2BOCB

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocB01
4N90E 4ZNCD 3BZEB 3ECBB 2HRPL 4XI5C 2XFXB 4LRNH 5EO9A 4B0MM 4PTUA 3OAUH 2ZSVB 3STZB 5A2JH 3MYZA 2YKLL 4N0CC 4XHQA 4S1SL 5INDB 4OM0H 3DSNA 1I8IA 1NBZA 1BLNB 3BKJH 4LSPH 5JPMB 1JPTH 1F58H 4DK6A 1WCBB 4NCC2 3D18B 1I9RH 4Y4KA 4UNTA 5FYLD 25C8L 3VRLE 3QT2A 2E8ZA 5DC4B 4PRPE 1LP9F 2B8OT 1JHLL 2YXMA 5IMOB 12E8H 4YXHH 4PJIA 2DQDL 4M8QB 4YHKH 1R0AH 1QKZL 1FL6B 3CPLB 4OF0A 1DVFB 1NMCC 4NN7B 3D2UB 4OCSL 2H1PH 4CDGC 3SDXA 3GSNL 2NQCA 2NMSA 4O5LL 5CMAA 2OTUA 4JFEB 1NGZB 4XPTL 4X9BA 3QJHB 3HAEG 2YD8A 4OZGA 5E4EC 5C0AD 1QA9A 4BSJA 4U0QB 1JGDA 1F3JB 1U3HA 4FFVC 4ZDHB 2VDPL 3ARUA 1IZJA 4YBHA 3RIFF 4UTBH 3MRQA 3SDDB 1ZOXA 5FYJL 4ZUTA 1IKFL 3MUZ1 3BZ4A 1ZLVK 3RWJB 2GT9A 3MBEB 5FOBA 3QG7L 1AH1A 3CJJA 1T0MA 4K8RL 1T21B 1FIGH 4X6DB 3VXTB 2GUOA 4ERSH 5EDXA 1KT2A 3T0AA 2VXTH 4TUOA 4JFDD 2D0FA 3OJDB 2VZTA 3H42H 4NHUA 4K3HA 4OCRH 4RGOH 3N9GL 2X9WA 3DVGB 2H6PB 1Q94B 5I6XB 2A6JB 2VNCA 5H2BA 1X7QA 3VXMD 4NM8H 4B41A 3KYNB 4ZXBA 4HH9B 2VZ3A 4KMTH 4XNUH 1YJDH 1LDSA 1BQSA 4QRTA 4JGMA 3CZFA 3ZSTA 4JY4A 4Z7QF 5D2NA 5HYEA 2VERN 4Z0XA 4OD2A 5F1IA 4YXKL 4HPOH 3NCJH 1U93B 4KQ4H 3B2VH 1HXYB 4WI6A 1FVCB 1G1CA 1PZUB 1GOFA 4MXQD 1LK3L 3W2DH 5E2WH 2AJVL 1V7ML 4F9LA 2X4SA 2LABA 3M17B 4RAVB 3IFNL 4WTWA 3MNZB 5I17A 4DK3A 4P5KA 4OD1L 5JA9A 2UY7A 1C16A 3GI8L 3RWEA 2NY3D 3CFBA 1VPOL 1D5IL 1FE8H 1MAKA 4JQXC 1Q9OA 3OBAA 2G2RA 4EVNB 5HGDB 3WN5C 5KSBA 3L6FB 4NQCB 4PJAB 3JZ7A 3MTRA 4NO0B 1OWWA 1QSEE 2HRPH 1FZMB 1NMBL 2Q86A 2BY1A 1JK8A 1WUNT 2P5EA 3L5WB 1FNSL 3VGAB 1ZWIB 3L7EA 3NPZB 1CK0L 4WW2F 4E0RB 3WSQL 3HA0A 1BJ8A 1V3KA 3BAEL 3RVVC 4KC3B 1YEFL 4S1SH 5IVZA 1P9MA 4QRRA 2HN7B 4P3DB 4LLMA 3QXTA 5D1ZC 4OZFB 4UIKL 4NQEE 1U3ZA 2NY4C 3BH8A 5JW4Q 3DBXB 5HYJB 1JZ6A 25C8H 5IMLB 4RMRA 1JHLH 1R5VB 1I7ZB 5IV2B 5KVDL 4Y0GA 2DQDH 1DP0A 4ZAKB 6CGTA 2J1KA 1QKZH 1YY8A 4HD9A 4XVTL 5J3HC 3SKOA 3LKRB 1T1WB 1FAKT 1Z6JT 3HB3C 3SO5A 4LVOB 4OCSH 4OFPA 1LK2A 3GSNH 4CL7A 2XT1B 4L3AA 4O5LH 4X7CC 2PW2A 1PVHA 2W38A 1Z3GH 4PJBF 1NFIB 1ORSA 1YEDA 4WWKB 4XPTH 1F13A 5ACLA 4GAJL 3TN0D 5GGVY 4Z77B 3L3KA 3QFJD 3PQYA 1DN0A 3T4AA 3QEHB 4HULB 2AK4B 2BZDA 2XYCA 5E5MA 2WWMD 1PSKH 1P1ZA 2VDPH 3DVIA 4K9EC 5DMGC 4Y4KC 4OLVL 5FYJH 2R0WL 1FO0B 2NY1B 5E95B 1IKFH 5F7LB 1A6PA 3WO4B 1E28B 3PNWA 1PX4A 1VENA 3REVB 3VFTB 3QG7H 2AEWA 5KVMC 4K8RH 5IQ9B 3A6OA 1E27B 3TFKD 4HGMA 1F6LL 3ARGA 5H35A 1QLEL 1S9XA 5DS8A 5AZEL 1I1CA 3MRPA 4R90L 3N9GH 4NRYB 4PJXE 4PD4J 3S3PA 4U1SB 5DFTA 3T65A 2PTTA 1JV5B 1WC7B 3QIBD 1IGIL 1W0VA 3U9UB 4D0CB 5LWYL 3RGVA 3EO1A 5JIPA 4PRAB 2VZOA 4XNZB 5FV1L 3LQZB 4NUJB 1NKRA 2ATKB 4UT7L 4K94H 1XF3B 3DVNB 2EE6A 4WTXA 2VLJA 3BGAA 1QSEB 5GJTL 5BO1H 4L4VB 4LEXL 4YXKH 4JKKA 5GSVB 4KXZH 4U1GB 3QPQD 5EUOE 5LQBH 2CK2A 3MRHB 4RMSA 1A3RL 5K9OA 1T20A 2WIMA 3BRDA 1E4KC 4DJMA 3D85D 1MNUL 1C12A 3MCG1 1B9ZA 4M8VA 1SY6L 1BIIA 2AJVH 2YA1A 5FA3B 1CFBA 2XG5A 3NN8B 3IFNH 2FJFB 3BO8B 1S7TB 1ITBB 4NQEB 4P4KB 1P6FA 4QHUA 2IMNA 4HBQA 4OD1H 2GITA 3GI8H 2D9CA 3QR2A 2UWEB 2DQJL 1D5IH 4HIEA 1ZLWK 3KXFA 4NQVA 4AYFA 5IKCA 3K1DA 3SE3A 3KS0J 3RX5A 5ISZE 4F15C 5K9KA 1H5BB 1NMBH 3MRDB 4G7VL 4L3CA 2H32B 4Y4HB 3RWIB 1FNSH 4N8VA 4LSQL 1T3FB 1CK0H 3WSQH 3BAEH 5E4IA 4GG6B 1YEFH 4G3YL 4RRPA 5AWNL 3KPOA 1ZKAA 4O2EA 3F7QA 3IDGA 1QSFB 2CXGA 1NAMA 4UIKH 4F9LC 5DJDB 4AENB 2DI8A 1SJXA 1OP3K 4F7MB 1GXEA 4WU5B 2HJKB 3CVIL 5C0BD 5KVDH 2X4OA 4GAFB 4KHXL 1GAFL 4XVTH 4J3UA 5EC1B 1Z9OA 4DVRL 2YD9A 2BDNL 4X4XA 2GJ6B 1N3NB 5C0AA 1ZSDB 1RJCA 5J57B 5A3IC 4OUUB 1CDCA 4GAJH 1JYWA 3REWA 1CGTA 4G9FB 3UO1L 1P9MC 2P8PA 4UMGA 4N90D 3DGCR 5HY9B 3O9WC 2UYLB 2XXCB 4OLVH 2R0WH 3GKZA 4CJ1A 1DUYA 4K9EL 2V7HB 3W9DA 2Z91B 5I73C 4H88L 4XCEB 3DRTB 2Z9TA 1ZHBB 2ZCHL 1FH5L 1XZ0A 2O93L 1UEMA 4K7PL 1IGJA 5DQDL 1QLEH 1F4WL 4X6DF 4YHNA 3QULB 4OCYH 5AZEH 4R90H 2Q87A 1JWMA 1R5IB 4ZSOE 1UKQA 3BDXA 2WP3T 4U7MA 5LWYH 4PRPD 3L3IB 1YMHB 2HLAA 4X98B 4IS6A 2FWOB 1ONQA 3ZE1F 1UG9A 4UT7H 1FSKB 5I1AA 5JZ7D 2ED9A 4JQVA 4LIQE 1UJ3A 3T0EB 2QQKH 3FOLA 4M7LL 5GJTH 1CFNB 2JB6A 1LE5A 4LEXH 5FYJU 1BJ1J 3KPPB 4Y1AE 4LSTL 3LCYA 1A3RH 1F6FB 1TNMA 3GIVA 4POUB 3CC5B 2ARJB 3BPLB 2EC9T 1MNUH 4RMWA 4NZDA 3FZUD 1AGEA 1SY6H 3BVNB 1J1OL 1YPZE 5DJAA 3NCYP 3BGFC 4HKZB 2ADGB 3S34L 4F7EA 4GXUN 3FN0L 4GQ9L 2R29H 2P44B 3MUGB 4JFPA 5BW7C 3EJJX 4Z7UA 5C0IB 4R26H 2DQJH 5FGCE 3B3IA 3OKOA 3RGVC 1JI1A 1P7KB 5CHNB 5HDQL 3X11A 2VIRB 2P1YA 4I48A 3VRLF 3GFUA 3UAJC 4JFXB 2FX7L 5A1AA 4OZHA 1UWXK 4G7VH 4PJ8A 3IDIA 2QR0B 4RWHA 4KKNA 5FK9B 4PJAF 4AJ0A 3EYFA 4LSQH 4WO4C 3N85L 1H15A 2FIKA 1CDBA 2CGRH 1UCBL 1H3TA 1JPGA 3AREC 4G3YH 5AWNH 4DAGL 2DIBA 3HZKA 2DWEA 1GH7A 1SJEA 3IFPA 3RWGB 2BNRA 1FFPB 4NCDA 3SKJL 1B4RA 1MJ8L 1MHEB 3O8XB 3VFPB 1MPAL 1F11A 3QIWA 1P84K 5DDHA 3VXNB 3CVHA 3WNLA 2PW1B 1FNGB 3CVIH 2D7QA 3IS1X 1BWMA 4NQDD 2J6EA 3KVQA 1KJ3L 4KHXH 3QEQB 2FHCA 4IRSD 1GAFH 2VXQL 1SVCP 2NY5C 1BX2B 3TNMA 3JV5A 4XNMB 5EU5A 4ZPVA 5KN5A 4DVRH 4HT1L 2BDNH 2BVQA 4WJ5A 4FA8A 3MACL 5FM8A 2BOBA 4IRZL 5DZOA 5T1KA 2MJWA 5F7HA 1QOKA 2G75A 