4L9LA

Crystal structure of a human valpha7.2/vbeta13.2 mait tcr in complex with bovine mr1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
198
structure length
196
Chain Sequence
NIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAPLDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords Beta-2-microglobulin, MHC class I-related protein
total genus 35
structure length 196
sequence length 198
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lA02
4Z0BL 1JTTA 5J11C 1Q9WB 5DMJB 5I1EL 5E2TL 1VPOL 5EWIH 4U1MA 3WNMA 1YNLH 5IV2B 4Y4KB 3VXUD 3MLUL 3HKFA 4XBEH 5TDPA 2LTQC 3WXVL 4LARH 1OGAD 3ZT6A 5K9JL 3TBTA 1OTUC 3S3SA 4NZTH 3QQ3A 4NHUB 3SE8H 4DN4H 2VISB 4IMKA 4F7EA 4BKLB 2NX5A 2HRPL 4R7NB 1OAUL 3SE8L 2DLFH 3RKDD 3L3GA 1RU9L 3T0EE 3IDGB 4FZEH 5DVOA 5FHBH 5HHMD 5ADOL 5D2NE 4APQD 1F42A 5D7JD 1GGBL 2FWOB 2MWCA 3BP6B 1HH9A 1RFDH 5CIPA 1AC6A 1ZSDB 3FFDA 1A3LH 1T66C 1ORQA 3IDIB 4JRXE 1MCPL 2P8PA 3PL6D 1K4DA 3TZVD 3KDMB 3S7GA 3ZSSA 3AS1A 1EHXA 4FQHB 2GCYA 2R0ZL 5EOTA 3I6LE 5EOCL 2RFXB 2HN7A 1GC1H 4GKSB 2Z35A 3U7YH 3SKMA 1FE8H 1GGCL 3V5DA 2M2DA 3MA7A 1FV1B 5H37G 3V95A 4F7CB 1GVIA 1A1NA 1S7SB 1P2CA 1RZJL 2X41A 3VCLB 5KW9H 5I30L 3L3OA 4PG2C 3VH8B 3DOSA 5TQ0L 3VFOB 5AG8A 3KJ4B 3FCTA 2VXTL 3C6SA 3CFDA 1FH5L 3FQTB 2XACC 1OM3H 5E2WH 3K2UL 4RSVA 4OAWB 2QR0B 2NY1D 3LKNB 4L8DB 3HE7B 4ODTL 4HIJB 4PRNB 5HYQA 1KPUB 1EEZB 1W72L 4KU1A 2A77L 3GI8L 3DSFH 1DN0B 3C6LB 3RWDB 5MEQB 2DOCA 5FA4A 4N8CL 2P5WD 4YPGA 2VERN 1KN2L 1V7NL 5LGHH 5I1JL 1U8OB 4FS0A 4NO3A 2AW2A 3ME0A 2Y1VA 3QQNA 3VI4F 4L8CB 3PWLA 3X12B 2HFEA 4BK5A 3E1F1 1QSFD 3VXRD 4L29A 4HS3B 1J5OL 5IGXL 1MY7A 3ULSB 2Y72A 4JM2F 2GJ6B 1HDMB 4M1DH 4WFGD 1MCIA 4F9PA 3QIBD 1JZ3A 3G5ZB 2R2EA 5SWZE 2VN7A 5LWYH 4HFUH 2BVOB 2WQ8A 5LCVL 5IVZB 4EJ1C 1ZA6A 3DTXA 3BZ4B 3NCEB 2GEEA 3ARFC 4QHLB 3F6IA 2HFFA 3ULSA 1V3LA 5IEKA 1S7VB 4UQ2A 2ADIB 2CMRL 1RZJC 5F8RC 3MQIA 4UI2A 3TYGH 4KK6C 4L8CA 3AGVA 1G6VK 1QO3A 1TJIL 2R29H 3MJ9A 1OQOA 1Q9KB 3V7MA 3V4VH 2FEDC 2VR4A 4GKSA 2Q1EA 3KLSA 4PJAB 2P45B 4ZSOE 2YWYA 5J9PA 4XX1G 5HVWA 2XFXB 5HI4D 3VG9C 2F58L 1D6VH 4EEEA 2A9NL 2QKIB 2QR0A 1PLGH 1T1XB 2HP4A 4LOUC 5EC2A 2IANB 5HHPB 1QLEH 4ZS6C 2DDQH 2G2RA 1UZ6E 4MSWB 3GRWL 4LLDA 5DUPH 2Q8AL 1GZPA 4C56B 3U9UA 3WL9A 1KENH 1JZ5A 5F6IB 3TESA 4LNVA 2GI7A 3O2WH 1WEJH 3CX5K 1IAOB 1QFPA 5DUBA 4D9RD 1UENA 2X89A 4I0CC 5D1XC 5ILTL 1BVZA 5K93A 4JG0H 1PZ5B 5C07A 1WBZB 4I5BB 2MCPL 2Z4QA 2GY5A 5C0GA 1JZ4A 2P24A 3IU3A 2FZ3A 2M26A 3RDTA 1ZSDA 2ORBH 3FFDB 4GKOA 2O5XL 4P9HC 3VDBA 4P9HL 4DAGH 5J6GB 2VE6A 5EG6C 2D7TH 2VL5A 5KS9A 3MBXH 1CD9B 5D4QA 1P7KA 5IMKB 1YPZF 3SGKA 4TNVF 1LEKA 4HJJH 1LE9A 3U46A 3ZKQD 3VA6A 4KTEL 4HJGA 4PJDA 1AE6L 2G9HB 4J6RH 2P4AB 3D18A 1CFBA 5F96L 3FT2A 2NY6D 3JV4B 3U1SL 3QBTB 5DLML 1VSCA 4ISVA 3Q0HA 4OGXH 2CUIA 3BPNC 4G8GE 4OZHF 2EC9U 5B4MD 3MRIA 5TH2B 1EJOL 1EMTH 1DJSA 4UNUA 2V5MA 4TSBL 4PRPA 4LLMA 4YHMH 4HMDA 3OAUL 4OCSL 5FUZH 2ZKHL 1P7QD 3L95A 4UV7H 4M4RA 2APXA 3I2CH 3EJJX 1QOKA 4L3CA 4NQED 4HAGA 4KJWD 1I7RA 3OG4B 4WRLA 1H5BB 2O61B 5IB5B 3MLZH 3N1GC 5ALCH 4G7VH 5TQ0H 1AHWB 4NRXB 5HHXH 4NZJA 3TBYB 1BF2A 3MFFA 4Q0XH 3VGDA 2A1WL 3QPQC 4YNYA 5ICYB 1C16A 3S35L 4A2MA 2UUDK 1LWRA 3UBXI 4LVOB 1FBIL 2BDNH 5F7HA 1VFMA 1A02N 2BSTA 2NZ9C 2Z91A 5ALBL 4G8EB 1JF5A 1N0XH 1BD2A 4DFIA 5FOJA 1AR1C 2H26A 1XGYL 2ZUTA 3U0TB 1VGKB 3VXQB 4B50A 1V3JA 3RBGA 2XZQL 1OTTC 2JB6B 2AJSH 4ZD3H 5JOEA 3U4EB 2CIIB 1J05B 4MMZC 5K59F 2B4CC 2A38A 2W65B 1FDLH 5E8OA 5IR1A 12E8H 1C1EL 1U8MB 4MNQA 2I9LA 4JM4L 1MIMH 2DTMH 3QJHA 1A0QL 2CKNA 4YEFA 1J0KA 4G80A 1EMTL 4NCDA 3WBDA 1G6RH 3DROA 2VDMH 1T4KA 3OKOB 3DURB 1NAML 3JTSA 2R15A 1KCRH 5D5ME 3RX5A 4UU9A 2ARJA 5ACMA 1EHLL 3MLSH 4PJXA 4HF5L 4OGXL 1UQSA 5D9SB 2F53A 1Q94B 5CGYC 2ED9A 3IYLW 1A3RH 1LNUA 3DLQR 3GEWB 4HH9B 3NABH 3GMMA 5CP7A 3KPPB 2W65A 1LK2A 3MUJA 4X7SH 4RZCB 4X4YB 5IR1B 1MCNA 5JW3H 5FECB 5HGGS 4NNPL 2VXTH 3TCLA 5IQ9B 2VC2L 4MNHB 3U4EA 2I9TB 3OR6B 4M7ZB 4CMMB 4MCYB 3MV11 4PRHB 3CFBA 4ODUA 3UTOA 5SWZD 4XCYB 3U0PB 3ZZ1A 5IW1A 1YEIH 3LPFA 5I6XB 1IEBA 3O2DL 2ZCKL 1TQBC 5CFHA 2AABL 1SYVA 4PJHE 1DVFD 5IB4B 5ACZB 1HN1A 4PUBH 5D71L 3U4BH 2AJUL 3H9HB 4MXQC 5CCKH 2HT3C 4JQIL 4YC2B 4OI7A 3VFVB 4PRHA 5I75C 4OD1H 1N7MH 1ZE3C 4ZFGH 1CI5A 5IQ9A 3TCLB 3WDIA 2LU4A 1S9VA 3CK0H 1G9EA 3O3AA 1P9MA 4RZCA 2APVA 1MJUL 5FK9A 1UYWL 4X5XB 2P44B 1B4RA 1KSRA 1CXIA 3D85B 4KVNL 4JY6A 4HSQA 5DC0A 2CDGB 5DHVA 2FO4B 5D1QA 3PWPE 3QDME 2EDLA 3QUZD 5DRZB 1UWXK 2PUQT 4YAQA 5BV7L 1BD2B 3D39D 3VD9A 3JWOH 1PD6A 3MLXH 3D9AL 1SYSA 2A73B 3LS5L 3SDAB 1R3HA 1CBVL 4HKJB 2EE3A 3EO9L 3Q5YA 4Y16D 1KLUB 3WFHA 5IWLC 3WJJC 5D1XA 4ZPVA 4NFCA 5I15H 4XVJL 4WV1C 5TGBA 2PNDA 5ID1B 2EXYD 5GS0C 1JNLL 4GAJL 4JHZA 4GXVH 2UVFA 1Z6JT 3B5TA 1RUAL 1BVKB 4IRSA 4ODSL 4ZSOA 5F7LB 5IVXB 1A9BA 1U8LB 3L5JA 3WUWA 3QEQD 3UTZA 4NN7C 4ZOCA 2K7QA 1YEIL 4DGVH 2VDKH 3HUJF 2IADB 4NQSA 3IU3B 3BFOA 1IL1A 2H45A 3P0YL 4Q9BA 3MLWH 4Y4HD 4JM2D 4K3DL 2R4SH 4YEEA 4PJ5A 5C2BH 3SDDA 3RWGA 2D31A 3BXNA 4ODWB 4JZOB 4X5WB 1TETL 3QDGE 5FIEA 2VLRD 4RBPH 3FHQA 4OLVL 2DKSA 4L4TA 2G9HA 