2BOCB

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocB01
3FB6A 3QISA 5B39A 4EKXA 2W9DH 5B21A 1BREA 2E9WA 1ZK9A 3KJ4C 4ZAKD 5FCUL 3ROOB 2EDOA 2FX8H 3ARBD 4ZFFA 3D2UA 3IXAB 1G9ML 2JCCB 4FZEL 4ODVL 1QBBA 1IC4H 2DI9A 3ARGC 4AZ8A 2J8UF 2VE6A 3LV3A 1EX0A 4KFZC 3OKMB 3GGWA 5EN2B 5A2LH 3HAEG 1YJDC 4JREC 1Q0XH 3WNPA 3OAZH 1M7IB 1SHMA 4PREB 5DJXA 4OM0L 4CVXA 5E1HB 4WO4D 3FB5B 1KYOK 3KDMA 9CGTA 2ZP0T 5L6YH 4HFWB 3FTGB 3R06A 4H1LG 5I1IH 2BOBB 1ZWIA 3QXAA 2XT1B 5FV2A 5C07E 5C7XL 4GMSH 3ULVH 3AC0A 5C0DB 3SE3C 1IAIL 3SCMB 4LSRL 1PQZB 1DBKL 2PW2A 2MKWA 1NBZB 4TSCH 2Y5TA 3WXVL 3QXWA 1YPZF 2G5RA 3X3GH 2O5XL 3WFCH 2OMBA 4POYA 1NGQH 3ROOA 3DROB 3IXAA 4UV4H 2DLFH 2JCCA 2V9TA 4OLWH 4JB9L 5DC9B 3GI8H 2EEAA 4ZTOH 2AJVH 4E41B 3RPIA 3OKMA 2DQCL 3L1OH 2ENYA 4DW2H 1BAFL 3TVMD 1M7IA 2CDFB 2BNRE 5I66B 1ZLWH 3FB5A 3FMGL 3T2OA 1RZJL 1F6AB 3MYZA 1YNTB 5CJXA 4NN5B 5IVXF 3FTGA 2RAMA 2BOBA 4X83A 4D0DB 2NY0B 3QIWB 4PS4L 3ZTJH 4ONHB 5DD0H 5KW9L 3C8KA 1MCCA 5DD3H 4ISVB 4PRID 2Z31C 5C0DA 3CSGA 3SCMA 3B9KC 2FEDC 1NBZA 3O4LB 4KK6C 1N2RB 2ADJB 4OF7A 4C4KO 2LTQB 4OLVH 3DXAD 5IHZA 3MV9B 3DROA 1EEYB 5EO1B 3RGHA 1A7QH 1Q72L 5FDYA 1HE7A 1L9MA 1QPXA 1QTYT 3ZKNC 1CTNA 2RHEA 3FJTA 4TVPH 2JIXB 3AROA 1HDMB 3MSPA 3UAJC 4E41A 2E27L 2UY7A 3GDBA 1MCSA 2EDEA 3RTQB 5CZXD 2CDFA 3OAUL 3HE7C 5I66A 2BNQB 1DZBA 2CKBH 4PGEB 1GRWA 1OSPL 1F6AA 3JV4B 1F13A 3RWEB 1YNTA 4MA3B 3VGFA 5A40E 4CKVX 2NTFB 3MJ7B 1I9EA 4YFLF 2CQVA 4D0DA 2PTVA 2B2XH 4OGYL 3QIWA 2X6MA 4ONHA 3BYTA 3IFNL 3PP3H 1EHXA 1EGJL 5E03A 2C9AA 1KPUB 3S96B 4YE4H 1VFOA 1HEZB 2XZQL 3O4LA 4R2GB 1IAII 1N2RA 5BVJB 1CE6B 2ICWI 3PDOB 3MOBL 1ND0A 3V7AE 5K59F 2DQGH 2MCG1 4WUKH 3MV9A 5SWZE 3WNNA 4M48H 2N7BA 5D5MB 2HTLC 1JGUH 4WW2F 5T1LD 4XB8A 5E9DA 4BA8A 2JIXA 2FNBA 3B9DA 1I3RB 3O8XD 5DJ0B 1GPOL 3MLZH 1ADQL 2P7TB 5IFAL 1SJHB 3PWNB 2XA3A 3RTQA 4Z7WE 4LU5L 4GQPH 4PJHE 4BQ8A 4MNQD 3C6LD 1QLFB 2BNQA 3JWDH 4U1KB 3GJFH 4PGEA 4HKZB 3JV4A 3RWEA 3DGCR 4MA3A 2R23A 2B7DT 2E7BA 2NTFA 3MJ7A 3MBXL 3JZ7A 1FNGB 5CGTA 4HX1B 2P43B 2AXGB 5F9AC 1S5IH 5D6DA 2OK0H 4PTTA 1JGLH 1F90H 4NO5B 2OI9C 5EULV 2AJXH 3BDBA 1KPUA 1YN6B 3LS5L 3MXWH 4Z7UB 5HI4C 5A3ID 5IB1A 4P2CG 3THML 1HEZA 4Y4FB 4I3RL 4P2RB 4FQQB 3WD5L 4GFTB 5C08D 5BVJA 3CU1A 4EEEA 1XIWB 1CE6A 3KJ6L 3PDOA 4HPYL 3MA7B 4HPOH 1P84J 4G80B 4PRHB 1UACH 5I17B 5HHXH 6CGTA 2PYEE 3QNZB 3LDBB 5D5MA 4X0KA 5TDNB 2XKSA 4ZPVA 5DJ0A 2G60L 2GQHA 3CMOH 5JIHA 1ZANL 2P7TA 5CJQH 1SJHA 4YHYC 3T65A 1QSED 1FHGA 2EDJA 4NQCE 3B2UC 4BFBD 4P0DA 4LLVB 1QLFA 4U1KA 4JZNB 1QEWA 4HKZA 3DETC 5D1XC 5JW3H 3PGFH 4P46B 1FNGA 1K8IB 4FXGB 4HX1A 2AXGA 1ZLVK 1FGNL 3ARDD 1CR9H 3DMMB 2ZCLL 4KI5D 1YEHH 4QNPF 1KIQB 4XI5C 4LVEA 1TVDA 3K81A 1YN6A 4PJ9C 4Z7UA 1ZOXA 4Y4FA 3C5ZD 3ARXA 1EHAA 4P2RA 4FQQA 5DMIH 4Z0BL 3OJ2C 3UBXG 5HHVH 1XIWA 4JG0L 4FFZL 3MA7A 1QLEH 4G80A 2G5BB 4LHJB 4PRHA 3EJYD 4PJ7B 5I17A 2AABL 3VWKA 1KTLB 3QNZA 5JOFA 1LGVA 3RGVC 5DUML 5MI0B 1ZKAA 3E8UL 4IM8A 3OF6D 5TDNA 2KQMA 1Q9LB 1S3KL 4PLKD 2Y36L 2EC9U 1ZVSB 3GMNB 2W92A 3BKYL 4TOYL 4OCYL 5SX5K 4Y19E 4GG8B 1QQDB 3QWRD 4KK8C 1KACB 4ZQKB 3UTPE 3HC4L 1U8KB 1E4XL 2J12B 4JZNA 3VXUB 4PJAF 4MQTB 1QKZH 1B0WA 5IESH 4P46A 4J3OC 4CJ0A 2V5YA 2XRAH 2QV2A 4WVRA 1K8IA 4FXGA 4RDQG 5F1IB 3KPSD 2F54D 2EECA 3DMMA 1KIQA 1KCKA 4LOUD 5CZVL 2IFGA 5C0CE 3IT8D 3BEVB 4MZ3A 1TMCB 3BPCB 5DHXB 3VGGA 3D18A 4IIQB 4LFHD 5F72S 1K4DA 1H5BC 3BXNB 2IAMC 5EUOB 2CXKA 4NUGL 3IFOB 5MENE 1IC5H 1KTLA 3X13B 1RZ7H 5BO1L 2V7NB 2GITB 3WKNA 5E8OA 5GGTA 2E7HA 1Q9LA 1MFBH 3EAKA 4GMTL 4HC1L 1ZVSA 3GMNA 1P9MA 1TCMA 2BY0A 4GAJL 4A6YB 2QADD 1QQDA 1FQ9C 4QRPD 1YY9C 4ZQKA 4LSTH 2OP4L 4XNMB 3V6BR 2MCPH 3VXUA 3EBAA 4KVNH 4BSVB 1H3PL 4WV1A 1E6JH 5FM8A 12E8H 4PJCE 5F1IA 4X7TA 5DMYA 3VWJB 3NAAL 4U49A 2B4CH 4XCEB 1KC5H 5T3XL 1GC1C 1KCRH 3HAEB 1DE4B 1HH6B 4YWGH 5KZCD 1RJYB 2W9EH 1I9IH 4OIIL 3IAQA 4NZDA 4KH2A 2VQ1B 4IIQA 3RDTB 1KJ2H 1N64H 3BXNA 4H1LB 4H8WL 4LLMB 5DLMH 4G6JH 4YEFA 4PP2B 1P84K 5EUOA 2HKHL 3QI9B 1F4XH 4N0RA 3IFOA 4QOKB 3TCXA 5KVDL 5ICYB 3X13A 1N0XL 4JFDE 4XP4L 4R4FH 4M1DH 2NY6D 5TF1H 1DVFC 2VDOL 5IB3B 5BMFL 2V7NA 3QHFH 3UC0L 3H42H 4A6YA 2R0ZH 3GI9H 1J0KA 5I8CB 4KROB 1I3VA 1FFRA 4NGHH 1RZFL 5CGYC 2MKLC 1IEBB 1CYGA 4X7SL 4NUJB 2AJSH 3TV3L 3UZEA 4XNMA 1R3KB 3V6FB 4NM4H 4QHUB 3HG1D 4BSVA 3C2AH 1OCWL 1UWGH 3U4AA 4WTXA 3G6DH 1TFHA 4S1QH 3VWJA 1HNGA 5ILTL 4XCEA 3WKMH 5JLZB 5DHVH 1DE4A 1HH6A 1MF2H 4QXGH 1RJYA 1W0WA 2CUHA 2HH0L 3I2CH 1NLDH 1VENA 3ZDZF 3SE8H 3U0TB 2AW2A 3UTZB 1I8KB 2VZVA 3HR5B 3KPRE 2CKNA 2VQ1A 3CAFA 4I77L 3WS3B 1J1PL 3RDTA 3V0WL 4KHXL 4H1LA 4G7YH 4LLMA 2NW3A 3V4PL 4PP2A 2HN7B 3QI9A 1ZHKB 4QOKA 5ICYA 3JSSA 3UTTD 3CXDH 2FGWL 4OLXH 4RFEB 5IB3A 1T1XB 3EYSH 1R24A 1G6RL 4YFEA 3OPZL 3QJFB 4XPGL 2NY3D 5CD3B 4ZXBC 4WU7A 1KCSL 5HHOE 5I8CA 1P1ZB 4ENED 2EDRA 4JRYA 1X6NA 3QDHA 1IEBA 2A9NL 4K8RL 4LARL 1R3KA 3V6FA 5E5MB 4NOBA 4QHUA 3VXNB 3GBML 2XZCL 5F8QC 3MV7A 5LGHL 3HPLB 4XPHL 2OL3H 3M1BB 4YH6A 4L5FL 4PRNB 2OZ4H 2NMSA 5JLZA 4LIQE 3S3SA 2GCYB 1RV6X 4M5YL 4F9LC 2VDKL 4G3YH 3B6SB 1HSAB 