3GMNA 4ZSOB 4J3WA 4L29B 3MO1B 4LSRH 5A2IH 2AK1L 3C9NB 4HKJA 3UO1H 5SV3A 3TBTA 5HYSB 4I18A 2IFGA 3QH3A 4LNVA 3KGRA 3SGJC 1GPOL 3E6FA 1CTNA 4PREB 5ETUA 4HPYL 4Z7WA 4BQBA 4H88H 4WI2A 4XAWL 4JGJA 2ZCHH 1FH5H 5E2VL 1K5NA 2Y5TA 4K7PH 5DQDH 4XVSL 2VXVH 4RDQF 3S8WA 2VL4A 1A6AB 1R3JA 1F4WH 1CLZL 3I3BA 3QIBA 2IBZY 2I24N 4Y5XA 1BM3L 4I4WB 3KLSA 3DX6A 2H26A 4PRNB 1MAML 2IH3B 3L3JA 3QWOB 2R39A 2A6DB 1PGRB 4IRJD 5HYFA 5C6TH 3X13A 2ADJB 5DHYB 2E7LC 2DLIA 1FNLA 2YA2A 2ZUQB 5FGCB 4YJZL 1LEGB 3RI5K 1JZ3A 4UIMB 4XP4L 3PHSA 32C2B 5B39B 3ZLQC 2NLJB 3D5OF 2A6KA 2Z8WC 4M7LH 3VXQB 5KS9B 2DQUL 5C0FA 5DVOA 2FCBA 3U30B 1NDGB 3FQUB 1A6TA 3V0VA 4LSTH 3T08A 5JMOC 2Z31B 4YFLF 4XX1G 3GSVA 2EYTB 2MCPL 1CDHA 3DX7B 4OF5A 5MEOA 4D94A 1NSNH 2WANA 1J1OH 5F6IC 1P53A 2D31B 1ZVSA 4KKCD 5HHQA 3S34H 3WV0A 2V17H 3FN0H 4GQ9H 2NXZD 5M95B 1QO3A 4RMVA 3VRJB 4K7PX 3TIEA 1U8QB 3IRZA 4LVEA 5C7XL 5CWSA 1HWHB 5HDOA 3DNKA 3T3ME 3VU2A 5I74B 3UZQA 2UWEF 2CDFA 3W39A 2WUBL 4G43A 1TZHB 4JQVC 4CUCA 4LP4A 4UNVA 5IFJB 3EOTL 1QLFA 3ARDB 3GB7A 4MXQC 5IW6A 1OSZB 3LB6C 1RV6X 5IBUB 5AAWA 3N85H 2B1HL 5E8OA 5ANMA 1KV3A 1UB6A 3T77A 1KIUA 4E41E 1UCBH 3V7AE 4WHDA 3DXAE 1S9VB 4DAGH 1WCQA 2BMKA 4Z95L 1YC8A 4PP1D 3LSOA 2AKRA 4V2BA 4GG6F 1H8OA 2NY3C 5SV4A 4RFNC 3SE9H 5J6HB 1MPAH 2X1PA 5FIEA 5DJCB 1AR1D 3P9LA 3WCYA 3PXHA 1WBYB 3IDNB 2ID5A 2MQ0A 4JZOB 4DUWA 4GW1B 1SYSA 3MV8E 1JZ4A 1XGQA 1JZ8A 5ERWA 1KJ3H 1CBVH 4YGVB 3SEPA 2F58L 5EU3B 1QRKA 2VXQH 4R0LA 2F15A 4X6CA 4QXTB 1HIML 2WM0A 1U3JA 2DKSA 3KPMA 4HT1H 4C56E 2NY5L 2V2TB 3MACH 4IRZH 4N1CA 2DI7A 3FRUA 2YZ8A 3ALWA 4UOW1 5LGJA 2YHGA 1FG2A 5IJKA 2AK1H 4OZFG 1SM3L 4R3SB 4M3KB 4NPYA 4HK3N 1ZHNA 5ISZD 5FYLL 1NCBH 4GS7B 4MQ7A 1KJ2L 3S88H 1GPOH 2VAAB 1RJLB 5IJVB 1NAML 4HPYH 1YUHA 3MJ7A 1KCSL 4RNRB 4CDHA 3O0RL 4XAWH 3VG9B 1MCFA 3B83A 5F3HB 3NZ8B 5D1XD 4M43L 2YPKB 4XVSH 4S1RL 3IJSA 4DKDC 1B0WA 1EHAA 4CMMB 1A1MA 2CLVB 1CLZH 5IG7A 1EHNA 1UGNA 1QLRB 2VXUL 3WNPA 1BM3H 1KPVA 4M7JL 1KJVA 1MAMH 4HUMB 4L9LA 4I3RL 4MJID 3VGDA 4GKZA 2WWMC 1MVUB 2IGFL 2ILLA 3WLWD 2XOTA 3V6BR 3MLUL 2BERA 3CIQA 3F7RA 3C5ZD 8CGTA 3G08B 3UTPD 4XP4H 4KQ3L 3DROB 2AXHA 3O3DA 1PYWA 4ZUWB 4R8WL 1EXUA 1FV1B 5J12C 4G42B 4G6FD 3VE0A 5B8CA 4RDQG 2XWJB 3TFKC 4OV5B 4KKAD 1AQDA 2DQUH 2VLRE 4L4JA 5KZCD 3EOAA 4YR6B 4FFWC 2NX5D 2NY6D 4GW5B 3KPLB 2MCPH 4E41B 1MCCA 1TQCB 5E0QA 5BZWB 4ODWB 1I1AB 2GSGB 3DXAB 3VXRE 2BSSB 1NJ9B 3QIBC 2X2YA 3MFFA 3FB6A 1CE1L 3KR3L 1AHWB 3EBAA 3U36B 1YZZA 3PL6A 1G7QA 2X4RA 2Y6SD 5DMKA 5E94B 5EIQA 2QKIA 4WFHE 4U1HA 1CL7I 1RIHL 1VSCA 3LKQB 2BY3A 3QDJD 1BD2A 1JRHI 1S7SA 2WUBH 4H0HB 1HHIA 2NY0D 3QPQC 4M4RA 2BVEA 3EOTH 2Z4QB 3VD3A 5DC0A 4C56B 3OG4B 4JLRA 2HAZA 3H7BB 4DCQB 3UJJL 1UM4H 4PGDB 5BV7B 2FSEA 2WBJB 1QR4A 2XKNB 2OJEA 4Z95H 5EBMA 2D7NA 4HS3A 1EERB 3LMJL 4R7NB 1ZA3B 3ULUD 3HFML 4I9WD 2Z93B 5GGRB 1IM3B 3BYTA 4NO2B 3HE6B 1DBBL 2J8UE 4Y1AD 3B6SB 2B4CC 4PLOB 4ETQB 3L9RA 2CRZA 3U4BL 2D7TL 2FZ3A 3U7YH 5D7IA 4DKEL 5CJBA 4MA3A 1HIMH 1P7QB 1Y18B 3OXRB 5TQ0L 4WFGD 3IDUA 5ITBL 2IG2L 2NY5H 4BFBD 2CKBL 5EC2A 2WWKT 2D03L 4PLJD 2KL6A 2IWGA 4M61B 5C0JA 3NIDF 3MRBA 1UVQB 4JVUA 1SM3H 5FA4B 3TPUA 4JDZA 1Z9MA 4OIAA 4YHLH 5FYLH 1T83A 2K7PA 3SJVE 1KJ2H 3SN6N 5DHVA 1O7SA 1KCSH 2VLRB 3O0RH 1NC4A 3FRPG 4ZFOA 1VFBB 1DFBL 4JFOB 4S1RH 4HIIB 1U8IA 4PV8A 2X9XA 1NCTA 4R0LC 1KBGL 2J6EL 2VXUH 3LRHA 4R4ND 2EDTA 4M7JH 3WIIL 2ZG3A 1EJOL 5HJ3B 3PGCB 2WNGA 1PD6A 3KPSD 2IGFH 1XIWB 2E9IA 3N1MC 4W81A 3MLUH 1YYLL 4KQ3H 4L5FL 4EUPA 3MR9A 3VXSE 3VFRA 4X7DC 3DECA 1F45A 1KB5A 3U4EB 4JFFA 4XPBL 4TNVK 3SQBA 4PG2A 4X80L 1FN4B 1PQZA 3OKDB 2APBA 5C0GB 3UTSB 2QADD 5KG9A 5KS9F 1RU9H 1CI5A 1KIPB 3FO0H 5GGSB 4C59B 4RX4D 3QAZB 3AAZB 2R1WB 1CQYA 5FCSH 1CE1H 4QNPE 2G5BA 3KR3H 3LN9A 2W0FB 3V6ZB 2PYEA 4HIHB 2DD8L 5JZ7C 2ENYA 5HBBA 43C9B 5AYQA 2O5XH 4AH2A 1T22B 2VR5A 1RIHH 2J8UB 4JN1L 5DMIL 4S1DD 4YHZH 4IMLA 5J1AB 4ORZC 3A6BL 1T0PB 4LCUA 4ONFL 3S5LG 2XQYK 1ORQA 4G8GD 5IWLA 3OMZA 4DEPB 1NFDE 3FZUC 3HZYB 1YN6A 1KUMA 4NFBA 3FQXA 3FT4A 4POYA 3O6FD 3UJJH 1D5XB 4YHIA 1TITA 5JIHA 5K59F 1RZFL 3SDAD 1UZ6F 3TNNB 5HHVL 3OR6A 4R9HA 4PJ9A 1MI5A 3L3GA 4NDMA 4F9PA 3LMJH 2FEEL 5KSAD 5MERB 4ZOAA 3HFMH 5DK0B 5JDJA 3MQIA 1RPQA 3GSWA 4NT6A 3P3YA 3ZYIA 3RZCD 2A83A 2FGWL 3DARA 3ZE0F 2IH1B 3RKDD 5E03A 1DBBH 4IJ3C 5MEPA 5SWSD 3B9KA 3UZVB 1IAMA 4AY0A 3MGOB 3SOBL 3U4BH 3U2SA 2D7TH 2EIBA 1KIQB 1MFNA 2VLKE 1S8DA 4XMLL 4DKEH 4U6YA 2JCCA 4ZS7L 5TQ0H 5ITBH 2IG2H 1HQ4A 2F53E 2CKBH 2ITCA 2D03H 5I2IA 5F7MC 3RVTD 5CEYB 1WFTA 3QWRD 5LAXB 5C3TA 2C1OA 5ESQA 3W0WB 4JREB 1UADC 3BD4A 3NIFE 1EAPA 2PXYB 2FYYB 4P23B 4IRSC 3FB5B 3C60A 4OQTL 1UM6L 1BECA 2PR4L 2YBRA 2DMKA 3QZWB 4KV5E 1PKQA 1ZT1A 3EDFA 4PJFE 4PPTA 1DFBH 4WFEE 1TTUA 3RVWD 4AK1A 5HVGB 1FGVH 5ACZB 2R2HB 1KBGH 4KDTA 4P5TA 5GRYA 1EEZB 1VEMA 4CU7A 2R1YA 4ZUVB 3WIIH 1U8KB 3SE8L 1BZ9A 4U1NA 1EX0A 1EJOH 3U46A 3H3KA 1YEGL 3U0PB 2P47B 3T2QA 3NABL 5HYSG 4BH7B 3MV8D 4LVNB 1IGTA 1YYLH 3DJ9A 1A47A 4L5FH 3HI1B 3EJZD 1IEBB 3IETB 1T83C 1TJIH 1SJHA 5C07E 1HYSD 3RBGA 1YEJL 4M7ZB 