2OMBA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(1)21 crystal form
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ombA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ombA02
1FGNL 3DVNA 4KTEH 4B53A 5T5FL 1A7PL 5IQ7H 1IQWL 1CFSA 2JJSC 3G9AB 3U4BH 1X6NA 4F58H 2WIIB 4WWKB 2AAVA 3LQAC 3RVTD 1T5WB 2BJML 3U1SH 3VXNB 4BK5A 1UM6H 1F5WA 3GK8L 4YXKH 1GOHA 1FO0B 4UINH 4XNQA 1M7DA 4ZFOL 5HVFB 3KPTA 1FG2B 1MLCB 5D5ME 2DQFA 3CVIL 3B9VA 3UTSD 1J05B 3T8XA 3X13A 4NFCA 1H3PH 4OAWB 5H2BA 1A22B 4L9LA 4HKXB 4LNRB 8FABA 3HI5L 4XP4H 1U95B 3ULVD 1FNLA 3MCLH 4UDTA 4DW2H 3WJLC 4JPKH 4MJ6A 3B8SA 4YH6A 2ARJA 3U7YH 3RY5A 1EHAA 4KQ4H 1P7HL 3O6KH 4L9LC 5DJ0B 4FQ1H 2Q1EA 3WN5A 5CHNB 3MBED 5ETUA 4J6RH 3BJLA 1AKJB 1R3JB 5A2JH 4XC1L 5I6XC 2BRQA 1QFPA 3IDGA 1JFQL 5DR5H 1HHHA 5HYFA 1GIGL 2B1AL 3DVGA 2D7OA 2W9DH 3OZ9H 1PY9A 3WLWD 4KXZH 3IAGC 2N1KA 1FL5A 1UZ6E 2D31A 2FZ3A 2Q3ZA 2C3WA 3MRIA 3WN5C 4NO2B 1YPZB 4CL7A 4I8DA 3MV7A 4JFDA 1FAIL 4NC1C 2LV4A 1KENL 4PJHA 4CN6A 5JNYA 5DFVC 2QV2A 1RK0B 5IB3A 3ARSA 1KB5H 3KPSA 4R3SA 2UYLB 4OGXL 1F4XL 2XKNA 2VZTA 2YD6A 1CCZA 1YEJL 3ZDYE 1U8NB 2AK4D 1MQKH 3O2WL 5D7JD 3HC0B 1JWUB 5EO1B 2Q76A 3HE6A 1J11A 4DQOH 1NQBA 3MLYL 1AR2A 1CL7L 4WCYL 1C5BL 3Q5TA 2XG4A 5DA4A 4XP9H 3ZHKA 5ELIA 1OP5H 3UC0L 4OLYL 3FT4B 4KUZH 5CKGA 3FB8B 3HE6C 2FL5B 1N6UA 5IB5A 5F96H 2OL3L 2J2ZA 5KSAD 4HKBA 3HPLA 1OSPH 3MCKA 4UNUA 1PLGH 3BH9B 2DQUH 1CWVA 3EHBD 4MD5A 3HUJF 2C3VB 4CGTA 3K2MC 4YBLC 2AJ3B 2XNAA 2CR6A 2YZ8A 1NGWA 5E4EB 1XGYL 1YYLL 4JFZL 4E41A 1SY6H 3LRHA 4FTVB 2M1KA 4BFBD 3DO7B 3MV9D 2NXYC 3CXHK 5C0CA 2AJSH 2YXFA 5GZOD 1D5ZB 3KPLB 4P2RE 5I1IH 5FUZH 5KTEH 1PVHA 1YEKH 1H3WM 3OG6B 4HLZG 4LOUD 5EU4A 5ICXB 5J11C 4KRPD 5JPNB 1P5UA 3NA9L 1U36A 1JTTA 3X12B 1M6OB 1MVUB 2HFGH 3BDYL 2H32B 3MACH 4Y4FD 5FGSA 5F7KC 4Y5YB 1MREH 4YE4L 5GRZA 3FT2A 3U4EB 1QRNA 2RB8A 4I48B 2N56A 1MIEL 2W92A 5D1ZA 1N5YH 3MFGB 5DRXB 2YKLL 4POYA 5CIPH 2NY4B 4HS8H 1AHWC 2X70B 3QA3B 1EZVY 4BJLA 1P84K 1JNJA 1CU4L 4YXLH 2EKSA 3TNMB 1N0LA 4KVCH 4Y4FB 5F1IB 5DUPL 1JK8A 5D1ZC 3EOAB 2IFFL 3MOQA 4ZS6C 2A77H 2F19L 3H8NA 4NUGL 3RNKA 3WDIA 4I3RL 2H1PL 4Y1AD 4Y2DA 3UYOD 5J1SC 3H9ZA 4M9OA 2NYYC 3MLVL 1DLFL 2H9GA 4JFFD 4NNPH 4NN7C 1C16A 2HT4D 4KKAC 1UXSB 2G60H 3ZTJG 5JZ7C 3FQWB 3SE4A 3UYPA 5DC0A 1IVLA 1RZJL 4M61A 4MQXD 1LDPH 4G42A 1G0XA 4Y2DC 1P7KA 4K3DH 5DD1H 4ZFFB 2VLJA 2X09A 3QR2A 1NFDE 4QKXB 4MDJA 3QG6A 1MFAH 1N5AA 1FE8H 3S3SA 1LP9B 1MPAH 2MPAH 2YPKA 3SE4C 5HDOA 5EWIH 3X3FL 3NCFB 1OGTB 4ZG1A 1ZTXH 4OZIE 5D8JL 5IW3A 4NO5B 1ACZA 1U8HB 2WUCL 1U91B 4UT7H 1G1YA 3BO8A 3GZKA 2DKUA 1JN6B 3MLRL 5D96C 1TQCB 1U8MB 3K8LA 1BECA 2C4FU 5KVEH 3L7EA 3HZVA 4MD0B 4U7KA 5L0QC 1QBBA 2IQAB 4G6ML 1G6VK 3OJVC 2IPKA 1NGYA 1S9WB 5CIPB 1TZHA 1OD9A 1A7OH 5HI3C 3CFCH 5IEKB 1KN4H 3GMMA 3EFFA 4PV8A 5HSFA 1NUGA 4O2CA 1OPGH 4Q9RL 4HWEL 4OF7A 2OJEA 1FNHA 4C83B 2W0LA 1MAMH 2JIXA 3D2UA 4E42A 1DJSA 1U58A 2I07A 3QEQD 4NP4H 4MA1B 1F6LL 3PJSB 1FVEB 3MRRA 3Q5OA 1NC4D 4PJBB 1BVZA 2EXWC 1ZLVH 3SO3C 1WJ3A 5JLZB 4ZUVA 1A4JA 4PRPB 3RA7L 3T3ME 4Y4HD 1B88A 2CLVA 2KDGA 3U79A 5IR1B 1GGCL 5CBEB 2BDNH 1WAAE 3EYQD 5I30L 4PRHB 2XRAH 1NCUA 4HK3N 2BNUA 1SYSA 1DE4B 2BRRH 5IIEA 3MRBA 3ZHDA 4M93B 4B50A 4YPGA 4FG6C 5FYKL 4B7IA 3JUYA 2FX9H 4EDWH 4EQ2A 5TQ2H 2SEBA 4Y4HB 2PO6A 4OCYL 2VDPH 4RX4D 4P5MB 3LIZH 2ZUSA 2N7BA 4HBCL 1LWRA 4L4VA 3KPOA 1DZBA 1P1ZA 3T09A 5L2JA 4H1LA 4M4RA 3EYSL 5SX4H 4LSQH 4D9LH 3O2DL 3QFJD 4O5LL 4N0UE 3SKUD 4CU6A 4F9PA 1UT9A 1AR1D 5HYSG 4PLNC 2PO6C 4MA8H 3ZKND 1MCWM 4PJIB 3RWIA 2YXMA 4LL9A 3PE9A 3I9GH 2YSSB 3N0PB 4XNZB 2VKXA 5DDHB 1NKRA 1JPGB 4F9PC 2YC1A 3LKPA 1FNSL 3HC3L 4WV1B 4YX2H 3HHRB 4ZTOH 4H88H 3TO2B 1RJLB 2CMRH 2X4NB 5HGGS 3NTCL 2DJUA 4MNQB 5D1QA 1ZHKB 4BKLB 3KHOA 3P11H 3WHXB 2D0HA 5SWZA 5DD0H 5HHQB 1K2DB 4F57H 4NQCE 3T0EB 4X7TA 3G9VA 2ZSWA 3IU3B 5IMLA 3MTRA 4HCRL 1MEXL 5D1QC 3I50L 5E8EA 3VFMA 4PGJA 2GTZA 2EDOA 3PWVB 1BFVL 3L3JA 3MNWB 4R4FH 1EEYB 2OMNA 3I84A 2YD9A 3S4SB 5HHNB 5D2NA 3TBSB 1HDMB 4HS6B 5DT1L 3BGMA 4MNGA 4RMWA 3KLHC 1T7ZA 3RX5A 3OKKA 4Y16B 5GZNC 4PJ5B 2XA8H 2UZXB 5JW4N 1ZE3C 4PJ8A 3Q6FB 1FN4B 4M4PA 5D2NC 4AEIH 1Q0YH 1VFMA 4L4TA 1CVSC 4LCUA 1MQ8A 2X1XR 3EDFA 3O4LB 2UWEA 3GUTB 1ZT4B 3DX7A 3OAZK 1KXVC 4PJ8C 1T22B 5HGAB 1B0WA 2EDDA 5F7EL 4UI2A 4KY1L 2ADIB 4JDTH 2R8SH 3DGGB 5JHLL 1X4XA 1HK6A 1TNMA 5EU5A 3P0YL 2BY0A 1BQLL 2GITA 2GT9A 5F8RC 4LVHC 5DD6A 3H7BB 3H3KA 5CJOH 1JWSB 5C08E 1RI8A 1YY8B 2I9LB 1YEIH 3G6JF 3PDDA 1F90H 2X7LB 5E9DD 2VSCA 3MA9H 4JKPH 4I77H 2PTTB 4J12A 4QXGH 5EZLA 1QLEH 1RZ7L 4TVPE 2AXFB 3MODL 4HZLB 4X6DB 3AAZA 1NLDL 5TF1L 2RIKA 5C2BL 1FNEA 5HVGB 1XCTB 2IH1A 4G9FA 2IANA 4NZRL 3UTZA 4NRXA 1OAUL 4KTEL 1LNUA 1NGQH 2IF7A 5IQ7L 3H9HA 4JFOA 4JKMA 4C57C 3U4BL 2GAZA 3RFZC 1GGBH 4F58L 1RULL 3L3DB 3DUUA 4MJIA 1XF2B 1XGTA 3L9RB 5IVXB 3U1SL 3TIDB 4ZUWA 2OI9C 1UM6L 4YXKL 1H15B 2V2WB 2DTMH 2AV1B 4PY7B 3MV01 4DVBA 1R5IA 1A0QH 3IDIA 4HK0B 5FUOH 4OKVB 4JREB 4LP4A 3L3KA 5DJDB 4D8PA 2XWBA 4NQTA 2GJ6A 1H3PL 3DX8B 1JCKA 4HWBH 1A5FH 3QAZC 3EW3B 1HI6A 4XP4L 3MCLL 3PQYD 