5JW5A 4MX7B 3HE7D 1IGCH 4KAQH 2EKJA 3B9KC 4G8GD 2A6KA 4Z9KB 5ECJE 32C2A 3QFJD 5I8KH 1X9QA 4DKEL 4XMPH 4M1DL 4IOSD 2DKUA 4K94L 1F4YH 5ESQA 5E94A 3D87B 3T0ED 3X13B 2JIXB 2BFVH 5JHLH 1FZJB 1T03L 2OYPA 5F7KC 1OL0A 3IETA 3QG7H 4WJ5B 4IJ3B 3BVNA 5FUCC 2JIXD 2WWKO 4RFNC 5KTEH 3EDDA 3K2UH 3EYSL 4NQDA 1Q9LB 3PWNB 1FPTL 3L3KA 2WM0A 4ODTH 2V17H 3QCUH 4OJFH 4HWZA 5F7EL 1N5AB 1A7OL 1G9ML 2ZSVA 3TCXA 5I1IL 1K8DB 2YEZA 4NO2B 1TCRA 2ICEB 1BX2B 2PO6B 5IEKB 3ARED 1ZT4A 5M94B 2JELH 3QUZB 1NANH 3NCYP 4FP8H 5DD5H 2FJGB 1NFDF 1DLHA 2WSKA 3CLEH 3N06B 3T8XB 2E9IA 1MPAH 1WZMA 4R97C 3FKUS 4RGND 4HIEB 2DLHA 1RK0A 4MJIE 3FQWA 2UY7A 2XFXA 5H8DA 3NA9L 5ITFB 3RIFF 2IALA 2MTPA 5I19H 4XXDA 4Y89A 3VJ6B 4W70A 5HY9A 5DJ0A 4MAYD 2CLRA 4OCMC 3VGFA 2QSQA 4M5YL 4PV8A 4WU7A 1EIBA 3IB4A 1AI1H 2A83A 4XWOD 4H0GA 4RX4D 3V7AE 2ZCLH 3MGTB 1AJ7H 2ZUWA 5I9QB 5BZDB 1F5WA 5CBEB 4W6WB 1SBSL 3OAZK 5D7JC 4K94C 4LVNC 2A74B 4ORGA 4X4XA 1VPOH 1KJMA 1HQ4B 1ZHLB 5DD3L 1KCVH 4X4MA 5CMAB 1J8HA 2OR9H 5D71H 2FHCA 4NPYA 4C56D 4HG4K 3LKNA 4L8DA 4DUXA 1JF6A 2R0LL 3IJHA 2ADFL 4EI5B 2C5DC 2LFGA 5F9AC 3SJVD 3G5XB 1MHHB 4IEFB 1N7ML 1QA9A 3QNZB 2H1PL 3FO2B 3S5LB 4XWGH 2NQCA 4QNPF 4Q6IB 3D85D 5IBTL 5K9OB 4E0RB 3TO4B 4KGLA 2YWZA 5BRZD 5JA8B 3CFKA 1SEBB 2IAND 4LLQB 5J11B 2W9EH 3MMEA 2GUOB 1E4JA 2R1WB 1ZHKB 1EAPB 1AKJD 3DJ9A 2XWJA 4WENB 5C0BB 4LASH 5MI0B 1TVBB 1JVKA 1VEMA 4ZXBB 2YD2A 3GO1H 2P8PB 3T3ME 3HAEB 1LP9E 1CDGA 4XPBH 1A3RL 4WUUB 2Y06L 4NN5B 1DDHB 3BP6A 4HS3A 1BOGA 1EZVY 1I8KB 3CVHB 3MRNB 2V2XB 5LAXA 1L0YA 1AD0B 2MPAL 2NXZD 5I16B 1SY6L 3MA7B 1ZT7A 1G7IB 4JANA 1IT9H 2YPLD 3LD8C 2VLJA 3QUMB 2J6EH 3CFCH 4ZFZB 2YN5A 1T04B 3QFDA 3VFTB 2XG4A 3QI9A 2AQ2A 4HWEL 2DQUH 1I4FA 1CF8L 5B39G 3P4OB 2RCSL 5IM7B 2NR6C 4UDUB 3RI5K 2IC2A 1F4WL 2VZOA 4MA7H 4RDQG 5IBUB 1KC5L 4X9HA 4S1QL 4P2QD 2ZCHH 3X11A 4LRIC 4UOW1 3WXWL 3IDGA 4YXHL 3MRPB 3S9DB 1LGVA 5F7DB 1P7QB 4ZO9A 1CGVA 1QPPA 4LKCA 2F53E 5T3XE 43CAB 3HI1B 4ODXA 5I1CH 3BRGC 5AZ2H 5KSUA 3V5HB 4GRWH 1RIUL 5FHAL 3QHFL 1KCSL 5CD5C 1JN6A 2P8LA 3B2VL 4NKIL 4LGSB 1NL0H 4QTHA 1EGJH 4FQHA 4I3RH 3ARGA 3QZWA 1T20A 5HI4C 5JIKA 5KANI 1AGEB 5FV1L 3B83A 4XVSH 5C09E 3VGHA 4P46A 1DUZA 5HHXL 1A9EB 4KXZH 5I15L 1D3CA 3I6GB 1GOGA 3RHWF 5CEYA 1F8TL 4X6DB 4QHKI 3QIUC 2P46B 3VXRB 4Z7WF 3SGDI 3L5XL 4X8JA 1WISA 1RZGA 4PGEB 4K2UH 5IEHA 4RQQB 2C3WA 5CP3A 4BZ1L 4KK6D 4NDMA 2X4RA 4GG6F 3RGVA 3TJEH 1CE1L 4AK1A 1IT9L 1LEGB 3MV8B 1UGNA 4QLRA 2PN5A 3KYOA 1TVDA 1YN7A 1LD9A 5F1IB 4QRQB 1HKLH 4Y5YA 4OD3H 4F3FA 2ESVE 5IJVB 1P9MC 1U92A 4P23C 5FO7B 2ICWJ 5JLZB 4XB7A 1YJDH 3WNPA 1QFHA 4DWHA 1CFTB 4HC1A 1IAKB 5D2LF 1X44A 4O2FB 5C7XL 3RBSA 3W82A 3HG1D 2CO7B 1E4XI 3IGAA 5TF1L 4XPFH 5ISZD 5EULV 1KN4L 3QDJE 2DQCH 1IBGH 4QRUB 3AXLB 15C8L 1YZZA 5FYKE 4WI3A 5GHWL 1A7RL 3RWHA 3VDCA 3OWEA 4I0PD 3O8XA 2C7UA 3WCYA 4HG4J 4GBXC 4KHXL 2R0WL 1J1PH 3OAZH 4Y4KD 3VXUB 3MV7D 4L4JA 4BSWB 4M5ZH 5L7XH 2P47B 4R4FH 5DEGB 2AV7A 3MOQA 1ZGLA 3K7UA 2J8UA 1WFOA 3NCFB 2CR3A 2A6DB 4ZTPH 3TT3H 3L3HB 1AGEA 2C26A 4WO4D 4LKXB 1QYGL 4JPKL 1KYOJ 1NC4A 5BVJA 4HCRL 3TBSB 3HC3H 4RWYH 5GRUH 5A2IH 3O2DA 1DQJA 4OF7A 2IFFH 3WLBA 4FRWA 5L2KE 3JV0A 2WIIB 3C2SA 5E9DD 4TSCL 3QO1B 4K9EH 4Z7VB 1AKJB 2DYPA 4KJPC 4ZPTA 4DEPB 2W07A 4MNQD 1WSST 2CMRH 2BNQA 5HGBB 4XNMA 4LASL 4FHBD 1TJIH 3T1WA 5MENE 3KLAA 1NSNH 1CFVH 1TXKA 2RGSA 3MRCB 3CUPB 3C60C 1LDPH 5GZOC 3S88H 2YPVH 4RA3A 3UTQA 3PQYB 4YXKL 2W9LA 1E27A 1F45A 5LWYL 5FKPA 2IPUG 5L88L 4HKBA 4CU6A 1V5JA 2BVYA 5H2BA 2HT2C 1BFTA 2HTKC 4YX2H 2L7UA 1KNOA 4E41E 1B0WA 4JFOB 4JRXA 3TYFA 3REVB 1ZLSH 2B2XH 2MQ3A 4JJ5B 4U1JA 3MROA 1KTDB 5D7LE 1QFWM 1U8PB 1JRHH 4CU7A 5FV2A 5T1KA 1AO7B 4P4KB 1VCAA 4TQEL 2L0DA 2J5LB 1FNLA 1MRDL 1NFDA 4DW2L 2PXYC 2EICA 3E6HA 4HS6A 3WIFB 1R3IL 2ZNXA 3BHBA 5B8CA 2W91A 5MP6L 1T2XA 2HVJA 4NN6C 3TO2A 2GITB 4V1DE 3W9EB 2GFBA 2XKSA 3H9ZA 5BMFL 4JFYA 4XVTL 1M6OB 3DXAA 3P30L 4OZGE 2E7HA 3V6BR 4JDVB 1RI8A 4BSVB 5EU6E 1U8QA 3S5LA 3NN8A 5DTFB 1HHJB 3MRFA 1MPAL 2YBRB 4U1IA 2CDEA 3PABB 4YHOH 5HY9B 3VJ6A 1XGQB 3R06A 3HRZA 4WFGE 3SY0A 5A2FA 5GIRA 3VDAA 4LAQH 3HPJB 4NHCL 2WBJC 4X6EB 2W92A 4MQ7A 1UB5B 25C8L 1RFDL 2GUOA 3TT1L 3AUVA 3OKKA 5D7LB 2FX8L 3U9PL 1I9RL 2X40A 3TT1H 2AP2A 5DA0B 3VXTA 1IJ9A 5FYLL 5CZKA 1QLEL 5HGDA 5BS0B 3FOMB 3QRGH 1UA6L 1T1WA 2AXGA 4YHIB 3IXTB 3SEPA 4FOMA 5E1AB 5C09D 3VFMA 2J4WH 4RGNE 2BSSA 4P3WA 2DQUL 5GGUA 1B4JH 4KKBC 2HJFB 3QIUA 5D7SH 3RTQC 1YEJH 1Q9LA 3PWNA 2F5AH 4EI5A 3CSYB 2DLTA 2R1YB 2F8VA 4NPYB 4Q0XL 1ZXQA 3BZEB 3NZHH 1IC7H 2GK2A 3DWTA 4JRYD 4MA3A 3SE4A 2K9UA 4YZFE 5I73B 1T1ZA 2BHYA 4BZYA 1GPOL 4M62L 2AAVA 1LP9A 2ESVD 4OCWH 5TE6H 3GI9H 4JRYE 1RZFH 4M3KB 1BPVA 4ALAL 4M00A 4NO2A 3QWRA 3VMPA 4OUOA 4LCCB 2YSSA 2AV1B 4X98B 3OL2A 1VESA 4BSJA 5I74C 5FEBA 1UEYA 3BWUC 3EGSB 3KHQA 5E56A 1OAQH 3IU4L 2IBZX 4U6XB 1OGAB 3GSWA 3SJVB 5GJTL 3T0EA 2DI7A 3NIDE 2Z93A 1GJIA 1BFOB 5CS7A 1CT8A 5JW4Q 2UY6A 1AGDB 3FTGA 5M7QA 2JIXA 4B7IA 4UT6L 3P4NB 2IPTL 2C3GA 2AK4D 4OF5A 1J8HE 3MJ7B 2BVUA 2B0SL 1PQZA 2QTEA 4NRZB 2NLJB 2X1OA 3WIHH 1RMFH 5H37H 1NCTA 2R1XB 5DMKA 4GRMA 5LBSH 2IQ9L 4XMLL 