2OMBA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(1)21 crystal form
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
total genus 43
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ombA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ombA02
4D0CB 1KCSL 4KK9D 2XY1A 1T0PB 1XIWA 3HMXA 2P5WD 1LE9B 3CXHJ 4IMKA 2Z4QA 4ONFL 5TGBB 1LO5B 4Z7NF 25C8L 1BFVL 1T1WB 2YRLA 4JPIA 2MWCA 4HIIA 1WLHA 1FL3A 3T4YB 1T2QH 2HRPH 2W60B 5I2IA 1RZJH 3ARFB 3NPZB 4GG6F 4JFZH 2NZIA 4MHHG 1Z5LA 3TO2B 4U6YA 1IFHH 4M6OL 5I1AA 4U1LA 4L9LA 1VENA 5TE7L 3V4UL 4GW5A 3TT3L 1KTLA 2MKLC 5A16A 4BELD 1RIUL 3PIQA 3LD8B 5I1IL 3RY6C 5IT2L 3DETC 4NM4L 3SKOA 4L3EB 2EECA 4F9LA 1FSKC 2QEJA 1WSST 2ICEA 4N1EA 3MRLB 4GBXD 3SKNA 4OAWB 4HJ0D 3V0WH 3E6FA 2A6IA 4TUOB 5DK3A 1PY4A 1PYWA 3BMWA 3SKJL 1OGAE 3OKNB 5F6HI 4PJGF 1DBMH 1K5NB 5C0FA 3V7AE 4JR9H 5GS2H 4NFBA 3I2CH 3PABB 4NM8L 4YEEA 5LAXB 4CL7A 3FOMA 4TUKH 1JL8A 4M7LT 4DGIL 2I9LA 2V7NA 5C0BB 4HPYL 4D3CL 4MJ5B 1YEHL 3HE6D 5IVXF 1O7SA 2Q86A 2V2TA 4FQCL 2DWEB 2EE9A 2F54E 1MQ8A 4NNYA 3HZYB 4NGHH 2NTSP 2CJUH 3BIKB 3MODH 1WTGT 3CZFA 4P5TA 4YDKL 4Z77A 5FDYA 1J1XL 1EX0A 2VLKB 1R6VA 3K2MC 2UUDK 4N0FB 5INDB 4V1DE 4GAJL 2YN3A 4LRNL 5LXGH 2NY0D 5I1GH 3H42H 5JPNB 3UBXB 5E2VL 3PWPD 1CDJA 2YEZB 3VXOB 1LE5A 5DMKB 1ZVYA 2AAVA 4M61B 4J6RH 2BOBA 2XZCH 2NYYD 4TSAL 1X5KA 2VITB 5E08L 5FECB 2UVFA 3TBWA 3V4PH 1AHWC 1DEEB 1PKQA 5T5FL 1KC5H 1G0YR 4XWGL 3MRBB 3U7WH 3SDXA 5BS0A 4JKWA 5ACMA 3FO1B 4JQXC 3ARBC 1MVUA 3EJZD 1AXSB 4OCLC 5F7UA 1I3VA 4P2OD 4MYWB 3L5XL 4KHTL 4Q2ZB 5KS9F 1BVLA 3LCYA 3BYYA 4JRXA 3IB4A 4WW1A 2DQHH 1KCSH 2DJ4A 4IDJL 5F7FA 1Y6NR 2N56A 1GGCL 4RCAA 1DN0A 3VXUB 2NY2B 3MRCB 2GFBA 1N6QH 4M43L 2JF1A 3C6LA 3REWB 2Q7NA 3RGHA 2WBJC 5TF0A 4GW5B 2WIIB 4XPGL 2B1HL 3OKOB 4KI5F 1YEFL 5DJ2A 4D9QD 3PIQB 3B83A 3BQUA 1VGEL 2BX5A 3IGAB 4HGWB 2VXSL 1ODAA 4KQ3H 1PDKA 5GGRY 4YFDB 4M5ZH 1TIUA 4XMKH 1LO5A 4P2YA 4ELMA 1QSEA 3S5LA 1K3ZA 1RIHH 5TQ2L 1F6FB 3ZKMC 3T4YA 2DJSA 5D8JL 3MO1A 2IF7A 2A0LD 5F9OH 4OD2A 4ODUB 3KYOB 5ESQB 1BZ7B 4TSBH 4ZYKB 4ZXBB 3NIFF 1KENH 1FGVH 1MRCH 4AJ0A 5L0QB 2CRYA 2OM5A 4BQ8A 2VMFA 4ODVL 4ZD3H 4F58L 2XY2A 3HG1E 4QT5B 3B9KC 1MFCL 5HYQA 3DXAD 4J8RA 1I7RA 3X14B 3LHPH 2A6DA 3VFUA 1WEJH 1ND0A 3ULUH 4ZS7L 2R9HC 3ULVC 2VE6B 3K1DA 5BZWA 2VXQL 4DUWA 4QRSB 1XR9B 3H42L 3JV4A 1MFBL 5J12C 2P49B 3BDYL 3ZKNC 2PXYD 5D6CB 4DZ8B 1MRFL 3QPQD 3RWEB 1UB6A 5D70L 1J5OH 1OAKH 1I7UB 3SE4A 32C2B 4MJ5A 4KK6D 4NHCL 3GSVB 4PG2C 2YEZA 3Q3GA 4PJIF 2NY4D 4P9HL 3KLAA 4NCC1 4XPFL 1NMBL 3GKWH 3WIFA 1KULA 2BJMH 3DMMC 3GB7B 3CSYA 4LPWA 2AABL 3W5NA 3IKCA 2ZPKH 4R2GC 4WI2A 2HKHL 1KOAA 1JYXA 2OZ4L 1V8HA 3HR5B 2R29L 5H2BB 1V7NL 3IFOB 3C2AL 1WEJL 1FFNA 2X1WL 2AJSH 4OCWL 1AQDA 5KG9B 3U7WL 2BK8A 4MJ4A 3CPLA 4NKOB 3DGCR 2FNBA 5IB4B 3IXAA 1R5WB 1G0XA 1PKQB 2BVQB 4F8TA 2IMMA 1QYGH 3MNZA 2HLAA 5HVFB 5JZ7D 4O58L 2FJGA 4TSBL 5FFLA 3VFPA 3L95B 5JMRA 2X4RA 2J8UE 4MNHA 3BD4A 1FL5B 4YDVB 1YJDH 3BD3A 5D7SH 3MTRA 4J3OC 4HK0A 1HCVA 3M07A 3MV11 1DSFH 3JWDC 1S7WB 4UIKL 4LU5L 4Z18A 3QJFA 2XV6B 4LCUA 1L9NA 1LK2B 5FCSH 3HMWH 3M1BB 5HD8D 3OAUH 2CUIA 2MMXA 3JV5A 1EGJH 1U2HA 2DLTA 2FO4A 3FONB 4M9PA 4ZUVB 3LKRB 4QHMB 2VIRA 5DJ2B 1ZHLB 4QXGH 4HMEA 3I3BA 3GFUA 4OCSL 4KVCL 1ONQB 4XBGB 4J3UA 5HGDB 4LP5A 4C56A 3GIZL 2F8VA 1NMCB 3S5LG 5IROA 3U0PA 3PNWA 1NLBL 2YA1A 4H1LA 3WE6B 2NY7L 3MXVH 5IBTL 4FMFA 1ZEAL 4I1NB 2FGWL 4LSTL 5DQ9A 4L5FH 4KZDH 3WUWA 1TVHB 1U6AL 2V2XA 1TCMA 4JO1L 4LSPH 3FHAA 1REIA 5D1XB 1GXEA 1BVKB 1QSFE 3D25A 1WBXA 3P4NA 4GBXB 4X7DC 1QEWB 1CFVH 5C1MB 3KPRE 4JRYA 4MHHI 3CGTA 2DKMA 1MCRA 4PRDA 3GSRB 1T66C 1JK8B 1MY5A 3BWUC 5I8KL 5CKGA 1RZJL 1P6FA 3BPNB 3PWJA 3F5WB 2OR8A 4QO1A 3DLQR 1S78C 5I0DA 1N64H 3H9SB 5CILL 3VI3F 4UOW0 3MBEB 3HNSH 2AJVH 2YS4A 1ORQB 3ARFD 3V0VB 3VE0A 2G60L 3SGEH 1DQQA 4YDIL 2ZKHL 5SWZA 1GIGH 1MIEL 5CWSB 2E6JA 3S4SA 4NKOA 1G7QA 1ACYH 5IVZB 4G6FD 4M7ZC 5C3TA 4OQTH 3ZTNL 3BKYL 3E8UH 1BEYH 4N8VB 3SQBA 4Y5XC 5T5NG 3QIUC 1C16B 5F7HA 1MFNA 2YPLE 5TFSL 3SKMA 4M1DH 3L9RA 4LGRB 5HPOA 4A6YA 5HHME 5BZDA 4R0LC 5DRWA 4W6YB 5F21B 4XCNB 4ENEC 4KUCF 1EV2E 1RMFH 1RV6X 2PW1B 2B7DT 1FAKT 1S9XB 2B4CL 3ABZA 3UTQA 2VLJB 4L9DA 1BZQK 4CNIA 3L5JA 5HYJA 3DPBA 3TVMB 5ESVA 1CBVL 1OAQH 3ME0A 4NQDB 4LLUA 4R8WL 4FQPA 4HCRL 2R2BB 1T83A 3WIIH 2FYYA 5E99L 4WWKD 4UDTB 4EZMA 1A7PH 5C0IB 1K8IA 3HAEH 2GSGA 1GSMA 3QDHA 1MREH 4H1LB 5SX4H 4GBXC 1G7JA 4O2CB 4XTRD 1EO7A 5E8PA 2BNRA 5D7IB 3VXNB 3P0YL 3J8F7 3QUMH 5B4MC 5IM7A 1TQBB 2B0SH 4XBGA 5FHAL 4WFHD 3LPFA 2DI8A 3RY5A 4U1NA 1EPFA 4DVBB 2OMNA 4MSWB 2E7HA 4M48L 5I73C 4QHMA 3O2VH 3WUWB 5GS3A 2YD8A 2KUTA 3ARSA 5E2WL 2DKUA 5FKPA 1GGBH 1TVBA 2C3HA 2PNDA 4XNXH 3UJJH 1V3JA 1RUQL 5ENWB 1HKLL 4A2LA 2J7LA 3DMMB 4EUPH 1LNUB 4OIBA 1PSKH 1ED3B 3TNNB 2PYEA 5I19H 2BVUA 3FQNA 3R8BB 3DRTA 4LAJH 4L8SA 4Y5XB 2R0WL 1WBYA 5F3BA 3VG9C 3BKCH 1CGXA 3BKJH 2XWTA 4O02L 3JZ7A 5CZXD 4XP6L 1DQQB 4LPUA 4P3WA 1F02I 3OF6D 2DM7A 3HMXH 4LCYA 2VDKL 1F2QA 3ARZA 1MHCB 3DIFA 5IB3A 3TBVB 5IJVA 2F8XC 3HZKB 3KXFD 1XF4A 3QT2A 1LK3L 3EYVB 1SJXA 5ANMA 3WO4C 