2BOCB

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocB01
2NYYD 3GRWA 1H0DA 2MNUA 4WWKA 4U0RB 1UG9A 2APXA 1DQLL 1T7XA 4J1UB 1IZKA 4L29A 1ZLUK 1HXMA 1JZ6A 1A7QL 4JFEE 2ORBL 4TUJA 2CRYA 2J5LB 3SE9H 3ZKND 4JVWA 2I07A 1FFOB 5CLTA 1JI1A 3RWGB 5D4QA 5DYOB 5DQDH 2NNAB 5GS3A 3WN5B 4L8BB 1S7RA 1NDMA 3NN8A 3C08H 3MRJA 4R7DA 1KIUA 3RX7A 2Y7QB 3BKCH 4GKZB 1MJ7H 3PWUA 4XMLL 4G43B 1TVHA 4CVUA 5KBNC 5CJBA 5IW3A 1K3ZA 4ODBD 4JAMA 5ELIA 4PTUA 4R90H 4ZAKA 4Q9QL 1L7TL 4BH8A 2XQBL 4E5XB 2CGRL 5FKPB 4NPYB 2GFBA 2ILLA 4NCC1 4URTB 1NBVH 4LCCB 5BXFA 2FLRT 4Y5VB 5DS8A 3SCMB 4YHML 1AR1C 1UKTA 3WS3A 1MF2H 1BBDH 1JWMB 2D0FA 3RJDA 1RZ8B 4X8XA 5D7JD 3KVQA 1D5MB 3MRBA 4U1SB 4PP2A 3IU4L 3HI6H 5I1HL 2EDQA 4TSAH 3DROA 5F9JA 1SEBA 1RUML 4EI6B 1EMTL 2DB8A 5I8KL 5K9KB 4X6DE 1MIMH 2Z31A 5EIVA 5AUMB 4KI1A 3QUKA 1MHPL 2A9NL 3QHFH 4O51A 3I2CL 3IJSA 4GMSL 2YPKB 3HNVH 3RDTC 1JUFB 4OGAD 1YEGL 3NIGE 5ADPL 4TNWK 2DQIL 3HNTL 4LRNL 1PAMA 4X6CA 3O6FA 3RAJL 5FA4B 4OFVA 5IBUG 3DYMA 4RGOL 5HPOA 5BV7H 3QQ4B 1E4XH 3VGAC 1R3LA 4WWID 2J8UB 4G8IB 3FRUB 2YZ1A 2AEQL 4UAOB 4QHNA 2CK2A 2ZUXA 5JPMB 2EXYD 2V17L 1F4HA 3FO0H 5AD0A 3GK8H 3ARWA 3HUJA 3BPNB 1CXIA 5FA3A 1MHHA 1PLGH 4JN1L 1H3GA 1EV2E 2H8PA 4UUJA 3S8WA 1MAML 4GW5B 5C0GB 1KXQE 3BFOA 3U7AA 1WBXA 2YUZA 3NPSB 2BY2A 3BXNA 2KH2B 2C3XA 3SGKA 4Y2DB 2VIRA 3LD8C 2IAMD 3TVMC 3CX5K 4U3CA 2Q7YA 5F7FA 1SBSL 3NFNB 5DD1H 1MFBL 5JQ6H 2B1AH 5HHQB 3V4UH 4KHTH 4MZ3A 3QPXH 4FQ2H 3BHBB 3ES6B 2CK0L 3QUMA 3F58H 1S7SB 1RIVL 4HKZA 4W4OA 5I19H 3W9DA 2VAJA 2VL5A 4HG4K 2W9EL 3VGGA 3CFIC 4D3CH 3U4EA 1D5ZA 4GW4B 1MFNA 1P7QA 1QNZL 4F58H 3NGBB 4ZFOL 2QKIA 3B2VH 2HLAA 5BS0A 2YPVH 4NYLA 4XCYA 4G3YL 4XMPH 1I75A 2VDPL 2CDGB 2ADFL 2XTJD 4I18C 1A02N 3QDME 1RQ5A 3TNMA 1T66D 3WXWH 3PV7A 5C2BH 4ZPTB 4UMGA 4XNZC 1X5KA 5C0RH 1A7BA 4QRUA 1NL0L 1T89C 5JO5B 2NXYD 3FB8A 5IMKA 3BN3B 2NY3C 1OL0A 1T6WA 2AKRB 4LARL 5HGGS 3MLXL 4U1GB 4UINH 4PY8I 4R4BB 3H42H 5JZ7D 2E8YA 1FL5B 2N56A 2M8XA 2NW3B 4OM1H 1FZJA 2BNQA 3BW9A 4X5XB 2FEDC 1WK0A 2BDNL 4ZS7H 4JQVC 1SY6L 3KJ4C 1PY9A 2DM4A 2F54D 7CGTA 4PJGA 1BWWA 2BCKB 2DDQH 1WFOA 5JR1L 3IDGA 3OKOB 2QTEA 3WHE1 3QIUD 5D7SH 1NGXB 4JKLA 5L6YL 2XPGA 2FO1A 1IQDB 4LDLB 3VD3A 1YEDB 2OR9L 4X80H 4HIJB 1G9MC 1DQLH 4N0RA 1AP2B 1Q9LA 5J1TC 3FRPA 4UQ2B 3VJ6A 5GPRA 3CJJA 3LRSA 5DRNB 1Y0LB 2JCCE 5HHOA 5M95B 3MFFA 3RI5K 4P9HC 1NLBL 1MY5A 5DJ2A 4Y4KA 2IADB 1CGSL 3ZKMC 2DD8L 4K3EL 4WUUD 5KJRH 2C1OA 3KPSE 5DK0A 1F3RB 4JDTH 4KHXH 1OAYL 5JMOC 2RB8A 3RVXD 3RBGA 1QBML 4L4TA 1NDGA 4X6CF 2FX7L 5D1XA 4D0DB 3MV8E 4N8CL 4JEGB 2AGJL 1U8QA 3OBAA 4IHOA 2P24B 1IM3A 4N0YH 2FBJL 5GJSL 3HUJF 1EPFA 5E8EA 2W65B 1LO3L 3EJZC 1LEIB 5DJXB 2DMBA 2IBBA 2WWKO 4QRTA 4DJMA 4OD3H 4KUZL 4GRMB 4M8VA 5LCVL 3V7MA 1LP9A 1OCWL 3IDYB 1CFBA 4C83A 2X4TB 3D9AH 3QUXC 4N1HB 3O11A 5I1HH 3V6ZB 1BFOB 4BFBD 2HLFC 1NUFA 1RUMH 1BZ9A 2IG2L 5I1AA 2DJ4A 4UU9A 2QSCL 3ARGC 4OLXL 5ESAA 2HRLA 4WTXA 1CL7L 5J3HC 1CBVH 2A9NH 4P3DB 4LSQH 5L2JB 3I2CH 1I7RA 1T04B 2VQUA 4WHTA 1NUNB 5L8LB 2O5ZL 3QRGL 5GIRB 4PJDB 4WIQA 3HNTH 3STZA 3HC3H 3E1F1 3MRGB 3DSFL 5EPMB 1XR9A 5E08H 2ID5A 5KSBE 1JFQH 1S7VB 1XGPA 4AQOA 5IHZB 1FVEB 2X70A 2IANA 3PQYD 3T4YA 4PJEB 3TFKC 3ZE1E 4UDUA 3QDAA 4PJ5B 4ERSL 5EU6D 4MA7H 3KHOA 4LVNC 4V1DD 5K9QG 1NGPH 2VLLA 2A9ML 1U91A 2WP3T 1GOFA 5F6HJ 3HMXL 1D6EA 5LGHH 5TJWK 3IAQA 3FT3B 1EO8L 5SWZA 4YHLL 3CFJB 1Z9LA 3WV0A 4PRNB 4JM2B 2NR6D 1FZMA 4YDVB 4R7NB 5I8OH 4DUVA 3DUHA 4JO4L 4ZUSB 4WHCA 5IESL 4CW1A 4Q7DA 5JIIA 2O93L 4RWYH 4WVRA 3MGTB 4YDJA 5JXAL 3PHOB 4PJGF 4XBEH 4ETQB 1EGJL 3OGCB 3EDFA 1NC2D 1RIVH 4J8RB 2CKNA 1S5IL 1NBZB 5A40E 5HD8D 5T1KD 3W5NA 3C6LA 2GI7A 5T5NG 1RZFH 4QT5A 1LD9B 5KSAD 3G04B 3VXUE 1KN4H 1ZHKB 1ORQA 4RAUB 2DJUA 2ADFH 2BNRD 3HMWH 3FMGL 1RHHA 3CDYA 5I1GL 3QDGE 5IVXB 3VXQA 5GSRA 4JVUA 1QVOB 2Q8BL 2DQFB 2ATKB 4F9LC 2NY6B 5CS7A 4BKLB 5CMAA 4QRRD 1XIWB 3V5KB 1MCIA 4M8QB 4GMTH 3MOAL 4Z8FL 3NCBB 3TO4C 1Y18B 2P44B 5E6IB 5CIPA 3MRHA 3O2WH 4ONGL 1FFPB 1GYAA 4ZODA 1BM3H 2ZCKH 1PD6A 2PO6A 4JFDE 2FB4L 3UAJC 4PJ5D 3M07A 5B8CA 2DLFL 2X1WL 1UC6A 3MRQB 1SY6H 2R15A 2H6PB 1KGCD 1NCDL 3TA3A 3IXTA 1Q72H 5JR1H 2IQ9L 5IFJA 1LP9F 4KK6D 2VITB 4WW2B 4F9PC 2OR9H 2A73A 4I4WB 1G0XA 1RIHL 1WVZA 2DQHH 1ZMYA 5KSUB 5DR5L 1BVLB 1BWMA 3EOTL 1D9KB 3E6HA 4IRSB 1E27A 3ULVL 3BEVB 4WTZG 2BHUA 2QEJA 1CLCA 1ZS8A 2VLJA 1XGQB 4XP6L 1JNHB 1L6XA 2A6DA 3T04D 2VE6A 1SHMA 4ELMB 4U4BA 2FHFA 4FNLL 3L3GA 2YZ8A 1I8LC 3V6OA 1CGSH 4UIMA 1SJVA 4K23L 2RQ8A 1W72L 3W11D 5ACZA 3KS0H 1F00I 3F12B 3TWCL 3TBTB 2GTZB 4M5YL 4KPHH 2HFGL 1RV6X 1DUYA 3UBXA 1CD8A 4XB8A 3JUZA 4LSVH 3D6GA 5FM8A 3DLQR 4KKLC 3T65A 4PYHA 5DD5L 2EYRB 4NKOB 3BWAB 4Y89A 4D0BA 3VXSB 3P30L 3PG2A 1OF2A 5E5MA 5IK3B 2NY6D 3MREA 2F8XC 3CLEL 4GXUN 4F15B 2AJVL 2UV3A 4YFDB 4E41B 2Y36H 3ARFC 1R6VA 3MBEC 4XC3L 5GJTH 1S9VA 4KZEH 1JP5A 1NEZB 5D96B 3BN9D 1N7ML 4MQXC 4NIKB 5F96L 1FIGL 1HSBB 3QCVL 4JE4B 2X4RA 2F5AH 3QO1A 3IVKB 4Z6AT 3BKJH 1T22A 1N2RA 3BKML 5TQ0H 1C1EH 4KAQL 5EZIL 4RFEA 4KDWA 3QO0B 2QSCH 5T1LA 1NCWH 1CL7H 3RUGA 4QHMA 1RK0B 