5IG7B 2FEEL 1EZVX 5I17A 4X6EA 1HILA 1KB9K 4D9QD 5EZJA 1A6VL 4NGHH 1QVOB 4EZMA 1KT2B 1MCHA 4JZJB 1TITA 2GSGA 3STZB 3LH2L 2UWEE 3O6FA 1MCOL 3UTTB 3GJFB 5CJXC 3SDXB 5EH1A 5AYQA 1UH3A 3SOBL 2QQLH 3QQ9D 5F1NA 3HE7C 2EH8H 4IBLT 3FQNA 4WY7H 3VWKD 3NVQA 3BP7A 3F7YB 3Q6GL 2GITA 1Y6KR 5CILL 1J0IA 1LO0L 4UOW0 3CK0L 3IDXL 4H1LB 5B8CB 1YMHB 4LARL 4UIKL 1RJLA 4JAMB 2P5WA 5ID0A 2VLKA 1P4IL 4G8FB 4ZUVB 4WFFD 1SYSB 5GRXG 5IMMB 1QSFA 1HHJA 3MRFB 3VFGL 3CH8A 1RAMA 3QCVH 2XZCL 1HI6A 5LCVH 3REVA 1OY3B 1ZV5A 5F8QC 4DZ8A 3I75B 5E7BA 4XCFH 3DMMC 1I3VA 3ZKSD 4S1DD 4M8QA 5E0QA 5E5MA 1FBIH 1NBYA 2XY1A 5DZNA 4FFWC 1J12A 1BMGA 1AR2A 3GK8H 5DJ6A 1S5HA 1DLFH 2A6IA 3KXFD 2F53B 3ZDYE 4QRSA 3UDWA 4P59L 4XBGA 1L7TL 4NM4H 3QO0B 4FMKA 3KLAB 3MV01 3OKOA 3PL6B 3RUGA 4WI8A 2R2HA 3ULUC 4WO4C 1XFPA 2J8UE 4P4RB 3VGEA 1ZHNB 4Z5RB 1A21A 4NP4L 4F8QA 1X5YA 2BRRH 3B2UD 4J3OC 4F37F 4RFEB 2N1KA 5F89B 5F97E 5L6YL 3J7HA 4NBYB 5I1JH 1ZLSL 1ED3A 1BJ1H 2BOCA 2BZDA 3DRQB 4KRPB 5F93C 5IJKA 4X9FA 4K8RL 1CG9A 3S6CA 1MCBA 4G8IA 1PG7W 1KEGH 3WHE1 3QFJB 5TE4L 5D5MA 3QXUA 3TWCH 4U7SA 4WUUD 4QRPB 3DV4B 4G6JL 1J87A 3RUGB 5LJYH 4JHAL 4C59B 3IFPA 1P4IH 2W9DH 4PRAA 2F8OA 2I9LB 1YEFH 3SO3B 1LK3H 5GRYA 5TFSH 2V2WB 3NCJH 2VO5A 5IFAL 3BEWA 5KS9E 4YHYC 4W4OA 4V2BA 5DEZA 1M71A 3BN9D 2KUTA 3BPNB 3IDJA 5EU6A 4P23A 3S5LG 1AHWA 2IPKB 3EKCA 5J1TC 1R0AH 4GAJH 4PGCB 4WTZA 2E7LC 4M8QB 5FHBL 3EOYG 3LKSB 4XCCH 2PXYA 1F4WH 2ARJB 5DJCA 1GGBH 2X4SA 1D5IH 3ALWA 3CJJA 2GJ6D 4ENED 1A6WH 3OTTA 2OTWA 5JLZA 3MNVB 4P46D 5DJYA 5DLMH 2CH8A 2AJZB 3GMOA 2DL9A 3EHBC 5FUZL 1D5XA 1QFWL 4EOWH 3DYPA 1RUKH 4OLEA 5EB9A 1WCQA 4OQTH 3MV9B 4KVNH 4JQVC 2DLGA 2IBZY 4BH7B 4JG1H 1IGJA 5KN5A 1KLGB 4BELD 3GFUA 4JM2B 4YDJB 1F6LL 4QRUA 2UZIH 3JV4A 3RJDA 3QQ4A 4P2CG 5GSVB 3RGVD 1IM9A 1T83C 1OOAA 1LE9B 2H3NA 2UWEB 2B1HH 3WDHA 1P7KB 4WTXA 5F7MC 5MEND 3U0TA 3HC4L 3KS0H 5I1LB 3WN5C 1XIWA 1N6QL 4XZUA 4UT6H 3C5ZD 5DDHA 1D6EA 3KJ6L 4PY7B 5CSZA 1T3FA 1WBYA 1CDCA 3CXDL 5DD5L 3DGGA 1QRKA 1T7VA 4DQOL 5E99H 4O51A 3T1FA 2V7NA 4YGAB 1EO8H 5TDNA 2OR8A 3PIQB 1EEUA 1IAOA 4WW1A 4HUKB 1WC7B 5JIPA 2AK1H 4M7LT 43CAA 1M05A 1UC6A 4CW1B 4APQC 1RD6A 5F7WC 5HYSB 4D2NA 1PQZB 3H2WA 5AAWA 4JM4H 1QLFA 4ZYKB 5FYKH 1X5XA 4KY1H 4OQ1A 4Y19E 1KB5L 1L7IH 1CDBA 3PL6C 3ULVC 4AQ1B 2VE6B 1OPGL 3MSPA 2ED8A 2VUYA 4Y5XB 1GSMA 3EJZD 2E5EA 2HLAB 1ZLWK 4JFXA 1CLCA 1DCLA 4I0KA 1H3TA 3ARGB 3QZWB 1OAYL 3WS3B 1RZIB 4KJQC 4XH2B 2VDOL 5DHYA 2DM4A 3HE6C 1YEKH 4XXCC 1G7IA 3EYQD 4S0SD 3FT2B 4U6XA 1GRWA 1OTUD 2R0WH 1U8JB 1JPSH 3T0EC 3G6JA 3U9UB 3WL9B 1BAFL 1UA6H 3AM8C 5CEXA 4HKZB 4M6NH 2R29L 3QH3A 1FH5H 5FB8B 1PBYA 2N56A 4TSAH 3PWPA 1T7XA 3QDMA 5D6CA 1BAFH 2IEPA 1A6PA 4ZUUB 3CX2A 1KB9J 2F5AL 2NY7L 5T1DL 2SEBA 1LEIB 5ETUB 4CDHA 3ZKXB 1AQDA 3UXFA 5CJOH 5GS1C 3BD4A 4PRDB 3W2DL 2BVOA 3FB7A 3KWWB 1UVQA 2YMXL 2VSCA 2AABH 2QBWA 3FQXB 1KN4H 3MV9D 1Q1JL 4BJLA 3T04D 4QOKE 1CF8H 2ZSWB 3M17B 3DRTA 5DSCB 1JWMA 3TBWB 1X5GA 2EXWC 3NCYS 3PWVA 1EA9C 1D5ZB 4L3AA 4NQCB 4X80L 1MVUB 4Y19B 1DVFA 3SHSA 3T3PE 3S37H 1I7UA 1WUNT 2EDQA 3BESR 2VDNL 4YFLF 3X12A 3DHJA 3S96A 3BW9A 4LOUD 2Y7QB 4QCIA 4NO3B 3QPXH 1MH5A 4GG6E 5J12C 5EN2A 5FYKL 3RY4A 2E27H 1UYWH 3NPZB 2DKMA 5F6HI 2OQJB 5T1KD 4KJYB 3GUTB 4QYOA 3FFCE 4UT9L 3GHEL 4QNPE 5BV7H 1XT5A 4N9GA 3UTTE 3F12A 5E6ZA 2W1NA 1G6RL 2YA1A 5DVMA 5D1ZD 2DB8A 4XVSL 2VIRA 4I2XE 5E70A 4FFVC 4R0LB 4LLQA 2WNGA 3ELAT 1IMHC 5AWNH 1GGCH 4GS7C 1R5WA 3TO4A 3OJVC 4L8SA 3MUZ1 1E6OL 4PJIA 4CN4A 2YD8A 3L3OB 1WJ3A 3MRMB 5B21A 3K1KC 2NXYC 5JXAL 2RQ8A 4MS8D 2IQ9H 4O5LH 4PV8B 4UINH 1T7YA 3QUYA 2R9HD 5K33A 2OI9B 4LVOC 1M7XA 4HUVA 4QXTA 2F74A 2Z92A 4PG9B 1ZVYA 4XH2A 2EDYA 4TRPH 1AD9B 3X3GH 3ZSTA 2Y9RT 4P9HH 5DRXB 2H2PC 3MYZA 4LL9A 4NWUL 4I77L 4D8PA 3IU4H 1G7MA 5F9JA 1I8IA 4WI6A 3IFLH 4ZUUA 4PRIE 4JFPA 4D94A 3QH3B 1X5JA 4PBVC 4S0TD 4WHYG 3TN0D 5BVPL 1MFNA 1A6WL 4N68A 1D5ZA 4LCYB 5FA4B 4JQXA 3DRTB 5DSCA 1P5UA 1Q72H 4QT5A 1S3KH 4I0PB 2BX5A 4X83A 4LPXA 3WNKA 5IESL 1YY9C 1ZA3B 4N0FA 4UV7L 5FDWA 2VDQH 3DUSA 5FF6B 1OGTA 4P9ML 3T8XA 5C0DA 2JKXA 3HHRB 4IMLA 5CLTA 4KI5E 3P0GB 1ZKAA 3RUGE 1JWUA 3GHBL 4MYWB 5KZCB 5B3NA 5DT1H 1FFOA 3S96B 1CDIA 3VFOA 2WAHA 5E03A 3RKDC 2XZQH 4JJHA 5CEXB 5HDQL 2JJSC 3VD4A 3U1SH 1A1NB 4XHJC 5BOPA 3NIFF 1KACB 3WFEL 3GSXA 2OI9C 2BC4B 1PY9A 2VR5A 3W39B 5DHYB 3FQUA 4PY8J 2MMXA 5JW4R 1NGWA 3LZFL 2MHAA 4YHNB 1MI5A 1U8HB 2OK0L 1NLDH 3WEXB 5C0RL 1TTGA 1FO0B 2SEBB 1LEIA 3PGDB 3PHQB 2J8UB 3BQUD 5JTWA 5H35B 2FWOA 1IGTA 3QEGL 2X4TA 3ALXA 1BJ1J 4KPHL 1A64A 1LO3L 2R23B 2PYED 3L3GB 4ZFOB 1N64H 2QHRH 1LDSA 4HUUB 3SCMA 2YPLE 1VFAA 3ARTA 1XF2B 5CINH 1OP3K 5KVEL 3QNYA 4LCWA 3BE1H 2MKLC 3CVIL 2WW8A 3HNSH 4X99A 5AD0A 4MAYB 3KPRA 4Y88A 5JPNA 5E00A 5I1KL 4CVXB 3CXHK 2ZOKB 3RWGB 3TA3A 3LKRB 1CFTA 5EUOA 3CXDH 2JCCE 1F2QA 4NUGH 3I6LD 4V1DB 4WU5A 5IT2H 4I18C 4KKCC 1TQBB 4UDTB 4HK0B 3IAQA 4MQTB 3FO1A 4R96A 2DQDL 1S7WB 2AK4B 3F62A 4XC1H 1UXSB 4OUUA 4PJEB 4MB4A 1CVRA 4TQEH 2DLIA 5I30H 1YEEH 5CUSH 2H32A 5GS1B 2PTUA 2X44D 4KROC 4OF6A 3LHPH 3QDGD 2EXYC 5TDNB 2BERA 4XWGL 4QOKB 4F9LA 3C60B 4UILL 5L2JB 3KPOB 4E41B 