1I1CA 3L7EB 3LIZH 3MCKA 1PY9A 4K8RD 3PWUB 4RMQA 1LGVA 2PF6A 2VB5A 2Y1VA 1IC5L 3C87A 5EO1A 3BKMH 3C9NA 3RHWF 1DANT 5C2BL 4YK4C 4NKIL 4PRAB 1BQUA 1N2RA 1KJMB 4JDZA 4ODSH 5EOTB 1N3NB 3ARBB 3D2UD 1YNTB 3WFCH 4M5YH 2W0LA 4POUB 3CD4A 3DUUB 4DKFL 1VADB 5EBWA 1B0RA 1OD9A 4X98A 2F54B 3AU1B 3BIAX 4MX7A 3K8LA 4DJMA 1C12A 1DVFD 2BZDA 1HSBB 4N90E 4R8WH 4H8WH 4CMMA 3L9RB 5KSAD 5I76B 1AIFB 3MGAA 3L3OA 3THML 3BIBX 4OM1H 1NCCH 3SDAD 3KWWA 3TVMC 4PGBB 3VFWA 1IARB 1FC2D 1QSED 3SDDA 2PO6A 4ODBD 1OGAB 3CJJA 3U6RA 1JZ2A 2ID5A 4HWEH 4FFWD 4RFNB 4N68A 4QRTA 4HWNA 5D4QA 2H6PA 4XI5D 5C07D 3RZCD 3IS1X 3EYFB 2DDQH 2WBJA 5HYSA 3FO9A 5IMKB 3IDJA 1BBDH 5F7DA 5T1LD 5J1TC 1NSNL 4RQQB 5MEOB 1XF5A 1QVOB 1YEIH 1S8DB 4LMQE 3N9GL 3D3VB 4OJFH 4O51A 1YPZA 2OR9L 3BISA 5HGBB 1XZ0B 1HYSD 3V5DB 3EUUA 1YYLH 4KY1H 4PJ5E 3FB5A 3ESUF 3L3JA 1FO0B 5IB4A 2OZ4A 3OWEA 2J5LC 1HHGB 3PL6D 2K3TA 5CCKH 5J1SC 2AGJH 1WBYB 4HJGB 2NXYC 4X4MA 5AAWA 1AD0B 1U2CA 4MNQE 3IDIB 2F5BL 4S2SA 4B7LA 3ALWA 1UKSA 3O11A 1YZZA 3UPRB 3F6LA 3MRDA 4Z76B 1A6UH 1X6LA 4YLQT 4POYA 2NY6B 4KK5C 2CLVB 3SKUD 1SYSA 5K9JH 1UWXK 1T22B 4RNRA 5FO9B 3QI9C 5JW4R 2XN9E 3WFHA 4MAUL 4PJAF 4Z78A 5DMGC 1DQDH 5HHMD 1HYRC 5E9DA 4PR5A 1GC1H 5E8OB 43C9A 3G6DH 2VR5A 5DZLA 1KG0A 3RU8H 2C4XA 4LCCB 4GG8B 1T4KA 4RAUA 1IJ9A 5T3ZH 1T7XA 3U4AA 3SDXE 4HS3A 5BS0E 1QLFA 3D0LB 4RMSA 2BC4A 2SEBA 5HGHA 4X6CE 1RIVH 5FYKH 1B6DA 5IHZB 1TQCC 4XCYB 4KKAC 2ADGA 4WUUD 2E27L 4GRWE 2DLEA 1I3RA 3WD5L 4L9LC 1ZGLM 2APWA 4Z7UB 4ZTPH 5EBWB 1MJ7L 5AYUL 5EBLA 1AXSA 3LB6D 1MY7A 4JY5L 3HI6H 1WWBX 3PGDA 3DGGA 3DSFL 1QFUH 5EIIA 3LQAH 1NCNA 3IYLW 3S35L 4Y5VC 3ZT5A 5I1KL 1S7XA 3FN0L 5CJ5A 2YN5A 5E5MA 3MV8A 5FO8B 4HS6A 2A2QT 2ZCLL 4P2RB 1A1OB 4G8GB 5FHBL 4HIJA 3WYRA 4N8VG 5GSVB 5HPMB 3BRGC 5C2BH 4Z0XB 4MX7B 1UM5H 4X4YA 4NQCD 2OLDA 3TA3A 4HUVB 1YEGL 1QPXA 2GTWB 5EUKB 1C12B 5IGXL 4NWUL 4LSTH 4BZYA 2IBGA 4WO4B 3TPKA 4ZAKD 3VD3A 4AEFA 2HH0L 2P8MB 4Y1AE 5I75C 4WHDA 3TIEA 4X5XA 4O9HH 1BIIB 4RWHA 4W4OC 5TDNA 4NJ9H 1YEJL 3DX9A 2BSED 3FAXA 3SKMB 2ITDB 3ARPA 4U1JB 3GJFA 2VL4A 1I8MA 3CSGA 1KJVB 4RWYH 1KLUB 4IJ3C 5SX4I 5DJ6A 2QJDA 3CC5A 5TPWH 1RZGB 4QXGL 3RI5F 4BQ9A 3HAEA 3S4SB 3HI1B 3ROLA 5D1ZC 2IALB 1JTOA 2VDLH 3BUYA 5MEPB 5E6YA 5GRZA 3VCLA 2EXWC 5F7MC 2CMRH 4UTBL 3UDWA 5BOZG 3HUJB 1MLBB 4Z7OE 4BH7A 3V5DA 4U2YA 4X4XB 3G9VA 3KS0J 3JBG7 1OB1A 5FOJA 2IQAA 5E2UL 5E6IB 1S8DA 5EIVA 4KV5E 5ALBL 5EO9B 3BP5B 5AZEH 2ARJQ 1UB5A 2PXYB 2R2HA 3H7BA 3KJ4C 4MA8H 5FUZH 1Y6KR 1EEZB 1CD0A 3CK0L 1FIEA 1T3FA 1P4BL 1VACB 2H2PC 5GPRA 4L4VD 2AXGA 3KLAB 4LDEB 5DYOA 1XCTA 3ZYZA 1OAKL 4ZD3L 5FHAH 4F7PB 3MXWH 5EA0H 3G6JA 1KENL 2HFGL 1A6ZB 2L7UA 4JG0H 1MIMH 2UZIH 5L6YH 3X3GH 2BFVH 5C08A 2DRUA 3VH8A 2VLLA 1VFAB 3V6OA 3LD8C 4OZIB 1V3MA 4O9HL 3JV4B 2D0GA 1NPUA 4JGJA 4QHLA 4ELMF 4JG1H 1TETH 1S3KL 5CUSH 1ED3A 2BNQA 2YOCA 1G7HB 3K7UA 3IFNH 3VU2A 4UUJB 4XPHH 3FQXB 4KI5D 2XOTA 4DGVL 5FHBH 4JO3H 1EBAA 1WFUA 1NCBL 2ERJB 1W72A 4MA8L 2ATPA 5FUZL 2K9UA 1QLFB 3LDBC 3BP6A 3N06B 3ZMRA 2DI7A 5HYQB 1JBJA 3F58L 4PY7A 3ZE1F 4BZ1H 5JA8B 3OGCA 3L3KB 1NGQL 4Y8DC 3VFUB 1H8SA 5CLWA 2Y6SC 5DRZB 4PRPB 1BIHA 5I18L 1BBJA 1RZ8B 5D6DC 3QJFB 4LLYA 5T1MA 3F12A 1U93A 2NY2D 1IKNA 1NCWL 1GPOH 4P5KB 1UJ3C 1Z0MA 3IDYB 3VXUD 3NPSC 2CRIA 4JANA 3EFFA 2H32H 3MLXH 2J6EA 5F9WB 5K9QG 3HZMB 3X13A 3CFEA 1KCUH 3T65B 5IBLD 1JZ7A 4WFGD 5DUMH 4L8SB 1YNKH 1RY7B 1K4CB 1MCHA 3NCJH 1BP3B 2BSTA 3LN5B 5EUOF 1MCSA 1IGYB 3KPRD 4L29B 3LQZB 2VXVL 2Z4QB 4I77H 4PLOB 5JORA 5I30H 3DIFB 2JJVA 3HI1A 1YNTA 4FFVD 3ROLB 1NEZA 2IANB 3KPSD 4PJHB 5CD3B 4PGEA 3BVNA 4JN1H 3PF2A 3MFGB 5HHNB 1A5FL 4JN2B 5DJ6B 4RZCB 1PFCA 2HFFB 5EZJB 5I15H 3H6JA 4HT1L 1F4XH 4FTVE 2BCKA 1OHQA 2ZUXA 3RAJL 1DUYB 4U7MA 4KUZL 3B9KD 4XP5L 5I6XB 2EH7H 5IHBA 3QQ9C 5C08E 3I75A 5HDBF 4LCCC 3KYMA 1KEML 3FOLA 4KZDL 4OI9A 3GI9H 1EFXA 1CQYA 5C6TL 5IMLA 4M9OA 1T2QL 2HRPL 4WUUE 3KPRA 4MLSA 5ESAB 3WHXB 5HJ3B 3VFRA 2CKBL 2OI9B 4WFED 2KQMA 4PJGA 3BH8A 5C0FB 4FQ1L 1NMAL 4F7MB 3WKML 4MXVF 2EXWD 5DQ9B 5BO1L 5DZOA 3WNNA 2JELH 1WZLA 1UKQA 5K9OB 4ZUVA 4KVCH 4HZLA 4U6HB 2VQ1A 2X9XA 4L3EA 1JGDA 1JZ4A 4ZOEA 4U0QB 5E08H 4PV8A 2HFTA 2ICWA 1CD1A 2NY1D 4GQ9L 4J6RL 2WBKA 4J23A 1K6QH 4BQCA 3PQYA 3INUL 4H88L 4TRPH 3OJDB 3C6LC 4EDWH 4L3ED 1F3JA 2WINB 4OZFH 4LVEA 1T1YB 5D2NB 2N7BA 3QEQD 2IAND 1MHEB 2AXJA 2BHZA 4OM0L 3OXSA 4KHXH 1T7WA 5EOQH 2PYED 4GXUM 4YHKH 5BZDB 5CGTA 4MD5B 5FA3A 3FOMB 3RA7L 4FQXC 4F15C 5I75B 1KV3A 2ILLA 2K7QA 3WHE1 1ZT1A 2LTQB 2O93L 3A6BL 2MFNA 3EFFB 3UBXI 1HXMB 4XCCH 1ZANL 3OG6B 3VWJD 3KPQB 4YDJB 5F1KC 1CGYA 3O0RL 1CFTB 2WSKA 3UTTA 1GIGL 5LBSH 4NQDA 3BP6B 4OFYD 4ONOA 2OBGA 1YN6B 5IF0A 4L29A 4KTDH 3ARDC 1D5BA 5CILH 5FM4A 5JORB 3STZA 1UWEH 4Q2ZA 1BZ9A 4EBQH 4C56E 3PWLB 3ZDXF 2YC1A 3BO8A 3MUY1 4P48A 3QRFM 4JFHD 4KKAD 4WI4A 2NTFA 4P5KA 3DO3A 3NIDE 4QHKI 5GGSY 5GHWL 1R3IH 4U7SA 1H0DA 4R96A 2HVJB 4KGJA 5ELIA 5FGSA 3UTPE 3X13B 1MCCA 1BGXL 1G1YA 2GK0A 1MAML 4MSWA 4RMVA 2FDBP 4Z95H 3T0VA 2ZG3A 3PHOB 4PBVC 1F4XL 2H3NA 7FABL 5JW3H 3C5ZC 3GMMB 2GT9B 4MAYC 5IB1A 4G42A 5CD5D 1HIMH 1QFWL 1FIGL 