3NP3A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 38
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np3A00
2GI0A 1L9PA 3CVBA 4HAKA 1WAEA 3WKPA 4YSCA 1ZIBA 1NINA 2HX8A 5B7EA 2J55A 4G7SB 1ADWA 1SF5A 1AS8A 2BWDA 1FWXA 1N70A 2RACA 1ETJA 3AZUA 2CBPA 2VW6A 3NSFA 1W6WA 3NJJA 4G70B 1CYXA 5AZUA 4DP1X 1JZIA 1NPJA 2YQBA 4M3HA 3ZBMA 1HAWA 2YAFA 2XLLA 4HCFA 2Y69B 3GYRA 3T6XA 3FPXA 1AR1B 1UATA 2VW7A 4E9SA 5FC9A 3CVCA 2UXVA 5I6PA 1WA0X 1F56A 2XUWA 2PPCA 5I6OA 2EIJB 1BQ5A 1MZYA 5D4HA 3NP4A 2OV0A 2XU9A 2DWTA 3FU7B 4NAJA 2YXWA 1KCWA 3WNJA 1DYZA 1MZZA 4KNSA 3TU6A 4DPBX 2FQEA 3FSAA 5I5JA 3QJVB 4YL4A 2CJ3A 3FQYA 1JZHA 1JXFA 5IY5B 3OMIB 1ET7A 1NICA 3H56A 3OM3B 1PNCA 1GSKA 1TU2A 1E67A 4X4KA 4E9WA 4DP5X 1GS8A 4G7QB 1NWPA 9PCYA 2A3TA 3ABMB 3PAUA 1SDDB 2AZUA 3OMNB 3NSYA 2XV2A 4E9YA 1CYWA 2GSMB 4YSAA 3MBWB 1AZRA 2AANA 4A2FA 2BW5A 2HXAA 1PLCA 2IWEA 2JKWA 1SNRA 3GDCA 1V55B 1L9QA 1SF3A 4MFHA 3ABLB 4G7RB 1J9QA 2IDUA 2R7EB 3X2QB 1X9UA 1J5DA 2I85A 1GW0A 4FAAB 3WIAA 1W6LA 5PAZA 1A65A 3NJNA 3FS9A 1AIZA 4P5SA 3T9WA 4AZUA 2J5WA 1CUOA 2FWLB 3FPYA 2VN3A 4KO9A 1ASOA 7PAZA 1A8ZA 1OCOB 4A66A 3ZX1A 1R1CA 3EF4A 3ZDWA 4YSOA 4BXVA 1OCRB 2B08A 1ILSA 2FJSA 3FSWA 1TEFA 5B1AB 4A2HA 3QJSB 5AKRA 3IBOA 4GYBA 1T5KA 3WI9A 3FQ2A 3SQRA 4NERA 4YVUA 2DV6A 2JFCA 2FQDA 1MG2C 3PLYA 3ABGA 4E9RA 3S3DB 2I7SA 4M4RB 2IDQA 3FSZA 4HCIA 4GP4B 2J56A 4E9XA 3JTBA 1NIAA 1AQ8A 4AI7A 3S8GB 1AZBA 2YXVA 4E9VA 1ET5A 2AZAA 8PAZA 4L0PB 3S3BB 3IN0A 5TK2A 1PAZA 2ZWNA 1PZAA 4N4YB 1OE2A 3IEAA 2EINB 1J5CA 1NIDA 4K9JA 1OF0A 3FU7A 2AVFA 3S8FB 1ZDSA 3X1FA 2DYRB 3CZUB 5PCYA 4DP7X 5I6KA 3UGEA 4JHVA 1AANA 3T6ZA 4E9QA 1GY1A 4PCYA 5B1JC 1SFHA 3EH5B 2FQFA 2TSBA 3UABA 5D4JA 3AY2A 4F2EA 3G5WA 5F7AA 1MG3C 3TASA 1HFUA 2NRDA 1V10A 1IBZA 2QDWA 3KW7A 3RYMA 3X1BA 1XB8A 2IH8A 1VLXA 2PCFA 3QJTB 3PAVA 4CSZA 3NJLA 4KO5A 3NJGA 1E30A 4JKNA 5B7MA 4AKOA 3V9CA 1L9SA 3NJFA 2IAAC 1BQKA 3NYKA 1KYAA 1E5ZA 1MDAA 1WA1X 1A4AA 1PNDA 4ENZA 3WKQA 2YAQA 3NP3A 5I5IA 1CURA 4ZK8A 2BP8A 3UADA 1BXUA 5B7FA 2DYSB 3SBPA 3AG3B 1RKRA 4DPCX 2IWFA 2BZCA 4HALA 5TK4A 2R7EA 3WG7B 5B3SB 3GXUB 3CVDA 3PAZA 5E9NA 2B3IA 4KNUA 1TKWA 4FA7B 1GY2A 1RCYA 4NB7A 2LLNA 1PLBA 3JT2A 1NPNA 2H3XC 2UX7A 2WO2B 1V54B 3NJHA 5D4IA 4QKTA 1SDDA 1JVOA 1PMYA 1QNIA 2PCYA 2Q9OA 4E9TA 2CCWA 5A7EA 4Q8BA 2DWSA 2HLEB 4HHWA 3UAEA 1JERA 2X87A 1XB3A 1PZCA 3N55A 2H47C 2P80D 4KO7A 1AZCA 2GC4C 4QLWA 2EIMB 2HRGA 4W9ZA 2XXGA 3X1EA 4DP9X 1EHKB 2BP8B 1KBVA 2YAHA 7PCYA 4W1TA 1N68A 2YAOA 2YAEA 3NJKA 4BDVB 3NSDA 3NJIA 1KDJA 4HZ1A 1KCBA 3AG2B 1FFTB 4BDVA 5B1JA 1ZIAA 1JZJA 2MTAA 1E65A 2FT8A 1OOWA 3OMAB 1QHQA 3NT0A 3MX0B 3X1GA 2Q5BA 4GP8B 3ASNB 4KNTA 2HZHA 1AACA 4BWTA 5I5MA 1OV8A 2BW4A 3DTUB 1RZPA 5AFAA 3KW8A 4YSTA 4GP5B 1J9RA 3EH4B 1BYOA 2XV0A 2JXMA 3OD3A 2OCCB 3ERXA 3AW5A 4Q89A 1B3IA 4UAHA 3PPSA 1DZ0A 4JHUA 5LDUA 1AS7A 2P80A 1BXAA 1AS6A 1M57B 4A68A 4YSUA 1AG0A 1JZFA 3HB3B 1M56B 1XMEB 3V9EA 4P5RA 1L9RA 4KOBA 3WNIA 1E5YA 4RH4A 2CALA 3NSCA 2IWKA 4YSPA 4HCGA 1JXDA 1AOZA 1ID2A 1KBWA 1JXGA 2W88A 4PAZA 1OCZB 2DY2A 4GY4A 1JZGA 3PCYA 3DIVA 4DP2X 3FT0A 4DPAX 2VM3A 1GYCA 2UXFA 1ZPUA 1PF3A 2FT7A 3EHBB 5I26A 5I6NA 1AZNA 5EHFA 4G72B 4UANA 4WTQA 1SFDA 3UACA 2PPDA 1W8EA 1J9SA 2H5UA 4YSRA 1NTDA 5ANHA 2IDFA 2FQGA 4YVNA 1A4BA 2VMJA 1NDTA 1NIEA 3T71A 3U25A 1GS6X 1NIBA 2HX7A 2QPEB 3AG1B 2UXTA 2OJ1A 2XVBA 3D12B 2IDSA 1SHWA 4WKXA 1PZBA 1YLBB 2CAKA 4N8UA 2BO0A 1KGYE 2J57A 2ZOOA 3CDZB 2WO3B 4BK5C 4YSDA 1BQRA 1X9RA 3DKHA 3ZIYA 2UXGA 3CG8A 3S3CB 2CUAA 1RZQA 1PLAA 1J9TA 3FU9A 4AKQA 2UX6A 2YAPA 2IH9A 3AG4B 3BQVA 4F2FA 5I28A 1AG6A 4UF7C 2HRHA 2YAMA 1XB6A 1JVLA 1EZLA 2XXFA 1PCSA 2PP8A 1ILUA 2VM4A 2VSMB 2QPDB 1KDIA 4GXFA 4YSSA 4DP6X 3C75A 3PXLA 1NWOA 2QDVA 1SJMA 3FSVA 6PAZA 1IBYA 3OQRA 4BWUA 1A4CA 3SBRA 3FYEB 3QPKA 3QQXA 4BWWA 4AX3A 2I7OA 3H4FA 2PPFA 3UAAA 1GS7A 2GHZA 2VSKB 2BWIA 3TA4D 2QT6A 2MRYA 1WS7A 5B1BB 1CC3A 1JOIA 2YARA 3FQ1A 3TBBA 4KO6A 1M9WA 4KOCA 2EIKB 2BZ7A 2HX9A 6PCYA 4DP8X 4G71B 1OCCB 2N0MA 3L45A 1WS8A 4BXSV 1A3ZA 4HIPA 1BEXA 2GBAA 1ET8A 2AFNA 3CDZA 4CSPA 2PP9A 1BXVA 1WA2X 5F7BA 1ZDQA 4A2EA 1ASQA 4YSQA 3T6VA 2PP7A 4YSEA 2ZXWB 4A2GA 4F7KA 1IUZA 5I6LA 2GIMA 2FNWA 1PY0A 2E86A 1GR7A 1L9OA 1OE1A 2PLTA 1AAJA 4A2DA 3H4HA 1URIA 1BAWA 3EH3B 1FA4A 2BHFA 4HHGA 1I53A 1TEGA 2XX0A 2XYBA 1IKOP 2PPAA 2IDTA 3FYIB 3SBQA 2XWZA 1KV7A 2GB2A 2W8CA 4AKPA 1OE3A 2PPEA 3QJUB 2ZONA 1NIFA 3TBCA 3BVDB 2FTAA 1JZEA 1ZV2A 3ASOB 3NJMA 4DP0X 2Y1AA 2EILB 3IE9A 2X88A 1L9TA 2TSAA 3T6WA 3IN2A 1NZRA 1QLEB 1IC0A 4DP4X 3FU8A 1BYPA 3HEIB 1ASPA 1SHXA 5B1KA 4EF3A 3ABKB 2WSDA 3N2JA 4TXVB 2BP0A 2XV3A 3QJRB 3QJQB 4A67A 1HAUA 1AZUA 2VW4A 5I6MA 2GC7C 3X1NA 2FT6A 2XX1A 2BP0B
chains in the Genus database with same CATH superfamily