1FH5H 2JJTC 4OD2A 3U46A 1PG7W 5IR1A 3SKNA 1OAXL 1AGFA 2Z4QA 1MFAH 4N90E 3FZUC 4PJIA 1ADQL 1P69B 5GGUB 2YUWA 4PRDA 4L3CA 2X89A 2X6MA 3DOSA 3QRGH 1IGCL 5F7UA 5KSVB 1D9KD 3VWJB 4IRSD 2OK0L 2AK4D 5DLMH 4M6OH 1D5XA 4QWWC 1FO0A 5EO9B 4RMSA 2J12B 4E42A 5JHLL 5GRVL 4YGVB 3LHPH 3GI8L 4FQ1L 2F15A 1EHXA 1M71A 2DAVA 5J57B 2PTTA 4JY5L 4RA3A 2A9MH 3CXHJ 3V5HB 1MJUL 3ARBA 4Y5XB 4HS6B 2WIIA 2X4UA 3MA9H 4XVUD 3DURB 5JUEH 2F5BH 2HA1A 3UTTD 4BZYA 4Z7VB 1BF2A 4LCUB 4JO4H 5SWSB 3TNNA 5IMMB 3DX9B 3C09C 1OTSC 5CWSA 4DZBA 1JHLH 4HWNA 4JQXA 2BK8A 4WV1C 3DMMB 4P5KB 3GIVA 3SN6N 4QCIA 3EYSL 3ROOB 1RFDH 3SJVE 3LZFL 3VRJB 3QHTC 3GSRA 4OZHB 3IKKA 4N8VA 4HFWB 4R4ND 5CZVL 5CBAB 4YIQB 1RUAL 1NC4D 5INCB 5DQJA 5EUOB 5EC1B 1EVTC 2LVCA 4IS6A 1VB9A 3B9KB 3MXVH 3L3HB 3EOAB 1N59B 4XCNB 1JNLL 3U30C 5HDQH 5CZXD 4JGMA 3V0VB 1YEHH 4K94L 3DV6B 5D1ZC 3QUYA 1I85A 5F9WC 1AGEA 4JRXB 5DFVD 5ISZB 4Y4FC 1IC7H 2Q8BH 3RGVC 2DICA 3TYFA 4YUEL 2ZZUT 5B3JE 5HHVL 1NCUA 5JXEA 4OBSA 4JG1H 4WJ5A 5D7IB 5GS0C 5AYUH 3MJ9H 1IGML 3KDMB 2NW2A 3CAFA 4P46B 5C0BB 1F8TH 3MLYH 5D71H 4G8GD 1LDSA 1NGYB 5J12C 3WNLA 5I16B 3BZFB 1FBIH 3DXAE 1ZHNB 1ORSA 3BIKB 2FB4H 3I6KA 2AJ3B 3B5TA 2DLFH 2ERJC 1R5VB 3C5JB 3OV6A 3BZ4B 2BSSB 4JFEA 2OR8A 4LCYA 3IU3B 4W4OC 1J0JA 4P3WA 2CLRA 4Q6IB 1DL7L 2YD2A 4QRPB 5INDB 1AGDB 5GS2H 3O9WA 4JPKL 2W1NA 4O9HH 5DRXA 3U0PB 3C60A 3W39A 1XF4B 3MPCA 4MXWH 4WHYG 5EOQL 3D0LA 1IKFH 3DMMD 4AIZB 1Z6JT 3RUGF 2UVFA 1ZGLM 1NBYB 3ILPA 4YDLC 2AJZB 2EYSA 5DVOA 3UXFA 2VZTA 4YE4L 2AXHA 2EO1A 5KN5A 2DOCA 1B3JA 4MCYB 3FO2B 4ISVA 4BJLA 1MCRA 1QSEB 3DV4B 3JTTA 5IM7B 3KHQA 1VKXA 1TLKA 1CN4A 1EAJA 4OQTL 1N5YL 4HKJA 4I3GA 5BVJA 3BE1H 1P84J 4ODVH 2WLZA 5IOPB 1R5IA 5ALBL 4X9IA 4BQBA 2FJGA 4JRXD 3QIWA 3EZJB 2DYPA 4XWOD 5AWNL 2FNBA 2XZZA 3C5SA 1FYTE 1G6RL 1UJ3B 1OD9A 1KCKA 4NWUH 4PJ9D 8FABB 4CVXA 5MEQB 4NN6C 1P9MC 4PJCE 4HKBA 1VGKB 3HE7B 5GZND 3RGHA 2DM7A 1HDMB 3BGAA 1IM9A 1N4XL 4X6DA 3BMVA 2C9AA 5C0BD 3DTXA 2JJVA 1UXWA 1RK1B 1EIBA 4PD4J 1N7MH 2VKXA 5F96H 2EDDA 2VH5H 2XYCA 4XHJD 5T33L 1M05B 2MSPA 1ZGLB 4KAQH 4LGPB 5C9KA 3JZ7A 3WFBL 4NC1C 1N6VA 5BO1L 3PV6A 4X7SL 5D7LE 4CN1A 1OAXH 2QHLA 3VDCA 3MRPB 4LLQA 1XF2A 4K3GA 1UWEL 1U8HB 4NO5A 1AE6L 4X7FC 5CEYB 2NZIA 3WO3B 3T2NL 4ZXBA 3OAZH 4X7TA 3RTQB 3VGHA 2BMKA 3HI1A 4XNUH 3P9LA 3TO2B 4FQXC 3WYRA 5J89A 3OKMA 1MFCH 1BD2B 1LO5A 1TQCC 4L9LB 2W9DH 4PJAE 4Z95H 5IHUH 4G9DA 2RHEA 2YA1A 3DETD 3GI8H 4FQ1H 3P77B 3VXNB 1DBAL 1HCVA 3CNKA 1CDUA 3DGGA 4U1LB 1DFBH 3SKMB 3D1MC 3FTGA 4Y16A 2LAGB 1DBJL 3DNKA 5DRWB 4NQEE 3MRRB 1A2YA 1I9JH 1OWWA 3A6BL 3DPBA 2HJKB 3OQ3B 5CILL 4K7FA 1YZZA 5B38B 2OMBA 2CIIA 3P0VL 4KQ4L 4HH9B 3MLPA 3HE7D 4WI3A 2COQA 4RX4A 2NLJB 5DJZB 2MHAA 5B4MD 1PVHA 3EYSH 1EO5A 4YBQC 3TT1H 1WCBA 4I48B 1AIFA 5MEOA 3PNWA 5CZVH 5K9JH 3GNML 3QDMA 1EAPA 4KK8C 1OGAD 3SE4A 2C3VA 1RUAH 1LE9A 4P9ML 5K59E 2OYPA 1G7PA 4ORZC 1G9MH 1CDIA 4K7PY 2F53D 3D39B 4J6RL 2DIAA 1OAZL 2XWJA 3QFJB 3SDDB 1RURH 5FEBA 1D5IH 2OM5A 3QEHB 4LLUA 5D6DA 4G9FB 3RDTB 4GG6E 1F11A 3PJSA 3V4VH 4JN2B 4P9HH 1N3NA 5FB8A 4HIIB 4LAJH 4HEME 3ARDD 5LXGH 3PDGA 4D0CA 3OF6A 3VWKA 1LEKB 1F6AA 4HC1L 2ZWLT 1L0XA 1Q94B 4HIEA 1ZLSL 3MLUH 2QSTA 5C0AD 2LVEA 5T3XH 4I77L 4KJWC 2YRPA 4RMTA 3K1DA 4LVHC 2QR0B 3DO7A 1N6QH 3ZE0E 4EXKA 5SX4H 1LK2B 2JJWA 4UILL 2BOCB 5IW6A 2EDLA 4XVTH 2R2EB 4UQ3A 3GDBA 2GUOA 5EN2B 4JRYB 3AUVA 5IJKA 2YOCA 4G6JL 3UMTA 3PWPB 2DLIA 2Y6SD 3QDJB 3LD8B 3TVMB 4X6DF 1KTLB 4HCRH 5EZLA 3CIQA 4MLIA 1P4IL 3SDXB 4Y4HB 5EFIA 1Q9OB 2JCCA 1F2XK 1Z0MA 4TUOA 4W70A 3QI9C 2ZG3A 4OJFL 3QULB 2CKBH 1RZGA 3C6SA 2H2PD 1ZE3C 3Q1SL 3GRWL 1NBQA 2EXWC 3NIGF 4JPKH 4WFGD 3GSVA 5ENWB 1YUHA 3TIDA 4EVNB 2BVOB 3VD4A 1XGUA 4NO0D 4KV5E 5HYJB 3EO0B 3CMOH 3MCKB 3MV8A 3SY0A 1KXTB 5ID1B 2PTVA 3CFKB 2OTPA 4XCEB 4NZDA 5JOEA 2AQ1A 3ZSTA 5IWLA 2PXYA 3I75B 2IFFH 1QRNE 3ULVD 4R3SA 2ICCA 1AH1A 1WGOA 2A2QT 4KGJA 4JFFE 2MKLC 4N0CD 4ESKA 2VDLH 4I18B 1HHKA 4OZGB 5DVKA 3EOBB 4OQTH 5JLZA 4L8SB 1N5YH 5E5UB 3D39D 3EDEA 1KJVB 3VFSB 3OMZA 5CP7B 4ZTOL 4OM0L 3L3KA 3WDHA 4OCSH 3VRIB 3QFJD 3SDDD 4Z78B 1AO7E 5HVHC 3LEVH 2VAAB 1I8IA 5FYKE 2DN7A 3CCHA 3JBG7 5AWNH 1KENL 4MWFA 1G6RH 4PRBA 3KLHC 3UTSE 1K4CB 3L1OL 5ETUA 2OTWA 5DD0L 4WW1B 3RZCC 2YKLH 4MA8H 1CVSC 3QZWB 4XVSH 5TPWL 4KI5C 1EFQA 4HHAB 1OSPL 3VFTA 4F57H 1RJLB 4C55A 5DJ0B 4OF6A 1PW3A 5E00B 3KJ4B 4MDIA 3EHBD 4XHQA 4JVPA 5T33H 1I3UA 4XAKD 5F7HA 2WWKT 3MQIA 1LEGA 3CK0L 3QDJD 5KSBA 3FO1A 2WZPD 1AXSA 1Q8MA 5C09B 4AYFA 1CICB 2EDYA 1LDPL 4Y4HD 4X7SH 1M6OB 1HHJB 2H32A 5DZLA 3W9EA 1N8ZA 3SDCC 1IC4L 4YAQA 2GSIA 2FJFB 1UWEH 1JJUA 3QCTH 4KVCL 3G6DH 3I3BA 4LLVA 2EKJA 1IAKA 4Y7MA 3VFUA 2D4DA 3MUGA 2E6PA 2VDQL 5FO7B 2X42A 1FL3B 3L3OB 1X5LA 1NFDB 1ZOXA 5HJ3B 1IL1A 5ANMB 5KVDL 3LRHA 3KPNB 3N1QC 2BC4A 5ICXA 4UV4L 5CSZA 1G0YR 5A16A 2VXUH 3Q2CA 2Y4SA 1XCTB 1DBAH 5EU5A 4JZOB 3QNXA 1QSFE 2GTWA 4LMQE 4HJGB 4Z7UB 2AV1B 1UJTA 3VMPA 5E8NB 5TF1H 3QNYB 1JIBA 1XF5B 1YPZB 4I8DA 5T1MB 3X13A 4L8CA 3A6BH 3GEWB 1X5JA 1HSAA 5GRJH 2VZSA 3UJJL 1TJGL 3VG0H 5FHBH 1J7VR 2AEPL 2JKXA 1FNGB 