3S88L 1QR4A 1HHGA 3T1FB 3DMMB 2AK4E 1D9KB 3MBEA 1E4WH 1Q38A 3KPQB 2DWEA 3MA9L 5EA0H 5FYKU 2L4OA 3RVVC 5HDQH 1GCFA 2IMMA 4KQ3L 4L4VB 5CEYB 2XA8L 2X9YA 5FGBA 4U6HA 4PGDB 3MNVA 1OW0C 2EEDA 2Q3AA 5KANG 5MEPB 2PTVA 2OXGA 3QUZC 1D5IL 2GQHA 2EH8L 3EHBD 4W6YB 4WY7L 3MRJA 4QF1A 5GS2H 5JOPD 1S9KC 1B3JA 3TFKD 3BPCB 2VWEE 3BP4A 5DUML 2AQ1A 1ED3B 1VERA 5FECA 2X4UB 1F58H 3CVIH 3KPNB 4D0DA 4OD2B 5KN5B 4JFEA 2EE6A 4UQ3A 4MVBC 1D7FA 3OSKA 2FD6H 4GLRH 2WLZA 2BOBA 3RQ3A 4N5UA 1RV6X 1TTUA 4TTGA 3RI5F 1G7LB 5GISH 2C4FT 2AJUH 2XZAL 4K3DH 2P49B 3TNMB 1FYTA 4XCYA 1JYWA 3U0PA 3ZTNL 2ITCB 4DZBB 4UQ3B 4DKFH 1KJ3H 1KULA 5BJTA 1JNJA 5DRNA 3WHXB 5LXGL 3QI9D 4L9DA 1WCBA 1J05A 2CIIA 3VXUE 3HFMH 1H5BC 1ZT7B 3MR9A 1R3KA 4JANB 4M5ZL 3WNOA 1H0DA 3TN0B 4CVZB 5LAXB 1GH7A 5F1NB 1PYWA 4YDKH 3IFNL 4JO4H 3HZMA 5IB2B 4OIAA 4PJDF 4IRJC 4OLXL 43C9B 1CXKA 1FZKB 2ZZUT 1EPFA 1FN4B 2YXMA 5E2UL 3GZKA 2V6HA 5A2KH 2D0FA 3Q48A 1UADC 4HUNB 1QHPA 4X6BA 4G8IB 4FTVB 2IBBA 3HI5L 5DD0L 5EZIL 1ZHKA 3V0WL 4E41A 1Y6NR 3GK8L 4DK6A 3TNNA 2BOCB 3DRQA 2X1PA 1B0GA 4RWYL 4ZS7H 5BO1L 3JUZA 2GJJA 1N4XH 4KWUA 3G9VA 3ZE1F 4AEHH 3IFOA 1IARB 1MHEA 1QNZH 3LV3A 1BREA 2RB8A 1T22B 2GJZA 4FQXC 2V9QA 4QRTA 1DQQB 3U0WH 3FN3A 2X4PB 1ACYH 4U6TA 3VMOA 1GIGL 2COQA 4OKVB 3GJFA 5EORL 3MJ6A 4NKOA 1MSPA 5C6WH 3P0YH 4YHLH 4UDTA 4KI1A 5B3JF 1XF4A 4JPIA 4XBGB 3K8MA 5TFSL 2C4FU 4JZJA 3NACH 3PWUA 4PJEE 1BFOA 5CMAA 3JVGA 1H3VA 4YHKH 5DYOB 3EJYD 1ES0B 5JW4N 1QFOA 5L2KA 3FT4B 5E6IA 4OCYL 3D18B 35C8L 3FMGL 1JNNH 4NYLB 3ZTJH 2DRUA 3QUXD 1I7RB 2HWZL 2EDXA 1F00I 2B20A 3VU2A 2BNQE 1ZEAH 4YZFF 3NIGE 5E1HB 1IGTB 5IHUL 3Q6FA 3BN3B 1TJHH 2FGWL 5H35A 1NDGA 7FABH 2FH6A 2CLRB 3E6FA 5MP6H 1AXTH 1UFUA 2BNRE 2OX5A 3MLXL 3S36H 4P2RA 1XGUB 5ITFA 3P9MB 1WBZA 1FORL 4N5EC 1A8JH 3LEYH 3MCKA 3O4LB 3KR3L 5EOCJ 3UC0H 3RWEA 3OXSA 4I3SH 3K3QA 2UUDH 1OVZA 4OLZL 1JRHL 4ETYA 1K5NA 5DURB 5KSAB 1FNEA 2VN4A 3EGSA 4KTDH 4OCXL 3BIBX 5HBBA 5D6DA 5BO1H 4LVNB 5IMLA 4WWID 1QFWI 5EBLB 1VGEH 3TZVC 4IRZH 4M6MH 4F80A 2AJXL 3EOBB 5SV4A 2YRZA 5EWIL 2A9MH 2HT3D 5EIIA 4FQIL 1DBKL 3UTTD 1MLBA 2F5BH 4HBCH 4IDJH 4L1DA 2Z8WC 3ARYA 1A1MA 4XCNA 2Q7YB 1CT8B 5GIRB 3RNKB 1KIPA 3OAYH 1FFQA 1E28A 1GAFL 1XGUA 2ZG3A 4Y1AD 4WDIB 3UTPD 3C8HA 3MV7E 5FM5O 2AJ3A 3CSYA 3OBAA 4CUCA 1BEYL 3BGFC 4GKZB 4Y4FD 5EBWA 1J1OH 1CFVL 3VXMA 1WZ1L 1B4JL 4MXWH 4WWKB 1MIEH 3IXTA 35C8H 3FMGH 4OLUH 3VRJA 3VWKB 2GIYA 4JFPB 5KS9F 3B5HA 3QCVL 4L9LC 5C07E 3IDUA 4JFYB 2UWEF 2VABB 5IIEB 2G5BB 1BJMA 2ZOLA 2B7DT 5L2KB 3BZ4A 4MS8C 1LO0H 5INDA 4HPYL 1BBJB 3BKYH 4WEBH 3HZVB 1U8KB 2HKHH 2DD8L 1MJ7H 1X5IA 1CZ8L 1DQTA 3CMOL 1MI5E 2ICWI 2F74B 3PABA 4Y2DD 1C5DB 4UTBH 4BH8A 1MFAH 5IESH 5D96C 5A43C 1Q9KA 1YYMH 1YUHB 4RNRB 3ZYJA 3Q6FB 3HE6B 3VRIB 4G43B 4W81A 4JJ5A 4U1JB 3ULUH 4RRPA 1BF8A 5KSBE 2X9XA 3PWLB 4QTIH 1T22A 4PBXA 4XC3L 5CZVL 3BMWA 1I85A 2CJUL 1FLRL 3B9KB 2BSED 5E2VL 3RA7L 1H3PL 1OTTD 2VKXA 3HI6L 3PDGA 5C3TA 2F53D 1RULH 2WUCH 1HIMH 1DEEA 4K3EL 4NC0B 5CCKL 3QULA 4JCMA 1MRCH 4ZO8A 1NFDB 2OR7A 3GMLB 5E4EC 5EUOF 1GAFH 1JE6A 4OAWA 4JQXC 4R6UA 4GO6B 5GGUB 4OM0H 2AJYH 4ZFOL 5GPRA 3IJSB 4MD4B 4YAQB 4JG0L 2QL1A 2J2ZA 3VXPA 5DHVB 1VENA 1U3HA 4OQTL 3L5WB 1RUPL 2BY1A 2NY3C 3KNBA 1C8PA 1L6ZA 3FOLA 3OHXB 3GKWH 5A1AA 4QXWA 4P99A 3RWDA 2UYLB 2X09A 3VW3H 4U2ZA 1TDQA 4FTVA 3BE1L 5IROC 1XGQA 2ARJQ 3C8KB 3SDAD 2PO6D 1PDKA 1CGUA 3FT3B 1M7DB 3CC5B 3MJGX 4PB0L 1OB1B 5IB3A 5HDOA 1U8NA 2OP4H 2KH2B 2YUVA 4WI2A 1NMBH 5IW1B 4FQLH 3LPWA 1U3YA 4YBLB 5F1OB 3RY6C 4H5SB 2W9DL 2P8MA 3NFNB 4S2SA 3HC0B 1C5CH 2NTFA 4QEGA 4LSSL 2PYFA 1MF2L 1H0DB 4KK9D 3I84A 2BVEA 1ROWA 4OLWL 3VXOA 4Q2ZA 3SKMB 3V5DB 2HTKD 1ZLWH 1C1EH 3V6OC 1GZQA 1MCJA 4HLZG 3X14A 2DTML 3MLVH 3MLWL 1HCVA 3RWIA 4I1NB 4U1MB 1QBLL 1G0YR 4DVRH 5I75B 1K4DB 2C3VB 4YHKL 4LDEB 4YE4L 1JYNA 4DVRL 3SPVB 1PSKH 3DX7B 1TFHA 5KSVB 2QQKH 1EEYA 2BCKA 3HI6H 5TJWK 3BRDA 5HHOB 3V0VA 4MNGB 2I07A 2QQKL 2PR4L 3L3DA 4G9FE 1S7QB 1OAYH 3GMRA 4CW1A 4NUJB 5E2JA 5HSFA 1BLNA 3TIEA 4OD2A 4D0DB 5B38A 3IF1B 3G5YA 3PQYA 1K3IA 3EYVA 1FIGH 2CO6B 4MXVF 5DS8A 3OPZL 5I2IB 3F7VA 3VFRB 2MSPA 3CUPA 4Z7NE 2DQEH 4KVCH 1A5FL 1UXSA 2J5LC 4M7KL 1FZMA 3I3BA 5DWUH 3OF6D 5FOBA 4R26H 4CU8A 3H6JA 3IFLL 3SE3A 4G7YL 5J0BA 5JO5B 1XAUA 1SJXA 3LN4B 3V4VL 2KL6A 4DTGL 5FCUH 3T4AA 5DK2A 1C16B 1ZLUK 3DMMA 3QQ4B 5CSGA 1JN6B 3QRFM 5FGBC 4JQVA 5JIIA 1ETZB 5C0IA 4NRXA 1ADQA 3IF1A 4XPAH 4QHNB 4KFZC 3DVNA 3P9LB 3HI1A 1SMOA 4IRJB 4ODXB 4Z7UB 2NX5D 2YKLL 1RZJH 5B4MC 4NUJA 4BH7A 4J4PD 2EDFA 2PCPB 4FFVD 5J13B 4AG4H 4HUUA 3D0LA 4Y4HB 1Z5LB 1EGJL 2VZ1A 3L5IA 5IFJB 5JZ7C 2R4RL 1PKQB 4CL7A 4HX1B 5CD3A 2HT4D 4P46B 5SWSE 5GGQL 4IS6A 1RZ8B 2X4SB 5DJCB 1B6DA 3MLTA 5GS0L 3CU1A 1I9IH 4TPRL 3P73A 3LEVH 4N8VG 4HXAH 5GRVK 1B88A 3PHSA 4ZUTB 5ENWB 4ZFZA 1K6QH 2VZSA 1NCDL 3B5GA 4U6YB 4Q2ZB 2PTTA 1BOYA 5C0FA 5ISZB 1AXIB 5JXEC 3GMRB 1RIHH 1H3PH 1KPVB 1LMKA 3ZHLA 3T0AA 1KG0A 4YQXL 5TQ2L 2ITDB 3V0VB 5EC1A 1ZAGA 1UWEL 4PJGB 5MENB 4HEME 3WIIH 4F3FB 3DX7A 4C55A 2CGRH 4CMHB 3ARFA 3LY6A 1FO0A 3RDTB 3HB3D 3D5OF 5D5MB 3O3BA 2P24B 3DV6A 2P1YA 4YHNA 4P5TB 4XCCL 3VFTA 