3HHRB 4XPBH 3T2PA 1S7QA 5TE4L 4X80H 2PKDA 4XP5L 2V2WB 3B2UC 1WIPA 1DE4A 3P73B 1KGCD 4YDVA 3ARRA 1BIHA 2XACC 4LKCA 3L95B 2CLZB 1X5YA 4LF3B 3SCMB 2YPLB 2LU3A 4APQA 1A14L 1FCGA 4IRJC 4Y2DD 3HMXA 5LXGL 2W59A 3KJ4B 1FL5B 2EC8A 4FG6C 3VD9A 5IEHA 2DD8H 1XR8A 2Q1EA 1BVZA 3DO3A 3I85A 5IVXB 5B39G 4QHLA 4JN1H 1X4YA 1NGWB 2PTVA 3VXUE 3A6BH 1AGCA 3D39D 2XQBL 3IFOB 5E7FA 5JTWA 4ONFH 2YUZA 1CVRA 3MLTA 3T0WA 4Q9RL 1Q8MA 4PG2C 2F53B 4GG8B 3QDMA 1CLOL 4HWZB 2GJZB 2XNAA 3MV7B 4X5WA 1RZFH 4P46D 5HHVH 3I3DA 1CR9L 3ULVE 4XC3L 2NXZC 4HUXA 5GS2D 3PWJA 3OKLA 2IANB 3FT3A 4Y16A 4U31A 4I3GA 3W11D 4EEEA 3H0TA 2XZQL 1T0NA 1JN6B 3ILQD 1A2YB 4HBCL 3O6ML 2FGWH 3BUYA 3FFDA 3K4AA 3TIDA 4ELMB 3WUWB 3IF1B 3SOBH 4L8SA 5BRZE 3QI9D 4IOIB 4UV7L 1N8ZA 3CMOL 4XMLH 3BH9A 1U92A 1A7PL 4ZS7H 3C6LA 5IP4A 1J8HB 5DEFB 5IBUG 5I8CB 5ENWA 1NPUA 5GRWA 4HAGA 4PP1C 4QHNB 3K0WA 1MFEL 3KPRD 4WFHD 5L0QC 2RR3A 1FJ1B 4MX7B 1BF2A 2CDEA 4MDIB 4F8TA 1KC5L 1JGEB 4JE4B 1AR1C 3VXOB 3WL9B 3IJYA 3BEWB 4UAOC 2IBGA 2MWCA 1G7IA 1JPFA 2Y23A 1X6NA 1MCDA 4XTRC 1WSST 3FMGL 1RZJC 3VFNA 4OQTH 1UM6H 5GIRA 2KUTA 2PR4H 5J13C 3OX8A 5HGHA 4JM2B 2CPCA 1A3LL 1BOGB 4MZ3A 5HI5D 4PRHD 2GEEA 4ZUUB 3AGVA 1EV2E 4E5XA 2R1XA 3VXPB 2H41A 8FABA 1N6QL 1AO7D 4CU8A 1YEGH 2JIXB 4YDJA 2D2OA 2X6MA 5F9AC 5KSVB 3WLBB 3NABH 1SJVA 3T0BA 5EOQH 4OKVA 4DW2L 5DI8A 4D8PA 4LARL 2DLFL 2OR7A 3G5VB 4PG9B 4GAYB 3HR5B 5CLTA 3G6JA 1ACYL 1EEUA 1I9JL 4JFZL 2D7OA 2A6IB 35C8L 4RGNC 1YEJH 2YEZB 1NANH 2W9EL 4YAQA 3LN4B 4GMTL 4NRXA 1JNNL 3LEXA 5TE4H 2QLVB 4HX1B 4XP5H 1FBIL 1LWRA 5DK2B 4F3FA 2I9TA 2XPGB 3KPQB 5D1QB 3O4OC 1ACZA 1A14H 1OB1A 2Z92B 2ZSWA 4OFKA 4P5TC 5LXGH 1JFQL 3QXAB 3SJVD 4HH8A 4OTXH 3E3QC 3CFDB 3C5ZC 1FVDA 4CVZA 3TJHD 2X4TA 4NBZB 3ZTNL 2HT3D 5JIKA 1ROWA 1I85C 4Z7OE 4JZJB 4KKAC 5IF0B 4G8GA 5DQJA 1T1XB 4YBLC 1Z9LA 3HZMA 5E8PB 3OWEA 3QNZB 4QRSA 5BVPL 3BQUD 3TBWB 2J8UF 5C0CD 2NY6C 1INQA 5J4MA 4Q9RH 1VKXB 5TH2B 1A7BA 1X5AA 3NH7L 4S10A 3WEXB 5HHXL 1KB5L 1CLOH 1TCRA 3QQ3B 2JK5B 2ADIA 4TN9A 1CGYA 3D69A 2P24A 4YK4C 5HVHB 4XC3H 2XTJD 4TVPD 2MHAA 2EYRB 2Y6SC 3STBA 3FKUS 3VXSD 3PDDA 4MA1B 4UQ3A 1U8MA 1AGDA 5T1DL 5I9QB 3DV6A 2OYPA 3ISWA 3WFBL 1KPUB 5DGRA 4HBCH 3O6MH 1FYTB 1RHHA 1K3IA 2EICA 2NY0C 4PJ7E 5DC9B 3BZFB 1S3KL 4O2FB 4L4TB 1I3RA 1G9EA 3ETBF 4UV7H 3CMOH 5GHWL 4H20L 1A7PH 1KN2L 3QWRA 1GYAA 4QT5B 1WAAF 5C8JA 1NEZG 4RAUB 1QUNA 2FIRT 2V5YA 3LN5B 4EI5D 1MFEH 1ZLUH 3EOBB 4Q6IA 3OL2A 3TPKA 1RUAL 5FO9B 4PR5A 2YN3A 3ULUC 1KC5H 4XCNA 1JTPA 1M4KA 5F7DB 5HHOE 3KYOB 1REIA 3QG6A 4ZFFA 3E6HA 4FTVA 3P0YL 1R3LA 1CCZA 3NA9L 4QXWA 1A8JH 1J0IA 3FMGH 1NDMA 3QUMB 1XT5A 1CD8A 2D9QB 1S7RA 1RZJL 2GI7A 4PJDB 5I76A 1YC7A 1A3LH 2DM7A 3NCEB 4X7TA 1JE6A 4JPWH 3SGEI 3TM6A 4WENB 1NC2B 2VXSL 1OAQL 4PLJC 2HG5B 2WV3A 3PDGA 1FZKB 2AXJA 4P2RB 3RWHA 1N6QH 1LP9A 3H9HA 5HHNA 5IFAL 1JHTA 4CVXA 4BH8B 4JRYE 5FM4A 4NSKB 4I0PA 3C6SB 1FHGA 3DVFA 3TJEL 3MCKA 4I77L 4HEPG 4DW2H 4MZ2A 2AJYH 4LARH 2DLFH 1CZ8L 5CJXA 3NFNA 3BP6B 1LO0L 1ACYH 3MRGA 3RIAF 1I9JH 4WY7L 4MJ5B 4K3DL 35C8H 1M7DA 3QCVL 2N7AA 4GKNA 4CBPA 1UQSB 4GMTH 4WV1B 1JNNH 5ICXA 2EDDA 4JG0H 1M6OB 1FBIH 3MLWL 4FQXA 3JTTA 4R4NC 3D2UD 2JJSA 1EPFA 3PHQB 1JZ5A 2ESVE 5C0ND 3MV9E 2XWBA 4N8PA 2QSTA 4KUCD 4R96B 5CSBA 4OQ1A 3AB0C 4PTTB 1MFCL 4RQQB 3ZTNH 5MEND 4L8CB 5EZJB 3WFEL 1SYVB 2E7HA 4PJ7B 2NNAA 3HRZB 3QUXD 3WS6A 1P84J 5C6PB 4WFED 3OGOE 5IVXF 2IEPA 2XICA 4FQHB 5BVPH 1KIRB 4TSAH 5ALCL 3I6GB 1XF1A 4XRCB 3TCLB 1G1YA 3MGTA 4HZLB 3NH7H 4CVWA 1A4JB 2VO5A 2F74A 1KB5H 4N9OB 5HHXH 3HLAB 4HSQA 4LSUH 3ZDYF 4MCZB 3T1FB 2X9YA 4DKFH 4NNYB 1W72A 1OW0A 1AKJA 2ED8A 5F96L 5MEQA 1GZQB 4HDIA 5HHOB 1AXSB 5C07D 1U36A 4HMDA 5T1DH 4S1DC 1LE9A 3WFBH 1UH4A 4LAJH 2B7DT 3VDBA 5TGBA 5L9DL 5IW1A 4LGRB 4XB7A 2JJWA 1E4XI 1S3KH 4G8FB 2AV7B 5DJXB 5JPNA 3INUL 4UT6L 3S97C 3GJFH 1ZEAL 3KPRA 4Y5YA 5GHWH 1A64A 3O6FC 4H20H 4ODUA 4ELMF 1CXFA 1KN2H 1PX3A 4G7YL 2V6HA 2EIZB 3FAWA 5EU6A 3SDAC 1CE6B 4JO2L 4S11A 2NW2B 2X4UB 1OF2B 3RX7A 4EDXA 5C3LD 1BPVA 4LP5A 1MWAL 1RUAH 2K1MA 2C7UB 5SWZA 2AV1A 3IS0X 2OQJB 4BFGA 3VXUD 1CICB 5KTEL 3ULUL 3P0YH 1ND0A 3MRNB 3RKDC 4HLZG 4MXVF 4FQQB 4BSVA 4WW2A 5E9DA 3NA9H 1N59B 1VCAA 3MNWB 1ODAA 1WBZA 1RZJH 4ODHL 1ZHLA 2EEAA 2ITDB 4NJ9L 2VXSH 1RQ5A 1HEZB 3FHAA 4YDLB 3ULVD 4H5SA 4XH2B 5JNYB 4Z5RB 1OAQH 1NGYB 4JM2F 3RVTC 4L3ED 2I9LA 1W8NA 2AVGA 4YQXL 3PF2A 3MV9B 4D3CL 2KQNA 5IFAH 3FQRB 1ZS8A 3DOSA 5EBLA 1J0ZA 3MLSL 2EDOA 2ICEA 4IHOA 3TJEH 2D4DA 4I77H 1U9KA 4Q74A 3RTQA 3I75A 3SY0A 1LMKA 3CFJA 4XPGL 1CZ8H 3FONB 5BRZD 1RUPL 1LO0H 1S7WA 4WY7H 4K3DH 3QCVH 2J3SA 2C4FU 4NKDB 4ZO9A 1IM9B 4O51B 2A9ML 3RVWC 2CKNA 3MLWH 4N5ED 2K7QA 3D6GA 5F8QC 5FM5M 4HFUL 3KLHD 5FO7B 4Y19B 2D7PA 2DLTA 5ESVB 2ZNWA 4R4BB 4KK6D 1JUFB 1CT8B 4OCWL 4PJGB 2DRUA 3EYVB 2HTLD 2FO4B 4GRLB 1NEUA 1T2JA 3X17A 1MFCH 2OS7A 4ODXB 4I0PC 5GZND 2AK4D 3V4PL 3EJZC 1DBKL 3VWKD 3WFEH 1HYSC 3B5GA 4FMKA 2ATPA 5F7NC 4HUWA 3VDAA 4BZYA 3DUSB 1EMTL 3K7UA 5ALCH 5D7JD 5CP7B 1IZKA 4JVWA 4K3GA 4KFZC 3RBSA 4QO1A 4EN3A 4Y2DC 3T04D 4HIJB 2X7LA 3UYOD 4FQXC 1DCLA 