2OMBA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(1)21 crystal form
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ombA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ombA02
5BCAA 5T1LB 1KIQB 3RRQA 3ZZ1A 5IKCA 3ILPA 5EC2B 2QL1A 5T3XD 4R2GD 1DQJA 3L5XH 4KJYA 4RFEB 3QUMH 1YEFH 2R69L 1I8KA 5HD8D 5DFVC 3MRFA 4NQVB 1NGZB 32C2A 5HGHA 4P5TB 4OKVA 5CSGA 3FT3B 5DJ0B 1U91B 2VLJB 4L4TE 3CVIH 3K8LA 4HEPG 2YBRB 2ARJQ 4GKZB 3VRJA 5D93B 3VW3L 3IGAB 2BNUB 3V4VL 2DIJA 2RAMA 2HJFA 3BO8B 4BK4A 4Y8AA 2FGZA 2QQQA 1PQZB 1T1XA 3K2UH 5CEZL 3GI9H 5CJOH 2CR3A 4LRNH 4Y4HA 2Q8AH 4I3RL 5ALBH 1AR1C 2VC2H 2IAMB 4JFPA 5FGCB 5J9PB 1MCDA 4PJIF 4MMXC 4JHWH 2DBJA 4OZHB 1HCVA 3G5XA 2C4FT 1IC4H 3O11B 3KYKL 4PRPA 4UZGA 4RQQB 1A7NH 1T03L 1CTOA 5D6DA 4M7KL 4ODBD 4LCIL 4HS8L 3SEPA 3LKPB 3HR5B 5MI0B 4DVRL 3CDCA 5H37G 4V1DB 2CUHA 4X9IA 2XA3A 4R97B 2H26B 1B6UA 4NJAH 2EH7L 4YNYA 4FQIL 4UUJB 2VTFA 5IW6B 1ZKAA 4EN3D 4OZFB 4BQ8A 1QVOB 3V5DA 5F7FA 1S9VA 4DVBB 4J3TA 3QJHA 4U6VH 1S9YB 2W0FB 3FQTB 1H15A 4HJJL 4LARL 5ICXA 1KPVA 2B1HL 2X89A 3L95A 2VSDA 4Z7WE 3EJYC 3TEUA 1AD9B 4PLKD 4RFOL 1KPRB 4X4XB 3RWHA 5I17A 3RVXC 2R29H 2ATKB 4F7EA 4M5YL 3WFDH 4YDJA 3T04D 5KS9E 4JFHD 2ADFH 4YAQA 3MUJA 1UM5H 4UNTA 5IBTH 1IBGH 4ZAKD 4L4JA 4PJGB 1NUNB 2EICA 4RMVA 3HMXH 3DBXB 5H8DA 1D5MA 2CPCA 5F21B 1UJTA 1UM4L 1BZ9A 1KACB 2Y36L 5EUKA 1JK8B 2AKRA 3DV4A 4JM2F 1PBYA 3MRRB 5D1ZB 2R2EB 3OKDA 1KCRH 5FCUH 4KKAC 2H1PL 3WNKA 3A6BH 1QBLL 1DUYB 4L9LA 2H2PC 2WINB 5SWZE 1BHGA 2OP4H 4Z9KB 1KCUL 4L3AA 4EQ3A 3U36A 1H3UA 3FQXA 3MOBL 3T3PF 1P7QD 1RJZB 1RMFH 5EZIH 3RY6A 3UAJD 1GJIA 4JFDD 1LDPL 1AQDB 4MMZC 4LIQE 5TFSH 3GDBA 3UJIH 3HB3D 3MLUL 3U0WL 5E00B 4I0PA 5D7SL 3DX7B 3LQAC 1A6WH 3GBMH 4KHTL 3EO0A 3OKLA 4N1EA 5I9QB 3SJVB 4OLXH 1W8OA 3E2HC 1DTUA 5KSBB 4LLQB 4XVUC 3CPLA 4FMKA 4PJAE 3CFBA 4AEHH 3QDME 1HQ4B 2PYEB 2DQTL 1TZHA 3TVMA 4XCNA 2A6DB 3S34L 5FB8B 1LE5A 1OTSD 5JA9A 5KBNC 2NXYB 4L4TD 4I0KA 3N1MC 4UV4H 43CAB 3QUYB 5MERA 3HE6B 3VG9C 4O51A 4ZNEA 1SJEB 4JHAH 2EYTB 3S35X 3U7YL 3ARUA 4P2CG 3HS0B 2OZ4A 4OUOA 4QRRB 2HA1A 1K8DB 1YDPB 1DDHA 2GJJA 3OAUH 1IFHL 3RL1B 3KWWB 1DCLA 1NLBL 2HKFL 4Q0XL 1EHNA 1CE1L 5CEZE 1T7WA 5IEHA 3QRGL 1UZ8A 5I15L 5I1HH 3CMOL 3CDFA 4EKXA 3QG7H 4S1QH 4XVSH 2YPKB 1NAMB 4NJ9H 1AKJB 1NQBA 4PUBH 4O9HL 4CNIB 5ADOL 1A3RL 5IHUH 3H9ZA 4NFBA 3ROLB 1J0HA 2A0LD 2WWKO 1RZFL 5HGDA 4BELD 5C0EA 2E8YA 2IC2A 4JRXA 4R26L 1GGTA 5E6YA 2WV3A 4OAWA 4F15B 3HE7B 6FABL 1BD2A 1VESA 1FFPB 1GC1C 4MXVE 4M93C 5CJ8A 3UPRB 4UOJA 5IMMA 4HK3N 3FHAA 1KB5L 4WTXA 1E4KA 2YPVL 3UZQA 5CD5C 5HYQB 5L9DH 2Y07L 3VI3E 2VLRE 4JN1H 3VRIA 1N5YH 4U1JB 4WJ5B 4XAWL 5D4QA 1U9KA 4XB8A 2CXKA 4L4VA 2CIKB 1K4DB 4JDZA 3V5HA 5JOFA 1BGXH 3MRPB 4ZUVA 3ECBB 2G2RB 4WWKC 4K8RD 4FQHA 2CJUH 3WDJA 1MNUH 4L1DA 2FB4H 3DVNA 4GW5A 3UBXB 4HH8A 4PJCF 4W68A 4DZ8A 3QNZB 1DVFB 1OW0A 1RZJH 3GKWH 3IETB 3T65A 1I7RB 3ZL4L 4MA8H 4RNRB 3PWUA 5CGYC 3QNXA 4M3KB 5EPMB 4I13B 2P8PA 1DQTA 3BP5A 1QKZL 1QSFE 1LK2A 4QT5A 2HTLC 1I1AB 5J6HA 4QRSA 2VIRB 5BJTB 3IFPB 1WT5C 5SWZD 4KRPC 4YQXL 3S3JA 3L3GA 5KVEH 1TJHL 5HI5C 1A7QL 1JI2A 1UXWA 5E8EB 5C0AB 3V0WH 1F8TL 1UVQB 1EO8L 4G9FE 4PG9A 2XN9A 3J7HA 5EOCJ 3KLHC 1MFDL 4FQ1L 4KV5F 1TJIL 4X6FB 2G60L 2CRYA 3IKCA 3ALPA 1YEDB 2V2TB 5HDBE 3S37X 1AGEA 2VQUA 4KMQA 1J11A 4XNQB 2DS4A 5IQ9A 2X4PB 4QHMA 3N1PC 1JWMB 4HJ0D 1CL7H 4YDVA 2O5YH 3NGBC 2DM3A 1IAOB 1PD6A 1HHIB 3TN0C 1EAJA 3AROA 3RWFB 1M1SA 4GXVL 4NPYA 5EU3A 5C0JA 1I1YB 1U93B 2D4DA 4LU5L 4RAVB 4XP4L 1TCMA 4ORGA 3MRCA 2NY7H 4IMKA 1R5IA 3EO9L 4ZO6A 3C2SA 3RWJB 5AD0A 5DRWA 1H5BC 2MWCA 2HFGL 3TYFA 5EG6C 1XF2B 4GMTH 1S8DB 1TTFA 3WFEH 4OB5L 1WICA 1YN7B 5B22A 2A77H 3O0RH 1R24B 1AY1L 3PP3H 1G9NL 4ELME 5CIPB 3WIHA 5C0RH 3JWDL 2ICES 3H0TA 3RAJL 2DBLL 3SDYL 1INQB 1FL5B 5CEXA 4AIZA 3QA3B 1QSEB 5FA4B 3MREA 1VGEL 2DLIA 2OTWB 1QFHA 4NRYB 4RA3A 3U7AA 3EYFB 5J57B 1OHQA 4P4RA 2ZCKH 5HYIA 1UKSA 5CSZA 5FUCC 4BFGA 4XPAH 1HH6A 1TCRA 2E7HA 3IYLW 4FP8L 2HJKB 5IFAH 4OFPA 1IEBA 5E8NA 2C1PA 5FHBL 2UUDK 3ZYOA 2R0LL 2BZDA 1QBAA 2FGWH 4EBQL 2VMFA 4UV7L 5K9OA 1KCLA 1SM3H 2AW2A 1TIUA 3MGTB 1N5AA 3VH8B 2MMXA 4Z95L 4Z7UE 5I19H 3ZT7A 3L3IA 4PRIE 4ZFZA 3QPXH 4TRPH 1G7PA 1GGBL 4EN3A 5DJCA 1NGPH 4E0RB 1NCDL 3SE9H 4CN1A 5DUBB 3OGCA 2DOCA 2QSCL 2VABB 3BMVA 2NR6D 4G8GE 3ULUC 5A3ID 1TZIA 5ID0A 1T5XB 4A2LA 1YQVL 3RNQA 4ODXA 5B8CC 3E3QE 1ZVYA 2FR4B 1I7UA 2A83B 4BH8A 4GRLD 2Y5TA 3PHOA 1GPOH 4AJ0A 3CFEA 1EFXD 2JJVA 1Q1JH 2P5EA 1YC8A 4ZAKA 3HR6A 3SE8L 3EFFB 4WW2A 3RKPA 1B6DA 4NWTH 2GTZA 4HF5H 3P11H 3FB6B 1VEMA 4LMQI 4ERSL 5DEFB 1QSFD 1UA6H 3IDNA 4X8XA 3V6ZB 1JGDA 1XT5A 1Q8MA 3WD5L 4ENED 3VWKA 2BDNH 5ITFB 2BMKB 4IS6B 4NQDB 1BBJB 1I3GL 4NO5B 2NQCA 4K7PL 2VLLA 4PJ8D 5GISL 3K46A 1U41A 5D2NA 4G9FD 4P9ML 3REVA 2JELL 1P7QA 3N9GH 5IMOA 3DGGB 4M8VA 4JFDA 5C07B 4CVZB 4Z8FL 2E9IA 3TIDA 1HHKB 4XPHL 3KPSD 5CP3A 3QXDA 1HZHH 5A2KH 1CF8L 1G9ML 2HFFB 2DB8A 4RISH 4HPYH 4IRSB 4QLRA 1N4XL 4E42B 1V3LA 5IMKB 4YH6A 4Y5VC 5D5MA 1FAIH 1Q94A 1RZ7L 2VR5A 1FZKA 3KLAA 1U58B 2AVGA 5EZOL 1A2YA 2V2WA 3U9PL 5LGHL 