5E56A 4YXHL 2GSGB 5IHUL 1DUYA 3REVB 4ORGB 3TBYB 1GGBL 4KPHL 3IF1B 1EVUA 2VC2H 1N8ZA 4PRIB 1FNFA 4KC3B 4K94C 1KJ2H 2RCSL 1MF2L 2AABH 3CVIL 4LGSB 5FOBB 3SGDH 3GSXB 3PV7A 3U48A 3TZVA 1V7ML 4PV8B 1OM3H 5LJYH 2X70B 1HN1A 4GRLD 5EU6A 2X44D 5E8NA 5EC2A 5DJZA 2YUXA 1J88A 4LF3B 1ORSB 3L5WA 5K9OA 1NAMH 3NABH 4GRWH 4HFUH 4OAWA 4WY7H 3U79A 1A4JA 2V5MA 5LGJA 1OB1B 2L0DA 3SOBL 3ZDZF 2NY5C 4LSVL 3RZCC 1AFVL 5D2LE 4WEBL 1EJ6A 4U33A 1N59A 5CGYD 3V6OC 1A7OL 1D5ZB 3PXHA 4FG6D 5C09E 3HZVA 5L88H 5KANI 4Y4FB 4BA8A 1FPTH 5C0CE 5KSBA 3GB7A 4J3VA 1F4WL 5F97E 2A6DB 5F6IB 5AWNL 1KJ2L 2RCSH 2KH2B 2XA8L 3QIWD 5SWSB 1PSKL 1MRCL 3QNYA 4HKBA 4G43B 5CEZH 2EIDA 4XMLH 4PV9A 5KSAC 3EYSH 3QCTH 1QFPA 1AR2A 4K3GA 1BD2D 1UEYA 3ARUA 5ALBH 5HHQA 3PWPE 1TZHB 43CAA 1CU4L 1J12A 5DT1L 3KR3L 4MB5A 2Q7YA 4WGVB 5D72H 3ZHKA 1BMGA 2HH0H 1G9NH 3T0ED 5ICXB 4G8GD 2FIKA 2DTMH 1KJ3L 35C8H 3PGFH 3GBNH 4M62H 4LEXH 1UACL 4L3AA 3MROA 4WJ5A 3IVKA 4K8RL 3H9HA 4OLYH 2X4RB 4R26L 4Z7UE 4OLWH 1HNFA 1B88A 2GJ6B 4G6AC 3MV7A 4KMTH 1W8OA 4GAJH 3TBWB 4JG1L 5DJAA 5DF0A 2NZ9D 2YUWA 3RI5K 1OY3B 1AQDB 1YMMB 5EOCJ 3CMOH 1U8OA 4JPWH 3CFKB 4PGCA 4XX1E 1J0IA 3F12B 5KN5B 1WWWX 4GT7A 3WIHA 4NFCA 1CFVL 3WUZA 1Q8MA 1MCIA 4GKNB 1KC5L 4XWGH 4AG4L 2WQ8A 4G42B 4B50A 1DBKH 4L1DA 5FGCB 4JFFD 4XAKD 4K3HA 4QHKJ 3G6DL 3NACL 2IFGA 5L2KB 3D9AH 1OP3H 1M05A 2ESVB 1AR1D 1XH3B 4PRIA 2JCCB 3RIAK 1XGQA 3B5HA 3BVNB 4N9GB 4NO2A 3JVGA 3Q5OA 4ZFOL 3AS3A 5JXAH 1SJHA 1Z9OA 1ZGLB 3PP4L 3VWKC 1YEFH 4NZUH 1GHFH 3AS2A 1T04A 2UZYB 1G9EA 4ZUTA 1M4KA 1QRNB 4N0CD 2VISA 1K8DA 2FATH 5DSCA 1VEMA 5DJYA 3W9EA 3LRHA 1QKZL 4PJAA 1ZT4B 5E5UB 3KPTA 1IAII 2EYTA 4X6EA 5DD3L 1BQSA 1HCFX 5F7DB 2WUCH 2OR9H 2ZOKB 4I8DA 1C1EL 1MFDL 2OXHA 3SY0A 5EBMA 3MLTA 4PS4H 2QADD 1ORQA 1OTSC 3MCLL 1NDMB 3UZVB 5GGVY 1PZ5A 4K2UH 2E6PA 1TVHA 2DDQL 3CFBB 4JRXD 2AK1H 1ZGLP 4HUUA 1QSEB 3LZFH 3FB5B 4XP9H 4DKEH 3BZEA 1IAKB 4OSUL 4UINH 1P4LB 4R7NA 1CDCA 3GI9L 3WBDA 3PP3K 1UB6B 5HPMA 4PRDB 3D85B 4W4NA 3LKQB 2IH1B 2ICWB 2VE6A 1DVFB 3IDXH 1R5IA 4I18B 4Z5RA 5TE6H 1ZWIA 4MJ6B 5CMAA 4YXKL 3UX9B 5DJXB 5HDOA 1IGCH 2GJ6D 2XACC 3OL2A 1PVHA 4ODWA 4I0CC 2Q6WA 5D7LA 3H0TA 3BZDA 3ARBD 4MAYB 3JSSA 2HMIC 2R69H 4AEEA 3FFCB 4JZNB 4K94H 4MJIA 5DVKA 2H9GB 4FQIL 3DO7A 4MXQD 4YC2B 5E9DD 3HS0B 3QB7C 2R39A 1QO3B 4NHUA 1QTYT 4PJCA 2PW2B 2XWJA 1NFDB 3DV6A 1KN2L 3NCJL 1ZE3C 4OLYL 4HBCL 4EOWL 5KBNC 2NYYC 5DJAB 1BD2B 1YYML 3AFLA 2DI9A 1NBVH 3KXFB 1CVSC 5JUEL 1BAFL 2NY5H 3VFPB 2BOCA 4KQ4L 5GISH 4KDVA 3V5KB 3FN9A 3K8MA 4Y16D 3ZT6A 3OJVC 4HUXA 1J86A 3IXAB 1DANU 4HS8H 3AXLB 3MV9B 4RFEA 5HHOD 4Q9QH 4UB0L 1GOFA 3ULSA 1NMCC 3OBAA 4L4TB 3QFJB 3UPAA 4U1KB 1S9KC 2F53D 4YBHA 5EC1B 4WENB 2DQIL 4P4RB 1F4YH 1I1AB 4JCMA 3C08L 2HFEB 4PB9H 4JRYE 5TE7H 2P8LA 4P9HC 1CGTA 4LLVB 2VISB 5D71H 3STBA 1ITCA 4LLDB 3RVWD 1TJHL 2ZSVA 1IM9B 5C0DB 3HC4H 3MLYL 4GRLB 3IDMB 4FFYL 4OTXH 4HXAL 3PJSA 5IKCB 3NCMA 1G7LA 2QQLH 1J8HE 1AGFA 5DS8B 3LIZL 3GMLA 5MENE 1DBAH 4G5ZH 3FL7A 3DTXB 5C0GA 5E2WH 3QSKB 4PJ7A 3S3PA 5I2IB 4OGYH 3K2UL 1N8ZB 5L7XL 4M6NL 4UDUB 4HV8A 3SJVE 4JM2F 4Y7MA 1FFPB 5J13C 1WCQA 4HGMA 2MNUA 4Q0XL 2RBLA 1YY9D 5J9PA 3QQ9D 5I9QB 4XHJD 2ZNWA 1KPUB 3HZKA 3VGAB 4JPKL 5CBEA 2IFFH 4OF6A 4WWKB 1MI5D 3GSQB 4PJXB 5AD0B 4K71B 3BGFC 2YMXH 2NW2B 4KPHH 1KLFA 3NH7L 2LTQC 3T2NH 3U4BL 4JO2L 1JGUL 2XQYK 4OCXL 1KCLA 5DJZB 1IAIH 1VGKA 1N7MH 3A0OA 1EO8L 3HE7A 3U82B 4LIQH 1MCKA 4R4NC 1JGVL 2X1OA 3EOTL 4M7ZB 3LN9A 3TBTB 1J0JA 4CN6A 4QHUB 4LLMB 2Z93A 3QWRD 3QI9B 5JZ7C 2ORBL 4FQHB 1YPZF 4QLRA 4GJTB 4LSDA 1IKFH 1Q0XL 4N5ED 3MYJA 1AXIB 3IAQA 1YA5A 4JCLA 3QDJA 4D0DB 4Z7VA 1AXTH 1R3IL 2Q6WB 3RL1A 3MUGB 4JFED 2R1XB 1LP9B 2H2SC 5JNYA 1D9KC 2CGRH 2NY2C 3B8YA 4M1GL 5E4EC 3G5VB 3PWUA 5I71C 1DQLL 2EDRA 2JB5L 5HSFA 2KKQA 5EWIH 3MODL 5HHQB 3EO0A 3W11C 3EDEA 3MFFB 4OZ4B 3VWJB 5IESH 3V4VL 1NBVL 5CWSA 3VFMA 3ZTNH 2ZZUT 1V5JA 1ACYL 4FQ2L 4WWID 2DJUA 4NT6A 3H9SE 5IIEB 5DMKA 2WWMD 4KH2A 1A3LH 2G9HB 3BP4A 2ZUVA 1I3GL 4KI5C 1UYWL 4DUVA 5CIPH 4IOFD 1I7TA 3OR7A 1HHKB 3HPJB 3DVFA 3TF7C 4FXGA 1CD9B 3ZKND 2CUMA 3EYUH 4F7EA 1N5YL 4EI5B 1HQRB 1ZLUH 4HIHA 3AREB 1MCOL 4QCIB 2N1KA 4BUHA 4LLDA 1NL0H 5I66A 4JKLA 4O00A 1HZHH 3RHWK 3V5HB 5T5NF 5I8KH 3R8QA 5T5FH 3O45A 4GLRH 5TF1H 1JN6A 3PJSB 4PJFE 5D71L 5EU5B 3MV8E 5BW7C 4BSVB 4WI5A 5DRWB 3T65A 5FYKL 1KIUA 3NOIA 3QRGL 2VQ1B 2FLRT 4NYLB 3DTXA 2H6PB 3RIFF 5C0GB 1IM9D 1SVZA 1K4CA 3NZHL 1KXVC 3GNML 3CUPB 2IAMD 1Q38A 1AGDA 1BM3L 3P11H 4MDJA 4IRZH 3LKNA 1F6AA 1CDIA 3FO0H 5EOCH 3HI5H 4JFDA 1A7BA 3VXMB 2O5ZH 5ALCH 5CIPA 2AJVL 5F3HA 3FB7A 1A8JH 1XGYH 3BX7C 3GGWA 4L4TD 2FJFA 5TFSH 1YC8A 4D8PB 5L9DH 1H3WM 4Y4FC 4XNYL 1TLKA 3MRKA 4OGXL 4QXUH 4DCQA 2IG2H 2MKWA 3P9LB 3IU4L 1IQWL 3DMMA 3I3DA 4OB5H 1ZSDA 1X5FA 3GMOB 5FDWB 3O8XC 4KRMB 1S7RA 2Y9RT 3LS4L 1CR9H 1KPUA 1MCFA 4HWUA 3NCFB 1A9BB 2BVPB 5SWQB 3OKKA 2OQJA 1SY6A 2ICWJ 4W70A 5EZLA 4OD3L 1T20B 4FNLL 4NZUL 4HKJA 4X6FB 1WZ1H 4JDVA 4TVPE 1OL0A 4WI8A 5MP6H 1IAOA 1N5AB 2HVKB 5MEQA 5DK0A 2IQ9L 3U36A 4OZFB 3IKKA 2O5YH 1WQVT 3MRMA 1Q94B 2X4UA 2Z35B 1BQHA 5E4IA 4OM0H 