4G80B 1ADQA 3R06A 3WHXA 1B0RA 4U1JB 5FKAB 5F96H 5EA0L 1AP2B 4ODTL 5HHME 1BQUA 4ZUSA 4OLWL 3GMLA 3OHXB 2W91A 4AG4L 5F3BA 3UTTA 1AD9A 1OGAE 3BP7B 3U82B 3I6LE 5D7LE 1EFXA 3ZDXE 5I18L 4L4VD 1OTTD 3INUH 4V1DE 4UT6H 7FABL 1ZEAH 4BSWB 4MD4B 4JY6B 3PWPD 4G7YH 3KYKL 2HFGL 4P46C 1PBYA 4WNQB 4JO2H 2W0PA 5D5ME 3O4LB 2ZUUA 4QOKB 3OZ9L 1WLHA 2J5LC 3OGCB 1MWAH 5D93B 3V52L 3FQNA 3W11C 5IB1A 1K8IA 4R7DA 4XGZB 3ILQC 1DSFL 4YBQD 5IMMA 3RL1A 4LIQH 5JO5A 1UENA 3GO1L 4U33A 3ULUH 4NCC1 3BZEA 1IAOB 2FATL 2H9GB 1JI2A 3ECBA 5C0RL 1WFNA 2XFXA 3MBXH 3ARBB 3WUWG 3QI9C 2ZSVA 3STZA 2Q7YB 3TVMB 4ODHH 2EEDA 5INDA 4NJ9H 1OQXA 2R2EB 4ONHB 3CH8A 3VW3L 1BLNA 4A6YL 4TTGA 3JUYA 3S7GA 5GGUB 4OB5L 2BNQB 4PJDF 4Y5YC 5JPMA 1AFVL 1WT5A 4YQXH 1WCBA 2XRAL 3D18A 3OTTA 4D3CH 2DQCL 3HNTH 4LK4A 3IU4L 3MLSH 3FN3A 1MLCB 5IMOA 4M5YL 5IESL 5GRJL 3BWUC 2BXYA 3ESVF 2X40A 4M8QA 4PJHB 1CXEA 3EYSL 4XPGH 4MWFB 1CIDA 2RJMA 4NC1C 1FL6A 3CPLA 2DB8A 3IU3B 3TWCL 1DVFA 4MA7L 1RUPH 3DI2B 5A43C 3D3VE 3D2UA 3LPFA 2IQAB 2X89D 1YDPB 1L0XA 2DYPB 2AXFB 5HI5C 5C08B 2A9MH 1PEWA 3ZDZE 4JFEA 3QDGE 5C09D 3I3EA 1NGZA 3QJHA 4HFUH 4XAKE 2HT4D 2IFFL 1I7RB 1OTSC 1F3JA 4OCWH 2FH6A 4ZDHA 3ZE2E 5JOPD 4XCFL 3SDDA 3P4NB 3HAEH 5HHMB 1QQDB 3RWJA 3I02B 3HE7B 3MBEA 5F1NB 1RULL 4LPTA 3O6KL 1DBKH 4KK9D 1T21A 4OKDA 4Y4FB 4UINL 4X6DA 2P48B 1KCKA 1I9EA 2AJUL 3RTQC 4WRLA 3VXTA 2BHZA 1KXQE 1QYGH 4TUJB 1EMTH 4FP8L 3OJDA 4PJ7F 1BJMA 1BFSA 2AJZB 3O2DL 1JNLL 2DJSA 5FYJE 4JRYD 1PEZA 1U2CA 1OAKL 3TO4D 3DVGA 2H6PA 1Q94A 4DOHB 4HWUA 1KELL 2KZWA 2A6JA 2P7TB 2OK0L 3KYNA 4ZOCA 4HH9A 3TJHC 5HDBF 4XNQB 5EA0H 3TLRA 2HT3C 4ODTH 2XZAL 3DMMD 2UUDH 4BJLA 4MAYB 3ORJA 4M93C 3U4AA 4AG4H 2CQVA 4PY7B 4HCRA 3CDYA 1U93A 1HXYA 3GMPB 1X5FA 1FVCA 1BVKB 2ESVD 4RAVA 3M17A 3SKNB 4ODVL 3QUZD 2GAZB 4ZOEA 3MNZA 3UCRA 4R4FL 2XTJC 1U8OB 1DSFH 4EVNA 1GGIL 1KLGB 4I8DA 2R0ZL 2XKUA 5HGDA 4TRPL 4MLSA 3K74B 3L6FA 4NQCA 4PJAA 1TETL 4NO0A 2DKUA 2FATH 5C0RH 1FZMA 3L5WA 4D2NA 1ZWIA 1TVBB 2H2PD 2BX5A 3QUKB 4E0RA 3ARFB 3AU1B 3QDGB 1MF2L 2FH8A 5J7CC 1LEIB 2ZKHL 4XHJD 3VW3H 4PJ5D 3WXWL 2HN7A 4A6YH 4P3DA 4EI5C 4OB5H 2MQ3A 3OPZL 4OZFA 3JV0A 2XRAH 3UBXB 4GSDL 3S35L 4U3XA 4EBQL 2DQCH 3DBXA 5HYJA 5CUSL 3IU4H 5IMLA 1ZVYA 3GSNB 1R5VA 4M5YH 5IESH 1I7ZA 5GRJH 5TDOB 5IV2A 4NBXB 2W65B 2OM5A 3EYSH 4ZAKA 5E24E 2B1AL 3TWCH 4MA7H 1T1WA 5DRXB 2X10A 3SBWA 3VGGA 5BS0D 3VFGL 4HS8L 1EVUA 4S2SB 4KKLD 1CG9B 3HNSL 3QEQD 1F4AA 3IDJB 4K55A 3HI6H 1PG7W 1NFIA 1YMME 2XXMB 4WWKA 1W2KT 2IFFH 4Z7UF 1UEYA 4Z77A 1T03L 1XCQB 3QEHA 2AK4A 1UA6L 5HXMA 2EC9U 1WT5C 4XCFH 3DSFL 4W4OA 1OY3B 3CU7A 1B0GB 3FN9A 1FO0A 2UZIH 4LHUB 1MCWW 4GMSL 4P9ML 1E28A 4PJGF 3QIUB 1MRDH 3REVA 3VFTA 1RULH 4LPCA 4Z7NF 1C5BL 4NYLB 3O6KH 1RMFL 4H25B 5IQ9A 3CX2A 1E27A 4UINH 5F1OB 2AJUH 4WUUE 2ERJC 1SMAA 4FQJH 3I6KB 3HZVB 1B90A 4FP8H 4C55A 2DWDB 2ED7A 3O2DH 1JNLH 3V5DB 1WWAX 5GPRA 2L7UA 4NRYA 5LVEA 2IPTL 2VMFA 3WFCL 1PLGL 5C0NC 2A77L 4ALAL 4U1SA 1OAKH 3F62A 4NZTL 3U9UA 1JV5A 1WC7A 4D0CA 3DI3B 1KELH 1JTTA 1A21A 5DRNB 5DSCB 3NACL 4PRAA 3WFDL 3LQZA 1CGSL 4NUJA 2ATKA 4WWID 3ZT7A 1DBAL 3LQAL 1XF3A 3DVNA 4N8VG 4WI5A 2XZAH 3RWFB 3SDDC 1P5UA 3QUXC 1QSEA 3MOBL 4L4VA 1HQRB 4HGWB 5ESAB 2JJUA 1JPST 4HXAL 5GSVA 3VGFA 3MRHA 5KOVC 5T3XD 2OR8A 4CAGA 1I1RA 2EECA 5F7EL 2DQTL 5FA3A 3MRLB 3NN8A 4ODVH 2FJFA 3BO8A 1S7TA 4NQEA 4P4KA 3ZKMD 4R4FH 2PCPB 3WIFB 2H2SD 5I6XC 1YQ2A 2UWEA 3DPBA 5GS2H 4TVPL 4JJ5B 1GGIH 2R0ZH 4TRPH 1F00I 1ADQL 4J3OC 3ZTJG 1KCLA 1TETH 4MNQB 2LTQC 2DQGL 1H5BA 1JZ7A 3WJJA 3MRDA 5DLML 2H32A 4JHAL 4Y4HA 3RWIA 4LPWA 5ACMA 1XGYH 1JGUL 1RZIB 2GK0B 5ICYB 1T3FA 3ARYA 3VFSB 3VFOB 4GG6A 1MF2H 3BPNB 4JANB 1FFRA 5L8JB 2ZKHH 4FN0A 4EI6B 3ROOB 3WXWH 5D6DA 1QSFA 1JYVA 3OPZH 1H0DB 1WZ1L 2DBLL 4GSDH 3MZGB 3S35H 2ZNXA 5KW9L 5GZOD 4EBQH 3OAZH 5T33L 1TDQA 4N0UE 5DJDA 2LQRA 1N0LA 3P11L 1GIGL 5CUSH 4AENA 1NMCB 4HV8B 5CBEB 4F7MA 3SDCD 4WU5A 2HJKA 2FRGP 5DA4A 3HPLB 1OGAD 4QTIL 3I6LD 4HWNA 5D7LD 1S78D 5EIVA 2B1AH 4WUUB 4V1DD 4JAMB 3UTZB 5I1KL 4PJHF 3VFGH 5EC1A 1BOYA 4HS8H 5JHDE 3QUYD 2GJ6A 3VGAC 1HCFX 1N3NA 2ARWA 3HNSH 1ZSDA 3FO2B 3DHMA 4OUUA 3CD4A 4Y5VC 1VFOA 1D3CA 4G9FA 1T03H 1UA6H 1TJHL 5DD6B 1QHOA 5HY9A 3DSFH 2UYLA 1NGPL 5IK3B 2DM2A 1V3MA 2V7HA 4GMSH 4P9MH 2Z91A 5DEGB 4XCEA 3DRTA 1C5BH 4MQSB 1ZHBA 2V9QA 3HG1E 1RMFH 1BBJB 3GBML 3CNKA 2H45A 4ZAKC 3S35X 1QRNE 3L3HB 4N5EC 1IVLA 4X6FB 5IROA 2YOCA 3KLHC 3QULA 5K9QI 4KI5E 1XGPB 5D71L 1WISA 2IPTH 3WFCH 1R5IA 1PLGH 4KK6C 2A77H 4ALAH 4GBXD 5L2JB 1EK3A 4NZTH 3L3OB 4WWKC 3L3IA 4AEFA 1YMHA 1SMOA 4X98A 2FWOA 2HTLC 3NACH 3M8OL 3WFDH 4JVPA 1CGSH 1ES0B 1HSAB 1NCDL 5GZNC 1DBAH 3LQAH 1OLZA 4U05A 3VWKC 3D3VD 3GRWL 1MQKL 3RUGE 3T0EA 5HVFB 1CFNA 2UV3A 5DT1H 4I2XB 3MOBH 2GW5A 3WO4C 3WFHB 4HXAH 4P0DA 3KPPA 5D7JC 5T5FL 3SDXE 4OGZA 4IMKA 3CC5A 2ARJA 1KLUB 1OLLA 2APFA 5F7EH 2DQTH 1QFUL 3BVNA 4BFEA 4OZGE 3T8XB 3GJEB 4HKZA 1EGJL 2ADGA 4L1HA 5K33A 3WN5B 1NCWL 4N0UB 2EDRA 3MUGA 4POZD 2VKXA 5C0IA 2AW2A 1P7KA 4LKXB 4TVPH 5CHNA 3NOIA 2VIRA 3VH8B 4XNZC 5DJ0B 3EIFA 2BSTB 1ADQH 1HK6A 