5E2JA 4DKFH 5TE7H 4Z7QE 2NX5E 1S5IH 3P73B 3CH1B 1P4IL 1R3KA 3IDXL 5IOPA 5A16B 1RQ5A 2AJVH 4JFED 4TNWK 2EDWA 4MNQD 2OCFD 3CDYA 1JFQL 5GRJL 4L4TA 4D8PA 1JF5A 2H2SD 3VFGL 4HK0B 4GW4B 1SJXA 4QO1A 4K71C 1E4JA 4N0UE 3X17A 3ARYA 3TBSB 1V7NH 3M8OH 3R4DA 2X1PA 3LIZH 4U1MA 3V2AR 3DURB 1VSCA 3HNTH 5IB5B 1H0DA 4EI5C 4G6JH 1DQQA 1YJDC 4WFGE 1CG9A 4XXCC 1SVCP 1A9EA 3QHTC 3VU2A 5HHQB 3BSZH 4NQTA 3OBAA 1JNLL 3PGDB 4LSDA 2GTWB 3WN5A 3GRWA 5CGTA 4OSUL 5IW3A 3X3FH 1N8ZB 3LKRB 3GSUA 3WXWL 4FQJH 5IB2B 1G7JB 4PPTA 2X40A 5D2LB 3HI6L 3IJSB 4AEFA 4ZFGL 1UH4A 4EZMA 3O6KL 3U79A 4PRID 5C6WH 3QPQC 4U0RB 3O41B 4PRNA 4JRWA 4ZPTB 4YHLL 3SDXB 4JG0L 1G7IA 4M1GL 5TQ2L 3HG1E 1OAUL 2XOTA 2MQ0A 1NLDL 1KSRA 3GJFH 4Z7WA 2XQBL 3FTGB 3PE9A 3I6GB 3UJJH 2GAZA 3VFPB 2OK0L 2XWBA 2IMMA 4JFXA 3SKMB 1ZTXL 1XF4A 4LQ1A 4O2FB 5KS9A 1JI1A 3MRMB 3U2SA 1MCEA 3BOVA 2VXTL 5DJZA 4X4YA 3RTQC 4WV1A 2YKLH 4U3HA 4Z7NF 1WFOA 2BOCB 3F8UB 1F3JB 3GSOB 4WRLA 3RGVB 4I3SL 3B9VA 4M62H 2EDKA 1UKQA 2NY5H 1E6OL 4HKZB 4YDKH 3HUJB 2HN7B 3I2CH 2X4TB 4G6FB 4AZ8A 5JW5A 2B2XH 1BJ1J 2FIKA 4PRDB 1F4YL 3L3JA 4OGZA 5JLZA 1NCAH 1QPXA 4QXUL 2PO6D 1MFCL 3WO4C 4XP6L 4X8JA 5DC4B 5SWZA 1U8JB 4LLDA 3FRPG 5D71H 3O3EB 1UCTA 3QYCA 3FAWA 1NFDE 3EFDL 4WHTA 4LLYA 4RSVA 4UINL 5D9SB 3WIIH 3NA4A 1EX0A 4PJFB 1KF9B 1BOGA 2YPLE 2DMCA 3ROOA 3VXSE 4YHYB 2DTMH 4PG2A 1E27A 5HI4D 3WV0A 2V7NB 4YWGH 4LSRH 4L1HA 4NN6B 4UNUA 4MSWA 3PV6A 4PJAA 1MQKH 3M1BB 4EVNB 1EEQA 1XEDA 1UACL 5ABDE 3QDMA 4PJAF 1HOCB 3D2UD 4K94H 1MUJB 2YMXH 3WKNA 3NZ8B 3FQRB 1S7TA 4KDTC 1AC0A 5F8RC 4ZDHB 1CDHA 2VDLL 2HWZH 2L7UA 3T2NH 1I7ZB 5I1JH 1AI1L 4NCC1 3PHQA 2WBJC 4JFFE 4IMLB 3WFCH 3SO3B 5ENWB 5IV2A 4N68A 4WGWB 1JPFB 4YIQA 1IGCH 1K8IB 3GIZL 5EUOB 3B5TA 3LQAL 1CFSB 2JCCE 4FQLH 3SDDD 4MWFB 4NGHL 3NCEB 5IB1A 4LLUA 1KPUB 4WFGD 1NMAH 2BVYA 5B3JE 2ZUQC 3DRTA 1FV1A 4PP2B 1WTLA 2XKUA 5CJXA 5KANG 3IFLL 1MCOL 4PJDF 1U2CA 4G5ZL 5CP3H 5MHSD 5E4EB 2MPAH 2QQNL 4MNHB 3AY4A 5MEQA 2DIBA 3MRIB 3ZTJH 3WCYA 1JGLH 2RHEA 3GSVA 4O2EB 1CWVA 2ZPKL 3MBED 4LSTH 1A6ZA 2PTTA 3QCUL 5EIVA 4YXLH 3U1SL 4MJ6A 5CWSA 1QBBA 3FQWB 4TTDC 2HJLB 5AZ2H 4KTDH 1CL7I 5IG7B 5KVMC 5DMGD 3TYGL 1HIML 4MDJA 4MXVF 4A6YH 3TESA 1IAIH 4WEMB 1WBZB 1N6VA 1FDLH 5L88L 3DUUB 3PGCA 1A8JH 8FABA 1KN4H 1NEZB 3F58L 2VLRA 3BT2H 4OZGF 3HG1D 3S5LA 4QF1B 1D5XB 2V5SA 3GMMA 3I9GH 5EC1A 4J6RH 4NZUL 5AYUH 1J8KA 3C2AH 3BXNB 2O5XH 3QEUB 1KCKA 2OJZH 2R9HD 2Z91A 4PJEE 5ID1A 1NSNL 5IWLC 4UQ2B 3AC0A 4ETQA 2UYLA 3KHQA 3BEVA 4EQ2A 1RIHH 1GGUA 2W07A 5T1DH 4GRLA 3QHZH 3T3ME 1WVZA 5C3LD 1GGIH 4LEOA 5EBWB 1EFXA 4HFUL 4CDGC 1GC1L 4H25B 3FO1B 1F02I 5DS8A 4MCZB 4Z78A 1AJ7H 3CX5J 3WS6C 4G8FA 2AV1B 4L29A 1ZT7A 3CC5B 2RFXB 1QSFA 2HMID 3FQUB 4EIZC 3VFMA 2Q6WB 2HFTA 1IJ9A 3DVIA 5DTFA 4QWWD 4KROD 4X6DB 1JF1A 1DP0A 5GGUB 2VITB 2AK4E 4OKDA 4G9FA 5ECJE 2Q3ZA 4DKEL 2GUOB 2NZ9D 4OFDA 5DK2A 4WVRA 4DCQB 1I3UA 5DI8B 4OF7A 4P23D 2FHFA 1E4XH 4R8WH 5ETUA 3VXTB 3IXTA 3MJ9H 2XTJE 2A9NH 2YPLD 3VXSD 3ZMRA 4NN5C 4WI4A 1RPQA 3OKNB 4EJ1C 4P46D 4DUWA 5BS0E 1OCWH 2HTKC 1ZA3A 4M93B 3QUXD 1BZQK 4M1CC 3C5ZC 5BO1L 3TIEA 5TE4H 5DHYA 1AC6A 1WITA 1HWGB 1XIWC 12E8L 5IR1A 4X99B 1Q9WB 4JLRA 3AFLA 2ZOKA 4MYWB 1NCCH 4R0LB 3SKOB 4Z5RA 2CDFA 4GT7A 5E1AB 3ARFB 1T7YA 7CGTA 3QIWD 1EFQA 1DBMH 3H9HB 1U8HB 2DKMA 4JFOA 2BJMH 4NKDB 2P42B 1LO4H 2BY1A 3O6FC 3TM6A 5FO8B 2NXZC 1HHGB 1FRGL 1T0NA 1J86A 1HINL 2B7DT 3VFOA 4KTEL 4ELMA 1BIIB 5T5NF 3MFFA 1RZ8A 2NYYC 3W82A 4HMDA 4NCC2 4ELMF 1DE4B 4TQEL 5T3ZH 7FABH 3DO3A 4DUVA 3MV9E 3Q5TA 4HS6A 5DD0L 1V3JA 3F6IA 4FXGB 4Y19E 1V5JA 5KSUB 5B39A 2A74B 4Q2ZA 4X9HA 2WBKA 1ACZA 3L3DB 1YPZF 4OGXH 5E6ZA 2QSTA 3VXNA 4GKSB 4K9EL 4XGZA 5EO0B 5IHBA 1KEML 2R23B 3X14A 4OLZH 3FCTA 4HPOL 2W60A 2P24B 2XFXB 1HYSC 1DSFH 5A2IH 4S2SA 4JFZL 1KB5A 4Z7UA 5IQ7H 4OFIA 4PRIA 3RDTD 4JM4L 1JGUH 1NMBL 3K7UA 1L7TH 1PSKH 4GG8B 2DWEA 5I1AB 2VR4A 3JTSB 1UM6L 5HHOB 3RQ3A 1MREL 3WIFA 2NW2A 4ODTH 3DX6B 3RVTC 4G8GA 5DJYB 5I1GL 3G08A 2BX5A 3EYOA 3VD3A 4OIIH 1QYGH 5IJVB 2R4SL 1AXTH 3HCVA 3G6AB 1FNEB 5C08E 2BY3A 3ILQC 3NGBB 4HSQA 4NT6A 5TDPB 1FYTE 3U6RB 3S35H 4O2CA 5IVXB 1JTPA 3D85B 5J11B 3DVGA 2YS4A 2LQRA 4MS8D 4WEUD 5FO9B 4HUVB 1QPPA 2O5ZH 1XGQB 1BQUA 4QCIB 4HLZH 5SX4I 1WBYB 2H8PA 5FGRA 5JORB 2FX9H 3F6LA 3FMGL 4PGEB 1U6AL 3V7AE 1QRND 3T0EC 1TXKA 3DYMA 4Y4KD 2EIEA 1FJ1A 3KPNA 1F4AA 1T21B 3MRBA 3UTSB 4WUUE 5TH2B 2ICWI 1CFNB 4GKNB 2ADIA 1BQLH 1UXSB 3C5JB 2PO6A 4L8DB 2YN3A 3N85H 5GGSA 3RBGA 3RGHA 5D72H 4E5XA 1IT9L 1ZHNA 3BI9X 1PZ5B 5GZND 3ULUL 3A67H 2OTPA 1RZKC 1T2QH 3W11D 3SKNA 2XY2A 4FFWC 2IBZY 1NL0L 1MAML 3EYSH 3KYMB 3FL7A 5TDNA 4RBPH 4N8VB 1PVHA 2UZIH 5HHXH 1NMCB 2XTJD 2V2XB 3HC0B 4PB9L 2IANB 3I75B 2AXGB 4XRCA 4WU5B 1OAKH 4DAGH 2GIYA 3ES6B 3WHXB 3I6KA 4JY4B 5GS0L 3SDCC 2MKWA 3QG6A 1DN0A 4BQCA 4WFHD 4HKJA 2NX5A 3LKQB 2HLFC 4TSAL 4EUPG 3AU1B 3VE0B 2OL3A 2GT9A 3D2UA 4HJGB 4OCMC 4CMMB 4XPBL 2FWOB 3T8XB 5HHMB 3H6JA 2ZSVA 5IBUG 2VDNL 4K23L 2J6EL 3M07A 1INEL 4UIKL 1IGML 4HWEH 3D69A 2GY7B 3SE4C 5IUSA 4NM8L 4NYLA 4PGDB 4HIIB 3RPIB 2XWTB 3W0WE 3HFML 3QEQE 1A9BA 