3NP3A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 38
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np3A00
5FC9A 4X4KA 4RH4A 4YSUA 3FS9A 3FSZA 1XB6A 6PAZA 4N8UA 1XB8A 1AS7A 1WA2X 8PAZA 3BVDB 3T6VA 1KBWA 4K9JA 3UABA 3WKQA 4CSPA 2H47C 1SHWA 1PLCA 4W9ZA 4BDVB 1ZPUA 1BQKA 3PCYA 1J9TA 1JVOA 1HAUA 3V9CA 4YSTA 2VSKB 3L45A 1BQ5A 4BWUA 1GW0A 2GC4C 3SBPA 4Q89A 2B08A 2BW5A 2XU9A 1URIA 3NSFA 5I6LA 4M4RB 3NJHA 5TK2A 1M57B 5D4JA 1NIAA 4DP4X 1AZCA 1J9RA 2IDTA 4JKNA 1CYWA 3NJIA 4UF7C 1W6WA 2JFCA 1PLBA 1ID2A 1SHXA 3AG1B 4M3HA 4L0PB 4A68A 2HRGA 5A7EA 2GBAA 4E9XA 3WI9A 1WAEA 2N0MA 2P80A 1I53A 2EIKB 1ZIBA 2R7EB 1AZBA 4GP8B 4DP5X 3DIVA 3NT0A 3TU6A 4GYBA 3ERXA 1JZIA 5B1KA 3S3DB 4HCGA 4YVNA 2YXVA 4HAKA 2PP7A 1PMYA 2QT6A 2YAMA 1AZNA 3FQYA 4YSDA 1JXGA 2XYBA 1JXFA 1ZDQA 1AS6A 1CC3A 1MZZA 2UXTA 3AG2B 1SFHA 2IDSA 3CVDA 2EILB 1AOZA 1OV8A 2VW4A 3ZIYA 5AKRA 1AS8A 4A2EA 1V10A 2IAAC 4GP5B 3FYEB 1NIDA 3QJSB 3G5WA 4JHUA 2IDFA 1NIBA 1N68A 2EINB 4HHGA 3KW8A 7PCYA 5B1AB 6PCYA 2J5WA 4YVUA 2Y69B 4G72B 1JZJA 2DV6A 4BDVA 4JHVA 3GYRA 2TSBA 4A67A 4P5RA 3NJNA 1OCZB 2I7OA 2IWEA 1PF3A 1A3ZA 2YAOA 3SBQA 1A8ZA 1KDIA 1PNDA 1NDTA 3HB3B 4FA7B 4KO6A 5B7MA 5PAZA 2NRDA 2VW6A 3IBOA 3D12B 5LDUA 1JERA 3ABMB 2DY2A 2GB2A 2VSMB 2YARA 4E9YA 4WTQA 1AG6A 1ZV2A 1NIFA 1L9SA 1QLEB 3GDCA 4F2FA 3IN2A 1JVLA 1NIEA 3FQ1A 2XV2A 2IDQA 1ILSA 3KW7A 2FT6A 1BXUA 4AKQA 4YSOA 4YSAA 1SF5A 2R7EA 3T9WA 1JZGA 3NJKA 2DYSB 3WNJA 2FTAA 1L9QA 4Q8BA 1E30A 4DPBX 2PPEA 2EIJB 3OQRA 1VLXA 1GR7A 1WS7A 2J56A 3N55A 1OE1A 1A4AA 1IC0A 1ET5A 2B3IA 3T6ZA 3T71A 1KBVA 2BP8B 3EF4A 3FU9A 1XMEB 3AZUA 3C75A 2DYRB 3S8GB 2A3TA 1PY0A 3ABLB 1OCOB 2I7SA 4QKTA 1GS6X 4A66A 4UAHA 1QHQA 1X9UA 2WO2B 1IKOP 1SFDA 4ENZA 4E9WA 3FYIB 1NINA 4MFHA 3DTUB 3EH3B 1L9RA 4KO7A 1GY1A 3UGEA 4BXVA 2HX8A 1KGYE 4F7KA 5B7FA 3NSDA 1J9SA 2AZAA 5I5IA 1OCRB 4PCYA 1A4BA 4E9RA 3SQRA 1ASOA 2BWIA 2ZOOA 4HCFA 4AKOA 1YLBB 1EZLA 1UATA 4AI7A 2IDUA 2QDWA 2FT7A 3AW5A 2GC7C 2WSDA 3S3BB 4NERA 1BYPA 3UAEA 1MG2C 2VM4A 5ANHA 5B1BB 1W8EA 2CCWA 1MDAA 4G71B 1TEGA 1BXVA 1NPNA 1V54B 2XX1A 4KOBA 4DP2X 2FT8A 3MX0B 2PP9A 2DWSA 1SNRA 1AANA 2BZ7A 4CSZA 5D4HA 4A2FA 5TK4A 2FQEA 4E9QA 1M56B 2MRYA 3V9EA 1OOWA 4DP1X 4E9VA 3CVCA 2CUAA 3FSAA 4WKXA 2X88A 2RACA 2HX9A 2AVFA 3H4FA 2HRHA 1BEXA 1ILUA 1ET7A 1SDDA 1JZEA 2H3XC 1IUZA 4DPCX 4EF3A 2BP0B 1AAJA 3CDZB 2P80D 1GS7A 4AZUA 1SJMA 5B1JC 2H5UA 4ZK8A 3EH4B 2YQBA 5I5MA 4AX3A 4P5SA 2OCCB 1QNIA 2JKWA 1L9PA 3ASNB 3NYKA 1AIZA 2BP8A 1A65A 1WA1X 3QJTB 3UADA 1HAWA 2Q9OA 3FPXA 4HALA 4YSRA 1KV7A 1OE3A 2J57A 1EHKB 1NPJA 4YL4A 3X1NA 1RKRA 4KO5A 2CBPA 1CURA 3TA4D 2PPAA 5I6MA 2XV3A 3NJJA 2HX7A 4HIPA 1AR1B 3QJRB 2VMJA 3TASA 3AY2A 4G7RB 1ZDSA 3TBCA 5EHFA 1ZIAA 3AG3B 3WG7B 1IBYA 5B7EA 1PAZA 2YXWA 4F2EA 5I6KA 3FU7B 3ZX1A 1FA4A 4BWWA 1BYOA 5B3SB 4TXVB 4A2DA 2YAEA 3NJGA 1DZ0A 2BWDA 1RCYA 1NWPA 2IWFA 3OMIB 3DKHA 4DP6X 3FPYA 1NTDA 2VW7A 2GIMA 2X87A 1PZAA 5I5JA 4W1TA 3CVBA 5F7BA 3WNIA 1AQ8A 2VM3A 3NSYA 3CG8A 3NJFA 3QJVB 3QQXA 1AG0A 3X2QB 1OF0A 2WO3B 1JOIA 2YAPA 2BP0A 2PPDA 2XUWA 3ZDWA 5I6PA 5AZUA 1JZHA 1E67A 3CZUB 4GY4A 2XXGA 1BXAA 3PLYA 2XLLA 2I85A 1M9WA 2XWZA 1B3IA 2HXAA 2AANA 2GSMB 4DP9X 7PAZA 1KCWA 3AG4B 2YAQA 3SBRA 2Q5BA 1TEFA 3TBBA 1GS8A 2PLTA 1ASQA 4KNSA 4HCIA 1V55B 3X1GA 3ABKB 3EHBB 4DPAX 2BW4A 1J5CA 3OD3A 1T5KA 1GSKA 2FWLB 4G70B 2FQGA 1PLAA 2OJ1A 2CAKA 3EH5B 4BWTA 1GY2A 1E5YA 2QPEB 2W88A 3GXUB 2FJSA 2EIMB 2ZONA 3FT0A 1L9OA 3UAAA 1W6LA 4YSPA 3NP4A 1RZPA 3QPKA 3QJUB 4NB7A 1NZRA 2AFNA 3NJMA 3QJQB 3FU7A 1SF3A 2UXVA 2YAHA 1N70A 1AACA 3PAZA 4FAAB 2HZHA 1XB3A 5AFAA 1JZFA 3FQ2A 4HZ1A 5B1JA 1F56A 2JXMA 3WKPA 2IH9A 1MG3C 3S3CB 3X1FA 3X1BA 3NP3A 4YSQA 4QLWA 3BQVA 4YSEA 2YAFA 1BAWA 1PNCA 2XVBA 4BXSV 2XX0A 3NSCA 2IH8A 1WS8A 2UXFA 1DYZA 5I28A 2XXFA 4GP4B 3H56A 3OM3B 3UACA 2CALA 4PAZA 3MBWB 1J9QA 4E9TA 5PCYA 5F7AA 2UXGA 1CUOA 2BO0A 3ABGA 1PZBA 4A2GA 3FSVA 3X1EA 1ETJA 1ET8A 3T6XA 2DWTA 2UX6A 1CYXA 1ASPA 2MTAA 1BQRA 1JXDA 3T6WA 2GI0A 3FSWA 2ZWNA 3ASOB 4KO9A 1RZQA 3RYMA 3PXLA 2CJ3A 1NWOA 1KCBA 5IY5B 5D4IA 3OMNB 2HLEB 3WIAA 2PCYA 3PAUA 2PPCA 1PZCA 2Y1AA 2UX7A 1KDJA 2E86A 1TU2A 4G7SB 3IE9A 3H4HA 3JTBA 1FWXA 9PCYA 4KNUA 2ZXWB 2VN3A 2BZCA 1A4CA 3IEAA 2XV0A 1WA0X 2TSAA 5I6OA 2OV0A 4G7QB 1PCSA 2W8CA 2LLNA 3JT2A 4N4YB 2PPFA 1ADWA 2QDVA 1E65A 3NJLA 1MZYA 1NICA 2BHFA 1IBZA 2PCFA 3U25A 1E5ZA 3CDZA 2FQFA 4NAJA 4DP7X 5I26A 1KYAA 2IWKA 1L9TA 4A2HA 4DP8X 3S8FB 5E9NA 2GHZA 2FQDA 3PAVA 3ZBMA 4YSCA 1HFUA 2QPDB 1AZRA 1J5DA 1GYCA 1OCCB 3N2JA 3PPSA 4UANA 1SDDB 1TKWA 4E9SA 1OE2A 4GXFA 3FU8A 3IN0A 2J55A 2PP8A 2FNWA 4DP0X 1R1CA 1X9RA 3HEIB 4HHWA 2AZUA 1FFTB 4BK5C 5I6NA 1AZUA 3OMAB 4KNTA 4AKPA 4YSSA 4KOCA