4JFXA 2M2DA 2LVEA 2DQGH 3VWJB 4I1NB 5EO0B 1HH9B 2DN7A 3ARQA 5DLMH 2QR0A 4JHAH 5FK9A 1ZLVH 3ME0A 1JGUH 1OTTC 1FC1A 3CH1B 4NUGL 2E6JA 3VD5A 4U1GC 4OF7A 2HKHL 1G84A 2NY4B 3HN3A 1MCQA 5EZOL 5T3ZE 3ZDZF 2XZCL 5EZLB 1MJUL 4X6BB 1S5IL 5FO8B 1WZ1H 1JMXA 3RWGA 2DBLH 3IJHB 1FFPA 5KW9H 5FM5O 1MHEA 3O8XA 1UWEL 5T33H 3VFPA 3EDDA 4KPHH 4H26B 1GIGH 5EORL 3FQTB 2F5AL 3VXNA 2PW1A 2ARJQ 4E9LA 1FNGA 3O41B 3KDMB 3HG1B 4QTIH 1AXTL 1BFOB 3BRFA 3QEQA 3OKYA 4HUKB 2F54E 1BX2A 1CGWA 1Y6KR 1QRNB 3HE6D 4XNMA 5I1KH 5JQ6L 1H5BC 2F8VA 2XZZA 3MXWH 3GSXB 1D9KB 3I50L 3ULSA 5B3NA 4PRDB 3H9SE 4ZSOA 3ULVL 1P7QD 4L29A 3MO1A 5IOPB 2VWEC 1KTLB 3C9NA 3O3EB 5HYSA 3LKPB 3PJSB 1NGXB 1TJHH 5E8EB 3ARTA 1NGPH 5KSBE 4PREA 3RUGB 3GNML 1UC6A 3RX8A 3ARWA 2E3VA 3G6AB 3GMQB 2JJVA 2IAMD 3PIQB 3GBMH 4WGVB 3M1BB 5D2LE 1SEQL 4MD5B 4KRLB 2FR4B 1A6AA 2BSRB 2HFFB 2X1WL 4OZIB 3R0MA 2VQUA 1MCOH 1RZ8B 4I4WA 2HT4C 4PRNA 4QRRE 1I1YB 2IH3A 5FECB 1IEHA 3QWOA 2A6DA 2X41A 4KROD 2ADJA 4XWOD 5DHYA 5EH1A 2I26N 3M8OH 2B20A 1LEGA 4UIMA 32C2A 1NCDH 5B39A 2NLJA 4KK9C 1XIWD 1Z0NA 2E8YA 3GRWH 1MQKH 1TCMA 4Z6AT 3VXQA 1HSBB 5KS9A 3PP4H 4KJQD 2VN7A 3U6RB 1NDGA 3FQUA 1YMMD 1MCRA 3BDBA 5I66B 5T5FH 2Z31A 1G6RL 5FYKU 2GY5A 1QACA 1UKSA 2EYTA 3LKNB 1Z5LB 3DX7A 2FDBP 1G7JB 3T0DA 1IRAY 3TO4C 1QFUH 5IROC 2D31A 3S37L 4Z7VB 1EGJH 3BMWA 4JKWA 1NCWH 3JXAA 2APXA 3B9DA 3VRJA 1U8QA 5MHSE 2IPKB 2ZJSL 4LEOB 1T6WA 3DMMC 4YXLL 4AIZB 4KRMB 1A6ZB 1KN4L 2FECI 1WBXB 1EJ6A 2DJUA 1S7UB 4X6EB 5F9OL 3D9AL 1TZHA 2F54B 4F7TB 5D72L 5IFJA 3B9VA 1MY7A 4OCLC 3T0EC 3ARDA 1OSZA 1CWVA 4NUGH 3FAXA 4KAQL 5L6YL 3QHFL 2HKHH 1GVIA 1A7QL 2QHRL 3H9SB 3QUZC 3Q6FB 1S9VA 4N9GB 5EZOH 3GIZL 4TOYL 2XN9B 2XZCH 4JRXD 1MJUH 1S5IH 1HOCB 2YZ1A 5ICZA 3FFCD 4UI2A 4HG4K 1F3DH 5D7KE 1UWEH 5J6HA 4KH2A 4QRPE 5DJCA 5EORH 3S96B 4D9QE 2F5AH 1WBYA 2FX9L 3IDNA 4JZOA 4GW1A 1AXTH 1OVZA 3X3FL 2AEIT 5D2LB 4JHWL 1CLYL 4YGVA 2H2PC 4QCIB 5EU3A 5GS1C 5A2LH 1RUKL 4QXTA 5JQ6H 4BELD 4LCWE 4OLEA 3OQ3B 2V2TA 1X5XA 4LOUD 2OP4L 4XHJC 2APVA 3I50H 3ZHLA 4BQCA 3ULVH 3O9WB 4P2QB 2IALB 1I3VA 4NKQB 4EQ2A 4R3SA 5I73B 3WIHA 1OPGL 5L7XL 2L0DA 4M48L 3NA4A 5E1HB 3KXFE 4P49A 2VAAA 2ZUVA 5EN2B 1RJLA 1LDPH 1NUGA 5BQ7B 5IJVA 4OZFH 3GNMH 3CXHJ 4RNRA 4OUOA 5DEZA 3DTXB 2NW3B 5F3HA 4HC1L 3NZ8A 2N7BA 1A9EB 3LS5L 4ZNEE 1ZLWH 2RGSA 3T0XA 1OT2A 1SEQH 2YPKA 5SX4I 4L9DA 4KKLC 4HS6B 4CMMA 2CLVA 3RL2B 4XBPB 1L7IL 3SE4A 1QLRA 4PRIB 1BFVL 5T1LB 1R24B 4RGMC 3MRRB 3RRQA 1MVUA 3VRIB 5DFVD 3G08A 5CBAB 1K6QL 3DROA 1TMCB 4ZUWA 1FV1A 4G42A 1SEBB 2XWJA 4OV5A 5JHDD 3WE6B 1F6AB 1OP3H 3DURB 5ILTL 5CZXD 5H37G 3WJLA 2V7NB 4YR6A 3QHZL 2YSSB 1G6RH 5C0AE 4HWBA 4GW5A 1HHHB 3CMGA 3KPLA 2VDML 4E41A 5BZWA 5F7YC 4NHCL 3TGXA 4ODWA 1I1AA 2GSGA 3DXAA 3VI3E 3S36L 2BSSA 1NJ9A 1YEHL 3PHOB 1AHWA 1FORL 3U36A 1FVEB 3QFDB 2Z8RA 3MRFB 4M02A 5E94A 2WLZA 2ZJSH 3F7VB 4Q0XL 4QRPB 3MROB 2HRLA 2HT2D 2Z8VC 4YXLH 2YD2A 5TF0A 2ZUQC 3VMPA 3KAAA 4JFDE 3LKQA 3BSZL 2C9AA 4WO4B 4CW1B 2GKIA 5F9OH 5DJ6B 3D9AH 2VZVA 4JDTL 1T7YA 1RZ7L 2UUDK 5HI4D 5D72H 3PGFL 3UPAA 3AREB 1GL4B 2Z4QA 1VACB 5DUBB 5HYQB 4C56A 4KI5D 4LCWB 1RJYB 1X4ZA 1VGEL 2H3NB 4X9HA 3H7BA 4KAQH 2GSIB 5DMGD 4Y4KD 3VXME 4DCQA 3QHFH 4WUKL 4MD0B 2Q7NA 1A7QH 2QHRH 2Z31C 4PGDA 3ZKSD 3SHSA 2WBJA 2XA3A 3PUCA 2XKNA 2LU7A 3GIZH 4TOYH 5AG8A 4U1LB 4R7NA 1ZA3A 3LHPL 2AJ3B 1TZIB 2J7LA 2Z93A 3C2SA 5GGRA 1IM3A 4DGVL 3F5WB 5BOZG 4NO2A 3EO9L 2FX9H 3HE6A 3R0NA 3B6SA 1BVLB 2DQIL 4ETQA 4Q7DA 3LKOB 3X3FH 4PY8J 4JHWH 1CLYH 3AS2A 1RUKH 3HKFA 4KZDL 1P7QA 1Y18A 3OXRA 2Q3AA 4AIOA 4I0KA 2OP4H 1FG9C 1U3HD 1KJ2B 1QPPA 1F4HA 4X8JB 1WTLA 3B8SA 1I7TB 4M61A 4EUPG 3HTLX 1J8HD 2QV2A 1UVQA 1QHPA 5FA4A 1UB5B 2CSPA 3LH2L 4NWTL 1O7VA 1OPGH 4UDUB 3SDCC 5L7XH 4M48H 4F58L 2HLFC 1VB9A 3F7YB 1A7NL 1BQHB 4YC2C 1S78C 1RHFA 2OTPA 3AFLA 2VLRA 2AGJH 4NZJA 1QBLL 4HC1H 4GLRH 2AJSL 3LS5H 3H9YA 1URLA 1VFBA 1O5DT 1FCCA 3QUYC 4JFOA 4HIIA 3B8YA 5DVNA 3V4VL 1BF8A 5T3ZD 1NBQA 1L7IH 3G9AB 5CGYD 4ZXBD 1T6VN 4Z76B 5IT2L 4G6JL 2DMBA 3R8QA 2OR9L 1BFVH 3V5KB 4OZIF 1W8OA 5HJ3A 3KLDA 3PGCA 1FL3B 2VZ1A 3TV3L 4B53A 1XIWA 3AVEA 4XP6L 3NMEA 1K6QH 4JFDB 4MSWB 4GS7C 4KVCL 3U4EA 3C2AL 1I1FB 1OWRM 7CGTA 1EO8L 1FN4A 3OKDA 5ILTH 3RNKB 5C0GA 3UTSA 4AMKH 2OMBA 3QFJE 3QHZH 3VXMB 1RUQL 2X4QB 1KIPA 2VDMH 5GGSA 2P4AB 3S36H 4GBXC 2Y4SA 1YEHH 3AAZA 2R1WA 3VD4A 3SE4C 2PNDA 3EKCA 1FORH 4UQ2B 2W0FA 3V6ZA 5D1QD 4HIHA 5DA0B 1K4DB 4Q0XH 43C9A 1KSRA 1J10A 4Z7VF 1QNZL 2F19L 2P5ED 1T22A 4Z7WE 2J8UA 5CEZD 3BSZH 2N4IA 3IKKA 5J1AA 5A3ID 1H3XA 2VISB 4OBRA 2GCYB 2NYYD 5CD3B 4HQQL 4JDTH 1RZ7H 3C09C 4BK5A 1XGTB 4QRRD 1PZ5B 3NCCB 5T3XL 2XY1A 3HZYA 3MREB 1VGEH 2FJHB 3K8LA 5IW3A 2AXGB 4QYOB 3UPRB 3WJLC 4WUKH 1D5XA 3FT2B 1HDMB 4FZ8H 4PJCE 3TNNA 4POZC 2YN5A 4OBSA 4KY1L 5M7QA 3R1GL 1WIUA 3JV6B 5IHZB 5J06A 3LHPH 5MERA 4Y8DC 5DK0A 3DV4B 5E2TL 4DGVH 3VH8G 2IH1A 2CKBB 1HILB 3EO9H 3SGDH 1NCNA 4F8QA 1UH3A 1IL1B 3S36X 2DQIH 1LO2L 3MGOA 3RY6C 2ZUTA 3QB7C 1U8HB 1KIQA 4NNPL 4KZDH 4XZUB 1UH2A 3KHOA 3QP3A 3DO7B 5D2LF 3PQYD 2GFBB 4AZ8A 1DTUA 1AQKL 5EZIL 5CEYA 