2GY7B 5ERWB 4YUEH 2E6QA 3VD7A 1EAPA 2FHFA 4WVRA 5FGCE 4M7KH 4N1HB 1J0HA 1JNNL 4KJPD 1YNTB 4WTZG 1SJHA 4NWTL 2JJTC 5DMIL 3VXRA 3A6BH 2QADB 1T83A 2XI9A 1N26A 2ATKA 2WBKA 1J1PL 1UWXH 1EH9A 5E99L 3MLPA 1IBGL 1K4CB 4OF0A 1BHGA 3IJHB 2XPGA 4OV5B 2VXQL 4Q9RH 2NY0D 5TE4H 3ULVD 4FG6D 5IBTH 3MRGB 1GZQB 5HGAA 4X6CB 1A7PH 4ALAH 3SKNA 3C8DA 3VFUA 3QUYB 1S9YA 3MRQB 4NQXB 5C08A 4E0RA 4NQEE 4NN7B 3ROOA 4RIRB 4K3GA 2D7NA 8CGTA 3WFCL 4OSUH 1QA9B 2XT1B 3QNZA 1OB1A 4PB0H 5KVFL 3CX5J 1H3GA 4S10A 3CDGB 3SDCD 3I50L 4OM1H 5ACLA 4EDWH 5IVZA 3AY4A 4NQVA 4RGNB 3FQWB 1CICA 2OZ4A 3RIAF 3WFZA 2VDKL 1MLCB 3SDCB 2ZP0T 4V2CB 4PJBA 1BM3L 1AD0A 3SDAC 1B0RA 2F19H 3PP4L 1WAAA 5CBAA 1DE4A 4DGYL 3VW3L 4NWTH 1A1OA 3LB6C 3RVXD 2O26U 3LAFA 3F5WB 1AI1L 1MHHA 3N1FC 4I2XA 1HYRC 1P4LB 2VLRE 4KK9C 4BQ9A 5KW9L 1SJEB 5I1IH 3ZE0E 1T2QL 2AGJL 4U1HA 1ULVA 4Z95H 5KVDH 1WEJL 2ZUSA 4OZGB 4GRMB 4Y2OA 1I8LA 1WK0A 4ODHL 1SM3L 3PWPB 3QDMB 5D6CB 4NJ9L 2HRPH 2HJLB 5FYLD 1NGZA 3VH8G 1MRFL 2NTSP 3QJFA 1HHKA 1S7SA 5JW5B 1PZUB 4U3CA 3QCUL 4OJFL 4AIOA 3VFPA 1P1ZA 5HI5D 4X9GA 5SWSA 3WFBL 4QTIL 1CS6A 4YO0B 1YECH 2ZCLL 3RNKA 1XGRB 1P5VA 1INDL 4PRDA 5SV3A 1AXSB 1OPGH 3QEUA 4P2OD 5D2NB 1ONQB 1YEDB 4HC1H 3TF7C 3NIFE 3LIZL 1IKNA 4D9LL 5C0RH 2MCG1 3GSWB 1JHKH 4YDIH 5FYKD 2JJTA 5TE7H 2FATH 4W6XB 3P0VH 1FJ1B 2E7MA 1CFSB 2XN9D 3ESVF 4O2CB 4EKXA 4KPHH 5BRZB 4LBEB 4EUPH 2F19L 2C3XA 4BKLA 2P5EB 1INQA 3RZCB 1M05B 3G08A 2XTJC 1K5NB 1KF9B 2DQTL 2CQVA 3UBXG 2VLLA 1ZMYA 2VZUA 2OL3A 2DWDB 1JUFA 4HKXA 2XICA 5DJDA 3MCKB 4M4PA 3FB8B 3PXJA 2QADC 3LD8B 2XWBB 1KJ2B 3ARQA 1BZ9A 1A1MB 4XCNB 1NBQA 1SQ2N 4NCC1 2OSLB 4OZ4B 4XTRC 4KHTH 5IB1A 2I5YL 4GQ9H 4F15B 4OKVA 4NFDA 2XKUA 3LN5B 3E0GA 4Z18A 2C9AA 5F9OL 4IOFD 4S1SL 1S3KL 2YD6A 1IC7L 3SQBA 2I27N 4HBCL 3OXRA 1HCFX 2LU7A 4L4VD 2WWMC 3VD5A 5F9WB 2OMBA 2EYRB 3HLAA 5DI8A 3MNZA 1UB5A 5GS0D 4WO4A 1BVLA 4B53A 5HDBE 4MJ5A 5KG9B 1FORH 1XR9B 5I8OH 3R8QA 1NFKA 1QYGH 1V7MH 4OLZH 1YEHH 3FRPA 4XWOC 4NOBA 1H3UA 5C08E 3SQOH 3UTZB 4PJEF 3BP5B 3S98A 1BFSA 5CHNB 3BSZL 5IVXA 2CDFB 1DQQA 1AR1D 5JOFA 3QDJB 4JVPA 4HHAA 4OD1L 4L8BB 3QNXA 3H0TB 5DQ9A 3VWKC 2DQGL 2ZPKH 1R3KB 1I1YA 3KXFE 1MJUH 5C0EB 5L9DH 4XP4L 2R0ZH 5D93B 3WUZA 5IF0B 2X6MA 3GMMB 5CP7B 1X7QB 5SWZA 3E6HB 5DQDL 4LPYA 4K23H 3SKJL 4CMHC 2V17L 4J3UA 4PJBE 5CWSB 4WCYL 4H8WL 2OJZL 5HYJA 4HDIA 4M61A 1ZGLP 3PWJB 3ARPA 4MDIA 3N0PB 4IJ3C 4GW4B 1A4JB 3KYNB 1AO7E 4OZFH 4FA8A 1ITBB 4G8GB 4HWBA 2Q6WA 3IFOB 4MAYC 5BVPH 3C9NB 2MFNA 1LP9F 1QKZH 3V4PH 2QLVB 4XI5D 1M71B 5TGBB 1U9KA 3UTQB 1AGBA 3I50H 4OM1L 3O3UN 1XZ0A 3AFLA 4PJFA 4YIQA 1X5HA 1UM4H 3LRGA 1RIVH 1N4XL 2E27L 3D39A 3MNWA 3NPSB 1JPFB 2F54E 3PQYE 5ACZA 5JHDA 2FH8A 3PWJA 4EI6A 2OM5A 3B2VH 4FXKB 4E9LA 1FP5A 1TZHB 5D70H 5D8JH 4P2YA 4TTDD 1HOCB 3UTSA 4CRPA 3QWOB 1G0XA 3P11H 4K7PL 1JCKA 4JY6B 3OKEA 3K8KA 4ZPTB 3IDNB 4WW2C 4ZQKB 4CVZA 4JY5L 4LQ1A 4G3YL 1CN4A 2OLDA 3BKCL 4M02A 4U3XA 4JFQB 4OLVH 1BQHA 5IROA 2VB5A 4TUJA 1IAII 4LLUA 4P49A 3WHXA 4HH9A 4AIZA 1CGTA 4KZEH 4KV5E 4H0HB 5IW6B 1U93B 3AROA 4N9OB 2NY2B 1RUAH 1B2WH 5CHNA 4FQQA 4NHCH 1U91B 5GS2D 4KDVA 1A2YB 4JM2C 4HK0A 4WGWB 4HLJA 4XAKE 2YK1L 1JV5B 3BD3A 8FABB 2BOBB 4PJ5D 1HH6B 4R3SA 4ODUB 4PB9L 4AYFA 3LQAL 4JB9H 4RGOH 2JE8A 4UTAL 1YEKL 4Z8FL 3KPLA 5J06A 3H3KA 2X4UA 4JB9L 4QOKA 1IC4L 5ABDE 5F6IC 1KEMH 3HLAB 2J3SA 3C09B 3Q3GA 3TT3L 1J0ZA 1OP5H 3BQUA 3EBAA 4G8GA 1PX3A 5GGRB 1A4JA 4Z0BH 3JTSB 4M61B 4HDIB 1FVDB 5FYJL 3DROB 1GL4B 1JHLH 4YHYB 4YH6A 2J8HA 4U1KB 4PRPB 4U1GB 1LD9B 3MUGA 2BK8A 4KHTL 5L7XL 1ADQH 1U8HA 2DJSA 5C0GB 3FZUC 4JPWH 1NMCB 2VLKB 3I3DA 5CZXC 5ICYA 4JGJA 4AM0A 5D72H 4LSRL 1HILB 3KPRB 4NQDD 1NGQL 4M6NL 3SBWC 4OTXH 5D1ZC 5I17B 5IG7A 3FB5B 5D93C 4HULB 4JFEE 4CN1A 4PJCA 4HJGB 4P5KB 2JJVA 6FABH 1KTKE 3O4OB 1WGOA 5EZOL 4LCIH 4X8JB 1IGMH 4J4PA 3P9WB 3QDJA 2YRLA 2H26B 3AREA 1A7OH 2W0FA 3ETBF 4JY5H 5FM5M 4YXKH 2AK4A 2IQAA 3QIWB 4PJHB 6CGTA 1NGXB 1YJDL 3O11A 4ENEC 1JPGB 1T1XA 3GHEH 3VXRE 1JHKL 1OGTB 4Y19D 1FL5A 3GMPA 3M45A 4EI5C 3ZE0F 4WV1A 1JGLH 3LKRA 3IJYB 2A0LC 1NGYB 3OG6B 5KAQF 3EO0B 5C0CA 2IGFH 1I3RB 3L7EA 2ZKHH 1CE6A 2YR3A 5FDYA 1Z0MA 3CNKA 3WS6A 2NY3B 4NZDA 3HZYB 1MFDH 3OB8A 4U33A 4KDWA 1U58A 4R9HA 3WUWG 1CLOL 4EQ2A 4NNYB 1MFDL 2J88H 3OJMB 3VXNA 1K2DB 3KPTA 4QHMB 3MRPA 3NOIA 2KZWA 3VGBA 1FVEA 4LLWB 4AEIL 1N8ZA 1S7VA 3QEHA 4UQ2B 2DMBA 3FAXA 3N1PC 1W0WA 4G7YH 3KHOA 4YX2L 4KQ4H 3T0WA 2EDJA 4XPTL 1MJJB 4NNXB 3DVFA 4WCYH 4F7TA 3L1OL 2YMXH 1IM3A 1W0VA 1OWRM 3GBMH 3GDBA 4MDJA 3S36X 1JUFB 3MACL 3SJVA 1JFQL 1XGYH 1P1ZB 2EDOA 1I1AA 4Y5VC 4H26B 4OCNC 1HHKB 4BFIA 2V2XA 4RA0C 4POYA 1IQDA 1ZT1B 1C7SA 4KROB 3MGOA 5F3HB 4A6YB 2DQFA 2PO6C 4YXHH 2IANA 4IRSD 5DFVC 5ADOH 1KTLA 3SGDH 1WAAE 1OAKL 5MEQA 1F4YL 5C92A 3GKZA 1YEDA 3DX8B 4HWEH 1WV7T 1OAUH 2Q86A 4M93C 3RDTC 3SDDD 3EYFA 2CR6A 5DD0H 4KV5F 3WSQL 1XH3A 4LQFH 4K9EL 2VLRA 1T5XA 4M3JA 1WFNA 2XRAH 4MAUH 3TYGL 4LLDB 4N8VB 5F72S 2BRQA 1XCQB 2AEPL 4LPCA 4PJIB 3LEYL 3E8UL 1VGEL 2O5YH 5EPMA 4OT1H 4K55A 4GMSH 1NUGA 1C12B 2HFFB 4OGAD 3VFUB 2WUBH 1DN0A 3C6LA 4JHAH 1MWAL 1N3NA 1LO4L 4G9DA 4EN3C 4JR9H 