chains in the Genus database with same CATH superfamily
5FC9A 4CADA 1UZ6F 4FKKA 2WMPA 3SE9L 3VFPB 5LGHH 1BXXA 3C5XA 1ZK9A 2QV4A 2WV3A 4EKXA 1YEKH 2VUYA 1L7IL 3BUTA 4KU1A 4CSPA 2H47C 5F9OH 1KOAA 1B4TA 4N2LA 3UTZB 3JVGA 1EJ8A 4MNQB 3UC0L 3ECWA 3INOA 1J9TA 4L0YA 2WWKT 4LGPB 4U49A 5FF6A 4YHPB 1UKQA 5JNYB 4CN6A 3EG9B 1BQ5A 5HGHA 3RGBA 1CXHA 1GW0A 3ARPA 4K07A 4TNVF 2I27N 4FOMA 4LKXA 1ORQB 1H8LA 2DKMA 3TBSB 4TRPH 4O51B 5J11C 3KPSD 3F58H 1UTDA 2V3DA 3ARED 2J8OA 2GJRA 3IETB 4FZEL 3OHXA 1T04B 4HF5H 4WTXA 2IMMA 4WO4B 3S3SA 1LQSR 1UWEL 3RPBA 3S8WA 4FI8A 1UOVA 4OT1L 3RVTD 3AS0A 1MRDL 4NO0A 2EH8L 3KJ4C 5ETUA 3GIVA 1IGCL 4N6RA 4XBGB 4P49A 2ADYA 1Q90A 2EIDA 1XF4A 3LZPA 4U1HA 5EBLB 3SQOL 1RUQH 4HJTA 2FZ3B 1ZLWK 2NTSP 3B37A 1WV7T 1Z6JT 4NCDA 2GCYA 3BP6B 4G8IB 4D9LH 4X9IA 3RHWK 1ETA1 3VXSD 1MCPH 5FO2A 2NUPB 3HNVL 3B9AA 4DKTA 1ZDQA 1G7HA 3V5DA 3EYFA 2GY5A 3AG2B 5T3XL 2MOVA 5FX3A 3HNSL 1DANT 4EIZC 3FRUA 2ZOUA 3MJ7A 2V9RA 1P4BH 3UTSE 3RWCA 3FYEB 3N1PC 2XT1B 2OYLA 3SY6A 4PR5B 4HUCA 4HHGA 1OW0A 1ETZB 1U42A 4L8SB 4K0OA 6PCYA 3PWUB 3U4AA 5I1GH 4HBCL 4EN2A 3GKWH 2J5WA 4U1SB 1YQ2A 1NCCL 4LU5L 3KPPA 3THMH 3BIBX 4I13B 2FJHA 5IJKC 5EEWA 2VXSH 5JR1L 4HZLA 2TSBA 2Y7MA 5DCCA 3JZYA 3SPIA 2YEQA 3QDMB 2X4OB 1PF3A 3L3OB 4GAGH 2JKNA 4M00A 5EIQA 4FD0A 2CLZA 1NDTA 2IANA 1FVDB 3C09C 1AGCA 3PHSA 5AVYB 2UY7A 1HESA 4B3VA 3CX5K 2VLLB 2V5SA 1PEZA 4HLEA 4NQTA 4TOYL 1LK2A 4XAWL 4H88H 3JQOB 3IN2A 1KENL 4ZXBC 4M5TA 1ITBB 1IGYB 4P23C 2P3YA 3D39A 3VD5A 2DYPB 1AP2B 4PJXF 4P2OB 1M7UA 5BS0A 3S88H 3NFNB 4RFEB 5C07A 3ARFB 4L3ED 5C2UB 3OZ9L 1MQKH 3JWOL 5KBNC 3K72B 3A67H 1UC6A 2DMBA 1GR7A 2RD0A 3BAEL 1HWGB 5FO8B 3BN9D 1JRHI 1IM9D 4BQCA 1ADQH 4GRWH 1J11A 3O3EA 4WSJA 1BD2D 4HBQA 1FI8C 4UQEA 5KW9L 3MUGA 2K8QA 1SOKA 3P11L 1TZOA 5EULV 3LPGA 3HC4L 5E5RB 4FQJL 4OJFL 2LQRA 3PXJA 2ERJC 4F93B 3QWOA 5BZDA 4IGBD 3V6OE 3Q9PA 1GGBH 3LSOB 1BX2A 2OZ4L 3IMTA 2B0SH 4XN8A 4NNYB 4YHKL 4LHQB 5C0BA 3LN5A 3X12A 4NN6B 4NT6A 5HYSG 2NZ9D 3UGEA 1S5HB 1KXVC 2PTTA 3QCUH 4WUUE 4X6DB 1KN2L 2HA1A 2XWDA 3BWZA 4GBXB 2BK8A 2DQIL 1T7XA 1A6VH 1P4IH 3QEUB 3AMLA 4GAJH 2RHEA 5DLML 2A99A 5JUEH 4EIUA 1Q0EA 4H20H 3ZRCC 1UATA 4ERSH 4RCAA 1E7VA 3S3BB 1XD0A 2WSDA 2BDNH 4MBOA 4NERA 1E5CA 1ZT1A 5HHME 2OMYB 3SDDD 4PWIA 4W9LC 4PJGB 3TIEB 5LVEA 5MENA 2CCWA 2NX5B 4V33A 3PQYA 1UXSB 2Y06L 4X0NA 3DYMA 5EZIL 4R7XA 1A6ZA 4OZIE 3KVPA 1I9IH 3ZW3A 5EZLA 3LZQA 3DA0A 1U8PB 3GXDA 3HKFA 3WEBA 3BAJA 1E4XH 4I89A 3H42H 5GGSA 4DK3A 3HRZC 2ZCKH 2VXUH 4KUZH 1QP1A 2YEVB 4N3TA 2FX7H 3RRQA 5AW0B 1ZCRA 3DSFL 4ODHH 1SDDA 1VADA 1NM4A 1IUZA 2GITA 2JB5L 5B3JF 3C5ZD 4AZUA 1SJMA 4ZK8A 5I5MA 3MV8B 3GSWB 1HU8A 4NQCA 1L9PA 3GBML 4QXTA 3QJFA 1J05B 4M7JH 1DO5A 5SWQB 5I23A 3K71B 4MLIA 1OTSC 3QXWA 1CDBA 1AQKH 5IJKA 1KLUB 4P2RA 4XMTA 4K94H 2LLLA 1I1YB 5GGTA 1KCVL 2CRZA 5TF1L 4OIIL 1MVUA 5HGDB 1F41A 4FFZL 3P4NA 4YZFF 1XGYL 4OCRL 5FDYA 4R5TA 2CMRH 4OLZL 2ITDB 4J1UA 3MRBB 3HG1D 4C83A 3CZNA 4CSTA 1IAII 2B77A 1SJHA 3UPCA 4F7TB 1IVTA 2OP4L 5EOQL 5C3LD 1F97A 1CU4H 3SKNB 4R7LA 1GIGL 4HK0B 1MFDH 4OF5A 3N42F 4WK4B 4FQIL 1KFGA 2ED8A 1U30A 4P9ML 5F9WC 1J0IA 5FGSA 4HISA 3WAJA 4LNVA 4TSCH 2HB0A 5SWZE 4P23A 5E5MA 1CBJA 1GGIL 1HSBA 5I6KA 3RVVC 1LD9B 3N85L 3TBYB 2R9HD 3H7BB 2DJMA 5KBDA 2RMNA 3G6JE 3H9SE 1WWWX 2O72A 3QQ4A 1WT5A 4K71B 1A3RH 1WITA 1M6OA 4PW9A 3ZJAA 3OXRA 3V52L 2OQJA 4Y9GA 1AFVH 3Q9QA 4Z7AA 5E51A 5JQIB 1KEMH 5AZ2L 4NQDA 2BXYA 5KBMA 4ZYKB 5FHAL 3TJEH 4MB1A 1M42A 2D7TL 4IIZA 2TAAA 5TDOA 1LNUA 2HN7A 5CGYD 1SN2A 3P4MB 1MCWW 2ODHA 3GJFA 3RGVD 3BPLC 3MGAA 4G1EA 4LCYB 5HP5A 4ORGB 3GK8L 4LOUD 1A7BA 5E9DA 4M1GH 2WO3B 4LOFA 3WL9B 2AP2A 2P9RA 4BCYA 3H2WA 5TE4H 4TNFA 1UA3A 1HEZB 4IMLA 2XXGA 4QCIA 5DLLA 3PIQA 4OSUH 4PB9L 1DANU 1KTKE 3O45A 4PWEA 1KXVA 4G6FD 4UT6L 4Y4HB 3TWYA 2CM5A 4KDWA 3MYZA 4KKPA 1FZOB 1QFOA 4FYRA 3GEFA 7CGTA 2ZWLT 5CCGE 4JBSA 2FGWH 3BP7B 1U6AH 3ABKB 3IDNB 3ULUE 3W5MA 4KRPC 3WO4B 3STLB 1N8ZA 4Y5VB 3FQTB 5T5FL 3HVDA 1SOQA 4ZPVB 3DX6A 1H3UA 1MCEA 4MDRA 3F7YB 3HOGA 4WEUD 3N43B 3GXUB 1RMFL 4LVHC 3FT0A 3POHA 1OCWL 3IXAA 3GD1C 3PU7A 2DIAA 3HJ0A 4NC0B 1J5IA 3H9ZA 4FQPA 3QJUB 3CXDL 3G6DL 4H0HB 4OH2A 4TULH 2Q8BH 3GMMB 1EXUB 3HRZA 5KSBF 1N0XH 3FDWA 3VAEA 4AYBA 2UXVA 1RVFL 1YYMH 1F3JA 1JPGA 1QMUA 1W72B 2BVYA 2Z8VC 4MJ4A 1XB3A 1XL6A 1ZTMA 2WAHA 3HI6H 1JWSB 2X10A 1MH5A 3KH4A 3KGSA 5DMYA 2CCLA 3S3CB 1KWKA 4OCSL 1X4ZA 2R23A 4U05A 3G08B 4F8PA 5G2NA 1HINH 4XVTH 4CMMB 4HGMA 4GG8A 3NRPA 1BAWA 4QOKE 3T65B 1JGEB 1OB0A 1OQOA 5IESL 4M8RA 5EU4A 3G7TA 5AAMC 3NFPB 4L9LC 2O5NA 3ARYA 2J1ZA 4RSVA 1ZLSL 1UG9A 2NY7L 1CZ8L 1VSCA 4PAZA 2P5EE 3E2HC 4XT1C 4LLYA 1BZ9A 4YXKH 1IGTA 2D31A 1CE6B 4OGYH 3HN8A 4ALAL 1GGTA 3AU1B 