4DW2L 1ZHLB 5I16B 2R1YA 3MRPA 4JPKL 3U7YL 4Z76B 5J12B 1TLKA 1N6QH 5BXFA 4PJDE 1A1NA 4KQ4L 2VLRA 5HI4D 3O6KL 3WD5H 4FQ1L 3KPNB 2NPLX 2A9NL 5D93C 1HILB 2Y5TB 4K71B 4J6RL 3RVWC 1I1FA 4F7CB 2P47B 2Y7QA 3EGSA 2YN3A 1G9MH 4WTZG 3ULVF 4AH2A 5DR5L 2A1WH 4PFEA 2W9DL 3OZ9L 2FLRT 3PWJA 4HIEA 2BVUA 4U1JA 3ZKSD 2HFTA 4YIQB 1BM3H 4FZ8H 3FQRA 5CJ5A 2F9BT 3VWJA 4OIIH 2Z0BA 2UUDH 5F1NB 4DCQA 2VTFA 1I3RA 3VXUE 1UJTA 4ERSH 4KI1A 5JIHA 2NW2B 3MLUH 5MEPA 1KB5L 5EULV 3QEHB 4K8RC 2WNGA 3BX7C 3CH8A 3TBVB 1ITCA 1MOEA 5FKAA 2R9HD 2GIYA 1LO0H 4AENA 4X6FA 1BBJA 4OCLC 5EU6A 1MLBA 3VXME 4CDGC 3VWJC 2QKIA 1X5GA 4QRQA 2EIDA 1YJDL 4LGSB 3HZKB 1ZVYA 5DC9B 1MQKL 3OPZH 4JPIA 2I25N 2FLBT 3VXOB 2FR4A 5I75C 2K7QA 4DQOL 1Z0MA 1T7WA 1I7ZB 4Z78B 4X5WA 1CICB 4XP9L 3RL1B 5I1JH 5I71B 2BOCA 5C09B 2LTQC 3LKOA 2HVJB 2CDGA 2OTWB 3NIDE 2F53E 5F96L 3KPRD 1OM3H 3DRTA 3VFNA 1OSPL 1PLGL 2DQUL 1FQ9C 5LAXB 3ZE1F 2X89A 3IDYC 3MFFA 4G3YH 3O6LH 1MFCL 3PDGA 4FFVC 2R1WA 1S7TA 3J7HA 2ZCLH 3TFKC 3MRHA 1SY6L 3QUZD 3KPRB 4M43H 1U8IB 4PY8I 1NGXA 1WFNA 2AJSL 1JV5A 2XPGB 3F6LA 5I1IL 4TVPD 1F3DJ 5FUZL 3QEUA 5KTEL 1YEKL 4EXKA 2PNDA 4PTUB 4XB7A 5I1DA 1BJMA 2P8PB 4ETQA 3RY6A 5IVNA 3BPLB 2ERJB 4OCRH 2CLRA 4JRXB 3W9DA 2HFGL 3MACL 3BP5A 1L6ZA 2ZJSH 5DMGC 2DYPB 3PWPD 4Y7MA 1CXIA 3MRKA 3VGFA 1MHCA 1N5YL 1CT8A 3QDJE 2GKIA 3RY6C 1CD1A 3CVHH 3VI4E 3H9SA 4HS8L 2NY5H 2D7NA 5KSBF 4PBXA 3C5ZA 2YMXH 4YXLL 2JB6B 1DQMH 1TTGA 4KVCL 1RJYA 4Z7UA 3S5LA 1OGAB 4GT7A 5A16B 3PWPB 5DSCA 4I3GA 5SV4A 2OZ4A 1OWRM 3TPUB 7CGTA 4UT9H 2A77L 1K85A 1WZMA 4GG6A 4KRNA 3C5JA 5KS9B 5TH2B 4QOKE 5D4QA 3FQXA 5D5MF 4NNPL 1A6TA 1UH3A 4WUUD 5SX4I 1CBVH 1YNKH 2Z8RA 4UQ3A 4NHUA 4E0RB 1Z9SA 1CDGA 1LDPL 4K3DL 5DD1L 2EH7H 2NZIA 2Z8SA 1U3YA 2NY0D 4Q58C 1AO7E 3N85H 1X5IA 2MQ0A 3TT1H 4F37F 4PJ9B 43CAB 1MFAL 4BUHA 1FE8L 3NGBC 2HP4A 4UBDD 1MPAL 4TUJA 5D1XD 1FC2D 1J1OH 5EWIL 1F00I 4LAQH 1QO3B 1ZTXL 4JQXA 4P2QB 5E8OA 3K80A 3U46B 4J2XA 1G7HB 4U1HB 3VXUD 5HI5C 5TE7H 1KIRA 4UT7L 2NY0B 1IGJB 4DZ8B 4OUUA 4IIQA 4JQXC 2B1HH 3RWHA 2FHFA 1ZK9A 2R2BB 3QI9A 5KVEL 5I1HH 1EEUA 1MJJA 3WNOA 4LLMB 4P3DA 1TETH 5AUMB 2ESVB 4JM2A 3V0VA 4X6BA 1NDGB 4M7ZC 2EDNA 1T21B 1A7OL 3CFCL 3O3AA 4OD3H 5JHDB 4IIQC 5DEFA 5ACMA 1OCWH 1OPGL 1UXWB 3QI9C 2JJWA 1KIPA 4JCLA 1MAML 4HIHA 3DPBA 1D6EB 3ULUE 3SDCB 4EUPG 4JM2C 4NP4L 1W8OA 1KJMA 3QUXD 3OAZH 5E8PA 4MB3A 1KIQB 4OCSH 4EDXB 3QBTB 1WF5A 3CSGA 4P0DA 4HIIA 3DX9A 1QHPA 3KYOA 4HWZB 3O3UN 1HXMA 3CDGB 3D39A 5L8JB 1CDJA 3SY0A 1IBGH 2ZG1A 2MFNA 3JV4A 4J23A 2BDNL 1MHHB 1ZLSH 4OGAD 4HFUH 2AJZB 2QADD 3IAQA 5BO1H 2BRRL 3ILQC 3EYUH 3R8BB 2Z93A 5E00B 3HG1E 2FX9L 4EDWL 4GO6B 2WBJD 4YFLI 1NGZA 5TQ2L 2LQRA 2VDPL 4A2MA 3EIFA 2I60H 3T1FA 3LIZL 4CVUA 1A64A 1DQDL 3IFLH 1IEAA 5J6HA 4QRRE 4L8SB 2JJTA 4D94A 4OFIA 4KKBD 4LSQL 4D9LL 3D85A 2H26A 1WCBA 4UNVA 4ODBD 5HJ3A 5I74B 3QIUB 4JKKA 3CXDH 3EOBB 4UOW0 4UQ2A 3PWNA 2L7UA 4ZTPH 4TRPH 2JJTC 2DQGH 4TTDD 3L6FA 3RIFF 5A43C 2FIKB 4MSWB 3GMNA 1IEBB 5C07E 4G6JH 4YX2L 4OZGE 5C6TH 5D2LB 1QG3A 4ZFOA 4H88L 4ZTOL 1ED3A 2PYED 4PLKC 2CMRL 2Y6SC 1RV6X 1CFTA 3P11L 4RAUB 5DJCA 2OJZH 4D9RE 1RIHH 3T4AA 5I8EB 4NRZA 4GQ9H 5I76A 5DD0L 3DTXB 1IGYB 4RA3A 4F57L 1OHQA 4QRSA 3QNXA 5D71H 1KEMH 2VLME 3IXAA 4V2BA 3STBA 4MJ4A 2BMKB 4J3XA 2HT3D 3DROB 3FMGH 5IEHA 3MRCA 3OGCA 2OQJA 2CO6B 4KGJA 5IBLD 4L29A 2XN9D 4UT6H 2YOCA 4R4FL 3H0TA 1J18A 3OX8B 5I1CH 4DUXA 5L2KE 5MEOB 1Q9OB 3V52H 1MI5E 4OFYA 1E6OH 2IADA 3RY4A 1ZGLA 4IBLT 1U8LB 2XA8L 3I6KB 2R4SH 3AY4A 2X42A 4N1EA 2EYRA 4U0RB 4GKZB 4AEIL 2A38A 2FJHA 3R0MA 1Q0YL 4L1DA 5DTFA 1NFKA 2V7NA 3KR3H 3TT3H 4NUJB 1GH7A 1KGCE 4HBQA 5B39G 3HC4H 1JZ7A 4P4RA 1SJEA 4U6XB 3AY4C 3LH2H 5AYUH 1G7MB 3P0VH 3ARWA 5SWSD 1R5WB 1CTNA 1RD6A 4LCWB 3LPFA 3LEYL 4RISH 3MUHL 5JIKA 3ARXA 4JDTL 4NCC2 2R8SL 3EO0B 4P4KD 4NNXB 5KVFH 5JXED 4KJWD 2BXYA 2X4QB 1RZKH 5LGJA 3TJEH 5BCAA 3T65A 3ZE0E 1CLYH 4JFQA 1NBYB 2VZOA 1GGUA 2VLKA 2D9QB 4Y4KB 5CJOL 2HLFC 3QWQB 3HMWH 5L88H 2GSGB 1F90L 5IJKA 3MA9L 4JKPL 4I77L 4QXGL 4G8IB 3VRIB 1JPST 1QSZA 2OL3A 1DUZA 5HDQH 3TN0D 1QLEL 1FIGH 1Z9OA 5KBNC 4R7DB 3AC0A 5DI8B 4GRLD 3TNNA 5IB2A 3OXRA 2UY7A 2HTLD 1U8JB 4M8QB 4CW1B 5JOPE 3CU7A 5TDNA 5IJKC 3VGHA 1NGQL 1CXFA 2VQ1A 4WFFE 1Y0LB 4KWUA 3HI6H 1GGBL 1IZKA 3WE6A 5A2FA 1D5IH 1WAAF 5A2LH 3IDNA 5BS0D 3MRMA 2DTML 2X4UB 1JPTH 4I0PD 1A0QL 3RNQB 5FUOL 4NPYA 3S37X 5HHOA 4WHTA 3P73B 3EAKA 5DK0A 5HYEA 1G9NH 2BVQA 1VHPA 4IRSD 3DSFH 1TZGH 5HHVL 2FJFA 4HWBL 1ZLUK 1A5FL 5FK9B 5DQ9A 5DRZA 2XWTA 1IC4H 4F2MB 4I0PB 4PJAE 1U8KB 4I1NB 2BHUA 2PYFA 3CC5A 3ECBB 3QDAA 4LHUA 3WD5L 2HJFA 5DJ6A 1OAQH 4U1IB 3U7AA 3V5DA 4IRSB 1SHMA 3K1KC 1G9ML 2X44D 2A1WL 4HUKB 1Z6JT 1BD2B 1HYSC 2IGFH 4C56E 2E6QA 3P4NA 2VLMD 4HD9A 3RWDB 2JE8A 1PYWA 5GHWH 4FZ8L 4OIIL 1UVQA 3OWEA 1O7VA 4NC2B 3LKRB 4ERSL 2DJSA 3MLUL 4U1SA 3DV6B 3IKCB 7FABL 4HS3B 4TN9A 5L2KD 1CGXA 3IFPA 4X9GA 3JWOL 3QQ4B 5DFWH 1LO0L 1V3MA 3EDJA 3S34H 2G5BB 3IGAB 3O11B 3EO1B 4GS7C 4S1DD 3WIHH 4NQDD 2NY6B 3OPZL 2CR3A 1RZJC 5I18H 2FGWH 4J3VA 2DWDA 1IKNA 4JY6B 1NCCL 4CN4A 1YMHA 3WXVH 1EAPB 4DKDC 