3U0TA 3UTZA 1I8KA 5CINH 3G04B 3CK0H 4Y16C 5IJKA 2GAZB 3WS3A 3EOYG 32C2B 2DLHA 1ZHKA 4FS0A 4XCFL 1I3GH 1S7UB 1NUGA 5J06A 1HHKB 1WFNA 4RFEA 1T1XA 3EZ8A 2EDBA 3VRLF 3QJFA 3CDGB 1FZMB 5JO5B 1BJ1H 5CD3A 5AZ2L 2N1KA 3UPCA 4EDXB 1YQVL 2CLZB 4GRLC 3MLYL 3RX5A 1BLNB 4D9LL 1I8IB 1GXEA 3VXNA 4Z9KB 5CILH 2AGJH 3V6OC 5IHLB 4Q74A 4L3ED 2D9CA 2W0LA 3HPLA 3CX2A 1JN6B 5DYOA 3M1BA 4HUNB 3CXHJ 5SV3A 1AQDB 2D7TH 5C8JB 2MJWA 3W9EA 2DQTL 5ITBL 1RZIA 4J3XA 1GGCL 2GCYA 4XP6L 3LN5B 3B6SA 5IQ9B 4RGNE 1HSAA 1T66D 2X05A 5TPWH 3G04A 4Y4KC 2GAZA 4XNUL 3MCG1 1E4WL 2R1XB 2W91A 2R15A 1UVQB 2LE9A 4KKBC 5JUEL 4HIJA 4KK9C 5L8KB 1U8PB 1NLBL 3NGBC 5JHDD 1MCOH 1S7UA 5E8PB 1RVFL 1IZJA 1HHKA 1HHHB 1NDGB 4L4VB 2FJFA 1G1CA 1SEBB 3CDGA 3ES6B 2BCKA 2DMCA 2NY2D 3F7VB 3NCBB 1HYSD 4EDXA 1AQKL 2CLZA 1G7HB 5D1ZB 2R0KL 1BLNA 3KPNB 1VFAA 3GSWB 1MJ8H 4W4OC 4KTEH 1I8IA 5T1DH 4RWYH 5D2NE 3B9EA 4XMLL 3VFSB 5ACZB 2QQQA 5H2BB 1CGYA 1LP9E 3QUMB 1A0QL 1U3HC 1JN6A 3V7MA 1T0PB 1T20A 4M1GH 2CH8A 2F53D 1Z3GH 5C8JA 4Q2ZB 4C56D 1AJ7H 1PBYA 2H45A 4HLZG 3MNVB 4K7FB 1T6VN 3LN5A 1MHPH 1MIEL 3EOAB 5IQ9A 1FYTB 4ONGH 2R1XA 1UVQA 2RBLA 1JYXA 3EOTL 2XZAL 1U8PA 4NOFA 2AJZB 2EIBA 3OJMB 1ACYL 5E8PA 4KKCD 2FATL 4WFHE 5H37G 1HHHA 4MXQD 1CBVH 1KCVH 1NDGA 1B9ZA 1LO0H 4L4VA 4WUUD 1SEBA 5EBWB 5KS9B 3MXVH 2NPLX 3MOAH 1NGPH 1F3DH 5EOTA 5ESQB 3LRGA 3ES6A 4ODTL 1XF4B 4WEMB 1NBVL 3M8OH 3WDJA 3UBXB 1BZQK 1JYWA 1G7HA 3QXTA 3DI3B 2VC2L 2BX5A 3KPNA 2ESVE 3ARVA 3L6FB 5JIKA 5MEQB 3GSWA 4FQCH 3REVB 4XP1L 3SQBA 1CXIA 5BJTB 1FO0L 3SE4A 1QFOA 1SY6A 1Q94B 3VFSA 5ACZA 5H2BA 4WWID 3VI3F 2XYCA 3QUMA 3VXMB 1JGVH 3DBXB 4YXLL 1BGXL 2P24A 2Y6SD 1M7DB 5D7IF 4D8PA 3GZKA 4Q2ZA 3GSVB 3MNVA 4LSQH 1JRHL 2FX7H 4K7FA 3EOAA 4IRJB 1U8NB 3RKDD 1EH9A 1CGVA 3K8KA 3AGVA 3IDYB 4HWBL 2AJZA 4KKAD 1GGUA 2COQA 1L6ZA 1RHHB 3B2VL 4M7KH 5I15L 4J4PA 3ALWA 3HA0A 1Y18B 1QSFE 2UWEA 5EBWA 5KS9A 3I6KA 4G6FD 4POUB 5ESQA 5I71C 4M8VA 1XF4A 3QDMB 5T1KD 4OJFH 4UB0H 4YHPB 3VA2C 3UBXA 3MV01 2FX9L 3KXFA 1FV1B 4OGXH 1DEEB 2XKNB 3MBEB 3L6FA 4HGWB 3REVA 3IDXH 3PF2A 1H3VA 1UWXK 1UQSB 1Q94A 5LWYL 1PEWA 2E6QA 5D96C 1WTGT 3O6FA 4LCIL 1M7DA 4G9DB 3CXHK 1OAXH 3DSFL 1S7QB 3H7LA 1J7VR 3BIKB 3GSVA 5CEZL 3KS0J 5JXED 5GRZA 4IRJA 1U8NA 5IVOA 1IL1B 1U6AH 1FNLA 5J12B 1XAUA 2DQHL 5JR1L 5ENWB 1J87A 1Z6JT 4O58H 4FQIL 5JW4M 2CRMA 3TO4C 3P73B 1PDKA 1IFHH 2ATPB 4TSBH 1Y18A 3BKCL 1T89C 3RVWD 3K4ZA 2D03L 4JFXB 2HYMA 4C57C 1NGWB 3JWOL 3CVHB 5LGKA 1SMOA 5DTFB 3RL2B 1CE1L 3QDMA 2Q8BL 5C0RL 4QT5B 4YHPA 4AEEA 3IFLH 3MRDB 5DUPL 4EZMA 3I9GL 5HI3D 1FV1A 4Y5YC 3V0VB 2OR9L 2XKNA 3MBEA 1NC2B 4BELD 3PWPD 4M3KB 2N56A 1UQSA 3BD5A 3LQAH 3GFUA 3MRCA 4F3FB 2ZZUT 4P3CH 4TRPH 3GIZL 4U6XA 5CLTA 4RGOL 4G9DA 1EUUA 3MJ6A 1CI5A 1UKQA 1LDSA 2N7AA 3MV8A 4NN7C 4MAUH 1S7QA 5EZLB 5ELIA 3RAJH 3BT2L 5CKGA 5FO9B 1AO7E 3GMLB 4HK3J 1FBIH 1A22B 1JRHI 3QQ3B 1IL1A 1OARH 2LU3A 2VXQH 3UJJL 5DRZB 4EI5C 5ENWA 4RBPK 4HJGB 2R9HC 4ZO8A 1XH3A 4XC3H 3P73A 2ATPA 2YPLE 2UY6A 4JFXA 1NGWA 3CVHA 5IQ7H 1OAZH 1CLZH 4NO0B 3RL2A 3QQ4B 4PJEB 3MRDA 5DXWA 1K5NB 1YPZA 4H0HB 5SX4H 3V0VA 5KSBB 5F7MC 3VFRB 4UU9B 2V7HA 4WWKB 5BZWB 3HMWH 3CFIC 1YEEH 4WFED 5GJTL 4RAUB 3DJ9A 3JTTB 4OZFH 4F3FA 3EO9H 2D31A 3PXJA 1MFEL 3TO2B 2DIBA 4X4ME 3AREA 1CGSL 4OCRH 4I2XA 3QPQD 4XZUB 3ARTA 1NUNB 4HDIB 5EZLA 1N6QL 1WBZB 5FO9A 3I6GB 1IILE 2ICCA 3GUTB 3GMLA 4DGYL 4UOJA 2ORBH 2UZYB 1WQVT 3TBWB 3QQ3A 4WHYG 1QUNA 5IVXA 2JB5L 5DRZA 2F74B 2RFXB 4YHIB 1OLZA 4HJGA 4TYUA 3BVNB 3D0VB 5HHMD 4DAGL 3BZ4B 3QIUB 1DCLA 4G8FB 3PGCB 3HNTL 3QQ4A 4P3DB 4PJEA 1K5NA 3S98A 3VXSD 3MYJB 4OZGE 3WNKA 3VFRA 2XTJD 1QBML 4UU9A 5BZWA 2BXYA 5JQHC 4RAUA 3JTTA 3GJEB 3TO2A 1FRGL 2FBJH 4MA7H 1RU9L 4NQTA 1DQDH 3CSYA 4XZUA 1N5AB 3MA9L 4HS8H 3S35H 3BQUC 1QO3B 4JY5L 1WBZA 5KSAD 2XPGB 3I6GA 3GUTA 4OZ4A 3IAPA 1IT9L 1Q9KB 3LPWA 2XN9D 4I0PD 1F8TH 1YYLL 4JLRB 3TBWA 3NACH 2F5BL 3CSPA 4P9MH 2ZPKH 3VCLB 3HUJE 4KJYA 5FYLD 1FNHA 4LAQH 2F74A 1V7ML 5BS0B 1SJEB 4YHIA 2NY1B 5DJZA 1TTFA 1X5LA 1XGYH 5GGVL 3BVNA 3QUKA 2LVCA 3D0VA 2ILLA 3BZ4A 1SBSL 3HE6C 5FYKU 5CSBA 3PGCA 3TPUB 3GBNH 4P3DA 3I02B 3I3DA 3JXAA 1A14H 4X9GA 1MFAH 1U58B 3X12B 3IDIB 1II4E 3O4OC 1VPOL 4OSUH 1T7WA 3FFCD 4WGVB 3VGAC 4WW2A 5F96H 1JZ2A 4ZO6A 3GJEA 5KVGL 4LPVA 3IDUA 4FFYH 3NABL 2WUCL 1N5AA 1HIMH 1QO3A 2HJFB 4XNYL 3ZKSD 4ELMB 1FZKA 2XPGA 3F7YB 3TA3C 1Q9KA 1I9JL 3BD3A 4JLRA 3U7WH 3WO4B 1ACZA 3BHBB 4NM8L 5J6HB 4DUXA 5BS0A 3C60B 1SJEA 3GIVB 5CLWA 2FWOA 1F02I 1BQSA 2HLFC 2W60B 3LH2H 5D7JC 3TZVD 3QZWG 3K3QA 4G42B 4IRSB 5CP7B 3BOVA 5DQ9B 3BMVA 5EIQA 3SDDD 3TPUA 4DK3A 4EUPH 3I02A 4ZOEA 1LO5A 1U58A 3X12A 4Y5VC 4X7CC 3UTSB 2DD8H 3C08H 5CSGA 3SJVD 5AG9A 1F3JB 2Y06L 1DBML 4K2UH 4JJHA 3Q5TA 1QVOA 1TJIH 2HFEB 4Z7WF 3STLA 4Z7NE 5GS2D 4AIXA 2HJFA 4ELMA 5KTEL 1NEZA 1GAFL 1WEJL 2GY7B 2AJYL 3KYOA 1TVHB 4O4YH 3MCKB 3WFBL 2AEWA 4PRAB 3D39D 4PY7B 1OWWA 4PG9B 2J6EL 5K9JL 4PJAB 4PRIE 3BHBA 5J6HA 3CNKA 3L3GA 3ZE0E 1EO8H 2X1QA 4ZFOL 1KEGH 3C60A 3GIVA 4YHZH 4WI6A 1QBLH 3MFGB 2W60A 1CFVH 2VZSA 4JFOB 5C0JB 4L4TD 1ZHNB 43C9B 