3WMPA 1YNKL 3X1EA 1T3FB 1IO4C 3WKNA 4CVXA 1AY1H 1KNOB 1Q9KA 2VJ8A 1TIUA 1DFXA 4ONHB 4R3SA 5CBEB 3SCMD 4PW3A 5CEZL 1BQRA 5DEGB 1RFDL 1YMMA 3BN3B 3G5YA 3FQWB 2X70A 4LQFH 4FQ2L 1QWUA 5DEFA 5AG9A 2MFNA 1OAZL 1G4RA 3BKCH 2Y6SC 1NFDF 1IM3B 3OB8A 3QJOA 4BSJA 3QHTC 5C0NC 1EUTA 5AD0A 4BFOA 1PZCA 4OI8A 3VWKD 2GI7A 4G7SB 5HHMB 1CLVA 2K1MA 4DEPB 4H7VA 9PCYA 4OZ4A 5TE7H 1EH9A 3WLWD 4F9PC 2WXPA 4TN9A 4OZIB 1S7UB 2N7SA 4B41A 4IBUA 4HWZA 1FAKT 3NQKA 4PJIB 5AKTA 4APQB 3OAZK 1JPSL 5GRJL 5LBSA 1LGVA 4XB7A 2EXSA 4RZKA 5DWUL 3NZHH 1E65A 1H9VA 3GB7B 2Q10A 2ZCLL 4ACTA 3NJLA 2KZWA 2XWJA 3BGMA 4ODWB 1SEQH 5LNGA 5T1MA 4JAMB 3JTSB 4HSAC 4E68A 4J2XA 4YQXL 3BVNA 2V2TB 1QA9B 2A38A 1RD6A 2CIKB 32C2B 3MRPB 4U7SA 1C5CH 1O7DE 1E40A 5IBLC 4XB8A 3ILEA 3NCFB 1CXIA 5D7JD 2VLKD 4X6BA 3HAEA 4QRSA 3SHSA 4ODXB 1AZUA 1IBHA 1DBJL 4YDLB 4D0DA 1JWUB 1R3JA 3US1A 2CHXA 2H6PA 3FUDA 4X83A 1LO4L 3O3BB 4XWOC 2HJKA 4Y19E 4RFOL 1ZK5A 3FTZA 5HHOA 3MC0A 3WS6C 3MNVB 4B9GA 3BZFA 3LY6A 4WVRA 2G75A 5IHUH 5AVSB 3ARSA 4Y1AE 3UABA 4GAYB 1EANA 5DTFB 4ZMAT 5MERA 3R19A 4LCUB 5DJ8A 4NM4L 3DYPA 4MYPA 5HDQH 3JT0A 2DQMA 4F7CA 4KX9A 4NQEB 5SWZB 4QHPA 1VHPA 2AEWA 2Z8RA 1VRSA 3JZ7A 3ULUH 4K7FB 2LU7A 1J7VR 4G80B 3H9SB 3O4LE 3QA3A 2X40A 1VDGA 1M57B 3VI3F 1AZCA 4K73A 2GW5A 2X2IA 2HPTA 1E27B 1W6WA 2UVEA 3GMQB 4A6YH 4L9LA 2YQ2A 5I5RA 1FNLA 4GQZA 3R0MA 3CLEH 4QO1A 4R0LA 1UOWA 1AD0A 2X6CA 4BUHA 5A7EA 4GMSH 2HJFB 3DX3A 3L3JA 2XJLA 2QVTA 2WJ5A 5CXPA 2B15A 3EOYG 3ZO0A 1HZLA 1JG9A 4POUB 4W9KC 4ENED 4HCRL 1YY9C 3FN9A 4M03A 5E6ID 1M6UA 5E4EB 2PP7A 2ZICA 4AXWB 1QYGL 4BQ8A 3VFVB 2AJSH 3TOPA 5GS0D 2Y5TA 2X4RB 4YUEH 1E28B 3AY4C 4F7MA 1R0AL 4FFYA 1W72L 1NC2D 4B9ZA 3GXNA 4GKNA 3FAWA 5CJBA 2WWOA 2HFEA 1FZJA 4BKTC 1MCLA 1OKEA 3KPRD 4ZOCA 2D2OA 1UHVA 4L4VD 3N06B 4H0GA 4WZ9A 4CBPA 2J4WH 2FATH 3V95A 3SJVA 4HWEL 5GJSH 1NIBA 3DIFB 2A0LC 1F02I 3KW8A 3M6DA 4L8CA 1UA7A 4AC2A 1L9MA 4CC1A 3ESNA 4TQ8A 5HHXL 3T4YB 2CK0H 2J8HA 5IQ9B 1WIUA 3ILPB 4JFPA 2VLJA 3QXTA 3KPMB 3RU8H 4ZFGL 4I2XE 2I7OA 4XE5B 1JP5A 1LP9A 2NYZA 2PTUA 3W0WB 2YAOA 1KDIA 5JXEA 2NY0D 5AVVB 3ILQC 4O9HH 4BQBA 1C7TA 5AW5B 5KN5A 1P7HL 4LHUD 3DX1A 2I5YH 3D9AL 2J3SA 3UO8B 4M4RA 5LDUA 4AEHH 1U8LA 2NT0A 3CZEA 4GO8A 3FB8B 4ZX6A 1AG6A 3NCXA 2EQDA 5D7IE 5LWYH 4KPHL 4N2HA 4LPCA 4ZQKB 3MGOB 1GCFA 4I77H 3PGDA 1YJDH 2FT6A 2OTWB 3TPUA 4XXWA 2YPLB 1KIPB 5AYTA 1BD2A 3BUYA 3C9NB 4R7DB 4L2YA 4MD0A 4QOKB 4O2EB 2IGTA 4ELKA 1S4IA 3RAJL 3F12B 3DSNA 3OQRA 4YDKH 3DX7A 1VLXA 2RR3A 3T0WA 3FO2A 1QHPA 4N85A 2J56A 4BFGA 2F19H 2EIZB 5I1CH 2B3RA 5HYQA 3MLSH 2B9AA 3TT3H 3PGFL 4ZAKA 2P5EB 3AXLB 1UCBH 1HDMB 4NJAH 3D0VA 3PWPA 2EO7A 4GO9A 4HUVB 3DXAD 4A7TA 4G8EA 4YXHH 1RJLA 1JI1A 3FSOA 1S78C 3FF7A 5IVXE 1JD9A 4HKBB 1WICA 5CFAA 3MROA 1N2RA 4XO4A 3NG5A 4J8RB 5CILL 2IH3A 3UMNA 1RZIB 2MPAH 1YUHB 5E1AA 4MDJA 2FJFA 5F0LB 5B7FA 1RZFH 4GAFB 4BA8A 5IUSA 4HIEA 4CAGA 2R0LH 4LSUH 5AEAA 3RWJB 5A40E 2HKHH 4HKZB 3ZT7A 1T89C 3QCTH 4X98B 2WKLA 2QSTA 4KVCL 2HTKC 1RIHL 3AW5A 4O02A 2VDRH 1MG2C 4JS7A 4NP4L 1A2YB 5GPRA 3NDYE 1NPNA 2ZKMX 1J48A 2W9DL 2CA3A 3DMMC 3E1F1 2VR6A 1D5RA 3LXUX 2A83A 2ICWI 1AR1C 3P3RA 4PLKD 1BMGA 2BZ7A 4CSZA 5GZNA 3VE0B 1PX3A 4FTVA 1S2EA 4B96A 5D7KD 2WQRA 2WZAA 2WZPD 4QF1B 2CUAA 4NQVA 2CBQA 4P4KD 3AY4A 2NY1D 3QFDA 2FEDD 3WBDA 3MACL 3SODB 4S0TD 2NXYD 3KYMB 3L8QA 4AYFB 3V0VB 1JZEA 2YEZB 4FFTA 3CDZB 3MXWH 4Z0XA 2Y22A 2H5UA 2IGFL 3UG3A 3LNHA 1BG1A 4Y8AA 4OTXH 3RUGE 4PJ8C 2BVUA 3FUMA 4QXGH 5I1EL 2ATKA 3ARBD 3V4UH 4MMYA 2Q87A 3KL0A 1A14L 4A55A 2WBJC 4LB8A 4UUJA 4ANWA 5F7KC 1I4FA 5DQDH 1TQBB 4Y19B 1N6VA 4NKOB 4C56D 2AXGA 4LXFA 1XX9C 4K3JL 4Y1AB 1JHKH 1MWAH 2YLHA 4P46B 4P07A 1Z9SA 3EOTH 4PB0L 2OX5A 2V4LA 3SDXE 4YLCA 1FL6B 1XCXA 3EOBB 3LQMA 4ZW6A 3EHBC 5GJTL 5E6ZA 5FUCE 4YMPA 3VRJB 4RMUA 5I8OL 4ZSOA 4FABH 1JF6A 3LMJH 3MRFA 1H6FA 3O4LB 4K9EH 1FIEA 5BUGA 1BSIA 2YD0A 3B2VH 1JXKA 2AQ1A 4MHHG 2A74C 3H9HA 5HYJB 3W82A 1GJUA 3WKML 4ZNEA 4GRMB 5AVUB 3WE6A 2ZKHL 4Z7NB 2GTWB 2EICA 4DGVH 4UZUA 3NCEB 4XVSH 1R24B 1FN4A 4I48A 2APXA 4IJ3B 2MCG1 3DOSB 4DVBA 1L3WA 3JWDH 5C0IA 4KKCC 5B38B 3UPRB 4N2OA 4OFIA 3V0JA 4Y2DB 3HG2A 1N64L 4NNPL 3TNMB 4LLUB 3ZMEA 4IBVA 3ETBJ 4J3OD 4DGIH 4DAGH 5K9OB 5D1QC 3EGXA 4LLDA 4BK8A 2I85A 3CZLA 4DH2A 1SYVA 4ZS7H 1VFAA 4GQRA 3N0AA 3AG4B 3I74A 4UYQA 1HEJC 4UNVA 5CKGA 4DPAX 4CU7A 1D5XB 1QEXA 1UFUA 1B2WH 1OD7A 4KRNA 4KMLB 3VGAB 4G5ZL 1JK8A 3ML8A 4XNXL 3RVXC 4U3XA 2FQGA 4HGKC 3DMMA 1KMGA 1HJCA 3VFMB 1IQDB 2L7UA 3HPJA 4U6HA 4Q2ZB 1TZIB 2MOQA 4HUKB 2DW5A 1HI6A 3WXWL 2X1WL 1NAMA 4KY1H 1KBGH 2MNJB 3NUKA 3U0TA 4IM8A 1PVHA 3L9RA 3FUKA 1LM8V 4QNPF 5JHLA 4PJDB 1JTPA 1TETH 1PZUB 1KV3A 5D7IB 3M7FB 2J5LC 4IBQA 1GTFA 4PJFE 5HGGS 