1E4KA 3V5KB 1JNHB 5I1JL 5KVDH 4YC2C 1OF2B 4PJEE 4X5XA 1JPFB 5IK3A 3VXQB 4GOSA 2VUYA 4C54A 1IKNC 1T0MB 3U9PH 1C7TA 1FVCA 4JKWA 1HNFA 4HMEA 4QHKJ 3FONA 1E4KC 2XY2A 1OM3L 1S7SB 2E3VA 5MHSE 3A0OA 5FO7B 2ICCA 3DUSB 4LFHD 1U93A 3RL2A 3LKNA 3B2UD 4I2XB 4JFEE 4ZOAA 1VGKA 4NFBA 5CWSB 1MH5B 3O41A 4IOIB 3RWGB 2ZCLL 4MXQD 5JW3H 4QRTB 1XT5A 3BKYH 4M43L 3LOWA 4UU9A 3W9EA 1QSEA 3RKPA 4MCYB 3FT3B 1NFIA 4X9IA 3W0WE 1QBLH 4APQA 1A3QA 4OCRL 1YN7B 1YY9D 1MRCH 1V05A 3SDDA 4D9QD 3DXAA 2JCCB 2ZJSL 5IGXH 1E28A 5C0JB 5J13C 1EEZA 4BH7A 5IKCA 3CX5K 4APQC 4Q2ZA 2FO4B 3CVHL 3DHJA 4YDLB 5FGCE 1R5VB 2NY5L 1HSBA 1FYHB 5HGBB 5ALBH 3SDDC 4ZAKB 4OBRA 3MV8A 5E94A 2YMXL 1MFNA 1HXYB 4RZCB 1CDIA 2J8UA 4KK6D 1DQML 3BEVB 1LHZA 1QR4A 2APVA 4JPWL 4BSWA 1CD9B 3DBXA 4S0SD 1SEBB 3T08A 3MXVH 5C0AE 3PGFH 4UT9L 3VFUB 2NLJB 5EB9A 4RWHA 3LMJH 4LCCA 4PJGA 5IW1A 2A74B 3FO9B 5BV7B 1IGFH 3O2DA 3BZEA 4X98A 1SJHB 3VXRB 5DWUH 1X5JA 2ZNWA 1CBVL 2AJVH 1YNKL 4KROC 3INUH 4YHPA 1WFTA 5JXAH 4LCCC 2G2RB 4XCNB 4F9LA 2EH7L 4HX1A 4Z0XA 1XH3B 4WY7H 4JFHE 2VH5H 2PXYA 5BRZD 3N85L 1CGUA 2Z35A 2HLAB 1KCVH 3EJJX 3TT1L 2I26N 5ITBH 4BUGA 4P9MH 4OZFH 4PJDF 1J1OL 1C12A 3DETD 1R3HB 2XICA 4LAQL 3DLQR 1WUNT 1TITA 3G6JA 5B39A 4F9LC 2BOBB 4XTRD 1R3IH 1D5XB 3C6LD 2PXYC 1BVKA 4YDJB 3QULA 3UTTE 5TE7L 5GSRB 4HCRA 3ZMRA 3AREB 4TNVF 3QB7C 3I6GA 5IB1A 1FNAA 5ACZA 3QDMD 4ODHH 1JHLL 3BRGC 4XP1H 4XBPB 3X11B 4YPJA 2B1HL 2KQMA 4PPTA 5I1HL 1N3NB 3MRJB 1EVUA 2Y25A 4Y19D 2WIIA 1TETL 4WWKA 4NHCH 4KDWA 5I9QC 1T5WA 3KXFD 3PIQA 4OD3L 5AG8A 1PKQE 1UC6A 4EXPX 1H0DB 4ZO9A 1OCWL 1TQBB 3LKSB 3ARZA 1IRAY 2FH6A 1VFBB 1WFUA 1FG2A 4M7KL 1MLCA 5EIQA 4WWKC 4JHBA 5EDXA 1J05A 4LLDB 4Y19B 1T5XB 4OAWA 1VERA 3GBNH 1K6QH 1FYTE 2EO1A 4HKXA 4LNRA 1KC5H 4OCSL 1Y6MR 5CD5C 1U95A 2C5DC 5EU7C 2CXGA 3D3VB 3LQZB 4EVNB 1OLLA 1IBGL 3O3DB 5DJ0A 4Z18A 1ZLSL 5CHNA 2Q6WB 4HFUL 1AKJA 1R3JA 4MNHB 1NKOA 3F12B 1T2QH 4HUNB 5BO1L 1JJUA 3EYUL 1MJUH 2OCFD 4OZFB 1JMXA 1I7TA 1JF5A 1K4DB 2CRYA 2FECI 2LU3A 4G9DB 2OR9H 2OK0H 4NO2A 4M1CD 1YPZA 3JWNC 5IW6B 5A2KH 2I60L 3H3BC 2YUZA 4MQ7A 1N8ZB 3W39B 3RPKA 2Q7NA 1RK0A 4LDLB 5BW7A 1I1AB 4FXGB 2UYLA 2HMID 1HHJA 1NAMH 5LXGH 5ANME 3TCLB 3W11D 2KZWA 2BNRE 1U8NA 3CXDL 3BKJH 4X7EC 3CXHJ 1PX4A 4ALAH 1I1CA 4PJ7F 4LARH 3QCTH 4TRPL 5DUBB 5FYLD 2VISA 4ELMB 3HC0A 5BW7C 1JWUA 2DQGL 5EO1A 4EI6B 2PTVA 4LPTA 1JNNH 3VWKD 5IFJB 1SMOA 3IDJB 5C0AD 4G6JL 5C6TL 3S4SG 4K07A 3ARUA 5JOFB 1WQVT 4WO4B 3WIFB 2OJZL 1RIHL 3FT4A 2AK4A 1ZLUH 4GQ9L 4W6YB 3ARDD 2EZ0D 2FL5A 5FB8B 5GGQH 2EDTA 1E0OB 2JLLA 1LEGB 2HFEB 5D71L 1KEML 3GFUA 4OCNC 4Z7WE 3QUMH 3BH9A 4PRDB 1YNLH 4QXWA 3RGHA 3WFHB 5KZCD 1ZA3B 3FMGL 3MUGB 1P84J 5HYQB 2C3VA 1UWXK 3PHQB 5JIIA 4UT6L 2CKBH 2AJ3A 5I1CL 3BGFB 4XPHH 3GSWA 4FTVA 1BPVA 3V52L 3DO7A 3EYOB 2YPLD 3HAEH 1BMGA 4L3CB 1D5ZA 4PGCB 4X4YB 3KPLA 1E6OL 3QJHB 4JVUA 1FL6B 4XI5D 3UTTD 1KCRH 2R4SL 5ICXA 5F7LB 4OLXH 3N06B 5E4EC 5IHUH 2V17H 2ZOKB 3K1DA 4WW2F 3X12A 1M6OA 1MVUA 2D7MA 6FABH 1INEH 3KR3L 3TT3L 2WBKA 1CGYA 5IOPB 1KB5A 2FATH 3HC4L 4U7MA 3EHBC 4I48A 4JRYD 4WFGD 1LD9A 1YEDA 4NGHH 1NAMB 2DD8H 1EBPA 3LH2L 2AJYH 5AYUL 5DRXA 3P0VL 4KFZC 3MNVB 1R24B 2HJLB 2X9XA 1OQXA 2X70A 3QA3A 4RISL 3ROOA 3R06B 5SV3A 4F33B 2EKJA 5DMIH 5KVFL 1QACA 1UCBH 4N5UA 1RZKL 3TNMA 4Y4FA 3TJEL 5F1IA 5GZOC 1CLYL 3K7UA 4GRMB 3EOAA 2NY4C 1JI1A 4D0DB 5FUCE 2FCBA 3HMWL 1AQKH 5L88L 5IT2H 1GCFA 1LMKA 3BWUC 5IB4B 3QNYB 2X6MA 4P9HH 1U9KA 4Y4FC 5D7IA 3MV7E 4JFDE 5TE4H 3WKNA 5HDQL 4P2RB 3FFCD 1FIGL 4PJHE 1EZVX 3FQWA 3QUMB 4QHNB 5GGVH 4H26B 1AP2B 3MJGX 2DM2A 3T2QA 1FZKB 3RTQB 4AIXA 2H2SC 4L8BA 2J4WH 4ZFFA 2CKBB 2BP3A 3NA4A 1IAIH 4RGOH 5EO0B 4Y1AA 2ZZUT 3HI6L 3RVXC 3IVKB 3PF2A 3LV3B 5MEND 4JFFA 1LP9A 2NXZD 1D5IL 3OXSA 1UKSA 3HAEB 1OGTA 3MZGB 3L5XH 5GRVL 3O6FD 1U42A 2C7UB 4B41A 1FCGA 4NO5A 1B90A 1W72H 2H6PB 1JPTL 1U8HA 5FOBB 3GSQB 1U91A 3CLEL 1X9QA 4W68A 5GGSB 4JFYB 3T04D 1JN6A 1BIHA 3IDUA 1G9NL 2A6JA 25C8H 2LU7A 3GI9H 1U8MA 2NXZB 3DSFL 1ZSDB 5T1LB 1TZGL 2BNRD 5F9AC 1N0XH 4MQXC 4MD0A 3DIFB 3BOVA 2IQAA 5F7MC 1S9WA 5CIPA 1ETZB 1IC4L 4MAUH 1ZLWK 3ZDXE 4ZPVB 5IP4A 4JANB 2IBGA 3LEVH 3FL7A 3NCYS 2H41A 1OAQL 4C83A 4E41E 5JOEA 1FV1A 4KUCD 1S7QB 3G08B 1YMMD 3KGRA 4X6CB 1NFDB 4PRIE 3PJSA 1LE9B 1FVEA 2IGFL 1YUHB 3H7LA 4OZGF 1PAMA 5J56B 1PFCA 1LQSR 5GHWL 4OZIB 3TP4A 4MA1C 4WU5B 3U2SB 1E4XH 1IGTB 2A73B 5I66B 1OB1B 1QRNE 5CBEA 3MRGB 1T2XA 1I8KB 3CDYA 1MCIA 4PRHA 3PWLB 3VRLE 1NC4A 2FX8H 4JDZB 3S34L 2CDEA 1DE4A 4GQPH 4ODVH 2EEAA 3WIHL 4QYOB 4R4ND 1VCAA 5C0IA 3O9WB 5I18L 2FGWL 3EFDH 5DVLA 1BP3B 3MR9B 2DQEH 4Y4HA 3WXVL 3QHZH 5DLMH 4P5MA 3LY6A 5KVDL 3WXWH 1Z0NA 4M93C 3GNMH 1KELH 2E9BA 4MXVE 5C0NC 3MUZ1 3MYJB 3U9PL 5I1AA 2ADJB 4Y4HC 4JM4H 4PJIA 4OFPA 2ZUTA 3EYQC 3B3IB 2P24B 1CFNB 2YSSA 4OLVH 1CFVH 4JHWH 5DDHA 4ZFZB 1D6VH 1JPGA 5ECJE 4RGNE 1IE5A 1LE5A 3LCYA 4WV1A 3QFJA 3TO2A 1RJLA 4JEGB 3HCVA 2X4NA 3X14B 5JW3L 2CUHA 3BKYL 1ZHKA 4BKLA 2R2CA 3WHXA 4KH2A 4XNZC 5CJQH 4KRMB 3MV7D 4JFDD 3ZE0F 5HHQA 1UFUA 1K2DA 2VERN 3T0EA 3V5HA 4WV1C 3IU3A 3CFIC 1QBLL 3KPSD 5CEYB 1MRCL 