1I9RH 3IS0X 2F8OA 5E9DB 1I1FA 2P8PB 2CUHA 4LCCA 3ZDXE 3IJHB 1AI1L 1IGFL 4HH9B 2GITB 2FSEB 4UT9H 1SJEB 3QBTB 1NDMA 4GW4B 2IH3B 4KKCD 4QRRA 4NQED 3ZYIA 2A9ML 4U3CA 4R0LB 5DWUL 1IRAY 4XNUL 1YQVL 4OSUH 2W0FA 3H3PL 3SKOB 5I71B 2PN5A 2GQHA 1Z3GH 1NC4D 3MRPA 5IWLC 3DARA 2IC2A 5ETUA 1MHCA 3HPJA 3C5SB 2W1NA 5ABDE 5EIIB 3EO9L 1IGTA 5JNYB 3SDYL 5JW4N 3GJFB 2C5DC 1P9MA 3FB6A 2XZAH 3MLTB 4QRUB 3ZYJA 1F97A 4LFHD 3IFLH 1MAJA 5T33H 3EKCA 2ZPKL 1DSFL 4H0HB 1FYTA 5LGKA 4E0RB 5FUOL 1F11A 4JREC 4XPFH 3DROB 1RZFL 3AMLA 2HP4A 4PJCB 2J8OA 5C6WH 3GHBL 3N1QC 1G6RL 5F9DC 3VXQA 4X4ZA 4BK4A 1BX2A 3U6RB 1MRFH 3TIEB 3T08A 2HT2C 3L95A 1UJ3A 5KS9B 3D69B 4N1HB 4FQXD 3V2AR 5SV4A 1FJ1A 4AL8L 2FZ3B 4WHTB 5GRUL 1KEGL 5H94A 2AJSL 4X83A 1TTUA 1EXUA 4R4BB 4ZUSA 3C5JA 1BOGA 5SX5K 1U0QA 2GAZB 3QEHA 1FN4A 4JY4B 1EEZA 1IT9H 4OLZH 1XF5B 1KUMA 5DJ0B 5HY9A 1C5DA 4Z7WA 1CVRA 1VPOH 3DOSA 1DBJH 1IKNC 1F13A 1UA6H 3ARDA 3OGOE 4URTB 2XWJB 1DQMH 5JLZB 4LAQH 5KJRL 2VITA 1RHFA 3KNBA 4YX2L 1T2XA 1ZHLA 4LSVH 4CJ0A 3TC9A 4ENED 1A7NL 2CQVA 1YEKH 5JOEA 1NCUA 2PYFB 3Q6FA 3LQMA 1KCRL 1YDPA 5IV2A 5C0DA 5I18H 4Y16C 1KYOK 3GRWH 3Q6GL 3T0BA 2FIKB 1V3LA 1RUKL 3WSQH 1YJDL 1N4XH 2O26U 4UOW1 5AEAA 3T2PA 3TH4T 1HHGA 5I1CL 4HC1H 4HH9A 3QIUB 2VLRA 3VWJC 2IAMC 4PR5B 4GW4A 5E8OA 4FN0A 5HHPA 2Z31D 1QBMH 4JGUA 5KSBF 1ZLSH 3MRMB 4HAGA 1KJ3H 35C8L 2EZ0C 4IDJH 5TDOB 4UV7L 4PJEA 3RWFA 1HQ4A 4JDVB 1NH6A 3S35X 1FNSL 4HXBH 4WCYL 2CO6B 1TZGL 1RURL 3QUYC 2P7TB 4MMZC 3L5WB 4OZFA 1GZQA 2YPVL 2AEIT 2ZG2A 4G8IA 2Z8VC 1A2YB 1K85A 2W59A 5BJTB 1UH3A 3LY6A 1RZ7H 2BOBB 5KJRH 5I8OL 2X4QB 3FO2A 5DJCB 4GKNA 1GOHA 1FGVL 1J0KA 4UILL 1JF1A 4C83A 2VLKE 3NAAH 3D5OF 3OKYA 4Z0BL 2ADGB 3QIWB 1JFQH 2VLKD 4ODTH 4WU5A 4UOJA 3NIGF 5FA4B 5GZOC 4M43H 2NMSA 2BDNH 4HKBB 1NGXA 5B21A 2L4OA 4Y4FD 4K8RC 1QHOA 3TA3B 4DFIA 2EYSB 2DQUH 1X5YA 4PFEA 2VDQH 4LOUD 3TV3L 2VXSH 4JFOA 4WFEE 4G9DB 1M6OA 3HC4L 3O3EB 4QNPE 3O3UN 1NANH 2VZUA 4X7CC 2Y6SD 3RIFK 5KN5A 4HS6B 1KB5B 5MHSE 2IPKB 2DOCA 4AM0B 3IFPA 1CTNA 4G8GA 4JHWH 5E8DH 2F19L 2DQEL 4YX2H 4OV5A 3CDYA 4IIQB 4MJID 1L7TL 2COQA 4FQXA 5GXBB 4XAWL 3W2DL 1OARH 3MNVA 5GSRB 1NFIB 2C3GA 4YH6A 3UYRH 3QUXA 4L1HA 3QULB 4MXVE 2GIYA 4P9MH 5IVNA 2P5WA 1H5BC 1D5IL 3WNLA 5ITBH 4X4ME 3RUGE 1WWAX 2FECL 1ZK9A 2ADJA 2QSCH 3BZ4B 2P5WE 3STLA 2OL3B 5GGUA 4XMKL 5FYLE 4LEOA 5EOQL 3WS3A 1IGML 5FO7A 5I17B 2Z8SA 1Z9MA 5FYLD 4OKVA 1I8LA 5FK9B 4TQEH 1FDLL 4XCFL 4HUUB 4U6TA 3QEHB 3CLFL 3VFMB 1P4LA 4YHZH 4EQ3A 2W9LA 2W9EH 4XHJC 1CL7L 5GGRA 2DMBA 2ZWLT 1YY9C 2WWMC 4G6ML 3V4UH 3TT3H 1I7RB 1OTUD 2F5AL 2VZTA 4YDLC 2K7PA 3GHEH 4QYOA 3O2WL 5TGBA 4OKDA 1FL5A 1HNGA 3W11D 5EH1A 4FA8A 5JIIA 2V5TA 5I1LB 2PKDA 1F6AB 2IQAB 4EBQL 3T04D 1VFUA 3ARGA 2AV7A 2DQCL 4P3CH 2MOVA 4TNVK 4OGAD 3EYUL 1QRKA 3LKPA 4ZFFB 4ELKB 4G6AD 3C2SA 2Y06L 4AK1A 2EC9U 2YD9A 3DNKA 2IPUG 2O61B 5DEFA 4PUBH 3TA3C 1K4DB 3UTPD 3DRQA 5IT2H 1DBBL 4UINL 2BP3A 2V2TB 1PKOA 4LHUG 1QFHA 3QYCA 3QDMD 1PEZA 1LMKA 4HKJB 1IFHL 1TDQA 2FL5A 5D5MF 3PWVB 4PRBB 5IJKA 4NQEB 2YC1B 1DQLH 4PY7B 3O9WA 4WV1C 1I9RL 4RFNC 4N0RA 2FJFB 2VLLB 3EJZC 4IRZL 1CK0H 1NBQA 1BFVH 1FCCA 1PZUB 2R15A 5ADPH 1H5BB 3W39B 2VXTL 3P9LA 2FCBA 1IILE 3GBML 5FDWA 3MZGB 1FC1A 2OSLB 2IPKA 1GYAA 3EGSA 4CJ1A 1UKTA 4M6OH 1KB5H 5K93A 2H3NB 4RIRB 3HLAA 1MI5E 1DVFA 1IC5H 1L7TH 3IU4H 3WLBB 1OSPH 3SDXF 1OTTD 2DLGA 2DQEH 4DOHB 2KL6A 2CSPA 3MLXL 3L6FB 2GY5A 4GUPA 4DKAA 5I6XC 4KVNH 1HWGB 4D0BB 4D9LH 1H15A 2FGZA 3TV3H 1T0MB 4YGVB 1CFSB 3VXOA 1T66D 5DFTA 5I8EA 3TIDB 1NGQH 2D7OA 2CKBA 3EBAA 4XP4L 4YPGB 4N0UB 2AJYL 3IXTB 4PLKC 3P4MB 3QCVH 1LDPH 1HE7A 4E0RA 4XVTH 8CGTA 1NCBH 1KJ2A 1DTUA 4TOYH 4JFPA 1BJ1H 4O2EB 4OM1L 2B1AL 3QUXB 4QGTA 3IGAA 4HGWA 2VAJA 4J4PA 4PJ7F 4D9QE 3D6GA 1OTSD 1Q9LB 4HUWB 4B41A 2AJ3B 5B3NA 1G7IB 1VFOA 1S9WB 1BVLB 4OZHF 2YA2A 4JM2D 3V52H 1IM3A 2H8PB 3WNPA 5EU4B 5F1OB 3AGVA 1OTTC 3VXUA 5BV7L 1MCEA 1A3QA 3FT2A 5F1IA 5DUPH 3VXRB 1FYTE 4H0GA 1UT9A 5F7WC 4JVUA 1RVFH 3RL2B 1LO3L 3KPSB 4K8RH 2BXZA 2YR3A 4ETQB 5ID1A 4JB9L 1KLGB 5DLMH 3HC3L 2AJYH 3I50H 1JRHL 2P45B 4JKPH 3QJHA 1U8PA 5ECJE 3RBSA 4AY0A 3V4VH 2NY0C 5BXFA 1EZVX 2HMID 2ERJC 3KR3H 5F7EH 4D9LL 2DD8H 2IAMA 1FBIL 2FYYB 3D39A 4DQOH 3L1OL 3O4LA 4NP4H 3O3AB 2GJJA 4ODHL 5IB2A 4DTGL 2EYRA 3QQ3A 4HQQH 3T4AA 4TULH 3RWEA 4FTVD 5F8QC 1T7ZA 2AJZA 3BH8B 1MAKA 4OFIA 5KANG 4IRJA 1EJOH 3O4LD 3IAPA 4PRPD 4MB4A 3ARYA 4U1NB 4E9LA 2YPLA 3LVEA 3ARWA 3QEGL 2QBWA 4XXCA 1GC1C 1K4DA 3BE1L 3S36X 3TBSA 3N1MC 1DBAL 4PRBA 1NGZB 3MUGA 4KKCC 5IQ7H 1OAYH 4OGAC 2Z9TA 4ZSOA 1XGTA 3QI9D 3F7YB 4M00A 5IFHH 1NQBA 4OCRH 1YEJH 3IFOA 2WK2A 2CLVA 4G6FB 5I66B 1YN6A 5GRWA 1NGWB 5D1ZA 3HE7B 3O9WB 4BFIB 4KRLB 3AS1A 3UTQB 3VA2C 3NFSL 1S9VB 1X7QA 3MRRB 4TUJA 4LLMA 4HEPG 1HXYA 4YFLF 2Z0BA 1BF8A 1U3HB 1O7VA 1KPRB 3MBED 2FHCA 3H9SD 5D7JB 5FGBC 2B0SL 1HHKA 4PJAE 3ILPB 1D5BB 1HK6A 5L8LB 3JTSA 1VERA 4D2NA 5E94B 5IR1B 4G80B 1CXFA 2EDLA 2PTVA 1P69B 2AK4E 2G5BA 2P48B 4RBPK 2HRLA 4X5XB 1UVQB 2J88L 3GMRB 2BERA 4IEFB 3ZZ1A 4X7EC 2EEDA 1MHPL 2VDLL 3IAGC 4PRNA 2A83B 1I8IA 4MWFB 1JZ8A 5GS2D 2A38A 4PJ9C 