4N0UA 4FABH 3SKJL 3QSKB 4TNVF 1EEUA 1NKOA 1A64A 4WHDA 4GBXD 4KDVA 4HXBL 2BNRE 4L8SC 2ICEA 2J4WL 5CFHA 4PJ9D 4Y19D 4HS3A 4UB0H 3C6LD 4WI9A 5I2IB 1KIRA 4LASH 1JPTL 1FVCB 1EGJL 2YR3A 3BZEA 4HXAL 4HUUB 1C12B 1CK0L 4MB4A 1EUUA 2X4QB 4BQ6A 3G5YB 2BVOA 4LSVH 4Y4FB 3S37H 3MBXH 4HCRH 1F11B 2H3NA 5DQ9B 4RGOL 1KXTB 2WBWB 4DWHA 4ZYKB 1U3ZA 1OAZL 1PX3A 4PJHF 3TA3C 1MVUB 1HXMB 5CBAA 2VXSL 4GAYB 4S1DD 3ZE2F 3HI1A 1YJDL 1K3IA 3RA7L 3HG1A 3EOTL 3KPPB 5F1SA 5DJ2B 1ZLVH 2FYYB 4MNGE 4JR9L 2E7LA 5D1XC 3NMEA 4HBCL 5C08D 4ZFOL 2CDGB 3S6CA 1FYTD 2BVQA 3MMEA 2BSSB 3E8UL 3HTLX 2D7PA 5GRUH 4KKCC 4Q6IA 2JLLA 3AS0A 4P4KC 1KTLB 1W72L 4DFIA 5SV4A 1D5IH 3SGDH 1AGFA 2QADD 3N50A 3BYYA 1OWRM 4GAGH 3CK0L 4NC1E 2EXYD 1YNKL 4P5MB 4AY0A 1QLFA 4HIEB 4LHUB 2HVKB 1FIEA 4WUUD 1YY9C 3BPOB 1XH3B 4I8DA 1F00I 1HHJA 2W0KA 3KGRA 5ICYB 3MOAL 3SDAD 1OP9A 1DEEA 1V8HA 1CCZA 4GJTB 5D7JC 4H8WC 5E5MA 1CZ8H 3ULUE 3GBLA 5INDB 2VE6B 1F2XK 1IGIL 2K3TA 3OKEA 4G8IB 3WMSA 3WSQL 4APQA 4XPTH 4DK3A 1NFDA 5GGVY 1NFDF 2J5LB 1IAII 4WI8A 1JYNA 1CFTB 3C09C 1WWBX 2YA1A 2EDQA 4LLMA 2YPLA 3VXSA 4BQ9A 2IGFL 3DETD 2PN5A 4LCUB 5IVZA 4LLVB 3TO4C 4G7YH 4P46A 1IGFL 3P4NB 3G5VA 5DT1H 3ARDC 3EGSA 3LRSB 1J8HB 4MJIB 3QUXA 3GNMH 4MZ3A 1L7IL 5F9AC 2CXGA 4DEPC 5DHVH 5FO7A 5FYJD 3B9KD 3IAPA 4ZPVB 1JWUB 1HI6B 1IL1A 2X9YA 4NRZB 3UP1A 1GGYA 1JPGA 3VJ6A 3BKMH 1U3HA 4KVCL 4BSVA 2M1KA 4XP9L 4LNRA 4M8QB 1FZOB 3GSNA 1MEXH 4M6AA 5SX5K 3C9NA 3N06B 3W0WD 2ADJB 4H0HB 2X4OA 3I6LE 2GJZB 2NY3B 5I8CB 3QEQD 2JB6B 4IOSD 3UEZA 4NFCA 1AHWA 1RHHA 2JCCA 3QEHB 4HWZA 5C9JB 3ZDZF 5FYKU 1UYWH 5KSAD 1XCQB 3QRFM 5MEND 1PKQE 5GJSL 2BNRD 1MWAB 1OF2A 4UIMB 2P46B 5K59F 3BPNB 4LEXL 3BP6A 4UTAL 5BXFB 4FQXB 4IHOA 5B3JF 4DW2L 1GIGL 5C6PB 2JIXB 1X5XA 3U4AA 2K7QA 2Z4QA 4OZHE 4XC1H 4MD5B 5L7XH 3QIUD 3F12A 1E4XI 1OWWA 3VI4E 4U33A 1ZGLB 3SOBH 4OLWH 2EE6A 3F7VA 3MJ8A 4OD2B 4XI5D 4KI5C 1F4WH 5IMLA 3OB0H 4V1DE 3T2OA 3ARGC 2OSLB 3S7GA 4KVNL 2JB5L 2WQ8A 3ZYZA 1KYOK 5E2UH 5C8JA 3JWOC 3RDTA 2EYRB 4F9LA 3G6JE 1T1WA 1BVKB 2VO5A 4XCCL 2Y5EA 3AB0C 4AG4H 3BRGC 2WIIA 5HJ3B 4XNYL 3MX0A 3CFCL 4B50A 3MLTA 1CGSL 2AV7A 3QO0A 5J1AA 1T7XA 4HX1A 4MA3A 2KH2B 3QHFL 3FQNB 1XR8B 4PJEA 4JY5L 2PXYD 1IGYB 3PL6A 3Q6GH 3QUZC 5TF0A 1EO7A 3UROR 2C4XA 5I8KH 3MCLL 5T1KD 1XR9B 4QRPB 1RIUH 4YGVB 3U7WL 4CJ1A 2QSVA 3T3MF 4PB0H 4BFBD 5HHNA 3KYAA 1QLEH 4PJGE 3MRHB 2W38A 5ALCH 3L3OB 3TCLB 3JVGA 5J1TC 3RWDA 3V6OC 1MY5A 5FUOH 4JPVL 2HKHL 4QRUB 2PYFB 2IH3B 4OI9A 4Y4KA 1T6WA 2VZOA 5J3HD 3LPWA 3JV6A 2X42A 1QA9A 1P53A 2LU7A 4JFQA 4RGND 1RU9H 3CUPB 1Q72H 1Y18B 4XNUH 4Y2OA 4EI6A 2ZCLH 3P0YH 4PP1C 2YWYA 1KENL 3S4SA 1CLOL 1OL0A 2AK4A 3R06A 4WO4D 2EXWD 3CH8A 4PS4L 5KAQG 3NFNB 2Y4SA 5IT2H 4HIJA 3V4UH 3PGFH 1IKNA 5GRWA 5H2BA 4NKQB 2QHLA 2HT3D 3ZE0F 1FZJA 2BNQE 1EHAA 5IFHL 4R96A 1LEKA 4D0CA 2KQNA 3CMGA 5GS0D 1B0GA 2V9TA 3E6HB 2ICWB 3ORJA 3ARPA 1G0DA 5T1LD 1E28A 1OSPL 1NKRA 2HT2C 3VFSB 5ESQB 4HMEA 5KSBE 1ED3A 1AXSB 4QY8B 5E95B 3WS3A 3B6SB 3MC0A 1MJUL 1WC7B 4KJWD 4K2UH 3VGGA 3K1DA 4P2OC 1C1EL 1FFNA 5BW7C 2CR6A 1VGKA 3MUGA 4U1NA 3TH3T 4P5TD 1CS6A 5L2KE 2ZSWA 1BJ8A 2DQUH 2VLJD 4XWGH 4NFDA 2VYRE 4HV8A 2EZ0D 3I6LD 1CD9B 3OKKA 5F1IB 3GSRA 1OGAB 1JZ7A 1RJYA 2YZ1A 3GJFB 3K74B 1E4WH 1SBSL 1IKFL 5JR1L 1UCBH 1F3DH 3IFNH 4LF3B 1M71B 1QFWH 2XZAL 3E6FB 5JOPD 3FOLB 2IAMD 1MH5A 3IRZA 5F7DA 1MIEL 3C08L 4PJ9A 3MV9A 1T0PB 4O4YL 3NA9H 3O4LE 5L0QC 4GRMB 2W9DH 4Y19A 3PV7A 3EBAA 4YHIA 1NDMA 1NBZB 3TPUA 4NO0D 3WFZA 3FOMB 3MCKA 3C6LA 4QRTA 2XZQL 1PEWA 1RULH 2WLYA 3ULVF 3T4AB 2C9AA 2Z8RA 2IPKB 3I02B 1HE7A 4DGYL 3UDWC 5FKAB 4POZD 2L7JA 2CRIA 4V1DD 3NFSL 2N1KA 4YPGB 4FN0A 1I9EA 3OHXB 2P8MA 4UMGA 4PRAA 4HGMA 5DWUH 3BGMA 4C54A 4TSCH 2A73B 3PIQA 3NFPB 5J13C 4NKMA 2DLGA 3L5JA 5D7LB 1MHPH 2BVPA 4XHJC 3LS5H 1MLCB 4HAGA 5C70A 3CFJA 4NN5B 3P4OA 4ODWA 1M7IB 5EOTB 4IOFD 3MACL 5CJ5A 1IGTA 5C08A 3QXVA 4AM0B 1ZVSB 1FYTA 2IALA 1WAAE 1VKXB 2XA8H 1XIWB 3DX8A 4MDIB 1NCWL 4KXZH 3GSXB 3CVHH 5D70L 3RKDD 4D9QD 3NZHH 4IRJD 2P5WE 3FAXA 3QFJB 4CU8A 4X80H 4AL8H 1DL7H 3HNSL 1TZGH 1BAFH 1A6PA 3RUGB 5JUEL 5KW9L 4IOIB 4WUUA 4C58B 3L6FB 1IE5A 2Z35B 4KMTH 3WNPA 2E9JA 1KJ2A 3SDAA 2B0SL 2MQCA 2PR4L 5I66B 1H3PL 3BZ4A 1B2WH 3RVVD 3UX9B 4J8RA 1EDQA 4HT1H 3QDGB 5C0AE 1YYLL 1MCLA 1B4JH 2JJSA 4OZ4B 1FGNH 4KJPD 4D9RE 3H3PL 3VFWB 1T5WB 3KPOB 2AJUL 1XGUB 3LPFA 4I77H 3GSWA 1A6AB 1U3JA 3SQBA 5MEPB 3QH3B 4UAOC 3GSQB 5JHLL 1BFVL 2M2DA 3SJVD 3W9DB 4OLUH 2F5AL 1C08B 2QR0A 2R0KL 4HFWB 5TE6L 2R1YB 2YWZA 4GXUN 1F3RB 2DLFL 4YLQT 4NO3B 2FX7H 1S7XA 2IG2H 3SO5A 5LGJA 4NP4L 5CILL 4Y4HC 3LOWA 5DZLA 1RZJC 4QHKI 2ARWA 1MFBH 2R8SL 5EIQA 1XGYL 4JEGB 3O2WL 3QAZB 1VEOA 4M43H 2P1YA 5KSVB 5L2KD 5IP4A 3BIAX 1FNLA 1AE6H 1TENA 3SGDI 4AEIL 4MA7H 4A6YB 2A6IA 1G7HA 2NXYD 1CTNA 4U1IA 3P4MA 3QUYD 4XBGA 1MRFH 3HE6D 4P48A 4NHCL 2QQLL 1Y6NR 5JHDB 4I9WE 1A7BA 1PG7X 5D6DC 1IAIM 3W0WA 5IFJB 5FDWA 1R5WA 3QEQA 4BQBA 3F7YA 4JN2B 1YNLH 5CINH 5IHZA 1LO2L 35C8H 1JNNL 4NUJA 1RUML 1YC7A 4XP1L 3HA0A 4LPWA 5KSAA 2AJSL 2H45A 1CE6A 3CX2A 4RFNB 2YC1B 1Q0YL 3X13B 5A43C 1AP2B 4YHML 