2GITB 4NUJB 1CLYH 4N0UE 4ANVA 2JXMB 5DFTA 3S8WA 1INDL 5DWPA 2VZOA 4PI0A 1WHPA 4R0LA 2X38A 5I0ZA 4GRLD 4OZHA 3L5XH 3UJJH 1RZKH 1CYXA 4DP1X 1I1YB 4WO4D 2GY7B 3UJTH 1QUNB 2X9WA 1AC6A 3A0OA 5HTSA 1VZHA 3ECQA 4PGBA 5IQ9B 4AK1A 1IGYA 4PP1C 4JRXB 3OKDA 1RZ8B 3ALPA 4Z78A 3KLAA 4M1GH 2XG5B 1RU9H 2R2EB 3X14B 3B9KA 4NP9A 3ZXAC 4AEIL 5D4HA 1HDMB 1T89A 4K94L 1G7JB 2L8AA 1XCXA 1CDBA 1ZVHA 3GNML 3VB9A 1SLXA 4XVJL 4RESB 3QEGL 3WNJA 1MZZA 1A5FL 3X3GH 4UT6L 4AMKL 3VXPB 3ECBA 5H37G 3SGEI 4Y2OA 3JV5A 3C2SA 3GRGA 2JI1A 2ZKHH 1SDYA 4M48L 3Q06A 2Z91B 4DP5X 4XCCL 1N18A 1YYLH 1I4FB 1PCXA 1AD0B 3HLAA 3EUDA 4DKEH 4E9YA 2ZKHL 2BSSB 3BKMH 1CYGA 3KWTA 3CVIH 3GRWH 5F44A 3BSGA 3CZFB 3P4MB 2K0RA 3DUUA 1DSWA 5GZND 3T6QC 1D2OA 4DKEL 4OVVA 3T77B 2Y22A 5CIPH 4AYID 1MWAB 3MACL 1DJSA 2OR9H 4FOMA 4RRPM 3BIKA 3QYNA 2AJUH 4WK4B 3HZYA 3KLHD 1CT8B 4FQIH 3WLBA 4FAAB 2O61B 3UDWA 5DJ0A 4FP8H 2XZAH 4KROC 2GIYA 4LO9A 3IMSA 5F97E 1AFVL 3LN4A 4FFWD 3D9AH 4OD1L 4D3CL 4TTDC 4S1QL 3NPSB 5FF6A 3A4AA 5FV1L 1FFRA 4WW1B 3ZL4L 2EABA 3FN3A 1FV1A 5BS0D 3KPLB 1TJHL 3LEVL 5D96C 4NM4L 4Q6IB 4HIEB 5CEYB 1VPOL 2IIJA 5ITFA 2R15A 1DP0A 1DQQA 3IBOA 1FVCB 4QKXB 5IMLB 1BFOB 3X14A 2VC2B 4LKXB 1BM3L 4YFDB 5IOPB 1U4FA 2VJ8A 3M7FB 4K4KA 4QMEA 5T5NF 1VKXB 2Q3ZA 4KV5E 2G5UA 2CLRA 3TFKD 2I7SA 3RJOA 3VWKB 4MNGE 4WWKA 2BSDA 2ITDA 2QPSA 12E8H 3H9SE 4N68A 2YD3A 2HP4A 3TIEA 5HDRA 2H4EA 3HUJA 3W0WB 1FYHB 3IT8D 5A16A 1HXYB 2YXVA 4CJ0A 1VADA 2OTPA 1IM3B 5EO1A 4HJUA 4ZYKA 4NPYA 5FO9B 4KX9A 3QWRD 1VADB 4NYLB 4ODBD 3MXVH 4C4KO 4YOKA 2VABA 2WD0A 4Z8FL 2RIKA 1QVOA 3T65B 4M6OL 5CU9A 4XI5C 1GY1A 1U3NA 1YY8A 4PLKD 2Y1YA 3U1QA 1ETB1 1QSVA 1NUGA 1E4XH 4XCEB 1LE9A 4JKMA 3F6LA 3NA9H 1A6PA 3SPVB 1X44A 1MG3C 3HPLA 4YBQD 1KGJA 1MJJA 2ZPKL 4QDGA 5DQDL 2W81C 1O9VA 1ZGLB 2A73A 2BVOB 1QQDB 1V10A 1IBZA 1U8MA 4NKOA 4GAFB 3H6AA 1P4BH 4Z18A 3FO2B 4XTRC 3WKMH 2H3NA 2G5BB 2W0FB 4Y2NA 1MOEA 4P2OD 3PV7A 3ZU8A 2NQCA 3UBGA 1TITA 4WEMB 4GFXA 3EDJA 1A4AA 4R5VA 2VCOA 4K73A 2HT2D 4QHLB 1F3RB 3DXAD 1CURA 1A9EB 1IGJA 1EFXA 1RKRA 2COQA 4DPCX 1PPIA 1WQVT 3F7YB 4MZ3A 4N0UB 2V4LA 3F7VB 3C08H 3CFNA 4FYTA 3AGVA 3BH4A 4WI3A 4M6OH 4WNSA 2EKSB 4YXHL 1O6VA 3BMWA 5C08D 4B5EA 2ZWSA 1WE5A 1SLUA 2EEDA 1XR9A 1PL3A 5GS2D 2MIZA 4P4KA 3P2BA 4X0KA 3OF6D 2IPTH 3M1CA 5IBLD 3WTTA 4J3OH 5D7SL 3AITA 1TJMA 4TRPL 1CDCA 4Y5YC 5ETUB 2X1QA 5K1VA 5SX4I 1JNNH 4P4KB 4YH6A 3I9IA 3WKML 1B4RA 3AS3A 2Q8AL 3WFCL 5FYKH 4NI6A 1JERA 2OYKA 2C4FU 4Z7QB 3QNYB 2CXGA 3RWJB 2HT4D 4QY8B 5I15H 2HWZH 3PABB 1ND0A 3M8OH 3O2VL 2LAGB 3CN3A 3S3PA 4KKBD 4ZW5A 1T2XA 2QSTA 2OBGA 5ILTH 2DI7A 3HB3D 2Q7YA 1EHKB 2EYSB 5ERWB 3WMQA 4R7XA 4C8XA 2AAVA 3CHRA 4HUMB 5D1QD 4IBUA 2NXZD 4UQ2B 5B1JA 4XAWH 1S3RA 3BGAA 3MKGA 4MAUL 3FF7A 3DROB 2XY1A 3TC9A 4IU3A 1E9PA 5JXEA 4PCSA 2H8PA 3RL1A 3U9UA 1PSKH 5D8JL 3V5KA 5TPWL 2E7LA 1EGJH 2ZUTA 1D9KC 5GSVA 5F9DC 1J9RA 1BBJB 4TSBH 3D39D 5DHYA 4WEEA 3IJ9A 4DN3H 3VQMA 4URKA 2D4FA 4MAYA 4PJ5D 3HFML 4NDMA 4UV7L 1J5OH 1S78C 1AXSB 1BXAA 2NY0C 1ZE3C 1V7NL 3ARBB 3KXFA 4U7MA 4EUPA 3O6LH 3QG7H 2YO3A 2Z91A 4K3JL 1S7XB 4P5RA 1CIUA 3VI3F 2J1XA 5C0NC 4MD4B 3J8F7 4WAFA 1VESA 1ZOXA 4ODUB 4D9RE 1AOZA 4ODSH 2B5IC 4M5ZL 4A55A 1XL6A 2V33A 3UG4A 2FHCA 3GBML 4YNYB 5HDBE 1SY6A 1UXWA 4JUSA 4KVNL 5DU7A 1PF3A 1UM6H 2ZYRA 3A6BH 4IBZA 1HOEA 3ABZA 5JHDB 5AB2A 1BPVA 5D8JH 4NCC2 5KVDL 2ZP8A 4UOZA 5D70H 1HX0A 5EH1A 1OPGL 5DYFA 4Z7IA 1SEBB 3O45B 2P24A 1MCOL 3N1MC 4L4VE 5BMFL 4Y4FD 2H5UA 4GQ9L 3WE6A 1OB1B 1XO8A 2E9GA 3VMNA 2W9LA 3L3DA 4WIQA 2P5WD 4O02A 2PR9A 3L54A 1FP5A 1AGBA 1AGCB 3BC9A 3PUUA 5FHBL 1PG7L 2BNQB 4ZG1A 2COVD 1OGAA 5AVXB 5F8QC 5DJZA 4GG6B 2V5SA 3QDGA 4KJQD 1NLBL 3PUCA 2HJKB 1QASA 5E6ID 1MCPL 1A66A 3IVKA 1NCIA 2NPLX 4WKXA 5DJ6A 4N90D 5BQ7B 4GG6A 5J12C 2KZWA 4W93A 2VLKA 4WQOA 2VKXA 3IDNB 3WDJA 5I0WA 3IDIB 2AXJA 4IBVA 3E6FA 5FFOA 2MOVA 1SMOA 4ISVA 4E41B 1ORQB 3QEHA 2B1HH 2UXGA 5DHVB 4AYGA 4Z7NB 3CG8A 1YN6B 3UL4A 3I3EA 3ULVF 1SXAA 1T22B 2A9AA 3DC0A 4V2CB 2YJLA 5AVWB 4JB9H 2FJHA 4A6YL 1SHSA 2GY5A 4LLMA 3FU9A 2ZOKA 3QXDB 4EI6A 4P4RB 4JMXA 2GJ6E 3MRHB 5EA0H 1AQMA 2FH8A 3RDTB 3ULVL 2J20A 3LS4H 4NLHA 4F9LA 1KIUB 2NYKA 3QYCA 3HG3A 4A6YH 1D2PA 1S3KL 5IW3A 5AEAA 1G87A 3RJQB 1GKOA 2A6JA 2LLLA 1HHIB 1ZHNA 2HFEB 4FE9A 2PP8A 1U95B 2CA3A 2E6QA 3BLBA 3ECBB 3PXHA 3ZKXC 1FL5A 4R7VA 2EDXA 1CWVA 4JQXA 3EGXA 4WU5A 4A1RA 2JF1A 4UIMB 4KI5C 4UU9B 2I07B 1EFXD 4HMCA 1K8IB 4LGRB 5T1DH 1LNUA 5E6YA 3ZW3A 2D7QA 2DMBA 2VH5H 1MHEA 1E4HA 1OAZL 4Y4KA 4O5LH 3LH2H 3BKYL 1R3LA 2OJEA 2J6EL 2ICCA 1BLIA 1S7QB 3GI9L 4QUOA 4GKOA 3W56A 5BS0B 2R39A 2QPUA 4ZUTB 3AADB 5LG6A 3SCMD 4GBXD 2JJSA 2BRQA 1CL7L 2EVHA 4JZJC 2ZCLL 4HH9A 1Y7VA 5TD4A 3C9NB 5HYJD 2R0ZL 3MN8A 2IGFH 3JWNH 1WA2X 4YDIL 4J1UA 4A2EA 2GITA 2A83A 3QIWA 3V9FA 2C9QA 2Y07H 3HE7B 4HXAH 2C26A 5LJYH 1ZLSH 4BFJA 1K2DA 4WFHD 4HUKB 5H8DA 1CLOL 1SY6H 2W9DH 3FQXA 2J1ZA 4QTIL 1P4IH 1G7HA 4XN9A 5E23A 3QWRA 4ZUWB 1BCIA 1IUZA 4XP9H 1QMUA 1NCDH 3BHBA 4JJ5B 4UQCA 3U83A 4AM0A 1NCTA 3FMGL 3LSOB 3MRPB 5EO1B 2JJVA 4KDTA 5DS8A 5IHHA 2XIIA 4HHGA 1I53A 3PE9A 1LK3L 1DBJL 3ZN6A 1JZDC 2PPAA 4J12A 5I8EA 1GCYA 1CPUA 1ZA6B 1M71A 4IMLA 4PJCA 4ANKA 2J2ZB 3GS4A 1G7MA 4KXCA 3LYRA 2P5EE 4O2CB 4RAVA 3UIYA 4AL8L 4H88H 1S9YA 2FZ3B 2Y2TA 3OKYA 5IEHA 4HGKC 1T04A 3KGRA 2NYZA 4JDZB 4EIGB 1XR8A 1OK0A 1UM5H 3EJTA 4ZMNA 5F0JB 1U8HA 2K6YA 3F6JA 1ASPA 1S78D 