3PV6B 3P4OB 1FL6A 4FMKA 3KJ6L 4YZFF 5D93B 1UEMA 1NCDH 4MZ3A 4FG6C 5B39G 1EHLH 1S7UB 5BRZB 4HUVA 3SE4C 3VRIA 3BXNB 1N5AA 2HVKA 4BKLA 4HLZG 1X5GA 4ZNEE 2F53B 2NLJB 2HTLC 3OZ9H 1T5WA 4LVHB 4PTTB 4H20L 4OD1L 3GJEA 4P46D 5TE6L 4X5WA 5HHOB 3WV0A 5EU6B 1SVCP 3D9AL 1YJDC 5JR1H 5L2JB 4CADA 3BZEB 2ZCHL 4NWUH 2AEQL 3Q1SL 4XPBL 3GEWB 4QGYA 4MD0B 1PEWA 3PL6A 1P7QA 2V7HA 1UCTA 1I7ZA 3B4NA 3VD9A 1HOCA 2AXFA 4XT1C 1BQHG 4OV5B 3RDTB 2PO6B 4F15B 4BH8B 2A6JA 1IGJA 12E8H 3QXDA 2YXFA 2X7LA 4GAYA 3OB8A 5CMAB 4PS4L 2HJKB 5BMFH 1SQ2N 1NBYB 4E41E 3OAUL 1R24A 4IMLB 3CVHH 3BMVA 4QXUL 3QUYD 4Y1AD 4G43A 4X4XA 1NFDE 2PO6D 3CFBA 4GRMB 5I73B 4JKKA 4JQXA 1IAKA 2KBGA 1XF2A 1D5ZA 2R1WA 4MAYD 4JPVH 4JFYA 1NC2D 5JW4M 4ELKA 5C0AD 3GKZA 3T0EA 2Z31C 1P7HL 5FYKE 4XNUH 3RVXC 3GZKA 5IVZA 1H3PL 1XCTB 3HRPA 3ES6B 2OP4H 3H9HB 3D85D 3IDIA 1UFUA 4TVSa 3P30L 3MMEB 2XI9A 3BDBA 1X4XA 3O8XA 1A6VH 5D72L 1AI1H 1ZT7A 2EKSA 5DR5H 2IPTL 1D3CA 1S9VA 1D5IH 4IIQC 4PB0L 5T3XH 1BOGB 2B39A 4A6YH 1TJIL 2JJTC 4P5TB 4Z77B 5JTWA 5GGTL 4Q9CA 1AP2B 4L8CB 1JTTA 3MRNA 1XEDA 1IAMA 3MRQB 1FYTD 2QQNL 1JNJA 4M61A 5DQDL 4JEGB 3X3FL 4RGMB 1BD2A 2P43B 4I3SH 3CFDA 3UYPA 3D0VA 4G8FA 1MJJB 4YHZL 4HX1B 4O4YL 1MHPH 3LEXB 4RGNE 2Q3AA 3ARFC 3WUWG 1T89C 1QRND 4XZUA 1D5XA 4WHTA 4X80H 2L7JA 1S78D 2ZOLB 1YEIL 1U8IA 1OQXA 4Y2DA 3EDKA 1KIPA 4WW2F 2D3VA 4ZS7H 2MCPH 4ZMAT 5I1JL 3JWDL 2PTTA 3KG5A 1F5WA 5FECA 4X5WB 5E8EA 4H1LG 1U8OB 3I02B 4JGMA 3CAFA 3W0WB 5IW6A 4AEHL 5I1DA 4N9GA 3FTGA 5JLZA 2BNQD 2C3XA 1AE6L 3HE7D 5D2NC 5CJQL 5T1LB 2NY1C 3OKMB 4ODVH 4OZGB 5IMMB 4P2QB 1WVZA 4N0YL 3L3HB 3HUJF 3I3EA 3OPZH 4JFFB 3C09B 2V2WA 4UMGA 2JLLA 3T8XB 4DN3H 2BRRH 3GM0A 2A1WH 1FGNH 1JYWA 4PJFF 2E9WA 4S1RL 4PJBE 5M7QA 2W91A 2V7HB 5EBGA 3GJEB 3C5JB 3MRCA 2FX7H 2UZXB 3QHFH 1U8MB 5HHOA 5KSAB 4YHML 5F7NC 3E3QC 2RB8A 3ARGC 1E4XI 1X44A 4RX4A 1JPTH 4JQVC 4APQA 4LHJB 3S96A 1OAUH 3IRPX 3QAZC 3FT2B 1T21A 3QDGA 5JMOC 3B3IB 4ONGH 3O2VL 3S34H 2FJHB 3W81A 3CX5J 3JWOL 4LSRH 1GGIL 4ZPTB 1N6QL 4PJXA 1WGOA 5AD0A 4AZ8A 1C5BH 2A6JB 1FH5L 3ISWA 4M8QA 2E8YA 4EI6B 1MWAL 3S9DB 3VFVB 2J6EL 2WLZA 5GRJL 4ELMB 5CP7A 5HD8C 4CN4A 2WWKT 3AVEA 2MJWA 1G7IA 3NIDF 2IBBA 4LASL 1JWMB 3T0EB 4TUOA 2VLMD 1A4KA 1S7TB 2ZSWA 3BPOB 3QO1A 4DK3A 3SBWC 3T0EE 3NTCL 4JB9H 1A1OA 1ZLSL 3VXRA 1I4FB 5FYKU 3ZT7A 1ZT1B 3PWPB 2CDFA 3HNTL 4LFHG 3UYOD 1RHHA 1I7TB 3OR7B 4MGXA 3ZSSA 3OHXA 2ENSA 3QQ4B 1N4XL 3UJTH 3EYVA 4B53A 3U7YL 1CQKA 2DQJH 3BI9X 1QR1A 5E2UH 3UTTD 3LKSB 4LRNH 1A1MA 1ZHBB 5HBBA 5BVJB 3P40A 3PP3H 3STLB 2WP3O 4UTAL 1FAIH 3O2DH 3OB0K 7FABH 2LABA 1CD8A 3WO3B 5LWYL 1I1AC 4WU7B 4AIXA 5D2LB 1DQJB 3K0WA 1W2KT 3GSNL 3BJ91 1K5NA 2NTFB 1GL4B 3FHQA 1OGAA 1JRHH 1V7MH 3WIFB 2WWKO 5B8CC 1X5HA 5HI3D 1SM3L 2Q76B 1CR9L 1P7KA 2A74A 4WDIB 5F72S 3AREA 4LGPB 3NN8A 3PHOA 1AQKH 3VH8G 5DUPL 3QPQC 1TXKA 4PJ8C 5F1SA 1HKFA 1LK2A 5ICZA 2F74A 3HA0A 5DHVH 4YQXL 2DL9A 4J4PC 1B9ZA 3MUJA 3AXLA 4RFEB 1N6UA 1R3JA 4YWGL 5SX5H 2R9HD 3LKPB 3ULVD 5DC9B 1ES0B 4U1SB 3O2WH 3RJQB 1L6ZA 3IF1A 3HZMA 1S7SA 4XI5C 4PGDB 1B4JH 5DUBB 2QKIA 1CXLA 4MDJB 2BXYA 4APQB 1OD7A 5B39A 1NGYB 3K8KA 4KI5E 5JHDE 1QFWI 5LGHL 5GS0H 5DD0L 3CLEH 4HWZB 1W0VA 4ZSOE 3TVMD 1PGRB 3B3IA 3D48R 5DFVC 5F3HB 4UB0H 5I1LA 5JHLH 1TITA 1P84K 3JTSB 5T33L 4LARL 5DS8A 1P2CA 1Q72L 1L7IH 4LVNC 5D5ME 4U49A 3RRQA 3UZEA 5HHXH 4PGEB 1MVFA 3IT8D 2B2XL 4KDWA 4LPYA 3MLWL 2CKBH 4NGHL 3B9KA 4S1SL 2CJUL 1IAIM 3P9MA 3B43A 1UZ8A 4FQCH 1G7LB 3L3JB 5FK9A 4KJWC 1OSPL 4DFHA 5KVFL 3ZE2F 4Z6AT 1A21A 4N5EC 5A3IC 2IPUK 5D1ZD 4KAQH 1P5VA 1CFQB 2AJUL 1JPGA 1A02N 4RIRA 3OR6A 2XKUA 2Y5TA 4TN9A 3IDNA 4I5BA 1I8LC 4R4ND 4TSCH 1U42A 3GK8H 2XICA 2DQCH 3DBXA 3T0EC 1FZOA 5EWIL 5LWYH 4HT1H 5B8CB 3BT2L 1YNLL 5FYJD 4BSWB 3O2DL 1NUNB 2B4CC 4KKNA 5KAQF 5EDXA 1S7XB 1AO7E 3K80A 4QY8B 4L4JA 4H1LH 1RHHB 2E8ZA 1FZJA 4FZEH 5HVGB 4XB8A 4EIGB 1DQJA 3VFGL 1FYHB 3CXHK 4J3SA 1Y0LA 3T3MF 3T77A 3NCEB 4D0DA 4BM7A 4QHUA 3HNTH 1ZVHA 2G5RA 2Y07H 3TCXA 4I48B 5BVJA 3WLBA 5ISZE 4Q9RL 3PWJB 1AGCB 3LRSB 4QRPB 2FWOA 2HJFA 3O81A 4NKDB 5E00B 5JOFB 1FZKB 3WKMH 5KSVB 1ZHNB 4S1SH 4HD9A 4JO2H 1GPOL 5EZOH 3QFDB 3GK8L 1CFSA 2YMXL 3DVGB 4G7YL 4EN3C 2X89A 3R06A 3RVWC 1M7IA 3ET9F 4A6YB 3QG7L 2CK0H 4D9RE 3V5HA 4YE4L 4IMKC 5J4MA 2DLFH 3GO1L 5IJKC 3TYFA 2EDHA 3L7FA 2C1PB 2XYCA 4U1HA 2BVQA 5DUBA 3AAZA 1F90L 2GUOB 3UTTB 4S11A 1IL1B 3WXWL 1UACH 1EVTC 3AC0A 1SYVA 1S9WA 4M1GH 4X5LA 2CGRL 3QUMB 4IM8A 4HG4K 4KK5D 1DDHA 3U46A 4GSDH 2JJSC 1FFNB 4M03A 3CC5B 2WUBL 4GMSH 3JTTB 2D7TL 2AS5M 3PHQA 1NGPH 1MLCB 1L6XA 1I3GH 3H9YA 1E4XH 2IALA 3TPUA 4DGYH 5I8OH 5B38A 1DLFL 2QKIB 2H45A 3LPGA 1AE6H 2VIRB 4NN5B 3RWFB 1TETL 2HLAB 5LQBL 1K8DB 5GJSH 3ZKQD 3Q6FB 1OPGL 4RISH 4Z7VE 4EVNB 1Z2KA 4JHWL 5E8DL 3SO3B 1JWUA 5EORL 3RVUD 6FABH 4Y4HA 4K3EH 2VZ3A 5F9JA 3KYKH 3OJMB 3MRKB 4DCQB 2C3VB 1OGTA 3DXAA 4LNVA 1U91A 2Z8RA 1EGJA 4M7KH 3BH9B 3MV8D 4BZ1L 1OWRM 4KK9C 1MNUH 2EDTA 3RNQA 4MNGE 4F9PC 3KDMB 3X11B 5J8OA 3LEYL 2X4NA 3FQWA 4K23L 1KN2H 2ZUWA 4JO3L 2QHLA 3NAAL 1I9JL 4Z0BH 1FZJB 1KXQE 1OAUL 2OCFD 2ATKB 4M6MH 3HC0A 3AY4C 3CFCH 3OGCB 