1F56A 1M7XA 5A2KH 4JKKA 1UQSA 3CVHA 4PJEB 1KJMB 1ANUA 5ADPL 2BIHA 1HTYA 2HFGL 4PJ8A 4AWJC 2GK0A 3NQIA 1SBSL 3B9KB 3FT9A 4NQXB 5C0DA 4HXBH 3OB0K 1T20A 4OQTA 5F1NA 3IPBA 1O75A 2V9TA 3LYRA 2WBJA 2LOEA 3JTTA 5DJDB 3MZTA 1MFBL 1IGMH 1TKWB 1OTTD 1VEMA 3WUZA 3VXRA 1FO0B 4JFHD 1YVLA 3D7PA 3OKEA 5KYNA 2NZIA 3UTTD 4IBTA 4U0RC 3DV6A 4D8OA 5L8JB 4HUUA 1F8TL 2E27L 4JHAH 3MV11 1ZSDB 4U4BA 4Q9RH 4W6XB 4FYTA 3QEHA 3C6LC 3R4DA 4MQSB 4NZRH 1CLOL 2HAZA 2L8AA 3ALWA 1K4DB 1R5IB 5A2FA 5JHAA 4B9IA 1X5GA 3VWKA 3LRSA 1M2VA 1SM3L 3BKMH 3DLQR 1U0QA 2ZWNA 1CD0A 3K0YA 4CGTA 4RWYH 4JG9A 2XN9E 3VGGA 2WYIA 3FHQA 5GS1C 1HH9B 1OARH 1CL7I 4N1CA 2A74A 5D4IA 4GIPD 5IIEA 3ARGB 4R4BB 1M53A 2F54E 1DUZA 3MLVL 1X4YA 3GZQA 2ZJSH 5E8OA 4HD9A 4NDMB 1UGKA 3PWNB 3QBTB 4JJHA 2FAUA 4OD1L 1CGVA 5D2NE 4PPTA 2Y2WA 5H4YA 2XBDA 2H6UA 5FGBC 5BZWB 1P7QB 2EZ0D 4OLVH 5I6OA 4HJSA 3L5WA 1P5UA 3SD2A 5IB4A 3QNZB 3HE6B 5JQ6L 1ND0B 2VR3A 3GSUB 5FYKL 3LHAA 3PWVA 5D1QA 5FYLH 2BP5M 3QI9C 5FV2A 2N7BA 5J3HD 3WD5L 4OZHA 3MV7D 4PCTA 3DGGA 3KD4A 3QB7C 3POCA 3UZEC 3CPLB 3Q48A 1RUKH 4S2SA 5J9PA 2JMRA 4MA3B 1HFUA 1QBLL 2EECA 1OCCB 3FZUD 2F9BT 5ENWB 3SKMB 1AGFA 4GQQA 3F01A 5DJ6B 4U1GB 3FU8A 1RZ8B 3KPQA 3L1EA 4ALAC 3RUGB 1NMBL 3CNKA 4GG6A 1UXWB 4XPHL 2R2BB 1JGDA 4DGWC 4TSBH 5F44A 4RSYA 3ZN6A 2VMEA 2AZUA 4XB3A 3AB0C 5DJCB 5I6NA 1N19A 3JUYA 4PV8A 3BH9B 4WHDA 3QZWB 1LYQA 5FFOA 2D0GA 5JW5A 3MGTB 4DT2A 1I7UB 4YSUA 1HXKA 3I75B 2YSSA 1A0QL 4N8UA 3RX5A 3T4AC 4N2DA 3GMPB 3BVDB 1E4HA 4MCYA 1EEQA 1YMHA 3FB5A 5L8KB 2EVHA 3GHEH 1W80A 2OTUA 2BS71 3SDXB 4PS3A 3VRLF 1VZHA 2XG4B 1HAUA 3MLRH 1MHPH 1HL9A 1Q9WB 3GSRB 2XXCB 4X5QA 4A7SA 3VVWA 4JFXB 1PSKL 1YQVH 4ICWA 3T0DA 2B4CH 3UEQA 1HQ4B 4G7YL 1ERNA 1B9KA 1AD9B 1OGTA 2KS0A 2EDJA 5I73C 2QFRA 3HS8A 5TK2A 4DP4X 2WLZA 4ZOEA 2VC2B 3IJHA 3HFFA 3W5NA 4PGCB 2Q3AA 4MXVE 5EEXA 1E9OB 5AW1B 4R7NA 4U4IA 1IJ9A 3N1FC 3EFOA 4WY7H 4UTCA 4M3HA 3A5VA 1IL1A 4X7TA 4YGAB 4YX2L 1JGLL 3S96B 4FDWA 4WJG3 4WGKA 3TXAA 1AGBB 2Z7YA 3HS0B 3IJEA 4JO3L 5D93B 2C9UA 4J3XA 3CFIC 4XNYL 5DUBB 5FA4A 3X3GH 3T8VA 1F1AA 3C6LA 1OAUL 4NWTH 1AZNA 4X7EC 2X7LA 5KANI 2O5XL 1MI5E 3TO2B 3IJYB 1UWXK 4V11A 4L8DB 2JCCE 4OZFA 1AO7D 4PFEA 2XQYG 1NMAH 2VXVL 3QDHA 4PJ7E 1G84A 1SFHA 3IPEA 1Q1JH 2VW4A 4HPOH 3WSQL 2WXNA 4XCFH 3MRIB 1CD8A 3P73B 3U9UB 2WBKA 4KUCF 1ID5I 1J86A 5ISZD 4JM2C 2AI0L 3V10A 4HJJH 4CBZA 5J5EA 3P9MB 1K8DB 5CIPH 3B34A 2C8NA 5FDWA 4K5OA 1SVZA 1TNNA 2GTZB 4L5FH 3LXCA 5ICYB 4QMEA 3LPFA 4QRRE 3ZQXA 5A6MA 2FX9H 3WFEL 4FQQA 5FGBA 2QADB 5IFAH 4KGLA 1RQ5A 1V7ML 1ORSB 2HSIA 1CBVH 1M4KA 3K6DA 5GISL 4Z7QE 1FO0L 3E3QC 2F8IA 2Z4TA 1MRCL 1A8ZA 4ZXBD 1C5DB 3WXVH 3HB3B 4PRNA 3TX4A 3QI9A 4X4ZA 4AJWA 4UINH 2NRDA 3MRMA 2H2SC 3WTUA 1I31A 1W0WA 3CFCH 4IEFB 4ZZFA 4XMKL 3ZUCA 1MFEH 2CQVA 1QUNB 1RK0A 4F2FA 1WUZA 2YPVH 3KVQA 3OX8B 4PJFB 2V9UA 3QFGA 3D69B 1W0YT 2CHWA 2XV2A 2JVUA 4JRFA 3C08L 1OSPH 3OKMB 1GKEA 4YSOA 2EEAA 1SY6A 3H85A 1MDTA 5AVRB 2P52A 3TM6A 4BKSC 4DPBX 5EU7C 3UH8A 5BCAA 1MFCL 4LZKA 2D03H 4M9OA 4LHUG 2R8SL 5SWSD 3WUWG 3U6RB 4YAQA 1D9KB 1OL0A 3NAAL 3V0HA 2BSBA 1ET5A 3GMRA 3FU5A 3QIUB 5IK3B 2JK5B 2CUMA 3T4AA 1P0SE 3IJ7A 1KLFA 1T0MB 1XCTB 3DETC 3BMVA 2XVGA 2XY1A 4Y4FB 4N8VG 4UAHA 2BSDA 1VPOH 3DVGA 5FW7A 3GLAA 1CFSA 3ULVH 1D5MA 3VG0L 2X09A 3OAWA 1KBPA 3ROOA 5F7FA 5G5DB 3CZKA 5K1NA 2DQCL 4KO7A 1LEIB 2PUQT 1G1KA 3MRRB 2AZAA 4ZODA 2XN9B 2OMZB 1T83C 2QMJA 4LGRB 3APCA 2Y5QA 1XR9A 2FL5A 3HMXA 3G5XA 3LKRA 4QT5B 4YIQB 1FH2A 1ZLDA 3FW6A 4NC1E 1KJ2A 2IPTL 4Y2NA 5CLZA 3CN0A 2WVVB 5F3HB 1IKFL 5D96B 1GAFH 4OCXL 2BWQA 2ADGA 2OMVB 3WS3A 5D71L 3I3EA 4QYOB 1G7JB 4QUOA 4XPBL 5DI8B 1W8OA 4K5NA 5CF3A 1MDAA 1FGNL 4G6KL 2XX1A 5D2NB 1V54B 1CGTA 3H9YA 3P9WB 3BJLA 4PGEB 5TE6L 4G6ML 4GLRH 2VABA 4GFXA 4LASH 1A3LH 1QFPA 1ZA3A 3APNA 3NABH 5BXFA 4NWUL 2VR4A 1LE5A 3RHWF 1IGIH 3RPKA 1XH2A 3GMNA 1JHTA 3MJGX 5FA3B 3UYRH 4GSUA 5HYSB 2H4EA 4KDTC 4XMVA 4V1DE 5IQLA 5CFHA 2VWEE 4XNQA 3U2SA 5LNDA 4HKJA 4O4YL 5BZZA 4F1SA 4JM2A 5B1JC 4BM7A 3QDJB 3EH4B 3TO4D 3HG0A 4OJAA 3U4BL 4X5XA 5E2TH 3IVKA 1SXZA 4AGMA 5GGQH 1XSKA 4I85A 4OCYH 4P04A 1BW8A 2BFVH 4OJCA 2VC2L 3LQZB 1GC1L 4AQEB 5FO7B 4L8BA 4W9EC 1A6PA 3D51A 3RWHA 1NOFA 1YEEL 4HALA 4F37F 3VB9A 1T1ZA 3BAKA 5E5LA 1I3GH 1K4CB 3CH8A 1JNNL 4IHOA 1CURA 4FXLA 2DIEA 1Z9NA 2PPAA 3I50L 2XV3A 3WTXA 1OLLA 3MRGA 3QQDB 4HIPA 4YDIH 2R0WH 4GT7A 1WK0A 5CZXC 3WELA 2JB6A 5AALA 4YHNA 2DN7A 4S1DC 1Q0XH 1QO3A 4JY5H 3PFQA 5HD8D 5JYMA 1LO5B 3D85D 1QSED 2A73B 5I1JL 2V8LA 1QACA 3ZX1A 1KUMA 1BYOA 1WZAA 1XF5B 4P59L 4KMQA 1PYWB 3EO9L 4AQOA 1B90A 1P69B 5E24E 2WQXA 5H94A 15C8L 4LL4A 4FYQA 5DRNA 2IALA 3GM0A 2KLTA 4PJ9D 5HI3C 5T1KB 1OGAA 4OFYA 1BM3L 4FQXD 4HSCX 2HT4D 