3GMNB 4X99B 3MCG1 4K9EC 3DX7A 1ND0A 3DBXB 3HI5L 4HUMB 4XCCL 5EG6C 1LE5A 4FTVD 2ZKHH 3VXUA 3GMPB 4Y19D 2Q76A 1IC5L 2CKBB 4KRPC 1HKLH 2AK1H 3QUXB 4WUKH 4OIIH 2DMCA 2JCCF 3B8YA 3MRDB 4U6HB 3QDGA 1MCJA 3GNMH 5GGVH 1NAMH 4YJZL 3L6FB 5B39B 1T7VA 1MUJA 3O3EA 1OB1B 4YK4B 4LPYA 1S5HB 4MS8C 3O8XA 4JCMA 3MRCA 5F1NA 2JB5L 1GZPB 1JZ7A 1OARL 5L7XL 4W6XB 2DWEB 2HT2C 5A3ID 1LO2H 3KNBA 2FGZA 1CGTA 2X9YA 2ZCLH 3EIFA 4LASH 1HXYB 1SJHB 4YXKH 2V2TA 5IF0A 1RZJC 4JFHD 2BP3A 1C08A 4HX1A 1CICD 4DN4H 4RDQF 1CF8L 3OXRB 1CTOA 2XQYG 1HILA 1YJDL 1KB5H 3GMMA 5FO9A 2X05A 1H3VA 3N1MC 4JFDA 1UB6B 1ZLSH 4IMKA 3FRPG 2ARJB 4LHQB 4XNQB 1GCFA 2R39A 3IDMB 2A6JA 3CFBB 1G6RB 4I0PA 4N0UB 4UILH 5EZJA 4LHJB 3M8OH 3NFPB 3FAXA 1YDPB 1YN7B 3CX5J 2R0WH 4G6JH 2DI7A 4TUKH 4P5TA 5J7CC 1F4WH 2RJMA 4L3EB 3ZL4H 1S9YB 5ECJE 2IPTH 4GKNB 1JGLH 2IGFH 5E9DE 1AGCA 5F93C 3KS0J 2BSTB 4WEBL 4OV6F 2CJUL 4HMEA 4MVBC 4YBHA 4H0HB 5CEZE 3IXAA 2EIBA 1N0LA 4FFZH 5JOPE 4CN6A 1SYVB 3HE6A 3LN5A 5KSBF 1MFEH 4MB4A 2W91A 2ICES 3NMEA 4GXVL 1P6FA 1T3FA 3S96B 4HULB 2MTPA 2P5ED 1HI6A 5KS9E 2NY4B 2AS5M 1WWBX 2EE3A 3ZE1F 3OKDA 4QXTB 3TM6A 4EDWL 3HZKA 4KK5D 2ICWA 1GAFH 4PJ8C 3EFFA 4JFOA 4XTRC 1YN6B 4ZTOH 4K3DL 1A8JH 1G0DA 4Z7QE 3OZ9L 5A2KH 4HK0B 3QIBA 4HV8B 3NACH 2JB6B 1MAJA 4ZDHB 4MNQE 4TSCL 2X4NB 1KPUB 4EDXA 3NA9L 1UCBL 3TO4B 4YHPA 3L1OH 2NPLX 3PHQB 2R0LL 2X41A 5E56A 3L9RA 4ZO8A 3LQZA 1U8PA 2IH1B 1AJ7L 3LKPA 3FQTB 1EEUA 5LAXA 1VGEL 4ODXA 4OBRA 4KDTC 5HHME 5JDJA 3FB6B 3V0WL 4S1QH 1I8MA 2VR5A 3CK0H 5FYLL 4DZ8B 2XRAH 1NAMB 4UDTA 4IOFD 5FDWB 3FFCB 3RNQB 4TPRL 2YN5A 1XAUA 4L3ED 1NAKL 4PRHE 3U48A 5C71A 2E9WA 2HTKD 3O6KL 4YX2L 4XWGH 1KLUA 4D9QD 4KVCH 3MJ8A 2ED7A 4NQSA 3DUSB 1E4KA 1JPST 5GISL 1SJXA 5FYJE 4ZNCD 1HNFA 4HIXL 4E9LA 3WIIL 5CJQH 1KB5B 5ITFA 2F19L 3PL6A 4YXHL 1HNGA 4J7RA 2Q87A 4FXGB 5I15L 3MLRH 1ROWA 2NY4D 1YEJL 2H2SC 2X1PA 1U8NA 1EFXB 1KCUL 3D85D 5FCUL 1P2CA 3ARED 4EOWH 1RSFA 1T21B 1MCDA 2DLTA 5T3ZE 3KPQA 1MREH 1RVFL 3G6JE 1MIEH 5I18L 1MWAA 3W0WA 3SJVA 2EC8A 2VISB 4Z0XB 3ZYOA 3A67H 4NQDD 2BSRA 3V7AE 2M26A 4QXWA 2EH8L 1Z3GL 3FQXA 1EZVX 3VDBA 1EEYA 1FL6A 4K7PL 5HI3C 4X5WB 1DBMH 1RPQA 4L8DB 4OD1H 4RBPK 3MYJA 1F3JA 4RMUA 3U79A 2MWCA 1JPSL 1QSVA 4CVWA 2PCPB 3QUMH 4P4RA 3NIFF 5FUCE 4BSWA 4U6YA 1YC8A 1BFSA 1NLDL 5IGXH 4H1LA 1MI5E 2UYLB 1NCNA 3MLSH 3T1FA 4DVRL 5IB1A 1J8KA 3V4PL 4O5LH 4UV7H 4GRLD 1P1ZB 4L29B 5EBLA 4DKDC 1IEHA 4NFBA 4TUJB 2I07B 4FOMA 2VSCA 4MHHI 2J6EA 3VH8B 5K9OA 3LB6D 4M7JH 3ZHKA 1KJ3H 1P7KB 1S7RB 3NN8B 5C86A 3MRJB 2K1MA 5K33A 2VXSH 5JW4N 3GJFA 1YJDH 3RNKA 2VLKD 3TLRA 3DXAA 2E27L 3LDBB 1TVHB 1OM3L 2GITA 2DQTH 5GGTA 4PGCA 1YQVL 4ZTPL 3AXLA 4OV5B 2XN9E 4DKFL 1KJ2L 1J12A 1VPOL 4FQIH 4L4JA 4LQFL 2GFBB 2HFFB 2GSGA 3I3DA 3B9AA 5IIEA 3SOBH 4M4RA 5DMGD 5T5FH 5BXFB 1KFAL 3RX8A 4HUVA 4GUPA 5F1IA 4QYOA 5BRZD 5F7WC 1A5FL 2VDOL 3WS3B 1EFXD 4OLZL 3GSXB 5FUOL 5FUZL 3INUL 1U9KA 3UBXG 4TRPL 1DVFD 3MRBB 5DUML 2ZPKL 4PP2B 3C09B 3DROB 5ILTL 1CLYH 5ALCL 1CYGA 4GQ9H 4WV1B 4LBEA 4HWEH 4J4PD 4PREB 3MNWB 3UTPD 4NQCA 4BZ2H 3QUKB 4J3VA 3H8NA 4O51B 1BEYL 2RFXA 2EKSA 3N85L 3IJSB 1AKJA 3MXWH 3FQWA 3WLBA 4JGUA 4WWKD 1OPGL 1S7QA 3O6FB 1HIMH 2OZ4L 1FYTA 2VYRE 3H7BA 5DHVA 4HMCA 1R3LB 5DUBA 5C9JB 4B41A 2DS4A 5D1ZB 5D2LA 2EEDA 4PJCA 5JORA 4QHNB 5F9OH 4PGDB 2E7LA 2C4XA 4IRJA 4Y4FB 5AD0B 4LPWA 2GJ6E 3HG1B 5FA3B 1GGUA 4QRSA 3O45A 2X5PA 1RZ7L 2H8PB 3B5HA 4UUJB 5HGAA 4JFZL 3VXRB 2EDKA 3MRIA 1WBXB 3ULSB 2VLRE 1KLGB 3NA9H 3I02A 1A3LH 4KKBC 5K93A 5CUSH 4F3FA 2LAAA 4MCZA 4LLDB 4ZAKD 43C9A 2XTLA 1A3RH 2R0LH 4OLUH 3PHSA 1H5BC 2B39A 3RIAF 1XH3A 2ERJB 5D7LA 2WSKA 5EU7E 4IDJH 2NTFA 3OKNA 3ZTNH 3EZ8A 5F89A 3QUMB 1JGUH 4D9LH 4KFZC 2V2XA 4WDIA 4HKZB 2SEBA 1CFVH 4G42A 4P59H 2EE2A 9CGTA 4EBQL 3KJ6L 1A7PH 4PYGA 5HVFB 2PXYC 2HLAB 3DWTA 4FG6C 4XCYB 5MENB 4XGZA 1BF8A 2Z31D 1MRDH 2VABB 5DD3H 5B3JF 4NZTH 2NX5E 4HLZG 3P73A 2AV7A 1QP1A 2WUBH 4YDLB 1YECH 4GKOA 3L5XH 1REIA 2XA8H 3BP5B 3ZYJA 3BX7C 5ITBL 4PJ7A 3WIIH 3MRKA 1J05A 4NQEA 4QRUB 1UM6H 2FEEL 4H26B 1QUNA 3FB8B 4YXHH 1ZT7A 5IMKB 2WNGA 1FO0L 2VQTA 4L3AA 5EO0A 4MXVE 1K8DA 3O6FD 3JWNC 5HHNA 5JNYA 1T1WA 3MR9A 2FRGP 5ACMA 5I76A 4MNHB 1TCMA 2IMNA 3WDJA 1DEEA 3E2HB 1FZJB 4BM7A 1FPTL 5J9PB 1Z3GH 2WV3A 1JZ2A 1LNUA 2MFNA 2H3NA 4JANA 4P2RE 5IT2H 4U2ZA 3CUPB 4PJXB 5TE6L 3IDGB 1RJZA 1JPSH 2E7CA 1TVBB 3CSYA 3UJIH 4OKVA 4YEEA 2XPGB 5HGBB 3LEYL 3P4OB 4GG6A 1GC1L 1NLDH 3ULUE 3EO9H 2OJEA 5CD3B 1BMGA 1T2QL 3NABL 5C0IA 3KPMA 1VESA 4R6UA 1M7DA 1MNUL 5E6ZA 4P2QB 3DX6A 2KL6A 3LRSB 4FA8A 5LWYH 3D3VE 3MFFB 3HB3D 5DJ2B 3U36A 4N9GA 4YC2C 2CMRL 3EYQC 3BYTA 4U6VL 3H9SE 4X4XB 3SGDI 3TZVA 1A3QA 3VXME 2BVQA 5DK0B 1QHPA 1P7QD 2J4WL 1FDLH 4Z7NE 4MA1C 2G9HA 5BS0D 1OGTA 1V7MH 1R3KA 1B4JH 1PQZA 4LK4A 3EKCA 2E27H 1OM3H 5IB2B 1DSFL 3R1GH 3GSQA 5DC4B 3T2OA 4ZTPH 5D2LF 4IHOB 4PJCF 2A1WL 1WWWX 3F5WA 1U8OA 1C7SA 1VPOH 2G60L 2PYFA 1OW0A 5E8EB 1AHWC 4P2OA 4XPFH 2WM0A 3S3PA 1S9WA 4MA3A 5CIPH 1KFAH 2NY7L 3G5VA 4QRTB 4LCIH 3QXTA 4LNVA 3GJEA 5FUOH 3S3JA 1BBJA 1I3GL 1RIUL 1LP9B 4OCYL 3GBLA 1AD0A 