C6SA 4MA8L 4JHAL 3CZFB 2QSTA 4KV5F 4I0CC 4OI7A 4GRWB 5HBBA 1R5VB 4Q9QL 4AENA 4ZOEA 4WW1A 3DNKA 3ZYJA 4LHJB 3C2AL 1QFWM 2VL4A 4PRPB 3SDAA 1TTUA 1CLOL 3MPCA 1HHJB 5I1LA 3U7WH 4JAMB 4JLRA 4LPWA 2NY1C 3NIDE 2PNDA 3RKPA 4EUPG 4DUXA 2VJXA 3RWCB 2R2BB 4LSUH 5I76A 4XBPB 3RZCB 3WSQH 4WY7H 2FIRT 5GGSB 1YDPB 3VJ6A 3KLHD 1OAYL 1DBAH 3MLXL 1KTDB 3K8KA 3BO8A 4AG4L 1S5IH 1QSEA 1RZ8B 1SYSB 2NY7L 2PTVA 1T3FA 3BPNB 1HH9B 1X5HA 2Z8RA 3LPGA 4S2SB 4M6MH 1HQ4B 1AFVL 4OIIL 2IGFH 1B4JL 2B1HL 3TBTB 3VG9B 1NFDB 5DMKA 1BD2A 5C08D 4B5EA 4JZJC 4YDLB 2FJFA 4KDWA 2EKJA 3HHRB 5B22A 2Y06H 1K85A 4ONFH 1QRNA 1F02I 4A2LA 1BZ7B 4YAQA 1KC5L 4NWTL 1WBYB 2FR4B 4H8WH 4C56A 1UXSA 3AXLA 1T20A 3NCYS 1A6AA 2UYLB 1IC7H 1MOEA 5D7SH 5DO2D 4KZDH 1R5IB 1T3FB 3GK8L 2ESVE 1WWWX 4PJXB 5GGTH 1JPSH 3GSNB 1U8IA 3K3QA 4PGEB 1OGTB 3RWHB 2D0GA 1RK0B 1NANI 5JPNA 1WGOA 4MXWH 5CEZD 1T21A 2FHBA 2NY5L 4NN6B 4YQXL 4GOSA 2IAMA 2VDPL 5IFAH 1PLGH 4M62L 2BSSB 1RZFH 2CXKA 4LSPH 4XMPL 3D39E 4HAGA 4AEFA 4APQA 5BZDB 3CXHK 5BJTB 4M7LT 4TYUA 4Q6IA 1QPXA 1W2KT 3D25B 5EUOA 4NT6B 2MCPH 3MUGB 1N6VA 4P2OA 2ADJA 2JJSA 3VFTB 4WV1A 2FGWL 2RQ8A 3RBGA 4MZ3A 4FFWD 4RNRB 3RGVA 4BSWB 4NQDB 4Z18A 2F8XC 2ITCA 3NCEB 4L3EB 2VO5A 5L6YL 1WEJL 1XGTA 4JQIL 1HH6B 4GRWF 1A1NA 3EYFB 4PREB 3UTTA 1KJVA 5D1XC 1U6AH 4WFED 5CEYB 2E7LC 3ARBC 1OLLA 3LKOA 1GGBH 1YMHA 5I66B 3L5JA 4HXBH 4HKBB 1CLZL 4IRSD 4MQXC 5DJ6B 5EU7C 1I9RL 3CZJA 5HYQA 2R9HD 4XB7A 2VDOH 5BV7L 4IMKA 4PY7B 1YPZA 4J1UA 3HB3D 4PJ7E 4NRXB 1MFNA 2ZSWA 4MYWB 4U7MA 2VXUH 3BKML 1VFAA 4PTTA 5FDWB 3D85B 3MBEA 4XP4L 3KPLB 1DR9A 1CS6A 1F45A 5KSBF 2X9XA 3KWWA 1U95A 1T03L 1B90A 3QIUD 1LO3H 1G7HA 1IMHC 2A73A 1JUFA 4LEXH 1FNHA 1N8ZA 1FFOA 3BQUD 3FN0L 1NFDA 5DMKB 3MRKA 3Q5TA 3RY5A 1FL3A 2Z91A 4U0QB 2ICWI 1FGVL 3ZYOA 4JN1L 4N5EC 5FO8A 3OKMB 4MA7L 4MB4A 2BOCB 2IPKB 2HLAB 4HIEB 1CFQB 5EOTB 2H3NB 3W0WE 4EN3C 3CFDB 3GJEA 3NBNA 3OKKB 1MCWM 2WLYA 3T0VA 2DQCL 3I6KA 4GKNA 3TT1H 4RSVA 3O45B 4QEGA 1N0LA 3L95B 1NAML 2BVPA 5HYFA 1UM4H 3QG7L 3D69A 4AL8L 2KPNA 4KQ4H 4JFEB 5I1EH 1H5BA 1ND0A 1ITCA 1MFCL 1UWGH 4LPVA 3HFML 3O6MH 2VDMH 3EBAA 5CD3B 1P2CB 2L7UA 4PJ8A 4ZMAT 1J9CT 1W72A 5IV2B 5FYLD 3GM8A 5HSFA 2HN7B 3OBAA 1EEYB 4NPYA 1V7NL 3UEZA 1CE6B 4GSDH 5ESQA 4S1SL 3QNZB 2OMNA 2DI9A 3VXPA 4ZTOH 1S5HA 2PYEA 2NXYC 2D7TL 3WD5H 2H8PA 1NLDL 