4YIQA 1L3NA 2ZKMX 1A1OA 4E0RA 3L1OH 3HN3A 1O75A 3OKOA 3NPSC 1HI6B 4X6DE 4RISH 3AUVA 3RWGA 3ROOB 3C60C 1ZT7A 3FHEA 2BVPA 2NY3B 4HJIA 5K59F 4HEPG 1MVUB 1NMBL 2KMWA 1RJYB 3UBXB 3LDBC 4HAKA 4O9HH 1IKFL 1BWWA 4RISL 4OAWB 1ZIBA 4AENB 5GRJH 4JDEB 2WW8A 4HWEL 2H3NB 1R3HB 3NCMA 3NUKA 3K81A 1ETJA 5E5UB 2F5BH 4ELDA 2ODHA 1TZ8A 2HVKA 3D4GA 4PM1A 1W6WA 3KBHE 5JPMC 2L04A 1U8MB 2AXHA 3H9HB 3QUML 4HWZA 1FC2D 3ZBMA 1IE5A 4I0PA 4YHMH 2R4SH 4H40A 3K72B 3QI9D 1LO5A 1SYVA 4TQEH 1RHHB 3ZYIA 1UATA 4WHYH 4E9SA 4IIQB 4WTZG 4FQXA 2BVUA 2NW2A 3CSFA 5DYOA 3DHJA 4U3XA 4GUPA 1GC1L 1KJ2A 3K46A 4X98A 1AIFA 1BQ5A 5A2IH 3H9YA 1TMQA 5I17B 2Y3AA 3VXPA 5CINL 1U8CA 3BCDA 2CHXA 2YXWA 3GDBA 1DYZA 3IETB 4DPBX 2H1PH 3C5JB 3FQYA 1MIEL 4LVOB 2KT6A 4K3HA 5JXEC 2OM5A 5AW5B 1JUFA 3OM3B 4Q2ZB 3GMRB 4DN3L 4E9WA 4P2RE 3PP4L 5E7FA 3DX6A 1BMGA 3AACA 3CSGA 5A40E 1RI8A 1PLGH 4JRFA 5IFJB 4D0CB 1EZUA 5GHWH 4CN1A 3TPUB 1AZRA 2AANA 2H2PD 4RMQA 5TTRA 4A2FA 2XHNA 1CLYL 2BXYA 3GNMH 1SBSH 3ZHKA 5EZIL 1HOCB 1NFIB 2DTSA 1K72A 2ZSWA 1D5IH 5SWZA 2ERJB 3FCTA 1QR1A 2R7EB 4ZO9A 1XCTB 4M8UA 2QSQA 1FHGA 5D55A 2DWYA 1UYWH 5BO1L 4R26H 4FL4B 3SKNB 3CMGA 3JBG7 3UBXA 3QQ9C 4LHUG 3FS9A 5JQ6H 2C1OA 1XGTA 4U4BA 5FYJU 4TL4A 2WXGA 4BFGA 1PVHA 4WWPA 1H5BB 3ATEA 3ETBJ 4FTDA 2JIXD 3B1TA 3ISWA 3Q0HA 5M94B 3RPKA 3N0AA 4LMQE 4NOFA 4PRAA 3TVMA 3EF4A 4YSOA 4M7JL 4PJHB 3FOMA 3ZYOA 4WNQA 5B1AB 2EVIA 1QAWA 1P4LB 3REVA 3UTTA 3KYAA 4ETYA 5CFAA 5AKRA 3VWJC 4S10A 3A6OA 3ZHDA 2W92A 2Z8SA 5FYLH 4HKJB 3PLYA 5EIIG 2ZUWA 3QFJB 3KYMA 3VXMA 5CD5D 1D5IL 4A37A 3V8OA 4JRYE 5FYJH 2R8SL 3VCLA 4HQQH 3NCCB 3GMRA 1XGZA 3JTBA 4HEMA 4LLDA 1K8DA 4Y2OB 2MFNA 2QHRH 3C09B 3FB7A 3FZUC 4FCHA 4ONHA 4JRYB 1BIIB 1BIHA 4RZCB 1A6UH 1FFPB 4RX4D 2ZWNA 4RAUB 4Z7VF 4B7LA 5EORL 2CMRL 3PHOA 1M1XB 1JFQH 4OQ1A 5EUOB 2ENPA 3KL5A 5EDXA 1DQLH 5KJRL 5D1QB 4A7SA 4FS0A 2XZQH 4HC1A 3WFDH 1ZWIB 5ESVB 3QWNA 2VDQB 5J4MA 5C0FB 3KDMB 4PTUA 1LL1A 5B1JC 3ZZ1A 4D8PA 5KAQF 2A6DA 5KJRH 4YK4C 3TASA 1YVLA 5E94A 3NTCH 2I9LB 2AXFA 2OMZB 4BH7B 4BKSC 4B3EA 2IH8A 4QRSB 2BLFA 4CC4C 3J2PA 3MNWA 3O9WB 3NJLA 4XOEA 4E36A 2YOAA 4KTYA 2V3FA 3U4EA 3U46B 1V3KA 5E4IA 3EFOB 4OGAC 4JJHA 2B20A 2FLMA 4YK4B 3VRIB 1CGXA 1E5ZA 2YFNA 1MDAA 1WA1X 3UPRA 1HSBB 5FDYA 4K07A 7FABH 4J3VA 3ZDXF 2ZXCA 5AOZA 4I0CC 5JIHA 1IBGL 3L9EA 3SYQA 1A47A 3MZTA 4B27A 5B7FA 2HKHL 2Y5TB 3KCPA 4LLYB 4EIZC 2BZCA 3MBXL 4M62L 5DFAA 3VXME 3QQDA 4YEEA 1ZSHA 5BV7C 4PJIF 3RNQB 4YEFA 3T4YB 1LO3L 4PREA 2F74A 3LRSB 2NY5C 2H32B 1K8DB 2JJTA 1KSRA 1L0YA 4PJ9D 1MHCB 1NPNA 4NXKA 2EADA 4AW7A 1D6EA 5HXMA 1J5IA 1BVNP 4QJ4B 2O4EA 1FRGH 4LARL 4EI0A 3RZCD 2BINA 4PR5B 5SWSD 5C0BE 3N40P 3D9AL 4OD1H 1J86A 3MROA 1RFDH 2YPKA 1C16B 3BRGC 3N5AA 4AIEA 1KBBA 2NW3B 3KJ4B 2QVTA 4ZODA 1PJWA 3S36L 5KN5B 1K5NB 2CUIA 4K9EH 3QZNA 5K9JL 2HN7B 1ANUA 3F85A 4UBDC 5DA0B 3ETBF 4ACPA 3F12A 5BRZB 4J2XA 1DFXA 3BQUD 3H3BC 4LHJB 2DEWX 3MOBL 3IU3A 4X8XA 1N3NB 2DQEL 2OSLB 4LSQH 4UILL 4WKZA 1CU4L 3VI3E 1K2DB 4C57C 1KCBA 2LGNA 2R56H 2V5TA 2FT8A 2YSTA 1J48A 1I1FA 2P45B 2WK2A 2XWBA 4H0IA 3MX0B 1X7SA 2IQ9L 4Z7UB 2DMCA 4PGDA 2EUXA 2GBUA 2ZKWA 3GJFA 4ODHH 3EZJB 2X4RA 1C1EL 2EDQA 1OV8A 1RZPA 5J06A 1JYVA 1TDQA 1BX2A 3G5VB 1OP4A 3OZLA 1YEWA 2DM4A 3MLUL 3L4CA 5HPOA 5JLZA 1PD6A 3BZFA 2QL1A 1JF1B 2YEZA 3LXAA 2WMPB 4TRPH 3B3IB 2R0KL 3HB3B 1E42A 2H0FA 5D6DA 3RJDA 4KC3B 1JDCA 2Z0BA 1TTCA 3EJYC 3F7LA 3HS0C 3PHQA 3EYSL 3QXAA 2E27L 4JRXD 2V9QA 5CIPA 3V79C 2NTSP 3II1A 2FE0A 3CVHB 4FL4C 3O2DH 1HNYA 5GS2H 5EWIL 3VTAA 4LVHC 1JXDA 1KIRB 1YEFH 4P9ML 5SWQA 1DQKA 1ZSDA 1H6TA 4ANUA 2L7QA 3B2MA 4XNXH 5DMKA 3P3SA 4YHML 5KYUB 3V4UH 1SJEA 5I1EH 1ZPUA 3TV3L 1QNZH 32C2A 3O8XD 4OUUB 1UOWA 1UH2A 3QJXA 4GRLA 2JTDA 3TVMC 4HCRH 4BSVA 1C5BL 4G6MH 3QORB 3DX9B 3LKSA 1FYTD 1G0DA 3KXFE 5T3ZD 3BVVA 3PGDB 5EIIA 3MLUH 5ANHA 3BVWA 3EH2A 3MNWB 1KB5H 4IU2A 2JELL 5DI8A 4F3FB 2VXQL 4UDTA 3BN9D 4Y2DA 1FFQA 4UBDD 1GS6X 4XMWA 5LBSL 1NCGA 1QSFD 1DUYB 1XDTT 4P05A 5KZCD 1A22B 3MJ9A 3SPJA 5KSBE 3TBVB 1LE5B 3T0ED 4BH8B 1AI1L 2WXRA 5T3XH 4OGYL 3N43B 2N59A 5AW4B 2WIMA 2EC8A 4IBSA 4PB0H 5SX4H 4B9JA 3LNIA 3SGKA 4YSDA 3MU3A 4L8SC 2RR3A 4HSQA 1EDYA 1IMHC 2PCXA 5GS0H 2NYYC 5C9KA 4PJDB 3F6IA 4F92B 1C5CL 3A4FA 3Q2LA 3U48A 4JGJA 4LLDB 3SYCA 2VL4A 4OCRH 3OAZH 3UIZA 1BJ1H 1U2HA 3UJJL 1RERA 3GUTA 3CQFA 3QDGE 4OM1L 4X2UA 2YAMA 2DB8A 2NUPB 3MJ9L 3C09C 5LGJB 5HI5D 3AXHA 4X0NA 2NY0B 2B15A 3ARWA 4DP6X 3AGWA 1OLLA 1LMKA 4JUTA 4HS8L 1S9VB 2R69A 3UAJA 4UNVA 4QXUH 3CCHA 1ZTXH 3QPKA 2GK0B 2R0WL 3EYOB 3RX8A 2Q76A 4PB0L 3IFNL 2J1YA 4L9DA 1PX4A 2I7OA 4F37F 2WTOA 5FLVA 2XQBL 4CSSA 5LWYL 2B5IB 2VUKA 1JI2A 2A9BA 3T2QA 4EDWL 1TJIL 3UPRB 1OAQL 2G9KA 4NKQB 1PZ5A 3SDXA 1NUDA 1KFGA 5E03A 4AQ1A 2PYFA 1EUTA 4XBEH 3GHEH 3ELAT 1A7NH 1X5HA 3HTLX 2EXWC 1XCTA 5KVMC 3H3PH 3VAEA 1AGBB 5LCVA 4DP8X 3CU1A 1YYLL 4JFFB 4HIIA 4RWHA 3CN0A 3L45A 5CR1A 5JORA 5CZVH 4JFDB 1A3ZA 2HKFH 2H9GB 4H26A 1ZMYA 2XDHA 3QFJD 5E4EB 3GRWL 3T0EC 1VFOA 3O4LB 1MJJB 1KULA 1G1YA 3BZDA 4NZDA 3T3ME 2MH4A 2Z34A 2W9EL 6FABH 1BZ9B 2DLIA 2FLRT 2R1XA 3TZVB 5CEXA 