5IFAL 2HN7B 4OZFG 1S3KH 2X1PA 3CH1A 1YY8B 4XAKE 4ORZC 5DK2A 2EYTB 4X6EB 4NC0B 5DXWA 5LCVH 4Q6IB 3VFTB 4PRHD 5IB5A 4P4KB 2A6IB 1MCNA 4P2QD 4GXVL 5BW7A 1MCJA 2F9BT 4HJ0C 4H8WC 4Z8FL 2OL3H 3H0TB 2BNQB 3IDXL 1CLOL 1U9KA 4F2MB 2DQDL 2ADIA 3DVNB 2DQIH 4NO3A 4Y5YB 3BW9B 1ZVSB 5INCA 5E24E 4RSVA 5DMJB 2CH8A 4N0CC 3J7HA 5DD6B 3KS0H 4OFVA 3JWOH 4LSRL 2V2XB 4Q9QL 4AEHH 3GMNA 1XF4B 4QOKD 5DI8A 2R4SH 3RUGA 3O8XD 5C0JB 1F4HA 1PLGH 2Y5EA 4WY7L 4ZPVB 5EFIA 3UO1H 5GRYA 1BX2B 1CXKA 4XNQA 1UVQA 3QCUH 5ETUB 5KS9A 1QOKA 1A6UL 1FYTB 1INDL 4DVRH 5C09A 3TYFB 3IRZA 4PJ8A 5B38G 1EMTL 4LNRB 2EDWA 3ZHLA 4K71C 1HHJB 3P0GB 1HILB 3D39E 4FFWC 4R6UA 1KPRA 6CGTA 3G04A 1EAPA 2N7AA 5C09D 4PBWD 1HI6A 3SO5A 5C08D 1QBBA 2VXUL 1OLZA 3MPCA 4DZBA 4CMMB 4WHYG 1IL1A 3C8KB 5GZNC 2IMNA 3EO9H 2WBJB 4MAUH 5HYSB 2NZ9C 1DVFC 1U8HB 4GW1B 1JTPA 2VTFA 4FP8H 5H94B 4GKZA 2BVEA 4AL8H 3OX8A 4X9BA 3MACH 1ZA3A 4LCIL 5JPNA 1UM6H 1SMOA 3U9PL 4MQXD 2E6QA 2AERT 1SY6H 4ZXBA 2BSRB 1S5IL 4ZAKB 2R4RL 3C8DA 3MBEC 3BAEL 1GRWA 5FGRA 3REWA 1NLDH 3QUYB 4Y1AB 3ARRA 4ELME 1G9NC 1B4JL 5J9PB 1SBBA 2VLRB 1RUAL 3MRBA 5B4MD 1OGTB 3BD5A 5F96L 4S2SB 5L2KA 5L0QC 2Q8AH 3AS0A 1QD0A 1WC7B 4JHBA 3K46A 1EAJA 1KG0B 5GJTL 3RX7A 1MCOH 1FO0A 3DI3B 3DYPA 5DJDB 1PQZB 5FO9A 1XCQB 3BGAA 3MRNB 9CGTA 3MGTA 4Z78B 1RIVL 4GMTL 5F1NA 4OCNC 1GHFL 4PJBB 3FQNB 4DW2H 1QLEH 5D1QB 4XCYA 2C4FU 1A6TB 4Y5XA 4PLJD 4HDIB 1SY6L 3K1KC 5CGYC 1UWXH 4FQ2H 1FFOB 1NAMB 4GRWB 2AEQH 4XPBH 4HJJH 1BOYA 4I2XB 3V6OE 2Y5TB 4JFFE 3EOYG 1MCPH 3QA3A 4G8IB 3DX6B 3MYZA 4DN4L 1WIOA 1EEQA 4GRLC 5ANMB 2ICCA 4ALAH 2VN7A 1AJ7H 3ARTA 4YEFA 1MEXL 1UZ8B 3CPLB 3MNWA 1N0XL 5GS0L 1D5MB 3ZE0E 2O5XL 1R5WA 4YDJA 2MQ3A 3H2WA 1FV1A 1J7VR 2OJEA 3LS5L 4P23A 5IIEA 2H2PD 3JV6A 3RNKA 1JYNA 1JP5A 4AT6B 1LEIA 3PP4H 5C8JB 3MYJB 4EI5D 1MUJA 2D4DA 2DTSA 1Y6MR 1KSRA 4Z7VB 2Q3ZA 3QHTC 5TDNB 4MNQD 3IKCB 4LVOB 2R1XA 3OF6A 1H15B 2J4WH 5FIEA 5GIRA 3REVA 3G5VA 3QNXA 4JKMA 4D94A 1N5YH 4ONFH 4XNMB 5CD5C 4AH2A 2VSCA 1Z5LB 5HHXL 3BZ4A 2I60L 4OZ4A 1Q0YH 3VWJA 5GSVA 3FO0L 1I7UA 2NX5A 1ETZB 1MWAH 3HFML 3LH2H 4GAGH 4LDLB 3MJ9A 1QYGL 2P5WB 3OTTA 3NZHH 2EDXA 4LVNB 1BF2A 3U9PH 5EZIL 4YZFE 2ADFH 3C8KA 3MACL 1NAKL 5IESL 3ARBA 4QRTB 4JFEB 5K9KA 5E8NB 5EC2B 3WEXB 3VXTA 3WFEH 3UJIL 5IB2B 3E1F1 2CXKA 3EO1B 3MRFB 2ZOLA 5D93C 3SDAB 5IFHL 4OLUL 1U8IB 4P2OC 5D1QC 3CDCA 2ED9A 3FB7B 3BEWB 5ERWA 4LLWB 2XIDA 5JIPA 3IJSA 1Z9LA 1CE1L 1G9MH 3TH2T 1IGIH 1AIFA 2DYPB 2QTEA 1TQCB 5E6IA 2P24A 1KLGA 1Q9KB 4ODSL 2F54D 5HDQL 1QLRB 2XXCB 1DFBL 5DHXB 4G9FE 2FHBA 5FKAA 1TCRB 4MXQC 4PJ9A 4YK4B 3PGFL 1JK8A 1QR1B 2QR0A 5T1KB 3ZE0F 3VRJA 5C2UB 3F5WA 1S7WA 5E03A 4ZFFA 3U0TA 3KYKL 4WTZG 1CE6B 5MEOA 2FL5B 3AY4A 3DUHA 5DFWH 4AMKL 2VL5A 3MUZ1 1FSKB 1YPZB 2XRAL 1CICD 1Q9WA 1K2DA 3I6GA 3F65A 1AO7B 1NUGA 4Z7NE 4Z7QF 4ZS6C 5DHVB 5AWNH 2CIKA 5K33A 1KTRL 4YHLL 4QRRB 1FFPA 5F1NB 2OQJB 2F53E 4R0LA 4JJ5B 3QPXH 3IETA 1XGTB 3DX6A 3RGVD 1C08B 2X5PA 1MJUL 4DK6A 3HC0B 5ADPL 2B4CH 4HCRA 3V8OA 5BV7B 5D7KD 5DMGD 3DSNA 4G7VH 3V5KA 2QADC 4LCWA 5EU3A 4OLUH 5JHDA 5JDJA 5DHYA 1TJHH 3QIBC 2OMBA 3MV9A 1S9YA 3QFJD 1YECL 4IRJD 1A4KB 4JRXE 2NQCA 1XGRA 3BH9A 1M7DB 4NN6C 1BWWA 5DMYA 5GRJH 3DMMD 4MB3A 4AH2B 4LDOB 1JNLL 3V0VA 3VE0B 2ADFL 1CLYH 1QR4A 3QISA 3LQZA 3I6KB 4Y16B 4HWBA 1RZKC 4RGND 4GBXA 5F7LB 4BYHA 2DBLH 5GRVK 4M6NH 5ESVB 4R3SA 3G6AB 3DX8B 3NFPA 4OGYL 4NCC2 3K2UH 5L7XH 2P5EB 1JUFB 3T2OA 1JPFA 4A2MA 1ZHBA 4JN2A 1QBLH 4ZDHB 4P2CG 5LKNA 3SCMB 3WIIL 5GJSL 5E99H 4P59L 5AZ2L 2IADA 2BNRB 5D7IA 3VXNA 3DX9B 5HVHB 3PWNA 4OT1L 2I5YL 4HK3J 1T89A 4W6XB 3MOAL 3MRIA 3GBMH 2AI0H 2X40A 4KUZH 2VNCA 3HNSL 4PJHA 3JV0A 5JHDD 5ESAA 5E70A 3WHXA 3EIFA 1CK0L 4WV1A 4X9FA 4E41A 4U31A 1EEYB 2Z91B 3BEWA 4AIZB 1KIRA 3WL9A 4HIHB 2BCKB 4MA7L 1R0AH 1B0WA 3HUJA 3MRFA 1OT2A 4M7JL 4OI7A 4Z7WE 4KGLA 5DD1H 3VRJB 3E8UL 4L9LB 2AEWA 4GQ9H 4Y19D 4U1JA 1T6WA 1CLZL 4JM4H 5EULV 1UXSB 3VXPB 3ZYOA 3K4ZA 4R7NB 5GZOD 2VZOA 1AC0A 1MPAH 3O0RH 1LDPL 1M71A 2EKJA 2LU4A 2QADB 4G6JL 3BRDA 3D18A 1RJCA 1HILA 3ES6A 4PJEF 2JELL 2GHWB 3P4LA 5FB8A 5F89B 4WFGE 1KTDA 3MBXL 2KZ1B 5D2NA 3HAEB 3QAZB 3LRSA 4K2UL 4JPVL 3QZWB 1MCWM 3P9WB 1XR9A 1C7SA 4KFZC 1JYVA 4DUXA 3PQYB 4WHYH 1SBSH 4IS6B 3SY0B 1KCKA 2C1OA 2X4PA 5J13B 5CS7A 2VDQL 1K8IB 1YDPB 5JXED 3EDFA 5E7BA 3IU3B 4NO5A 4A6YL 4KJYB 3QG6B 3UO1L 4PP2A 1CI5A 2CDEA 2P42B 1I1YA 1UCBL 3DUSA 3IDGB 5M95B 3TFKD 2I25N 1TPXB 3TJEH 4NM4H 1YC7A 2PXYA 2R2HB 4JFXA 2QLVB 1RJZB 1A7RL 4TYUA 4U6VH 4KTYA 5CZXC 2UWEB 2YD6A 3BWAA 2QSQA 1QLEL 2ESVD 4GG6E 4DVRL 2EIBA 2Y36L 4NQXA 3UTSB 4EEEA 1VADA 1UM6L 4KTEL 4QRQB 1T03H 3NGBC 3O3BB 3NFSH 5HVHC 2CK2A 5H35B 4OLVH 1QSFB 2C7UB 3P73A 5ITFB 5IOPA 4CU6A 4V2CB 3C2AH 1JGEB 1QG3A 5F88A 2GJZA 3BIKA 5LAXA 4MJIB 1G7MB 1OSZA 1BFTA 3BZFA 1RUML 4JHAL 4XX1G 5CINH 3M45A 4P2QA 3X12A 5C0EA 4XAWH 4FS0A 1DJSA 1FV1B 2OJEB 1JE6A 4XZUB 2XTJC 5IW1A 1FO0L 5DO2D 3LN5A 3KGRA 4N9OB 4LCWE 3KPLB 4MCZA 1MNUL 2YUZA 1CGUA 2ZCKL 3TN0D 4HFUL 1NAML 3SPVB 5TE4L 3CXDH 4OZGE 3E6HB 2FD6H 1CTOA 2GCYA 1NSNH 2NNAA 4N8CH 4G80A 1DR9A 3C5ZD 3S96B 5ITBL 