4HT1H 3PWPE 1GGYA 5EOQH 3QXWA 3ZKMC 1AD0A 2FB4L 3MUY1 4RGOH 5L9DL 4TN9A 3C5ZC 2ZUSA 1Z6JT 1FC1A 4PGDB 4QXUL 4D94A 3L95A 1OAUH 1BEYL 3MJ9A 1XIWB 2EYRA 4MCZB 3ARFD 3QFJB 3P0VL 4XNMA 1OD9A 4X6CB 1H8SA 3QNXB 5C0DA 4KKCC 4R4BA 4WUUE 1QYGH 3FL7A 4KJYA 4KKAC 5JOFA 2QQLL 1FFPA 2M1KA 3O8XB 3Q1SL 4Y4KA 4EI5B 4EKXA 3CU7A 5CSBA 3BD5A 3BPNC 3AROA 4KI1A 4CNIB 4M5YH 4LLQA 3THML 4JZJA 3UYRL 1P1ZA 2FNBA 1HZHL 4IRSB 5DVOA 1AJ7L 1T83A 1YY9C 4QWWD 3RPIA 2IMMA 3D18B 4JRYE 4UBDC 2B39A 2CLZB 5I1KH 2BNUB 4GUPA 4XWOC 2BVUA 5T1MB 4G8EB 2AW2A 1ZHNA 1RUQH 3B9KA 3K4AA 3DI2B 1IFHH 5F9OH 4ALAL 4DK6A 3SBWC 5JNYB 4H0GA 1X6NA 4PJ5D 5KSVA 3PV7A 3UC0L 1XGQA 3ZDYE 4DZ8A 1BM3H 3DIFB 2NY1B 4Z9KB 1MFEH 1JWUA 4NQEE 3MREA 4LHUD 5JOEA 3IJSA 4OFDA 5EB9A 3W0WB 3DXAD 4LNRA 4JZNA 5K9OA 1OAYH 3GSVA 3L3KB 5E00A 1N5AB 1E6OH 2G60L 3ES6B 5HI5D 1WFUA 1QO3A 3FRUA 1IAII 3MGOB 4GRMA 4MXQD 4X7CC 2GITB 1I1AA 2F54A 3GUTA 32C2A 2FBOJ 4ZYKB 3CLEH 4KZEH 3S37X 4PRDA 2EE3A 2IBZX 3OL2A 4U2YA 4X80H 2GFBA 3KLAA 3E8UH 3QPQD 3RWGB 2R0ZL 1P84J 4RIRA 5E7BA 2PKDA 3FO1A 1QLRB 1FGNL 1HOCA 3O8XA 4Y4KB 4WV1B 3IKKA 4WI6A 1KC5H 2VMFA 5F3HB 2VYRE 1CGSH 4OAWB 2ID5A 5DO2C 1TTFA 5FKPB 1F8TH 1EZVY 4NO5B 5I1JH 3ARYA 4NO2A 2BY2A 1JNNL 1JGEA 4WVRA 1IGFH 2DQHH 1J1OL 4I3GA 1ZSDB 1IILE 5IVOA 4OZHB 4HGWB 3QBTB 3S4SG 1T66C 3I6LE 4NO5A 2SEBB 3QDJA 1KENL 4OLUL 5GJTL 3MLZH 5CLWA 4BSJA 4WIQA 1PLGL 3WFEL 4OFYD 5DMIL 4ZFOA 3MV8E 3BIKA 1E6JL 1NQBA 2DYPA 4HULB 4K23H 2R69H 5C0CD 4G7YH 5A2KH 1NEUA 1ZEAH 2WBJD 4JG0H 5EO0B 2OTWB 1NDGA 1FNGB 1PEZA 2I26N 3A6OA 1JE6A 1AY1L 5D93B 1NFIB 1TVDA 4DCQA 2AJYL 3RNQB 4LFHG 5F93C 3I84A 1N64H 5EBWB 5K9OB 4OLVL 1Q1JL 5BXFA 4M1GH 4FXLA 3AVEA 3WO4C 2GKIA 2HJKA 4HFUL 4XWGL 4WUKH 3IDGA 4XVTL 5SV4A 3W39A 3BKYL 5JPMA 3BIAX 1NFDE 5K59E 3DYMA 2E9IA 4JFDE 2ZSVA 4HXBL 2XTJE 1I9RH 1MLBA 2C7UA 3QG6B 1DSFL 4PLJC 1V3LA 4I77L 1N5YH 4YXLL 1C5BL 4KTDL 3D3VA 2R29L 3KLSA 1XGPA 2X5PA 4RMUA 4S1DC 1LEIB 4XNUL 3TPKA 4FFZH 4D9LH 1IGYB 3SO3B 3KYNB 3EO9H 1LEKA 3ALXA 3DYOA 4G9FA 3L3JA 1S9WA 4YHKH 4Y19E 1SEQH 2HFFA 3VW3L 4HW6A 3VXMB 1DLHB 1KF9B 1TPXC 4O5LH 4P59H 3UTTE 4PJCA 4F7MA 4B0MM 5KG9B 5T3XH 3QUYD 4G6JL 5IHZA 3DPBA 4F2MA 1UZ8B 4XMLL 1QNZL 4KAQH 1I8MB 1FYTB 1T1XB 4W70A 2F19H 4WDIA 4NN7C 1INDH 3T0AA 1GPOL 1YPZE 5JIIA 5F44A 5FGCE 3RNQA 1JF6A 4PB0L 3O3BB 2X9YA