4KUZL 1E4XH 3FQXA 4LFHD 3RRQA 5BQ7A 1C5BH 3SY0B 1NGPH 4N9GB 4PJ7F 3AMKA 3FB7B 3K4ZA 1WZ1H 2FDBP 1KJMB 4IIQA 4X4XB 1X3DA 3CDGA 4MJ6B 2Y07H 4O4YH 2V7HB 4JDTH 2E7BA 3MROB 4DKFL 3QDHA 5IVXF 4QXGL 4L3EE 4NSKA 1T5XB 1I1AB 3RP1A 5C0BD 1TNNA 4PP2A 1IC1A 2HVJB 3MOBL 4N0YH 4PGJA 1SEQH 4XXDB 4BQBA 1CL7H 4JN1H 3G5ZA 1RK0B 1DN2A 3MZGB 3UTSE 3Q6GH 4WNQB 5EU6D 4OI9A 4OV5A 2NXYB 1IVLA 2V9TA 2X10A 1CBVH 3D1MC 1K4CA 4M5YH 4XP1H 4Y5XA 1D5MB 3SGEI 4KI5F 5KVMC 1ACZA 4HZLA 3C6SB 3RUGF 1AGFA 1J7VR 3FCTB 3MCLL 3RJQB 2BSRA 5DWUL 2F54B 2ITDA 3ROOB 3MGOB 5F3HA 4A6YA 3BO8B 3REWB 3VXNB 1A47A 3IS1X 3MUY1 2G60H 5HHQA 1EBPA 1U58B 3U7YL 4WW1B 1E27B 3QUMH 3SO3C 1NCDH 5SWSD 3L7EB 1ZANH 2GK0A 4WFFE 4HGWA 1OSPH 4ONGL 1PKOA 5ERWA 2CK0L 4P5TA 4G6MH 1BZQK 1FZJA 2F15A 4DCQA 3D39E 3T08A 1ZS8B 4P2OA 4G6ML 2ZUUA 3DBXB 4NQDE 4QY8A 3GO1L 2HLAA 5CIPB 3OJDA 4NBXB 2NW2A 1W0WB 3QIWA 5JORB 3QHFH 3U30C 5T1MB 1E4XL 2NY5C 4KMTH 4URTB 3NIDF 3ES6B 2VLMD 1QRNE 5ISZA 3QO1A 3ZYIA 3R4DA 3V5KB 3HMWL 3E2HB 3SOBH 4Y1AA 2CLVA 1N5YH 3WLBB 3BSZH 2DI9A 3KXFB 4LSVL 4F2MB 3R0MA 3Q1SH 3T77A 3SDDB 5F21B 3K81A 4Y4KA 3ORJA 5E2TH 1A7QL 5JPMB 1B9ZA 1A6UH 5JNYA 2GSIB 4M62H 3O45B 3QAZC 4Z77B 5JHLL 1KCLA 1M4KA 1R3JA 3RVWD 1XIWB 2LQRA 3TJEL 3N1QC 4X5LA 3G6DL 4XNZC 2VQ1B 3TBVA 4PGCA 3GIZH 3HPLA 3ET9F 3QQ3B 4NHUA 3VGGA 3DVNB 3INUL 4OCXH 1KUMA 3PIQA 1W72A 5E2WL 5E9DA 3WFEH 2V7NB 5B38B 4PV9B 5IOPB 3WO3B 4X4ME 1T21B 1DZBA 3P73B 2PYEB 2APBA 4IS6B 1DUYB 1UM6H 1E4KA 1FO0L 4X8XA 1IC5H 1NEZA 5JA9A 1XF1A 3A6OA 1T89A 4O58H 4JVUA 1DBJL 4OM0L 5JNYB 1CFQA 2Y36H 4LU5H 4RMVA 3VFRA 1QBLH 4HMEA 4GBXB 1EV2E 3TPKA 4ZO6A 2FL5B 3EYVB 5J1AB 3D3VD 1P4BH 3BEWB 4G6AC 1IKNC 4L4TE 2G75B 3T4AB 2X70A 3H3PH 5C86A 4G5ZL 4P3DB 3MRHB 2Q8AH 5BRZE 4P0DA 1HOCA 1I7ZB 5JORA 5HHVH 2VXVL 1MCOH 4OBSA 1VHPA 4KI5D 4AENA 5I1HH 1Y0LB 4NQCD 2RHEA 3EUUA 1XIWC 2LTQB 5KSAD 1AGCB 2FR4B 2C3VA 4NM8H 3GSQA 1KIRA 3K1DA 4LIQE 5ADPL 3A6CH 1KXTB 3AREC 1I3GL 5HVFB 4I4WA 2IPKA 4OZHB 1HHHA 5AUMA 2J8OA 1UJ3C 3BWAA 3MLYL 3PGCB 3KNBB 1YEFL 4PRPD 5F89A 3OKLB 1MRDH 3L3DB 1HEZB 5F7DA 3ULVH 3QXAA 2XTJE 2QQNH 4NRYA 1T4KB 2EYSA 1XF5B 4PJGF 3SDYH 4DGYH 3OGCA 3LEVL 2B1AH 1KJVA 3MO1B 5EO0B 1RJCA 3L6FA 1JPFA 4JDTL 1CIUA 3CFIC 4BYHA 3FT3A 3ILPA 2NY5H 3KG5A 4MJIA 5B39B 2VSDA 3BAEL 4NO5A 1CWVA 3V6ZB 1XZ0B 2XWJB 1DBBL 3U7WH 1AHWC 1SVCP 1H15A 5DVKA 4AH2A 5A2LH 3IDMA 3MRKB 4D9RE 5I18L 5JW3L 5EIQA 3H0TA 2HLFD 4NSKB 5F7NC 2FATL 3TZVB 4L8BA 4TSCH 3ZE1E 2XNAA 1YDPB 4FQ2H 4HF5H 3VXPB 5C09A 1I8KA 2DQEL 3OR7A 3HN3A 4KVCL 4NZUH 3EDJA 4P2QB 5GRUL 5MHSD 3K2MC 1DDHA 1FIGL 4R4NC 5FCSH 3WKML 3WLWC 3MRBB 1CK0L 2D2OA 4GRLC 3ZDXF 3HMXL 5DK0B 3STZA 3M1BA 4YXLH 1IQWL 2R9HC 2CIKB 4KRPC 4J3WA 1X5KA 4G8FA 3V6FA 4QRRA 4XXCA 2R1WA 3MRDA 1UWEH 3RTQB 4HV8A 2Z31D 2WBJD 3OHXA 3ARXA 2H41A 3GMNB 4UT7L 1SEBA 2O61A 2NLJA 3OF6A 3ROLA 4D0CB 5GXBB 2R0KL 4LSUH 2G5RA 3PG2A 4DZ8B 1UM5H 4PBWD 4OZIE 5E6YA 5KSBA 1EBAA 1FAKT 4L9LB 3I6KB 3OB0K 1G9NL 2WV3A 1RK1A 4XNXL 2Z9TA 2MQ0A 2AS5M 1J86A 4XNXH 2OSLA 4TVSa 4X6CE 1C5CL 3EYFB 2YUXA 1OP3H 2XWBA 1E28B 1UJ3B 4PG2A 1F6FB 4C83A 2VYRE 1U3HC 1FIEA 1KXQE 1HQ4A 2VAAA 2ZUVA 4TOYL 1QRND 3DX8A 2UZYB 4I9WE 1KCKA 1OGAA 2FGZA 3F7YA 1PX4A 4F7MA 3PP3K 4PJDB 3FQNB 2O5ZH 3VFNA 5BZDA 2EZ0C 1YQVL 5DFTA 4EUPB 5JXAH 1KGCD 1EVTC 1XEDA 5EBLA 1R24A 3BH8A 3X17A 5IT2L 4X7SL 3FFCD 4Z6AT 4XAWH 4N0UB 4S1SH 2RIKA 5GGTA 3UPAA 4NKQB 4BH8B 4EBQH 4LEOB 4BM7A 4X7EC 3TIDA 1F02I 1JTOA 1CDHA 1HXYA 5FGCB 4PJFF 2Z4QB 3X3FH 3L9RA 2Z93B 3H9SD 3PV6B 1ZVHA 3UCRA 5INDB 1NBZB 4PRIA 5C0CD 3KPRD 1TZIA 4TUKL 3JTTA 5HGHB 2R1XA 3QUZA 1UWGH 2XZZA 3QWQB 5C0AA 5DMKB 3RZCA 1MFBL 1HXMB 4NRZA 2DBJA 4PJGE 1A6VH 4NGHL 3F65A 3O2VH 2YSSB 5TF1H 3VWKA 4JFHD 4O2CA 4X6FB 1VACA 4XP9H 3RL1B 3WLWD 4NNYA 3VXMB 3RVTD 4Y16A 3UAJC 3HZYA 3O3EB 4M9PA 3DVIA 4PJ9B 3BVNB 1KENL 4OZHE 4PLKD 3UZQA 4M6OL 3L9RB 3C5JB 3FB6B 5FYJE 3T0EB 5SWSB 1V7ML 4N5ED 3GHBH 3VFPB 4Y16B 4LLYB 5F70A 1PLGL 1MWAA 4G6FD 3S35H 4Q9CA 3I6KA 1NGZB 1T7WA 4L9LA 4ZSOB 4PJAE 4PJHF 1G9MC 1DQLH 2GJZB 4FN0A 3S35X 3O0RL 2X4OA 3EIFA 5HYIA 4HJ0C 4L4TB 3FB5A 5EIVA 3W9EA 4KJWC 4PIRF 4CKVX 2BY3A 4PRPE 1ES0A 2FIKB 2IH1B 2D31B 3NZHL 4RFNB 4FXGB 4HS6B 4GG6A 1UJ3A 2C4XA 2CIKA 5C08D 4W4NA 4K23L 4U3HA 1SVZA 3TIDB 1EXUB 3ARDD 3WKNA 2V9RA 2CPCA 3ZT7A 4JFHE 4N0UA 2ESVA 3OGCB 1NEUA 1FZKA 5DTFA 5HDBF 3MGAA 1R24B 3BH8B 1J1OL 1DBMH 4CVUA 9CGTA 2LE9A 4Z76B 3J8F7 1I9RH 2NY6C 1Z9LA 5DHVH 1K3ZA 2Z31C 2I26N 3LRSB 1BWWA 2EE9A 5H2BB 3VE0A 3AS3A 2CUMA 4LVHB 1HSBA 3UYOD 1CICD 5CZXD 3SKNB 5JW4M 3TNNB 5D7IB 4L3ED 2VDRL 3WMSA 4ZDHB 3NZ8B 4FG6C 3IAPA 3HRZB 2OJEB 1Z9OA 4HIXL 1MOEA 3R06B 1S7RB 3EO1A 4NQVB 4TVPD 1IQWH 1TVHA 1MFCH 3ULVE 5HHOE 1FGNL 1G6RA 5IK3B 1A2YA 3EW3B 4YGVA 4RAUA 2BNRD 2ATKB 4XNMB 1A6UL 3HNTL 3B2UC 3G6DH 1U93A 3P11L 5DD6B 4FFZH 3S4SA 2FO1A 4DN3L 1CE1H 1M6OA 3DXAB 3SDCC 4Z7VA 1R5IB 4AIXA 3FJTA 5E8DH 5FK9B 4G6AD 3RNQB 3SKOB 2DL2A 2I9TA 2WK2A 2AI0L 3MRKA 4X6CA 4YWGL 3TJHC 4M8VA 4I4WB 4XP5L 5HDLA 1JHTB 3RTQD 3TBSA 4P5MA 4MQXD 4E41D 4PJXB 1G7PA 1MAMH 3QWOA 2JLLA 3HMWH 3MRJB 1MEXH 4RX4A 4LHUD 