3VMNA 4TRPH 4C83B 1VFAB 1U93A 1B4RA 1LO0L 3O11B 3ZT6A 4RGMB 1OLZA 5FYKU 2BNQD 3S88L 4MMZC 3KYNA 1BZ9B 5H37H 1QRNA 5I1AB 3THML 4ENED 5ESAB 3F7YB 4JFFA 3FB5A 4UOJA 3BDYH 3EJJX 4WCYH 3H9ZA 1QLEL 1BEYH 5DRZA 2Y06L 4YHYB 1OAKH 3HC0B 3EFDL 3PQYA 1K3IA 3CZJA 1IBGL 3UZQA 4M62H 3QH3A 3STZB 2I60H 4F8TA 3JWOC 4ODTH 4RBPH 1KBGH 4XB7A 5EWIL 1XR9B 4CMMA 3UPRA 5FDYA 3TC9A 3NCFB 5EU6A 1YMME 1FAIH 3HC4L 5HYIA 3UTSA 3X12B 2IANB 5HHOD 4U1IA 2ICEA 1F4XH 4Y4KD 1CE6A 2P5WE 4PJ7F 3M1BB 4CVZA 4JHWH 2ESVE 4UDUB 1RZ7H 1WEJH 2Y23A 1ZHLB 4XNYL 4P3CH 4G6FB 4P48A 3UJTL 2MCG1 3P4NA 1FNFA 4L4TD 3RY6C 1NGQH 1F90L 2VLLB 4I0KA 5D1XD 1AY1H 4LVHB 2CDEB 3E3QE 1N0XL 1NCBL 4ZUUA 3OKKB 5SWZB 1QFUH 4PJFE 3BP4A 1FZMB 1PKQE 4OLYL 5F44A 1B6DA 1AI1H 3LH2L 3JWDC 4XPTL 3V8OA 1FNHA 5DT1L 1CIDA 4WFHE 4Y1AE 4XH2B 3I9GL 4YDJB 3ULUC 4HJJL 4GW1A 1TIUA 5K59F 4GLRH 3DVNA 1NJ9A 3MV7B 4B53A 3H9HA 3CU1A 1FAKT 2ZUUA 3HE6C 1JWUA 4N8PA 2BNRA 4BZ1H 3C6LB 4NZUH 4HUWA 4GG6F 3Q3GA 4JRWA 1JK8A 3HS0A 3QEGH 5EC2A 5IFAL 2CRZA 4LKXA 5FYLD 2XZAL 4PP1D 4GAFB 4PRPE 1FORL 2DLHA 3U83A 2CIKA 4JPVH 4MHHG 4YHOH 5GSRB 4ZOAA 1QSFA 1UM4H 2YPLE 2D7QA 3UTZA 3X14B 1RZJH 5E7BA 4D8PA 3P4LA 4NRZA 1X4YA 5HGDA 1J1PL 5F71A 2ZSVA 5CMAB 4K71C 4ZD3H 3BEWB 2VSDA 2FL5B 5DWUL 4PRIB 4GAYA 2O5YL 3OG6B 3EJYC 5HVHB 4DVBA 2IAND 3LKNA 4MD5B 4EZMA 5ICYA 4B5EA 4KJQD 5CIPB 5C0DB 3MRHB 1RZKC 2A6IA 4LVOB 7FABH 4P4KC 1TPXC 3WD5L 3WCYA 1T5WB 2R29H 1PX3A 2EDJA 1Z9SA 2B5IC 2PO6B 4LCWB 4E0RA 5B8CB 2IQAB 5J8OA 4JY6A 4LF3A 4RGND 4GKSA 3RZCB 3MC0A 1BP3B 1RMFH 1X6LA 3TA3B 2UWEB 4TYUA 1DANU 4ODSH 2YRLA 5SWZD 3WBDA 3CFDA 2PYEE 4LHUB 2R2BB 4KV5F 4IIQA 3QEUA 1HWHB 3ME0A 2A73B 2G2RA 3A6OA 1B0RA 5C0CB 1O5DT 1T0MB 5TDPA 5IKCA 3AY4A 4WO4C 4F7PB 3E6HB 1ZANH 2NXZB 1CS6A 2BRRH 5E2UL 5J6HA 1JHKH 4NDMA 4BH7B 2A6DB 3NTCL 5DHXB 2JELL 3VFMA 1EJOL 2Y5EA 3L3GB 2CMRH 4UIMB 3SDCB 4U6VH 4N5EC 2EEBA 2LQRA 3U4AA 4R26H 3C6LD 4GJTB 2M1KA 2J4WH 1UGNA 2I25N 5KVEH 5GGSY 4MJIE 1UWXK 1IGIL 2DRUA 3IT8D 5DTFA 4EI5A 1ITCA 2P1YA 4HKXA 4YHZL 1DUYB 3V95A 3UBXB 4BSVB 3CH1A 5KVFH 1T1ZA 2HH0H 4KU1A 3RKDD 4TNVF 3T65B 1GGIL 2XWTA 4LL9A 2HKHL 4BFIA 4DGIH 4PLJD 4D0BB 5E9DA 3O2VL 1PDKA 3L3DA 4U6XA 2APBA 3MREB 3CPLB 5AEAA 3QXDA 1IARB 2NYYC 1WQVT 4U7KA 1BLNA 3K8MA 3T09A 5JDSB 1T4KA 3W5MA 2YC1A 4Z18A 4J2XA 1CZ8L 1F2QA 1JHTA 5C07B 3TBYA 3TPUB 4NCDA 3NZHL 3S4SA 5JIHA 3PGCA 4Z5RA 5J56B 5D6CB 1KTKE 4W81A 5EZOL 5JPNB 2PW2A 2X4RB 3VI4E 3QO1B 3ZKNC 4U1JA 4TTGA 2PO6D 1SYSB 3O6ML 2YUVA 1ZLWK 5KS9A 4RFEB 4NNYA 1Y6NR 4JM4H 1GOHA 4ZPVA 4G6AD 1JVKA 4KRPB 3TA3D 2MQ3A 4ODHH 1YY8A 1A1MA 2Q86A 3RUGB 4QHMB 5JOFA 5F7MC 4F7MA 4ZFFA 4OD2B 3TIEA 1HYSD 5IR1B 3IFNL 1QLEH 1QG3A 2Y06H 4FRWA 2ATPA 3SKNB 1AGFB 1NPUA 2KQMA 4KMTH 2OTUA 4U1NA 1MCEA 3BH8B 4XVJL 3SO5A 2R2CA 1GGBH 1RU9L 4MNQA 2ZOKA 4FFYH 4ODWA 5EORH 2NXZD 1CLZL 4FXKA 1A6WL 2W38A 2VLJD 1HE7A 2YBRA 1G7LA 3L5JA 4BQ8A 3HC4H 4PBXA 4XBPA 1D5XB 5CP3A 5GRUL 1F4YL 2OSLA 2J8UE 4LFHG 4JY4B 3SDAA 2HRPL 4E42B 1BQHA 5CCKH 1NFKA 1I9RH 1TXKA 4DGVL 1VFBA 5D7JC 1QO3A 2PTTB 4QHKI 1BQLL 1IAII 4U7SA 3F7RA 1KTDA 5CKGA 1ERNA 3BJ91 2QL1A 1QFHA 4FQLL 4JZJA 3P11H 1HINH 2WIIB 2X4UB 4FQHB 2HFEA 5LKNA 5HDOA 1MFDH 2WBJA 2HJFB 3WUWA 4PRHA 3RWHA 1NGWB 4JG0L 3TNNB 3HPJB 1FGNL 3RJQB 4L1DA 1NC4A 2YSSA 1Q9KA 4OGAC 3PP4L 3GIVB 2P42B 4QCIB 5I66A 4U0RC 3WFHB 3AS1A 4N8VB 2FO4A 5HGHA 4WNQA 2BFVH 4G80A 4WENB 1DQJA 3ECBB 4IS6B 4AM0A 1YEFL 5IFAH 1NGZB 2EXYC 3AVEA 5E2WH 1BZ7B 1U8LA 3U9PH 3HLAA 4HF5H 2Z8SA 4FS0A 1B0GA 2F74A 2Y07H 1KG0A 5T1LD 2VNCA 3RX5A 2CDFB 4LEOA 1EUUA 3PWLA 3X11B 4C57C 3O4LB 1XZ0A 1J0YA 3QXAA 1P4BL 3ZDYE 2ZNWA 3G6JA 4CU7A 5D1QA 2YMXH 2VZ3A 2VXTH 2NCMA 2IAMC 1J1PH 1PFCA 1XGRB 2V2WA 4WJ5B 5D9SA 3MMEA 1UA6L 2YD6A 5CINH 3RWJB 1IGTB 1J8HB 4LCCC 2D7PA 3PWNA 3ESUF 2YD1A 3DYOA 2J1KA 4Y5VC 2YEZB 1RULL 1JRHI 3LMJH 1A6TA 3HRZA 2H1PH 2P47B 4KKCD 3REVA 2OJZL 1WZ1L 3SE8L 1BGXH 4F33A 2B4CL 3I6KB 3KR3H 1HH9B 1MI5A 5DSCB 5IB3B 3ARBD 3BISA 2Q8AL 2DQDL 3SQOH 4LCYB 3ARYA 2AJSL 4ZSOB 3A0OA 3QFDA 3LKSB 2QQLL 1G7QB 4FZEH 4TVPE 1T66C 3ARZA 1FZOA 3P9MA 5DRXB 5KS9F 4M6MH 3QJHA 2AXGA 3W39B 1HWGB 4O58H 5IV2A 3D0LB 2NXYC 5IG7A 2Q20A 4MJ6A 4QF1A 4YBLC 1MCNA 2YA0A 4GSDL 3LRGA 5KW9H 1DE4A 5JZ7C 3JTTB 3MRLA 1O0VA 3LIZH 1ZWIA 2E9BA 3TCLA 6FABL 3BPNC 3LV3A 3NAAL 3TBWB 3K81A 2E9JA 4OGZA 1GZQA 1BVKA 3UROR 3QUYD 1MLBA 3Q5OA 2FJGB 4IOIA 1BJ1H 4XPBH 2DYPB 2QQKL 4L4VE 4NBZB 2YD4A 1FCCA 3FAWA 1ES0A 3QIUC 4ALAL 1HHGA 5JXED 4GRWH 2CR3A 1JGVH 1HQ4A 4X6BB 4OFIA 2D0GA 2V7NA 3QBTB 4X6DB 3TEUA 4I3SL 3FCTA 4XPHH 4O2EA 1CZ8H 1NSNL 1UXWB 5EU3A 3NZHH 5DMIL 1A7RL 4NT6A 1FV1A 5FGBC 2FX8H 5CBEA 1ONQA 3JVGC 1CK0L 1MPAL 2Z8RA 2B7DT 3O6MH 3ZE2E 3BD5A 1I1AD 3RVXC 1WSST 1TDQA 2BOBB 5CD5D 4XXCA 1TJHH 2B2XH 1J5OL 2ZUVA 5EBWA 4DEPB 4JFED 1DN0A 1BFVH 1DLFL 3C8KB 2GJ6A 3KYKH 3U4BL 1XF2B 3GI9H 4XVJH 1WZMA 1RU9H 4NO5B 2DBJA 3O9WD 1UYWH 1E4JA 3C60D 4PJDE 2ADIA 2VLRA 3MBXL 4MD4A 1OAUH 1KEGH 1I3RB 3G08B 1T2JA 1IEBA 1G7JA 1DLHB 1S7TB 4K8RL 1BOGA 2OLDA 3TH2T 1NMCC 5TQ2H 5IFHH 3OL2A 3QQNA 