1RURH 2WVVA 1MJUH 3DOHA 1B0WA 1KUMA 5HVWA 5GRYA 2YIHA 1XH2A 2IANB 5K69A 1K4DB 1QSEE 1AAJA 4A2DA 1XVSA 2BS9A 2WLLB 1E5AA 1U3HD 1FNAA 3ZVVA 5C0RH 1NUFA 3QQ3A 1O6SA 3RWJA 2XYBA 3T0VA 5I8KH 1C12A 1EXHA 3ZE0B 4OF5A 5E56A 4OCNC 2Y6SC 5IG7A 4IEFA 4G2AA 2QVFB 4N5UA 1MRFH 4WGVB 4HKJA 1KTDB 2CNZA 5IGXL 5DO2C 4GLRH 2ERJC 3MACH 5F1OB 3PL6D 4PGCA 5T1MB 1BFOA 3MGTB 4XNZB 3UEZA 1X5XA 3WO4B 5LHDA 4L8CB 3PGFL 3A22A 4OCMC 4KXZH 3I6LD 1NZRA 4N20A 3GXIA 1RUML 2XWTB 1NH6A 3DV6B 1E8WA 1LO3H 1Q9KB 3LRHA 4PLKC 4YDJA 5IHUH 3LZNA 1HHGA 2WVSA 3K2KA 3QIBA 1MFBH 3B9AA 2RFXA 4OJDH 3CFKA 5I71B 4XPBL 2EDNA 4OIIH 1CZ8H 3F00A 4GAYA 4BFRA 4QRRA 3OJDA 4L3EA 1QA9A 4ZFOL 1JWUA 3ENEA 4KRMB 2CO4A 3D18B 2YA2A 2X4QB 2J55A 4G7SB 1KLGA 2AGJL 1B0RA 5I73B 5L88L 2CBPA 1CXHA 2F08A 3NJJA 1DFBL 4G1EB 4HWUA 2KQMA 5CU5A 1PD0A 5I2IA 3MTRA 3T0WA 4BK4A 4XN4A 3PIQA 1S5HB 2X4NA 1JMXA 3QAZC 1JNLL 2JLPA 3CDYA 2DEXX 1J1PH 3LZLA 1HILB 2CR6A 3SGJC 4PJXE 4JFOB 2UXVA 4O5LL 3CFTA 4S1SH 5KG9A 3SDDC 2ADGA 2OMWA 4KZDH 4ODTL 4IDJH 3V4LA 4YNYA 3ZDXE 1LNUB 5IMMA 2XU9A 3VFRB 3FU7B 1O6SB 1U6AL 1RUQH 2B16A 2BHZA 4AYEC 2J6WA 4K3DL 2RCSH 3LHPL 3NIFE 2F2HA 3U0TA 2HPTA 1JZHA 1GGTA 1UXMA 3BH9A 2Y36L 4NQDB 4KHTL 3H56A 4X4KA 1JGDB 1QEXA 2C9VA 3VFVA 2N7AA 3A5VA 4XH2B 1FH5L 1KXTA 4F27A 5JO5A 1D5XA 2SEBA 3FUDA 3CH1A 3S96A 4WTWA 1YNKH 1IFRA 3DSNB 1NGXA 4GKZA 4M7LH 5CXPA 4KK9D 1BBJA 3TEXA 1KXVA 2FYYB 4J39A 2DQIH 4PBVC 1NEZA 1RULL 3CLFL 4PJGB 4KMTH 4TNWF 5E1AB 5F21B 2D8KA 5C0DB 1JZ4A 1R46A 3IDIA 3O3BA 3FHAA 4V2BA 3IPEA 1CDYA 5I1EL 3MLZL 2DF3A 2AK1L 3BVNA 2AJVH 4L5FL 2YLKA 2HVBA 1G6RA 1KT2A 1N9PA 4KK8C 5I1HL 3BYYA 2IJ0C 2PW2B 5D7LB 2D7PA 3ZX1A 3CVHL 3U9WA 3P2DA 3SEPA 1QWNA 5DEGA 3ZTEA 5D5MF 2OSWA 4GXUM 3WGVB 3EFDH 4C56A 1II4E 1V3JA 2FZ3A 2P24B 3ZZSA 4DGIL 4M7LL 1GTFA 4K9EC 4TUJB 3AREC 1PQZB 4GAJH 2VM9A 3AAZA 3PV6A 5EZOH 1G7MB 2X40A 4JJOA 1P2CA 4NJAL 5J13C 4NQCD 4K71B 1TZGL 4D0BA 3L2MA 3HE6D 4ZFZA 2Z31D 3DYMA 5GRJL 3QIUD 3L2LA 4MKMA 4QCIA 3T0EA 3FBKA 2R9HC 1AR2A 3MLZH 4BZYA 4L0PB 3WTUA 2LU4A 1VFAA 4A7QA 4URTB 1PZAA 4WW2F 2BIOA 5ECJE 5E6IA 3BDBA 4PJGF 4UM8B 4XX1G 3NIDE 4KJPD 5IQLA 1KELH 3VG9B 4A6YB 5I8OH 2B4CH 1CFSB 1ZDSA 2P42B 4YHPA 3CZUB 3QULA 2BRRL 3FUJA 2AJXH 3QC5X 3H55A 4E9QA 4W6WB 5IF0A 4M5ZH 4XO9A 2XPYA 2G60H 3EDDA 5AW8B 3ZUNC 1A25A 3G5WA 5EO9B 1EH9A 1Z5LA 4DSYA 2AJXL 3CXFA 5C0DA 5KBPA 1Y0LB 3SE4A 1UM6L 2W94A 3X1BA 5AENA 4DKDC 1XB8A 4MB3A 2PCFA 4ZSOA 2W60B 2FIKB 5DCCA 5DI8B 4IU3B 4JG9A 4R0LB 5IHLB 3VX1A 4IKIA 4TF4A 5DLLA 1U8OB 3OHMB 4UTAA 1ML0A 5C2BL 1P5VA 3BPOB 2MKLC 3I2CL 4ENZA 2KKQA 5AVSB 4MA7H 1TJGH 4XMKH 5DC2A 4YXLH 5EU5B 3C2AH 3HCVA 3HNTL 3DX7A 1F3JB 3AG3B 5K39B 2X6MA 2Y06L 3MUUA 3BLKA 3I6GA 3MRRA 4I85A 3KPOA 4ZOBA 5FM5M 1FO0B 3QIBC 2CHWA 1TJGL 3QUZA 4XMKL 3I84A 5DVKA 3U0TB 2OYLA 4F57H 3KPOB 3IJSA 3HUJB 1QBLH 3CVDA 3W0WA 4CU8A 1HXYA 1MELA 1RVFL 2CO7B 1VIWA 3B2VH 5E24E 4RBPK 3IGKA 1SDAB 1XGYL 2OYPA 4X4XA 3WS3B 1WBXB 1CF8H 2MMXA 3HC3H 3OB0H 4YBLC 3KBEA 1P9MC 4KV5F 5H4YA 3TBYA 4UZSA 4FNLL 4Y8AA 1A7RH 3S34L 3FU0A 4LEOB 4JPKL 5HI4C 1TZIB 1XH0A 2DBLL 1B0RB 2ESVB 3DJTA 4OGAD 12E8L 5FW7A 3Q1SH 3LQZB 4NKMB 3TF7C 2X4QA 4P3CH 3UXFA 2ZCKH 2WUCL 4R5TA 2ZCZA 3MRCB 3GSVA 4G9FD 2YAOA 3O3DB 2K3HA 4MASA 3N06B 3NEEA 4BQ6A 2LOEA 4FEIA 1G7IA 4HZ1A 3AG2B 3WLWC 1YJDC 3MRCA 4H0LC 1VPOH 1GJUA 1XD1A 1U8JB 4JFED 1E28A 4ABUA 1GJWA 1WHOA 4AT6A 5MI0C 5BUGA 2HKHH 4L8SA 4ZUVB 3X1GA 2VDQH 3FO2A 3RZCB 2HZHA 4MRCA 3CN2A 3SKMB 4TVPL 3X13A 5JPMB 2BW4A 3L4ZA 4ZOEA 3C8KB 1RP9A 3AB0C 2ZE0A 4MNHA 4TOYL 3GM0A 4IRSD 4G6AD 1MCWM 2MHAB 1I8UA 3ERXA 4MMZC 4EAEA 2D7TH 3HMWH 4M02A 1JTOA 2X70A 1I4FA 4YSUA 4FLRA 4J5VA 3B9KD 2K4AA 1WYJA 4LAQL 5I6XB 3AY4A 4FYQA 2CO7A 3GMPB 1QRND 3LHAA 2DQCL 1R19A 3MXVL 1RZFL 1ACCA 3IJSB 4R4BB 1FAIL 3LPFA 3QZLA 5SWQB 3PWNB 5DRXB 4XHJC 4ZYKB 1WEJL 4TSAL 2WLLA 4WHTB 5D2NB 1K4DA 1F02I 4M43L 1A6WH 5CILL 3D0LA 3PCYA 5T3ZE 3MRDA 2K7PA 4NO5B 4R96A 4JM4H 5E9DE 4KTGA 1FYTE 2W07A 4P2OA 4PPTA 3TBWA 3HS0A 3N43F 2XFXA 1TQBB 1I9RH 4TNVF 3UG5A 1MIMH 4LPCA 3B3BA 1I9EA 4Z7UF 3BH8B 5FB8A 4Z95H 1U3YA 3IU4L 3PJLA 3IGFA 4PJXF 3QDJA 2WC7A 3RBGA 2VZTA 5EWIH 3B2PA 5JNYB 1A6AB 2FIKA 5CJQH 2WM0A 3ZKQD 2HUHA 2VL5A 4IOSA 4JLRA 3EJYD 1KB9K 3G5YB 3DROA 4F20A 2L3BA 1EZSA 3DV4A 5FF6B 5CGYD 4B5ZA 1BPLB 4FQQA 5EEYA 2BCMA 3ZQXA 3U30B 3TESA 3RVVD 2WN2A 3QIUA 5A6MA 1N6QH 1U2YA 5HDBF 1EERB 1XGPA 4NQEE 5BUPA 5DZOA 4WTXA 5K1NA 3Q9QA 2XV6B 3BESR 3NEOA 4KXAA 4LHUB 1A6WL 2XI9A 3C6SA 2ZOWA 2BH0A 3BP4A 2ZAHA 3MYJB 3QJFA 5IUSA 4QRTA 3BSHA 5CNHA 4PFEA 1AQDA 2Q86B 1E6JL 3QQNA 5DLMH 1A7OL 2QSCL 5IVNA 3BD3A 4YZFE 2PF6A 3VW3H 5IZ7A 3VJ6A 3Q5YA 1JRHH 5FOBB 4PWJA 4CKVX 1WH0A 1JPSH 4RDQG 4K5PA 3F7QA 5J13B 2NUPA 1G5GA 1BOYA 5AVYB 4PRNB 1QPPA 5JZ7C 3N1GC 5ISZE 4NO0D 3TA3D 1YJDL 3D8MA 1CGVA 4QTHB 2HG0A 1JXJA 4QRRE 3ESVF 2VSMB 3V6OC 2DIBA 3JXAA 1UOKA 3HMXA 4HK0B 1N2RB 3C75A 3RY6C 3WE1A 1NWOA 3ES6A 3ZE1F 2WBJD 3TLRA 3FXIC 1R5IA 3NIGB 4BV1A 4R4FL 4ANXA 3RTQD 1T7YA 2AQNA 3MODH 3N85L 4N90E 1ZT4B 2CDGA 2VLJB 4FQCL 4UDUB 3L4UA 3TWCL 1KTKE 