3UBXI 3OKEB 5MHSD 4MNGE 4AL8L 4LCCC 4Z9KB 5LAXA 1GOGA 3ES6B 3W0WA 4D0BB 1U42A 3LH2H 4NWTH 1IMHC 5ITFB 4F58H 2Y06L 4GO6B 2W1NA 3ARGD 1M1SA 1A7NH 5LBSL 3P4MB 2PXYA 2FYYA 4P23A 3FB5A 4XMPL 1ERNA 1QBLH 3HE6C 3QZWA 2AJSH 3TN0B 4X9FA 5DHXB 4MCYB 3QFJB 3V4VH 4P5MB 1EAJA 5ACZA 2R2HA 3RGVD 4LDOB 4ZQKB 1EEZA 1N0XH 4M6ML 4ZUVA 1U8KA 5IT2H 4G6JH 2Q8AL 4PJEB 4IIQC 2OR9H 1IC5L 5KVGL 1D5ZB 3EDEA 3U0PA 1QR1B 2X1QA 4ODBD 5J12B 2VLJD 3TV3H 4P2RD 3JSSA 5HGGS 4XP6H 4BH7A 1CXKA 2LAAA 2X1OA 4X4MA 5F93C 1AGFB 3BPCB 5EU4B 2BVOB 1MAJA 3HI1A 1IEBA 5L2KB 3U7AA 2IAMC 3IETA 3HUJB 4KVCH 5KVEL 1EO8H 3VFMB 4DVBB 4X6CE 2V2WA 3VG0L 5I1HL 4BA8A 3P73A 1CDYA 4M1CD 4P3WA 3L95A 1RUQH 2CLZA 2CD0A 4ZG1A 1EZVX 4LCYB 4LF3A 3SCMA 2YPLA 1GOHA 4PJCB 1UACL 3GM8A 4KROC 2E9JA 3MJ6A 2CR3A 4XWOC 4KXZI 3KXFD 4NO3B 5FDYA 5TQ2L 1FL5A 4QRUB 5E2JA 5DMYA 4NIKB 4FQCL 1HHGB 5IVXA 1XIWC 4JR9L 1QNZH 2F19H 2IBZX 3N1PC 1P2CB 3BJLA 4M3JA 4WI4A 3D85B 1NGWA 4KJQC 5EBWB 1VDGA 1QBBA 4OF3A 3IFOA 3JBG7 4HQQH 1JF5A 1GGCL 4FRWA 5T3XH 2F53A 4GG8A 2AJXL 4CJ0A 4HWZA 4N0FB 2GJZA 3MV7A 1J18A 1G7HB 4MNGB 4IDJL 5CCKL 4ZYKB 5F70A 1HKFA 4GT7A 4KY1H 3QAZC 2IANA 3R1GH 3H7LA 1RJZB 1JN6A 5E2TH 1A2YA 5DYOB 2OZ4A 2HVKB 2FHBA 3WKNA 1X44A 3SKUD 4ELMA 3WUWA 3IF1A 2JJTA 1LO2H 4WHTB 3IDXL 4IOIA 3L5JA 5EWIL 3OKMB 1J8HA 2CRIA 1QVOB 5DEFA 5I8CA 5B22A 2QSQA 2VDRH 1I8LA 3G5YB 4OLUL 1VESA 4QHNA 3X3GL 2B0SL 1AQKH 5EZIH 4R97C 4JY5L 4AL8H 1QFWL 1FJ1A 4MX7A 5C0BB 4DGYL 4MDIA 1JGEA 5ELIA 5IB3B 3VXOA 3QEUB 3WL9A 3BEWA 1PY4A 2Y06H 2AEPL 5GRVK 3LS4L 5J1TC 3LKSB 5LBSH 2FD6L 3P9MB 3PGDB 4XMPH 1K9TA 4CGTA 1AXIB 4JM2A 3QCUL 3IKCB 1A6UL 1BOGA 4MA8L 5A2KH 1WZKA 2WBKA 2CUIA 4LOUC 4GRWB 4ZUUA 2C4FT 4FHBD 4LNRB 1PG7L 4O9HL 3VXPA 1UJTA 4FXGB 4M6MH 3MLZL 1RAMA 4UB0L 2Q8AH 5CJOL 5DJYB 4G8IB 4Y88A 1IC5H 5C70A 5KVGH 2JIXA 1INEL 5KSVA 3WLBA 3LQMA 4NQDE 1G7PB 1IAIL 5DJ2B 2EDWA 3JTSB 3MXVL 2BVTA 3LB6D 1YECL 2WP3O 3Q5TA 3G5VA 4I5BB 4GAYA 3HR5A 4JREC 4LFHG 4PG9A 3WBDA 2A6IA 4JHBA 1NCAL 3E2HC 3TT1L 15C8L 2YEZA 4WGWB 5KVEH 5T1MB 3LN4A 5D7IE 4P23C 4Q9BA 5I8EB 3GUTB 4HX1A 3VG0H 2ZP0T 5I1HH 2Y7QB 4PRPB 5DK2A 1ZMYA 2EE2A 4KRNA 2XPGA 2VDQL 3KWWB 5ALBL 3KPQA 5D1QA 1CFTB 1S9YB 1UACH 3TBSB 3VA2C 2Z92A 1NUDA 3QXVA 3QXAA 4MMXC 3MLYL 5TQ2H 5D96C 3CFDA 5DFVC 5C9JB 3BRGC 2YKLH 1R5WB 4FQCH 4IBLT 4ACPA 4JR9H 4PJ8D 3QQNA 4JZJA 5AUMB 5IF0A 5EFIB 2WUCL 4LVNC 1T1XA 1A3QA 2R2CA 3QXDB 5E8PA 1RVFL 1AR2A 3PWLB 2HH0L 4JG1L 5CZXC 3QNZA 1DANU 3TBWA 2B5IB 4GRMB 3V7MA 3ZYZA 1GGCH 1ZHKB 3F7PC 4NZUL 5TH2A 1VKXA 4JKPL 3WEXA 2AJXH 1CDIA 3QQ3A 2JK5A 2BNRD 4RA0C 3BPOB 1HI6B 1JF1B 1K4CB 3GMMB 5JW3L 3LPGA 4IDJH 5CCKH 1DL7L 3QIWD 2LE9A 5FEBA 2EYRA 3IT8D 2ENSA 4PBXA 3F65A 1Q0YL 2HT2C 4IJ3B 3FHQA 1B2WL 4OAWB 3QJFB 1KPUA 4PIRF 3MJ8B 1OP5H 3R8BB 1FYTA 4PV9B 1D5MB 5HI4C 3BZFA 4O2FA 4L4TA 5T1KD 5F89B 4KI5C 4M7KL 4R6UA 3IDXH 2OX5A 4P48A 3F12B 5EWIH 2MQCA 1WGOA 3E1F1 4QT5A 2R0LL 4RAUA 1RD6A 3GBNL 3LN5A 4OLUH 4H1LB 2B0SH 3EOBA 5FO9A 4JY5H 1TTGA 1QFWH 4QTHB 5ECJE 4DGYH 4UTAL 4NQDB 4IRSB 2QQNL 3BOVA 5F7DA 1YY9D 3SKMB 3KYOA 4FFWD 4RSVA 2AEPH 1ZT7B 3KPTA 2FD6H 2E7BA 1T5XB 4NJAL 3V6FB 1JPSL 3QUMA 3GMRB 4PJDA 3QCUH 2MTPA 3MLXL 1A6UH 3QO1B 1EHXA 1NC2A 1TLKA 2FEDD 4J2XA 1U3HC 1IEAB 2V9RA 3ARBD 4LL9A 5DD0L 2R9HD 1PG7H 2FLBT 2HG5A 4O9HH 1FZKA 4G6KL 1CU4L 4P2RA 1ZA6B 2DM3A 4YZFE 4UB0H 5B4MC 3WNOA 4ONGL 4BH8A 5CJOH 1YEKL 1S9KC 4NSKA 4GKSB 1I8LC 3C6SA 1INEH 2CIKB 3N06B 4ZFZB 1IAIH 4PJEF 5I0DA 1LK3H 1YECH 4QRQB 2B2XL 1BQHG 1HKLL 1IC4L 1HWGB 1V7MH 3BP6A 4MJ5A 3OJVC 1NCAH 3RP1A 4NRZB 4O02L 2Y9RT 3TT1H 15C8H 1UQSA 4WV1A 4IRJB 1M6OA 3HUJF 1VPOH 5J89A 4MB4A 5CS7A 3P77B 5CGYC 4JM2C 4ZXBC 1XF2B 1MQ8A 5IB5B 3EZJB 1C5CL 2VDQH 2J8OA 5ALBH 4PP2B 5C08D 3PHQA 1JWSB 1AIFB 5D6CB 1EEYB 1V5JA 1G0XA 3O6LL 5D2NC 1J11A 3MLYH 4R96A 4PJCF 5HPMB 5AYUL 4PTTA 4CADB 4RQQA 4L8CA 4RGNE 5EZJA 3QXWA 1SYVA 4PJ7A 3HRZA 2WUCH 5F7UA 1OAZL 4Y2OA 4TNWF 1RVFH 1PKQE 2HH0H 4JG1H 4TPRL 2FO1A 1LO5B 4FQHA 1KIRA 3I6GA 4XRCA 3TCLA 4MJIE 2P8MB 4XPAL 2I5YL 4HZLA 2CRMA 4JKPH 1A4JA 5EPMB 3HLAA 5IFHL 3E3QE 2OL3L 4MCZA 3T1FA 3UTPE 4P2OB 5KVFL 3EUUA 5FB8B 1VFAB 2Z8SA 5JW3H 1DL7H 5CGMA 2YA0A 5F7FA 5D1QC 1BEYL 5GSRB 3BKML 5BCAA 4NNYA 3P2TA 2R23B 3P0VL 1IGML 1GZQA 5HHOA 3VMOA 1Q0YH 1AXSA 4WHYH 4ISVB 3GJFB 4PJXB 4U3CA 3MOQA 4AT6B 5E2UL 3D1MC 3EYUL 1LO3L 2NX5E 2NYYC 2AAVA 4P99A 3RA7L 5EB9A 4JZJC 4G8FA 2AV7A 1ZGLM 3BIKB 5DJXA 4M7KH 3DGGB 3T1WA 1IQWL 2DKMA 2EIZA 2R0LH 1CE6A 3GBNH 4CRPA 1LD9B 2NW2A 2X4UA 1OF2A 4MGXA 5EUOB 2C7UA 3TYGL 3BZDA 3QDJE 4UTAH 1LILA 2OQJA 4DUXA 1RY7B 2QQNH 1CICA 4U1KB 5J13B 3MRNA 4FQQA 1KEML 1P69B 2XA8L 1N59A 3QNYB 1DBJL 5FGBA 4HUUB 4NJAH 5DO2D 2N1KA 1JPSH 3MNWA 1I8MB 1IGIH 4PD4K 3MLXH 2ITDA 4OF8A 3QDME 1HEZA 3T3PE 1G0YR 5F1SA 5JNYA 3P40A 4XH2A 5DD0H 4Z5RA 1NGYA 2BK8A 4G6KH 5ISZB 1WTGT 1CU4H 3ULUE 3NIGE 4O58L 4I9WE 3MV9A 4GRWF 3FQRA 2WK2A 4ONGH 1INDL 5SWQB 2KH2B 1K2DB 3OJMB 4J4PA 3SO3C 3U9PL 1K85A 3HRPA 5D1XB 3ARGC 2VJXA 1JTOA 1UKTA 4U49A 2HYMA 3MLPA 2B2XH 3FONA 1HKLH 1IC4H 4WFGE 1X5HA 