3ZDZF 4ZUWB 3RVWD 2BVPA 5TH2A 3DGGB 3ZKSD 4NKIH 3WNOA 1BQLH 4MSWB 5E7FA 4LP5A 3U0WH 3FTGB 4Y16B 5CHNA 5GSVB 4HXAL 3CDFA 2FYYA 4WTWA 3QIWD 4WRLA 5BZDA 1RUKH 2DYPD 4K7FB 1SEQH 1UWXH 3PP3K 1C5DA 5TDNA 3V5DB 4HZLB 2NY2B 2CIIB 1UH3A 5FO8B 5E8OA 1A4KA 2E9IA 4ZYKA 4PY7A 3PP4H 1IM9D 2OQJA 5DI8B 1ZT1A 3LKRA 1B6UA 1K2DB 1KCRL 1WCBB 4XX1G 4Y5YC 5LBSH 5MEOB 2NX5A 3CX2A 4C54A 1INEH 3HNSL 3QDMB 4OFKA 3WS6A 3IFLH 3U6RA 3D18A 3DRTB 1G7PB 4L5FH 1J0ZA 1A6AB 2VQ1A 2XG4A 5IJVB 1A21A 1MELA 2CLZB 3O3AA 4F7TA 4YZFE 5CEXA 1F11B 4G8FA 4JPWH 6CGTA 5DJCA 1N3NB 2VZVA 5M7QA 4ZUVA 1IGFH 3AM8C 3RWDA 3BQUA 1CD9B 1VACB 4H1LG 3MROA 4TN9A 4UT7L 3NCJH 2NR6C 3JV5A 4HIEB 1ZGLP 3FL7A 4NUJA 2V6HA 1RI8A 4ZXBD 5GHWL 2ITCA 4YHNA 1FE8L 5BVPL 3RPKA 4P2RA 3UC0L 1BJ8A 1EEZA 4PBWD 4NHUA 4CDHA 4GRWB 1YNTB 5IW6B 4JFXA 4HW6A 3KPOA 4C56B 4EUPA 1Q9WA 5HY9A 3WIFB 1ED3B 2GUOB 2GJZA 2JJSA 2OJZH 1DN2A 4U33A 1MWAL 1EBPA 4B7LA 2VZOA 3BAEH 4X8JB 5HD8C 1T6VN 3GO1H 4HBCH 3ARSA 4P57A 4FABH 1QA9A 3C5ZA 1K8IA 2IBZX 3VG9C 5KSAC 5E5RB 4Q9BA 4Y16D 4P2YA 1H5BB 1QFWI 2ITDA 4NO0A 2JCCB 4TUOB 3D3VA 3TBVB 3WXVL 4NRYA 2R56H 1RZGB 3H9SA 3VXMA 3C9NA 3MRFA 3HZYA 1FYHB 4EN3A 2UZXB 2NY2D 3EGSA 3G6AB 1NUGA 3GSVB 1YUHB 1VADA 2Q7NA 5DJYA 1AQDA 1XGUB 3U1SH 3MOQA 3QWOA 4FZ8H 2IALB 4MQ7A 3MV8B 4RX4D 3SY0B 4OCRL 1A9EA 1FFNB 1H9VA 1MAKA 3N50A 3NZ8B 2PXYB 3FQNB 1KC5L 3QDMD 4ELME 1U8IA 2J6EL 4JCLA 1KN2H 2B0SH 2P45B 3CDCA 4S1SL 4UB0L 2V5YA 4U1MB 1RZIA 1HHKB 2VXVL 3Q6FB 5E2VH 6FABH 5JLZB 1CR9L 1A7NH 1UB5A 2F58L 1F13A 2N4IA 4JFQA 3VGDA 3X3GL 1T03H 2PW1B 1DBKL 1ETZA 5GGTL 3TN0A 3CCHB 1NCTA 1ZSDA 1B2WL 2NZ9D 2O5XH 4MD0A 4MWFB 3OF6D 3VWKD 4RFOL 1SMOA 4X98A 4KK6C 4ALAH 3UYOD 3BESR 1R3HA 1BX2A 2DQCL 1FLRL 2OTWB 3VXSE 3VFVB 3MOBH 4WTZA 5FOBA 1G9NL 3OKLA 4AL8L 5L8KB 3VFTB 5DEZA 4ZO6A 5DMIH 4E41E 4M43H 5MHSE 2Z93A 3GBMH 5IUSA 2C4FT 1G7HA 3JWDH 4HEPG 4MDIB 3GFUA 5GGRB 3EDDA 3G5ZB 2QQNL 3BT2L 1DBBL 1M7IA 5D5MF 1LEGB 4OLWH 4GH7B 1E4WH 4WHDA 3IDIA 5KSBB 5L88L 3FO1B 4YR6A 1AXSB 1U3ZA 5EIIA 4YO0B 3W11C 1GOGA 2H32B 4YXLH 2P5WA 1J1XH 2W0FB 4YAQB 2X10A 1WT5C 2GSIB 2K7PA 4XPGH 2ESVA 3KPSD 4FQQA 1CXFA 4PUBH 5IROA 4OCNC 3OR7A 3QG7L 1KJMA 1SM3L 1KCSH 3HR5A 3MUGB 4MXVF 1ZEAH 4YC2B 4K3HA 1MCOL 4NN7C 3MV8D 3KXFE 1XCQA 4UZGA 1U92A 1IAIL 5IHBA 1X4ZA 4K07A 3W82A 5DJ6B 1TMCB 2YRZA 5ID0B 2NY6C 4JZNA 3P0YL 3WJLC 5FHAL 4JDZA 4K8RH 4PJFA 4MA1B 1NCAH 1CXEA 1PKQA 2BC4B 5I30L 2PR4L 3HA0A 5TFSH 3UPCA 5CKAA 3AU1B 3KYOA 2H26B 4LNRA 4P99A 2HVJA 2OL3A 1NANH 4Y1AA 3BN9C 3GSNH 4F7EA 3MLZL 4APQA 3QNXB 4J12A 4XMKH 2YK1L 2GTWB 1A1NB 1QPXA 3JV4B 1EVUA 2X4SB 3PWVA 4Y19A 4ZOCA 4ZFGL 3X13B 3QXVA 4N0FA 2BHYA 4PV8A 1IMHC 5HYSG 1HSAB 1RZKH 5MP6L 3RL2A 4U05A 3MACH 1HHIB 2R0KH 4Z7VE 3DX7B 4K2UL 3B9EA 5SWSE 4WW2C 3FB7B 3VXUB 4HJ0D 2Q76B 4NN5B 5I8CB 3WFCL 1QBLH 3CC5B 4P5MA 1D9KC 1P4LA 4IRSC 3SDYL 5F7LB 5IMOB 3HNSH 3WIHH 3SKOB 4HK3N 4OF3A 4W6YB 2WANA 3O3EB 2YPLA 1BIIB 1EHNA 3CD4A 3O6LL 3ETBF 3MRCB 1MCLA 1UVQA 2HWZL 5EUOE 5F1NB 3T3ME 3KNBB 2YXFA 3CFCL 4MNGB 1NMAH 3CVIL 2X2YA 4JFYA 5E0QA 5IF0B 4LFHD 4HX1B 2GK0A 2XACC 4Q9RL 3OPZH 3LVEA 2AABL 1IVLA 3OAUH 4OT1L 4R4FH 1JRHL 4LSSL 1HILB 5ISZE 3BZEB 3GMMB 5L0QB 1P84K 2APVA 2FCBA 5CLWA 4XVUC 2AXFA 4JFDB 2Q3AA 3FQRA 3RFZC 3CSGA 3BH9B 3EYUL 5TGBB 4NM4L 1FE8H 4ONHA 5D7IE 4I0PB 4MAYA 5GS1C 1UENA 2PYEA 4NOBA 4XRCA 2XKSA 5HBBA 1PZ5A 2EDHA 1NMBL 3CXDH 3AC0A 5TDOA 5GGQL 4HUNB 4R4NC 2R8SL 2XZCL 3MODH 4GBXA 4YPGB 1J1OL 2D03L 3ROLA 5DD6A 2R1YB 4K55A 4LRIA 1YYML 2ED9A 4PD4K 1CT8B 1AGCB 5F97E 3F7VA 4J1UA 5CZXC 4LLYB 2AJYH 1PEZA 1XGTB 4YHIA 5F7DA 2P5EA 1CVRA 1FFOA 5DFVC 3IXAB 3RVUD 1U3HA 3RWGA 5DYOA 4MJIA 1Q1JH 4QRPE 3CVHH 1JNNL 3VXUD 3HE6B 3LN5B 3N0PB 3T0EE 4LSUL 4F37K 4OCRH 2XI9A 1T3FB 4GKZA 1AXTH 3EBAA 1Q0XL 3PP3H 3QDGD 1HI6B 3HAEH 1R3JB 3OKDB 3HZKB 1AQKH 3O8XD 2ICWB 3U7YL 4TSBH 2OI9C 4NPYA 5FKPA 1QSEE 1CI5A 3GJFH 3CLFL 1V7NH 2BSED 4A2LA 3D25A 4BELD 2BXZA 3SCMA 5D2NA 4M4PA 4PJFF 3OHXA 1B2WH 2FATH 3GSNB 1QACA 2F8OA 5EO1B 3O0RH 3T3PE 2QJDA 4Y5XC 4EDXB 3VW3H 3SGJC 4UTBH 4UBDD 3MCLL 4PG2C 1D5MA 4YDIL 4YHPB 4U1SA 4JFDD 5HXMA 1UACL 1MSPA 1HOCB 4GG8B 3TP4A 4HD9A 3BP7B 1EHAA 1TPXB 2VRAA 5CJ5A 1C5CH 4FQCL 3RQ3A 2B5IB 4NJ9L 3K7UA 5AUMA 3DMMC 4JQIH 3AMKA 4G6KL 5LAXB 4YDKH 4ODXB 5FAAA 3L3IA 5D8JL 2IH3A 1UCTA 3O2DA 2YPKA 4AMKH 5ICZA 1OSZB 4RWHA 3MLWL 4PGZA 4P5TD 1EX0A 4MAUH 1FFRA 5FA4A 3JUYA 3BSZL 4NHCL 5KG9B 4WO4B 5I1CL 2BHZA 2J8UA 3T1WA 4G8IA 2PF6A 3T8XA 4KUCF 5SV4A 3WFDL 3RPIB 5JPMA 2ARJQ 4U1KB 1UT9A 2CSPA 1G1YA 3QRFM 3WSQH 4XWOC 1DQDL 5FYKL 4HAFA 5AZ2L 1I9EA 1NCCL 2AXJA 3D85A 4PJ9C 4GW5A 5DHVH 5C0GA 1FGVL 3TV3L 5GZNC 4J3XA 5A1AA 3PL6B 3HR6A 3PGFL 3N06B 1BD2E 1CFQB 4KTEH 2DI9A 3K4AA 4TOYL 3D48R 4Y2DA 1U8NB 5C0EA 4MLSA 2R4RL 1P2CB 4JKPH 1DP0A 1EJ6A 3MLZH 4K8RD 5HHQA 1ACZA 2Z0BA 2YK1H 5LG1A 4XHJC 3WFZA 3DVFA 5AZEL 3WFEH 2DQGL 3BGFC 3RWCA 3W0WB 3QWRD 1CGVA 5J11B 3QIBD 4ZFGH 3V52L 2BSRB 2VN7A 3FQXB 1PBYA 5FFLA 5C6TL 3U0TA 4K2UH 4X9HA 3UCRA 1G7IB 4GW4A 3WFCH 3S36L 1KIPB 4BSWB 4U6YB 4YNYB 4DQOH 2CDGA 