5J1SC 4X0KB 2R2CA 3U7WL 1SYVB 1FFRA 5K9QI 3HB3C 1FFPA 1P84J 5HGBA 4APQA 3D39B 4DQOH 3VFGH 1UACL 4JFOA 4JRXB 3TYFB 1BJ8A 3NBNA 5DQJB 3H7BA 5KOVC 4M1CC 3TVMD 3VXSE 5I1DB 4PJFE 2OMNA 3U82B 1CD1A 3O3DA 3CCHB 5DQDH 3S3PA 3QIBB 2ZPKL 4KK5C 5FKAB 3OZ9H 3RPKA 4UIKH 1F4AA 4GBXA 4BZ2H 4ZFFB 1TIUA 4TTDC 4FZEL 3IKCA 3VG0H 2MNUA 2AKRA 1VKXA 1ZK9A 5FYJU 1RHHA 2EDRA 4FQXD 4GJTB 1U92B 1PFCA 1R3JB 2D03L 4Z0XB 3LH2H 4PTTB 4Y5YB 5F1IA 1CGSH 3BPOB 2PF6A 2J6EL 2EO1A 2YOCA 3KYOB 3CZFB 5HPMB 1S5IH 1KPVA 1QD0A 3QR2A 3I02A 4I0PC 3ARBA 3KPQA 1AKJA 2DYPB 3U2SA 5DJXA 4YNYB 3NTCL 2JJWA 4XBEL 1HHGB 3AS2A 1Q8MA 2PTTB 1SM3H 3F7PC 4HGKC 1W0YT 5GRZA 1CXEA 5T33L 3MOAL 2EDKA 1IAKA 4L3EB 3QNXB 4JCLA 5D7JB 5JOFB 4OLXH 4IOIB 4OF3A 3B3IB 5EFIB 3UZEA 3IDYC 4M48L 4U1NB 4XNQB 1S7WA 3I6GA 2KQNA 2EDHA 3B8SA 3GM0A 3IVKB 3RU8H 4XB8A 3O45A 3JBG7 3MRLA 1UCBL 5ANME 5GRWA 3BAEH 4D9QE 5HI3D 5TH2A 3O8XB 3GSOB 3MBEB 2ZG1A 2HG5B 1A7PL 2HTLD 4GW1B 3TH3T 1MQKH 4QGTA 3RGVB 2YA2A 4N8PA 1ETZA 4JPVH 3T2NH 3SE4C 2NY5L 1WWCA 1YMME 2GTWB 5DJXB 1DBKH 3OXRB 4RAVB 3QXDB 1FGVL 1KPRB 1ZLVK 1O5DT 4NNPH 2AJVH 4L3CB 3VFWA 2F54A 3P0VL 2O5YL 5JMOC 3L95B 3MXVL 4QRQA 3PJSB 3PDOA 4TUKH 1U95B 2C1PB 1A7NL 3EDEA 3L3JA 3ZHKA 4EVNA 1ZA3A 4QTHB 4HT1L 4JO3L 1WT5C 2A6JA 4HUXB 5IOPA 2CJUH 3RX8A 2DWDA 4HKXB 5FKAA 1JGVH 2VLLB 3CCHA 5I16A 3D2UB 2IAMD 5GGSB 5DMYA 2NTFB 5I9QC 2OL3H 2YS4A 1WWAX 4FQCL 5AG9A 1TETH 5IVOA 4LNRA 4LPWA 5I1GH 1S5IL 3CAFA 3U48A 4XPGL 1DBAL 2PXYD 5EUKA 4M6OH 1QSED 2DD8H 5KSVA 1MREL 2VXQH 4Q9RL 4X0KA 2QKIA 2OZ4H 4LAJH 4MB3A 2O93L 1ONQA 1G7PB 4WNQA 1NL0L 1AJ7L 3O81A 3QI9B 5IHUH 1NGWB 1T04A 2J6EA 1T5WB 3QFDB 3T77B 3SCMC 4DGIH 4YO0A 4RFOL 1NCUA 4H88L 4GAGH 1J18A 4ODVL 2YPKA 3HMXA 3CFJB 5DJAB 2N7AA 4LMQE 4XNYL 5GGQH 5H94A 4Z7WA 3MCLH 4F7PA 3N1MC 5INCB 2GHWB 1HSAB 1U8NB 3U36B 1T1YA 1TQCB 1XIWD 3OJDB 1LO5A 3T0DA 3HG1A 1ZS8A 2WUBL 4P2OB 4QY8B 5GJSL 3F7RA 4ZXBA 1MCDA 2PW2A 1OLLA 1SJEA 2VDNH 3TVMB 4I0PA 1L6XA 2OXHA 2VLJB 1FNSL 4GMTH 3QA3B 4HD9A 1HDMA 4GRWF 4NP4H 4PJCE 5DFVD 4QHUB 5C9JB 4JFDE 1AP2A 4CADB 2E9BA 1UH4A 3BO8A 2QHLA 4PJ7E 3CVHA 2HAZA 3CFCL 1I7UB 3PNWA 4JLRB 4N8VA 2NY2C 1AE6H 3DX9A 3CD4A 1MVUA 4PRBB 1I8IB 1OTSC 3OMZA 2B2XL 4G6FB 4K71C 5FO8A 2J1KA 1NCBH 1C5DA 4RMTA 5KAQG 3QA3A 3BUYB 1Q0XH 2H8PA 2YHGA 5I0ZA 3RL2B 3UP1A 4LSTH 5I8CA 1PG7X 3EFDL 4G9FD 4QO1A 2IG2L 3BH9A 2OQJA 5D72L 4TN9A 1P6AB 1DLHB 3MMEB 4OTXL 1WICA 1VEPA 2X4OB 5CBEA 1QFUL 4ONOA 3ZKXC 2X1XR 4XTRD 4ODVH 1QPXA 4UB0H 1A6ZA 1FVEB 4HXBH 4KK8C 4LLWA 3TH2T 4DGVL 5K9KB 1VA9A 4WWKA 1IAIM 3HUJA 4OCRH 1PJ9A 1U2HA 3RY5A 2P5EE 3RVWC 1INEL 4GKZA 4NQDB 4I3GA 1JFQH 3ZLQC 3D0VB 3O9WC 5FGRA 5F44A 3O4LD 1YNKH 4JGUA 2Q86B 4WJ5A 1KPUA 1K8IA 2XRAL 1W0VB 1BBJA 4GOSA 4AT6B 2WIMA 4K7PY 3TO4C 3MODL 2QQLL 4ORGB 4MLIA 3VXSA 5DD1L 1T1YB 3EOBA 4HPYH 2QSVA 2I60L 3KAAA 4XX1E 3B43A 2YEZB 4RGOL 1HSAA 3SGKC 4ELKA 1F3DJ 3U9PH 4Y19A 1P2CB 2Y06H 5DO2C 1GGUA 1OQXA 1NUNB 4KTYA 3L5HA 3CH1B 4S1RL 4X5WA 5HYSG 4HJ0D 1RZIA 2DBLH 3C6LC 4CGTA 1I9IL 3EZ8A 3BZDA 3UPRB 1YPZE 2OS7A 5MI0C 1HXYB 3CDYA 4KQ4L 3ILQC 5JR1L 1X6NA 3E6FB 4LEOA 5HVGB 3ARFB 2CD0A 5FM8A 1T2QH 2AGJH 5D5MF 4XPFL 3VFSB 2VR9A 4XCEB 1FL6B 1N8ZB 1FO0H 2V5RA 3V79C 2A9ML 2JK5A 5GGRA 4JN2A 1PY4A 4DOHE 2XN9B 1ADQL 3KGRA 5C70A 1OT2A 1WC7A 2Y07L 2H2PD 3PF2A 2ID5A 3BZFB 1DBML 4HUXA 1F11B 4J8RA 1JIBA 4PJ5B 4Z7QF 1MEXL 3RA7H 3GJEB 4I3SL 1IL1B 2Y5TA 1RZ8A 1MFEL 1A6AA 4WEUD 3ZT5A 1MJJA 2BJMH 4NNXA 5JUEL 5F71A 1PKQA 4EXKA 3N9GH 4NJAH 4Z7UE 4Z7WE 2DDQL 2VXVH 3NAAH 4CNIB 1X5LA 1MIML 2I60H 1HINH 2CLZA 3D85A 1YMMA 4PJ8B 5GRVL 2H3NB 2BFVL 4MX7A 3HNVL 5GSVA 3BEVA 1REIA 4O02H 1UH2A 3FO9A 2CSPA 4YDVA 1BQLL 1CQYA 1NCNA 5I8KL 2HKHL 2LV4A 1S9XB 4M9OA 2BHZA 4DKDC 5I1CL 3KPLB 1FC2D 1IGJB 3LDBB 3KJ4C 1KCSH 4LGRB 5F7UA 3OKEB 2NY7H 1T0NA 5T1DH 3LN4A 1X4ZA 4DGIL 3N85L 1IGIL 1OD7A 1RZ7L 4BQCA 5C8JB 1YEJL 2VNCA 5AYUL 1FVDA 1G9MH 1T7ZA 1S7UA 1FG9C 2ATPA 4OIIH 4R8WH 2F8XC 3D3VE 2F5BL 5D1ZB 1NFIB 4JFZH 5SWQA 4R4ND 1U0QA 1DBAH 3O3AB 5JDSA 4XNUH 2XQYG 2YC1A 3DVGA 2VLJD 5J56B 5DHXB 1H3WM 3V4UL 5D9SA 2J7LA 1FYTB 3RWCA 2I07B 3HA0A 1RUMH 4TSBH 4APQB 3MLZL 5ALCL 1R6VA 2NY1B 3K74B 3BPOC 4HPOH 1J1XH 4UTAH 1OCWH 4G80B 1CD8A 4OD3L 4OCLC 4NZUL 3RWFB 5D1QB 5T3ZH 3QFJA 4KC3B 4NJAL 3MTRA 1JBJA 1NUDA 3IKCB 3NAAL 1A7QH 1QRNB 3X14B 2YC1B 5C07D 2DJUA 3ZKND 4PYHA 3JWOL 4HQQH 5C0EA 4KKAD 4Y4FC 5AUMB 3P40A 1HNFA 4K2UL 2P8MB 2E8ZA 1G1CA 3CLFL 3NFPA 3LKPB 3ARBC 1VGKA 2YD4A 3BISA 3QG6A 3G6JF 2H1PH 4GSDL 1YY8A 4OLYL 3CZJA 5JOPE 2W0LA 3L3IA 5HYJB 3CPLA 2DJ4A 3W9DB 3PL6A 5L9DL 2R0LH 1SBBA 3CVHH 1XCTB 2NXZC 4WGVB 4P3DA 4JG1L 2HMIC 3C8KA 1QBMH 4YHZL 1U8MA 4MNQB 4AIZB 4JFEB 3UJTL 1JHTA 1GIGH 3U7AA 4TUJB 1WFTA 4FQJH 3MC0A 3LCYA 4Y4HC 1F4XL 1OSZA 3GRWH 2Q76B 3BIAX 3KYKH 5DUPL 1Z0NA 1CR9L 4Y1AE 1BIIB 3O2WL 4XPAL 3IS0X 1CFNA 1NFDE 4S1DC 4ZAKC 5L0QB 5DO2D 3GMQB 1QKZL 1TZHA 5C8JA 3LMJH 3TFKC 3V9FA 3V8CA 5TE6L 1RIHL 4V1DA 4WU5B 3RWCB 3MLSL 3GJEA 5EUOB 3QULB 1XR9A 1QVOA 1X5FA 1DEEB 5CJQH 3E3QE 3ECBB 4KKNA 4ZTPL 3LOWA 5FA3A 2NY4C 4X7FC 2V2TB 3RVUC 2LAAA 3QXVA 4ZD3L 4F8TA 