3ZKNC 1UA6H 2YD7A 4E5XB 3E3QC 3VD3A 4CJ0A 3CGTA 5IGXL 3PWVA 1ODAA 3Q1SL 4UV7H 3MNWA 4MDIB 1N7MH 3TA3B 4Z7OE 3T0EC 1EEYA 3S4SA 3TBSA 4IDLA 1PGRB 1T0NB 3MJ9H 1HDMA 5ALBL 4PRAB 1UYWH 2Y5EA 2NQCA 4Y16A 4ZUSB 4PJ5A 3OHXA 5EZJA 4KZDH 4PJFB 3Q6FA 1FN4A 4PJCE 3MXVL 5MERB 3PGFL 4XWOD 5ESVB 5HHXH 4JLRB 4DN3H 3P4OA 4WI2A 4Y16C 1IGFL 3O4LA 5T1DH 3KAAA 2NXYD 4NQVB 4NQEE 1ZT4A 1MFDH 5DWUL 2XQYK 4TSBL 1T22A 5HGAA 2HRPH 2ADIA 2AJVL 3FB6A 4CN1A 3INUL 4Z7NF 3DGGA 5JXAL 4U05A 4ZSOE 1FC1A 4MMXC 5EZOH 4N0RA 4WY7L 3DX6B 5C0CD 2VH5L 1BQUA 3F8UB 3T4YA 5IFHH 2DBJA 1KCVL 4IMKA 2WK2A 5KW9H 5ITBL 1JWSA 4HDIA 4WDIB 1YY8A 1DP0A 4P9ML 1UCTA 2ID5A 1CXLA 1KB9K 3Q6GH 3QZWB 2PTTA 3N1FC 1R3IL 3V2AR 5ISZD 2FO1A 3DV4B 3RJQB 4QGTA 2AXFA 1CXKA 4IMKC 4LCIH 1UWXH 1XCTA 2VQTA 5D1ZD 3SE8H 1NCDH 4ODHL 4XP1L 5TDPB 3BFOA 4L8CB 4ZS6D 3NIFE 4NZDA 1RUPH 5SWQB 4AT6B 1X5KA 3BP7B 2P5EB 2UZIH 4U1LA 1OP3K 4O9HL 4NHCL 3L3DA 3R0NA 1XF2A 3ARPA 2NYYD 2AS5M 3L9RA 1NUNB 3TIDA 5KG9B 3RU8H 4F7TB 5IMMB 3ZKQD 3PABB 2HJKA 1H15A 1IFHH 2V2WA 4LKXB 4Z5RA 2AV1A 2OMBA 1X3DA 2BK8A 1HZHL 5E8DH 1OSZA 4HK0A 5HYJB 1DBKH 5JUEH 5SWZE 1S5HB 5DJDA 1QSFE 5F9OH 4Q97A 5DFTA 2OTUB 5CMAB 3DX8A 3GBNL 5C08B 1K6QL 1RQ5A 1GYAA 2D03H 1URLA 1BQSA 3V4PH 4JHAH 3RUGF 3VXTB 2Q8AH 2XTJE 1PZ5B 2BC4B 1ZHLA 5B4MC 5I16A 2VLJD 1HHIB 4Z76A 2BSTB 4C55A 5DJYA 5TFSH 1KV3A 4D2NA 5I2IA 3KPNA 1HILA 3ZZ1A 5B38G 1I7RB 4F7CA 2UVEA 4ZOBA 1T2QL 4MNGE 2E9IA 1MJUL 5J12C 3U0WH 3PQYA 5I0DA 4S0TD 4NZUH 4U3HA 4HWNA 2OR9L 4YIQA 3SKNB 1CS6A 2OK0L 5HI3D 1GGTA 3MRNB 4K71C 2Z9TA 4ZNEE 3EDDA 5F1NA 4YHOH 4L4TE 2NW2A 2E8ZA 4DOHB 4QXUH 4MLIA 4Z7VF 2H8PA 3GMQB 1CI5A 4M3JA 4BELD 3TBVA 2HA1A 3WNLA 1NAML 3HR5B 4X4ZA 5LXGL 5IM7B 4N0CC 5HI4C 5KANG 1WBXB 3HZKA 4I0KA 2D7PA 3BKJL 4ALAL 1VPOH 3TWCH 5FCSH 5K59E 4LARL 3QCTL 3GIZH 2AEQH 1K4CB 1JNNL 4M5YL 2XZQH 2QQQA 3QWRA 5CEZE 4Z78A 1L0QA 1CICA 4M1GH 4JY5H 1TJIH 1A9EB 2QJDA 3RL1A 5C0FA 3HE7B 3TZVB 5C09A 4OFKA 2HVJA 2OTWA 5ILTH 1SVZA 3BW9A 4XP6H 1RHHB 5GGQL 4YWGH 3MOBH 4HWBA 4P23D 1CICC 1ZLWH 2P8MB 4O51B 3QUML 2R9HC 2VZVA 3FRPG 1YNLL 4MLSA 3T77B 5I71C 3ETBF 4PR5A 1D9KB 2EE2A 4QWWD 3NCYP 3EKCA 2CKBL 1ROWA 1I9IH 5EUOA 4OQTH 3T2OA 5GRXG 3ZT7A 1F97A 4XPHL 3IJSB 4NBXB 3KPRA 1U8IA 3HRZB 2WZPD 2XPGA 2BZDA 1RZGA 4YHNB 4L4VD 5INCB 1KCRL 3VFGH 4OLXL 4DUWA 4YZFF 1KPRA 2V17L 3V6ZB 3ISWA 4JRXA 1G9MC 4OKDA 6FABL 2DYPA 2XIDA 5TGBB 2FATL 1ZS8B 5C92A 4BSVB 4IRJB 3G5XB 1E4XI 3B83A 4NGHL 2AJYL 2F53B 5GGSY 4LPCA 1P53A 3BPLC 2ERJC 4NWUH 1IAKB 4XPGH 3WEXA 5DMIL 4AG4H 2DI8A 3QPXH 5ADOH 2DLHA 5A16A 3PWPA 1H5BB 3TPUA 2XTLA 1AQKL 5ESAA 5IT2L 3BRFA 3ALXA 2QQNL 1F4AA 5KS9A 4P9HL 4N0FB 5TE4L 1A02N 3B4NA 1SM3H 1LO3H 5IVZB 5GGVL 3DYOA 5D7KD 4E0RA 3QIBB 5C2UB 5E56A 1F3JB 3DOSA 5EU6E 1IAIL 4RGOL 3GSOB 4YEFA 4AIZA 4LMQE 1G7JB 4PGEA 4CVXB 2AXGB 3MRLB 4OF0A 4PJ9A 5DHYB 3BE1H 43CAA 1CYGA 3CIQA 3LN4B 3QDJB 4WUUA 1YQVH 2A6DB 5IQ9A 4FQQB 3FCTB 4XRCB 3HNTH 4JZOB 4P2QA 2R2HB 3L5XL 1A9BB 3OBAA 3U46A 4D0BB 1S3KH 1G7QB 1W72L 4S10A 4MX7B 5B8CB 4PJ9C 4PJXF 4DZ8A 4HUWB 4HEME 1QPXA 1Q0XH 4G7VH 4J4PA 1AXSB 25C8L 3GI9L 4LSVH 5GS1B 5D1XA 2R2BA 4GW5B 1N0XL 1PG7H 4LLMA 1HOCB 5AUMA 2ESVA 2NY0C 3CVHA 4OCXH 1TVHA 4QHLB 1NDGA 4MAUL 2IC2A 1T21A 3HS0B 4AY0A 1UEYA 1XMWA 5JHDA 3U0TB 3F7PC 4J4PC 5LG1A 2Q3AA 4M02A 3MYZA 4ISVB 3WIIH 5GGUA 1Y18A 3PV6A 1D6EA 3SDCA 2ZOLB 5IMOB 12E8H 4M3KB 3K46A 3WJJA 3FFDA 3IJHB 4LU5H 5HVHB 1AD9A 1H3TA 4I0CC 1PQZB 5DRNB 5FYJH 3CUPB 3C60B 3VFOB 1KIQA 4EDXA 4G9FD 2IAND 4XBGB 4X9HA 3GSXB 3SDCC 1Z2KA 4HWZA 3WJJC 1AGBB 3FOLB 3BESR 4K8RH 2VDOH 3B5GA 1OQOA 2E27H 4MJID 1IILE 4I9WE 4Y2OA 2FX8L 2AJZA 1FFQA 1CGTA 4ODVL 1I8IB 3SGEH 3OR7B 2X2YA 4CBPA 1XF5B 1DVFD 4G80B 5E00A 3BZ4B 4M5ZL 3QQ3B 4Z7UE 4P5KB 3EFDL 1WZKA 2DLGA 2DQEL 4NCC1 4NQXB 4X4XB 3MJ8B 3QHZL 2GJ6D 5DLML 1WITA 2Q7YB 4GG6E 3WXWL 2DM7A 4DKAA 1L0YA 3CFDA 3GNML 4L8SA 2HKHH 5FXCH 4F8TA 1CGSL 4LFHG 2OM5A 1GJIA 3TIEA 1OP3H 4RFEA 1DVFB 4AYFA 4JM4L 1KPVB 1CDYA 2R0KH 3QIUA 1QRKA 3VH8B 5TF0A 1NCWH 3H3PH 2VLRD 4OGAC 3EOBA 1CFVL 3KLAB 4OLVL 1ORQB 3V6FB 4JHWL 5FYJD 4ZO6A 1D6VL 4L8SC 4U1GB 2QADC 3VA2C 4WI7A 2FIKA 4K9EC 4EI5D 1IEBA 3BN3B 5D2LA 3QIUC 1EFQA 4NQSB 4K8RD 1FFPB 3FB7B 4CUCA 3SQBA 4RAUA 3WUWB 5CJQL 3FB5B 3N1GC 5I8EA 3DTXA 1IGYA 4F8QA 4NO0B 3JTSB 2D0FA 2E7BA 4KKBC 3D69B 3U9UA 4EI5B 1T1ZA 2BMKA 3OJDB 1KF9B 1KEGH 1UA6L 2PYEA 5FDWB 1AE6H 3MLXH 4UV7L 4OLUH 1N7ML 3OX8A 4QRRB 4DVRH 4ELKB 4PJHF 1T20B 5MEOA 3OG4B 2QLVB 3MJ9L 1Q9OA 2DMKA 1QD0A 1ULVA 3BKCH 1WISA 1UYWL 2WWMC 1XF4A 4TUOB 5C86A 4ONFH 1U8LA 3I6KA 3B8YA 3S96B 3ESUF 2YPVH 2R56H 2XN9A 4KZDL 4XCEB 1WC7B 1XGPB 4GKZA 4NKOA 3FRPA 4HAGA 3T1WA 2X10A 4FFVD 1A1OA 4NUJA 4IOFD 5HHXL 3TFKD 4DN3L 5T1DL 3SJVD 4GRWH 5IBLC 1MFDL 1OAZH 1G7MA 1R5WA 2HRPL 4LCWA 1AD0A 4U0RC 1NL0H 5I17B 1BFSA 5C70A 4MHHG 4OBSA 5EZOL 1F42A 2A83B 1FL3B 3IDXH 1NBYA 3DVFA 5IFHL 3T0VA 5T1MB 3SJVB 2FGZA 3ZDXF 2AP2A 5KW9L 2V5YA 4G6FB 4OF6A 3HMXH 3K0WA 4CJ1A 3VFPA 2NNAA 2GSGA 3O45B 1KLUB 4U2ZA 1MI5B 5D6DA 3Q6GL 4G8IA 3VRIA 4D0CB 1RUAH 1S9VB 4HKJB 2YUXA 