2Z35B 3AMLA 4O02H 4NKDA 5FXCH 1IM9A 4RBPK 3O3BB 3L7FB 2NCMA 3O4OB 3QEGL 4MJIB 4O51A 2FNBA 3GKWL 2YK1L 2NR6C 4KTEL 5EUKB 3K8MA 4X99B 3NPSB 2QSVA 4QKXB 5FO7A 2DMCA 5T3ZL 4Y19A 3PL6D 3C5ZB 5ESVA 2Y72A 5EOTB 4AEIL 1RZKC 3IDMB 4Z78B 4R4BA 5I1JL 1JUFA 1CT8A 4G6FB 4PJGA 3H3BC 3O6LH 1OT1A 4BQ6A 3EYVA 3IXTB 1V3LA 3PDOB 3OXSB 4GRLA 5AYUH 1BD2D 3STLB 4ODXA 5KZCB 4HG4J 1U41A 2W60B 3CK0L 1WF5A 2NX5B 5IB4B 4JGUA 1OAZH 4BM7A 1R3KB 2HJLB 3DUSA 5JIIA 2R8SL 1A0QL 2QJDA 3ZKND 4TPRH 1LEKB 5CP7A 4M1CC 3HPJB 4YK4B 4CNIB 4XPAH 3ZHDA 2I5YH 4WV1C 3KPSE 4F7CB 4HIJA 5IFHH 5GS3A 4BUGA 1VFMA 2OL3H 1WQVT 4LQ1A 4G80A 1WWCA 5KVFH 4RFEB 3GSOB 5E99L 5JW4N 3SE3C 1BEYH 3QDJB 3BKMH 4U1JA 5FKAA 3P0VH 1IGMH 1AP2A 2NY0B 4BKLB 3JWOC 5CD5C 4WW1B 3OHXA 3G6JE 1D5BB 4JQIL 5DVMA 5E2UH 3K2MC 3EYUH 5HI3D 1LO3H 5CEZL 1IJ9A 3RA7H 4E42B 3BP7A 3RU8L 4M62L 1MWAB 2ZPKL 1G7MB 1EZVY 1IQWH 4BSWA 4MD4A 4JY6A 4K9EH 5BMFL 1EFQA 4WNQA 3C5SB 2WBWB 3K80A 3O4LA 5CKGA 1DBML 4QOKA 3OGCA 3I9GL 4Y1AB 3TYGH 5J6GB 4XGZA 2WWKO 3J8F7 1CFVL 3B2UD 4OT1L 1NC4D 1J1PL 4PB0L 4OGAD 1IAOA 4G8GE 2H9GA 1KEMH 2D0GA 2XA8H 3GDBA 1SBBA 1YPZB 1DBJH 3NFSL 2CIIB 3ARBA 3EGSB 5F21B 2DQEL 2HFEB 2Q7YA 3TVMA 3U48A 2YWYA 5GJSL 2E6QA 3IXAB 4FG6D 3TBYB 2P5WD 2R2EA 4ONHA 2G9HB 5GGUA 2BNQA 2GYSA 1J88A 4O58H 3C8DA 3SPVB 1KACB 1INDH 1V3JA 5GISL 3EDJA 3U9PH 3U7WL 5SWSE 5F44A 1MLCA 2JELL 2YS4A 4JFFD 3FOMB 4WDIB 4NN5C 4PJHA 4AEEA 4MWFA 3IU3A 2CLRB 2FBJL 3FTGB 5EBGA 2VDNL 5FGRA 4M03A 2IQAA 2WLYA 1YDPA 1KEGL 1FFQA 2DYPA 2AXFA 4PY8I 3QEGH 5C08A 4LCIL 4ZD3L 5I30L 3GKWH 2YK1H 4KTEH 3V5HB 3HAEB 3RZWA 2NY2D 3KPSB 5HDQH 1MRFL 3UJIL 4AIXA 5T3ZH 4KKBD 2PYED 3V4UL 3B9AA 1I7RA 4AEIH 4LU5L 4YDLC 2HJFB 2FX7H 5I1JH 5DRWB 1DQQB 2C4XA 1UJ3C 1E6OL 1RZKL 1VGKB 3FO1B 3P4NA 4S0TD 3CAFA 3ZKQD 1QQDA 1MRCL 3I02A 3HE7A 3L5XL 5BZDB 1GGUA 5F1NA 2R2BB 3CK0H 2QADB 3GI9L 4Y4FA 2W07A 2OMNA 5B38B 2R8SH 1A0QH 4UUJB 4TUJA 1CDGA 4B7IA 3SKJH 4KHTL 1MJ8H 2AJZA 2EH8L 3ZZ1A 3JUZA 3B4NA 1RI8A 4PJ9D 4JFYB 4L8DB 1MI5D 3IFLL 4PGEB 3R4DA 4XPFL 3VGHA 2RQ8A 4QWWD 1BMGA 2P7TA 3P9WB 4NGHL 4XTRD 5E99H 3ZYJA 4YHPB 3GSUB 1Q38A 4XNQA 5JORB 3TP4A 4PJ8C 3B9KD 3OR7B 4UU9B 3JWOL 4MAYA 3KYMB 1KGCE 4JQIH 4I0CC 4U7SA 4NN6C 1T7ZA 3EW3B 3O6FB 4PY7A 5CEZH 3RU8H 4QXGL 4PJXF 3SDAB 2ICCA 5HTSA 4DQOL 3GMPA 4LPVA 2ZPKH 1BVKA 3VFWB 4Y89A 3LRSB 3ET9F 1AI1L 1KCVL 1EEQA 3SKNA 1FZJB 1XF5B 5KSAB 5BMFH 2GAZA 3QIWC 1J7VR 1DBMH 3RZCB 5E2VH 3I9GH 4RGND 4JCMA 5SWSB 4ZOBA 1U8OA 1WIOA 2ZWLT 1KLGA 3D39E 3C60D 4F2MB 4Y8AA 2X4PB 3LVEA 5DVLA 5C92A 4OT1H 1J1PH 1LO4L 5EUOF 3EZ8A 3BYYA 3MUY1 4PB0H 1P4LB 4A6YB 3NFSH 1TVBA 4P5TD 1CLCA 3QUKA 3ARFA 2DQEH 3MMEB 3AU1A 3QDGA 4P3CL 5GJSH 5MI0C 1LEIA 4I18C 5CIPB 1U2HA 3EFFB 2PF6A 5FUZL 2RIKA 3UBXA 2R4SL 4H1LG 4Z7QE 3RPIB 5GISH 2AP2A 1YY9C 4CN6A 3U7WH 3GSNA 5HGBB 5TDOA 3NCMA 5FF6B 2W65A 1A1NB 4LSSL 1BZ7B 4HZAA 5E6ID 4Y5XC 1XGRB 2FBJH 5DRXA 2VDNH 4ZODA 1QFPA 1KEGH 4APQD 4NKOB 4S2SA 2FEDC 3KPRE 4LCIH 4ONOA 4ZD3H 1CG9A 3ARBC 5I30H 2IPUG 2R9HC 1OGTB 3IDJA 2BSED 2X70B 3TVMC 5C7XH 1MRFH 5EU6E 3UJIH 1OSPL 3MV8B 4F7PB 3V4UH 1XCQA 1D9KD 1FLRL 3LIZL 4LU5H 1S7VB 1U91B 5I1EL 4PRBB 3FB7B 2Q6WB 4OD3L 5JA8B 1E6OH 3P4OB 2ZG2A 4DN4L 43CAB 1B0GA 4NC1E 1ZT4B 4LHUA 1MRCH 2B1HH 3QIUA 4JFHE 5C0DB 5E9DE 2PUQT 1HXMB 4X4YB 4NYLA 4H25A 3GI9H 3OB0K 4PRHE 2VN4A 3QDMD 4MJ6B 4Y2DB 1AJ7L 1AO7E 3I6KA 5DJ8B 3HZVA 5F7WC 4KHTH 4UOJA 2DWDA 3MRMB 2EH8H 3V5DA 5E1AB 3IFLH 4Y16D 2EH7L 5JOFB 5FYKE 4AQ1B 4JM4L 1S7XB 3CSBA 5DRNA 3ELAT 4NGHH 2LFGA 5DSCA 3FCTB 1S5HB 2F58H 2A38A 3D39B 4XBGB 3F6LA 4J7RA 3RWFA 3JWOH 4UV4L 3BKCL 1KTRL 3HE7C 1HQRA 4HGWA 3VJ6B 5ESAA 4PJBE 3C6LD 2CUMA 3UTOA 1UXWB 2QEJA 1I9IL 4P46B 2DAVA 4DQOH 3WMSA 3FJTA 2FEEI 4MHHI 4YPJA 1BBDL 2J5LB 4RIRB 1AI1H 3MRLA 1NAMH 1PFCA 1C08B 4WCYL 2W9DL 3MYJB 5IVOA 2PCPA 1DLHB 1QFWM 3WIFA 1F5WA 5ADOL 1N4XL 4M43H 3ULUF 3CVHL 4JJ5A 3GSQB 3CSYB 1CDUA 5CJ8A 3QI9B 3VXRB 4UOW0 5E8NB 1LO4H 4MNQA 4Z0BL 5C0CE 3P30L 2HWZL 2VLLB 4W4NA 4I3RH 2HFTA 2P5WA 4MAYC 4U2YA 1OP5K 4YO0B 3CDGB 1RZIA 2GK0A 3VCLB 5ICYA 3FO9B 5D9SB 1YPZF 3VFSA 5IJKC 4OGYL 4P3CH 4TYUA 3VFOA 4JANA 2C3VB 3BX7C 3A6CL 2XTJE 4TVPE 4EI6A 4R8WH 3ROOA 1U8LB 4M9PA 4G6ML 5FUZH 1H0DA 3B5TA 1SHMA 2R4SH 3VFUB 3TESA 4WI3A 3G5XB 1ZVHA 4ZO6A 4HV8A 2XN9D 5CBEA 1IAIM 1KF9B 1BGXL 1X5ZA 1MCWM 3GGWB 3UJTL 4CU6A 2ZCKL 3HPLA 3BKYL 4QEGA 2ZOLB 4LSSH 5DO2C 3CUPB 3RNQB 4PRHB 2VDOL 4WUUA 4N0YL 4JAMA 4C83B 3PWUB 4X4ZA 3QHTC 1AO7B 3UTZA 3DIFB 4L9LC 1J05B 2YD3A 5JW5B 4XBEL 1OP9A 3FO2A 2GHWB 1ZK9A 1N5AB 2FL5B 4GQPH 2G60L 1OSPH 1CF8L 1CFSB 5IIEB 5IVNA 1NANI 1FLRH 5B8CC 5I1EH 4OD3H 4F37F 3T09A 5DD6A 1KG0B 2NTFB 2CO7B 5IK3A 1SBSL 2EO1A 5DJZB 1FFNB 2VKWA 5DEGA 1U8NB 1FZOB 4MDJB 1DZBA 3QWQB 2ZOKB 4KDWA 2HA1A 4PJBB 1BBJA 5TF1L 2BVUA 1DEEB 3K8KA 4LFHD 3V79C 1MREL 3CSPA 1AJ7H 3L3HA 4X6FA 4ZPTB 2A74B 5TE6L 1VEOA 2AEQL 3SJVB 2P45B 3PL6C 3K4ZA 1XGPA 2EH7H 2J4WL 2NZIA 5L2JA 1KXVC 2R15A 3L3OA 4UBDD 1DQJB 5DVKA 2B4CL 1T1ZB 1ES0A 1HSAA 3LDBC 4EKXA 2RFXB 3BQUB 2PETA 1OARL 1MJ7L 5C0CB 4PYHA 