4XNZC 3EOBA 5EORH 3OKMA 5AAMA 3QUKA 5HYSG 1A9BA 4DGVH 3AREC 4AYFA 4P9ML 1S5IH 2CR6A 5F7KC 1BFOB 1NEUA 4WV1B 3JWNC 5C71A 4HJGA 4M7KL 3WLWC 4PY8I 1MVUB 3GSNA 1YMHB 2AV1A 4WEBH 4LASH 1HINL 2G75A 3CX5K 3OV6A 5DTFB 3N85H 3BFOA 3BXNA 1Z0NA 2NXZC 3HB3C 4O51B 3ARDD 3QIUD 2WIMA 1J0YA 5FOBA 1BZ7A 3L3OB 3UCRA 3U4EA 4DGYL 2DBJA 1VGEH 5TDPA 3FQWB 3NGBB 4NO3B 1C5DB 3TP4A 4Z7WB 5KSBB 1G6RH 3O3DA 1INEH 1OLLA 3KAAA 4PP2B 3WNMA 4NRXA 3JUYA 5GGTA 3ARXA 1RQ5A 4OLWL 1NAKH 3BEVA 4JO4H 3QDMA 3I85A 1HHHB 2XQYG 3QDJD 2AKRB 2XZCL 2Z92A 4PLNC 3E2HC 1NBYA 3QUZB 3IDUA 5TQ2H 3CH1B 2E7LA 5C0JA 3QNZB 2W0PA 5BZWB 3VFTA 3LH2L 2X1QA 4J1UA 4Z7QE 1OP3K 3W9DA 5D7JC 1MFBH 3S36L 4QRQA 1KCRH 3DUSB 2PYFA 2MPAL 3KPNB 2DF3A 4NQEA 3WD5H 1HINH 32C2A 5IOPB 5ITFA 2ADIB 3VRLF 4HKZB 1VFMA 3C6LD 4V1DD 4HCRH 3DETD 1DCLA 3JUZA 1G7MA 1OSZB 1WTLA 1UGNA 2NX5E 2VRAA 3UTSA 5IFAH 1DLHB 5DEFB 2HWZH 1DFBH 4KWUA 2GYSA 4OI8A 1DBJL 2GJ6A 1UA6L 3RUGB 4WJ5B 4PJXE 4CVWA 4KROC 1ZT7B 2EKSB 5A2FA 2HN7A 4ZNEA 1GC1L 1O0VA 5C9KA 4M4RA 3IETB 3O11B 3UPRA 4C55A 3S37H 4F9PA 4X7FC 2XN9D 1FNSH 1AGEB 1J1OL 1Q9OB 4BJLA 4EJ1C 4XPTL 4MCZB 5J1AB 5HYIA 5L8KB 3OKLA 4XPAL 2EIZA 1UXWB 5FYJH 1G7JB 3BP7A 4BSVA 2JE8A 4KKBD 1KPVB 2WLYA 4NUGH 1KLUA 4LVHC 3O41A 5KVEL 4LL9A 4YHOH 5IFJB 1JPSH 4EN3B 4I13B 4PP1D 4NSKA 1W0VB 1HXMA 4NKMB 3HC3H 1EHXA 4GOSA 4OF8A 4FXGB 4KMLB 4WI9A 2GSIB 2AVGA 5BO1H 1G84A 2ZUQC 2JCCA 3DX8A 2D7PA 3BESR 4MS8D 4JRYD 2YD2A 4ZTOH 5HDLA 4JFFA 4WNQB 4QHNA 1R3KB 5LVEA 4YO0A 1BLNB 4QRRE 1MWAA 2BHUA 1GH7A 5E2TH 1B2WH 3B8SA 3FCTB 1M05B 5BQ7B 4L4TE 5IW6B 1HIML 4C54A 4LSQL 4JPIB 2VR9A 3S8WA 2EDDA 3MV9E 2X4TB 4FFVC 4BZ2L 2X41A 5HYEA 2VAAA 2BVOA 1J0ZA 5F96H 4PGZA 4YPGA 1EDQA 3TM6A 1T83C 3P11L 1RK0A 1A1NA 3RWGB 3BHBB 2AK4B 3U2SA 3EZ8A 4OCYH 4LCYB 1TPXC 2E7BA 2DMKA 4F7PA 3KXFE 3S6CA 3SJVD 4R90L 4NQSB 5IBLC 2MCPL 4QNPF 3KJ4B 1P2CB 4UT9L 1XIWD 1T1WA 4JFDB 3HKFA 3WE6A 1INQB 3ROOA 1I8KA 3MGOA 5KW9H 1PAMA 4H5SB 5EUOB 3U83A 2P5EA 1HH9B 3HCVA 4M02A 5I74B 1H3XA 5C0CA 3MCKB 4ZUUA 2BRQA 2EE2A 3LSOA 5IBTH 4OIIL 3E6FB 1CCZA 1P4IL 4LF3A 1A3RH 3GJFH 3ECBB 3VGBA 3MOAH 4TNVF 5DJCA 1YEHH 5DMIH 3TNMB 4PRAA 4UT6L 3VJ6A 4JVPA 2X89D 5JW5A 5DQJA 4I3RL 1OT1A 4PUBL 2NY4C 4HHAA 1KXTB 4ETQA 3PNWB 4KK6C 3VXMD 4NPYB 1JPSL 2YHGA 1RUPH 3B9VA 5C0BA 5MI0C 2YPLD 5D1XA 4OJFL 3LAFA 2PXYC 4NKQB 5E5RB 1ADQL 5IVXA 4IRSD 2H1PL 2W9DH 1EEYA 2Z91A 4GS7B 2WP3T 2IAMB 3C6SB 1EUUA 4PG9A 2GITA 4XNMA 4ESKA 1P1ZA 5DA4A 2EC9T 4Q9RH 1OAZH 4ZNCD 2LE9A 3BP7B 5LGJB 1CFNA 2NCMA 2A9MH 1G7QB 2EE6A 4NRYA 3PDOA 2ZSWB 3HRZB 1KBGH 4M6AA 4Y88A 4AT6A 2FX8L 4HDIA 2R0LH 2DKSA 1U6AH 5KS9E 3ZL4H 3LKSA 4NUGL 4Y5YC 3S3JA 3AU1A 3QQNA 4XTRC 1YYLL 5K9KB 3TO4B 2Y4SA 2EIZB 4CDGC 4CGTA 2APXA 4WDIA 1ZEAH 4MA1C 1NANI 3VD5A 5E2TL 4OFYA 1QSFA 2C7UA 2R1YB 3T2QA 1ADQH 3ULSB 2XFXA 4QHNB 5EZJA 4NOFA 3MLZH 4OF5A 2UVEA 1ETZA 5ANME 1AQKL 4HUXB 4YHYC 5A2LH 1VEPA 3DURA 3C60B 4XCNA 1X4ZA 5HYJB 2PW1A 1RJZA 2ESVE 1F00I 3QFJA 1LD9B 1LO4L 4EN3A 2D2OA 1EFXB 4MXWH 3QDJE 4XP5H 4AMKH 2R2BA 3QH3B 1V3KA 4IOSD 3TJHD 1X5XA 1MHHB 5I15L 4ZUSB 5HTSA 2D7NA 2RFXB 3L6FA 4MCYA 1FAIL 1XT5A 2YD3A 3RNQB 2VL5B 4HV8B 4KZEL 1A1NB 2YA0A 3NVQA 1AGFB 5MI0B 3NCYS 2XXMB 4X6DA 1YEEH 2CIKB 1FVEA 3PGCB 4I0PA 1NC4A 2NY3D 1YMME 2ORBH 1MFEH 4L4VE 1E0OB 4HF5L 4LHUA 3V7AG 1W72L 4UDUA 3U9UB 5H37G 4OLXL 4PGDA 3WNKA 2JJTA 3HHRB 3IDMA 5F93C 3DXAE 3G08A 3V6BR 4LIQL 1JGVH 1LQSR 1NGYA 4OQ1A 1MI5B 1EO8H 5A2IH 4Z8FH 3P9MB 4YQXH 4NN7B 3N85L 2UWEE 1HDMB 2FD6L 4L4VB 1LEKA 5HHNA 3ZDYE 5GRUH 5ERWB 1KEGH 2IFFL 1CDBA 4K55A 1FNEA 3T0AA 4PGJA 3S3SA 1KELH 4HHAB 2X2YA 4MVBD 4KDTA 2YPKB 4QTHB 1NMBH 3GKWL 4CUCA 5E6ID 3PDDA 5I1AB 1QA9A 2FB4L 3KPQA 2ZUYA 3VXME 5IJVB 1MQKH 5EUKA 4FQHA 5FKAB 5EB9A 1J5OL 3C6SA 5DJYB 3W9EB 1JHTA 5J6GB 3OXRB 4PTUA 3S37X 3QDJB 5L8JB 3SE8H 3HI6L 2YZ1A 4Z5RB 5ID0B 2OR7A 3UJJL 1E6JH 1IGCL 4O4YH 4M3KB 3C09C 5DVLA 5CJXA 1KNOB 4KRPB 3MV9D 1CICA 1JWSB 1U8LA 5EO0B 2NXYD 1F42A 3RVVC 1WUNT 4Y16A 1EA9C 5TPWL 4XHQA 3GSVA 3ULUE 2VDMH 1CDYA 4R3SB 1QBML 3TCLA 2Z92B 4WO4A 3VWKD 1VEOA 3MNZB 4ZQKA 1N2RB 3CFDB 2DMCA 4DTGH 1RK1A 3PHSA 2XG5A 4APQC 4KRNA 3BPLB 3HZYA 3MCLH 2IPTH 4MNHB 4NQCB 5FYJE 1CLCA 1ZWIB 4MJ6A 2MPAH 4ZUWA 5IBUB 5KSUA 1NLBH 2GKIA 1AHWB 3KPNA 4X7TB 4UNUA 3IFPB 1U36A 2DL2A 4CVXA 4ACPA 2APTA 5DD3H 4KJPD 2J1KA 3B9AA 5I16B 3K74B 3CUPA 5KG9A 3PABA 5C0RH 4I3SL 3U7AA 2OTPA 4OF0A 3RWIA 5IEHB 3RZWA 4OD3H 4E42B 3TN0B 3G6JB 5IFJA 2XTJE 4N0YH 4Y4HD 3NA9L 2A9NL 3D0VB 5CJQH 1I1RA 2P5EE 4P4RA 2CLZA 2CK0L 2Q86B 3RZCA 3P3YA 3G5XA 3H8NA 4LLQB 4CBPA 1C5CL 3WFBL 3O45B 4OGXH 4M4PA 5I1JH 3OX8B 1QFWM 5EZOL 3U46B 2VABB 1P7QD 5DJDA 2UUDH 4U3HA 1X5AA 1T0NB 3ULVH 2R0KL 4JRXB 1T03L 1DDHB 1W0WA 2EO9A 1GCFA 1R3HB 1FG2A 4U0RC 2A83A 1FCGA 1WIUA 3BDXA 3RWHA 5HI5C 2ATPB 3ORJA 1ZAGA 1IBGL 3HNVH 5CLTA 1EHAA 3EYFA 4I0PB 1FHGA 4NKMA 5JQHC 4C4KO 5EUOE 1MLCA 2VSDA 3UTSD 2X4UB 2Z35A 3DYOA 4K7PL 3D25B 4JFDE 4P3CL 3UTZB 1U41A 3LKOA 5K9JL 1CDHA 1U93B 1QPPA 3OG4B 3IFLL 4QF1B 1JHTB 5J6GA 3VRLE 1PQZA 4M93B 3TBYA 2NR6D 3DX7A 3SDDD 2X4NB 1H5BA 5DA0B 