2BNRA 3NCBB 5DMIH 2F54E 5HYJE 1QSEE 4F57L 3C5SA 3TN0A 1S3KH 1AKJD 2VDRH 1PLGL 3EYUL 1X5JA 5DQJB 3B2VL 4GAFB 2DJ4A 3W5NA 1ZANL 5F9DC 3GK8H 1IAKB 4C57C 3B3IB 3QIUA 4LLAA 3GMRA 4MXWL 2AERT 3IDUA 4OJFL 1IC1A 4M48H 3HE7D 4XWOD 2NZIA 5CZVH 5GZOD 4OZIB 3HC3H 1XF3B 3SGKA 4OCSL 3D0VB 1Z5LB 3HLAA 3TBVB 4YZFE 4OUUB 1IC5H 1DZBA 3RX5A 5F9OH 5B38G 3FT4B 4JY6A 2FSEA 4GQ9H 3FB7B 1J05A 3SDCB 3ZKXB 4KKLD 4MNGA 3DUHA 3EOBA 4Z0XA 5C0IA 4EDWH 1IEAA 4PJ5B 5F6HI 1TETH 4L9LC 1B0RA 2G5BB 1QO3A 5F9WC 2PXYA 4ZG1A 2ZCHL 4NM4L 4R4BA 3FZUD 5GGRA 1ACYH 5T1KA 3BH9B 2PCPB 3O6ML 1YA5A 4U6HB 3RY6C 4LVNC 2P5WD 1U36A 1S78C 5CMAA 2VXVH 3WXVH 1Z9LA 4F33B 4Y1AB 3GHEH 1C8PA 1DEDA 4I0PC 1SYVB 2NY0B 5C09B 5EIIA 3ULVH 2C3VB 3WFBH 3MRGB 3TBWB 5DLML 3MV7E 1I8MA 1EEZB 2EDRA 4YXKH 1KFAH 2BK8A 3CXDL 1I1AD 2DQCL 1ZLUH 1UQSB 3OAYH 2Q7NA 4KZDH 5D7IF 3VFTA 4R90L 1MFEL 4NOFA 4Z76A 3AAZA 1FO0H 4N1CA 5DJ6B 5HGAB 4HKBA 1BQHA 1OSZB 5C0AD 3BAEH 2F53B 4OM0L 4PTUB 3FKUS 4GKOA 3BPLC 2GK0B 4P3DB 4YO0A 4D9RD 5LAXB 5E2VL 4WO4A 4F7TB 4NZTL 2DQEH 5EO1A 5IESL 4CVWA 5E56A 1T1ZB 3CLEH 5T1MA 4B53A 1FN4A 1ZA6A 4HC1L 5TQ0H 4FQ2H 5TPWL 3T0EE 3BZDA 1KIQA 4F2MB 3RVWC 2NTFA 5EC2A 1JPSH 3N1GC 2AK1L 4OCRH 5DD6B 3D18B 2OR9H 2R4RL 4RFEA 4KJQC 3H9SB 2DKUA 5CUSH 5EFIA 3KS0H 1HKLH 3V9FA 4CN6A 4NQVA 1NGZA 2E27L 2J6EA 1ZK9A 2DI7A 1ADQL 4N90E 3LKOB 3CZJA 2OR8A 4P5TA 43C9B 2EC9T 1D9KB 3NTCH 1QQDB 3FT3A 1FIGL 1U91A 3HMWL 5D1XB 2APWA 4I9WD 4FG6D 4U05A 3RHWF 1RUAL 4H1LH 1ZLSH 1CDIA 4RAUA 4GRWB 2IWGA 4UBDC 4D3CL 2YBRA 1IM9D 1FFRA 3IGAA 4UOW1 4NQEB 2BNUA 4ZS7H 5I6XC 3V4PL 1REIA 3BO8A 4MB5A 4ODHL 4JG1L 1PDKA 4MD0B 4P4KB 3UTTE 3PNWA 1XCTA 1PKQA 4TOYH 5E08L 2F54D 3MLPA 5HYJD 4ZD3L 3TFKC 1QSED 1XGTB 1HQRB 3LAFA 5J9PA 2NY4C 3L9RB 5C0CE 2E9WA 1JGVL 3BP7A 3KHOA 4PJDB 2CLRB 4OZHA 1EEYB 3HRZB 4NO0A 3O11A 1EGJA 4P3CL 3RZCB 4OZHF 4QRQA 4RQQA 1JGEA 4JKKA 5AZEL 3DJ9A 3MRNA 3KYOA 4YGAB 5D7JB 3VI4F 2IBGA 3GGWB 1YN6A 3LKPA 2YOCA 2V17H 2YD2A 3BN9C 3UO1H 4V1DA 1BWMA 3SKUD 1HH9A 5D2LE 2WW8A 4MD4B 4N5UA 5E99H 5SWQB 5F71A 5FYJH 4QYOB 5IB3B 5IW6A 2VDPL 1X9QA 1TMCB 3G6JA 4EI5A 3WL9B 1A7RL 4OZGB 5C6TL 3BDYH 3FQTA 5GGTL 3ZKNC 5E6IB 2J8UB 2CKBL 1MPAH 4D0BB 1WWCA 2CO7B 3Q6FB 4ZFOA 3QZWB 2E5EA 2VRAA 3EO1B 3IDJA 1NCBL 4YHZH 1ONQB 4UT6H 2BSED 4FZ8L 3O4OC 4DEPB 4CDHA 2O93L 3LKSA 3F5WB 5IF0B 5EWIH 3HAEA 4FHBD 5I73C 4S1SH 4ONGL 1QFWI 4PJGA 4IRJA 4GUPB 3L5XL 4PJGF 3VFVB 1CN4A 5ESAB 1JNJA 3WLBB 3QUML 3HUJE 1CICB 3MV7D 1KBGL 1JK8A 3MRRA 1GYAA 3IFOB 4OQ1A 1U42A 3V52H 1J1PH 3D5OF 4HUWB 5BV7H 1T2JA 1X7QB 4LVOC 5CD3B 2WINA 2W59A 1WFNA 5GSRA 4NQDD 1ZHLA 1UG9A 4R2GC 5C07D 1BX2B 1AQDA 4B41A 4L3EE 4X6CB 5HD8C 1CIUA 4JHZA 3K2UL 3GI9L 2R0ZL 4X6EB 5CJOL 4LRNL 2Q8AL 3JV4B 5ALBL 2D0FA 2VC2L 5E00A 1O7VA 3GHBL 4F7MB 3G6DH 3SBWA 3DX7A 4IRSD 2BNQA 1ZV5A 4HQQH 4I3GA 3QUKB 2WNGA 5FKPA 3QXAA 2CH8A 4JHWL 5HPMA 5I8OH 4LOUD 5BRZB 2EDXA 1FNHA 1MFAH 2XKSA 4YHPA 3RVUD 1A7NL 2LTQC 1H3GA 3VWJD 5KSBA 2PUQT 5KTEH 4MJ2A 4KHXH 5F3HA 4FNLH 4LCCC 5KSBF 2I9TA 4LSUL 1A3QA 4BSJA 1T7ZA 4OCNC 5FK9B 2OI9B 4KXZI 5DUPH 4N90D 3EHBD 5L2KA 4NJAL 5FB8A 1SY6H 1LEGB 4J1UB 4UQ3A 3NCYS 5ICZB 4ONHB 1WZKA 2IPUK 3QUYA 43CAA 4ZS6D 1AO7B 3HE6A 3BKCH 1U8LB 1FNAA 3QUZB 1JPST 1I8IA 4U1KB 4U6VL 3AXLB 3HS0A 5EUOE 2KZ1B 5M7QA 3T09A 2MCPH 3B8SA 1K8DA 1YDPA 3UTTD 4F7PB 2B5IC 2Y1VA 3PABB 1HWHB 2YD9A 1CU4H 3CLFH 5B4MD 2X41A 2R29L 1OB1B 3O4LA 4EN3C 2YPKA 2ADFL 1UM5L 3DIFB 5EBMB 4CNIA 3PDGA 1IBGL 2Z31D 4NNXB 5E8DH 3PWNB 3PP4H 5HSFA 1OPGH 1SJVA 3HZMB 1NUGA 3S5LG 3WE6B 3MXVH 5CBEA 2DQFB 4J23A 4PLKC 3TNMB 3HE7A 1KLGB 1KCRL 5FCUL 1FFPA 2D9QB 1LP9E 1HK6A 3ZE1E 3A6BL 3S88H 1J0KA 3UPRA 3EDDA 4C55A 3GBNH 2OP4L 3LH2H 5FECA 4ZAKC 3ZDXE 2YEZB 5FYLE 2UWEE 5HYQA 3G5ZA 4RRPA 4R7DB 1RMFL 5EZIL 3DV6A 1II4E 1YZZA 5FOJA 4U1JA 1Y0LB 5F7NC 1JHLH 4KUZH 1HHHB 3UJIL 2P4AB 4ZTPH 3FO2B 3ECBA 1KJVB 3MROB 1A6WL 3GBML 1WAAA 5JW3H 1HSBB 4LLWB 4P2OB 4R4ND 8CGTA 3Q5OA 4OLXL 1WAAF 5IBUB 4JPWH 1FC2D 3PWVB 2D03L 5D2NC 4AK1A 1AD0B 1SEQH 1EUTA 3RGVD 3UAJC 1PW3A 2P5WA 1U8NA 3REWB 3ZSSA 2OYPA 1NBVH 4PTTA 2HYMA 5DO2D 4RNRA 5DHVB 3HB3C 4AEHL 2HT4D 3TPKA 1XZ0B 3AVEA 5EPMA 1RIVH 3V5KB 5L8KB 3VFNB 3S36X 1KC5H 1RVFH 3TBTA 4WI6A 1I1AA 5BJTA 1CT8B 4UV4L 5FDYA 4PGJA 4TUKH 4U3XA 1VADA 4ZSOB 5BVJB 3O3UN 1YUHA 5C0AA 3QR2A 5FM5M 3CFKB 1UVQA 4PGBA 5IWLA 3P0VL 1VPOL 2GITA 2EIDA 5L0QB 3OAUL 2GQHA 3HC4L 5GRVK 3BKJH 4OZFH 2I27N 1OTSC 5I1HL 4TNVK 3QG7L 4AYFA 1N59A 4S1QL 4LMQE 4XVSL 5BOPA 3V6OE 4PV8A 3JBG7 2WK2A 3IVKB 5IHUL 1VHPA 1IAOA 1HHIA 2VISA 3KNBB 5DD3L 4TUOB 5T5NG 5I1EH 5JQHC 4LCIH 5H94B 4HS8H 2MCG1 1LO3H 4RWYL 5D8JL 1U93A 5JXED 4R7NA 3F7RA 3WN5C 1BFOA 5L9DL 4XBPA 5B39G 1A1MA 2A0LC 3RWJA 3MLVL 1KCVH 4XMLH 1U8OB 1A1OB 4QHNA 1IM9A 1XF2A 1S8DA 1GOGA 1CXIA 2IPUG 3GZKA 1R24A 3KYNB 5GGSY 1G7QA 1BGXL 4QTHA 1RJLA 4HJJH 5CIPA 2F54A 1FL5A 1D6VH 1G6RB 1ZHBB 3QA3A 1QSEA 5HYJA 4N8PA 3OTTA 2FB4L 2OTWA 1A6TB 1RZJL 3EYFA 2Q86B 4MAYB 4XZUB 3DROB 4TUJB 4MA8L 4N0CD 4BKLB 3CSGA 4K3JH 1SHMA 5IKCB 3ILPB 3EW3B 3ZYIA 1S7SA 1DQJB 4EDXA 4K8RC 2NY1B 