4TOYH 1R3LA 4R7DA 5DI8A 4LCIL 3LAFA 4I18B 4OQ1A 3ZSSA 3CU1A 2XWJB 3CK0H 1U8JA 5GGTA 2K7PA 4CW1A 3SE8L 1NCDL 3CCHB 4PP1C 5EFIB 1IC7H 3ET9F 1HSAB 5D6DC 4WEMB 3H9SD 2ZUUA 4I3SH 2ADFH 1KJ3H 1RUPL 2HAZA 1IM3B 2EDFA 2UZIL 3ARBD 4WRLA 3TN0A 4PIRF 1A3RL 5GSVB 3RU8L 3V8CA 3EYVB 1A6PA 3C8KB 1PY4A 1IFHL 4TTGA 2X4UA 2D0GA 1NEZG 3RI5F 5E8DL 3RNQA 1DBKL 5JUEL 3TN0C 2ZUQB 4L3EB 5K93A 4O2FB 5KJRH 2HFFB 5F9OL 1HWHB 3RDTB 2APWA 1GC1H 5HHPB 2QBWA 2HTLC 3UZVB 2D03L 3V4PL 5FK9A 4JHAL 4GRWB 4WW1B 2Q8AL 4RFNB 1N6VA 2NX5E 3SDXF 4F2MA 2C3HA 4I0PA 2VZ1A 4OI8A 1U8KA 1MWAH 2DLEA 2FD6H 5HI5D 4NYLB 5TFSL 2PW1B 3ECBA 4U1IA 2AKRB 3DUHA 1NANI 3KYNB 1IGIH 4IRSA 2A0LD 5KVMC 1QZ1A 5HY9B 2Z4QB 4IOSD 4I0PC 1BD2A 1TDQA 3U0WL 3AGVA 3GSNH 3UTQB 4NZUL 3U6RB 3VXSE 4ZPTA 4OF5A 5FYKU 5H35B 3RWDA 2BVYA 3P9LB 4IRSC 2DRUA 5EC1A 1AIFB 1EJOH 3F5WA 2N7AA 3KJ6H 4YHOL 3QI9D 1G6RH 3LKRA 1KCUH 4QHUB 3DV6A 4QXUL 3WCYA 2NY2D 1QEWB 3BP6B 2DWEA 1YA5A 4HS3A 4EN3D 4TNWK 2X1WL 5DJXB 3QQ4A 2C26A 3MNZB 1BOYA 2G5BA 3IGAA 5J1AB 4P46B 2KQNA 2OBGA 3TWCL 3GIZL 3Q5YA 3SKOB 4Z7OF 1FFNB 2AEQL 4HAFA 1R0AH 3FO0L 4OFDA 4JY6A 4PJAB 2XZQL 3CSYB 1XF1A 4TQEH 2VLKE 3I3DA 1IM9D 1EAPA 2NY2B 4M1GL 4KTDH 4JY5L 1D5MB 2O5XH 1TJIL 3V5KA 1JNHA 2VE6B 4EN3B 1Q94B 1OF2A 1JPFA 5ILTL 1UJ3B 3VXQA 5IV2B 4NQDA 1T0MA 1TXKA 3D0LB 1A7QH 3PP3K 4YWGL 3MOBL 3D39D 3QXUA 1OTUC 4C56B 3CX5J 1BZQK 1S7SA 4NZTH 1NMAH 1DUYB 1A7RH 4OFVA 1MJ7H 5IG7B 3DUSA 3B9KB 4U3XA 4Q6IB 3F7QA 1MWAB 5CUSH 4I2XA 1G9NC 2JJUA 1WZLA 4S1DC 4RIRB 3WS3A 3GMLB 4U6HB 5CWSA 2Y36H 5F1KC 1MH5A 1I9IL 1MCDA 3L3OB 1TNNA 4OQTL 3JV6B 1D5BB 4IOIA 4KRLB 5FHAH 4M1DH 5H37H 4WI5A 4ZD3H 4Z77B 2XY1A 4MCYA 3K8MA 3GSNB 3VFGL 1RZ8A 1MY5A 2CDFA 1YN7A 5HHOE 3SDAD 3AXLB 1FNFA 3VGAB 2R0LH 1G6RB 2JCCA 2DLIA 4TULH 5C9KA 4PLKD 5FECA 2VR5A 2BHZA 4PJEB 3LDBB 1K8DB 1Q9WB 2FO4A 3S98A 1CG9B 3G5YB 2IBZY 4ODUA 4MXQC 4XPGL 1F2XK 2FYYB 3WIHA 1HXYA 4RZCA 4HKZA 3SDAB 3AS0A 1TJGH 4AG4L 3NIFF 3QPXL 5EBMB 4XP5H 5ADOL 3NCJH 4JFEB 1NLBL 1SEBA 4YDLC 4LF3B 3VFUA 2NLJA 3O8XD 3HTLX 5LGKA 2A74A 5FDYA 1PG7W 1YDPA 3AS3A 1SJHA 4WFHD 3VXRA 4G43B 1SM3L 3ARQA 1LO3L 3W0WB 3MGTB 1WFOA 2QHRH 2G2RA 3G5ZB 4XCNA 3GSUB 4XPTH 3O8XB 1XH3A 3LRSB 2YZ1A 4KK6C 1E4JA 1QPPA 2HLAA 4ONOA 5J6GA 2NMSA 3BE1L 1MRDH 2ICWI 4R6UA 5IHZB 4NRYB 1YQVL 1R3HA 1T1YB 1CE6B 2V9RA 3U48A 5DYOB 3HNTL 2BOBA 1D5XA 1S3KL 1XR9B 4JO3H 1NCBL 4YDJA 5HHME 1V3KA 5GSRA 3AREA 2B39A 5GJSH 5BRZA 4UIMA 1Q0XL 4G7VL 1KG0B 1YQ2A 1INDH 1WSST 3X11A 4Z7QF 1EK3A 4LSVL 2HLFD 3KJ4B 3GGWA 1N3NA 3MRJA 1TZIB 1BJ1H 1PG7L 2FSEB 5JW5B 1JGVH 3AREC 4OCXL 1F45A 2O26U 3GM0A 2UWEF 1W2KT 3U83A 2X4TB 1CK0H 2VLKD 1H0DA 2V2XB 3LKSA 2ZWLT 1S8DB 3DETC 3QDMA 1C5DB 3WIIL 1VFBA 2VAAB 3F7RA 1SVCP 4BFIB 4XTRC 1BQHG 5K59F 5JMRA 4JVWA 12E8L 3QO1B 4K7FA 5C9JA 4OJFH 4LU5L 1QSEE 4LLDA 4Y19A 1T5XA 5FYJL 1TQBC 3A6BH 1QSVA 2AV7B 2X1OA 2BSED 3L5HA 1XZ0B 5F6HJ 4X80H 2NTFB 4PRNB 5GPRA 4RMUA 5ACLA 5LBSH 1JHKH 4PGBB 1PZUB 1EFXD 3DXAE 4OSUL 3QYCA 1PSKH 1KACB 4K8RL 3LQZA 1UB5B 2DQIH 4EVNA 3O3DA 1FCCA 2X9WA 2CIKA 2E27L 1NCTA 4LLQB 4MNHA 4DGYH 3F12A 3MV8E 1YN6B 1UG9A 2J8UE 4OZFA 1EFXB 1L7TL 4LIQH 1K4DA 4G9DA 3UBXI 1TMCB 5IW6A 3GIVB 4P2OD 1UB6B 2YD5A 4R4BB 4DTGH 3R1GH 1HINH 1QFHA 2HKHL 1IAOB 1I1AA 4FXGA 1Z3GH 1JIBA 1MAKA 3OJ2C 2R0KL 1TPXB 1HYSD 1WK0A 1NCWL 4KVNH 1FYTB 3H3PL 3KLSA 4HMDA 3IDMB 4LHUD 4NFDA 1LO4H 4Q9QH 5DUBA 1NCAH 4P2OB 4ELMA 1KXQE 1I1AC 4EI6A 1A6WH 5EC2B 5IFJA 2OTPA 3IDJA 4XVTH 2CH8A 1DCLA 1B6DA 4KMQA 4QRPD 2PUQT 3O6MH 5JOFA 3QPQC 4M1CC 4WO4A 1WBZA 3WIFA 3P2TA 2H45A 3G6JE 1C5CH 5FB8A 1BF8A 1WBYA 4KDTA 1LEGA 2HFEA 3VWKA 5F9WB 1BAFH 4PRDA 3WFHA 1VKXB 3GSRB 4WO4C 3AU1B 1KEGL 4LBEB 4DFHA 3MUGA 2A6IA 5HYQA 5DMJB 1AE6L 3PHQA 3G6AB 2MSPA 4OLUL 4WIQA 1S7RB 4DVRL 4KDTC 2M8XA 2VXVH 3ARDA 2ICEB 3AMLA 2BSSB 3VWKC 2EICA 4DK6A 5ANMB 3BKCL 4PYHA 4L3CA 4PGCA 4X4YA 1X6LA 4ONFL 1FL6A 3IJYA 2YPVL 4WEUD 3L7FB 2OXHA 2R56L 3BGFC 5EU7E 2ZOKA 5HDLA 2E6PA 2VDNH 3AB0C 1KJVB 4JZJB 3L5IA 1WLHA 3HR6A 4F15C 5IOPA 1T80A 3FN0H 4MA7H 5F6IC 3K81A 2YPLA 15C8H 1NAMA 5JIPA 2EDXA 2EDYA 3D9AH 3MNVA 1R24A 2HJLA 1NL0L 2C3XA 5EBWB 3ZLQC 3R06A 2O61B 3UTSE 4F33A 4Z7WB 1V8HA 3KWWB 1GVIA 2RBLA 4GAGH 1JUFA 5EZIH 1J0IA 3C6SB 3IDXL 1TCRB 4GRMA 4BQ8A 1CFSB 5GGRB 1QSED 4XI5C 4G8EA 4D0DA 2XZCH 5IBUB 3ULVE 3HMXL 2VDRH 3CSPA 1ZV5A 1LEKA 5IB4A 2XT1B 3QNYA 1MNUH 1MELA 2MJWA 3SDDD 3I2CH 4CVZB 1ZT7B 3IU4H 1RUAL 3UX9B 1AXTH 4TOYL 2A6KB 3QUMA 3HLAB 4H26A 1EUTA 3CK0L 4RMTA 4LSPH 1BIIB 4ZUUA 4X7SH 1FZKA 1IC7L 2HH0H 3QO0B 4KKLC 4ODTH 2W0FA 2CKBA 2XA3A 4I3SL 5EO0A 1KJ3L 5T33H 3IVKA 5FYKD 3LV3A 2FIRT 1GOFA 2VL4A 3HAEA 5CINH 3RTQC 1MFEH 5AEAA 4KROD 2C7UA 4BQ6A 4BFGA 4FQIH 4LVOB 2H6PA 2DBLH 2WSKA 4N9GB 3LN5B 3GSQA 3TH2T 2R69H 5GGSA 2AK4E 4JFYA 3P30H 3EBAA 5KJRL 2VZUA 4Q7DA 1J8HD 4Z7UF 3IDGB 2HG5B 1FO0H 5MENA 4FA8A 3DVGB 2CLZB 1GC1L 2IALB 3C8DA 5T1LA 4YFEA 2AERT 2YK1L 3DIFA 2FRGP 1A14L 3O6FA 3UO1H 4GG6F 5JDSB 4PBWD 2GW5A 4LPVA 4CDHA 1ETZA 3RIAF 3WUZA 5F44A 1MWAL 1RZFH 1UWEH 3QHTC 4JANA 3ZE1E 2FD6L 4G7YH 1MFBH 1L4IA 