4W1TA 2BVOA 4EI5D 4GSDL 4NUGH 4F20A 4H8WH 4KK6C 5E7FA 5L2KA 4KZEH 3FH7A 3W11C 3Q8BA 3NTCH 3X2QB 3SDCC 4WF7A 2RQ8A 3TT1L 4NOBA 3FQUB 1KFAL 1QPPA 2BY3A 1HNFA 3VXNA 2CO6B 4KQ3H 1E9PB 2JCCB 2V8MA 4GKOA 5T1LB 4QTHB 3M8OL 3UZQB 4XR8C 3M86A 1M9WA 4EIGB 1LDPH 1N67A 4KRPD 4BSWA 3BZ4B 1T83A 3RNKB 5JORA 4HPHA 3QORB 5I1KL 3SBRA 4HIJB 3O8XB 2DQTL 4HD5A 1GRWA 4P3DA 4P5TB 5K39A 4PUBL 4PV9B 3CXFA 5DK2B 1PX4A 5FLVA 1PU0A 1GZQB 3DI2B 5GIRA 2BW4A 3PG2A 5IM7B 2ADJA 2ENJA 3OF6A 4Q6IC 5EO9A 4ZJ9A 4QRRB 4U1JB 2AJXH 4J3OG 2F6AA 1XZWA 1MJUH 3IJSB 4Z7QB 3KYKH 3MRHB 1Y18B 3HN3A 5IHHA 2VNCA 4MJID 3WNPA 3G9AB 1OSZB 4A7QA 5B8CB 4OJDH 4Z0BL 4FXKA 1WP6A 4NYLA 4GRLC 2OM5A 3KPSE 2XTJC 3N41F 2OL3A 2D0HA 4O58L 3SPGA 1IGFH 4OBRA 5MEQA 3GWJA 4KDTA 4QY8B 3MLWH 1LLAA 3LD8B 4X6EB 1DQLH 5DVMA 3HI1A 5IFJB 1BVNT 4KMTL 5B1JA 2C3GA 4I0PC 3HR6A 1U4EA 4G6AC 5FIEA 1F45A 5E08L 2CNZA 3FH5A 3NP3A 5K1JA 1DBKL 2CH8A 1MCKA 4XP9L 1MCBA 4K8RH 4UU9B 1RZJL 2EC8A 4RGMC 4RAUA 3TH3T 4U6VH 2HKFH 1F6AA 3C12A 4QRPB 2I32A 3CWGA 4XVJH 2V17L 4GP4B 3WEOA 1WC7B 4RRPA 3TN0C 4AMXA 4DN3H 3UBXI 1A1OB 1ED3B 4M8UA 4PJ5A 1FV1B 4XN5A 4YEEA 1INEL 4RMQA 1DE4B 3ATEA 2UZIL 2Y36H 1AC6A 1UKTA 2O93L 3QJZA 1CYXA 3RWIA 1QSFE 3E6FB 2E3VA 3QEQA 1J8SA 4NN7B 3DECA 3NFSH 3W39A 1PDKA 5EZJB 1QABA 4FCHA 2YN5A 1DBAL 2VDKB 5J13C 2P5WD 1ZLWH 4GNKB 4NGHH 1LP9F 1K72A 2RH0A 5MI0C 4P5MA 3L5JA 4O2CA 2VE6A 4QHLA 2Y3NA 3L08A 2X3CA 2BSCA 2HJLA 5J8OA 1ZWIB 5TDPA 4BSVA 1TEYA 4YR6A 1E5AA 4R4FL 5ESAB 2PYEA 3SOBL 2HLEB 5A16B 3TA3C 5KZCD 4WWOA 3VWJA 1UOLA 5KSUB 5HXMA 2BIPA 1I7RA 4AV5A 3G5ZB 5I1HL 4WSGA 1TQCB 2D8KA 4KNUA 2HH0H 3VI4A 1ZHBB 2F7RA 3SDCA 1G6VK 2R2EB 5L0QB 1D6VL 5SV3A 4EN3B 1KYOJ 5DD6B 4JQIL 2JKRM 5LQBL 1Y6MR 2C9RA 4JHWL 1RSFA 5C0RH 5K59F 5HPMB 3GSVB 4OZGE 3RP1A 3ETSA 2CGRL 4L3EE 1MZYA 5I0VA 1JTOA 4JR9L 5AW6B 2FQFA 1CF8L 2CM6A 2Z93B 3D3VB 3TZVC 4V1DB 1FSKC 1OGSA 4UIMB 1BZ8A 2CDGB 4W4NA 4XODA 3IF1B 2FGZA 3MLYL 1NGWB 4UANA 2HP4A 3T0EC 1BBJA 2PP8A 3L7FB 1UACL 4DP0X 3MBWA 2QHRL 4MZIA 1PKQE 2CJUL 5AOZA 3PJNA 4I5BB 5HDBF 3QIBB 1IAKB 1FZMA 5J6HB 4KOCA 1RZKH 5EU6E 5LBSH 5IQ7L 4G59C 4XP5L 3FS9A 4HEME 3KYNB 4GRLA 8PAZA 4BQ6A 1RU9L 2LAGB 4ZPTB 4AV0A 5KBLA 4JPVH 2BHUA 2KBGA 3O6KL 5GZOD 1I8MB 1RP9A 2VOTA 2ZX6A 1WIOA 3DV4A 4Q9QH 4NRXB 2QVFB 3GGWB 1DQIA 3R06A 3R0NA 5KJ4A 3WIFA 3DTXB 3GIZH 3PGCA 3Q1SH 4I0PA 4PJAE 4Q89A 3U36A 2BNQD 3H3KA 2NNAB 1OP9A 5FCUL 4JDEA 4M5ZL 4EUPA 5ESQB 3L4ZA 3EJRA 5D4JA 2AGJL 4PTTA 4QWWC 4XPFL 1YY9D 3SQBB 2LHAA 3OPZH 3ECBB 1TENA 1ID2A 2DF3A 3GSNA 1SHXA 5F70A 4BFIB 2F58L 1ES0A 5A7BA 3Q5TA 3SKUD 1LWRA 3TN0A 2OKMA 2R7EB 2VH5L 3HCVA 1DCEA 3DIVA 3FULA 3VFTB 3RX7A 4X4YB 5DQ9A 2ED7A 1HL5A 1NC4A 1JZDC 4AIZA 3I02A 5IWLC 4N2KA 1OQXA 2PNDA 2QT6A 4JDVA 4A38A 2WAQA 5HGAB 1E9QB 2B5IB 1IV8A 4F9LC 2WTPA 4M3KB 1JXFA 2E8YA 4NQQA 3OBAA 2Z35A 4R7VA 1XBDA 4KROB 3FUNA 4ABWA 2DQFB 1UA6L 1J0KA 4YNYA 5TF0A 1OV8A 2JJSA 3V0EA 1NCGA 2HVKA 3VFUB 2WYHA 1EQWA 1J1PH 2IJ0C 3P02A 5GGUA 1QFHA 3TA3A 2OK0H 2YGVA 3P3TA 4P4RA 5DC0A 1I9JH 2WC7A 1YEKL 1JZ2A 1N68A 3L3GB 4WJ5B 2X6AA 4UB0L 4F8TA 1S7RA 2YC1A 3L4YA 3OHMB 2K3TA 4Z3GA 1AGEB 5IKCB 1ZANH 5DDHA 2PWFA 1OK8A 1GOGA 3AAZB 3ZMRA 1KLGB 1Y7VA 1UZGA 1I3UA 2BHYA 4JUSA 1S9YA 1RHHB 1FBIH 2BCMA 2CXKA 3E38A 4X9YA 5GSRB 3ZVVA 2IWEA 3GS4A 4BHUA 2VUKA 3QS3A 2C34A 5H2BB 1F58L 4CMHC 2ZYHA 4TRPL 2CPUA 1ZHNA 3FKUS 1Z0NA 2F53E 1QRNA 1NOLA 3MLXH 4I3SL 4NHCH 5J57B 1NCAL 1NKGA 5EO1B 1YPZA 1EAPA 4AENB 1DQQA 2VJ0A 3MCLL 3MMEB 4XPAL 4XMPH 1QI3A 3QUKB 5LKNA 2ZKYA 2QQNH 2IDQA 1KYOK 2EVFA 1H3TA 2WUBL 2VDKL 2E47A 3T0EA 2JJWA 1XXFC 1ODUA 4NRYB 5ALBH 3CBKB 1RUQL 4WI7A 4XC1L 1WBXA 5T3XD 4LARH 4U2ZA 5KG9B 2C7UA 3L5XL 2X9XA 3GI8L 1OIOA 3LEXB 5F21B 4BQ9A 1O5DT 4JFED 3ZTDC 1BVLA 2OSWA 1IVLA 3RWFB 5JW3L 1I1AC 1JTTA 1WS7A 3EKCA 2WQAA 2ZPKH 4AMKH 2R29H 1UEMA 5KVGE 4PP1C 1CVRA 1TVDA 3MI6A 3AZUA 3H2QA 1IKNC 3KMDA 3US9A 2D9CA 4DCQA 1PY0A 2DQDH 2XA8H 3TF4A 3QUZC 4PD4K 1S9WA 5JHDE 4ZTOL 4KHTL 4PRHD 1QSFB 1ZHKB 2FB4H 2VKXA 1C1EL 4WWPA 2A2QT 3MBEB 4MFHA 4X5WA 3HR5A 1NCOA 3GKWL 4PRPE 3X11A 4IOSA 2VDMH 4F7KA 1TLMA 3HE7B 4RGOH 2ZWSA 3QWNA 5F8RC 4C4BA 1JE6A 2G5BB 2F1BA 1IGJA 5JYLA 5D2LE 1X5LA 3AGWA 4BFFA 1KXQA 4M48L 1LEKA 1PEWA 1FFPB 2BOBA 1M7IA 4JKPH 1FUNA 4KI5C 4EI6B 3T8XA 1XGRB 3NA4A 1CD9B 4PG9B 3TIDB 5ITFA 2Y2YA 2PR4L 4BCZA 5GQBA 1DVFB 2EE0A 4TUOA 1FYTA 2W0PA 3T77B 5DT1H 3ZE2E 4H88L 1AANA 4KAQL 1P7KA 1IEAB 3D50A 5IWLA 2V0AA 2L7QA 2IAMC 1HXMA 2MRYA 3W9DB 4RRPM 5EF0A 1D5BA 4F9LA 2KDYA 4FLRA 3ZKSD 4J28A 1JV2A 1VEOA 4WI2A 3ARGC 1JNLH 1HWHB 4JZNA 3MNDA 4M1CC 2X88A 5DJ0A 5FKAB 3A67L 2AVFA 3MJ9L 4LOEA 2J1KA 5IVNA 2H3XC 3EADA 1OSEA 2BVQA 3QUXC 5EIIG 4BZ2H 2F7QA 2XWBA 4O02H 