3IFOB 3QQ9D 3J8F7 1NEUA 5HVGB 4N90D 5DK2B 5IB1B 3H7LA 4GXUM 1MJ8L 2EICA 5JO5A 3DETC 3HAEB 4O4YL 2VDKH 1GXEA 3MV9E 3G5YB 4G9FE 2ZCHL 4R4BA 3GJFB 1WIUA 2AQ2A 1FL5A 4LLMA 4WI7A 2GITB 2NW3A 3BD3A 1TTFA 3AXLB 1T83A 3K80A 4OCXL 5BRZA 3GSWA 5FGCB 5I1EH 1IAIM 3HE7C 1QFWL 2GSGB 2C7UB 3GBNL 5D7JB 3PL6D 5B4MC 5IIEB 2EIEA 3OKOA 4GUPB 4F7CB 2UZIH 2HTLD 2BJML 4IRZL 4X9GA 3VI4F 3AB0B 1KIRB 1IQDA 1A47A 4JRYE 3TYGH 1YEDA 1CGUA 2P48B 5FK9A 1NKOA 32C2B 2VTFA 5GRZA 4HIJA 3S3SA 3PWPE 4QLRA 1PEWA 3W0WD 3SJVD 1AGBA 2EC9T 4UQ2A 1OHQA 2M2DA 1ZT4B 3SDXE 5CZKA 2PTUA 1QBBA 1Y0LA 3KYMB 1H3UA 4YEFA 2IADA 2FGWH 4NQCB 4RQQB 4UT9L 2KUTA 3ARDC 3O41B 4AK1A 1BJ1J 3P3YA 1TNMA 2EKSB 3HFMH 3S4SG 5HYJE 4D0DA 5F1SA 1I9IH 2C3HA 1AKJB 4MJ2A 4HAGA 2J8UF 4NBXB 4RSVA 3RTQC 2HP4A 2P24A 2QADD 1LO4H 2E5EA 3ZKXC 4L4VA 5DHVB 5DUBB 4L9LC 3SGEI 5D2LB 1WICA 5JORB 2W65A 3GHBH 1X7QB 4JO3L 4IRJB 4OZGE 4KQ3H 3HZMA 2VDNL 2VDMH 4QRSB 2Y6SC 3O45B 1OTUD 4JHAH 2IAMB 4GRMA 1MQKL 1IGYB 1PY4A 3DXAD 1H3PL 1NANI 3I02B 4YDIH 2FECI 2X4TA 2HAZA 4C4KO 3STLA 2IWGA 3H0TB 4Q58C 3V6ZA 3DVIA 1BFOA 2H2PC 4JO2H 3X17A 43C9B 4XNXH 1YY9D 3MZGB 5CEZL 2AJUL 1YNLL 4ZNEE 1BQHG 1FN4A 3FKUS 4RFNB 5F89B 3QJFA 3W81A 4I5BA 1X5YA 3ULVC 2JLLA 2BZDA 1I1RA 5GIRA 4PJDA 4X9FA 2R1XB 1UZ6F 2XTJB 4N0CC 5GRYA 5F6HI 1S7VA 5SV3A 5I1CH 5C09E 2EIZA 4KK8D 3WUWG 1ITBB 3WFDH 3SDDC 1JL8A 4XGZB 2R23B 3ZDYF 2GY7B 1FCGA 2NXYB 3OKEA 2ZUWA 4YBLB 1IGJA 2E3VA 1UWGL 1MQ8A 1AFVH 4NQCD 4NM8H 4NQUA 3P73B 4KY1H 1WIPA 4OGXL 4H25A 4KROD 1I1FA 4OZ4A 4PJ7B 1S3KL 3TV3H 3SBWA 1AKJD 3IDXL 1QKZL 3FT3A 1NFDE 4Y0GA 1FNLA 3CFJA 5H35B 5ANME 4JM2A 4YDVA 5T3XE 5HHNB 1FYTD 4R7NA 2HMID 1G84A 1T1WB 4F8QA 3R06A 1I4FA 5I76B 3FFDB 2F54B 4ZUSA 2QQQA 3EHBC 3K3QA 1WAAE 1PYWA 1OP3H 3QHZH 3ARTA 4IRJD 1TJIL 4JB9H 1GGCL 5IHLB 4I9WE 1DEEB 4Z7UE 3PHOA 2BVUA 3QIUB 5SWQA 4ETQA 1JPTL 3OGCA 2N7AA 4U3XA 4J8RA 4R2GB 3S5LB 1YPZE 1LNUB 2H3NB 4Y4HC 2BNUA 3V7AG 3X3FL 4A6YH 1A6UL 4EEEA 2Y72A 1VERA 1KT2A 5I2IA 4NNXA 2VC2L 3G04A 3ZTJH 2EC9U 1ZHKA 2LTQC 4I3RL 3LS5H 4HS8H 1MCFA 1QBAA 2OJEB 1BAFH 4WUUB 3VFOA 5D7LD 1IAOA 5FYJL 3KPMB 4OZFH 5BMFL 1M7DB 1VEPA 3DX6B 5D93B 4W68A 4N9GB 2YS4A 2ATKA 3P2TA 2XY1A 3TZVB 5BW7A 4LSTL 2BVQB 1XIWA 5J1AA 4M8QA 3V5KA 4L8SC 4H88L 3RL1B 2ZCHH 2AEWA 1OQXA 1OGTB 1Y18A 3O3BB 5E6IA 1PQZB 5HHPA 4M6NH 5I1JL 3J7HA 5T3ZL 4HWBL 3K4ZA 1I3VA 5E4EC 3DVGA 1FFPA 5KAQF 1IE5A 3IF1A 1ZA3A 4AEIH 3F5WB 1I7UB 1KTRL 1NMCB 2FHCA 4G8EB 2LABA 2PYFB 4DGYL 4P2OB 4NQED 4WY7H 1VENA 4MA3B 1E6JH 3DARA 2JTDA 3G5VB 2BJMH 4PS4L 3TJEH 1QR4A 4NNPH 1QYGH 1YEKL 3GJEB 1BBJB 4BQ6A 3LQAL 3GIZL 3ZE2F 1CG9B 5KSUA 1BVLA 1JN6A 2ZOLB 3MX0A 1HEZB 4PRAB 1X5IA 1WBYB 2EDFA 4HGMA 4XBGB 1XGQA 5A3IC 2PNDA 3WJJA 3KYNB 4H0GA 2R69L 1H8NA 1QRNB 4ELMA 4R2GD 1CICC 1ODAA 1T0NA 4UT9H 3FB5B 4Y5YB 3SE3C 2R1WB 2B8OT 1ZLVK 4CGTA 4D9RE 4PJDF 5DRZB 4K94C 1XGYL 1TETL 2V9QA 3F12A 3LKQB 3PQYB 1A7QH 4AG4L 2ORBH 3TBTA 3MRNB 3NCCB 3QA3B 2OBGA 2MMXA 3UPRB 3OXSA 4JKWA 3RIFK 5EU6B 3B2UD 4V1DB 1IT9L 5IQ9B 3S35L 2BXYA 5I8EA 2ICEB 3BWAA 4JO3H 1IKNA 3GHEL 2JIXD 4XMLH 3NVQA 3VXSA 3WUZA 4RRPA 4I1NB 3TZVD 4CVZB 3L95B 2UVEA 2G5RA 4Q9QH 1L7TH 1QD0A 2XQBH 1T1YB 2HG5A 1UM5L 1SMAA 4HUKB 4S10A 1UADC 1MRCL 4M7KL 1MQKH 2CGRH 4JM2F 3EW3B 1H3PH 5JW3L 3MTRA 1NEZA 2YHGA 3IDJA 5JW5A 1OP9A 4JKMA 4ZUUB 4G5ZL 3FOMA 1HSBA 1YEIL 3BP4B 1JI2A 4YHMH 5DFTA 1WBZA 5A2IH 3VDAA 3AAZB 4S0SD 4KTDL 1NC2B 2H45A 4A6YB 4P2OD 1QEWB 4R96A 3UTQB 2IPUG 5T1KB 4POYA 2D2OA 1RK0A 3IU4H 5D7KE 3VD9A 4GW1B 3RY5A 2ZJSL 3VG9B 5KSAB 5DDHB 5ERWA 2Y5TA 2ICWJ 1EMTH 5GGUA 3H9HB 5I8KH 1DTUA 1MCHA 4IMLB 4YK4C 1JWUB 4WFFE 4RISL 3VWJA 2BNRB 1BOYA 3KXFA 4OZFB 5HTSA 3FFCE 4XAWL 1MHPH 4HUWB 5F88A 3HRPA 3Q3GB 4HUXB 1JK8B 3D5OF 1Z5LB 2BY0A 3HS0B 5EC2B 4HQQL 1HK6A 4HPYL 2OS7A 4GMSH 5BQ7A 1QRND 2EDTA 1TITA 3MNZA 1YEGH 5ADPH 2DQIH 1E6OL 4LRNH 2R9HD 1N64L 4JFFD 3HZVA 1EK3A 4LAQL 4YGVA 4QRRB 3RAJH 4O02L 4RGOH 3BUYB 3HCVA 3DIFB 1QSFB 4ZO9A 4PB0L 4G7VL 4RMVA 2AEQH 5FM4A 4N5UA 5DEGB 2D7MA 3IDXH 1AO7D 1QKZH 4NRZB 2V17H 1T7ZA 3V5HA 5CJXA 5FYKD 3HPLB 2AI0L 2ZSVB 2VO5A 4JN1H 3OJDB 4HS6A 4MB5A 1UQSA 4QXGL 3TJHD 4FP8L 1MAMH 5F3HA 4DVBB 4Z7VA 4LCUA 1MCKA 3UTSD 4O2FB 3LKNB 5SWSA 5ICYB 3DX9A 1T0PB 3EYFA 3LN4B 4AQ1B 1EHLL 1A1OB 4XPAL 3BP6A 3BPLC 5DEFB 1FZKA 3RWIA 3P4MA 2DLEA 1MLCA 4IOFC 3V8CA 4XNMA 4P5KA 2V5TA 3NBNA 3ROOA 5L8JB 3VRJA 1SBSH 1MFBH 4JY6B 2VWEC 3UDWC 4LF3B 4F2MA 3K46A 4HFWA 4LEXL 2DM3A 2HTKC 3VI3F 5EUOA 3CFDB 2CUHA 2CK0H 3B9KA 5E1AB 2DQEL 2DI8A 3QEUB 4IIQB 5ADOL 1WIOA 5TDPB 3FT2A 4XCNA 5IKCB 4EUPG 4KKAD 3ZKQD 3V0VA 3QCUL 3JSSA 2W9EH 3DV6A 5FYJH 4ELMF 3SHSA 1MRFL 2QHRL 1QNZH 5DVMA 5C70A 3WKML 3QP3A 2NY4C 4G3YH 4OUOA 2VDPH 5I1LA 5D7IA 1XF3A 1GPOL 3AREC 3KDMA 4H88H 4P46A 4FN0A 4HLJA 5ABDE 15C8L 4JPIA 4X0KA 1A22B 5I1JH 1NL0H 2ZSWB 5D70L 5T3ZH 4NN7B 5I16A 4B50A 3QXWA 4X6EB 3CH1B 4LARH 5DO2D 1KJ2A 4DAGL 3BIKA 4NZRL 1T1ZB 3RVTD 3MLXH 2AJ3A 1QSFD 2XWTB 2C3WA 1BIHA 4BFIB 1ACYL 3C5JA 2B1HL 3BVNA 1CWVA 2BSSA 4U6XB 4CJ0A 3TBSB 5HVWA 5C7XL 4NJAL 1T4KB 4R0LA 