1TVDA 3CIAA 2KLSA 3GC3A 3M45A 1VEMA 4JGMA 3N50A 5B1BB 3TA4D 4WSGA 4NHUB 2NY2D 2VJ0A 3MTXA 3CX2A 1M9WA 1WD9A 2YD8A 3S37H 5F7EL 4LCUB 1L7IL 4F3FA 2EIKB 5KVDH 3RY4A 2V5YA 3CFIC 5C1MB 3JV6A 3OR7A 3ZT7A 3P0VL 2FYYA 3RGBA 1UQSA 2EE3A 4C55A 3TEUA 3EW3B 4ZX6A 4YHLL 4GQ9H 5ALCL 3P4OB 3MLVL 1ASQA 5EDSA 3NIDF 4G6KL 3DO4A 3DVNA 1FGNL 3GB7B 4OGXL 3LD8B 2Q3AA 2BSTA 2F1EA 2BY2A 4L29B 5D2LA 3BWZA 4X5PA 5D72L 4ZS7L 3P0GB 1ZLWH 3STZB 3TTYA 5MHSD 4ICXA 2OL3A 4BRVA 1J0KA 4NPYB 4FQ2L 3MCLL 2AQ2A 1F4AA 1KIQB 1U8CB 4JN1L 4TVPE 3BAYA 4UUJA 1T5XA 2D3LA 1TEGA 3HG1A 4M5YL 2FWOA 2Y5QA 3B7TA 1DDTA 2IPUK 2CZNA 3SO3B 1SMDA 4HSAC 3LH8A 5E5LA 4R8WH 5AVRB 1MLBA 3IDXH 3ISRA 2ENJA 4UV4H 3QFJA 3PNRB 4KI1A 4PGBB 5IQ9A 3ZE2F 1WSST 2JQZA 3FB6B 3NJMA 4PJBA 1MFEL 3VRJB 1FNLA 5GRUL 2OI9B 3JUZA 4HKZB 4EKXA 1TT6A 2QR0B 3NK3A 3QP3A 5IB3A 1L9TA 5E9AA 5MEPB 3S3JA 3FUIA 2ZUVA 2XTJE 4P5KA 3OJVC 1Q0XH 4N8CH 3HI5L 2IADB 3OKEA 1MFDH 1CXKA 1S5IH 3WN5A 5IR1A 3K4AA 3OJDB 4TXVB 5E8PA 4OV5B 4QHKJ 4GAYB 4X42A 1FYTB 1MLCA 1ACXA 2NY6B 1AZUA 1A3LH 4FNQA 4ORGB 4QAWA 4PJCF 4UI2A 5T1DL 2BP5M 4AXWB 5I6MA 2AS5M 4RNRB 2FT6A 1OOAA 5BVJB 4Z7VE 2JB5L 1E5CA 1ZK9A 2PWGA 3HE6A 4U1JB 3JT0A 4ZMPA 1GC1C 4FLQA 1RD6A 3AZUA 1RUMH 5D7LE 1CQYA 3FAWA 3UTSB 3H0TB 5EIQA 4OFKA 2NY1B 3Q1SL 5JA8B 1S3KH 4PY8I 2P8LA 2VN7A 4DZBA 5GSRA 4LSSL 2E8YA 5IJVB 2JH2A 2F53A 3D51A 4YPGB 5F88A 3VGHA 2PABA 1AR1B 1KY6A 1PIGA 4PWEA 4W9CC 1DUZA 1Q0EA 2YUZA 4PRIE 5I66A 3P77B 5LBSA 4F7CB 2HJLA 5C0AA 2XUWA 3N0PB 4CJ1A 2HSIA 1JHKH 2TRYA 4YXKH 1KLFA 1U3ZA 2Z0UA 4A2MA 5HHPB 4DH2A 2HAZA 3BE1H 3AWFA 4OZFH 4NAJA 5EFIA 1UWGH 4FDWA 3VFOA 5IEKA 2FQEA 1CDHA 3FSAA 3QQDB 3MV9A 1FFOA 3BEVB 3RPBA 1KGCD 1X6NA 3RGHA 4U1LA 4BELD 4BKTC 2IH3A 1U8IB 1MFNA 2UZYB 1PS3A 2GSGA 1TU2A 5CZXC 1E67A 3ILPA 3QS2A 4POYA 2BZDA 2VE6B 2MKWA 3DURB 4MS8C 3TN0A 3D06A 2AAAA 1NC4D 4Y1AA 5AD0A 5HHOB 3C12A 4HSCX 3NSYA 1QSFA 3AABA 7CGTA 4KJYA 1G0XA 5J6HA 2FNBA 1OM3L 2H9GA 1W15A 1I3RA 2EICA 2P8MA 1EUUA 1H3WM 1KCRL 1U91A 3CZGA 2IWEA 3GHBL 5DRNA 5IW1B 4G8EA 4MDJB 4WUUE 1BVOA 1D5ZA 5E2TH 2VDNL 3VI4B 1YEKH 2OL3H 4BSWA 2WYHA 3BUDA 3PPEA 2P47B 1PZ3A 2X9ZA 1B9KA 2GK2A 2PCPA 3ML8A 2A77L 4KUZH 2VITB 3RWDB 1NFDF 4D9QD 1CR9L 5AAMA 3ARXA 2EIBA 4UOW0 4D7PA 2DQDL 4DOHB 2YGPA 1CD9B 3S3SA 3QZWG 1KV3A 1R3KA 2WZ0A 43CAB 2M8XA 3EYUL 3ZDWA 2O5XL 5KTEL 2WYTA 3O0RL 3CLFH 3QORC 3MCYA 1HWWA 4WU5B 5KS9E 4O2FA 4O9HL 4HK0A 3WJJA 1QSED 4MCMA 1TLMA 3O6FC 2EUWA 1H3GA 4RLDA 2K6ZA 4FMVA 5ACZB 1E4WL 2EYRA 3FQ2A 4Z3IA 3OHXB 4DZ8B 2E47A 3CSYA 3QR1A 3LMJL 4B7IA 1C9SA 1D5MA 1F0LA 4LFHG 5BRZE 5F9WC 4E9RA 2RBLA 1D6EB 4DGWC 3CBJB 2JI3A 2EVGA 2IDQA 1HL4A 4YGVA 2VXSL 3ZRCC 1D6VH 1QLEH 2Q76B 1CFVH 2DQFB 3LRSA 4KXZI 4NN7C 3FQNA 1FLRH 1Y1UA 4NFBA 2DH2A 1ZXKA 3U36B 2DJ4A 3HE7C 2H0PA 5F9JA 4TUOB 1J5CA 1C08B 4FTVD 1KPRA 2AVFA 4LSUL 2VR5A 3FN0H 2YJQA 5I6KA 4ONFH 3KHQA 2VXVL 3IJYB 4ODXB 4R90H 4S2SB 4X5RA 3FC8A 4DT2A 4ZFFA 3FB5B 4XC1H 1CGSL 4EUPG 2WWKT 1VFMA 4QO1B 4UIKL 3UG3A 4AMXA 5I1HH 5IJKC 1C1EH 1P7QA 1CICB 2APBA 2YLHA 3MV8A 1V05A 5G4OA 3F84A 3VGBA 2FX9H 1KENL 1Z9PA 2I60H 3DUHA 5I74B 5MEPA 2NY4D 4UQAA 2F68X 3PHSA 4HEPA 4AQ8C 1AR1D 1L6XA 5EU6E 3R4DA 3QJZA 1SYSB 3WENA 1R33A 3FO1A 4AKOA 3V9CA 5CLYA 3ULVE 3S7GA 2FO4A 3DHPA 4BJLA 1GYWA 1DEEB 3QUZC 1PYWB 2YGVA 5BOZG 4L4TE 2Q1EA 4XRCA 2VDOH 1BXUA 1JNNL 2Y7QB 5LNEA 3B8YA 2FJFA 2WNXA 5GZNC 4MCZB 3V4VL 5ES4B 3WL9A 1G9NC 1B6DA 3C5JA 5F3BA 5L8KB 5EIVA 1ITBB 2HG5B 3I85A 4WNJA 4ZS6C 4YS4A 4M1DH 3T2LA 1QD0A 4DERA 4OLVL 4KRNA 4KRPD 1CF1A 5AAWC 5TFSH 3JTTA 3U0PB 1J05A 3IGUA 5JXED 1EJ6A 5IVZB 4XMLL 3O6LL 3QG7L 1EJFA 5K9OA 3DOSB 2PR4H 2ZG2A 3B4NA 4Y5VB 3DTXB 1TSHA 2J1WA 3B9EA 3H9ZA 3SCMC 2VN4A 5F7HA 4XNZC 3L2NA 4QOKA 4AVJA 5TDOB 1BVZA 1XH1A 5IVXE 4QLWA 1BAFH 4IMKA 3B7RL 3G6DH 4Y2DC 4XN1A 2DZEA 1NL0H 5HGBA 4A7GF 3QUHA 2V2WA 4JDEA 1SUJA 2VLKB 1AC0A 1IAKA 2J3SA 1JGEB 3SN6N 2NY3C 2C1OB 2JMRA 1EEQA 1CDGA 1KDJA 4JZJA 4DNLA 1WBZA 4HKBB 1DUZB 1HEHC 2FEJA 1ZIAA 1ZXQA 2BY3A 3SGDH 5IFHL 5HJBA 4M1CD 1OOWA 3RDTD 4GRMB 5F3HA 4XI5D 4RX4A 1KN4L 4OB5H 3L17A 4PJ9A 3SDCB 2A4ZA 4OCRL 5DD1H 2NY1C 3S4SA 1LO0H 1AACA 2ICWJ 3RI5K 2DKUA 3GJFB 1YMHA 4I9WD 2H41A 3POCA 5AFAA 4YSTA 2OMUB 3MUZ1 2XNAA 3QSKB 3U30C 5JDJA 2ZX7A 3HZVB 1ES0B 3VYNA 4BUHA 3VG0L 4JVWA 2V9UA 4IKNA 4POUB 2ZOLA 3C87A 4GMTH 5HI3D 4F8QA 5J12B 3UP1A 2F1BA 3RUGB 3WJJC 4WKZB 1MHCA 1IZKA 3SZ6A 2GFBB 3EYQD 3V0IA 2C4FT 1CMOA 2IOIA 4ZZKA 4P23B 2X4TB 4DW2H 4M61A 4DJMA 3OGCB 3B83A 2YKLL 3AT0A 3EJZD 4Y5XC 2XQBH 3Q9PA 5DT1L 5EOQL 1FNFA 4MMYA 5HGDA 5C07E 5IVXB 1G6RH 2MOGA 2N7SA 1YNLH 2UXFA 2XXMB 5SWZE 4DGYH 3K3QA 2H32H 1S7VA 1N8ZB 3BZEA 1GTNA 4OGZA 4OLWH 1RMFH 2EEAA 4GXVL 1K4CA 4ERSL 3UACA 1HXMA 4WU7B 4MZRA 4X4ZA 4X6FB 1EIBA 1U8NB 3ATFA 3G5YA 4PUBH 2IDFA 2XG4B 2GJRA 3DJ9A 2AK4A 5CCJA 1S7TB 1SLVA 1THAA 1XCQB 1JWSB 2I9LA 1NAKH 2NNRA 5FM5O 2EDFA 2Z7ZA 4LLAA 4DFIA 2VQ4A 5CGMA 2NYYD 3KCPB 1SOKA 5CR8A 1AKJD 2PW1A 4Z7QE 2BOBB 4Z76A 5D7KD 3QZBA 1RIHL 4M4PA 4HUVA 2OSYA 3EOBA 4NN6B 3UTQB 2QQKH 5F6HJ 2B2XL 5IB4A 2HCZX 5E8DH 