1G7HA 5SWQA 1KT2B 2F5BH 5CJOH 2HA1A 4TPRL 4LSSL 4P5MB 3MBXH 1F8TL 1J8HB 4Y2DD 4HUKB 3OAYH 3GSRA 1CXIA 3HAEG 2C4FT 2Z93B 3UAJD 5IHZA 2DM4A 1FVDB 3RFZC 3O6LH 4R7DB 1WBXB 1RUMH 3P4NB 4M62L 1HEZB 3UTTE 1Q1JH 2W0FB 2M2DA 3RU8L 5ID0A 5JR1L 1H8OA 5JIKA 3DGGB 4KRPC 1ND0B 3RTQB 1DE4A 3MRPB 2JJSA 5DC0A 1YN7B 3ULUL 1OGAD 5INCB 5BV7C 1IEBA 1WZKA 2MHAB 4N90D 5DO2C 3FB6B 1DBBH 2HLFC 4XNQB 4ODXA 3PXJA 4HKXA 3LQAC 5KZCB 2YWZA 3LN4A 3RX8A 1WAAF 4PJ8B 1YMMD 1U8NB 5IEKB 3PDOB 4MLIA 3BWAB 2W65A 1HHIB 5DVMA 1UJ3B 3IDYC 4JQIL 4U1IB 1DL7H 2F15A 1A47A 2ZP0T 4XRCA 1J10A 1EFQA 4JFEE 3EDJA 5ISZB 4NZRL 3CMOL 5HI4C 2JJWA 3MV7B 1RK1B 2AP2A 4F3FB 1U3HC 5LCVL 3JWOC 5E2JA 4BQBA 4WWKC 4XH2B 4CVZA 2CDGB 5IQ9B 1JV5B 1RUQH 3C8HA 2PTUA 2A9NH 5J56B 1AKJB 4NN7C 3QPXL 4R26H 3GSOA 4KI1A 4WGWB 5FYLL 3SCMD 2EE3A 5EU5A 3IVKB 1IGJB 2VDPH 4M48H 1XFPA 1A9EA 3OMZA 1QRNA 4O2EA 4F7TA 5D70H 1AGBA 1RVFL 4XCEA 5B39B 1NFDF 3BKJL 2R0KH 2FJGB 4CW1A 4I0KA 4R4BA 1Q9LA 4HUWA 3CSYB 2GEEA 2G2RB 1GZPA 2H26A 3TWCH 3VFRB 3BRFA 1YECH 2AW2A 1IM3B 2EO1A 2D03H 1RURH 1CGVA 1FFRA 1KF9B 4FQJL 4GRMA 2YD5A 2ZUUA 2JB6A 4PREA 1QSEE 2CKNA 4DVBA 4IRJB 1HKLH 1AXTL 1D9KB 2ICES 3L3GB 3HE6C 1RZJC 3G5ZB 1CD1B 1C8PA 3CVHA 3WFCL 5B3JE 1QHPA 3GMOA 1EEUA 4F33A 2CRMA 1TVBB 5CBAB 1U8PB 1J8HA 1NGZA 4NHCH 4NKIH 3MLSH 3OKKB 3WJLC 2VOTA 5BXFB 1PW3A 3CX2A 4I2XE 4ZSOB 3EDDA 1CDGA 3DX7B 4TULL 5HGAB 1ZHKB 4LKCB 4NIKB 3WXWH 3FRPA 4X99B 1OP5H 3IJYB 3TWCL 3WFZA 1LK3H 3MA7A 1JFQL 1FORL 4PJ5A 1A2YA 1F58L 3NZ8B 2EXYD 5TJWK 3B2VH 2VYRE 3BPNC 2JCCE 1NCTA 2VDPL 1SEQL 1UQSB 5E9DE 1W72H 1LO3H 2J8UF 1QSVA 1F2XK 1JPGB 4X6CF 1IC7L 4XVSH 4YXLL 4RA3A 4LCWB 5EU3B 4KKLD 1OF2B 2PCPA 3B9EA 4LBEA 5FGCE 1BZ9B 3SOBH 1EJOL 4NQDD 5IR1A 2HTKD 2GTZA 3SN6N 2X42A 4OCRL 2R69L 3RX5A 4ALAL 1BLNA 1GAFL 1FVCB 1G9MC 3VFOB 1R5VB 3FQUA 4KXZH 2DYPD 2MSPA 4NZRH 1HSBA 5JOPE 3L1OH 1A14L 3BE1H 3MBEA 4L4TA 1SJEA 3FZUC 1MQKL 4MJIE 1AKJA 3MLUL 4TSAH 2IH3A 3VGFA 4AEIH 1D5MA 2LVCA 4LHQB 5I1HH 3LV3A 1UADC 2DLFL 1NEZB 2IANA 2GJ6E 4YIQA 3T8XA 3RVTC 3SE9H 2YD1A 4I4WA 5CKAA 2I60H 3MGOB 3O6KL 5FUCE 3UTSE 1IM9A 5FYLH 1IGYA 4GG6B 4N8VA 4UBDD 1KB9J 3O6FC 2EDFA 1AGEA 1Q9OA 3C60D 1QNZL 1LP9F 1AY1H 4X8JA 3CFEB 3FQRB 3I9GH 2YRZA 2OL3A 5GGUB 3SDAA 5J3HC 1RUPL 1H8NA 1CF8L 3MLYH 1FNAA 2Q87A 4G9FD 4NHUB 1YQVH 1I9EA 2C3WA 4P0DA 3U2SB 5I16A 4NJAL 4P4KC 5I1EL 2HYMA 3WJJA 1VPOL 3NMEA 4IOIA 4XNZB 4JAMA 3TO4D 2EEAA 2BSSA 3PQYE 1RAMA 1Q9KA 5ADOL 1L4IA 3EO1A 4NO0B 4YUEL 3S88L 3HCVB 3WS3B 3CDGA 2I07A 4LQ1A 4PJGB 1G1CA 5C0CB 1ZTXL 4GRLA 1Q72H 5J11B 2G2RA 4YO0B 4LLWA 2NY1B 5D1XD 4JN1L 4PG9B 5FGBA 2HT3C 1VGKB 4XWOC 4UDTA 2QSCL 2F5AH 2H1PH 3ZL4L 1U91B 3U0WH 3BGFB 1BEYL 3RTQC 2KQNA 4X99A 3TNMA 4U1SA 3VJ6B 5CBAA 1RZKH 4OUUB 3I75B 1XR8A 4WIQA 3NBNA 3RGVA 4U3XA 4O2FB 3CLFH 2NY3C 4IRSB 4ONHB 1KB5L 3GMQA 1JNHB 3L3IB 5D7KE 2A77H 5F7YC 1MIEH 4MQSB 5T1KA 2FLBT 2LAAA 1LP9E 4RAHA 5GGVH 4HUNB 3DRQB 5HJ3A 3F7VB 4FQ1H 2VDOL 4Z7OF 3ILQC 4H5SA 5EUOA 3D2UA 1QNZH 1P4IH 1ZA6A 3SDCC 5AG8A 43C9B 1MCQA 4K9EC 4U6XA 5HGGS 4WTWA 4YHPB 3QXUA 3I6LE 1T22A 4RNRB 1MHEA 3B9KB 3W0WE 1CG9A 1UQSA 2BNRE 3FQTB 5MERA 3SGJC 3CLEL 4NT6B 1BQLL 3CCHB 3VFGH 3R4DA 3FO2B 3PE9A 3KPLA 5E1HB 5HHPB 3GDBA 1PBYA 2A0LC 4YHKL 3BPOC 4RDQG 4P2OA 3ZKMD 3LZFL 1A0QH 2F74B 4QOKA 3E6HA 2NW2A 3QEQE 5DD5H 3BOVA 1I3RB 4YUEH 3S88H 4ZOAA 3RWDB 2P8MA 5D7SL 4NNXA 5T3ZE 2AJXL 1DE4B 4Y4KC 1PLGL 1BIIA 2J2ZA 1JRHI 2YSSB 1JIBA 3MREB 2P44B 4NNPH 4EI5C 4HG4J 2IGFH 2LU3A 3TBTA 2ITDA 5MENB 1UYWH 1FVEB 3PGCA 2VZSA 3SE3C 3MRGB 1RZ7L 4HKXB 4P2RA 1OAXH 4YBQC 5KVFH 4ZFOA 4HIJB 4GG6A 1U8NA 5IEKA 1EMTH 2XKNB 3AB0C 1SMAA 2OXGA 4U1IA 4EQ2A 5HYFA 4Y2OA 4K3JL 2BSSB 2UV3A 2PUQT 2FX9L 3A6CH 3BN9D 1G6VK 3VMOA 2DQUL 2HG5B 4QXWA 4MQTB 4LU5H 5EOCL 4QWWD 1T7VA 4IRSC 5IB1B 5I8CB 4Q6IC 4MDIA 1IEAA 4ZAKC 5KVDL 4PJDF 4JFOB 3DECA 1RUAH 1JN6B 3CH8A 2GK0B 1K3IA 1YPZE 5EO9A 1F3RB 4AM0A 3DURB 4RAVA 3UBXG 4QKXB 5FEBA 4JO4L 1JNNH 5D7LE 5D2NE 5J11C 2JK5B 4UU9A 3B2UD 2XTLA 3WXVL 1WICA 2D7QA 4PTUB 1TJGH 2NR6C 4HGKC 3VWKA 2XKSA 5D7LB 5C3LD 2FBJH 4HPOH 2VJXA 2KPNA 3S37L 3LB6C 4FXKB 3VH8B 5IHUH 4AIZA 3X3GL 4LP4A 5SWZD 1FIGH 1TZIA 2VUOA 2X09A 3T3PE 2HFGH 1MIML 1N0LA 2VXUH 1XIWC 4OLXH 3TESA 1KCVH 3QIBB 4P4KD 3QUZA 1NGPL 3MJ9H 3H3BC 4XMPL 5JO5B 3CK0H 1I9JH 5KVEH 1J1PL 1OP5K 3NFNB 4XPHL 5CJBA 5J3HD 3RP1A 1I9IH 1AD0A 3MJ7A 3QUZD 2BOCB 4YHPA 3QHFL 3OB0H 1IAOB 4NQCA 5MEQB 3UP1A 5T3XD 2YZ8A 3NCBB 1WC7A 2C3VA 4MS8C 3L5XH 1X7QB 5H35A 2DD8L 3D3VA 2J12B 1N59B 1NJ9B 2PW2A 3HZVB 3KLDA 3RVTD 3GMPB 2HJLB 4I18C 5MEND 4C58B 1F4AA 4JFHE 1T1XA 3BQUD 4S1DD 4PP1C 1OWWA 3UTOA 3PL6C 4NDMA 4P2OB 2Y07L 3TCLB 4NNYB 1O5DT 2R56L 5D1QA 4PV9B 5T3ZL 3MROB 3VXQB 2IANE 4HW6A 4OF7A 4OLZL 2HT4D 2WUBH 4WO4D 1IAIL 4F37F 4W68A 5F88B 1HYSC 5INDA 3HLAB 1E6JL 5I0ZA 1IGFH 2Q7YB 2XKNA 1JGLH 3GMRA 4ZO6A 5CEZE 2R2EA 3VI4F 4R4FH 5IUSA 2FIRT 3DV4B 1UC6A 3VFSB 4P2RD 5CEXA 1MCBA 1H3UA 4QRUA 4KTEH 3FMGH 3VD7A 3GSWA 3RWIB 2NY0B 2NNAB 4GG8A 1A7RH 3AUVA 4U6VL 1I8IB 5D96B 3TVMA 2D9CA 4HMDA 3FAWA 2EDJA 5C0EB 1BFSA 4KK8C 4RMUA