1J8HD 4IRSA 1IGTB 5CP7A 4Q6IB 1IE5A 4BZ1L 2V5MA 1K6QH 5A2JH 3O9WD 5KAQF 4NQSB 2HKFH 3HMXL 3GSUB 1NCNA 2CRZA 3OKEB 2PYFB 5C09D 1F3JA 4IRZL 4OLUL 2HFEA 3QFJB 5K9QG 1KOAA 4U1HA 5D7LD 3O3DA 2JJVA 4NBYB 1JNLL 1GVIA 5KVEL 4RGMC 2DAVA 4HD9A 5L88L 1TVHA 4M02A 3P30H 4PRAA 4PY7A 4PG9A 2CMRH 3LHPH 4PJAA 2ARWA 4Q97A 2OSLB 4R26H 2DQDL 4RX4A 4IS6B 5E2VH 3V4VL 4OD2B 3MNWB 4AM0B 4HFUH 1J1XL 1GH7A 1WIOA 1FPTL 5C0JA 3T77B 1ZHNA 3KR3L 4QO1A 3U4EB 3NCYP 1BFSA 1IGTA 4KRMB 1X5IA 4Q6IA 3S36X 1MAMH 1WWCA 1CDUA 4NQSA 3CUPB 1EFQA 3GSUA 1MRCH 3OAYK 2YD1A 2PYFA 3LIZH 4PJ5B 2IH1B 5EOCJ 3R8BB 1JE6A 1FLTX 4JZJC 4FNLL 1BIIB 1FC2D 2R69H 3HZYB 4MNQE 4R4ND 1EV2E 3LB6C 4W70A 3RWJA 4ALAL 1AGEB 5GRJH 3F58L 1FG2B 3AB0C 4ZO7A 1AFVL 2Z91B 2YXFA 1GYAA 1P6AB 3VMOA 5C1MB 1I4FB 2OSLA 2YD7A 5H8DA 4IS6A 3NA4A 3MNWA 4XVTL 4UINL 1SJVA 4AM0A 4MB3A 3T2NH 1U2CA 2EDQA 5C08E 3T77A 2WWKO 3ZYIA 2J5LB 3U4EA 3MO1B 4WFGD 4P23D 1NAMH 4QCIB 5C0NC 4PGCB 2X44D 3DURB 3CUPA 4OGZA 3BFOA 5ESVB 5FCUH 4HMCA 4LHUD 2EC9T 1G9MH 4EOWL 2XV6B 2VDPL 4FZEH 1VDGA 1QSEE 4ODVH 5F7NC 1BIIA 4ZDHA 3HZYA 4BZYA 5DJ2B 4WCYH 3IF1A 1VGEH 1AGEA 2DRUA 3LPGA 3WIIL 4G6KH 3EJZC 1FG2A 4MNHB 3IB4A 2IADA 3JBG7 5IFJB 4MAYB 1MRFH 2E8YA 2WP3T 2OTWB 1EEQA 3CFDB 4OM0H 2NXZB 4KI5E 4ZUSA 2QHRL 5JZ7D 4ZYKB 4G6AC 4KXZI 4R97C 1I4FA 3W2DL 3W9DB 1CICD 4K23L 3BJ91 1W8NA 1YEDB 1W72H 5C7XH 3P2TA 3ULVC 4NHCH 3MO1A 1ZGLP 1TTGA 1IAIH 4LSRH 2HJLB 1DBKH 3DURA 3WSQH 5FOJA 5D1QC 1LEIB 3KJ4B 5EIVA 5LQBL 3WXVH 5HI5D 4L9DA 5DRNB 5FHAL 2O5XH 1RZ8B 4MCZB 5ESVA 3V8OA 3ARGB 3QDGD 4JB9H 1YEIH 4BYHA 5J6GB 1KBGH 4RAHA 1MCQA 2DMBA 1IAIM 2KH2B 5DJ2A 1O7SA 4XNQB 2V9QA 4JREB 4KRPD 1LD9B 2VXUL 5JDSB 4MNHA 4APQD 2DQCH 1T83A 1V3MA 5E5UB 1BAFH 4MAYA 5IFJA 3NIGE 2OTWA 3MGOB 3CFDA 3KPSE 2F54E 4LCWB 2A6DB 1A9BB 1RZJH 3RY6C 2HVKB 4NNXB 4HUXA 5AWNL 2HFGH 5B22A 3W9DA 1XGUA 1T7ZA 4WO4C 3B5GA 4K3DL 1YEDA 2IWGA 4HXBH 4QXWA 1NPUA 1KFAH 4U0RC 1QD0A 4LIQL 1DSFH 4FQXD 4A2LA 4LMQE 2HJLA 2XNAB 3PL6C 4NCC2 1LEIA 4LSUL 5AZEL 3OMZA 1AP2A 5D2LF 1AC6A 5DRNA 4N0CD 2ICES 1RZ8A 4BQ9A 1PX4A 1TZHB 3VGHA 1UYWL 1Q72H 3ARGA 1A7RH 2A0LC 4QRUB 5IMKB 5C71A 1MHHA 2CIKB 4XNQA 3EYVB 1LD9A 4GG6B 2VLKB 2HT2C 3CPLB 5JDSA 2OM5A 1T03L 1J88A 2I5YL 2J8OA 3MGOA 5HVFB 5HDBE 3B4NA 1M7XA 4LCWA 2A6DA 1OSPH 1A9BA 1ZS8B 2I60L 1SVCP 3QUYD 1N26A 3GRWH 5EBGA 5J7CC 4OGYH 1JNHB 2Z31B 4HKXB 4HLJA 4GJTB 3SE3A 1S8DB 3B9KB 3IFNH 3H3KA 3MRMB 4TUKL 1EGJH 5IB4B 3QG6B 3DX6A 4C58B 5LCVL 2XNAA 1JTPA 1MI5B 2XZQH 2GJJA 3F7PC 3V5KA 4JHAL 3MOBH 2R2EA 4XXDB 2DQIL 5DC0A 1TZHA 3KYMB 2RCSH 3LKRB 5AYQA 2OTPA 1X4XA 2ERJC 2X4RA 2P5WB 3QZWB 4GW5B 5IMKA 2CIKA 1OGAB 3EYVA 1GPOH 2WLYA 4GG6A 3HG1E 1ADQH 5IFAH 2APXA 2VLKA 3HE7B 4YXKL 1A4KA 3TN0D 4MD4B 4LU5H 1CXFA 5JPNA 2BDNL 1MLBB 3JWDC 4ODBD 4CN6A 1EO7A 5C2BL 4K3GA 1ZS8A 3OKDB 5GPRA 3V95A 2J1KA 1UXSB 3OR7B 2ED9A 2V2WA 2JE8A 5EOCL 3V4UL 1Z9MA 1OVZA 1JNHA 2Z31A 4HKXA 4LLYB 1H8SA 1S8DA 1OAQH 3RVVC 1C5CL 3B9KA 3MRMA 2FHBA 5IB4A 3QG6A 4BSWB 2VWEE 1I1AB 3FZUC 3ZT5A 2E3VA 3LS5H 1KCUL 4PJFE 3THMH 1CZ8L 4O02L 1ZLUH 2ZSWB 3UTTE 3D2UD 4BK4A 1MI5A 3RP1A 3WD5H 1LDPH 2H2PD 3ULSB 1T3FB 1DL7H 4XXDA 4OZHB 4IJ3C 2P5EB 1AD0B 3KYMA 4LCYB 3LKRA 5CWSB 5DD5H 3VDAA 3QZWA 4GW5A 3FB8B 2WBKA 3CDFA 4JPVL 2YPVL 3ZDYE 2LQRA 1CU4L 4LBEB 3HE7A 1ZGLB 4CDGC 2PO6D 4Z7VE 3L9RB 4MD4A 4K3HA 1F58H 3O8XC 5F97E 1MLBA 2IPUG 1X5GA 2F15A 4QHKJ 5FGSA 2HVJB 3K4DA 3OKDA 1LP9F 4YBQD 1UZ8B 3ETBF 1KXQE 4IHOB 3OR7A 4CNIB 4HK0A 1DBJH 1BJ8A 5HGHB 4P2QE 2OI9B 4LLYA 2P8LB 3MX0A 5BZDB 1INEL 1FVCA 3H0TB 4ZD3L 4BSWA 1YEGL 3RQ3A 4KJQC 4R90L 2GK2A 2YOCA 3SOBH 2J4WL 3CFCL 4NYLB 1KF9B 4Z0BH 3VH8G 2HTKD 4JG0H 2VLRB 1GGIL 2DBJA 4FFZH 3ARFC 1T3FA 2VKWA 1F4YH 4OZHA 5CBEB 1OD7A 4LGPB 4YDIL 2P5EA 4OCSH 1AD0A 4LCYA 1MPAL 4JRWA 1EUTA 1P7QB 3L95B 1U8QB 3G9AB 3FB8A 2YRZA 5DR5L 4YHYB 1D5IL 3BRDA 5L7XL 2Y36H 3EFDL 3T8XB 4LBEA 3W82A 5CJBA 3BKYH 4TOYH 4OCYH 1ZGLA 3L9RA 3MTRA 4L3EE 1S78D 4GAGL 5D1XB 1MCEA 2A77L 4Q9BA 2HVJA 2VRAA 4PV9B 1UZ8A 1MLCB 4IHOA 4OIBA 4CNIA 3SCMD 3AM8C 5HGHA 3HI1B 2Q86B 2P8LA 5BZDA 4PJ9B 5GRXG 4M5ZL 1CF8H 3X14A 4FQLL 2DQUL 5JHDE 4NZUH 3EHBD 4HWBA 3NBNA 4NYLA 4WI2A 3CLEH 1PG7L 1YC7A 3ZHLA 1IM9D 2VLRA 4OLYL 4PB9L 1JPST 3RGVB 4E41D 2E7CA 2AK1L 5CBEA 4Y4HD 2XQBH 2F5AL 3L95A 1G0XA 2EZ0C 1U8QA 4P9HC 5BO1H 4U4BA 4RFNC 1QFWH 2XY1A 4GMTH 1XR9B 1XMWA 1X9QA 4JM2C 3T8XA 4OFVA 1FCCA 5K33A 2IPTL 3FRUB 1NCCL 1FAIL 1BECA 5D1XA 2NY0D 1KTRL 3QIWD 4PLKC 4JR9H 2OP4H 4J3UA 1NGYB 2F53E 3VMNA 4PV9A 1MLCA 1C08B 4C56E 4OGAC 1J9CT 2NR6D 3UYRL 1NGXB 3HI1A 5DURB 4K9EL 3NAAH 3O4LD 2B4CC 2AAVA 4POZD 4JN2B 5T3XH 3MCLL 4G7VL 5HGDB 5EIIB 1U3ZA 3MV9D 4OQTL 4OIIH 2X89A 1H5BB 3OAZK 2IAMB 1LO4H 2B1HH 1O7VA 4WUUE 5JNYB 2JIXD 2GK0B 2QSQA 4MQXC 4PTUA 3ARSA 1N0XH 3MODL 3RTQD 3MRQB 2VDOH 3MLXL 1U3JA 3NA9L 4XAWL 3GO1H 3SPVB 1RK0A 2BNQD 2H1PH 3MRLB 4UIMB 4EXKA 3UC0H 1KJVB 1GSMA 3FRUA 3H8NA 4XXCC 3IU4L 1YNLL 1WICA 4OUUA 1F6FB 4X7SH 4I4WB 2ZCKL 1NGYA 3MJ9A 1C08A 5DWUL 1OCWH 1NGXA 1Q1JL 3JV6A 3WE6A 3ZL4L 4NKIH 4PP1D 1FE8L 5AG8A 