5DJXA 1UM4H 1I8KB 3EYVB 3DMMB 3MRFB 4WV1C 1U8MA 3MGTA 4OM1H 1EJ6A 5KVEL 5FYLD 5HGHB 4OKVB 2FIRT 3V0WL 4UAOB 4NQUA 1Q0XH 4KZEH 2G75B 4C4KT 5HHOE 4YZFF 3VRJB 3BGFC 3FO9A 2VABA 1KEGH 4OIAA 4Q9BA 4JO3H 3UZEA 1YNTB 1T1XB 1FH5H 3MLUH 1UB6A 2AI0H 3U0WH 2UY7A 1EXUB 5D7SH 5D7KE 4KKBD 2NW3A 1CL7L 2CMRH 3G5XB 1NAMH 1KUMA 5JW4M 3EFFA 4LAJH 3GFUA 3OGOE 3FB6A 4RGMC 3MV7A 2B4CC 3IDYB 1IAMA 1MQ8A 3UTSE 3V6ZA 3AUVA 3Q3GB 3T08A 3KPQA 2NY7L 4HJ0C 5ITFA 1BBJA 3N0PB 4NO5A 1A6VH 5ESVA 3SHSA 2I26N 4YHOH 3WFEL 3V5DB 1S9VB 3EOYG 3DGGA 5C2UB 2A77L 3O0RL 4CVZA 4DQOH 1LEIB 1HHKA 4U1GC 5C0RL 1KPVB 1DBAH 1UENA 3L95B 4MJ4A 4I48B 1QFWM 4E42A 2OS7A 5JIPA 2XG5A 1J87A 5IMKA 4K3GA 3T0EA 3GMPA 4F7EB 3MRDB 1TVHB 2ZCKL 4F7CA 1EERB 4YAQB 1VFAB 3ARVA 4PYHA 3VWJA 4XPAL 1W0WB 2WUBH 1S9XA 5IFAL 3P73A 4JJHA 2HG5B 3CH1A 2FGWL 1RZFH 5EU7C 5EUKB 3DV4B 5HHME 2VR9A 1ZWIA 3U9UA 6FABH 3MA9H 5I19L 3ARFD 3OKDB 3AY4C 4IDJL 1N64H 1PG7W 3QPXL 4TRPL 2BSTB 4WDIA 4L9LB 1FBIH 4HK0A 5F9WB 4GW4A 4I5BA 4YX2H 1X6NA 2YPVH 4P2RB 4M1DH 3U36B 1H8OA 2Y07H 3TBSA 1NJ9A 3NIDF 3UTTA 1EBAA 4LVNB 1ZAGA 3W39A 4OIBA 5I18L 4OBRA 3IF1B 4MCYB 4S11A 4XAWH 3KPLB 1PAMA 4TVPL 1T6VN 5JPMA 3GO1H 4K7PY 5C0CA 1E0OB 1EBPA 1GPOL 4PJIE 3OKLB 3WKMH 1Q1JL 3PGDA 4G9DB 2Z31A 3C8DA 3L1OL 2GTWA 5BZWA 3U46A 1JZ5A 3L7EA 2NR6C 4YBQD 4KH2A 4P9HH 5A3IC 3RY4A 1N8ZA 4NWTL 3LKRA 1SVZA 4HF5L 3P11L 4OCYH 4JRYE 3CPLB 2H32A 1UA6L 3SE4A 1F13A 2YRLA 4ZO9A 5DXWA 2Z0BA 1RV6X 4GRLC 1TZHB 3TVMB 5D2LA 3T77B 3IJSA 1FC1A 1WCBA 4XCNB 1QKZH 2NY2B 2BDNL 5D2LF 1LE5B 3FFCB 2VNCA 3BJLA 4X6BA 3SDXA 5H35A 4L8SA 3M45A 5HHOD 4O51B 3N9GL 3L3KA 4G8EA 3SDXF 4Y5YB 1CI5A 1XGRB 2DICA 1F8TH 4PJ7B 2J2ZA 1DDHB 2MHAA 1HZHL 3FTGA 1EO8H 5ADPL 3I6GA 4DJMA 3PXHA 2RCSL 4RISL 4HPYL 4PD4K 4ENEC 3MV8B 4JQIH 1PG7H 3SKMA 4XT1C 1MFDH 4FQ1H 5D7KD 4XNXL 2I07B 3MRMA 1FAIL 4PJ8C 3WNLA 3QWOA 3LS4H 3MLWH 3B43A 1F3JA 3GSOA 2AABL 3C6SA 5DJ8B 3RGVA 2VL5A 1RSFA 1CDBA 1IZKA 4HKZA 3TA3A 3HUJA 2HN7A 4O00A 2X4TA 3GMNB 5HGDB 3MLRL 5C0EB 2N7BA 2K7PA 4PRDA 3HUJF 3UTSD 1V7MH 2AJVL 3IDMB 3MRLA 1KXVC 3QXWA 1WQVT 4WI7A 1VERA 2Z92A 5IMMB 1A14H 2D3VA 3WNOA 1OLLA 4G6MH 1F4XH 1BF8A 3DXAB 1M7DB 4NZRL 1V7NL 3M8OL 5I76A 4HBQA 4L3EA 1CQYA 1JZ2A 3LIZL 5D9SA 3HNTL 1MCFA 2LAAA 4ZOCA 3FB8A 2NMSA 4MVBD 5C0FB 3KJ4B 3V5HB 5JOFB 4ZUVB 2QBWA 2X4RA 3VMOA 5I74C 2H2SC 2YK1H 3BSZL 4PJFF 4UTBH 3SDYH 4TPRL 1YECH 2V7NA 2APFA 3QISA 1CR9H 3LDBC 1UJ3B 4DZ8B 1LK3H 3X3FL 4MJIE 3L5IA 3O2DA 1EV2E 4FQCL 3T65B 1GOHA 4FQJL 1HOCA 1MUJA 3QNXB 3NZ8A 1NC2D 1FZMA 5T3XL 2P8PB 5HHMD 3MRKA 4KGJA 1ADQA 3BP5B 1FFOB 1Z9OA 4ZDHA 1LK2B 5F7KC 3TO2A 2GK2A 3OAYK 4QRSB 1V3MA 4H5SB 3U83A 2X70B 4IMLA 4H26B 3GM8A 3L3GB 3ARWA 1BJMA 5EUOA 5FGBA 1CFSA 1GGBH 5K9QI 5J12B 5EUOF 1LQSR 4MWFA 1C5DA 4NKIH 3UJJL 4PG9B 4LRIC 2QSCH 3GKZA 1N3NA 1KOAA 3IRPX 2YKLL 5I1IH 4MNHA 4M62L 1JCKA 5EOCH 2NY5L 5IQ9B 3MA7A 3TNNB 4O2EA 4YDKL 3RX7A 4U49A 1X6LA 1DQDH 4Y4FD 4YDVB 5A2JH 3I2CL 1U8IA 1U2HA 2B2XL 3E3QC 5C0NC 1T0MA 2FEEI 1YEKH 3EDJA 1NCAL 2HFEA 4DN4H 4NPYB 4NSKB 3W9EA 5IM7A 5EU3B 1MI5E 1FO0B 3RJQB 1WBZA 2DQDH 5D71L 2UWEA 3NCYP 3HZKB 4FFVD 1NEZA 1R5IB 3O9WD 5IW1B 3VD4A 1S5HB 2IBBA 1CXFA 1ZSDB 4QF1A 5DRWB 1D5XA 4OF0A 2H41A 3MPCA 2CKBA 1OLZA 4WEBH 3R8BB 4XPGH 3WIIL 3BXNA 2PO6C 3QEUA 4Z8FH 5I1DB 4UQ2A 3OSKA 4O58L 4XVTH 3STLB 5GS1C 2DTML 4KC3B 2F8XC 5CEXB 4YWGL 4LSRL 1O7SA 3BWAA 3JZ7A 4QRPE 2VZUA 4ZOBA 4PJCE 2Z8VC 3ARGA 4J3UA 3S4SG 3MRQA 1SMOA 3RIAF 5JTWA 4H25A 1MQKL 1Q38A 3FO1A 1YY8A 3P30H 4S1RH 4DKAA 4KAQH 5GS3A 1K4CA 3TF7C 2ZZUT 1TCRB 2AV1A 5I0DA 4LHUD 1B0WA 1IEBB 5E8NB 2RFXA 4JM2D 2C1PB 3MR9B 4LNVA 1LNUA 4PGZA 5FM8A 2HWZL 2QKIA 5HI4C 2Q6WA 5K9OB 3O3DA 3T2NL 2B5IB 5I1JL 1I3VA 2EDTA 3WFCL 1N5AB 1OP5H 4MA1C 3B9EA 2YN5A 3L3IB 1SQ2N 1IGCL 4NQCB 4ZFZB 3QWQB 3IKKA 4P2QE 4FQLL 2VITA 2FO1A 5DJCB 4X6DF 3ME0A 1S7UA 2GUOA 3OGCB 2QV2A 4DCQA 3D48R 4I2XB 4AIXA 1NMAL 2P8LA 3WFHA 3LEXB 3VXTA 1TZIB 5ID0B 1JZ6A 4KV5E 2O26U 4NZJA 3SY0A 3RNQB 4Z7VB 4ODXB 1KXQE 3V6OA 1OM3H 4EXKA 1B90A 1F5WA 3OKNA 4BH8B 1FNFA 4WI3A 1NDGB 4EIGB 1J8HD 1JGLL 4PBWD 4MJID 3SDDC 3TJHD 3CFEB 2W1NA 1G9NC 1T7VA 2P5EB 3DVFA 4LSTL 3QPQD 5C2BH 4U7KA 3NABH 3JWDC 1ETZA 2YUWA 4YXLL 1UEMA 2PETA 4WW2B 2BSRB 4X99A 3OJDB 2CLZA 4KTDL 3IDNB 4R0LA 3SKOA 5I1CH 1RUPH 4GQPH 1IAIL 2ZJSH 4PY8J 1W0VA 1FDLL 1UWEH 1KN4L 4ZFGH 3H9HA 3VWKB 2NY3D 3BT2L 3EKCA 3MBEC 2AJXH 5C3TA 2FCBA 3I9GL 1CDYA 5D2NB 5AYUL 2AS5M 1Q9KA 3TZVB 5MEOB 3VD9A 3C2AL 2I60H 3DX9B 4JFDB 1BIIA 1YMHA 2QJDA 2Y23A 3TIDB 3WEXB 5DMGC 3W5MA 3T0DA 2YD5A 1RIHL 1T04B 15C8L 3QXDB 5T1DL 4YUEH 4FQXD 1JE6A 3QHZL 2RR3A 2VXQL 2JIXD 1GGIL 1ZTXH 4Y7MA 3HMXA 2A74A 4RIRB 4DGVH 2BOBA 3B9AA 5D5MB 1Q94B 2VXTH 3JTTB 1R3JB 2E7LC 3A6OA 3KLAB 1AJ7L 2OJEA 2XPGB 3BPCA 5EO0A 2R9HC 3MYZA 1RURL 3S98A 3O2DH 1BVLB 5J6GB 5BV7B 2P24A 2XFXA 4ZNCD 5IOPB 1MI5D 4Q6IC 1B9ZA 3UBXI 3CU1A 3NCJL 2VKWA 5TF1H 4E41B 4QXUH 1T22A 5CCKH 1X5YA 5D7LE 1S7VA 5I1AA 3V7AG 1NAKL 3JTSA 5HHOA 2DF3A 2HMIC 4X5WA 5DJYA 3PWPB 4ZQKA 1E4XL 1HXYA 4R8WL 3K8MA 4OF6A 5IJVA 3MJ9L 4UDUB 3G6AA 