1A1MB 5IB3B 2NXZC 4NKIH 2VOTA 3SCMB 1IGIL 1ZLVK 4RSVA 2BVEA 4XAKD 5F7UA 1S7QA 4GH7B 4X6EB 3G08A 2HT2C 5E6ID 3S8WA 4JGMA 3STZB 2EYSB 2MKWA 1NFDA 4X6CA 1LE9A 4OZ4B 3GSNL 4XGZB 3ZKXC 3AMKA 3BUYB 1LEIB 1YUHA 3VMNA 4N8PA 2R15A 4OZIA 3PL6B 1BEYH 1EJOL 4UIKH 4WU5A 3E6FB 3KJ6L 3U2SA 2Z8WC 1IGTA 1G6RL 4WJ5B 2RR3A 1KCUL 2A73A 3MV9E 5E6IB 4WWKD 4HH9B 2CGRH 3MRGA 3CFKA 2DS4A 4P9HC 1I8KA 3REWB 3PWLA 3BPNB 4YBLB 4JDZA 1JVKA 3WNPA 3HPLB 3MCKB 1TENA 5LQBH 1CD0A 4I13B 5KSBE 4KK8C 3F6IA 3O9WA 5CD5D 1M05B 1R0AL 1U2HA 3KPPB 1EEQA 3MR9A 4JM2F 4TQEL 2VWEC 3EJZC 5TE6H 4KTDL 2O5XL 2YHGA 3JTTB 1W72A 1NGWB 1S78C 2GTWB 4XXDA 3E2HB 3O9WC 5D7IE 2DMCA 4AM0A 2MTPA 2ZG2A 1A7QL 2ADJA 4PRIB 4WU7B 4S2SA 5CZVH 3WJLA 3B3IA 2P24A 4MCZB 1CFNA 4NZTL 1NMAL 5GISH 1MJ7L 4XHQA 4AK1A 3QWOB 4EEEA 1BHGA 1UENA 1AKJD 3GB7B 5CUSL 1Q9KB 3VW3H 5ITFB 2WLYA 2APBA 4R4NC 1QFOA 4X9FA 2Y36L 4Y1AE 2F8OA 3ARTA 1PX3A 4KAQH 5FHAL 4JFFE 4M1DL 1DBMH 1U8PA 2BNQD 4ZD3L 1P5VA 5I8OH 1JBJA 4UV4H 3THMH 4ACPA 4H1LG 1DEEA 1H3VA 1U2CA 3GM8A 3FHQA 2QQLL 2CK2A 4BQBA 1A6VL 4OIBA 1RU9H 1JZ6A 4LGRB 4L4JA 3LZFH 4ORGB 5CEYA 1G7PB 2GUOB 2HWZH 2VO5A 3F7VB 1F02I 4E5XA 2MWCA 2BNQB 4FQHB 1IC1A 4MDIA 4NKDB 5JQHC 3P77B 1MCKA 4GW1A 3ARRA 2H9GB 2H32H 1T0NA 2Y9RT 1P7QB 4PRAA 1JPSH 4KJPC 1F6FB 5KSVB 4M61B 1IEHA 3RZCB 1KB9J 1TJGL 1XGQB 3CLFL 3VI3E 3U0PA 5I0ZA 3NCJL 2VXSL 2QSCH 4PJFA 4RGNB 1JZ2A 5MERA 3M8OH 3T0WA 1VA9A 5D70H 4LEOB 3QG6B 5ESVA 4LK4A 1OAKH 5HPMB 5T3ZH 4JLRA 4HW6A 2AXJA 2GJJA 3A6CH 1UH4A 4NQVA 5BVJB 2ZCKH 1V5JA 3HZYA 3PNWB 4GBXD 2I5YH 1TTFA 3QEQE 5CSZB 3BO8B 3BPCB 2QHRL 3U82B 4FTVD 4XPTL 1ES0A 3DX6A 3BVNB 4QRUB 3L7EB 3HZVB 1EJ6A 4CADB 1U92B 3TBTB 2IMMA 1MRDL 3F62A 4GBXB 3QIWD 4JGJA 5CLTA 5EIVA 2J7LA 5D7LB 4XWOC 3QZWA 4PV8B 5INDA 3ESVF 3VD7A 4H8WH 4PYGA 4JO3L 3LVEA 1BZ9B 4PB0H 5T1KB 1EHLH 3DECA 1ONQB 5GJSL 1U58B 2I07B 5CZXD 2DICA 2W1NA 4DFIA 1INDL 1YC7A 3TC9A 3X3GH 4PJCB 4NO3B 2NY4D 5CKAA 5TDPA 3QIWB 4PJIE 3MRRB 4L8CA 2E7CA 4AT6A 3BP7A 2P5EA 1AHWA 1KN2H 1JGVL 5ISZA 4NQEB 1NGPH 5T3ZD 3MJ9A 5K9KB 4GMTH 5KG9A 1CK0L 4F3FB 5IMMA 3PABA 4LKXA 3QFJE 4ZSOB 3SE9H 5HYJA 2H2SD 3ZDZE 2GCYB 4OJFL 2OTUA 3QDGD 4P99A 2DN7A 5CMAA 3RVXD 3T0EE 1CVRA 3A6BL 2QL1A 3P4LA 4Y88A 5EIIA 3VCLB 5C8JB 4X80L 4GUPB 5E4IA 3VXTA 4PRBB 4IEFB 5LBSL 1JHKL 3IRPX 1PZ5A 2BC4A 3DJ9A 1PSKL 1HHIA 4Q9CA 2ORBH 3KPOB 2BSTA 1AGFB 2DQIL 1LDSA 3SDXA 4X8JB 3QDGB 3RGVD 4URTB 4N0YH 1CFQB 1I7RA 2ED7A 2YEZB 1X5FA 4DGYL 1I8LA 4K2UH 2UUDK 1CDUA 3O3BB 3BIKA 3E6HB 4LIQL 3D48R 2CUIA 4OF8A 5FO9B 3BYTA 3SKNA 3OTTA 4M7JH 1GGIH 2EECA 3MRNA 3TBWB 3M17B 3QUKA 1I8LC 4DTGL 3RWJA 3R1GL 3RGVB 1HINL 1QP1A 4R96B 3GMQA 2X1PA 3P40A 1QSFB 1Z3GL 3HR5A 4HT1H 5IM7A 3HNSH 1W0WB 1WBXA 1LK2A 5IMLB 4KVNL 4P3WA 1XF3B 1LO4L 1HWGB 4Q9QL 1NCAL 1BJ8A 2XTJB 2GTZB 1K4CA 3VU2A 1HCVA 3WDJA 2D4FA 2ZCHH 5L6YH 4XVTL 4HGWB 1A9EA 3O6ML 5H94A 3RKDC 2XOTA 3HE7A 3QG7H 3TZVA 3GI8H 5BQ7A 5E08H 4YHIB 2VL5A 2EC8A 3WNNA 4EIZC 3OKKB 5EA0H 5GGRY 4JN1H 4PRPD 3DHMA 4TSCH 2P8MA 4O51A 2I27N 1BAFL 5GS0C 3T77A 2J8OA 3HE7C 3TZVC 3ZTJH 4PRHD 1D9KA 1WTLA 5E9DE 2LVEA 3MPCA 2VXVL 3IJSA 3C9NB 4W4NA 5C0ND 1QR1B 4LVHB 4P23A 4PGDA 4LHJB 4ONHA 4N5ED 3LS5H 1D9KC 5HVWA 3HI1B 4YHNA 4ZS7H 1IZJA 1SBBA 3HNVH 3IKKA 4HFWB 3V4VH 2W9EH 2JB5H 5H8DA 3SKMB 3OAUL 5F7HA 1IAMA 3V6ZA 4NM4H 2VDNL 4P23C 4XPFH 1F4WH 2DIBA 1VFUA 5FGRA 4J8RB 3VD9A 4LSUH 1MHEB 1O7SA 3FN0L 4MA7L 15C8L 4KI5D 4QTIH 5CJXA 3SKJH 4BSVA 4IRJA 3G5XA 4QWWC 2F53A 1N2RB 4J3WA 1IAKA 3OKDA 1GOGA 1U3JA 3VDAA 4CMMB 1BX2B 2VN7A 2WQRA 4GAGL 3SOBH 3UTZB 5EZIL 5CJXC 4MNQD 2OI9B 5J1TC 4IRJC 5FO8B 2AJUH 1X44A 3H9HB 1H5BA 2CRIA 3M07A 3PDOB 4UILH 3ZL4H 3MSPA 2XZCL 1HKLH 2F5BH 5EO9B 2VDRL 3PQYE 3T0ED 3K4ZA 3RHWF 1NC2D 1MCQA 1V7MH 1TVBB 1MNUL 3DYPA 3TJHC 5KSUB 5CGMA 4LQFH 3I2CL 3IU4L 3N50A 1H5BC 4DVBB 1AXTL 5IVZA 3IDIB 3ALWA 3R8QA 3H2WA 2LABA 3ES6B 4LSPL 2C1OB 4X7SL 3QIBA 1KT2B 3S5LG 2XWBB 1RUMH 2HH0L 4ODTL 1F3JA 2YA0A 4XC3H 4OGYH 1NC2B 4OQTA 3RWCB 5T33L 3MMEB 5E1HB 1G7JA 4OM0H 4Y16D 4CVXA 2AXGA 3MRLA 4PJ5D 5DHYA 1H3UA 1F11B 1RSFA 3LN4A 4QXTB 5CINL 2A6DA 1AC6A 1FLTX 2R1YB 4FQQA 4X9BA 1RUQH 3FCTA 4XRCA 3MLWH 3QIBC 1MFEL 4JZOA 2R2HA 4KMLB 1A9BA 4P5TB 3IETB 4D0BA 4EBQH 1FZOB 4FQIL 4MB4A 3BMWA 5KAQF 2DBLL 4MX7A 2J8UF 5IFAL 5B8CA 2R69L 1F4YH 3O4LD 2J88H 2Y7QB 3O3EB 2BCKB 4HJJH 1G7IB 1FO0L 1WCQA 2HVKA 2NY1D 3MREB 4NNYB 1AXSA 3VFSA 3BEWA 3UJJH 2MHAB 5GS1A 1ZGLM 1EXUB 1W0YT 4GW5A 3UJIH 1HOCA 3UO1L 2VXTH 4M62H 1S7WB 4MJ5A 4PJGF 5B8CC 4QHLA 3D5OF 3VWJB 2EEDA 4Y5VB 3U0TA 1RZFL 4G7YL 1MFBL 3FO2B 3KPMB 5EUOE 1NCNA 3ZTNH 5GS1C 3QCVH 5AD0A 4NKIL 3UPAA 4ISVA 2NY1B 4XCFH 3KPRE 2ZOLA 4U4BA 1BBJB 5IMOA 1AI1H 2V2TB 3IJHA 5ESQB 1ZXQA 1U6AH 1RZIA 3N1QC 1PQZA 5DRNA 3G5VB 4QGYA 3CUPA 3C60A 3VFOA 4D3CH 1IGML 4LRNH 4RBPH 3ILPB 4PG9B 3Q48A 1BEYL 1DQQB 1IC5H 1VFAB 4XPAH 4UIKL 1AGBA 3RBGA 3WNKA 5HVHC 3GHBH 4R90H 4MMZC 2FJGB 1GRWA 2YBRB 1A7NH 3C60C 2CGRL 2W0PA 3UP1A 5HD8C 1U3HD 5E6YA 5A2IH 4HQQH 2ZUWA 3DRTB 5LQBL 3TBYB 4OZHB 3NACH 5TJWK 1XF5A 4G80A 1JF6A 3BZ4A 1HYRC 1VDGA 4P5KA 