3WV0A 4R2GD 5ILTH 4L1DA 2XG4A 4JN2A 2X41A 3LAFA 5HGDA 4BZ2L 3FHAA 5EIIA 4OT1H 2AP2A 2HH0H 1H5BA 2IAMA 2AVGA 1ZLWK 4I77H 2HAZA 3ESVF 5JNYA 5C07A 2GK0A 1ES0B 3V4PH 1DVFB 1X4YA 5DQDH 4DKAA 1AKJB 3MRQA 3BP6A 4DOHE 1VADB 3OXRB 3KPTA 3SPVA 1G6RH 5ISZB 3MRLA 1IC4L 3OPZH 4XPGH 4X5WB 5DFVC 1KJVA 1R5VB 3F65A 1KCSH 4HIXL 5F70A 1PG7W 3PXHA 4HIHB 1IM3A 1Q0XL 4RMRA 4MCYB 2A9NH 3DUUA 4K8RH 4LARH 4F15C 2C26A 2C3GA 1M4KA 4YDVB 5HHQB 1G7IB 3IXTB 2VDNL 3D0LB 4FMKA 3GBMH 1FL5B 3ZDXE 5I1IL 1AD9B 1UJ3C 4Y4FD 3DIFB 4P2RD 4XPHH 4C4KT 4PG2C 1XIWD 4GMSL 1MCKA 4U2YA 3OR6A 4Y2DC 4PRHD 1EZVX 4FFVD 4TULL 4F7MA 4M5YH 4I5BB 5F7HA 4URTB 2AK4B 1MJUL 1FFPA 1KSRA 4X8JB 3X3GL 3WFCL 1DVFA 1MVFA 4F2MA 3WBDA 4XCFH 3OGCB 1K85A 2WANA 1AKJA 1WWWX 2DLFL 2ZOLB 5EU4B 4OLWL 4ZXBB 1VADA 2QTEA 3OXRA 3PP3K 3TNMB 5ISZA 5T1MA 4X5WA 3BISA 1R5VA 4LPCA 3PWPE 2P47B 4OZGF 5AZ2H 4WI5A 3GKZA 3C8DA 4HIHA 3FT3B 2V6HA 4HIIA 3TJEL 3MLYH 4MCYA 3VD5A 1KJMB 1XF2B 3DMMD 4GSDL 4YDVA 5HHQA 1G7IA 1EHNA 2DF3A 2XG5A 3D0LA 2SEBB 1MCJA 1FL5A 5MERB 4ZNEA 1AGFA 4HBQA 1AD9A 4OD3H 1RUKL 4ZFGL 3ULVF 2Z93B 4XMPL 3DIFA 4MVBC 2IBBA 3U0PB 4XNZC 4HQQL 3FFDB 2DQTH 3OJDB 5ITBH 1MCLA 4Y16B 5ANMB 3HUJF 1GGCH 4I5BA 3CFKB 2AK4A 3O2DH 4XNUH 3C87A 1E4WH 3GJFK 5A16B 5JUEH 5BW7C 5TJWK 1KULA 2VR9A 4X8JA 1EAJA 4OLVL 1NLBH 2YD8A 1XZ0B 4U3XA 3OGCA 1A7QL 4K3JL 5C3LD 4HS6B 1R3LB 5EU4A 4D9RD 4UNVA 2PN5A 4ZXBA 1U8JA 1ZTXL 5T3ZE 3TNMA 3LKOA 4AY0A 3SDXE 2EXWD 3VXUD 4GRLB 4WFEE 3NCMA 1OF2B 4WIQA 3U9UB 1AQKH 1QRKA 5SWZA 2R0KH 1JHLL 1L0XA 2MWCA 1KJMA 1LE5B 1XF2A 2W1NA 3DHJA 3SBWC 1AR2A 1FGVH 5HGAB 2DYPB 2SEBA 2O61A 1NJ9B 3BN9C 1KIRB 3L5XL 5MERA 3OXSB 4UTBH 4XMLH 1P5VA 2Z93A 1JYVA 4Z7WA 1A0QH 3U0PA 3FFDA 3BSZL 4F9LA 3MRHB 3OJDA 1RJLB 4Y16A 4Y4KB 5ANMA 1UGNA 1Z5LB 3VG9C 3FO0L 1MIEH 4YE4L 4JKLA 3NGBB 4M6OL 1B6DA 5A16A 5HHME 3EOTH 2XZAH 4KMLB 1XZ0A 2WV3A 3UP1A 1ACYH 2DQGL 5IMOB 4N8VG 4HS6A 4M48L 1R3LA 4NKDB 2HT4C 1X5AA 3VXSE 3VWKC 3B83A 2X09A 3FN0L 2XTJE 3QQNA 2PKDA 3ME0A 5CIPH 4GRLA 3Q5OA 3MLZL 1NBVH 4PJIE 4X6BB 2CJUL 2H9GA 1OF2A 3VH8B 3EJJX 5KG9A 3O11B 2AQ1A 3VWJD 1LE5A 2VQUA 4XP1H 3SO5A 3JV5A 3V6OA 2WIMA 5HGAA 2DYPA 4Z7NF 1FO0H 1BBDL 3P11L 2DLEA 1JPSH 5IW6A 4RIRB 2XN9E 4YXLH 1Y6KR 1BGXH 3RDTD 1JGLL 5FYLE 1F90L 5EH1A 3MRHA 1RJLA 2D0FA 4HKJB 3QI9D 4Y4KA 1JRHH 1Z5LA 1N59B 4QOKD 3EYUH 3ZE0F 5EO0B 3ZYZA 4KUCD 3OB0K 1KCLA 4IDJH 4HPOL 4F7CA 1KLUB 4ZUUB 1VFBB 5IMOA 4OFIA 1G7MB 4KROD 4NKDA 3FT4B 1TXKA 3ALPA 3HMXA 1NMAL 2FZ3B 3FFCE 3CMOL 4GRMB 4TQEL 4X6BA 1JJUA 1VGKB 4YHMH 2E7LC 4HGMA 2FX9H 4W4OA 3HFMH 3CSBA 1P9MC 1T2JA 4QWWD 5GZND 4U1LB 2QQKL 3T1FB 2ITDB 1U3HA 5JW3L 1JPGA 4OD1L 4X6EB 4JCMA 4OM1L 5JPMB 5LWYH 4RIRA 2OYPA 2E8ZA 3U79A 4LCIH 4FQJL 3MRRB 1BJ1J 1YEHL 4WI7A 1IGJB 5FM5O 4LSSL 8FABB 3HAEH 3DSFH 4Y88A 4MQ7B 5CEZH 1N59A 5GS0D 3SY0B 3T0EC 5GGUB 2X42A 1PX3A 1OAYH 4M7LL 1J5OL 5F1NB 2B8OT 1T5XA 43CAB 1FSKC 5JR1H 1VFBA 4OUOA 4KZDL 1G7MA 4DVRL 2V5TA 4FQIH 5I71B 3FT4A 3BKCH 4U7KA 3GSNL 3T0WA 3JWOH 2FZ3A 3SJVE 1WWBX 4GRMA 1CE1H 2CDGB 2Q8BH 1VGKA 5C0RH 1A7OH 4EI6B 5DUPH 3I9GH 2YD6A 4TPRL 1AXTH 5E95B 2IQAB 4PJBE 3QG7H 4PY8J 3LQAC 1EO5A 2ITDA 5D96B 3T1FA 4X6EA 3HZVB 2C1PB 5HDOA 1WZ1H 5JPMA 3GIZH 4W68A 1IGML 3D39E 4RWHA 4RGOH 1IGJA 5E24E 2YUWA 4BH7B 5I74C 1WLHA 1O5DT 1MCDA 3H3BC 4K3EL 4L8SC 4MQ7A 4N0FB 3QB7C 3SY0A 3SKOB 1P2CB 1BVKB 4LKXB 5GGUA 4L4TE 1J8HE 1A3LH 2Z9TA 3ELAT 4H5SB 5F1NA 3TO4B 3UJJH 43CAA 1I7TB 2E6JA 5HVGB 1NUDA 3W39B 4X6DE 2IALB 2W0FB 1U41A 2EE3A 4Q9RL 5D6CB 1CFQA 5C09E 4Q9QH 1CLOL 1MFBL 4Y5YB 2CDGA 1A6WH 5SWSB 1VA9A 1OP5K 4GRWE 4EI6A 1HCFX 3BH8B 5D2LB 5D7LE 3H7BB 3KG5A 4BKLB 2IQAA 3H9SB 4GW1B 4KVNL 4NC1E 1UXWB 3S36L 4NBZB 5HI3C 5GJTH 1P4IL 3HZVA 3VXQB 4NJAL 1MFEH 1E6JL 2W0PA 3VD7A 1ZHBB 3W11D 3MR9B 1CGSH 1F3DJ 4X6CB 2H32H 2J2ZA 1V05A 2FEEL 4KI5F 5FOBB 1KCRL 5F6HI 4WTWA 1U8HB 4BH7A 1N6QH 5C6PB 4R96B 4N0FA 3RVXD 4I18C 1INQA 3SKOA 3G5ZB 4DGYH 3L7FB 1P2CA 1BVKA 4LKXA 4K7PX 4EI5B 4L4VD 4H5SA 3EYOB 2JB5H 1U8LB 5DLML 3TO4A 4NJ9H 1I7TA 1OAKL 5IJKC 1T89A 4XP9L 4IMLB 3W39A 2IALA 2W0FA 4R4FL 2C3XA 5I18H 4M1DL 5D1ZD 2BXZA 3KPRA 4M6AA 5CBAB 4DAGH 1PZ5B 1JK8A 3Q6GH 3H42L 4HGKC 4LNRB 4Y5YA 5SWSA 4L8CB 4ZSOE 3HNTH 3GI9L 4I3GA 3FOLB 1LO3H 5D2LA 1BF2A 1Y6NR 3FHQA 1CVSC 1S9XA 3H7BA 4BKLA 4OKDA 5FYKD 4GW1A 1UXWA 3MNZB 3V5DB 3IS0X 3VXQA 5GSVB 1UWGL 1G9EA 3F6IA 3G6DL 1U91B 4S1QL 1FYTD 2OX5A 3NIGF 3MR9A 3NPZB 2VB5A 1RU9H 4X6CA 5FOBA 3MA9H 4LQ1A 5I1KL 1A6ZB 5HYQB 4R96A 3QXVA 1MF2L 3GMOB 4QXGL 1NLDL 1IT9H 4JPIB 3L7FA 5B8CC 4EI5A 4J4PD 1RQ5A 1DN0B 4WFGE 1JWSB 5GSRA 3EYOA 1U8LA 5E2WH 3VGBA 1V7MH 1FN4A 1JL8A 2ZUVA 4IMLA 2D7MA 5F89B 4YGAB 1KPRB 4FXLA 1T6WA 5DZNA 1IC1A 5GGVH 3CZJA 3QH3A 4S1SL 5CBAA 3GB7B 1SBSH 5CMAA 1PZ5A 4DCQB 4LNRA 4L8CA 3IKCB 5I75B 3FOLA 2PYED 1XEDA 2IANB 4KKLC 4WU5B 1FFQA 1EBPA 3E1F1 5J3HD 3VXMD 2X40A 1VPOH 3J8F7 4XVSH 3N9GL 4JDZB 1B6UA 3ZTJG 2XTLA 4MSWB 1JZ5A 1MRDH 4TTDC 3MNZA 3V5DA 4Z6AT 5GSVA 4LLAA 5KVGH 3G6JE 4KMTL 1U91A 4IRJD 3BQUB 3JTSB 3NABH 2OL3L 2WUCH 1HQRB 5HDBF 4F80A 