2A9NL 5GIRA 5TDPA 4UINH 4FS0A 1NCUA 1DQQB 1JZ3A 1AIFB 1H3WM 4CN4A 4QWWC 1CG9B 4KROC 4QRPD 2IF7A 5HVHB 4HUVA 5IVXF 1DBJL 1OCWL 4YFLF 1I85A 4K8RL 2FDBP 4XMKH 5JORA 4PGEA 2NZ9C 2JJWA 5TE4L 3WN5B 1G9MC 4P23C 2CUMA 2D7TH 2VQTA 3U0TA 2M8XA 5MP6H 1JV5A 1DLFH 5FM5O 1T21A 3UTSA 1UACH 5TH2A 4YC2C 2D0GA 1CFNA 2WQRA 3IS1X 4P46C 3C5JA 1UXSA 3OZ9H 4L8DA 3BN3B 1DBML 4OLYH 1P7HL 1PZ5A 2KBGA 3QUXC 2BJML 1LO4L 4JZJB 3DGCR 3OG6B 4X7TB 1AI1H 1JRHI 1JZ4A 3RHWK 4NNPH 2VLME 4PJBB 3KYMA 1GZQA 1G7IB 1U8KB 3GIZH 4OFKA 3LEYH 3OKOA 1MAKA 3LQAH 4N8VA 4Z7WB 4PLJD 5T3ZL 2W9EL 7FABL 2V2XA 3HC0A 2GAZB 3QIWC 3I75A 2AXGA 2XWBB 3BD4A 3IJHA 3NPSC 1AHWC 3WHXA 4JY4A 5KS9B 3U2SB 3IFLH 5LJYH 4WV1B 4OGXL 1IARB 2LVEA 4URTB 5JQ6L 2DIAA 3LKQA 5E5RB 1L0YA 2X2YA 5GGRY 4OLZL 3J8F7 4CMMA 3MNVA 4CAGA 1NC2A 3T8XA 5JW5B 3R1GH 4DGIH 1DSFL 3VG0H 1KJMB 1PX4A 5JLZB 1ZHKB 1JGUL 3VXQB 1L7TL 5D1QD 1PSKL 1GGCH 5K9JH 2XKNA 5JHDE 1J88A 4HIIA 4X8JB 1HIMH 3RPIA 1OGAD 3THML 3NAAH 4LLDB 3S36H 1K2DB 4ODTL 1VDGA 4XPFH 3RWGA 3OKYA 2AJ3B 4WHTB 3QULB 4OIIL 1QYGL 4QXTB 1AXTL 1I4FB 5F97E 4I4WB 4NZUH 5FYJU 3RDTC 5L2JB 2VZTA 2JK5B 4F9LC 1I9RH 1CXHA 3VXPB 4M7JL 2O5ZL 2YD6A 4N0FA 4WFFE 4PJIA 3ARBA 1P5VA 3ROOB 4ODVL 1EZVY 4PIRF 1E27B 5I2IA 2FX9L 2ITCA 1FPTH 1KCSL 1PFCA 1QFUH 2BVEA 2CLVB 3C60A 3LMJH 2BXZA 1A6UH 5E8PB 1C12A 2X4QA 2F8OA 3G5YA 4JRYA 4WUKH 3PV6B 3PL6C 1I3RA 3N1QC 4Y4FA 4WTZA 3CXHK 5DQ9A 3QDMB 1M6OB 4MS8C 4LKXB 4ZYKA 1S7TB 1QTYT 4OZIE 3N85L 5D72L 1MVUA 2MFNA 3IDIA 3A67L 1HXMA 3O3BB 5D7LD 3JVGC 1T2QL 1RUQH 4P2YA 4GAYA 3BZFA 3WJJA 4GLRH 3KJ6H 3O9WA 3EYSL 4M3JA 4YIQB 1FL3B 2RJMA 1BF2A 4Y4KC 3VD7A 5JIHA 2GCYA 5DJ2A 5HHXL 2HTKD 1DFBH 2FYYA 1P69B 4WI2A 5F6IB 2Q7YB 4RWHA 4LLUB 2Z93A 1G1CA 5F1NB 2BSSA 2VDKH 5DVKA 5GZNC 5SV3A 4DAGL 2VQ1B 3DRTB 5GRXG 3W11C 1JBJA 4FXLA 1WSST 1BQHG 5TDOA 2Y7QA 4W6YB 3QFJD 3K1KC 4Z7NE 1X4XA 3LN4A 1IKNC 2MJWA 4RMTA 1MJ8H 2C3GA 2XTJC 1Z3GH 4P5MA 1H3VA 3IAQA 4LHUA 3FJTA 1T66D 2HVKA 4MJ6B 4JM2A 5CWSB 2Q20A 4L8CA 5ICYA 2WIMA 4KPHH 2XIDA 5INDA 1H3TA 1EH9A 2VE6A 1KTRL 3QDGD 5M94B 4G8IA 2EDFA 1BPVA 4FABL 8FABB 4NHUA 2VLMD 3BEWA 2VLRB 3S5LB 4QOKB 3LSOB 3SCMD 5ANME 3O8XB 4YXHH 3WUWB 3OV6A 5L8LB 3VRLF 1CFTA 5JMRA 5T3ZE 1YMMB 4Y2DA 2Z91B 2AXFB 1KLFA 3M17B 4ETQB 1OAQH 2ED8A 1BLNA 2UYLB 3ETBF 4UB0L 4LASL 2JF1A 3P4NA 4MJIA 1EFXB 1RK0B 1R0AH 4XMPH 3CD4A 3BISA 3MBXL 5I30H 3IB4A 4EXPX 5F6HJ 5HHPA 4G8FB 4PJ9C 4NRZA 4N9OB 3HHRB 4L29B 3BKYH 3TT1H 1QSFB 1KEMH 1OD7A 4JVWA 2ORBL 2GSIA 3VFMB 3C6LC 4K3DH 1HEZB 4M8QA 5FOBB 1F6FB 3OAZK 2X4UA 1FZOA 5DD1H 5JHDD 4WWID 1J0IA 4KDWA 4X7SH 5I8CA 2JB6A 3PDDA 4CVUA 4NN7B 4NQEE 3QEHA 1JF1B 4G42B 5C9JA 4W4NA 4Y88A 1CGXA 3U0PA 4Z77B 5I1KH 1XCQA 3O81A 5DK2B 4UIMA 5JMOC 2FO4B 2XRAH 1MCWW 4XAKE 2R4SH 4WFFD 5BXFA 4FQXA 5EOQH 2VWEC 5JIIA 5GRUL 2BRRL 4S1DC 2GYSA 4F9PC 4PJDE 5E94A 1D5IL 3QI9B 4MQXD 4OZFG 2DQIH 2HLAB 3IXAA 3BDXA 5H37H 4MD5A 5EU7E 4BJLA 5HYSA 2ITDA 3DRQA 4X7FC 4GAGL 4K7FB 3BH8B 2PW2B 3FMGH 3TIEB 3K81A 5DHYB 4OD2A 1T20A 1U95A 4DN3H 3GJEA 4H0IA 1V3KA 2OSLA 5GRYA 4JLRB 1MI5A 3ZDYE 1J9CT 3Q2CA 3H2WA 3HAEG 2EYRA 5D96C 1HNGA 3NBNA 2QADC 3LHPH 4HGWB 2EXYC 5I74B 4JFOB 4R6UA 5HJ3A 4OZGE 4WI5A 4ESKA 4JZNA 1CXLA 1MRCH 3D9AH 3BUYB 5DJDB 2NY6B 3OXRA 1T0NB 4PJ5D 1MAMH 5C71A 3VFOB 1F4HA 1F45A 1XR8A 3SDAC 1UGNA 2HLFD 2VH5H 2D31B 3KPMB 5EU6B 1OT1A 4LPUA 4G7YL 4QRPA 4PB9H 3FHQA 4TSBH 2JJSC 5DT1L 4HS6B 4X0KA 1T80A 4PJCA 2DKSA 2EH8H 3GNML 3TCLA 2FJHB 2MQ3A 4Y1AD 3GUTB 2NY0D 4BZ1L 4U2YA 3VXNB 1X3DA 4X7EC 3UYRH 2IH3A 3TT3L 5DC9B 3BKML 5JZ7D 3DETC 5GXBB 1QP1A 1LILA 3FCTB 1KLUA 2W60B 5DRXB 1MEXL 4LQFH 4HWUA 2VDNH 5LKNA 4Z7UB 4PRIB 1AGCA 2ADGA 2APTA 2P45B 1CFVH 3IS0X 1OAYL 4P2QA 4NM8H 3B9KC 1UYWL 3HFMH 3GIVA 5I75B 4G8GB 5T3ZD 2JKXA 1RFDH 3G08B 3EYOB 1CFQA 4PR5B 1MSPA 3X12A 3HCVB 6CGTA 1NBYB 4NT6B 3KPSE 2ZG2A 4XC1L 3DVGB 2ICWA 3E6HA 4P57B 5L7XL 1JUFA 1T89A 3VFSA 5ESQA 5E5UB 4W70A 4QY8A 5KSAC 3SOBL 3B6SA 4OLWL 5HGBB 1WC7A 2WSKA 2AEIT 2Y06H 2GSGB 1BWWA 4JKPH 3C8HA 2P44B 1YEHH 3KPNB 1D9KD 2OL3L 1NH6A 4RGOH 4M03A 3HPJB 4YPJA 5SWSE 5E2UL 2YSSB 5D1XD 4JDTH 2QQKH 2ARJA 3QIUC 1F3DJ 5D1QA 4Y16B 4JFEE 1KTDB 4K9EC 1AO7E 1OAZH 4LVHC 4E9LA 2C3XA 1XGPA 4MNQE 4AG4L 1G0YR 2W92A 5F1IA 3B5GA 4NQED 5FF6A 5GRVL 4XI5C 3GJFA 3LZFH 4P4KD 4JJ5B 4LF3A 3SGKC 3Q6GL 5TDNB 3E6FA 4XAKD 1DQML 5I8KL 3HPLA 4LCCA 1HSAB 1RIUL 2AEQL 4GRMA 4XRCB 5AAWA 4PB0L 1NBZA 1QLEL 4M6MH 4RRPG 4PFEA 3RZCD 5ALCL 1FLRH 3I6KB 3T4AA 4TYUA 3QG6B 1YPZE 1W72H 5FUOL 3I02A 3IU4L 3P3YA 3QWRD 3P9LA 4MA1B 2YA0A 2NX5B 1YYML 5FKAA 2PXYC 1GAFH 3QXTA 2AQ3A 4NOBA 5E70A 1I9JH 3EDEA 3OHXA 3DHJA 1RU9L 1Q72L 2ZSVB 3DNKA 4XNUL 2ZCLL 3R0NA 3P0YL 5KG9B 1QSZA 3NFPA 4HUXA 2DDQH 4UU9B 5D7LA 5EZJA 3D69B 4YDIH 4NC1C 1MLCA 3X11A 4AH2B 3DTXA 4WHYG 4MGXA 1M7IA 5E6ID 1A9BB 3BGAA 5EBLB 4KK9D 5IT2L 5J3HC 3V4UL 3PGFL 5INCA 2FRGP 1Z9MA 4AM0A 1ZVSA 5FIEA 5I71C 1N0XH 3VD5A 1VKXA 2ICEB 4MDIA 4WNQB 1MWAH 4AMKL 2FH6A 1DANT 4HS3B 4P49A 4WO4C 2EXWC 3T4YA 1KIRB 4K2UL 3X3GH 5JIKA 5ACMA 3BZEB 2FX8H 3BQUB 1CICD 2IBZX 2HT3C 1OARH 3OPZH 