3DYOA 3NYKA 3ASNB 5A2IH 4HS3B 5AW9B 1L6ZA 1PKQB 2DBLH 4NBZB 1A65A 1J0HA 2OA9A 1CXKA 1TTGA 4U1KB 2VLRE 5JDJA 1OAYL 1EJFA 2WXOA 3B2XA 4JRYD 4KZ0A 1T6WA 4M3JA 5GRVL 1GGBL 5EU6B 5I8EA 1Q0YH 1ACCA 2B0SL 1D5IH 2VMDA 5IVOA 3NIGF 3T2NL 3T8MA 4KJQD 4HETA 1BA9A 1F90H 4UTBL 3LNGA 1YC8A 3NMEA 4RDBA 1WBZA 4IS6A 4N2GA 4PRBB 4YO0B 3WJLC 4DQAA 3RPIB 3VXUA 1F4YL 3GXTA 1OY3B 3J27A 4H20L 4ERSL 1AH1A 4R90L 5IG7B 5KUKA 5E2WL 3GRWL 4HIIB 3DJZA 4ZUSA 3QPQC 4PJAB 1RZGA 3CSTA 5G55A 3G04A 1BWMA 3RZWA 2EUWA 1NFDE 4MNQD 2JI1A 2ILLA 3RILA 3MZGB 1URLA 5M7QA 3PFUA 5C0GA 2DTMH 3TVMC 4ODUA 3PDOA 1SN5A 1I8IB 1I1AA 3MFFA 4OZHF 4WCYL 5ADOH 1WRFA 3ROLB 3H42L 4B9PA 2GAZA 3M1BA 2CIIB 4MB4A 4WNQA 3RNQA 1UD4A 2YFNA 1SJXA 3WTWA 5HGBA 4D0CB 1J8HA 3HZMA 4KKZA 2XPGA 5FUZH 3IB4A 4MJ6B 3C5ZB 4WO4D 5CLYA 4JW3A 4GG6F 3BP4B 4ODSL 4IQHA 3K5RA 3CFUA 3EYQC 4JFDD 4W6YB 3NIDF 1CGSH 4M7JL 4DGYL 1NL0L 3O6FC 2F5BH 4Z78B 5E6RB 1B0IA 5I0XA 2I9TB 1S7VA 2WXJA 1ZS8A 3K0WA 3QIWC 5FM8A 4AW4A 3GT6A 4WFED 2Y72A 3OAZH 3FL7A 1S7SB 4PLJC 2CMRL 3R7QA 3TBBA 1NGPL 4BH8B 1ASQA 3MLTB 1IFGA 2EYTA 3X1GA 4ELMA 3VW3H 1VZIA 1BV8A 4OFKA 5KVGH 1EEYB 1KN4H 1DR9A 4C4UA 2X28A 5ECGA 3VSQA 4OCNC 2COQA 1HN1A 3N40P 5DHYB 1XIWC 3HZYB 4DKEL 4CNIA 2W91A 4HJGB 1CU4L 1B3JA 3LV3A 4AEFA 5JPMC 3LIZA 3T09A 1NBZA 2BLFA 2AV1A 2CHZA 3D2UB 2J43A 2A4CA 2IC2A 2CR0A 3DX8B 1NGXA 3OWEA 3QYNA 2G4EA 1D2OA 3WIIL 1RZPA 3A4EA 4RX4A 3A6BH 4J8QA 4MAYC 3C60A 1H8SA 2F53B 3N42B 1Q72L 4YE4H 5I74B 3KBPA 3KR3H 1OT4A 2E9JA 3QNFA 4LSTL 4ES9A 4FAAB 1BVOA 4FMFA 3P9LA 3QDMD 5INDA 1AGDA 3KWUA 1FFNB 3QUXA 1ZLVK 3EBGA 4TUKH 5HHNA 2WP3O 2XZCL 2JXMA 4OY9A 3TJEL 4PSRA 3RGVB 2QKIA 1U3HC 2BY2A 3VMPA 1KXHA 3UJIH 3BQVA 1IAOA 4I9XA 4YSEA 3U4KA 1XD1A 4LHJB 4EZMA 1KC5H 1A7PL 4K3EL 1YECL 4M1GL 4XVUD 2FD6H 2FHBA 4LNRB 5DQJA 2XZAH 3WO3B 2DYPD 3LKSB 1WAAE 1MY5A 2UXFA 5C97A 3BZEB 1P1VA 4E5XA 3KCPA 4P2OD 3U46B 5JW4Q 4FKEA 4DKFL 4XNZB 4KWUA 3FFDB 2C4XA 4U33A 35C8L 3F7VA 1QLEH 43CAB 4M7LT 5JHLH 2BO0A 3KPRE 2IH1A 4L4VE 4W6WB 4NI3A 1G9NH 4WTZG 1HIMH 5DHVA 3WJLA 5JHDB 5LN8A 1FVEA 4WV1B 2DM2A 5EOCJ 4RISH 3KLHD 2BC4A 2R0ZL 4RQQA 1I1CA 3GDBA 3FSWA 4FG4A 4OGZA 2A6DA 4PRPB 2WINA 4LEOB 5JOFB 4M5SA 4QD2E 3DWTA 3FHAA 1EHLL 3L6FA 1B6DA 5D2LB 1Q38A 4XBMA 2AV7A 2C3VA 1KCBA 2OJEA 3C2AL 3TVMA 1GJWA 5F6IC 1G7MA 5IY5B 5J6GB 4R8WH 1KXTA 3WNMA 5ICZA 1V3JA 4DVRL 4UZGA 4GBXD 4L3CB 3T2OA 3IE9A 5DD0L 2HRLA 5KTEH 1CB4A 4U6XB 4OF3A 4BKLB 4W70A 4XCEA 3DVNA 3ZE2B 4IU2B 5TQ0H 3MRCA 2TSAA 4M7ZC 1A7OL 1DQJB 5H35B 4XRCA 4KJPC 4OGAC 1IEBA 3JV4A 5KSBB 2CZNA 5CD5C 1VACB 1EGJL 4N4YB 1NSNH 2CHDA 5IMLA 4PBXA 3V4PB 1HINL 2NX5D 4FZ8H 4DPRA 3O6FA 4BZ1H 4IKIA 3SKOA 2H2PC 4E41A 5CGMA 1DVSA 3BH4A 1WBYA 2PO6B 3QIWA 4N5EC 2JIXA 1KYAA 2GT9B 3BUDA 4PREB 2O4EA 2MCPH 5DO2C 5CEZD 1DJZA 3B2UC 3T0AA 2OYMA 3QG6A 4KXZI 5T5NF 1XQ4A 4YXKL 1AHMA 5C0FB 3P40A 2OSLA 2ZYSA 3J07A 1XIWA 2NY2C 1B4JL 5EBWB 5CJOH 4JG1L 3VGHA 2XN0A 2VLRB 3CSFA 4M7KH 4ZFFB 1AY1L 4LLAA 3ZDYF 2CLRA 5BRZD 2CSPA 3BEWA 2VDNH 4PH8A 1FF5A 3EJQA 4OFPA 4Y5YB 3VMNA 3ZZSA 1T1XA 2O61A 5DRZB 3O81A 3RTQC 4ZMOA 1HCZA 3K46A 4LQFL 4MAYA 1XB6A 6PAZA 4NPYA 4NM8H 1CDCA 1WA2X 2R59A 3EO0B 4DO4A 4G5AA 2YK1L 2ZUSA 1QLFA 2HWZL 2VLME 3O11A 4IRJC 1DTUA 5C86A 3NK4A 1ACZA 1U8NA 4IRSC 1DL7L 2BSRA 4OF8A 1CK0L 4YGVA 2NYYC 2EEFA 1TTAA 1IC7L 4JHBA 4NHUB 1KB5A 5ERWB 2QSVA 1RURL 2G30A 3MNZB 1E3XA 1R75A 2DTSA 1NFDB 1KYFA 2VN6A 2XU9A 5TE7L 2FSEB 1P2CA 1F6LL 3STZA 4N0FB 3DX4A 3HC2A 4TTDC 5C08A 4Y16B 2EEXA 2IQ9L 5ABAA 4JKNA 3O0RL 4C58B 5IBTL 5FOBA 5D7KE 1THAA 5DFVD 1T0PB 3PL6B 4F57L 1PLBA 3MKKA 3MN8A 4Z7WA 4WU5B 2ZSVB 1UJTA 3CJJA 1IC4L 4JRXA 1ZIBA 2E7HA 3ARRA 4JM2F 5DZNA 5EWIL 4JY6A 4TV3A 4RZCB 2B1AL 2DL9A 3MXVL 3NH7H 4AM0Q 1HE7A 3DROA 1MLBB 4JMXA 4RAVA 1ZGLB 4X0KA 5ACZB 2E6PA 3V9FA 1E4WH 4PG2C 3G5VA 1U58A 4OD3H 4XBPB 3ZGIA 3FCBA 1PCXA 3ETTA 3LNEA 1CGXA 2ICEB 1WDAA 1VGEH 1AS6A 3D06A 2I60L 4PJHE 1F4XL 1EEZA 3DUSB 4TPRH 4HJIA 3TPKA 3VFRB 4ZD3H 3B3IA 3WAKA 1D5ZB 1OP5K 5GS0H 2WLLA 2PXYC 5C7XH 4C56E 5AYQA 2FR4A 1NFIA 1D7CA 1NUFA 3S9DB 2IG2H 1O9VA 3BPOB 1CDJA 5L7XH 3WJJC 1K6QH 2XIDA 5IW6B 4JFQA 5B1AB 4NKMB 4Y4HD 4MA8L 1ZEAH 3LH2H 2W9EH 2EVJA 3O9WC 1S7WB 2NSMA 1UJ3C 4H1LG 1LE9B 4LCVA 3ZKND 3T2LA 4U2YA 4L05A 1DVYA 2H2SD 4A67A 5FLUA 2BVPB 2C1OB 4P5RA 2HG0A 1PBYA 3Q6GL 2PCPA 4IRZH 4LPVA 2ZX7A 3BT0A 3IU3A 1JNHA 4OZFH 1TTRA 2VQ4A 4Y9CA 3MSPA 3RFRA 4FA7B 4KO6A 3QFJE 5DYOB 1HSAB 2BM3A 3GSQA 4ONGH 3VRIB 1INDL 5D70L 4A6YL 1FFOA 3ISWA 2AJYH 3CLEL 2Y07L 4GMSL 4G42A 3IDMA 3Q6FA 5CINH 2Y3AA 3ABZA 2Q7AA 3ZTEA 1UB5B 1QWNA 5A3IC 4JQVC 3WENA 2ITCA 5D7LB 3WNJA 1DQDL 1P4UA 3ZZLA 4MNHB 3ZMNA 3GJEA 2ROYA 3DETD 1DLHB 1G6RH 1VFUA 1WEJH 