5DA4A 5FYKH 2OZ4L 4D3CL 5CFHA 1EA9C 1A6ZA 5GRUL 4XNYH 5HYQA 4LPYA 3TH3T 1RPQA 2GSIB 2IBZX 3GMOA 5BQ7B 2E9IA 5E8DL 1RZKH 4JPIA 4U1JB 4M8QB 1I9JH 1DN0A 3NH7L 4NM8H 5KSAC 3R1GH 4FTVB 3QXDB 5E0QA 3PUCA 3QDMD 35C8H 3ARQA 3WNMA 1I3GL 1ZT7B 1DQLH 1KPRA 1HINL 2BK8A 1WV7T 2X4UB 3HE6B 2YN3A 5E4IA 1F4WL 3MBED 4AMKL 5HDQL 3GB7A 4JFZL 1WFTA 5DZLA 2YZ1A 4DCQA 3O4OB 4NCDA 3IKCA 5AAMA 5IG7B 2IANA 2XICA 4WU5A 2ZCHH 3KS0H 4LMQI 2CXGA 3ZMRA 3VGAB 4JDZA 1DDHB 1D5BB 2Y9RT 1K8DB 4N8VB 4JQXC 5FGCB 2Y06H 1QHOA 1DBMH 2IPKB 5F7KC 3FQUB 2AGJL 5BV7L 2WK2A 2WQ8A 4YJZL 3BQUA 5C9KA 3JTSA 3TA3B 4RMSA 4YX2L 1YMHA 3M17B 1WEJH 2OCFD 2GSIA 2AJYH 4PJ8A 3WFBH 1XCTB 3P4OB 1VKXA 4U1JA 5K9JH 2J6EH 1LP9A 5ICZA 5IWLC 1BX2A 4FTVA 4MJ5B 4XBGB 3MZTA 5D7JB 1MCOL 3GSXB 3QXUA 3IDNA 4JY6B 1ZT7A 3VRJB 5CZKA 5E99L 1V8HA 4PGJA 2X4UA 3HE6A 3LN4B 4Y1AE 2Q7NA 1HOCB 1NC2D 4Y5VB 1RURH 4BZ1H 4PR5B 1AHWB 2ID5A 3M07A 5CHNB 3T4YA 3TWCL 5MEND 1RUAL 5IG7A 5TE7L 3ESUF 2EDWA 1BWWA 3QJHB 1GJIA 1DDHA 1D5BA 1AY1H 4MS8C 1WCBB 1K8DA 4N8VA 4KTYA 4KTEL 5T1DL 3ZDYF 3G9VA 3OKLB 1JWMB 5J1AB 5B4MC 4Z7VF 1X3DA 5IOPB 2OJEB 3TA3A 2R1YB 4QXTA 4B41A 2YPKB 3M17A 3SGDI 1XF3B 5KVEH 2WM0A 3O6FC 4KXZH 3PQYB 4JN1H 1XCTA 2NLJB 3D69B 1YEKL 1X6LA 1L4IA 1NL0L 2YBRB 1ZHLB 3EO0B 2DQDH 4UAOC 4MJ5A 5D7JA 4NO0D 4CDHA 2MQCA 4JY6A 3VFMB 1J1XH 2EDNA 1RUPL 3VRJA 1FPTH 3LN4A 3BKJH 1CQKA 1HOCA 3BIBX 2VAAA 3MXVL 3MOAL 1NGPL 4PR5A 4WWKD 5DK3A 5CHNA 5FGBA 3M8OL 4BUGA 3TIDB 5IEHB 3O0RH 3WHE0 5FUOL 4X9HA 3WXWL 3QRGL 2R29H 5GZOD 3BGFC 3QJHA 1PKQE 1WCBA 1QSFA 3FT2B 2GTWB 4FNLH 3L5WB 3OKLA 1BOYA 3OG4B 1JWMA 3MUZ1 5J1AA 5ADOH 4J3VA 5CP3A 1JGVL 1DQQB 4RGMB 5IOPA 2WINB 2OJEA 2R1YA 4PJGB 2YPKA 4XVUD 1C8PA 3KYAA 4UV7H 1XF3A 5ECJE 3PQYA 5IIEA 3D69A 4AL8L 2ZNXA 1BM3H 4B0MM 2YBRA 2QBWA 4QLRA 1ZHLA 3EO0A 5T5NF 3HS0A 3QIUD 4M6ML 5HGBA 5I1GL 3BD4A 4XVTH 1ZAGA 4LAJH 3VFMA 3DX8B 4TUJB 4XTRD 3Q1SH 4UZGA 1BQLH 4M7KL 3KPMA 1NC4B 1YEFH 1UH2A 1KLGB 4MA1C 2ADIA 2Q3ZA 3TIDA 5IEHA 3CDCA 1PYWB 5E2TL 4JZJB 5T33H 4MMZC 4FFWD 1RZGB 4R3SB 1CDYA 1G9MC 4G5ZL 4CW1B 3FT2A 4EOWH 3VD9A 2GTWA 2VDPH 3L5WA 5IB5B 2KKQA 4XNXH 3SKNA 4Z7OE 1NFDB 3AB0B 1RUMH 1TLKA 1DQQA 4EVNB 2WINA 5JW4Q 4W6XB 3QEHB 2BFVL 4M61B 3LKPB 3EFFA 5LXGL 1OQXA 3AREC 1FVDB 2NY1D 3DVIA 1MCFA 1BQHA 1LHZA 2NW2B 4OI8A 4UILL 3EGSB 5BVPL 3TCLB 1YZZA 2IBGA 1EVUA 2X2YA 4V2BA 4K23H 1ZT1B 3MC0A 1QACA 2JCCE 3NZHH 4OI9A 1DJSA 4TUJA 3WDIA 4O58L 3F12B 2R8SH 1IFHL 1NC4A 4JGJA 1H3XA 5I19H 2HFFB 2NZ9D 1ZEAL 5LQBH 4LPWA 2F8OA 3RX7A 1PYWA 3DYPA 5FDWB 1EAPB 4JZJA 2APWA 2VUYA 3O3EB 4N5UA 5FHAH 4RZCA 1ORQA 2YPLA 3CC5A 1RZGA 4R3SA 4CW1A 5IB5A 4PB0H 2KBGA 4NFCA 1F6LL 3JWNC 4HXAL 4TRPL 1F00I 3HB3D 4EVNA 1OW0C 3AMKA 2VXUH 3REWB 4M61A 4JM4L 3LKPA 3LY6A 1FIEA 1NEUA 2YMXH 3C60D 4R97B 1FVDA 2QJDA 1KB5B 2QSVA 3DVNB 4JG1H 4JHWL 3N85L 1RZJC 2I26N 3QQ9D 1S7VB 4LEOA 3K74B 4LEXL 4AQOA 1S7TB 1UT9A 4IRSD 3TCLA 4H20H 1OARL 5AWNH 2J7LA 4LFHG 1ZT1A 1IGCL 1AGCB 5JZ7C 5HVHC 4RGND 4DKEH 2CPCA 3UTSD 2DOCA 5D1QB 2VDQL 4LIQH 4B5EA 4E41E 2HFFA 1S7RB 2FIRT 5IQ7L 1YMMB 3RA7L 4RFOL 1CLZL 4HWEH 5HPMB 4TN9A 2IJ0C 3O45A 5FDWA 1EAPA 5J13C 3O3EA 5I1HL 5DK2A 1UENA 1SYSB 3X3FL 1UYWH 3SO3B 5HI5C 5IBUG 1YEEL 4HUKB 4KUZL 1X5ZA 3A0OA 4H25B 4JY4B 4OCRL 4OZGA 1ZVHA 3REWA 4O2FA 1T03H 1QPPA 1NKOA 2I5YH 4F8TA 4RX4D 2AV7B 5ALBL 1URLA 3ARUA 4NZJA 1KB5A 3DVNA 3O4LE 3ZDXF 1T4KB 1S7VA 4WO4B 3RHWK 1S7TA 2R2CA 5JDJA 4V1DB 3W0WB 4XH2B 3MV9E 3O6MH 1EZVY 4DQOL 2XWBB 3IRZA 2AI0H 1Q9WB 1AGCA 4U0RB 2X4PB 2DL2A 3RRQA 3EIFA 4ESKA 3OV6A 4Y89A 5M95B 4CMMB 4TUKH 3PL6B 4ETYA 1WK0A 5D1QA 1LEGB 4HLZH 4ERSH 1S7RA 3HUJA 2O5ZH 4FG6D 2UZIH 1IARB 1MQ8A 4JHAH 2BNQE 3QFJD 2QR0A 1N0LA 3VXPB 3SDYH 2DQIH 1M6OB 1SYSA 2K7QA 1YECH 1REIA 2EYRB 3D3VB 1CGTA 2ZUSA 3VFVB 2ITCB 3CCHB 5LAXB 1A6VL 2QQLH 1P4BH 3RKPA 3IETB 5T3ZL 1MSPA 2FBJL 4MA7L 1PLGH 4PPTA 5L2KB 2R2BA 2ESVD 4H25A 4KU1A 1W2KT 2CKBB 4ODXB 1L0YA 4YXKH 4U1NB 3S35L 2FDBP 4BQ6A 2AV7A 3RY6A 4CVZB 3KLSA 3HI5L 1T4KA 4S10A 5J89A 3KLHC 3NIFF 4WO4A 3NACL 1MWAB 4NZRL 7CGTA 2N4IA 3W0WA 4XH2A 2XWBA 5EOCH 1Q9WA 5DHYA 3V4UH 3U6RB 1WBXB 5M94B 2X4PA 5D5ME 1DBBL 1C5CH 1JNJA 2R4SL 4CMMA 2GJZB 3PL6A 4GLRI 1LEGA 4PJ5D 1HXYB 2OLDA 1QYGL 1U36A 1KCUH 1CZ8H 3O41B 4HK3N 4O02H 2YD9A 2IFFL 1I7UB 1MFAL 4ZTPL 3VXPA 3HI6H 4GOSA 5IB2B 1M6OA 1YQ2A 2ERJB 3DXAB 3I6LD 4OSUL 2GHWB 2IC2A 2XY2A 3LEYH 3D3VA 5SX4I 1A64A 1S5HA 3VFVA 2ITCA 3CCHA 3VFUB 5F96L 1FVEB 3LKQB 3IETA 5L2KA 4JPVH 4FFYL 2YPVH 3F7RA 2CKBA 4ODXA 2ICWJ 1HSBA 3GJFB 4PJDF 2O93L 1CXLA 4U1NA 4Z7UE 4JFEB 5I2IB 4P2RE 1MWAA 5DRXB 4ZS6D 4PRHE 1CGWA 3WLWC 1J1OL 2BVUA 4OCMC 3U6RA 1WBXA 2NXYC 4Z18A 4OZIB 3FQTB 5FYLL 1HXYA 4D2NA 2J4WH 3O41A 4NQXA 3F8UB 1MNUL 4OI7A 3RHWF 5F71A 1UM4L 1I7UA 2AV1B 4IJ3B 1GGIH 1OTTD 4TUOB 4Z0XA 2HJKB 4HJJL 4IOFD 2DD8L 3QUXB 5IB2A 2QQNH 3DXAA 4GAYB 2IGFH 4LDOB 1MPAH 4FP8L 2PF6A 4PJIF 1DUZB 5D7SH 3VFUA 2YR3A 3TH2T 1TJIL 4NQUA 5DR5H 2AXHA 1FVEA 3LKQA 1D5IH 1MCBA 4KV5E 4KC3B 5L7XH 2WIIB 3O8XB 3EFDH 1E6OL 3GJFA 2R1WB 3QAZC 4JFEA 5I2IA 1SJXA 4LSVH 