3WFBH 3PWPE 5B4MD 2EDEA 1B4JH 5GRJH 4NQXA 4HZAA 4X4XA 5TE6L 3MJ8A 3OKOB 1AGCB 2R1WB 1S7TB 3TH4T 4IMLB 1U3HB 2Q7YA 3A6OA 1T0PB 5ICYB 5KS9E 4KPHH 2P1YA 3TYFB 5C1MB 3BN9C 4WNQB 4UINL 5T3XH 1DVFA 3QEUB 4KK5C 1KPVA 2V5SA 4JY4B 4U6VH 5CZVL 1I9RH 5HYSB 3K2UH 1CTOA 3Q0HA 1BJ1J 3KLAA 3L3IA 5GISL 1ORQA 4ETQB 3V6FA 3ULUC 2OSLA 3VW3L 3OKYA 1T3FB 3BP5B 3GDBA 5ERWB 4WGWB 5E5MB 1DVFC 5JA8B 1I85A 4P57B 3I3EA 3QISA 4HUUB 4KAQL 4NQSA 1DBML 2RHEA 1CF8H 3FB7A 5I8OL 4UDUB 4UV4L 4WUUE 3THML 2R39A 3FB5A 4N0CD 4ZNCD 2J6EH 4P2QE 4N8VG 3OB0K 3C5ZB 4JO2H 1IT9H 4NO0A 3MO1A 3JTSA 3FAWA 1RU9L 1I85C 3D69A 3LZFL 1ND0B 3WKMH 1JTPA 4EI5A 5DSCB 3OJDA 2VKWA 2HWZL 1I7UA 2ZP0T 4BA8A 2Z91B 5KOVC 1ORSB 1YPZF 5FDWA 4HUVB 3D0VA 2EYTA 2YWYA 3IXTB 3MRDA 5AYQA 2DB8A 2G75B 4ELKA 4QRRA 5F7YC 1U0QA 1T20A 2WWKO 2QSVA 1X5HA 4XVUD 4LPWA 4EI5C 3QWRD 1JGEB 1CICD 3WFDH 1BVLB 4TUOA 3T0XA 4NHUB 2YRLA 2AEWA 1E27B 5ID0B 4JPVH 5C09D 4HXAH 3V0WH 5DZLA 3L1OH 1UEMA 2QSCL 3IYLW 4Y8AA 4XCEA 4HG4K 5H37G 1WC7A 3M8OL 4YDIH 5D70L 35C8H 1OAKL 5T3ZL 2XYCA 4Q0XH 1KOAA 4NM8H 3A6CL 3AM8A 5CLWA 3VGEA 2GI7A 2ZCKL 4NKQB 1RURH 2I5YL 5I17A 2DLTA 4KUZL 3ZKMD 4YQXH 4HUMB 4OGZA 4RNRB 1J0JA 3AM8C 1FL3A 2KH2B 2WUBH 4UAOB 1FORH 5T1MA 4V1DD 3SJVA 3T2NH 1KPUA 2WW8A 5DUMH 1BGXH 2CIIB 1ZOXA 5DD5H 1JZ5A 1NJ9A 4JM2B 3O45A 1VEPA 4JRXD 4IOFC 4H8WL 4D0CA 1S9VA 2DYPD 4HKJA 5FKPB 4PB0L 1EHLL 1S9KC 2X05A 1KCKA 4I18A 4IHOB 2XWJA 4QCIB 5C6WH 2R2EB 1MJ8H 4MQSB 4V1DB 3CCHA 5EFIA 3X3GL 2NW3B 1HQ4A 1HSAA 2EDKA 5D9SB 5GRVK 3MZTA 2KUTA 5DVKA 1KN2L 4RRPG 5E24E 3L95B 1NGPL 4BZ1H 4I18C 4RMVA 3KYOB 1MREL 1OGAD 4GMTL 4PJ7E 5GSVA 3ZYIA 1QLFA 3EYVA 4P59H 4GKNB 1Z5LB 3C8KA 1CD8A 1S7XB 5D2LE 3NFSH 1JP5A 3AROA 3SE9L 3AS2A 3LS4H 5F93C 2X9YA 2P42B 4L3EA 4Z95H 2HFFA 3ARGD 3ARBA 1KXTB 3D18A 5HHPA 5JTWA 3CFJB 3ROLA 1J12A 4WW1A 1JHTB 1S7UB 4PV9B 2PYEE 3SGJA 2ZUQC 3T1FB 4ZXBB 5D7IF 3LKQB 2GJZB 2ORBL 3ARBC 5E6ZA 3FQUB 4NYLA 3RDTC 3MLPA 3C5SB 3MJ6A 4PJ9D 1Q9LA 1T89A 3ARGB 1QLRA 5E1AB 1C08B 2H26B 2G60L 2ILLA 4N0YL 5HJ3B 4P2QD 4RFNC 5HY9A 2Z4QA 5F7NC 4K2UL 4ZUTB 3SGJC 5F7DA 4CMHB 1QTYT 2X5PA 3HMXA 1FJ1A 2C1PB 2E9WA 3UTQA 3U6RA 1T89C 2XN9E 5F89B 4M7JL 1LP9F 2FX7H 1GGIL 4LMQI 5DA0B 3P9LA 4J4PD 1CL7H 1AIFA 1C5BH 1C1EH 2MPAL 3TVMB 2IG2H 4QHUA 5F9JA 4LHUG 3QXVA 1QEWA 2ESVD 5I76B 4HT1L 1YEFH 4FQXD 5DJXA 3G04B 5JHDD 3HNSL 2CXKA 3MNZA 2CUMA 3QNXB 4UNTA 4ODXB 4P46A 3QT2A 2A0LC 3SKOA 2NX5B 1FFNA 4K9EH 3SDCD 3NAAH 2OQJB 3BH8B 2VUOA 2YD4A 3CSYA 4L29B 1MCFA 2ZCHL 5L6YL 3BKMH 3HUJB 2Z31D 4IJ3B 1YNTB 1D5MA 3L5JA 4EN3A 2VE6A 4FQXB 5SWSE 1JI2A 4P46C 3QG7L 1KN4L 3GI8L 5E08L 1UJ3A 1X5YA 5TDOB 5IV2A 3VI3F 2IPUK 1QQDA 3RPIA 3D0LA 2IADB 5BOPA 5EA0L 4JN1L 2NY2C 4C56A 1OTTC 4TSCL 4EN3C 2MCG1 2DKSA 3VXSB 1JMZA 1IM9A 2Z31B 3K4DA 1K8IB 4PJBF 4XH2B 3ORJA 1UJ3C 1MWAA 4RIRA 3W5NA 1GC1C 2Z8VC 1NMBH 3GMLA 3DNKA 3L3OA 3JV6A 1VADB 3VFVA 2F58H 1D5BA 32C2A 3NCEB 4Z77A 2YKLH 4HJ0D 2RFXB 4P49A 3SDYH 1BFOA 3MRQB 3B9KC 2D2OA 4Q6IC 3LS5L 4ZS7L 3HNVL 3GSNA 5EOCH 3CMOH 1EDQA 2MOVA 3IFOB 2XRAL 3WV0A 3LHPH 2W9EL 3FO1B 2JB5L 5E8NB 3V4VL 3T65B 5A1AA 8CGTA 3AXLA 4XPFL 1F4WL 1G6RA 5I8KH 4LSUL 3QIUD 5K33A 4XNUH 4QTIL 3UMTA 3V95A 3SKJL 5BS0E 4PJEA 5D72H 2CJUH 1Q9WA 3G5YA 3V8OA 3P4MB 1U8QA 3VGAC 1M4KA 5IF0B 2O5YH 5IB2B 3O2VH 4PJIF 4N8VA 2VLLA 1UKQA 3SDAA 3SOBL 2DMBA 4MA8L 5EBMA 5C3TA 1AGDB 3LDBC 4LLYB 1RK1A 2V6HA 3I9GL 4RQQB 4QNPF 4AQ1B 2AQ3A 1K9TA 4LF3A 4UILL 3ZL4L 1HKLL 2F5BL 1T66D 1BD2E 4EUPH 4I4WA 4ZDHA 3QCUH 2NY3B 3SDAC 1V7ML 3H9YA 2V5TA 4LQFL 3VE0A 2I9TB 4G43A 4U49A 3ZDZF 3CDCA 2WWMD 1EGJH 2IEPA 3BZFB 5KAQG 3W0WA 2W59A 2CO7B 3MGTA 4XNXH 5HHOB 3G5ZA 3MLRH 4WHTB 1RUML 3GSUA 1VACA 3O8XA 2D7TH 4FQLH 3LRSA 5C0BD 4XC3L 3SGDI 4OGYL 1FZJB 4LLUA 4OM0L 5MI0B 3WLBA 1MSPA 5GGTH 3GMRB 3OB0H 1G7LB 3IB4A 1ITBB 5IHZA 1UKTA 4NRYA 1QUNA 1T1YA 1RUQL 3MLWL 5DYOA 1J1XH 4OTXH 3O8XC 1XR9A 4EBQL 4Q9RH 1I1YB 2HJFB 2DLFH 2XFXB 4U6TA 5C0BB 4G8GD 1F4YL 4ZOEA 2J88L 1RJZA 4HJJL 4NQDE 2QEJA 5JW4Q 4LCWD 1F3DH 3UJJL 3P4NB 5J8OA 1TZIA 3UJIL 2EIZB 2FSEA 5JW5A 1XIWB 1PYWB 2VXTL 4M62L 3D6GA 4Y0GA 4NOBA 3RWFB 2GY7B 2D7QA 1U3ZA 1B0RA 1RUKH 2X4TA 1PDKA 4YK4B 3KYMB 4G8GB 5I8CB 4U1SB 2V2XA 4Y4KD 3BDXA 3KJ4C 3QCVL 4R2GB 3ZTNL 1S8DA 3ME0A 1SBSH 1C5DA 3IFPB 5I30H 4XCFL 4PP1D 1B0GB 4BFIA 3OKEB 3ARFB 3W81A 1AI1L 3QO1A 4F7EB 1X7QA 2EO9A 4EUPB 1AGEB 1NH6A 5FAAA 4FP8H 4MGXA 2AV7A 2X4SB 1XZ0A 2NTFA 4PRNA 4LRNL 1PBYA 1DR9A 2B4CC 4PGBA 1IC5L 4UUJB 4RRPA 1YEIL 4XPAL 4Q6YA 4M6MH 1BWMA 5HHMB 3GHBL 4R90L 1UB5A 1A7NL 3EYSH 1VEMA 1PG7X 5CAYB 4IM8A 4LLQA 4BFEA 1FZMA 4MD4B 1YN6A 4H5SB 3NACL 4GSDH 1EFXA 4D9QE 1RVFH 3QXAA 3JZ7A 2IAMB 3QH3B 4UZGA 3UCRA 2QQKH 3WFBL 4JJ5B 3DI2B 1B4JL 5GRJL 1CLZH 3GIVA 3O41B 1UB6A 4R4BA 2L0DA 2VDQH 2FDBP 2FBJH 3STLB 5GRWA 3VA6A 3K3QA 4KDVA 4KPHL 4UU9B 1NBVH 4K23H 3VXRE 3IS0X 3ZYZA 3R4DA 5T3XL 4CNIB 2O5ZH 1NFIB 4U6VL 2E7HA 1I9RL 5B3NA 3K2UL 4PUBH 1N59A 5J7CC 3IDMA 2X4PB 4GG8A 4ZQKB 1I1RA 1HEZA 1ERNA 4OLZH 4P2OA 4Z7NE 1CDCA 1DBBH 2P43B 5EC2A 4OUOA 1OLZA 1JNLH 1CLOH 3DMMB 5I1LB 1DDHB 