2X1XR 2H6PB 5B38A 2H3NB 1X5HA 4IOIA 3L6FA 5GS0C 3RUGF 3QNYA 2DQUL 5I1LB 2VL4A 1PY9A 5I66A 3RI5F 4ZSOE 5EU5A 3QIBD 4QTIH 4KJWC 5CBAB 4M6NH 1X5IA 1MIMH 1E4WL 5JW4R 4F3FB 1TQCB 1D5BB 2APVA 2CGRH 3VFWA 3SCMA 1QFWL 4P5TC 3TH2T 4Q9RH 4EOWH 5MEPA 3QH3A 3GSQA 3UCRA 4GLRI 2EZ0C 3ISWA 3MV01 3W9DA 2W9DL 4MB3A 3V6FB 2AJZB 4LEXH 5D93C 4G6KH 2R1YA 2EO9A 4ZUUB 1GIGH 4DW2H 2ILLA 1KB9K 1SJHA 3WHE1 4NO3A 4HKXA 1ZT1A 1AGFB 1LHZA 2IAMC 4LCYB 1TFHA 4X83A 2DQGL 5DGRA 5KSVA 3QQ3B 5DRNA 4W4OA 5DEGB 5SWSD 5C0GA 4A6YA 3AGVA 4CADA 1K5NA 1NFIB 1AO7D 4KVNH 1H9VA 4KQ3H 3STBA 5JHDA 1DEEB 3LS5L 4PD4J 5E5MB 5IFJA 5MI0C 1CFBA 4JN2A 4APQB 5HYEA 3GSNL 4POZC 2XT1B 4LSQH 3AREB 4XCCH 3HNVL 4QHUB 4BFEA 5DFWH 1MCQA 1TJGL 4XNYH 4N1HB 1QNZL 3NCFB 2XA8L 3VH8G 4OQTA 1X5LA 1A4JB 3OKMB 3P0GB 2CUIA 2YRZA 3UPCA 1LD9B 4JY5H 5EA0H 3CVHL 1MOEA 5DQJA 3MCLH 4PREA 4IOFC 1IAKA 4P46B 1JYVA 3B3IA 2FZ3B 4X80L 3G5VB 3EGSB 3MQIA 5MHSE 1TZGL 2Q3AA 3BWUC 4Q6YA 4XBEH 2GHWB 5C7XL 1OVZA 4KMTL 1IL1B 2YRPA 4OZIA 4U6TA 4UDTB 4YFLI 3VJ6B 2DTSA 3RKDC 3NN8B 3D0VA 1U3HB 1Z5LA 4P3WA 4OZIF 4IRJC 4PJHE 4HT1L 4LNRB 2Q1EA 1CGYA 4JFFB 1B4JL 1TQBC 4ONFH 4OD1H 1FGNL 1G1YA 1QEWA 3ZE2E 1KENH 4NRXB 3NPSB 1AHWB 1RHHB 4J3WA 4HWZB 5EDXA 5DUML 4I77L 3BW9A 3MJ9A 4IJ3B 4PS4H 3LD8B 3MRJB 3UYPA 1OF2B 3Q1SH 4OLUL 3RVVC 3BP6B 3ESVF 4KRMB 2PCPA 1MLBA 3P9WB 2FX7L 3T2QA 1OGTB 4KJPC 4HIHB 3L7FB 4BZ2H 4F33A 2D4FA 3N1FC 1R3LA 1MCRA 4Y1AA 1MFBL 1SYVA 2PNDA 3SBWC 3RWCB 4OBSA 3MJ8B 1AE6L 5DYOB 4M6OH 4MA7L 3LV3B 2YD1A 2NCMA 1UQSA 4U1HB 1MRFL 4CKVX 3ALWA 5B21A 3LRGA 5DJ6A 1OSZA 1IC7H 5C8JB 4PTUA 3RDTB 4HIXH 1YNLL 5CINL 1T1WB 4OT1H 1IQDB 1CYGA 2ZNXA 2BC4A 5LAXA 2DRUA 1QR1A 4F7TA 2XACC 3FO0L 4JGUA 5ANMA 5F7WC 1MRDL 3MLTB 5J89A 5DMIL 1W8NA 2NXYC 3QO0B 3QUYC 4MA3B 2X7LA 4UILL 3MTRA 1IKFH 2KL6A 1S3KL 3HE6C 4Z7OF 2BCKB 4NQSA 5JR1H 2GW5A 1T1ZA 3PL6B 2VDRL 4JQXA 4C4KO 1OY3B 1FNSL 1R3IL 1YEIH 1ZT4A 2EDBA 2GJ6B 3KAAA 3OF6D 4OCLC 25C8L 3KLDA 3TGXA 5B3NA 5DD6A 3D18A 4M48L 1J18A 4ZUWA 4HDIB 4F8QA 5CZVL 4YEFA 4DGYH 4QGYA 3HC3L 4LAQL 3LKOA 3NACH 5DA0B 5FFLA 43C9A 5DHXB 1ORQB 2ESVB 1QA9B 1QQDA 2FHCA 5DMKA 2DJUA 1IC5L 4EI6B 2E6PA 5F9OL 1CLZL 1U8QA 4F15C 4GRWF 3UC0L 3HE7C 4NQEA 4P2RE 3MXWH 3V7MA 4GQ9L 4XWOC 3MJ7B 3QT2A 4FRWA 2AK4B 4MD0A 2X6MA 3R06B 4EDWL 3ZDZE 5GZOC 1TETL 3MACH 1BBDL 4QNPF 3B8YA 1XGTA 1HQRA 5K59E 3L9RA 1QRKA 1FZJB 2DD8H 4R96B 4D0CB 3IU3A 4PJDA 5E03A 2CLRA 4MAYD 4U1SB 5DZNA 1B0GB 2B39A 2VXVL 1U0QA 3RZCA 5BS0B 1E28B 4U7MA 1S7RB 4KKLC 1ED3B 1SBBA 3ULVL 3ZLQC 3QWRA 3RIAK 1RHFA 4YBHA 4YXKL 3SPVA 1KFAL 2CDEA 2NY1D 2HVJB 3FZUC 3HNSH 3QQ9D 3DMMD 3CCHA 1R5VA 4MD4A 4KZDL 3HKFA 5SWQA 4U1NB 3MUGB 5L6YH 3QCTH 4MQSB 1FO0L 4QYOA 3ZDYF 3BAEL 1RK1B 3FFCE 2ERJC 3DWTA 3UZVB 4HV8B 1H3PH 3OKKB 4OZGA 5E6IA 4PJ7E 2DQEL 1I1AC 3Q6FA 5CP7B 2J8UF 3QZWA 3EO1A 2RIKA 4IIQA 3F7PC 2ZUVA 3MV8E 4G7VL 4ZTOL 3E2HB 1NC4D 3CLEL 4TULH 5C0BB 4LK4A 2BFVH 4ZO7A 1UWGH 4FQ2L 5F7DB 5TQ0L 2CRZA 4RZCA 5JHLH 3F5WA 4PJ9B 3MV9B 1K9TA 5IF0A 3MLXH 1NGXB 2LU4A 2YXFA 4N0YH 1BZ7A 4OQTH 1JPSL 3TPUB 4FFZH 5TE6H 4QRTB 2VDOH 3VFVA 2G9HA 3AMKA 5CUSL 1CICA 5EN2B 1OTUD 5JW4Q 3NOIA 1HKLL 3MLSH 1QRNE 3O6LH 3VG9B 2IPTH 1WV7T 4NO2A 3NTCL 2WM0A 3LN9A 1RZKH 1X7QA 2XWJB 5GS2D 3OB8A 3ZHLA 5CD3A 4AEIH 1ZLSL 3QCVH 3BGMB 2R15A 3QIBA 3PIQB 1P2CB 1KJ2L 5IBLD 2QQLH 4ZS7L 5I16A 3DXAE 3MODH 5ISZB 3CFDB 3ET9F 1BX2A 5BQ7B 4TOYL 1A47A 4PJ8A 2X89D 5J0BA 4Q97A 4X6CF 4XTRD 4R4FL 1IGTB 4H20L 3DO7B 4FG6C 1Q0YH 4JGJA 3ZE0E 1MCJA 1DBBL 3QUKA 3KPSA 1FYTB 1LO0H 3R0MA 4HEME 2K1MA 1UC6A 2QTEA 4N8CL 4Y89A 3EYUH 2C4FU 4JKMA 1ZANH 4HCRA 5EZLA 2V17L 3ZYJA 3H8NA 3ZHDA 4WFHE 3H42H 5E99L 1FVDA 2ZUXA 5SWSA 1LEGA 5FYJL 4V2BA 3S8WA 3WBDA 4ZO8A 4JFEA 1AO7A 1U8LA 4MNQA 3D39B 4XNMB 2L0DA 4IDLA 4J8RB 4P2RD 3BDYL 3GEWB 3I50H 4JO4H 4WWKB 5GJTH 1G7LB 2R56H 1MPAL 1RZIA 1KG0A 4F7PA 3PABA 2X44D 3UTZA 2RGSA 4YHZL 3BHBB 1PY4A 1OB1A 2VZVA 2ED9A 5EWIL 4ALAH 2EIZA 5EBMA 4S1SL 4NNXA 1I7TB 1NEZG 4JQVA 2QR0B 2ED7A 3PWNA 3D1MC 3HZMA 1YPZA 5LQBL 3ULVE 5JNYB 2DQFA 1FNGB 5LGJB 1P84K 3VGFA 3TNMA 1OOAA 4KRPB 4U1LA 2DLTA 3PQYB 4IBLT 5CZXD 1KLGA 2YD8A 5F7YC 3V52L 4C83B 3TVMD 1J1PL 3BP4B 1NPUA 2NY2D 2YUZA 5DURD 3CXDH 5ACZB 3V79C 3FFCD 4U31A 2YEZA 4ODUA 2A6IB 3E0GA 4U1IB 3P4MB 4XBGB 4LRIA 4R90H 1IM3B 5F9JA 5F88A 1FORH 4CU6A 5FDWB 1R5WB 3SQOH 5IHZB 2VWEE 1HHHA 4NUJB 5FXCH 4GRWH 4P59L 3ZTNH 1J1OH 2VERN 4JDVA 3G6DL 1VFOA 1CE6B 3MV8D 4X4ZA 1KJVA 4LSSH 5D6CA 2BNRB 1YEJH 4LLWA 1OTTD 2DN7A 5FUZH 1JN6B 1ES0A 3PWVA 3C5SB 3TN0B 4GG6B 1IGJB 1MFAL 1A7PH 2F5BH 1EJOL 5KTEL 1GOFA 4X5LA 4HC1H 4KHXL 3VFRB 3REWA 4FNLL 4YE4L 1CD1B 5IIEB 5DHVA 1Q9OB 3GMRB 1D5ZB 4I18A 1XZ0A 5HY9B 4RMUA 4UBDD 5DUPL 3EUUA 2R4RH 1INDH 3BD5A 4H8WH 1SY6L 1ITBB 1H5BB 3P40A 3TWCH 1F97A 2PF6A 4GSDL 3P77A 3RVUC 5KVFH 3BKCL 2VAAA 3UTQA 4X5XB 4ZSOA 3VWJC 2GFBA 2YZ8A 4NQCE 1WFUA 3DXAD 5GS1A 1WIPA 3BE1H 3GMQA 4XXDB 2V7HA 3LB6D 1CU4L 3EHBC 4I2XE 5HXMA 3BMWA 1SYSB 2FSEB 3V4PH 1J05B 3CLFL 4F58H 4YHKH 4MNGB 3EOBB 4JG1H 5C0IB 5HVFB 3MYJA 4ZS6C 4Z7VE 1B0RB 1QO3B 3CXHJ 