3DI3B 5DWUH 4AIZA 3PGCA 4NZUL 4GBXC 2HFFB 1L0XA 2D9CA 5LAXA 1CLVA 3MA7B 4ZMYA 1M3JA 3X17A 5EB9A 3HG5A 4H44C 4F15B 4JRYA 5FA3B 1CVSC 1AZZC 4P9HH 2PTUA 3BZ4A 4MNQB 1PLAA 5BCAA 4LPXA 2UX6A 2NMSA 1NFDB 1WFIA 2XPGB 3BAKA 3M1BA 1HIML 4PRNA 3V7AG 3LRLA 5BQDA 1XV8A 5LKNA 5FWRA 2HKAA 1TEYA 5MEND 1XB6A 4X0KB 1BVLB 3TONA 1QFWL 5DF0A 5HGDB 1KN2L 1WV7T 1T3FA 2DQEH 1FFOB 4A7TA 5IBTH 2C9XA 2FUQA 3GBNL 4M8RA 3LIUA 4H25B 3VTMA 1OAXH 1WWAX 2K78A 3P02A 5CBAA 3SE3A 2ZYHA 3SIKA 3ZE2B 3VU2A 4OZHF 4TQEL 4YDIH 4HUCA 1RHFA 1GS7A 5DJ2A 4AVIA 2ZXGA 2AEWA 2MRYA 2V7NA 5FK9A 1MWOA 1G6VK 3QDGB 1E2VA 3TBBA 1P6AB 5E1HB 2YGOA 3MRNB 1LD9B 4HOXA 3QO1B 3DX8B 4KKZA 3S5LA 4WNQB 4YHYB 3T77A 5HDWA 4QRPD 1EHAA 3HR5B 3K6FA 2HLFC 4CSPA 1OVZA 2E9IA 4JL1A 1DBJH 1B0IA 1ETZA 2VAAB 3QUZD 3BRFA 3C6SB 5E4AA 1KLUA 3L3OA 4LHUA 4JPSA 4BK8A 1R17A 2PP7A 5I71C 3DLQR 3FQWB 4FERA 3WUZA 3V6OE 5DDHB 3VXUB 1JD7A 1GKEA 1NCJA 2F19L 4MS6A 3OWEA 5TF1H 1A14H 4ZW3A 4JAMB 5DK0A 3TIDA 5D2NA 2C9UA 4ODUA 2WCGA 5LNGA 4LDCA 3RX5A 3GJEA 3VXUE 1RPKA 1AQHA 1ZHNB 3R06B 3DX7B 2EDMA 4GUPB 4AJ0A 2NOYA 2XQYA 3GSUA 3QJUB 1BZEA 3EBAA 3KGUA 1C5CH 4U4IA 4Y19B 2DMGA 5CHNB 4EZMA 2ZONA 2OTWA 2EH8L 1YY9D 2FBJH 1VKXA 3ULVC 3V4VA 4B96A 5GZOA 4J1UB 1I8LC 3TWCH 1WITA 1QBAA 1L5GA 4MJ5A 3GKWL 3KYKH 2FVNA 3FH7A 2O6EA 2KDYA 3FNKA 4Y16A 3I50L 1UXLA 4N2BA 1AI1H 3V0GA 4OZHB 4OCXH 2QADD 1FV1B 3RI5F 3QPXL 3FN9A 5C0CE 1ADQL 1DJXA 3H9SD 5BZXA 3SJVD 1ZHBB 4M7LT 3PP4H 1OP3H 5KS9A 5DVOA 2XV3A 4NZ8A 4ZQKA 5BV7H 3MI6A 1WF5A 1IBHA 1HSAB 5BZDA 1C7SA 1DEEA 3SQOH 3AROA 5DJZB 4H8PA 4DCQB 2X1PA 4L4VB 3UEQA 1CFSA 3BYTA 3H2PA 3WKPA 4M48H 4LCCC 4XODA 1SF5A 2E6PA 3HNSH 4NN6C 3E3QC 2J8UA 2R2BB 4N8CL 1HT6A 3S37X 2ED7A 4ODSL 5CN2A 3H2QA 4MJ6B 3QW9A 4PD4K 3HUJF 5LCVH 4NQVB 2YAFA 4PJIE 4FFTA 4X9IA 4RA3A 5ETUA 4NHCL 5DHXB 3Q3GA 1X7TA 4WENB 5LCVL 3BSZH 3NJVA 1AMXA 3RDTA 4UMSA 4KQ3L 5I8EB 2EIJB 4OJCA 1R5IB 1N7ML 4XX5A 2XBZA 5GGVL 3LEXB 1TNMA 1WZLA 2JJUA 4BFKA 5JYLA 2WYZA 2CJUL 2XRAL 1FO0A 3QJVB 5JHDE 2WTRA 2VLKD 4QYOA 1XR8B 3MLSH 1F3JA 2Y9RT 1N0LA 1CL7I 1NICA 3HI5H 2F18A 1NCCH 2VB5A 2EDEA 2ZQKA 1GSKA 1DLFH 4B9GA 5HYQB 5ICYB 2AK4E 1E7UA 3Q48A 5IK3B 5IQNA 1QP1A 2XG5A 4M56A 4L9LB 4XO4A 1FGVL 4MMZA 5HHVL 2UYLB 1IBGH 5EZLB 1A3RL 2GSMB 3GBEA 5K9KA 3ULVD 5C0AE 4GAAA 1PLCA 4GO9A 5F7DA 1LGVA 4YHIA 4X6BB 3V4PB 4WGWB 5C0CB 5DEFA 4OTXH 4BFEA 5JORB 4M7JH 5L6YH 1A3RH 3ZRFC 1KNOA 3X2QB 3O8XA 1RU9L 3QHTC 4NUGL 4RSYA 5HDLA 5K39A 4X7EC 4MQXC 4WJ5A 2CA4A 3Q8AA 5I75C 3KPMB 1NJ9B 4LMQI 3DWTA 3S5ZA 4L29A 4P2OC 1FRGL 2VR4A 4RQQB 3KJ6H 4QGYA 2XZCL 4AZUA 3HAEB 2GJJA 3LEVH 2ZUQB 1OPOA 1FCCA 1URLA 1GGCL 4PVNA 4L3AA 2L4OA 5DZNA 1IVTA 1VA9A 4FQXD 2XACC 3L3OC 5BVPH 4AYSA 1CDUA 3EGXB 1KYUA 1NCWH 3IMWA 3HHMA 4S1QH 5L9DH 5I0VA 5EORH 4XBMA 3MV01 3FF8A 4J4PD 5FUOL 1LK2B 1JK8B 3JWOH 3VWKA 2JQAA 3CDGA 4XWOD 1BYNA 2LR4A 2WSKA 1BQHG 3P30L 2MHAA 3FFDA 4K3EH 2OR9L 5H37A 1RAMA 2IH3B 1OZTG 3ILQD 3B9KC 1EZVY 2EDYA 3D85B 1EEUA 2K1MA 4OVUA 3MV9B 3HS9A 4IRJC 5KVEE 4J3OC 4QGTA 3HJ0A 4Q6IA 3P1VA 5FFLA 1ECZA 4O2EA 1RL1A 2RHEA 3S3BB 4ZUSA 2VR7A 4AL8C 4IBWA 3IEAA 4HS6A 2B9AA 2EINB 1KGXA 1MI5B 3BWUC 3CDCA 2OL3L 3HFFA 4ADGA 2GTZB 2WXPA 1U8JA 4AH2A 4PV9A 5EOCL 2Z4QB 1JGVH 3JTSB 2DYRB 2ZWKA 4R5XA 3IXTA 5PCYA 3S5YA 4QRRB 3KPRB 4I48B 5GPRA 2HJKA 4EXKA 2X3CA 1GGUA 4D0DA 3GSVB 1R5WA 1Q1JH 3EXLA 1MFMA 4F2EA 4ZMQA 2NNXA 4JY5H 1YA5A 3QUXA 4DIXA 1QABA 2V9RA 4FI6A 1B4LA 1CE1H 4L3FA 3T5WA 3A47A 4IIZA 4KO5A 3RZCA 3QDHA 4JKNA 1S7UA 2PO6D 2I26N 4HIXH 2VLRA 1XIWB 2QVKA 2R83A 3KLHC 3ELQA 4N0FB 1UB5B 4ZAKD 4PJ7E 3L6FA 4JHBA 4NNYA 4OIAA 4WI7A 1PZSA 3LPGA 4OI7A 5I5IA 3BO8B 4PJHF 5CN1A 4APQB 5DRZA 1TQUA 2DYSB 4NQDA 4M6MH 3W37A 2YPVL 1BXXA 1ZSDB 3MJ6A 3ETSA 4KK9C 3QR2A 4JM4L 3GMQA 4XBGA 4KMLB 3HI1B 3SZKC 3G5ZB 4DVRH 3WS6C 5FPIA 1WFNA 3IXAA 1MFUA 2EO1A 2BPBA 2IPKB 4Y16B 3WTSA 2PYEE 2UUDK 1BM7A 1QLFB 2B3IA 3LXUX 4PJBB 1GY2A 3DX1A 1GGBH 1NGXB 4GKZB 1LO2H 4P46A 5ACLA 4JFFD 2ZZUT 5SWSE 3WS3A 4AC2A 3CZJA 1PMYA 2PCYA 4OGYH 1F5WA 3VFVB 4DO6A 2OMTB 1CI3M 5EEWA 2NZ1A 2FWOB 1TZHA 1AYRA 2R29L 2VXUH 2W1NA 4LBEA 2VUOA 4RBPH 4I3RL 3MRDB 3DBSA 4Y16D 1IAIL 3QFDA 3ESOA 8FABB 3DX8A 4N24A 5HJ3B 1KBPA 4AUUA 1E3FA 3RKPA 5EC2A 1MF2H 2PO6C 3GI8H 4W9ZA 1U8PA 4TTGA 4UT7L 1E4WH 3CC5A 5GZOD 2Y24A 4NQSA 3UPCA 3V5HA 4AZ8B 4UZUA 2G75A 5C0GB 5GS0C 4P2RB 5CJBA 5ADPH 1HCFX 2Z6FA 2FSEA 1FI8C 4U6VL 3PWLB 5I8OL 4NQTA 1FFTB 1UCBH 4K8RH 3LKOB 5JOPD 2X42A 3J07A 3L3JA 1BD2D 1DDHB 4YDJB 1A7QH 1MW3A 1ZTMA 1KCLA 1I1AC 3CQQA 1SQMA 2XN9B 2ZX9A 5FDWB 3ARZA 5DEFB 3UH8A 1USQA 5E9DB 3QO1A 2XIDA 4BFIB 5J3HD 3DVIA 3L3IA 4J6RH 4JO2H 4G8IB 5FYKL 5B8CC 2GSIA 3GXMA 4ONFL 1H6FA 5D7JA 1LP9F 1I9IL 4A68A 4G59C 5C2UB 5J1SC 4QXTA 4G7VH 1NGPL 1TVBA 4HK3N 3ZDZF 1F6LL 4JK0D 2D9QB 3TWYA 4Y5VC 1T6BX 3BP6B 1DN0B 4MJIE 4P2QB 4PJFA 3EAKA 2XVKA 4JM2B 2JELH 4PJAB 4AE0A 3BP6A 1E5BA 3Q6GL 3SE8L 3NZHL 3VQ1C 1ECYA 4P46C 2YA1A 3TCLB 4MA3A 4YJZL 1I7RA 3EHBB 4KMQA 1ZJBA 5I6NA 3SOTA 2ODIA 4I7ZC 2C1PA 4F80A 2WBJB 4HD9A 5CHNA 2R2CA 5CGBA 4AW4A 1IX2A 3A6BL 1JWSA 