4YDVB 5TDOA 3BP7B 3BJ91 3IRZA 3ZE2E 2XTJD 3QNYB 4LCWB 4HW6A 5HPOA 1J8HD 1SY6H 4PGBB 3HC3L 4YPJA 3I85A 4JFDA 5E24E 4PJ8A 3VXQA 4NKDA 1OTSD 5ANMB 3GIVB 1UEMA 4GW4A 5IBLD 4RMSA 2NYYD 4JFFB 4D3CL 1I75A 1NCCH 3ARWA 2ZCKH 3SDXA 4XCEA 4WFEE 4OGAC 4U1SA 5DJ8A 3FO1B 5EU5B 4QGYA 4ONFH 1JPST 4Z77A 1UB6A 1X5ZA 3T65A 3LDBC 2VUOA 4MQSB 2Y5EA 5CEZH 4M1GL 4JKLA 4OZIF 4S1QH 1F11A 4H25B 3MREA 4MJ5B 5KG9A 1IILE 2DLFL 4WO4B 2JF1A 3C5SA 1XR8A 4MAUL 2X1QA 5GJTH 1G7HA 3C08H 4X6CF 1J5OH 2X9WA 2BMKB 4UUJB 4U1GC 4M93B 1IGYA 4JEGB 2AV1A 4CNIA 5C0NC 2CDFA 3MV7B 1CFSA 2VL5B 3UC0L 4U0RB 1GOHA 1NCBL 4TULH 1OARH 1EGJA 5EBWB 5HHMB 1QLRB 3P4MB 5DJZA 4LCUB 2AJ3B 1KBGL 3DI3B 1UKSA 2CKBA 3D3VA 5E8NA 3T3MF 4ZO7A 3L7FA 5I1HL 3LEXA 1KN2H 3L5XH 4Y5VB 1FGVH 1AY1H 3ZDZF 25C8H 1VACB 3LVEA 3RL1A 4MWFA 2P7TA 2E8YA 1R5VA 1NAKL 2BSRB 3IRPX 1N0XL 5BS0A 2D7TL 5EC2B 1FL6A 5B8CC 3ULVL 2FLRT 4HZLB 4PLJC 4F7MB 3JWDL 2OJZH 5IVNA 4KRNA 4AT6A 4YUEL 3KPMB 2VAAB 1PZ5A 4CVWA 5C6PB 2FSEB 5HHNA 2OTUB 4JREC 1G9NH 4YDIL 4QT5B 4XGZA 3WHE0 3HNVH 5FO8B 5D1QD 5I1GL 3G08B 5E6ID 1FLTX 3ARGD 1INDH 1MCPH 1U8QB 3C5ZA 2ZUYA 5J3HC 4K3EH 4YQXH 4JDVA 4CDGC 4ELKB 5ILTH 5E4IA 5K9JH 5DD1H 4NYLA 5C08B 4DVBA 3BDBA 2BVPA 4R0LA 4JN1L 5ICZA 4OZGA 5EORH 1RZKH 1OARL 5DGRA 3QIWC 5D2LB 3MV8D 3HPJA 3O9WB 3OAYK 1CICB 5DRXA 4XP1L 1PW3A 3HUJE 1AD9A 2R2EB 4BQ6A 4PG9A 4PJAA 3MRRA 1N3NB 2ZNWA 4UZGA 2YN3A 3D0VA 4JPKH 2QJDA 4Z7UF 3W0WD 4HUVB 1PAMA 3IXAB 1GOFA 1C12A 1MH5B 3HRPA 4L29B 3WFCH 2X4PA 3ZYZA 3R1GH 1YNLL 4QRTB 5HGDB 4R4BB 2XNAB 1XF3A 5HVHB 4XP6H 2C1OA 1AP2B 3OGOE 3WE6A 5GZND 4YR6A 2DQHH 2ADJB 4OZFB 1BFVH 1H8SA 4C54A 4G6JH 3MRGA 5HGAB 2GCYB 3QCTL 3WIFA 4QWWD 3HFML 1P4LA 4QYOB 2B1AL 5I66A 3DV6B 3HE7A 1XGTB 5DK0A 4YBLC 4R26L 1KTLB 1BD2D 4K8RH 1KCUH 5KJRL 3FL7A 4HC1L 4ELMF 3PNWB 4JLRA 5GGVL 1I8MB 1K85A 1NQBA 1RURH 4GW5A 5IHZA 3CFJA 1U8OA 4FQXB 3PWVB 2EKSB 4RGNC 4CAGA 1J0JA 4AH2B 1WZLA 5CKAA 5DRNB 4HAFA 1UVQB 2X5PA 2DF3A 2H32H 5J6HA 2PR4H 4DZBA 4G9FB 1U95A 2C1PA 2CXKA 1AGCA 2FR4A 5IP4A 1ITCA 1LO5B 5ICXB 3EOAA 3EYOA 4ODSH 4ONHB 4R8WL 1IFHH 1ODAA 3GSRB 4MXWL 2NY0C 2BNRB 2EECA 1DL7H 1NANI 1VEOA 3H8NA 4FQ1L 5C0FB 3U4BL 3QDAA 1B90A 2WLYA 4MJ4A 3PGCA 1WBXB 1C08A 2R0KH 4LSUL 2XQBH 4M7ZC 1I3RA 1QBAA 4LSTL 2AERT 1T5WA 4NFBA 3O6ML 1UACH 2X1WL 5C7XH 3GMPB 5CGTA 4JHWL 3TO4D 3PDOB 3RZCC 3QUXC 1T3FB 4WFHD 4XNZB 3BX7C 4N0UE 5LGJB 3C5ZC 1AO7D 1NEZB 4P4KD 4E5XB 4N90D 4ZYKA 4BSWA 1FYHB 4WHTA 4ZOAA 5GRJH 3VWJA 1FZOA 5D7JA 4EIZC 1D9KD 3CU7A 1KPRA 4FQLL 4WI9A 4F7EB 3LQAC 4ODBD 3RFZC 4XMKL 3KPOA 5C0IB 1QEWB 2UZXB 1URLA 2A6JB 5ENWA 3HPLB 1S7TB 2Q3ZA 1RJZA 1S8DA 4EXPX 4JY4A 4PPTA 3MLTB 4Y5XC 5HHOA 1NCAH 1QQDA 4E5XA 5FO7A 3DUUB 5F9OH 1JZ7A 4GAYA 2AI0H 2VLKE 4WWKC 4U1NA 4XNQA 5B38G 1RHHB 1ZTXH 1HK6A 2EH7H 5EC1B 4IHOA 2RR3A 1EERB 3LSOB 1LO3H 5K9QG 1T21A 3QIBC 2YPLB 1DQML 5FYJD 5E00B 5L8LB 3RAJL 4U6YA 4EDXA 4DUVA 1NSNL 4WFHE 5EU7E 5DK2B 2VDRH 4L1HA 3ARBB 3I02B 5CJOL 1UCBH 2IH3B 3B9VA 3ES6A 3VMNA 3HR6A 4RMRA 5HPMA 4WHYH 5CKGA 3S37X 3QEQA 3M8OH 4LSPH 5D96B 1IEHA 2EIDA 3EYOB 4ONHA 3JWNC 4PY8I 1W8OA 3DX6A 2WP3T 2R2BB 5E5RB 5EFIA 5F9WC 3D0LB 4Y4HA 5IFHL 1MI5B 5DVLA 3EJZC 4L3EA 3G9AB 1U3ZA 2KKQA 4HGWB 3FQUB 2ENYA 3OKDB 4P9MH 4KRLB 3QIBA 2IF7A 3B9KD 3SE3C 3QT2A 1DFBL 4K9EC 2DQIL 4JRYA 5I1DA 4PP1C 4NO0A 2ERJB 4UB0L 3SGEH 5T1MA 5C0JA 1IEAA 2AEQH 4RAUB 3LS5H 5IB3B 3STBA 4QRPA 5LGJA 4WUUA 2VXSL 4FNLH 1F4XH 2XTJB 4JFZL 4LCWD 3MNWB 3HZKB 5FF6A 2BHUA 4O58L 2AKRB 1VKXB 1J9CT 3RWIB 5GS0H 1PVHA 4L4VE 4POZD 4OZFA 4F33A 4YHPA 2R4RH 1IZJA 1IGFH 1U42A 1K6QL 2PYFB 3RAJH 2MKWA 2NW3A 1WIUA 4PD4J 2XKNA 4S11A 3REWA 3T0BA 4G42A 4TPRH 4Z76A 4LAQL 3OKNA 4P4RA 2I25N 4PJ9C 2CK2A 2APTA 2FHBA 3FO2A 5F9JB 4AQOA 3G5XA 1NC2D 3UPCA 4UDUA 4JFFD 5DF0A 1DR9A 1M7DA 3GBLA 4PJ8C 3RWJB 3EYSH 5BV7B 1P6FA 4HQQL 3BGAA 3U4AA 5HJ3A 5C0BA 4DTGH 5J6HB 1FQ9C 3DO7A 1RJYA 5BQ7B 1E4KC 1CLYL 2X89D 3ULUE 1UWGL 3O6FC 3AAZB 5F96H 3DGCR 3OB0H 3VXOB 2HFGL 1KCRL 3TV3H 2YUWA 1NEZG 5I76B 4FQXA 3UMTA 3HC0A 4FFZL 1JNHB 4RISH 1EO8L 3I3EA 4H8WH 1CDUA 3RDTD 4OGYH 2IGFL 3DECA 4NJ9H 1J88A 1V3MA 3HE6A 5IMOA 5IQ7H 1J1XL 3TP4A 2VLRB 2HFTA 1G6RB 4Y5YC 5IK3A 5F6HJ 2VIRB 4XHQA 3SKUD 4OZGF 1E4WL 4WDIA 5I66B 2A2QT 2FSEA 5HHNB 4GG6B 2YPVL 3NCCB 4JFED 4S1RH 1X5AA 1N2RB 4PJ7A 1MIEL 4OLUL 3LKOB 3BDXA 3ARDC 4PLOB 4O2EA 5GGTL 2ZOLB 4CBPA 1MREH 4YR6B 2EYRA 4GLRI 1QSFE 4N90E 5J3HD 3LRSA 2Y7QA 4QCIB 1SJVA 1U3HB 2CKBL 2XA3A 2ZSVB 1PSKL 4MMXC 4PJ8D 2B8OT 4PTUA 1IQDB 1ZT1A 3KPSD 3OKMB 4JZNB 1YUHA 4KGJA 4RNRA 4WU7B 1FNEB 3VWJC 2DIBA 1P7HL 1BQLH 3M17A 3IKKA 1YN6B 1UT9A 2MPAH 3MRRB 5KTEL 3GSUB 1DVFC 3HMXH 4C4KT 2APWA 3IETB 2Q7YA 4HIEA 1NDMB 1VFUA 4NN5C 2D7PA 4OCRL 3X13A 2A74A 3T2QA 5EIIB 2I5YH 3JV6A 3GSVA 4GQ9L 4TUOA 4XBPA 3VGAB 2P5EA 1WF5A 5BZWB 5C0CE 4HT1H 4JO3H 5FO9B 3JWOC 1I85C 5FB8A 4HLZH 4D0BB 1CGWA 4QHMA 1LQSR 4FZ8H 1PGRB 1YYLH 3UJIL 1TZGH 3QISA 1CDYA 1BFVL 3JTTB 2ZG2A 1FNFA 1JGLL 3LQMA 1DBJH 1NBZA 4PRIB 1S78C 4H8WC 3QHZL 4H25A 3PV6A 4W68A 4R4FL 3ABZA 1IAIH 4PJXF 4NOFA 4P2RB 3UYRH 1MJ8H 5T1LD 3HS0A 2E6JA 5A16B 2FECI