4EDWH 4XGZB 5C3TA 1PY9A 3RTQA 5KYWB 2H9GA 1NC2B 2DQEH 2ZYIA 1BAFL 2AK4E 4HH8A 3RZCC 3L3DA 2BP8B 2EKSA 5LXGH 3KLQA 3Q8CA 2DYRB 4GSQA 5FYKU 1BZOA 4P3WA 4IRJA 2NY3B 4L4VB 1UD5A 2Y7QB 3ABLB 1OCOB 1IBBA 5FS5A 4IRSA 1QSVA 3L7EB 1X5FA 3MRDB 4CUCA 3KM1A 2CKBA 3HLAA 3V4PL 1U8IB 1HOCB 1NJ9A 2DDQH 3GM8A 3I9GH 3GBLA 2B8OT 3QULB 1NINA 2ITFA 5IB3A 1PQZB 1G7QA 4AJYV 3CZJA 2NLJA 3A6CH 3QEGH 3QUYA 3VXQB 2C7FA 4NLHA 4R2GB 2NR6C 2WXFA 1HHKB 1FNEA 2BNRA 2GPZA 4LHUB 4RA0C 2X6MA 2I5YL 2X1PA 2XWTB 3FQNB 3QUMA 4GUQA 1T1YB 5A6LA 3LKQA 3FCSA 4G71B 3ZSTA 1IM3D 5IVZA 2G9HA 1M1XB 2DWSA 3N3EA 3GLZA 4LBEB 4E42A 4Y2OA 4A2FA 4M93C 1E2WA 1JV5B 1MJ8L 3O2WL 4N8VB 4PG2A 4TSAH 1Z3GH 5HHMD 5HDRA 4QNPE 3N50A 4Y88A 2OMWB 1KZQA 3RKDD 1JDDA 4HPYH 2VISB 3KCWA 5DFAA 5IHZB 2CDFA 4M6AA 1JJUA 3MRNA 4APQD 3HZKB 2HX9A 3ZHKA 1S9XA 2XWRA 1KIRB 4GW4B 1SQ2N 3QNYB 3S5LB 3MLSL 2PXYA 3TT3L 3MOQA 1FNAA 3BEVA 3VFWB 4JM4L 2PTVA 5EEUA 2OCCB 3EFDL 3BQUC 2E9BA 2E8ZA 3WJJA 2CLVB 3VACA 4JFFA 3ZHFA 2WXLA 2BHZA 1XDTT 2RCSH 2EDNA 3BPNC 3ZTJH 3O9WA 2GJZA 3QJTB 2QJDA 1UJ3A 2F74B 1NDGA 5BW7A 5DMIL 1U36A 1JN6A 2VDOB 2MPAL 4KI1A 5J1AA 1HCYA 2NY4C 3S4SG 3E80A 2C4FT 1FCGA 5EA0H 4Z9KB 2R0LL 3OB0H 3QDAA 4CU6A 4YHPA 2HKHL 4KK9D 4HGWB 4MJ5A 3EG9A 4ZFZB 2A9CA 3TASA 1BLNB 3QAZB 4QHMB 1C08A 2DWEB 4MXWH 5E70A 3VSTA 1ORQA 2CD0A 3TBCA 2J88L 4YFDB 3VI4F 3WTSA 5AVQB 2FH6A 5EUOA 4CDHA 2DQGL 3OKLA 1AHWC 2VDRL 3BFWA 3GC3A 5HI3D 1PAZA 3IETA 4TQIA 5E99H 3A24A 1II4E 2IANE 1X5JA 4PVMA 1TZGL 5IF0B 4OR1A 3OLDA 5CSZA 3PNWA 1IZJA 1VGKB 4NQED 4TNWF 1NTDA 4N5UA 2P46B 5SWZD 3W11D 1MFNA 2YWYA 3S34H 2ED6A 4P4KB 2G60H 2X4SB 4UWQB 1H8NA 2X2UA 3RVUC 3H9SD 3V0GA 3RZCA 1MOEA 2LTQB 2VM3A 2WLYA 5BV7B 3MV7E 4F91B 4G8IA 5BO1L 4X4MA 5BS0E 5D55A 5AW2B 2K8MA 3IDJA 5CZKA 1MHEA 2FJGA 1KCUL 1UYWL 3QRGL 2ZUQC 4IMKC 5CKAA 1KCLA 2BP0A 4OD2A 4MQXC 1NCBH 2XUWA 3GMLB 3GMOB 5CEYB 4G8GD 4OM0H 4MSWB 3LXBA 4GEJA 2H41A 4K2UH 1Q9LA 4U1LB 1QI4A 2VT0A 3MNWB 4JPKL 3EBIA 4X5PA 3K74B 3UTQB 2N0KA 5EC2B 1O7VA 4M9PA 3WHXA 2VDPH 5B39B 2KMWA 3NACH 3UROR 4C56B 4U1MA 3ECUA 2NR6A 3PWUA 3OR7A 2CBMA 3H55A 4CKVX 3CX2A 4J3OH 2XFXB 5HHVH 1H19A 3BW9B 3DIDA 1JHKL 2YBRB 3MCG1 4ZMTA 4ODVL 4TQEL 1B0GA 1S7TB 1ZRUA 3PY9A 2NY6C 3ISYA 3L3OA 3WFHA 1G9MH 2WWNA 3BDYH 4Z77B 5L88L 4WWKC 3DHJA 3MRQB 2Q76B 1R3LB 1W6LA 4NJ9H 3D05A 2VAJA 5KSAC 1LK3H 3L3HB 1WCQA 4KK5C 1TU2B 2X4TA 5J4MA 3C2SA 3QC6X 1DVUA 3FU7A 3QFJB 1IE4A 4JO8A 5MENE 1ONQA 3RQ3A 2F61A 1G7LA 4X6CE 3V5KB 1JGUH 1IGYA 1OD9A 2I9LA 3W0WD 4LCWA 3PNRB 3VH8B 1A5FH 1AP2A 3CK0H 3FQ2A 4HZ1A 2GJ6D 2OXGB 3RWGA 5BMFL 3VXOA 1AIFB 3NFNA 4PGZA 1UT2A 3EH1A 4RFEA 4IDJL 3A4AA 3ARFA 3BQUA 3I3BA 3VJ6A 4YHMH 1CDHA 3K72A 2PCFB 4K5MA 2XN1A 4CJ0A 2NXZB 4JO2H 4YHIB 4LSSL 5IQMA 2E7BA 5C0JA 4ABUA 1H6EA 2W65A 5LGYA 3Q3GB 3BIKA 3F6IA 4UTAL 2YPLD 5KBPA 2PCXA 3ARWA 3BKYH 3O0LA 1DQMH 4NQCE 2AK4B 2ESVB 3WTYA 4YHLH 1SQMA 4K94C 3UCRA 2AQRA 3ZL1A 4E9TA 2DOCA 2EDYA 3PJSB 4U3SA 4ZS7L 1XGZA 3R8BB 5FO9B 5HY9A 5E00B 3UO1H 2OJZH 3FSVA 5ISZE 2VAAA 4P2RE 1XH3A 3TNNB 2MNWA 2P5ED 2UX6A 5D9SB 4QRAA 1YEWA 5DVLA 4W9GC 3U2JA 1ITCA 3CSYB 2WMPB 4CADB 4M29A 1AHWA 2GI0A 2XTLA 3QEUA 1MSPA 5C0CA 4GUPB 2V5RA 4FNTA 4NBYB 5I75C 1TVHA 4ATTA 3QRLA 2WIIB 3PXLA 1T0OA 2JELH 4JDZA 2EJ1A 5JIQA 3OMNB 2GFBA 4NX0A 3UAJA 3O2DH 5HGHB 1YPZF 1UWXH 5I8KH 1E2VA 1KBGL 2KHAA 3CZFB 3AMKA 5LDSA 4LDLB 3N9GH 3ELAT 4LKXB 3GSOA 4WWNA 5EUKA 1LO3H 1MVYA 3NPSB 3MLZH 1U8PA 3LQAL 1QUPA 4MA1B 3OHXB 1ADQA 1CGUA 3TZVD 3EJPA 1K3IA 2VDOL 4IMKA 2X12A 3ULAB 2AC0A 4U3CA 2YPKA 1A9BA 3BUIA 4NO0B 3A47A 3NPZB 5ETUB 1PJWA 3GIVB 3I2CH 2XTSA 4LVOC 4N6RB 3CLFL 4UV7H 1F4HA 4HOMA 3U4EA 2BHFA 4U1HB 4ADJA 3KVDD 1N26A 5K69A 4NAJA 4XHJC 4S1SH 4DP7X 5SWSE 1QNZL 5F71A 3MV8A 3U0PB 3S8FB 2BSED 3U30C 1AKJB 3DRQB 5L9DL 1QLRB 1R19A 2ZOKB 3OJVC 1FPTH 2RQEA 2E9IA 3WHE0 3FMGL 3LPPA 4K3GA 5ELIA 2J6WA 1GMEA 1OM3L 3V5DB 1ICTA 3KL3A 3EYFB 4JREB 1I1YA 1C7SA 1MW3A 4HHWA 4Q9RL 2MJWA 3MJ7B 4F5CA 3P0VH 1YDPB 4MAZA 5FR3A 4WDIA 3RWCB 4WWKA 3T0VA 3MRBA 3CE1A 3UMTA 2YJLA 3RJOA 4AK2A 5KSAA 2OW6A 3HC3L 3OR6A 1V7NH 2AJZB 3JWNG 4K9JA 1UT9A 3V6OC 3KPPB 2FJHB 4B27A 4JFTA 4P57A 4Y19D 3HFML 4OF7A 1ZPUA 1RJYA 3RIFK 4F15B 3TESA 4HZLB 5DHEA 2A6IB 3MBXH 3WEMA 2FEJA 4Y1AD 5FYKD 2ZUUA 3CDCA 4BWUA 2K45A 4P46D 2J7LA 2IANB 4J6RH 2B08A 2MEJB 1AGCB 3OG4B 4A37A 2UY7B 1N4XL 1SLWA 2R51A 5I18L 2CO3A 3L95A 1TO5A 1NIAA 5DD5L 4GI9A 2TRHA 3OSKA 1DJXA 4P2QA 5F7NC 2UYLA 4GKZB 3F65A 2CCVA 3D39B 3TS8A 3O4LD 3R1GL 1TJIL 5FYLL 3WI9A 5KJRH 4ORGA 3ZPDA 1DSYA 3I6GA 5EORL 5BS0B 5IMMB 5C07B 3GTVA 3CHXA 4GYBA 4P9HH 2K3HA 4X7DC 1ZTXH 4AC4A 3T1WA 1RUKL 4G11A 2VDQB 3QDGD 4EOWH 5HYJD 1T21A 1NGQL 4N86A 1I8AA 4XXDA 