4G8GE 4HJ0C 1ZRUA 3WFEH 1B9ZA 1OK8A 2VR9A 4L23A 3QEGH 3SDCC 2HTLC 2WP3T 2E7HA 3C60B 3ULUD 1FGNH 1YEIL 1YC8A 2R1WB 3PGDA 1ZLVH 3UBXI 4BH7A 1OTUC 4FNLH 3S34H 1Y1DA 1YYMH 4NWTH 3FT3B 2EDHA 3LNDA 2LU7A 1E27A 3ALWA 4EDWH 4Z0XB 1PZ2A 1QFOA 1UWEH 1XF1A 2YN5A 3E0GA 3G5XA 4GSUA 1QHPA 5IHWA 4TN9A 1BAGA 2DN7A 4QOKE 3ZKMC 1JGUL 3LQMA 2OSXA 1UCTA 1RK0B 3H3PL 3PY9A 2F54D 4H26B 3ARFC 3MXWH 1KYOK 1MNUL 5C08E 4ABVA 3SQBB 3NESA 1UKTA 1UM4L 1U8KA 4P23C 2B77A 3VI3B 3W9EB 4OJYA 5EEVA 5CIPB 1BOGA 2AJYH 2JB5H 3GIVA 2FX8H 3IFPB 1MCOH 4OIFA 5JQHC 5TQ2L 1NCBL 1EXGA 1Y07A 3RUGA 3EO0A 3T2PA 3VI4F 5ISZD 5C6WH 4CL7A 1IIKA 2WAQA 3V0JA 3WHXB 3WBDA 3BQVA 2FATH 1MCEA 5IROA 4IOFC 4OZ4B 3TNMB 2JI2A 3VU1A 3E2HB 2WTRB 4F2MA 1UTDA 1DQVA 1HESA 4G6JH 2QDVA 1JHKL 1H9VA 3LEXA 3OKNB 1DBKH 2BOCB 2P9RA 5HVFB 4ZXBD 3B5HA 4NKDA 4D7BA 4BWWA 5FW8A 1IKNA 4N2EA 5EU7E 2UV3A 2DLGA 4WK2B 4JZJB 4YHNB 4DKFL 1QEWA 2ZXAA 2R0LL 1AYOA 2VSKB 1IGFH 1F1AA 1UT9A 1WS7A 1OGSA 1GJIA 1F00I 3HZVA 5JMOC 3ULUL 1JPFA 4JFQB 1XL4A 5DZJA 2XN9A 4G71B 4F33A 4B53A 3VDCA 2W59A 2ZXQA 5IHUL 3V6BR 2GBAA 2W9DL 5C08A 4ZAKC 4DCQA 4HXBL 4UQDA 4XAKE 4Y5YA 1J8HE 1GHFH 1FAIH 1FO0L 3UTQA 2MEJB 3CPUA 4IW4C 2XKNB 3GSOA 4LPTA 3DYPA 2Z4TA 1FBIH 3R7RA 1T7WA 1VERA 3N1PC 4GXVH 1FPTL 4HD5A 5FUCE 4Z7NF 2KZ1B 4E5XA 2ZXWB 4LOEA 5DO2D 5IGXH 4LL1A 4OFIA 4JY5L 3W57A 3FU3A 1FO0H 3PWJA 1KCKA 1ROWA 4HCRA 3NGBC 2VZVA 4HW6A 4K9EL 3DGGA 4UOW1 1KEGH 3OL2A 5BXFB 2GTWB 4H2CA 2WNWA 3TT3L 5I0YA 3S48A 1NFDE 1E4XI 2BHFA 3HN5A 1BV8A 3AY4C 1W8OA 3GI9H 4KKBC 2UVEA 2KC0A 1HNFA 2Y1ZA 2CRIA 3FRPA 4HIXL 1K3ZA 1E6JH 5FUCC 3VH8A 4F7EA 6CGTA 5DURD 1OCWH 4HLZH 1UB6B 3V4VB 1ZY9A 3V95A 3MFFB 4C58B 3TBCA 1SUHA 4ODTH 1I3GH 2D0HA 2WVTA 4PTTA 1BZDA 2FTAA 3PDGA 4GBXB 3W5NA 3WTXA 2VDNH 3V6FB 1Q9WA 4OCLC 5TE7L 1QATA 5ENWB 2NY6C 3LKNA 2YPLE 3HI1A 2B59A 1ZLSL 4B9PA 1UFUA 2HVKB 3ILQC 2R1YA 1CGYA 3D25B 2M83A 2EKJA 1SHXA 2YD9A 2IANA 1NOFA 1I1FB 2FEDD 2XWBB 4PVMA 1ACZA 4WUUB 2NX5A 5C9JB 2VLJE 1UM5L 3CXHJ 1K3IA 4L9LC 4HAFA 1MW2A 2ATKB 4OZFB 4AEFA 3EOBB 2H2PC 5LXVA 3NFPB 5B3NA 2VW4A 4J2QA 4L37A 4OLEA 1O7VA 2HMID 2YK1L 4CBPA 2DLFH 3O3AB 1ES0A 2FB4H 3QARA 1ZJAA 2GEQA 3MBED 1ZV9A 1OARH 1AS8A 2K45A 1FWXA 1WLHA 3HG4A 4JZOB 1I1YA 2FBOJ 4PJDF 4ENED 1RUQL 2ADJA 2B1AL 3MJ8B 1EQWA 4ONHB 3H7LA 3JWOC 5KBKA 5A3IC 1NPJA 1P5UA 2DRUA 2YQBA 1F2QA 2NY4C 3GSNB 3OAYH 5D1ZA 3VWKC 2PMZA 4HCFA 3D2UA 5L4MA 4JKPH 1A9BB 1I7TA 2VLRD 4FULA 5M95B 4N6RB 4U0RC 1A6ZA 4B0MM 2D3VA 1T1XA 3NACL 5KOMC 3LNHA 4HWBL 4G42A 1WA0X 3L9RB 4DZ8A 2YUXA 1FE8L 4Z77B 1ZA3A 2PPCA 3C5SA 3GLAA 1DZBA 1T5WA 4JKPL 4R26L 5I6OA 3Q13A 4ZFQA 3PRZA 1NA8A 2FD6L 2DQJL 2EE9A 3MV8D 4G9FA 5E8NA 1TENA 2GUOB 2K3TA 2J7LA 5I19L 5CD3B 2VXTL 4O51B 4MA8L 4QRRD 3U7WH 4XPAL 3V5DA 3OMIB 3RU8H 5IESH 2ZUUA 4JVUA 1A3QA 1D7FA 4QHUB 3FOLB 1PKQB 1F11A 1GGIL 2OR7A 4HWEH 5GXBB 3QH3B 1LE5A 2CD0A 4W6XB 5ICUA 1QACA 2AZUA 4O58H 3K6IA 3U0PA 1ZHLB 5A43C 3E3QE 4Z0BL 1RJCA 4M6AA 4R8WL 3HVNA 5L7XL 1JV5B 3ZE0E 4V1DB 2CJUH 2XRAH 2J44A 3FH5A 4HH9B 2QELA 4G8EB 2ITFA 4LSRH 4XVSL 1JNHB 5L8JB 2O5NA 1FE8H 3VD4A 2K8QA 2IDCA 3LQAC 1J5DA 1NGWB 1WTLA 3MA7A 4AIZB 3DUSA 3TEZA 1A6UL 1M4KA 5AKSA 1CF8L 5DZ9A 1CUOA 4HJTA 4JN1H 4R2GC 3MLTB 2VN3A 1LLAA 4FLOA 4LCVA 2DIEA 5D7IA 4NQXB 3GXNA 4K94H 4NEHB 3BW9A 4PJIB 1EAJA 1EO8L 3GZOA 4KTEH 3PG2A 2DL9A 4L4TA 2JJTC 4MDJA 4U7SA 1U95A 2XWXA 2VMFA 1HXMB 3TCXA 3DTXA 2XTJC 4L8BB 2BM3A 3G3LA 3D39A 2A6DB 4M4RA 1BW8A 1DLFL 4BKLB 1AHMA 1YEDA 3PWUB 4ZXBB 2IOOA 3BZFB 3EYQC 4FXTA 1YRKA 1BQLH 2YRLA 3C2AL 5C97A 3V0WL 4P04A 4MJ4A 3VFPA 4FG2A 4M4RB 3MR9A 3ILPB 3GMMA 1BAFL 2WQVA 2AEPL 4XBEL 4V33A 1NC2B 3EIFA 2BSEA 1FFNB 1NIAA 5D9SA 3RPIA 2Y3NA 3O11A 1AGDA 2WB7A 3V0WH 3FQ4A 3PU7A 5EF3A 2R29A 1TCRA 1UJ3C 2FHBA 2PWEA 4HQQL 4N2NA 4OQTA 5DD0L 3D09A 2AQ3A 4MCYA 3DJSA 3RTQA 3W11C 2CLZA 4XNMB 1F58L 1E40A 3IDNA 1MXDA 4K23H 1CBVL 1VGKA 2XWJA 3MGAA 1OZUA 1EO8H 2EP6A 4HPYH 3IVKB 1JFQL 3EH5B 1W8NA 3N42B 4AVKA 5AG9A 1VFUA 3F04A 1IQWL 5T1KD 4DGYL 3UBXG 2ZF9A 3KPSD 4PRDB 5HHMB 5TQ0L 1H8NA 3W0WE 3RWEA 1V7ML 3QJTB 1BVKA 1KTRL 1LILA 2X89A 2WKOA 4IHBA 4XXCA 2N56A 3L4XA 4P3DB 1RVFH 3AMLA 5AVTB 5HJGA 3GIZL 5DHVH 4G5ZH 3IDMA 3DETC 4BYHA 1J9CT 2TRHA 2X9YA 3ASWA 3WKQA 4BH8A 5FGCE 1MCLA 4S2SA 4AGLA 5JOFB 2YD5A 3UADA 4QD2E 1A6VH 3MOBH 3PWPB 4OZGB 2ARJB 3CPLA 5ICXB 3Q6FB 3T4YA 3P0YH 2FH6A 1A7RL 1FZJB 3AXLA 5E8NB 1BZ8A 3EHBC 3L4TA 1QW9A 4L1TA 1I7ZA 1NC2A 3MGTA 4QRAA 4MJ5B 5FKAA 1CQKA 3LOWA 3LQAL 3MR9B 3NTCL 4TPRL 3QDAA 1CD1A 1TETH 3QUGA 4JCWA 5IFJA 3K0WA 3JTTB 2BY0A 1J05B 3SYAA 1MAJA 1N19A 1G9EA 2DWSA 4AYFA 2Q87A 4CMHC 2YGNA 5FGCB 4YMPA 4LGSB 4HBCH 1ZANL 3IKKA 3SKOB 3TO2B 3II2A 3U6XA 2EEFA 4XMUA 4OFVA 2Q2LA 3WL9B 1WG3A 1I1RA 3LKRA 2H8PB 4FMKA 4FXGC 3WEBA 2FECI 3NFSH 3AREB 2WY3B 3B2XA 1QFWH 5DDHA 4FJZA 4N9GA 3PNWB 2BP8B 2DM7A 4Q0XH 2CGRL 1OCWL 3FSOA 1BM3H 3IF1B 2CLVB 2K7QA 3MAWA 3UYOD 2OCJA 4OLYH 2XKNA 4MNQE 1I8AA 3FU6A 1VEPA 3CFBB 1TLKA 3HIZA 2FO4B 3MRIB 5EOCJ 4XNXL 1E65A 5CP7B 4EDXB 2F53B 1TYJA 4EN2A 3FL7A 4XO3A 4IGBC 3INUH 4JKWA 