2BDNH 2VXQL 2JF1A 4Q6IA 3OJ2C 1JZ3A 1JHTB 4QRPA 3TBYB 3VXPA 4OI8A 1AGDA 3S4SB 3ULUL 3GSOB 1JZ4A 2CQVA 4Z5RB 3T0EA 3KPLB 4KJYB 1J11A 3FOLA 4GRLC 3OAZK 3U0PA 5DJ8B 1RUQL 1JZ5A 4U1JB 3K2UL 4AIZA 5L6YH 1X5GA 3LS4L 1I8KA 3LB6C 4OLVL 3WDIA 3A6CL 4NNYB 2QLVB 4ZPVB 1F5WA 2XNAB 2AJZA 4OZIA 4PJBB 1R5WB 5GRVK 3L5HA 1A64A 3O81A 1A1MB 2Q86B 4ODUB 1S9KC 2VLME 5DUPL 2AK4B 5JOFB 1ZA6A 3FO2A 5IM7A 1XGYH 5CGYD 3M45A 1RUPL 2OTUB 4OSUL 1U8KA 4U1NB 1NLBH 3CFEB 4DOHB 2DD8H 3EO1A 1OT2A 4K3EH 3OTTA 1WWAX 5IOPA 2OZ4A 1F3DH 2Q1EA 1OAYH 4J3WA 1G7LB 3Q6GL 1KEML 5DMGC 1QBMH 3IJYA 4XBPB 2A6KA 2FX7H 1E4XI 3GHEH 1UJ3A 1C5BL 8FABA 4N8CH 3QUZA 2I9TB 3SDAB 2AGJH 5B21A 5DMKB 1BQHB 3RU8L 2FBJH 1WZKA 1HHHB 3FHQA 4H8WL 4TNWF 3JXAA 3HG1E 5GJSH 1UM5H 4I2XE 4D2NA 1QO3B 2H2SD 1DVFC 3UTTB 4M7KH 1IQWL 1TFHA 4EI5D 3T2QA 2BVTA 2PUQT 4MDJA 1LO3H 3VXRE 2DIJA 4RMQA 1KTDB 4Z7VF 1MVUB 5GS1B 1M05A 4QEGA 5MEPA 4J4PC 3NCYS 4KUZH 2WUCL 4HXBL 5LCVH 4PRHB 1OCWH 5J6GB 1F4AA 2VJXA 5E9DD 4JO1L 1S7XB 1NC4B 4QHKJ 1AC0A 1Q9KB 1U95B 5IBUB 4WWKC 5I66B 1YA5A 3MRPA 5CEZD 3L7FA 2IG2H 5JOPD 5HGHB 3T3MF 4OLXH 1LGVA 4PBVC 1DQJB 2G75A 1WC7A 5CEYA 5DURD 3C2AL 3ARUA 4W4NA 5FM5O 4ZFOB 1H15B 4AM0B 2CXKA 4HQQH 1A14L 1U8LB 4HPYH 3HLAB 1BD2A 3E8UL 2DWDB 1KG0B 4DUXA 4TULL 2O5ZH 3VFRA 2GHWB 5MENE 1N64H 3DSFH 3MJ9A 4DTGL 4D94A 1V3JA 4LAQH 4Z9KB 3P77A 3PWLB 3VA2C 3LDBC 3QXAB 4XI5D 5D7IF 4G8GB 2AJXL 1DUZB 5D1QB 4U1LA 3BWUC 4ZAKC 4HT1L 1CIUA 4Q74A 5FIEA 2OI9B 4MNQD 4GAJL 3MRRA 3MMEB 4FP8H 1ZLVH 4ERSH 2HJKA 5C0ND 2K3TA 3PWNB 2OL3L 3HMXH 3DUUA 1KCVL 4HH9A 3SDAD 1EO8H 1H3TA 3HRZB 1F58L 3B43A 1GIGL 4YHLH 4F33B 5JQHC 2J88L 2I9LA 2FSEA 5IESH 5L9DL 5HHMD 2EDXA 4GAGL 4PFEA 4ETYA 1VSCA 4XX1E 4YHKL 2DL9A 5JXAH 4PJXE 2DQEH 5F21B 2Z31C 4AT6B 1EGJH 2A74B 3QSKB 5F7EL 2WBJD 4NQXA 3QFDB 1S5IH 4U2YA 4PRHD 3QEQE 1YYLL 1UH4A 1FZOB 3T0DA 3QEHA 3RDTA 3MV9A 4G9FA 5I1KL 3UYRL 4Z76A 5IV2B 4OZIF 1ZTXL 4HIIA 5IG7B 1U58A 3MA7B 1LEKA 4P2QE 3O6FC 4U6TA 5JIPA 4NC1E 3V6FA 1UH2A 3BPCA 4WFEE 5FYJD 1DE4B 1GPOH 3FMGH 5I1GH 5E70A 2XFXA 3SKUD 3LY6A 3MRLB 4HSQA 2QR0A 4Q6YA 5T1DL 2HKFL 1ZWIB 2DKUA 3MNVA 1FNEB 1QPPA 3T3PF 5D70H 2RIKA 1QFPA 1LK2A 1MHCA 4S1DD 4PJ9B 2R2EA 3RI5F 5EN2A 1BVKB 4AJ0A 3ARVA 2PN5A 4IOIB 3MOAH 1BQUA 4Z8FH 4PG9B 5T3ZD 2GIYA 5D1QD 3TVMA 1ES0B 3SGKC 2ZUQC 1KTLA 1HHGB 4LLWA 2EH7L 5ACLA 2FJHB 4V2BA 3T08A 1HQ4B 4ONGH 5JIKA 3SDXA 43CAA 1J9CT 1R3IL 4J3SA 3BGFB 4O2EB 2CUIA 5EU3B 1QR1A 1I1AA 1NCDH 4RAVA 2YXMA 5ENWA 4M1GL 2DKMA 2IQ9H 5HYJA 3EO0A 5CBEB 3HB3C 3LQMA 5ID1A 2FDBP 1RJCA 2VR4A 1LK3L 1A9BB 4HUUA 4F80A 4HDIB 1RIHH 3H3BC 4TQEL 1MI5D 5DR5H 5CGMA 3EOTH 4S1RL 4L9DA 3AMLA 1CFNB 4QTIL 3ULVH 1DR9A 4XP6H 1URLA 4DW2L 4I18A 3N9GL 2QSVA 4OZGA 1U6AL 1KIQB 1ZAGA 3U9UB 2V7HB 1KJVA 3KPRE 4FNLH 5MI0B 4HS3B 4OIBA 5C8JB 3VFSA 3VRIA 4K23H 4Z78A 1YJDC 3B6SA 1AR2A 3H3PL 4PJIF 1T89A 2VAAA 5DZNA 1GL4B 1W72H 2VLRB 5EUKA 1TZHB 1IEBB 2EIDA 3GGWB 3TWCH 4M5YH 1C5BH 3L7EA 1BOGB 2XN9D 3IB4A 1K4CA 2HFGH 3S34L 1G7MA 2CH8A 1IFHL 1OAQL 4WW1A 3KLSA 2NQCA 3QZWA 1CQYA 4JR9L 4ZNEA 2BVPB 4B7IA 5DD5H 4HHAA 2P8MA 1RJLA 2HT4D 3E2HC 3P30H 1CE1L 4JQVA 5IBLD 5CHNB 3CLEH 3BO8B 2O26U 5EB9A 4G7YL 2AJVH 3ZYIA 1F02I 2FYYB 4O2CB 4ENEC 2HJLA 1KF9B 5BZDB 4NZJA 2JE8A 4XP5L 4XC3H 5TDNB 1C5DB 3S97C 5JW4M 4WI2A 3QPQD 1OGAB 5C09A 5D5MB 1A4KB 4ZYKB 1FIGH 4PY7B 3QCVH 4X6FA 1HHJA 4P23D 4C4KT 5MERB 2BX5A 1ZT1B 2F53B 3BKMH 1OWRM 5EZIH 4ZFZB 2NX5B 3O2DL 5KZCD 3MV7E 2D4FA 3EDKA 4BA8A 2BRQA 3TCXA 3U6RB 1BJMA 3D18B 5FO7A 3AS0A 4Y4KC 1FL3A 2MKWA 3L3OA 3ARDB 2GW5A 4NKMB 1ADQH 5HJ3A 3TH3T 3O3AB 1VHPA 1IGCH 3ZYZA 5L2KE 4F7TB 5CEXB 2RCSL 5C0AB 4DN3L 2OK0H 1FLTX 5D1XC 1XCTA 5DJCB 4DUWA 1I1YA 1R0AL 5HI5D 3ZKXB 3RWDB 2GJ6D 1AXIB 3MROB 2OP4L 4OAWB 2IPKB 4Z7UA 4R8WL 1BPVA 2AV1A 3JV0A 1HZHL 5JHLH 3JTSB 2ITCB 1YPZA 2X4QB 3CH8A 1CDJA 4OQ1A 4YHNB 2VLRD 3NH7L 3GB7A 1EEZB 2FD6L 4JY5H 5I1IL 5GZOD 4PRIE 4HCRA 3GMNA 1G1CA 1KCVH 1MJUH 4JFXB 4EUPB 3KPOB 1CFSA 5HY9B 2YA2A 2DM2A 5IEKA 1GIGH 4NO2B 4KKNA 2CKBA 1C12A 3QUXA 2E7BA 1T7WA 3SDXF 5I6XB 4CAGA 1JGEB 3MRDA 2C1PB 4LCWE 4U6HA 4P57B 1QA9B 3C5ZB 4RGMC 5L9DH 5B39A 3M17B 4GAGH 4PP1C 1OB1A 2ITDB 3ARGA 4NO0B 2UWEE 3D3VB 4KI5E 1S5HA 5I73B 4NRYB 5DQ9B 3VFGL 3LZFH 2X7LB 3H9SB 1GGYA 1TTUA 3EGSB 1HXYA 5C0CE 4YHYC 2KDGA 1VADB 5DJYB 5DQDL 2FR4A 2E7HA 4DKAA 1OY3B 1A9EB 3BKCL 4Y2OA 2GCYA 1MJ7L 4AH2B 4YPJA 1JNLH 1J0HA 2NX5D 5EULV 4K94H 4OZGF 1U8IB 2W92A 1W72B 4R90L 4XNQA 4KJQC 3CFBA 3K2MC 2EYTB 3MJ6A 5EOCL 5IVZB 1UB5B 1CDYA 4Q9CA 1VCAA 1OOAA 4YUEH 4JFPA 3FONA 5HHVH 1ETZB 1HQRA 1LWRA 3TN0B 1IGMH 4RGNC 1ZSDB 1YN7A 1MF2L 3FN3A 5FCSH 1BBDL 4LPTA 3EDJA 3ALWA 3BQUD 3OB0K 4QO1A 4X98B 1R3HB 1S9YA 4CRPA 3N1FC 4J3OC 1PJ9A 2X4OA 1T5XB 4TSAL 3G9VA 4UIKL 2HT3D 5FOBB 2BSTA 4UNUA 4P2RD 2YWYA 5KAQG 3HTLX 1KSRA 4TVPL 1MIML 5F6IB 3S7GA 1A4JB 3OR6B 5C07E 1FHGA 3DX8B 3RWEA 1G7HB 1SYVA 2FHBA 4BUHA 3VE0B 2XG5A 3QHFL 1X44A 4QOKE 3S96A 3ULUD 1RJYB 2Z8WC 1DL7H 3C6LC 3HNVL 5EBMA 3KPSA 3C5ZD 1KYOJ 2VZ1A 5EBGA 1EERB 1KPRA 2LTQB 4QXTA 5BV7L 1CL7I 