2PXYB 4C56B 4ZD3H 5GGRB 1VB9A 3IVKA 3PP4L 1OPGL 2GY5A 1IQWH 4U6YA 3OF6A 1VFMA 3MXVL 2EKSA 4GXUM 2P49B 1JNHB 4P3CH 4TUOA 3EJZD 2QSQA 1QACA 4WW1A 5B4MC 5H94A 4ELKA 5EIIB 3S88L 1I8MB 5DSCA 3A6CH 5FYJE 5J7CC 2Z31C 1P1ZB 2W9LA 5F7UA 3WHE0 3AAZB 1ZS8A 2VDPH 3H3KA 1GCFA 1A1OA 1JHLL 5B8CB 1F2QA 4KUZL 2XG4A 3KYNA 1I1FA 4XB7A 5GGTH 3SDDA 1HILB 4U0RC 1X5AA 5DK3A 2R0WH 5EO1B 5FV2A 1QSVA 4JPWL 5MENE 4NUGH 1A6TA 1SEQL 3PWLA 4BSWB 1DQLH 2Q86A 4MAYA 4XZUA 1KV3A 3L3HB 4PY7B 4TUJA 1NBVL 4BKLA 1JWSA 3MZTA 3ULVD 3V95A 5F93C 4ONGH 1RIVL 2NTFB 2FJGA 3VXOB 4WCYH 1KC5L 3GMOB 3O2VL 1RVFL 5F89A 4R4NC 3MBEA 3O45B 1MCWM 3AS2A 2VDMH 5EFIB 3EYVA 1KBGH 3DMMA 2K9UA 3JWOH 1VACB 4TUKL 4R3SA 3RGVC 3VA6A 4B0MM 3PDOA 4PJHA 4E41E 3WDIA 4BYHA 2Y6SD 5DO2C 4G43B 1N6QH 2R1WA 2HT4C 2G75A 4RAUB 4LCWE 3BKJL 1MHEA 4BH7B 4X7CC 3KR3L 2X4SB 4OV5A 3PWPE 1YNTA 4J4PD 4KK5D 4Y5VB 3PNWB 1XCTB 1PKQB 3ZKQD 1T83A 2R0ZH 3INUH 3PP3K 1J5OL 4UT7L 2DMKA 1NC4A 1EXUA 2E7MA 2FEEL 3GHBH 4XCFH 1YEEH 3UYOD 3A0OA 3P9MA 3VGDA 3BP7B 1AR2A 1NGYA 1F90H 4NO0B 5LWYH 1AGDA 4QRQB 1JGEB 3U82B 5I1EL 3MRNB 1NEUA 2R1XB 3KYOB 4N8VG 5AUMA 1U92B 1YN6B 3VXRE 1LO3L 4LSUH 4YK4C 1C16B 4YHYC 2ZUYA 2ZUTA 2FHBA 2XZCH 1HH9B 5DQDL 3Q3GA 4BUGA 1Z0MA 1TLKA 4NNYB 4K71B 4NN6C 5T5FH 2ZP0T 1WEJH 3IT8D 4OF5A 5D7IE 5EU4B 4NQCD 1TITA 1KCVL 4RGNE 4XMLL 3KPRB 4OI7A 3G6JB 4EI5B 4AT6B 1MHCB 1IZJA 4PJBE 1MCKA 1LEIA 3QFDB 3VDBA 5JXEC 5DRZB 4X9GA 4I48A 1D6VL 2LV4A 3OXSA 1N2RA 4ZFOB 5BZDB 4LSPL 3SO3C 3IDJB 1JL8A 4P23A 1P4BH 1OD9A 5FGBC 4EUPH 3MRDA 3D3VE 1TVHA 3LKSB 1UKTA 4K3JL 3FN0H 1VFAA 3HAEB 1W72B 2P5ED 1W0WA 4WU7A 4IRJB 4ZUSB 1JF6A 2HG5A 3QDJB 1JHTB 4M02A 1TQBB 5EO9B 1UB5B 3OR7B 2DM7A 1DJSA 2R2BA 4OM1L 4HG4K 5E4EC 2I5YL 4JAMA 1TNNA 4R9HA 3DSFH 3AM8A 3LN5B 4N0CC 3VWKD 2BSTA 1K6QH 3VCLA 1Q0XL 4KZEL 5GSRB 1ZHLB 5F72S 2VLJE 3QIWA 4P2RA 5JPNB 2CK0H 5ILTH 1KEGL 2XNAB 3TZVD 4JO3L 4WTZG 3UJTH 3VXMB 1L6XA 4DTGH 3IF1A 4MCYA 4LHJB 3KPLA 5HVGB 3OR6B 1FH5L 3RTQB 3NH7H 4HWBH 3HI5H 2AI0L 5GSVA 1P7KA 2WP3T 4WY7H 2BNQB 4FQPA 1A0QH 3CVHA 1D6EA 5JXAH 5FKPB 5JOPE 1DANU 1WTGT 3QXAB 5FGCE 5HPMB 2CMRL 4G9DA 5JDJA 4EEEA 1UH3A 2YA2A 2D03H 1NAML 5CJQH 4YHPB 1ZEAH 4WTWA 5F3HB 2I9TB 3WO4B 2QEJA 2A6JA 2ICCA 5KAQF 4KKBC 3T77A 2FL5A 1ZGLM 2BERA 5L2KB 4Y8DC 4E41D 4ZXBD 4ZODA 1HCFX 3FFCA 1A6VL 4UQ3B 3C8KA 4ISVB 4YHOL 4LCWD 2ATPB 3WDHA 4LBEB 1I8IB 3GI8H 4Y5YA 2C7UA 4DQOL 1XGRA 3LKNA 3MLZH 4PJ7A 3PWPD 3P0VH 1VPOH 2XXMB 1DBAL 5KVDH 5A1AA 4LHUG 4L8BB 4PJ7F 4BFIA 3HC4H 3MV8A 3W2DH 5HHVH 4D0DA 1FL6B 3IDGA 4M00A 1FGVH 3NCMA 2I07A 2DAVA 1A5FH 5KANI 3O4LB 4OGAD 2GI7A 2F19H 1HDMA 2MKLC 1G6RH 5DJ8A 4HMCA 2WUBL 4FQQB 4QXGH 3CJJA 4D9QE 5CBEB 3MNWB 4N5ED 3VXRD 3GMNA 1OAXH 3KXFB 1QRNA 5DD3H 1J12A 2WBJB 2VZSA 2JTDA 3MA9L 3OL2A 1P6FA 3IDMA 4OCWL 2EYSA 5FYKH 2DYPB 4L5FL 1N64L 3TV3L 1Q9LB 4ZFFB 4RWYH 5IK3A 1TVDA 5D8JH 3K2MC 1FBIL 2FBOJ 5FECB 4YX2L 3LEVH 4M1DL 1P6AB 1M7DA 1ORSB 3DXAA 3G5ZB 3FONB 3DV6B 2ZUQB 4XC3L 3MLVH 5IROA 3RL2A 4QOKE 4R0LC 5E8OA 4JZOA 2NNAB 3RWIA 1LE9B 3ARFC 3GO1L 5GGQH 5C0FA 1EK3A 1YMME 2C26A 3GJFK 4M9OA 2IFFL 4OCXH 4X4ME 3PWJA 3WKML 3EIFA 3D3VD 3ULSA 1G7MB 4OLVH 4XVJH 4U7SA 5LBSH 3ZKMD 1UJ3A 5KZCB 3U48A 3SJVE 4P9HL 5DDHB 2P5WB 4OCYL 3KG5A 1U8NB 4WHCA 2UVEA 4PTTB 2ERJB 5BOZG 1KN2H 2EDEA 4HGKC 1JRHL 2H9GB 1FFOA 2PYEE 3TBTB 4H0GA 4H5SA 2FJFA 2X70A 4YBQC 1LGVA 4H26A 5HYSG 2A1WH 2JJTC 1VADB 2UVFA 4P99A 1P4LB 5E9DB 1YUHB 1R3HB 2DI8A 5GGVH 3FFDA 5GS2H 5ERWB 1NGQH 4PGBB 2GITB 4PBVC 1EO5A 4QRRE 1XF5A 4JQIL 1PG7L 1ODAA 2HH0H 3RNKB 4FZEH 4ORZC 5HPOA 4CBPA 4MHHI 2Q8BH 3TBYB 4GBXA 4Z0BH 3Q0HA 2FLBT 1N59B 3LS4L 3MLWL 4JPIB 4JB9H 1DLHA 3G04A 4PV8B 5F1OB 1C5CH 2A9MH 3EZ8A 3TNNA 2IH1B 3T1FB 2VISB 1V7ML 2W0LA 3CZFB 3QDMD 5AAMA 5TJWK 1EPFA 2ZG1A 5J11C 1V05A 4JPKH 5IEKA 4OF3A 4NSKA 1I85C 1B88A 1FO0A 1A14L 4YFDB 4R7NB 2MTPA 1EA9C 1BFOB 3HZKA 4G6ML 1MCHA 2J88L 3BESR 1F4XL 1A3LH 4XBPB 1A1MB 5IW1A 2QHRH 3RI5K 1S5HA 1ZSDA 3DYOA 4QHNB 1IM9B 1N6UA 4F9PA 4JO1H 1S7WA 1KB9J 5BVPH 3V0VB 1A4KB 4UI2A 5CEZD 4J4PA 1CIDA 1G7QB 2EDYA 5I1DA 4QTHB 1RJLB 3JXAA 2ZKHH 3STLA 2YK1L 4UTBL 2CD0A 2F54B 5EU6E 3C5ZB 5HYJB 3K4ZA 1YECL 1CVRA 2OR7A 1CLYH 1CR9L 1WUNT 1SEBA 1HNFA 4YR6A 1KIPA 3DI2B 4MX7B 4K3EH 1LK3L 1WZ1H 4NKOA 2B1AH 2VAJA 4RX4D 2HRPH 1NMCC 1B4RA 1VFBA 1KT2B 4MVBC 4CU7A 3QO1A 2CRMA 3MR9A 1S7SB 4EDXB 1L4IA 4XNZC 5DJXB 3O6FB 3FT2B 4AENB 3BDBA 5D1ZD 4DZBB 4OLEA 2NXZB 4H1LA 1U8MB 5LXGH 5AG8A 4LP4A 5C0DA 4CW1B 4FA8A 2AGJL 4IDJH 1FVEB 2EIBA 4NQCA 5F96H 1GHFH 4O02H 4CJ0A 5LCVH 3TH4T 2VLRD 1KJ3H 4X98A 5JOEA 4QOKD 1QG3A 4NKIL 4LPVA 3O8XD 3S96A 3FO9B 3KPTA 4I2XA 4PRHB 1FG2B 2Q76A 3LEXA 1YMMD 2A6KA 4H88H 2AEPH 4M7LH 2OZ4H 3ESUF 4Z7VA 1CBVH 3CU7A 1TVBA 1HN1A 4TVPH 4Z7VF 1UB6B 5I1IL 1NDGA 1AFVH 5EOCL 4NDMB 2NW3B 2P7TB 1DQDL 3L1OH 4NWUH 4M61B 1YEKL 1QBMH 2BSRA 4NBYB 4JCLA 4DN4L 3MV7B 3OJDA 2V9QA 4WW2F 2PYED 3ARBC 2FD6H 3L5WA 3B9KA 1A7OH 2DQDL 3SE3A 3C60C 5FEBA 3KPQB 1EHLH 1JHKH 5C1MB 1EVTC 3BVNB 5BMFH 5SX5H 4Y4FC 3VXUB 5J4MA 1CQKA 2WAHA 2VUYA 4WEBL 5ESVB 4XPGL 2FEDD