3BP7B 2DN7A 3FQNB 2A6KB 5DRXA 4PJ7E 5T5NG 3K1DA 1U8IB 2R56L 3ZKMC 4YHZL 4OZIA 5H35B 4M5ZH 1CFVL 2YKLL 4FQLH 5DD1L 5C2UB 5CSZB 3PV7A 2Q1EA 3ARFB 3ARGD 1D5ZB 5GRVL 4D9RE 1PG7H 4NIKB 2AV1A 4GT7A 5AAWA 4TUOA 2HJKA 1EBAA 1OP9A 5JIPA 3VXUE 4PB9H 2AK1H 1B4RA 4GAYA 2WW8A 2F5AH 2VL5B 2DQFA 3P0YH 2H8PA 5IBLC 1EK3A 1DUZA 2BMKB 2AEIT 3UO1L 1J8KA 4U6TA 1ZA3B 4N0UB 4LCWD 5T1LA 1RIVL 5ACLA 2WSKA 3ILQC 3O8XA 4MGXA 3MRNB 5GIRB 2R1WA 5LBSL 3NMEA 1NCCH 1FAIH 7FABL 4ZOBA 3WHXB 1DR9A 1FNEB 3N1PC 2WWKT 3L3HB 3BP7A 1UA6L 1T21B 3FQNA 2E7MA 5EUOE 3UYRH 1S78C 4UIKH 2DDQL 5E2VL 4EQ2A 1U8IA 2X9XA 3RL1B 3UDWC 5FCSH 3FO1B 4GBXC 2X7LB 5H35A 5JORB 3MCLH 3NCFB 2P1YA 4OFPA 4OV5A 2WAHA 3FB6B 3KLAB 5CSZA 3DVGA 4OQTH 1MAML 3ARFA 1D5ZA 5E08L 3V2AR 3MRKB 5C08A 1EVTC 3LIZL 2VLKD 2BHZA 3QCVL 4RFNB 3MODH 1QLRB 5BOZG 2M26A 2FJHB 3ZHDA 1G1YA 2DLGA 2BMKA 2PUQT 3V52L 1NUFA 4ONOA 4JM2B 3NA9H 4XAWH 1ZA3A 4N0UA 3EYFB 1YJDH 4Y4HC 1NMCC 2DJ4A 3LV3B 2VE6B 1QR4A 3BUTA 5FB8B 3MRNA 2JJWA 4XWOC 2QL1A 1FNEA 2EDYA 1BD2B 3L3HA 4CU6A 4XCCL 3B9KD 2ZCKH 4GKOA 5DFWH 5HGGS 1T21A 4QTIH 5FKAB 1IRAY 2FIKB 3R06B 4QOKE 4LRNL 3ZL4H 1MI5D 4JANB 5JOEA 1FE8H 3RL1A 4Q58C 1MFCH 2X7LA 5JORA 3FONB 1HK6A 4BZ2H 2C4XA 4D0CB 3KLAA 1KJ2B 1NAML 3ZKND 4J2XA 1CD9B 2PW2B 2LU7A 2Y5TB 1JYNA 2DKMA 2ZWLT 1I3UA 5C0BB 2P5WD 4PD4J 3MRKA 3QO1A 4X6DF 3QUZC 1OGAD 4UTAL 3K0WA 3BZDA 4XCYB 1QLRA 1NFIA 2FJHA 2FHFA 5TQ2L 4JM2A 3FB7B 3EYFA 4WCYL 3IGAA 1VGEL 5FB8A 5DQJB 3RPIB 1OOAA 4HIXH 3MUGA 4G6KL 3QPXH 1N7ML 1Z9OA 1MRFL 4K8RC 4ETQB 1HI6B 4PV8B 1BD2A 2ICEB 4QRPB 1IJ9A 2CDEB 2VDNH 1TZIB 4JDVB 4HZLA 5LKNA 4MQSB 5IBUB 1I1AD 4HUWB 5FKAA 2FIKA 3R8QA 5DHVB 2ZSVB 5EORL 4JANA 4X99B 1W72L 4K7PY 3KPSA 2F54A 3C8KB 4GW4A 4MDIB 2AJUL 4NHCL 3FONA 2EDTA 1CD0A 4D0CA 4I0CC 1KJ2A 2D9QB 5DMGC 4TULH 3QRFM 3WSQL 1DEDA 1MJUH 2VZ1A 4Z8FH 5C0BA 2D7OA 3AS1A 5F1KC 5DGQA 5CGMA 5IHZB 4H0GA 4XCYA 2GJ6B 2BNUB 5E56A 1YEIL 2DKSA 3FB7A 1KBGL 2WBJC 2Q87A 5FUCC 4JFPA 4XXCA 2R0LH 5HSFA 5DQJA 4HCRA 3K2MC 4F15B 2VIRB 3BRFA 4LQFH 3UMTA 3TJEH 4ETQA 1HI6A 1CGXA 4PV8A 2ICEA 4QRPA 2CR3A 1UZ6F 3BGAA 2CDEA 3DTXB 4GSDH 5ERWB 5HI4D 1TZIA 4JDVA 4FN0A 2GTZB 1F2XK 4HUWA 2WZPD 4YHKH 2HFGL 2XZZA 1RUKH 1KELL 5DHVA 4ZFGH 4XMPH 2ZSVA 4JPKH 4Y2DB 4X99A 2EIZB 2FR4A 4HQQH 5EC2B 2VLRD 3FQWB 4HXBL 4MDIA 1KFAL 4YHOL 1DSFL 2EIDA 1GGBL 1FCGA 1T2XA 1H3TA 1P7QD 1ND0B 4FFVC 1PJ9A 4YNYB 1WISA 3B2UD 3QHZH 3DOSA 4K3JH 1A7RL 2GJ6A 2BNUA 2GFBB 3DETD 1ZTXH 5D1XD 3F6LA 2EDDA 5E9DB 1F42A 1JV5A 3BI9X 1WZKA 2VIRA 1IAOB 1ZLUK 2DQJL 1H8NA 5F88B 3R4DA 2YRPA 1JHLH 4XI5D 3GSRB 1CL7L 3B9VA 4PJ9D 5ERWA 3DTXA 2EKSB 3P9WB 1UJ3A 3G6JF 2XWJB 3NFNB 3RUGF 3BZEB 2GTZA 1NCWH 1DUYB 2R23B 3L5XH 4PG2A 3CGTA 4XNZB 3HG1A 2OZ4A 3ET9F 2IBZY 3GRWL 3LVEA 4JFHD 2P46B 1O0VA 3Q5YA 4Y2DA 2EIZA 4L4VE 2BRRL 5EC2A 4PTTB 3BSZH 3FQWA 4QGTA 4ACPA 1BJMA 3RGVD 2D2OA 3FO0H 4KRLB 3MLVH 5EU7E 5IB1B 2VZUA 5C0EB 4M6OH 4F8QA 4XVJL 4XX1G 5AYUH 2YS4A 4PD4K 2XA8L 3QDJB 2HRPL 4YNYA 4XP5H 4KK8D 2OJZL 5I1CH 4XMKL 5TE6L 3KYKL 3TF7C 2RCSL 1ZE3C 2GFBA 4PLOB 4X0KB 3QEQB 3FN0H 4ZPVB 4NQVB 5FYKE 3U83A 4F7TA 2CJUH 1IAOA 3T65B 5F88A 5DURD 3EDFA 1AC0A 3U82B 4IMKC 3GSRA 1FYTE 1GHFL 2EKSA 1QEWB 1HILA 3HNSL 2XWJA 3NFNA 1QSVA 3BZEA 4CVWA 1DUYA 2D7QA 1BBDH 3P11H 1EPFA 1D6EB 2IAMD 1OAQL 4Y7MA 3V5HB 3VFGH 5INCB 3VG9B 3DWTA 4UDUA 5KS9E 2F9BT 3TBYB 5BW7A 4BH8B 5C0EA 1CGUA 5HD8C 1LDPL 1DL7L 3QDJA 1SEQL 1I1CA 1YY9D 1X5XA 3VWKB 5JOFB 5HYJB 4JQIL 1WAAA 3D85B 5DD5L 3CD4A 3Q0HA 3QEQA 3VXME 5DVLA 5BXFB 1NMAH 1FFOA 2AXFB 4NQVA 4TQEH 1UEYA 4Y2OA 1D7FA 3SBWA 4YHLL 4WY7H 1A6AA 1F58L 1DBAL 1ZVYA 4X80L 1U42A 3LMJH 2CK0H 3FQRB 1EJOL 3ZE2E 1ORSA 2QQKH 4OD1H 1CL7I 1DQTA 2F58L 4OM1H 4D9QE 1DBJL 4QXUL 1D6EA 2ED8A 4F9PC 1D9KC 5KJRL 3V5HA 3BIAX 3MUHL 4FQJH 5INCA 1MQKH 4LSSH 4P4RA 3WO3B 1ROWA 4NKQB 1DVFD 3QDME 3SOBL 3TBYA 2HMIC 4BH8A 1N6VA 1AKJD 3D18B 1A7BA 3QEGL 4M7LH 1J5OH 1K4DB 3PABB 1S9KC 1JHKL 1F4YL 5CGYD 4KZDH 3BDXA 4DVRH 2D7NA 5ITFB 5GRWA 4OCSL 3BX7C 5HYJA 1G6VK 2OQJB 5TH2B 3D85A 1GL4B 1S7WA 4X7EC 3GSNH 4P99A 4OQ1A 1GCFA 3JWOC 1NCTA 2F19H 1C5DB 5BXFA 1WJ3A 4NRYB 2AXFA 3DV6B 5E8OB 5C86A 3LZFL 2E6PA 1OB1B 3DX7B 3WEXB 3G5XB 1C5BL 3TYFA 3U7YL 2I07B 4TPRH 1WT5C 3FQRA 3QIBC 3L5IA 5D7KD 1M1SA 5IP4A 4JKPL 4X6FA 4WV1B 3G08B 1GC1H 4YDLC 1IGMH 1TPXC 4X7TB 2AK4D 3DGGB 4EIZC 1CF8L 4MLSA 3WFHA 1KEML 3T0EB 2HT3C 4K3EH 1HH9B 4C56A 4NZUL 3CLEL 1BBJB 4PGDB 1FSKB 5MP6L 4ZXBD 3D1MC 3RZWA 2EDKA 3EUUA 3PABA 4EN3C 4Z7QF 5HYSG 3H9YA 4YK4C 5DDHB 2XQBL 5ITFA 3RWIB 4XB7A 2OQJA 5TH2A 4Q9RH 1U2HA 2GEEA 1UH3A 1C5DA 4NRYA 1QFWL 1JPTH 2ADGA 3DV6A 1CLOH 5KVMC 2E7LA 1OB1A 3DX7A 2D7PA 3WEXA 3G5XA 1V3JA 1TTUA 2I07A 3T0BA 4JR9L 1TQCC 4O2EB 4XC1L 5IGXL 1CFBA 3S36H 1P4IH 4QRTB 3OKYA 3G08A 4Y16D 1EMTH 4NJAH 1T5WB 1N4XL 5IUSA 4FRWA 3WJLA 3C9NB 3HRPA 3ULUD 5I74B 4RMWA 1M71A 4L8SB 3MUJA 3DGGA 4OF3A 4CJ1A 3SGKA 1LO2L 3T0EA 3TFKC 1HH9A 5JTWA 1W0WB 3OGOE 4PJEE 3BPNC 3S5LG 3KHOA 1BBJA 4PGDA 1LO4L 2B1HL 2JCCF 5KSBE 3VRIB 1A8JH 4XPBL 3WDHA 1R0AL 2NW3B 2ZKHH 4GRLD 1OAKH 