4KJPD 2V9TA 3CSGA 1X5IA 3HC0B 3S4SB 4KGJA 4ERSL 1SY6A 4UV4H 3BKCH 4I2XA 2P42B 1MFBL 3WFHA 1OQOA 2O61B 3BD3A 3QIUC 3ZKNC 4QHMB 4RMQA 1ETZB 3PABB 2UY6A 4FZEL 4OCRL 4JFEE 1KLUA 2QSCL 5KAQF 1KXTB 5AD0B 4LLVB 1BBDH 5F9WC 2VQ1B 3VXSB 4K94C 4JQXA 3T8XA 3GJEA 5JDSB 3SDYL 4WCYH 2W9DH 4KK8D 3WN5A 5MENE 4FTVD 1R6VA 2BHUA 4N0UA 1IQDB 3IDYC 3W5NA 5ADOH 1N4XH 4LKXA 3CVHH 3VH8A 5DXWA 5DJ0A 2BSTA 2WAHA 1N26A 4F57L 1IAKB 1MH5B 2J6EH 5HI3C 1NBYB 4Z0BH 4X6DE 5TDNB 4Z18A 3VWJA 2HWZH 4FOMA 2DLEA 5EO0A 1HH9A 4JZNB 3IAPA 4C4KO 4XX1E 3CH1A 4EI5B 3W2DL 4X5XB 1GGTA 4OGYH 1XEDA 3A6CH 4I0PD 3ZE1E 4FXKB 2YUVA 2E27L 3JV4B 1G7LB 5EZLA 4X6BA 2XTLA 4G6MH 5FO8A 4XPHL 3EAKA 2OTWB 3IJHA 4M6OL 1U95B 4AEHL 3T3MF 1H8SA 4H26A 1NFDB 5E6IA 1BGXH 3FQTA 4OGAC 1IGFL 3UJTH 2F5BL 3DETD 2ZCKH 3O41A 3KDMA 3BKYH 3HG1A 1BFOA 4HMEA 5FCUL 2VDOH 4P2YA 4FQXD 4N0YH 1NUFA 3D25B 1QRNA 2ADFL 3EO0B 2ZUSA 4OIIL 4IM8A 3GSXA 1D9KA 4XBEH 1KJMB 4GUPB 4PRDA 5HDLA 1TXKA 3BPNC 2HVJB 2G60H 5DMIH 5IOPA 1CF8H 1KTLA 3O3EA 4G9DB 1AY1L 1HH6B 2VLKB 3T4YB 3LKPA 3PJSA 1NGXA 2A1WL 2P8LB 5E8EA 1LHZA 3HS0B 4KRPD 4NQCE 4PJAE 2ERJB 1SBSH 3RUGA 4YWGL 1MCSA 3G6AA 3GMQA 3TA3B 3LEVL 3PIQA 1LNUB 2AS5M 3M1BA 2NXYD 5TF1H 4LMQE 3WFZA 4MD5A 1LVEA 2FR4A 1MREH 4L3EE 2BSRA 2DL9A 2DDQL 1EBPA 2HFFA 4LVHC 2NY2C 1Z3GL 5B21A 4CN4A 1F90L 2GJJA 4OZIA 4LLWB 4HXBL 4KJWC 5TE6H 1RZ8A 2AEQH 4KKBC 1S9WB 1I1YA 4PBWD 5FECA 1Q9LB 3IVKB 1AKJD 1TTFA 2J4WH 5MENB 3UYPA 1PSKL 5CILL 1T2XA 3QUXB 4ENED 5HYJE 4PJFB 4K71C 5DURD 1KLFA 1XMWA 2B4CH 2MOVA 1FFOB 4IEFB 4LPYA 1OARH 1MJ7H 3MJGX 1T4KB 1FYHB 5IWLC 4D9RD 4P9HC 3X14B 1HSBA 1E4KA 1MFBH 1F3DJ 4U3HA 1YQVL 3U6RA 3S9DB 1HHKB 3T0VA 5B38G 3MLRL 1MHCB 5EU6D 5I66A 4FZEH 1TFHA 4PJ9C 1OAXL 1KCUL 3RIAK 3LKNA 4QLRA 2QSCH 1Z5LA 3OB8A 1CS6A 5AEAA 1G7JA 4QWWC 5SWZD 1KOAA 4F9PC 1TQBB 5C07B 3CGTA 3CCHB 4Z7VA 3SDYH 2EE3A 2AK4E 2YD6A 2L4OA 4K94L 4JFHD 2IPKA 4LEOA 5E9DD 4YX2L 3U0TB 1QEWB 2LTQB 4MS8D 5GRXG 1DLFL 2D3VA 3B9KC 4AIZA 1A6ZA 1A1OB 5BO1L 1WBXA 4F57H 1S7UA 4X6EA 3OF6A 5LQBL 2I27N 2F54A 4F7TA 3SE8H 3G5ZB 5H8DA 5KAQG 3WO3B 1OTSD 1IC7L 4YNYB 5FYKD 1MFAL 1D7FA 3UXFA 3H9SA 3RPKA 4LBEB 3Q6FA 4N9GA 4UILL 2E27H 4YIQB 3VXUB 3D0VB 2XN9A 1FLTX 3WNMA 3QQ4B 1NBVL 1HOCA 1O0VA 1WWBX 4XPHH 3RTQD 4M6OH 1DN2A 4AEHH 3C60C 2BHYA 2VL5B 2V5RA 5E00B 3S96A 5JW4R 4LLQB 3S3SA 3MRKB 4KUZL 1IGFH 1H3PL 2F5BH 2IC2A 4L4VE 4ZO8A 1B88A 3PWNB 4YLQT 4ZFOL 5FCUH 5D2LA 4QCIA 4KDTC 3PWPE 4L3EB 1K8DB 4WI9A 1QBML 3VWJC 4Q97A 2BC4B 4Y5VB 4JN2B 2ADFH 2CJUL 3CFKB 4OIIH 4PUBL 3GHEL 2FJGB 2DJ4A 3O9WA 4P2QA 1FNEB 2IALA 4JPIB 4Q2ZB 2XQBH 1AY1H 2UWEE 1L9MA 5BRZB 3MPCA 1XH3B 5FV2A 2A1WH 3LD8C 1I3GL 5K93A 4LHQB 5EN2A 5H94B 4JJHA 5BQ7A 4NKIL 3N0PB 5E6IC 2VDLL 4YWGH 3V7AG 3ZYOA 5JW4M 4N5UA 3DTXA 3LEVH 2NW3A 3TH4T 1A9EA 2I07B 1CR9H 4APQC 5IHUL 4EN3D 4HJJL 4HS6A 4QY8B 2DDQH 3RL2A 4GG6E 4XBPA 1F90H 2XZQH 1KB9K 4HXBH 2IF7A 2VWEE 4PRIA 2XG4A 5E6YA 1NKOA 1QSFE 1D9KC 5IMKB 3OKNB 5T1LA 1R24A 3MRRA 4AM0B 5CILH 3VWKB 4PGJA 5IEKB 5DWUL 3VRIA 3LPWA 2DQFB 3JVGA 3V0AC 5CBAA 1G6RB 3UTTD 2QL1A 3AUVA 4HK0B 1SEBA 5D7JB 1ZTXL 4I13B 4RMUA 1EFXD 2UZXB 5C09E 3WE6A 5JLZB 3D48R 4WIQA 1F6AA 1YQVH 3DURA 3O45B 3AXLB 4MB5A 4P9HL 5L2KD 2RBLA 1BAFL 1CD1B 1GC1C 2V7NA 3MLRH 2GJ6E 4OCYL 2YSSA 5C0EB 5GRZA 5DK3A 2HMID 1HHHA 1L9NA 1KCUH 1OAXH 4C4KT 3VI4E 4Y16C 5EO1B 5JOPE 5BW7A 5IM7B 2VUOA 1RIUL 5H37H 3PHOA 4G9FE 2BNUB 5HGAB 1FVEA 4J1UB 4UDTB 3QFDA 4NQXB 2EYSB 3MRFA 5I16B 4QRPA 3F7VA 4YX2H 3MROA 2YC1B 1DLFH 4U1MB 1P5VA 2QQKL 4L8SC 4WI7A 4TULL 2UZYB 1DUZB 4WO4A 4CW1A 3QYCA 4UT9L 3C6LC 5DJ6A 1NLDL 3PWPB 1C5DB 4JPKL 3QNXB 3AREA 2J8HA 5HYQA 1VACA 4GXVL 5DUBA 4DZ8B 4LCWA 1RJYA 1IC7H 4HGKC 5F8RC 1Y0LB 1WZLA 3BN9D 2H3NA 2A0LD 5E6ZA 2GSIA 5I1LB 4QNPF 4FFYL 4R2GB 4J8RB 1MFAH 4MD0A 1IGCL 2D0HA 2BJML 1R3HB 1YNKL 2R29L 3TC9A 4UILH 4JFZH 1NBVH 3IB4A 4R26L 4G8EB 1NL0L 2W9EH 4U1LA 1ZGLB 3Q5OA 2AJ3A 2JTDA 5BJTB 1TZIA 1DVFD 2GIYA 3F5WA 3V6OA 2GTWB 5DHVH 3T0EE 4KUZH 4KVNL 1H3PH 4K2UL 5DZLA 4Y7MA 1BVLA 1NFDF 3LKOA 2AABL 4ZNEA 4JFED 4ZMAT 2XIDA 1JFQH 3BP4B 5J11B 5HD8D 1QBMH 2CGRL 3BHBB 1A6WL 2BY0A 2CJUH 4PUBH 3GHEH 1KJ2A 4QF1B 4X8JA 4YPGB 3SDDD 3SGJA 1I7TA 1RZGB 1BZQK 3MBED 2APTA 2I25N 4DZBB 1UB5A 4FQIL 4UDUA 4PYGA 5TE7L 4EUPH 1PKOA 2FB4L 3F7YA 5E70A 1QP1A 1I3GH 1BQHA 4NKIH 2VDLH 5C09B 3D0LB 5MP6L 4PJ5E 5IHUH 1U58B 4HJJH 5ADPL 3L3DB 1G6VK 5DR5L 2E7LA 3HMXL 4YFDB 4LSRL 4Z76A 2JE8A 4P57B 5IB2B 5CZKA 3V5KA 2D4FA 1KTDB 1FL3A 2IMMA 4B50A 4N0RA 4KUCF 5DWUH 3NIFF 1TPXC 5IR1B 1N5YL 5F71A 4JFDA 5BS0E 4KV5F 1T5WB 4MSWA 1RK1B 4PJFF 1ZTXH 1MCHA 4J3VA 4ODSL 3QEQE 2VXVL 3MRIB 1I1FA 3QISA 4JRYB 5F6HJ 4P9HH 3RNKA 3TO4B 3QCTL 1BAFH 3K1KC 2LAGB 3NIDE 4WEBL 3VXMA 3U0WL 2X4QA 1DANT 1GC1L 3RVXD 1EHLL 1AE6L 2PO6B 1UFUA 5C6TL 4HHAB 1RIUH 2DIAA 4UBDC 4W6YB 3DMMB 4D0DB 2OI9B 2A73B 4YH6A 5EOCL 4UQ2A 5I0ZA 5FAAA 4NQCD 2JKXA 4JFQB 4NO0D 1K4DA 2G5RA 2JLLA 4OI7A 2OSLB 1X4XA 4KJPC 4TULH 3JVGC 1YN7B 1MJJB 4NQSB 3S4SG 2VISA 3S5LB 2ESVB 2GCYA 4UT9H 5CD3A 1NLDH 4JPKH 1YNTB 2VLME 3MA9L