2VC2L 4AGQA 5I1LA 5EU7C 4DQAA 1SN2A 3WIFB 2F54E 1D9KD 4RFNC 3EH4B 4G82A 1MPAL 2A0LD 4PJ8B 3TL5A 3KMDA 2CM6A 1NAMH 3V7MA 1JZFA 2X4OA 3DTDA 4K5MA 4HETA 4AQZA 5C0EA 2CUHA 3KJ4C 1HH6A 4N0YH 3KPQB 1LHZA 1HU8A 5D71H 1HEZB 5I1AB 4E0RB 2WLNA 2V8LA 4Z7NE 5ITBH 2WOBA 2ZUYA 4I13B 4XWOC 4TUOA 4KUCF 1MRDH 2CALA 4P2YA 1QHOA 3HPJA 4D9LH 4W9EC 2PKDA 1KBWA 5GGQH 1J8KA 5BXFA 4XC1L 4GY4A 4QRTB 3ARYA 5L2KD 1C5BH 4G6ML 5BO0D 3VRLF 4DPAX 4HG4J 5MEQB 5BQ7A 2X1XR 5LO7A 1LEIB 2DLTA 2IAMA 3BI9X 3TA3C 1MUJA 1NGPH 1IO4C 3TJPA 4Z7VB 4NP4L 2YZ8A 3VXRD 1WJ3A 3TJEH 1DJWA 2JE8A 4XNYH 3C5ZC 3H0TA 1B0GA 1WK0A 5B22A 4MJID 4NI3A 5KYXA 3FCBA 1R3KB 4YDLB 1F41A 3K80A 1HS6A 2K9UA 3BUQA 2ZXEB 4TNWK 2LFEA 3FQTA 3SDYH 1H5BC 3MUGA 4N1CA 3B6SB 3DPBA 2PW1B 4WFGD 3NFPA 4KROB 2O6PA 4UV7H 3UTSD 3WTWA 2LU3A 3FTVA 3SPGA 3K6NA 4LLVA 4EI5D 1S7WA 1ACYL 1F42A 3D39E 4L2LA 4HYTB 1KWGA 2JKRM 3P4OA 2I07A 3R0NA 3OKNA 3L7FA 5L7XH 3MBEA 5FA4B 3KNBB 5I1DA 4ELMB 3O11B 3LKQB 1FL5B 1MF2L 1Q0XL 1FFNA 5JNYA 4NC1C 3WFHB 4TVSa 4X7TB 2CKBA 2VUYA 3TURA 3TIEB 1JV2A 2I24N 2A9ML 1HKLL 4Y1AB 5AD0B 3ZSSA 3LZQA 1BQHA 5FECB 3QDMB 5I18H 4MDRA 1GMEA 2YD1A 2AK4D 2VXQH 2GT9B 4KDVA 5AWNL 4XMZA 1M7DA 1ONQB 4B0MB 4MMXA 5IMLA 1PCSA 4Y4KC 1MCDA 2ITCB 2GW5A 2VDKL 1IM9D 3HG1B 5CD3A 2VLKE 3VD1A 3DECA 1ZD6A 3ARBC 3AXLB 3IFLH 3MPCA 4JFZL 1HJBC 1C5DB 5GISL 5TJWK 3W11D 1SJMA 3VACA 6PAZA 4PJBF 1FUNA 3OQRA 2X09A 4HUXB 3SBRA 3UAJD 3UYRL 1J1XH 5E7BA 5FHBH 1QBML 4FNSA 1A64A 4UNUA 3WMSA 1WAAF 3EO1B 3O6FA 4DKAA 3VFUA 2J72A 2PPFA 4NO0A 1WD8A 2FJGA 3FTSA 4WUKH 2BWIA 3TA3A 3GZPA 4IMKC 3FRUB 1OALA 1Z9NA 4IIQC 4AGOA 1NOLA 1CC3A 4I18C 3QIWC 4FN0A 1SYSA 2OMUA 3RA7H 4Y9FA 2P8LB 4DZBB 4OH2A 1VGEH 5GSRB 3GPSA 2NNCA 2MCG1 2HX9A 2X4RB 4G8FB 4XPGH 4WFFD 2X05A 4FCAA 2N0MA 3VRLE 3RFZB 2W9EH 3C6EA 3CHPA 3PWVA 2UUDH 1HZHH 2X7LA 3IRZA 3L5WA 1ET8A 3GBMH 2NY7H 3NDZE 1N5YL 4TMPA 3QUYB 3QPQC 1GAFH 2F9BT 4FQJH 4S1RL 1UJTA 1A1MB 4RFEB 1MW0A 3WV0A 2YC1B 1IGTA 4JANA 3EO9L 3M07A 4YSQA 3MRMA 1HINH 4XBPB 1YMMA 3LV3B 4XT1C 3ZYJA 3DXAA 3WUWB 5IR1B 4FFWC 2XN9D 3GD1C 4AH2B 1MAMH 1YEHL 2RA1A 2VO8A 3QHFL 4GRWH 3LKPB 2KPWA 3RURA 3PXJA 3VD0A 3WNNA 1OQXA 1H15A 4OLWL 3RKDC 1NFIA 2P52A 4IOSD 1GGCH 2D0GA 3FYIB 3SBQA 4G6FD 4AKPA 2OMVA 1GZHC 1A7PH 2BNRA 4PUBL 5AOKA 4F7PB 4FG6D 4BKLA 4XN5A 1HCVA 3QIWB 1P4IL 1F6AA 2Z92A 1RPQA 3GJFH 1UC6A 1QFHA 2PTVA 5ANMB 2CK0H 2Y1AA 3SBWC 2EILB 5IB2B 2G5BA 3IDUA 4NUGH 2AQPA 5D1XD 2G3ZA 4CVUA 1QUNA 1FL6A 1JWMB 2DH3A 1YDPB 2W60A 3M17A 1QLEB 1T7XA 3BWAA 4ZDHB 4DP4X 4S0HA 1FNGA 3JV4A 3SHSA 4HJJL 4KZDL 2OL3B 2NTFA 1CFQA 3RIAF 5DRWB 2DQTH 1DDHA 1I9JL 4LSSH 1MFVA 3LB6C 3QS3A 3ZKSD 3HZMA 2GC7C 1NJ9A 3X1NA 1E5UI 1RFDL 1SZNA 1X4XA 3ARDD 5G2NA 5CSBA 2WKOF 2ZNXA 3KM2A 4NQSB 3UTOA 4WV1B 2W0LA 4LQFL 1T7VA 1IRAY 1DLHB 4DEPB 3CDFA 4LEXH 4WFFE 4ZSOB 3GZQA 1WAAE 3H7BB 3GSXB 1IFGA 2V8MA 4XVUC 1I3RB 1TQCC 4JL2A 5A3ID 4ODWA 5DR5L 2A6JB 1HAWA 3RRQA 2PO6A 1TZHB 5HHXL 3RGVC 1AD9A 3BUBA 1GYAA 2VW7A 2YUVA 3NIDB 2BVPB 4TQHA 4Z5RB 1DJGA 2Q7AA 4UTAL 1ZT7B 3VH8B 4GG6F 5AB9A 1HWGB 4Q97A 5AB1A 5EUOA 3UAFA 3BWSA 4Q9QL 1T66D 3GTTA 1CDJA 5EOCH 1NANI 4UIMA 4F9LC 1KGIA 2ESVA 4X4YB 2WNKA 4KNSA 5DJAB 3GMQB 3FQNB 4WO4C 5DFWH 1KYFA 2CBQA 3LMJH 4HPHA 2FEEI 3JQOB 4RAVB 3A23A 4HVBA 4ODVL 2ZYIA 3ABMB 2A5UA 4PJFE 2DWXA 2H45A 3OHXA 3ZRSA 4KMTL 1UT1A 2BNQA 5I1CH 1I8LA 2VLRB 2DKMA 5KVFL 1E9OA 3PL6A 3REVB 3US0A 3V4VH 1JPGB 2IPTL 1DQJA 1ZKAA 2DWDA 4LF3A 1XT5A 4BGDA 1L9QA 2H6OA 3WD5H 3IDJA 4I1NB 2CO6B 4W9HC 3SKMA 4MA8H 3ME0B 3SE9L 3QUZB 2Q20A 3GWJA 4OLVH 2XQ0A 1Z0MA 3LEYH 3IMTA 1X9UA 5LBVA 3L9YA 4QEGA 2M26A 3E80A 4F9PC 3FT1A 1EFXB 3WD5L 2DIAA 1D5XB 2NR6A 4DGUA 5HHQB 4BM7A 4OI8A 2XWCA 4GKNB 3AUWB 3CV5A 4QLRA 4CKQA 1LTXA 2YPLA 4HT1H 4L1SA 5HYSA 4YXHH 3JYBA 2OXHA 1A8ZA 1ITCA 1QSFE 4JPIB 2H0JA 1DVSA 1T1WA 2JCCF 5I1IH 2ZTBA 4X6DA 3CFCH 4GQZA 3V4PA 1G5AA 3K74B 3VYPA 1ODAA 2ITCA 4N86A 5IQOA 4XPAH 2JFCA 2OMWB 5JHLL 3MFFA 1CLCA 2GG1A 4UM9A 5F6HI 1EEYB 2OTWB 5DMYA 4ZNEE 2IO5A 3QVAA 1TTGA 2F54B 2QQLL 2UZYA 5BZWA 3L1EA 4BZ2H 4E9XA 3QCVL 5C0CD 4KKNA 3N04A 1MHEB 1WGVA 3GI8L 3V6ZB 4NNXB 1EX0A 1QLFA 4ZFGH 2CUMA 2D03H 3NDYE 1M2OA 3WHE1 3T2OA 1ZGLP 2A4EA 4GOSA 1IM9A 3EOYG 4NNPL 4ZTOH 5EU6B 4AEIH 4PJXB 1K85A 1P69B 4U1KB 4EN3C 3ESPA 2YSSA 3BIBX 1IEBA 3S8FB 5GGVH 5JDSB 4IRJA 4R7DB 2XA8H 4D0BB 5JHAA 4XZUA 4R3SB 3GB7A 2W65A 3KLSA 2GHWB 3NVQA 3MUGB 2ZP9A 3MO1B 4RGMB 5G5DA 1FVEB 5IOPA 4GSRA 3ZPDA 2O61A 1JL8A 4LKXA 1XIWC 2DYPD 4IKJA 3WLWD 4HLJA 4B50A 5DHYB 1KB9J 4R2GB 3GUFA 4NQVA 3MGOA 4GKLA 4KFMA 4LOUC 4QRBA 2D31A 2UWEE 1KTJA 1U3JA 3TEWA 4QR7A 1R5VB 4JPWH 4NJAH 2J8UB 2R2BA 4L05A 3TH3T 2D31B 1E30A 4GI6A 4H1LH 1Z3GL 2X9XA 1U2CA 3O8XC 5FCSH 5KUKA 1G9ML 1GGIH 5DJ8B 3QEQB 1N7MH 5HDOA 4JO1L 4Q56A 1S9WA 4BINA 4XVJH 3RWFB 3RKDD 3GXDA 2YAQA 4LCWA 2WXHA 3KPSA 4HZLB 4ZK8A 5KW9H 1IV8A 4IM8A 2IQAB 3FT4B 1Z5YD 5DJ0B 2DWEB 4GSDH 4P0DA 3VGDA 5CEZD 1I8MA 3D1MC 4UNIA 4E42B 2FCBA 1OAUH 5DJAA 5B3SB 1IQDA 1TZIA 3PWPE 4OZGE 4KKQA 3VRJA 4FA7B 1NL0L 3IKCB 3NIGF 1WBXA 5EU4B 4OT1H 2ZT9C 1OGAD