5FGRA 2NY7H 5DDHA 4XP9H 3RWIA 2A74B 3G6AB 1OP3H 2B0SL 1QA9B 2FL5B 5B3NA 1R24B 3GO1L 1SYVB 1ZT4B 2H1PL 2JJTC 4WU7B 2DYPD 4LNVA 1LNUB 4JKKA 4JRYB 1OTUC 3WLBB 4MX7B 5F44A 4O2EA 1CIDA 4FMFA 5DVKA 3RIFK 4YDJB 4QRTA 4Y4KD 1T5WA 4JEGB 4KKBD 4KK9D 2ZUQC 3MV7B 3C9NA 4PRDB 4NKIL 1NCAH 1G9NL 2APBA 2QKIB 4L8SA 4I18B 1C1EL 5I1LB 5I1KH 2K9UA 4OF8A 3QDAA 4F7PB 4OT1L 2GW5A 3W11C 4KQ3L 5FECB 3ULUH 5E2UL 2NX5B 1NBQA 4LGSB 1CT8B 5K59E 1J05B 3VRIA 3GKWL 5FO7A 3T08A 2A74A 5DQDL 1DANU 1LEKB 1HN1A 3G6AA 4S1SH 1QA9A 1T1ZA 1QRNB 2FL5A 5DD6B 1SYVA 1ZT4A 2GSGB 3FQXA 1KGCD 2ZNWA 3K80A 5GRYA 1LNUA 4ZFZB 3ZZ1A 1QFWI 2V2XB 1DLFH 2DM7A 4YZFE 2R4RH 2UVFA 3WLBA 4HS3A 3N9GH 4MX7A 2DI8A 4JVPA 4P48A 4QKXB 5A43C 2FGZA 4YDJA 1HZHL 1SM3H 4HBCL 5BS0E 3MUY1 3PWPA 5IVNA 5F3BA 5F7UA 1AXSB 1MCHA 5EFIB 5IHUH 5T5FL 4RAVA 4KMTH 3SGDH 4PRDA 5DYOB 2QKIA 4I18A 5J1SC 3T3PE 3EO1B 3VD4A 1B2WL 4PJDB 5I1LA 4D3CH 3W9EB 5GRUH 1RZIB 4F7PA 3VGEA 3VFNA 1RZKC 3B5HA 5FECA 2ADFL 4P2QD 5E8DH 2MTPA 2NX5A 3NVQA 1CT8A 1J05A 3RZCD 3NH7H 4HIJB 4RCAA 3I75B 1E4JA 1LEKA 1HINH 4YXHL 2B5IC 5DD6A 1QRNA 4E42B 3PHOB 1F4WH 2FJFB 1N5YL 4AMKH 5HDQH 4JFZH 4QY8B 2GSGA 4WFFD 4FHBD 4J3WA 2BCKB 1UJTA 4MJIB 4W81A 4ELME 4ZFZA 15C8L 3MRGA 2V2XA 4UMGA 3PWLA 2W65A 3IRPX 3E2HB 3NIDF 3QSKB 3RVUC 1VFAB 1HHGB 3DECA 2BY1A 3PWVB 4XWGL 4G6ML 1AXSA 4OD3L 5EFIA 1F4AA 4PGZA 5BV7H 4QNPE 2EO1A 2YZ8A 3MLRL 1T20B 3EO1A 5IMMB 4PJDA 4YX2H 3OX8B 5B8CA 3DHMA 5DEFB 4E5XB 4U6HB 5KSAB 3WFDL 3QEUA 3RIFF 3H3PH 3UTSE 3O2DL 3DYOA 3UTOA 1XF1A 3LS4H 1BVZA 5C6TL 3I75A 5E99H 3T4AB 5IROC 4E42A 3PHOA 1A4JB 5FKPB 2AQ3A 4QY8A 5EOTB 2DJSA 5DJYB 3TWCH 1JZ4A 4MJIA 2KL6A 4LDEB 1YEJL 1RUAH 5EO9A 5IBTH 1NEZG 5TE7H 1K9TA 5INDB 4CN4A 3VXSA 4PJAE 1HHGA 4I48B 3ZT7A 1FGVL 1PD6A 1UADC 3PWVA 1DTUA 4UTBL 5H94B 3WYRA 4Y5XC 3WL9B 2P24B 4D8PB 5IMMA 3OX8A 3TO4D 3E3QE 5DEFA 4E5XA 4U6HA 3GHEL 5KSAA 2I9TB 5E6ZA 1YEKH 1OM3L 1NL0H 3RFZC 3BE1L 2UV3A 1Q38A 5SWSD 1RUPH 3RWDB 3QFJE 3T4AA 4EUPA 1A4JA 5FKPA 5TQ0L 2W38A 2UWEB 2DBLH 2NY4C 3I6KB 4JO4L 3W5MA 3H9SD 5DJYA 2DMKA 3L3OB 4OLZH 3CJJA 4IDLA 2YXMA 2VN4A 5FUOH 3VW3H 3WXWH 3QRGH 3KXFB 5INDA 4JQXA 4PJXB 1FP5A 4I48A 3P0VH 3TH4T 2R0WL 4X5XB 1MREL 5C0GA 1FNFA 5H94A 1J0JA 3U4BH 1JPSL 3WL9A 4S0SD 3PV6B 1A6TB 3O6FB 4ZS7H 1KT2B 2R9HD 2YUXA 5CD5C 3IJYB 5IWLA 3ZTNL 4PJ7F 3EYUL 2YD3A 4AL8H 2I9TA 1I85C 4UAOB 4CMHC 1IVLA 1JTTA 4PJ5E 4GAFB 2JJSC 4QHNA 4IDJL 4M6MH 5I1GH 3VFPB 4W4NA 1CDBA 4Z77B 4M9OA 3RWDA 1KXVC 1KB9J 1PVHA 4NO3A 4IBLT 3I6LE 3QA3A 1B90A 4A6YL 4NCC1 3UJTH 3BGFB 4N9OB 1JUFA 4YHML 3L3OA 4NPYB 1OLLA 5LGJB 5E2TH 5ID1B 1KV3A 3HFML 4PJXA 5FUZH 5AD0B 4Q0XL 5HYSB 4KQ4L 4G5ZH 1HWHB 1I8MB 4X5XA 5IKCB 5IM7B 1B0GB 3IDMA 3MRCB 1WCQA 4DTGL 4U6XB 2J8UB 1A6TA 3PV6A 1BVLB 4FQ2H 4OF0A 1Z2KA 4NRZB 1KT2A 1TNNA 2BFVH 1FZJA 1BOGB 4AENA 3MV8B 5LXGH 1P7KB 3GSQB 3IJYA 4X7FC 5EUOF 1K2DB 2NYYC 3S37L 1G7QB 4LRIC 4UILH 1L7TL 4XVUC 3VJ6B 3D39A 2UYLB 5BVPH 1OAYL 8CGTA 3KYNB 5C0AB 3VFPA 1NAMB 1XGPA 4Z77A 3LD8C 3UYOD 4MA1B 1XH3B 2IAND 1VFUA 3QIUC 2CRYA 2BOCA 4L4TA 4LHQB 3M45A 3MLPA 4I3SL 4XGZB 3S5LB 4XTRC 1ZEAH 4NPYA 1A7OL 5LGJA 5ID1A 1YPZB 1AXTL 1HKFA 5AD0A 3WN5C 5HYSA 2V7HB 5C09A 5K9OB 3MZGB 1I8MA 3QG7L 3MFFB 5IKCA 5IM7A 2EDFA 1B0GA 1OPGL 3DRTB 4KGJA 1WZ1L 2D31B 4FFWC 4HXAH 3AREB 4O00A 2J8UA 5J1TC 1BVLA 3U36B 4NRZA 4I2XB 5D7LA 2PTTA 1BOGA 1CIUA 4JM4H 5J57B 5KOVC 4FTVD 1P7KA 3GSQA 1HKLL 1KUMA 4JHWH 1K2DA 2JLLA 3N85H 1ERNA 1G7QA 4LEXH 3H9ZA 3HE6D 2H6PB 3Q3GB 4WHCA 5GISL 3VJ6A 2UYLA 1UCBL 4KUCF 1A3LL 1M05B 5IVXB 4MD0B 3KYNA 5C0AA 1IGCH 4OB5L 4GLRH 5GS0L 1NAMA 2ICWB 1MCNA 2EE2A 1DQML 4AK1A 4L9LC 3AS0A 2VDQH 3B8YA 4Q9QL 3RA7H 2VH5L 4RFOH 4XGZA 3S5LA 1A6WL 3B8SA 4R0LA 2RR3A 4CU8A 4LCWE 5I1HH 2NZ9C 5EC1B 5T3ZD 1KENH 3H9HB 3TA3D 3X3FH 5K9OA 5IEKA 3MFFA 3U1SL 1BMGA 3DRTA 1JF1B 4KUZH 5I1EL 2CRIA 1UG9A 3U36A 3CSYB 2G9HB 1RHFA 2HLFD 5D7JD 5ALBH 4LLQB 3D9AH 2DIAA 2DI7A 3T09A 4OZ4B 3RX8A 3AY4A 2H6PA 3Q3GA 4YAQB 3RUGB 5HVHB 2DLIA 3D87B 3RJDA 4KJYB 1M05A 4MD0A 5E6IC 1LQSR 1CCZA 1BZ9A 4DQOH 2RIKA 4NJ9L 3LRHA 4RQQB 2ICWA 5DJZB 3NCYS 2Z35A 5I18L 2WWMC 1CN4A 3P9MB 3QUKB 1NCBH 2KDGA 4GG6E 4IOSD 2VLKE 5J13B 3Q6GL 4QRRB 4RGNC 4R7DB 3QP3A 4M4RA 1LO3L 2BSSA 1VEOA 3P77A 5EC1A 3H9HA 2VXVL 1F5WA 4LHUA 5AUMB 4JPWL 4WW2B 1OW0A 3QDGB 1A6VH 1JF1A 3PQYD 5GS3A 3KPQB 5T3ZH 1H3GA 5C9JB 4JHZA 1EJ6A 4F33B 2EH7L 5JXAL 2FHCA 2G9HA 3OHXB 2EDLA 1FZKB 2OTUB 4LLQA 1MI5E 3SDCC 1F45A 3HI5H 1JGEB 3GK8L 4YAQA 3RUGA 4NZRH 4PJ8C 4YLQT 5D2NC 3S88H 5E2WL 5BRZB 4M43L 5I0DA 4YUEH 4JQVC 1CICA 1DBBH 2FWOB 4LLDB 4RQQA 3LN9A 4XT1C 2R4SH 2P5WE 4X4XB 1A3QA 3P9MA 1OGAE 5F3HB 1QYGH 1R5WB 4M9PA 4QTHB 4QRRA 3LRSB 4R7DA 2IFFH 4O9HL 1T7YA 3FAXA 3EYQC 1LO5B 4ZTPH 3TJHC 1A3RH 4XVSL 5F21B 4OFYA 4FG6C 3GNMH 4S1DD 5GS1C 5AUMA 1MRDL 2DTMH 1QVOB 3QDGA 2V5SA 2M2DA 3KPQA 1K3IA 3QUML 4KJPD 5C9JA 1EDQA 1JVKA 3STLB 5FK9B 4FZ8L 4F33A 5FYKL 3BUYB 3OHXA 2XACC 4APQA 1NEZB 2OTUA 4U1MB 3ZE1E 3KYOB 1JGEA 1RZKL 1U8MB 4DN4H 4MJ6A 4L3AA 1NC4D 2GKIA 3RJQB 3DRQA 4OZHE 2V9RA 1EGJA 