3UDWA 1BD2D 1TPXC 2XKUA 1ZAGA 1T4KB 1CF8L 4BH7B 4YO0A 4M48H 1LILA 1OT1A 1N6QL 3GO1H 1XR8B 1ZT1A 2J6EL 4G6AC 4P2OC 4KV5E 2OLDA 1J0YA 4JO2L 1IT9L 5C0DB 4YFLF 3UDWC 3T3PE 4BZYA 5BRZE 3WKML 4BSWB 1D7FA 4DEPB 4HIJB 1VKXA 4QRPA 3AU1A 4LBEA 3RIFK 3RVVD 4AZ8A 2DQDH 3RX7A 5FF6A 1MCWW 3G6AA 5IESH 1BM3L 5DJ2B 1S7RA 3CZJA 4JO4H 5CEXB 3WHE0 2NY6D 2ICEA 3HZMB 5EPMB 4X98B 4S1RH 2AVGA 5ANMA 1NDMA 4KY1H 3WFDL 4NN5B 1OTUD 2NR6D 3QEGH 4IS6B 3QDME 4JPVL 5FA3A 4HXAL 3V0WL 3L7FA 3L1OL 4HX1B 3REVB 4XT1C 1V7NH 4Y19E 1KJVA 4JZJA 4YDIL 35C8L 2DM4A 4R7NB 2YD8A 4LASH 5K9OA 4Q0XL 3KXFE 3ULVH 1C12B 1CL7I 4NM8L 2P5WD 2ZSVB 3G6JB 5B39B 1UACH 3RUGE 2F54B 1KJ2H 1OWWA 1RURL 3O4OB 1WWWX 5EBWA 4JZJC 2O61A 5BV7H 4Z7WA 3E8UH 4YQXL 2FEDD 3KWWA 3HRPA 4X0KB 2ZNXA 1MCRA 2AXHA 1ZWIB 4XX1G 3C6SA 4YBQC 1TCRA 2WUBL 4B7LA 3NPSB 1FORL 3JSSA 5GGRA 2J5LB 2P5WB 4UB0H 3T2NL 5DUML 1BGXL 1GAFH 5DD5L 3F58H 1RULH 4G3YL 2BVOB 5EUOF 3O6LL 3PIQB 4LVNB 4L8DB 4PY8J 4CVZA 1ZT7A 2E6JA 4O2EB 5IUSA 1HHKB 1X5AA 2A6KA 4RGMB 3HLAA 1BIIA 1MJ8L 4Z7VE 3QO0A 5CD3B 2V5MA 4ZAKD 3O81A 3D1MC 4FXKB 4BZ1L 4PP2A 4N8CH 4ELME 3KNBA 4P59L 3ZE2F 1WWCA 5DS8B 3UTSB 3NFSL 1OT2A 2R29H 4N9GA 2A9NH 3LN5A 3LS4L 1EBAA 4Z95L 3CFEB 3VXRD 2EDRA 3OQ3B 2HG5A 3CZFB 5FYLE 2CLZA 3UPRB 1JWMB 1I7TB 2IALA 1G9EA 2HTKC 4MXWH 3OKLB 1ZHNB 4LVOC 2VR9A 3PGCB 5JDSA 1KJ2B 5KS9F 1NMCB 4MQ7B 3MBEB 4M03A 3PWUA 1QFUH 5FUCC 1A1MA 1G0YR 1J8HA 2J3SA 3ZYJA 1HHJB 3SCMA 1J87A 5DURD 4U1NB 4X6EA 3KDMA 3STZA 2EDQA 1YJDH 1DN2A 2EYSA 1QYGH 1HHGB 1WIOA 3U30B 4OZ4A 4XGZA 1FSKB 2GSIB 3BUYA 2VISB 4DAGH 1LEIA 3ARED 4P2CG 1CN4A 4NSKB 2FX7L 4K7PH 3SCMC 3PL6A 4YZFE 1NSNH 1C1EL 3E6FA 1XAUA 2IG2L 4WJ5A 2B2XH 1AQDB 2YPLE 5DURB 4HMCA 1L9NA 5E6IA 2AK4B 4HH9A 2JELH 4YHZH 3C2AH 1YEFL 3REWA 1EHXA 5D7JB 3PL6C 2DQTH 3VFWA 3FOMA 2DDQH 4LP5A 4Y5XB 3O0RH 4POUB 1M05A 4K9EL 5E6IC 3NAAL 1GXEA 3BHBB 3KPPA 3GMPB 2AJXH 1MFCH 3QNZB 4JRYE 3BKML 4HF5H 4WFGE 3BPNC 3JTTA 5J4MA 2ENSA 2X1QA 4OI9A 2GTWA 3VXNA 4LPUA 1FRGH 3GSWB 1OAYH 2B7DT 2RJMA 1TCMA 5KSAB 1FO0A 3W82A 1GSMA 4PRIA 3VG9B 1HE7A 4WU7A 3D3VD 5F71A 3TYGH 1NEUA 1IQDB 5B21A 4MCZA 3E2HC 5DVOA 3QWOA 3GB7A 5I73B 1EO8H 1Q9KA 4JFPB 3V4UH 5ITFA 3WNMA 2WLZA 1NMBL 1KB5B 3MV9B 2F58L 1LD9B 3VMOA 1YEDB 1JRHH 3FFCE 3SDYL 2KBGA 5F72S 3ROOB 1KCSH 4KRPB 5DQJB 4RMSA 3BGAA 3NZHH 5EOCL 5MP6H 3CMOL 5KSBB 2DL2A 3LHPL 4Q74A 4PTTB 4JDVB 4LKCB 1I1AD 4ORGA 3BUTA 1G7PA 2GUOA 4HC1H 4UTAH 4PJXE 5MENE 5DK2B 4ONGH 3F7VA 2BNQA 5I8KL 1CIDA 1FAKT 1OP9A 4FQHA 4UTBH 3EJYC 4XNUL 4NKDA 3QPQD 4ZOCA 4Q9BA 3P77A 1KNOB 5D72L 2CJUL 5D7IB 4QTHB 2BERA 3IFLL 4RA0C 5DJZB 1P7QA 4JVPA 5D5MB 3VFRB 2O5YL 3O2VL 1OD7A 1WIPA 5KSVA 3RZCA 1XGQA 4WO4D 1QA9B 4L8BB 1MCPH 2R4RH 1NAKH 4Y1AB 4ZTPL 3MRFB 3B9EA 4X6CE 1MHPH 1KIUA 1KTLB 4LEOA 3B5TA 3ZSTA 4LRIA 4JFFB 3QCUL 5HPMA 4XVJH 5C0GB 5D2LF 3OXSB 2V9TA 3RZCC 4XZUB 1F4HA 1ZVSB 2HN7B 5BVJA 3PNWA 4RGNC 1M7XA 1EGJL 2Y1VA 5DC4B 5CSZA 4XNXL 3FB8A 1EV2E 1YMME 3OL2A 3BPCA 4LRIC 2ITDB 4O58H 2HYMA 2VWEE 2CRZA 2A6JB 1I3UA 2D7TL 3BVNA 4FQLL 4QRUA 1HH6B 2EE6A 4MA3B 1JE6A 5GGTL 4CADA 1U92A 4YAQB 3TBTA 3UEZA 4GBXA 5IVOA 4PBVC 4LSDA 3QJFB 4AEEA 5D7LA 1J1XL 3IF1B 4OTXL 2ZUVA 1QBMH 5A40E 1BZ9A 2DLFL 3EO9H 1FV1B 5T1KA 1ONQA 4GBXC 1J0ZA 1FFOB 4RFOH 1DL7H 4PJCA 4HHAB 4NO3A 3QIWA 3LPWA 4FOMA 5JPNA 2BY3A 4FFYH 4PD4K 3BP4B 3BAEH 1T7XA 2H32A 3IRZA 4NQEA 5K9KA 4Y5YA 2VXQH 1MCNA 1MUJB 4LLAA 3U4EA 1RUKL 4F3FA 3QEQB 3VDCA 3QIWC 3JWDH 3N1MC 5I1EH 1SBSL 1FFRA 4TNVK 4QY8B 4K94C 4ZSOA 4ENED 4MS8D 1AFVH 4KKLD 1NC4B 4JFXB 2GCYA 2CDEB 4Y5YC 2VITB 4P2RD 2ITCB 4FP8L 5C0IB 5B3JE 4JR9H 3KVQA 5CZXC 5JORB 3VCLA 5C8JA 4NC1E 5DHVH 4GUPA 2FECL 1WWAX 4PRBA 1OTSC 1HQRB 3RTQD 2VN4A 4M6ML 1DQDH 5E2VH 1AGFA 2APXA 1FG9C 4Z9KB 4X8JA 1F6AB 3VGGA 1UXSA 3QDGA 5C0RH 1T03H 5I1AB 1CFQA 1P2CB 2YEZA 3KPSE 3CSBA 3HPJB 4XAWH 4GSDL 3O3BA 4OIAA 1RVFL 2RGSA 3E6HA 3OGOE 3QFDB 2QQKL 5C6PB 5FO9A 2DQHH 4JHZA 4PJFE 4JN2B 1Q38A 1LE5B 3TBWA 3M17A 4FQJH 5CBAB 1CLZL 4ZO8A 4NJ9H 3QFJB 2VDQL 5T1LD 1J8KA 2FBJL 3HCVB 3RGVA 1YECH 4R96A 1N4XH 1NBVL 1SMAA 4GLRH 4K23L 1CDHA 1QSFA 2WBWB 2HT2D 3V0AC 3IFNH 3MV11 3NZ8B 4BH8B 3L3HB 4HK3J 2O5ZL 4H8WC 4BQ9A 3V5HB 4AEHH 5F21B 1W0WA 4MZ3A 2APFA 4PUBL 1RFDH 1XF3A 3RGVC 4OLZL 1DBBL 4MAYD 1V3JA 2GEEA 3MC0A 3UXFA 1CFBA 2XACC 1JNLL 1CLOL 4HGWA 2R23B 3OR6B 4BSJA 5IEKA 4M48L 3TESA 3GO1L 1TQCC 1XGUB 4YHIA 3UJTH 2XTJC 4WI3A 3KHQA 1N64H 4LAJH 4M6AA 4EOWH 2EIEA 4MAYB 1RAMA 5LCVH 4KK8D 3OHXB 5DHVB 5EZJB 2QTEA 5CSGA 5C0CE 1BF2A 4R97B 4KXZI 2XQBH 2DQDL 3EJZD 4ZNEA 4PJBA 1BREA 1EAJA 3GJEB 5IESL 4O4YH 1S78D 4JO4L 3P4OB 2P5EE 2YRZA 5JLZA 3FZUD 5ISZE 3O9WD 3C9NA 3NFPB 5ENWB 1QR1A 2O93L 4HJGB 4S1RL 4PRPA 5DZOA 3JVGA 3J8F7 3LEYH 5IR1A 1EMTH 3FB6B 3QEGL 3HI1A 5JPMB 4HFWA 5HYJE 3SKMA 3S7GA 4GW4B 4KJQD 3T4YB 3VFTB 5KVGH 1V7NL 2G5RA 3JVGC 2AABH 3AFLA 5CFHA 4I5BB 3SHSA 4J8RA 4HDIB 1IKFH 2D4DA 3BRDA 4LASL 1MHEA 3ULVL 2VSDA 5DK3A 3DRQB 1UACL 2VRAA 3F7YB 3LB6C 1KJ2L 2L7JA 1H8NA 1N2RA 3RQ3A 3SDXE 4CMMA 5BV7L 1T7VA 3E8UL 1BX2A 5JW4M 5LVEA 4N5EC 3QRFM 2LAGB