3MGOB 1E4XL 3D3VD 5EOQH 4DW2H 1QLFB 1W0WA 2P5WB 1U6AH 3H9SD 3VXMD 1YN6A 2ESVB 3FO0L 1MCWM 3GK8L 4EN3D 3VFNB 3RKDC 4YE4H 3OR7B 1KJMB 1PLGL 4HV8A 4F9LA 3ZDXE 3SEPA 1U92B 1ZVSB 1KPUA 5I1DA 4JZNB 3WHXA 3E0GA 4PJFB 4DCQB 3TO4A 5C3TA 1IFHH 2LU7A 3LAFA 5ALBH 3H6JA 3PHQA 3E6FA 4M5ZL 3B83A 3KYOB 4Z7UF 5E4EB 4LNRB 3PDOB 2G5BB 4LVOC 4LGRB 5JQ6L 4F7EB 2B1AL 4APQB 3V4UL 1S8DA 3MUZ1 3EJYD 4QHLB 3QPXL 4KRLB 2PO6C 1CE1H 1OTTD 3FQTA 3KWWB 5IW1B 5B8CC 3QNZA 4FTVB 1EH9A 4FQ2L 4Y19B 3TN0D 3GKWL 1N4XH 4G6AC 2XOTA 3F58L 4N0FB 4PV8B 3TA3C 1L6ZA 4DZ8A 5ESQB 1NAMA 3FFCA 4WHYH 3RNQA 3RL2B 3B4NA 3CSPA 1Z0NA 4F9PA 3O3UN 4PGEA 1FG2A 4D3CL 1JGDB 4F58L 1DEDA 2KBGA 3B2VL 2YPVL 5DGRA 2NXZC 4XMPL 5EU4A 3WFBH 4JDVA 1JZ8A 1X5HA 2D9CA 1I8LA 5BO1H 1K5NA 3WXWL 5C2BL 3G5XB 3V6OC 4JGJA 5C0RL 3CZFB 3MJGX 4JJHA 1AE6H 3T2NH 1YMMD 2GK0B 2I26N 2IC2A 4ZMAT 1UEMA 3ZT5A 3VRLE 3MLVL 3H42L 2P5WD 3O4LE 1KNOB 3I6LE 2ESVD 1T21A 3V9FA 1N5AA 1MCCA 2VISA 4R97B 4MX7A 4OM1L 3IJHB 5I0ZA 1DDHB 5CAYB 5FOJA 4POUB 4MYWB 3IFPB 5JHDE 5J0BA 1JTPA 2PYEB 4L8DA 2XQYK 1J8HE 3ARFA 3GM8A 1DBJH 2DDQL 3MBEA 4XRCB 2WINB 1IEAB 2ADJA 4WI9A 5D7SL 4GBXB 3IAPA 4KC3B 1EZVY 4WFHD 5CILH 4ZUTB 4X80L 4Y1AD 5DD6B 4JKKA 1WFTA 2GKIA 4APQD 2FH8A 5E8PA 1TCRA 3P0VH 4KQ4H 4QNPE 2UYLA 3IS0X 2J8HA 1NUDA 3F7VB 4GS7B 1JPFB 1P1ZA 3VFGH 2JJTA 4QKXB 4YHIB 5F7DB 2P5EB 4ZSOE 3VH8A 1U3HB 3OG4B 5KJRL 4MJIB 3MUHL 1MHEA 3CDGA 1P7KA 4JDTL 4KHXL 4P9MH 4PRPD 3T77B 3PUCA 4AEFA 1UXSB 4CU8A 4J6RH 1OAZH 4OV5A 4N0YL 3IGAB 2YPLD 4FMFA 4KUCD 2BERA 2WW8A 3VXOB 2A83B 5EOCH 4PJHE 4OUUB 2HFFA 4KKCC 5M94B 4HC1H 3D25B 1WTLA 5E94A 1UEYA 1BVZA 4QY8A 4DWHA 3MV01 4I77H 5D2NB 5F3BB 3OHXB 5FV2A 3S35X 2EECA 3GSXA 2ZG1A 3ARBC 4OD3L 4X4YB 2GAZA 5CSGA 3KLAA 2L4OA 3D9AL 4RIRA 3C8HA 1KB9K 2CPCA 3OX8B 4UIKH 1U8MB 4NSKB 4AIXA 1VFUA 1VEOA 3BPLB 3EYOA 2P7TB 4TVPH 4MAYD 4RRPG 4WV1A 3UP1A 4JQXC 3MNWA 4PREA 2PYED 4NQVA 1F3DJ 1A6PA 3D2UD 1BQSA 1CBVL 1P4IH 1BHGA 5IEHB 1GC1C 2X40A 1QZ1A 4LSQL 2H9GA 3L3IB 2IH3B 4OJFH 2ADGB 4GBXD 3ZMRA 5ICZB 1NEZG 3ILQD 5HPMB 3OJVC 1LQSR 3HC3L 1D7FA 3GRWH 3Q1SH 1JF1A 4M3KB 4TTDD 4KK9D 5E08L 4HGWA 3W2DL 1JFQL 2D7TL 5C9JA 1JNJA 5D1ZA 4OF8A 3GMQB 3T8XB 2NY1B 2K7QA 2X4PA 3QUYC 1I85C 4PGDA 4Y4FA 1MJJB 3RGVA 3BPOB 3HG1A 1U3HD 4I2XA 4MJID 3WLWD 1U8JA 1CDCA 4CJ1A 3D85B 4MA7L 3MRMB 3VXRA 3ULSA 5JXEC 1NGPL 3AREB 1EDQA 1KLGA 2YR3A 5LGHL 4OM0H 4AZ8A 5I75C 3JV6A 3QWRA 4LLDA 1A6ZB 5C0EB 4M5ZH 3RA7L 3VXTB 4NQDB 5FKAA 5I8OL 3RWFB 4WGVB 2MQCA 1KENH 3SO3B 3PIQB 1JTTA 3RWCB 4RWYL 5DD0H 3GKWH 1C8PA 3SCMD 4WEMB 1I1AC 4XBEL 3U2SB 1NFIA 2ARWA 1IC1A 3EYVB 3QG6B 5TPWH 5CD5C 3I6GA 1OSPH 5GQBA 5JW4R 5TE4L 3U0TB 2DQUL 1PKOA 1V8HA 2KKQA 1RZFL 4HBQA 3GUTA 4H0IA 1YMHA 3R8BB 3R0MA 4GRLB 5E2TL 4YLQT 1KN4L 3O9WC 4Z77A 5MENA 3C60C 1G6VK 3RVVD 2VABA 5IMLA 3OB0H 5FGRA 1A7OL 3HMWL 3T4AA 5HYQA 4CUCA 1LDPH 1W0VA 2VB5A 1L9MA 3BP5A 2X44D 4ONFL 5FF6B 1IC4H 3FT4B 4H26A 2VLKB 4C59B 3MLTB 3PWJA 1BFTA 3RVWC 3RBSA 4AENB 4GMTL 2VDQH 4WI5A 3MLVH 5DXWA 4MNHA 2NY1D 4UTAL 1LMKA 1D6VL 4LLMB 4PR5A 5KVDH 3O2WL 3QIWC 4UV4H 2HVKB 5BRZB 3GSWB 1BM3L 2ZCKL 4Q97A 4PGBA 1P9MA 1W8OA 5J9PA 1L4IA 3CUPA 1DVFB 1Q72L 4PJXA 5HHXL 5SX4I 5JMRA 2A77L 4GRWE 4QHUA 1AD9B 1TVBA 4HIHA 4Y2DD 4C56E 2I24N 3QEQA 4N68A 3H3KA 1I7ZB 5FK9B 5HGBA 3UJJH 1TJGH 2DQHL 3P4OA 2AEPH 3IAGC 2Z35A 5CD3A 2EDOA 3HI5H 4XCCH 3AROA 1U36A 1JTOA 1FVCB 1AGBB 1JWSB 4P2QA 5GGSA 1IC5H 2C3GA 2PKDA 3D87B 3O3DB 4FXLA 4NO3B 1H0DB 4WWKB 4DEPC 4X4XA 2C5DC 3R0NA 5BV7B 1CD1A 2JB5H 1HXMB 1OARH 5L7XH 5IB2A 4ZXBC 5IP4A 4KPHL 1EEQA 5F8QC 5AAMA 3MSPA 4FQXA 2NY5L 2D7OA 4L4VB 4LSVL 3STBA 1CDHA 1CF8H 1WFUA 1B0WA 1NDMB 4X9BA 4R7DB 5I71C 3HKFA 3PWUB 3DRQA 5DMJB 3HZMB 4JAMB 2QSQA 4PTUB 4ZAKB 4I13B 4BH8B 4YFLI 5FECA 4H5SA 2Y36L 4Y16C 5GJTL 1JPGA 4WI8A 5SX5H 1WTGT 4KZEL 4LSRL 4EQ2A 1VFAA 3STLB 1YQ2A 5DS8B 2F5AL 5KVMC 2X1XR 3BKJL 3UX9B 2NY2C 1D5BA 5TQ0L 1C1EL 1FIEA 1RAMA 1JE6A 1NCWL 1FG9C 1FN4B 3F7YA 5AG8A 1FH5L 3QJFB 5HSFA 3CMGA 3KPRA 4I5BB 5F9JB 1SEBB 3HC0A 4ELKA 4TVPD 1MFAL 4WEBH 3SE4C 2CJUH 2Z31B 1H8SA 3ARXA 2ZG2A 4NWTL 5DA4A 5DLML 2DL2A 2RR3A 2VERN 3W2DH 2D7TH 3RY4A 1H3WM 4M6OL 2EIZB 35C8L 5CJOL 1TZGL 4GXVH 3X12A 2XKUA 5D6DC 3OKEB 3ZZ1A 3UPAA 1IGJB 2NZ9C 2DBLL 3M1BA 2WIMA 4X6CB 4YH6A 3LHPL 3VWKC 1M7XA 1ZHLA 4EDWH 5J13C 4H25B 1I1FB 3EOYG 4OZ4B 4M61A 5TE7L 1ZLUH 2CDEA 2YD8A 4K3DH 3HUJB 3OKKA 3OZ9H 1U42A 1MHHB 3V2AR 4L4VD 3RA7H 4IJ3C 3MA9L 2ZUYA 3GKZA 3B3IA 4TSCH 5JUEL 2F5BL 1FVDA 3R06B 1I4FB 4UNTA 1PYWB 3BXNB 5IJKC 4XH2A 1UCBH 1JHLL 3F7QA 2ZUQB 3QDHA 2VIRB 5SWQB 1S78D 4PJXF 2Q7YB 1RFDL 3MV7A 2EZ0D 3QI9A 2Z91A 5TE4H 1AJ7H 2BNUB 2DQUH 1TNNA 2WQRA 1KT2B 4S0TD 1VGEH 3IS1X 3MXVL 3V0WH 4NNXB 3ALXA 2FZ3A 5I2IB 3VFWA 5E2TH 3S9DB 5L2KA 5FYLH 5B38G 5LQBL 2D3VA 1S9XA 5HDQL 4S2SA 4TPRH 1YEHL 3W9DB 4FFWD 4PV9A 1A7OH 2VL5B 3VFOB 1NAKH 2AEIT 1IAOB 4OFPA 3U4EB 1D5ZB 1P7QB 5IWLC 2QKIB 5I74B 1CXHA 1IC7L 4KTYA 4JHBA 4ONFH 4ORGA 4NYLB 3O6KH 3X14A 4YX2H 5BS0B 4PJAA 5GGVY 4LIQE 3BOVA 2FX9L 2BVEA 4JG1L 3IDUA 5AYUL 3BEWA 3U7WL