3L3GB 3R1GL 4KDWA 1B88A 1J1OH 2PW1B 2P5EE 5BRZA 35C8L 4LLDA 1DQLL 4X4XA 2IG2L 4TVSa 4LF3B 1IKNC 5FYLH 5F3HA 4I1NB 1T2QH 1R5WA 4QTHA 1R3JB 1MNUH 3LRSA 2X1WL 1UM4H 1GGYA 3SEPA 4IOIB 3BP4B 5E6YA 5TE4L 2ZCHL 2W9LA 4HJJH 2P49B 5FGBC 2XOTA 2FJGB 3T0VA 1WFUA 4AIZB 4YBHA 5D70H 1ADQA 4FP8H 1E27A 3IAGC 4U1HB 5FK9A 3VI4E 4PJHF 2VERN 3VGDA 1E6OH 1WFOA 4KKNA 3BUYA 3O3DB 1A7PH 4JO3L 4RNRB 4U1MA 2EH8H 3C6SB 1ED3B 5FYJU 1J0IA 3MRIB 1U8MA 5C0ND 3IVKB 2VLRE 3V8CA 2NXYB 2EXYC 3F7QA 4RA3A 2PW1A 4MHHG 1U93B 3ZYJA 3H6JA 2R56H 2J5LC 1MVUB 1V3LA 1ZSDB 2YKLH 4ZS6C 3VXRB 4LF3A 5DD1H 3RVTC 3O6KL 4L8DB 1RURL 2ENSA 4H0IA 1R3JA 1L7IL 1J86A 3DI2B 3TNNB 2APTA 4U33A 4IOIA 4MXWL 3BP4A 2GIYA 1P53A 3EJZD 1AH1A 2FJGA 3BH9A 3MACH 4P2OC 1AY1L 5I1JL 4AIZA 4DN3L 5FV1L 5JW4N 1FNSL 3UO1H 4G6AD 4G9FB 2YN5A 1RIVH 3RWJB 3QAZB 3HZMB 3GHBH 5EU6B 4PRPB 5LBSH 1YYML 4RNRA 3PP4L 3ULVD 4JFHE 2MSPA 7FABH 3MGTB 3C6SA 1ED3A 4Z95L 4JN1L 4RDQF 3MRIA 2NY5H 1UA6H 2M8XA 3IVKA 2BVPB 3WIHH 1FIGH 5GS2H 5D1QD 5JIIA 4LL9A 4ODWB 1RY7B 2DDQH 1YMMD 1U93A 4K9EC 5EG6C 4J3SA 2ARJQ 1S7SB 1MVUA 1ETZB 1ZSDA 3VXRA 3JV0A 3BKJL 3CVHL 4L8DA 5DI8B 3TNNA 5JW5B 5E08H 3O0RL 3HKFA 2R29L 2FD6L 5HVWA 3UBXI 4PFEA 4X9FA 3QCVH 4R7NA 5A2IH 4HUMB 1CG9B 3V52H 4G9FA 4ZDHB 4JDTL 3KVQA 4OCNC 5ADOL 4H88L 2O5YH 1OTSD 1J12A 3IF1B 3HZMA 3MRBA 4HF5L 1MY7A 1F97A 2YEZB 4PRPA 4V1DD 3IJSB 5EU6A 3W0WD 2IADB 4GRWH 4UV7L 3MGTA 1KB5H 2PO6A 1JMXA 5HYEA 4XCCH 4ZUSB 5DMKB 3PL6D 4HULB 2BVPA 4X8XA 2WQRA 1BM3L 2QEJA 2H41A 4MWFB 4GBXB 4ODWA 4LRNH 3MLUL 1S7SA 3Q1SL 1BQLL 1ETZA 2ZG2A 5JHLL 5JQ6L 3PDDA 1BHGA 1CDHA 2A0LD 1YEFL 4TVPD 3ZKQD 3KHQA 5DI8A 3D3VD 5JW5A 1JI1A 2I24N 4YFDB 2XWTB 1U3YA 4HWZB 1TCRB 2CUIA 1UM6H 2HT2D 1IM9B 5L2KD 1T0MB 1MAKA 5T33L 5F7LB 4UTAH 3WNOA 1KLFA 1MOEA 4JRXB 4UNUA 4Y4HB 2X9WA 4HC1A 1NMCB 4QEGA 3TC9A 1CG9A 5TQ2H 5EN2A 2P44B 4P4KC 2FO4B 4XNXL 1MFNA 4PREA 1RUML 1P69B 5FEBA 2YEZA 3U0WL 3IJSA 1N7MH 4PUBH 5EU5B 2DLTA 4HFWA 4LPUA 4KK5C 4G8GB 1MJJB 1QNZH 5DMKA 2EEDA 4PJCF 4HUXB 3UDWA 4MWFA 4GBXA 4DK6A 1XGUB 3PHSA 2XIDA 1PQZA 3NZHL 5EORH 1CVRA 2PXYC 4PJEF 5ISZE 2R8SL 4XBEH 2AJUH 4ZG1A 3SDAD 4FQPA 5I19L 5KSBF 1UC6A 4JFFB 3QUZB 2XWTA 2W07A 4HWZA 1TCRA 1AP2B 3R0MA 1IM9A 1YY8B 4HJ0D 5ESAB 1T0MA 1I1YB 3RY4A 2IQ9H 1G6RB 4JRXA 1ONQB 5CCKL 4ZNEE 4Y4HA 4NQDB 2LAGB 4EDWL 4JFED 3S8WA 5F7FA 2IEPA 4PB0L 4RRPG 4ZAKC 2FO4A 3DUHA 1MHHB 4P5TD 3ARBC 5D7KE 4WHTB 4PYHA 2JB6B 3RVVD 2Z4QB 1RSFA 5EU5A 3H2WA 1JFQL 2YMXL 3C2SA 4G8GA 1MJJA 3FZUD 2AK4E 4JG1L 4ZODA 1B3JA 1MWAH 4H20L 4ISVA 1D3CA 4ODUB 1KELH 3AU1B 3P4MB 4DKEL 1I1AC 4YHOH 3DX6B 3QUXD 2YD4A 2ADJA 1PSKH 4JFFA 1GGBH 1LK3H 4HWEL 3LOWA 1EEYA 3QUZA 5EO1A 2GUOB 1ITBB 3V5KB 3QFDB 4KGLA 1T22B 5ESAA 1YY8A 2R2EB 4Y1AD 1I1YA 5C3TA 1G6RA 1HDMA 1IBGH 1ONQA 2WBJB 2VLMD 4NQDA 2DS4A 3DO3A 1B0RB 4UT7H 2X4RB 4DGIH 2ZG1A 3D5OF 4K7PH 3ALXA 4YZFF 4WHTA 3I50L 2JB6A 2DQJH 5ANME 5EU3B 1A4KB 2Z4QA 2OMNA 5JPNB 1B4JH 4KJQD 3ULUE 1CL7H 1OD9A 4NFDA 3TVMC 2WLZA 1RUQL 4LASL 1QOKA 4ODUA 3T3PF 3O6ML 2V2WB 5C70A 3AU1A 2AI0L 3ARFD 3S96A 4NP4L 2BRRH 3P4MA 4YFLI 2ZUXA 5DEZA 2CR6A 5DVOA 5EZIL 4ERSL 3VA6A 4KDTA 1WIPA 3V7AG 2O5ZL 2GUOA 2UZIL 4XVJH 3LKSB 1DANT 3QFDA 1T22A 4TSAL 2XA8H 3V6OE 3SDYL 2HRPH 1TQBC 1I3RA 1AI1H 2OJZH 2WBJA 1YECL 4XMKH 5TE6H 4D94A 3KYKH 1RIUL 1RMFL 4ONFL 4UDTB 3PWNA 1B0RA 5TF0A 2CO7B 5SV4A 5DJAB 4ELMF 1ZLSL 4DKFL 5I30H 2QQLL 1P4BL 3OKOB 5DMJB 3RBGA 1PLGL 5ALCH 2AQ2A 4KZEH 4AT6B 4CL7A 4WNQB 1U9KA 3TT3L 4UT6H 1CXKA 1ULVA 4NQEB 5EU3A 3HLAB 4Z76B 3AS2A 2Q76B 4P3WA 1GHFH 3HNSH 1V3KA 2YHGA 1R3IL 4ORGB 4A2MA 4NO5A 5CZXC 1MHCB 4HK0B 4Z78B 3W81A 2YUZA 4OCWH 3I85A 2Z8RA 5D7IB 1FVCB 3X17A 1RIHH 3O2DA 2EZ0D 2EKJA 2Y1VA 4JVUA 2VLJB 1WUNT 1BEYL 5KAQG 3LKSA 1TETL 4JM2D 1XFPA 2PR4H 3HI6L 1SEQH 1KGCE 5GHWL 3OSKA 5F93C 3LEYL 5CIPB 3DV4B 4JQIH 4MNGB 4UDTA 5DSCB 5DJAA 4NFBA 3BDYL 4OGAD 1BD2D 3D25B 3S6CA 3OKOA 4LLVA 4AT6A 1HXMB 4WNQA 1IGIL 1U0QA 2YD5A 3OB0H 4YHLH 1JPFB 4NQEA 3KGRA 5DVNA 1FO0B 3HLAA 4Z76A 1DBAH 1S9YB 4X80H 2Q76A 4N1EA 1EJOH 1U92B 2KQNA 4ORGA 2F58H 1MHCA 4Z78A 3C6LC 3KPPB 3FRPG 4QXUH 4WEBL 1MHEB 3NCCB 4XHJD 3P4NB 2IMMA 5KJRH 2VNCA 4MQXD 4F58L 5JMRA 5D7IA 5C0BD 1I7RB 3OWEA 3X14B 3NN8B 4O5LH 1H9VA 5K93A 2Z8SA 3BKML 2G5BA 1BZ7B 4PJ7A 5DJDB 2VLJA 3K8LA 1A2YB 3QEGH 1PZUB 1OSZB 4WFFE 5HBBA 5A3IC 5HHPB 1JHKH 4P9HH 4GKNB 2QQNL 1RJCA 2IGFL 2WNGA 3NTCL 5CIPA 3DV4A 4MNGA 4AG4H 4GG8A 5DSCA 5D7SL 4W6YB 5E2JA 3D25A 1BQUA 3LZFH 4C83B 1RD6A 1HXMA 1U8KA 4IMKA 1FJ1B 1GOGA 4N0YH 3LPFA 1NBYB 5DA0B 1JPFA 1C5BH 3U7YH 5DEGB 1FO0A 2VITB 1S9YA 2GY5A 4M6NL 4LSVL 1U92A 4LVNC 4JKPH 5FA3B 1D9KB 3CH8A 5DO2D 1TJGH 1Y0LB 2E9JA 3KPPA 3GMRB 3STZB 1MHEA 3BEVA 3P4NA 3BPCA 1I7RA 1T04B 3NN8A 4WRLA 1KEMH 2K7PA 1BZ7A 4K71C 3ARDC 5DJDA 4KI5C 2GJ6D 5DFVD 3ROLB 5MP6H 3VDCA 1A2YA 1OSZA 1MJ7L 2X1PA 3L7EB 5HHPA 2GITA 4GQ9L 4GKNA 3C5ZC 2DB8A 1RJZB 1EEZB 3P0YL 4PTUB 5HY9B 2BSRB 2JKXA 3OZ9L 3EJYC 1RK0B 4C83A 3U2SB 4HCRH 1FJ1A 1NBYA 3QIBB 1A1OB 5DEGA 4S0TD 1E4XI 2VITA 1NCUA 4OUUB 3L3KB 4LK4A 4Y2DD 3ZHKA