1MAMH 4Y4KC 3T3PF 3TGXA 3DUUA 2W94A 1JXGA 1SJVA 1KIUB 2CO1A 4HV8B 4KFMA 1G43A 2XYBA 8FABA 1IX2A 4HXAH 1ZT7A 1A7NH 1XMWA 3UTSA 2DMGA 1KZYA 3B7RL 3MUGB 4MB5A 5L4MA 3H2PA 4Y2DD 3V5HB 4JPQA 3WFCH 1ZVYA 4LMQI 3IDNA 2IAAC 4L1HA 5TD4A 1HH6B 1UM5H 5BZDB 5DVOA 4Y5VA 1E8WA 1BX2B 3FQTA 2EDHA 1YMME 3FTSA 3LN5B 3X12B 4NT6B 3KPNA 4DUVA 1YZZA 2PTTB 2ZWKA 3GHEL 4FJZA 5J11B 4JPIA 2FBOJ 3BXNA 3GTTA 3INUH 5EB9A 3MLRL 3FHEA 2FECI 5KOMC 2WWMC 1UWGH 1QSEE 3EJUA 3EYOA 1YQVL 1JRHL 1MEXL 3HMWH 2ATPA 3BDXA 3KJ4B 4EEEA 1PNDA 1ZT1B 2P8MB 2J6EA 3EGSA 5MENB 2C3HA 4I4WA 3PQYB 3QQ9C 1JWSA 4HULB 1BQHA 2VSMB 4JHZA 1A6ZB 1W0VA 4WEBH 3EUDA 4N0UE 1BZQK 2BIIA 4WY7L 5EZLB 3G08A 1B4LA 1CT8A 5K9QI 2AEOA 4GQ9H 1X5YA 1BXUA 1JPFA 2EYSB 5GGSB 3VNZA 1JGEA 4NRZB 4LAQH 2PETA 5JHBA 2NW2B 4PU2A 1XXDC 1VADB 4AQ8C 5AG8A 1CR9H 4RDQG 2XDHA 4NWTL 1R34A 5CZVH 4M6OH 4OIAA 3QUZD 4NQCB 3RVWC 3ZE1F 5ESVA 3B9KD 3C6EA 3QJFB 4QXTB 1T3FA 5GS3A 3DJTA 4ONHA 2OS7A 4N20A 3V6OA 4XCFL 5CBEA 4ELMF 1BP3B 2KQNA 4KI5F 5D72H 5GGRA 5ISZB 1CFNA 3C8KA 2I7SA 3AXHA 5DEGA 4P2RB 3FFCD 4YHZH 1OAXL 2R4RH 2YGNA 5DA0B 2EDRA 1SFDA 1MVUB 3MCKA 4WUUA 2E7MA 5HHOE 5FB8A 3JVFC 4F7PB 1BQLH 1PZSA 2E46A 3LB6D 4RMBA 4J1UB 4C83B 4XPGH 3C09B 4BRJA 4XPTL 1E4XI 4LP5A 3WU1A 5IFAL 1QTSA 1U9KA 4PY8I 5JA8B 3WNOA 4WI3A 1A4BA 4ETQB 3ULUC 3D0AA 3LAFA 4MJIE 1CBVL 4MWFA 4Z8FL 2ZOOA 4HCFA 1AXTH 4ZXBB 3J2PA 4RFNC 3RURA 1A64A 4AI7A 4FFWC 4P23B 5E5MB 1HSBB 1ROWA 3B9DA 1NCIA 4OVUA 2DWDA 3ZKMC 1UM4H 3BWAA 4LDEB 1CDGA 3WYRA 4UOW1 4LRIC 3CFCL 1XGTB 3QQ4B 2X0UA 1MFEL 1M6OB 3ARGD 4LSVH 1HHIB 1KELH 4QRFA 3OXRB 3MO1A 4E0RA 2HMID 1EBPA 2OQJB 1PKOA 4KK8C 5D4HA 5K9KB 2WTRA 4Z6AT 2C3WA 5TDOB 4A04A 5F72S 2XIIA 4PVNA 4HIHA 1LNUB 2HN7B 4U1NB 1IAIL 2D0FA 2EH7L 3J8F7 1P7QD 3GJFB 3JTSA 3CFDA 2ZOTA 2H32H 1EK3A 2A7BA 5SWSB 1QA9A 2D03L 2DEYX 3ZZQA 3ZO9A 1A21A 1M71A 2NNCA 3HE6D 2EVIA 2ERJB 1AAJA 3ZGHA 2YMTA 4BFEA 3SE8H 3QUGA 3QYCA 4B0MB 4WHTB 5KVDL 2BZDA 2V7HB 3PIQB 5JPNC 1XHHA 2OYPA 4ILDA 2P26A 1JWUA 1SHSA 4EE2A 2L3BA 3O3BA 3ZQWA 3ARXA 5SV4A 4NIYE 1KCSL 3KGRA 4UILH 2NZ1A 5I19H 4GAYA 3SJVE 1SLXA 5DTFA 4BH7A 2FHFA 4LCUA 2IVFC 2M2DA 2MQ0A 2VDQL 4K3HA 5BVPH 3DX6B 3REVA 3SZ6A 3TA4D 5ID1A 5I6MA 1MRFH 1UD2A 3IXAB 4K7FA 4LBAA 4KHXH 2K6WA 1N9PA 2Z31C 4LLMA 4QRBA 1LP9E 3G6JA 3ESPA 3H0TA 5DUPL 3TEXA 4KV5F 4Q0XH 1WZ1H 1TYRA 3HRZB 1A4JA 1DQKA 2VZ3A 1F3JB 4A2DA 1JPGB 4Z76A 3FO9A 3GMQA 4OLXH 1YJDC 4FEMA 1X4XA 4LASL 4AQ8A 2AHIA 3DKHA 3QR0A 5E6UB 3NABL 3OTTA 2HJFA 3AS1A 1JYWA 1MH5B 3F2LA 3I6KA 2PW2A 1M05B 3LIUA 1IGIL 1NPUA 1FLRH 3L48A 3MV9D 2R23B 4LDCA 2WTOA 1GTNA 1E3FA 2HUEA 4PN6A 2KZBA 2N59A 4XX5A 2JQMA 3NK3A 4GG8B 3IT8D 5C6TH 1S7XA 5EU4B 4YHYC 5B4MC 1C16B 5AVWB 3P4OA 1HKLH 4Y16C 3ZLQC 4XCYA 1U92B 4XI5C 3PLYA 3SDAC 3Q01A 5T33H 4LLYB 1BZ9B 1OF2A 2J72A 2JH2A 4OLYL 1UM6L 4A7UA 2AANA 5L4IA 1OO2A 4XCCH 4H0IA 1YNTA 5ABDE 1NEZB 1ZVSA 4CVXB 1Q9KB 4LEXH 4R3SB 5CS7A 2ZZUT 1DDTA 3U9PL 4WEEA 1YMMB 1I3GL 2Q20A 1E8ZA 5ALCH 3T4YA 3G5YB 3QVAA 4NEHB 2X70B 3U0WH 1NCWL 1SVCP 2IPKB 5DSCA 3ILPA 2WZ6A 1TTCA 3SSGA 4LRIA 4XO9A 5C0CB 5DEFB 4XP6H 4W9FC 3V6ZB 4QRTB 2QPEB 4MYWB 4H25A 4EBQL 1TCRA 2Q2LA 1L9OA 3D85B 4JY5L 5L2JA 1RK1A 5KVEE 2BNQE 3GZPA 4EQ3A 4LRNL 4KXZH 2BCKB 3BDBA 5FXCH 5ID0A 1QG3A 2QADD 4M1DL 2G2RB 2YAHA 3BPLB 4Z7WF 4PCKA 1TXKA 4MCMA 5GGTL 1H3WM 1GGCL 4N0RA 2WVSA 4HWZB 2OTWA 1GZPA 1J88A 4PQXA 5ILTH 2Q8AH 1WHOA 4LOVA 1YC7A 5E2VL 5F0JB 1SYSA 2ICCA 3HB3D 1PGRB 3C9NA 5INCA 3O3AA 5AZEL 4OGQC 1QFWI 3FRPA 4QOKA 1JMZA 1KB9J 4M62H 4N2BA 5JPNA 2XWJB 3L2LA 3RDTC 2KZ1B 4JO4L 2ZUYA 2ZD0A 2B1HH 3LIZH 4KJWC 4LL1A 5KYUA 5T1MB 1OAQH 3IDXL 2YKKA 5HDWA 4UQ9A 2X89A 4KQ3L 4G3YH 2WSKA 2XXFA 2RAMA 5I2IB 3L13A 1OB1A 1YN6A 2GJPA 4A2LA 4AVJA 4KRPB 4EZKA 1Q9OB 1CG9A 4X6BB 2B14A 3HAEB 1OTUC 4QRSB 1D9KD 4A2GA 3FU0A 2WBXA 1RPKA 4JE0A 4XOEA 4J8RA 4D0DB 1R3JB 4LVHB 4ECNA 3QIUD 2H6PB 3QYMA 1FJ1A 3EJCA 2Z31A 4HEPG 2XBTA 4X6FA 5HHOB 3BZFB 2UY6A 3LHPL 4JVPA 2BRRH 3H7LA 2G75B 1XH0A 1A25A 4Y4FD 4D8PA 2AJXL 5J12C 5MERB 5AKSA 3GFUA 4MJIB 2VZ1A 3GI9H 4X9HA 5LLIC 5CCHE 4NZUH 2IQAB 3GBNL 2VJXA 4K9EC 4X7CC 4F7CB 2VUOA 2PCYA 2PPCA 1E42A 4X7SL 2XQBH 2XN9D 4XO3A 1IGFL 3BO8A 4ZSOE 3KYAA 3B6SA 1SMOA 1UXLA 5KWYC 1I3VA 2JI3A 2BNUA 2EXYD 3QA3B 4QTIH 3DI3B 3EH2A 5B21A 5HSFA 1A4CA 3HI5H 2XV0A 3FCGA 5DHVH 2APTA 5B3NA 4P5KA 5MP6L 1UB6A 2ICWB 1BM7A 3F04A 4FNQA 2BOLA 4L9LB 1X9QA 3N41B 2ORBL 3AT8A 3Q13A 4ZNEE 4QO1B 1HKFA 3JWDC 3P2DA 1EBAA 2Z92A 3K6FA 4M5YL 1U4FA 5DO2D 3SDAA 3E2HB 3B2UD 1ZY9A 5IOPA 3AM8C 4R97C 3CDZA 4POZC 1RUAL 5F7EL 2WCGA 5F1KC 3OLIA 1I85C 3ZHLA 3B7TA 5E9NA 1EFXA 1JVKA 4LSRL 4XVJL 3TCLA 3U1QA 4AK1A 3WN5C 4LSPH 2YMXL 1SEBA 3LS4L 2Y5TB 3IN0A 4F7MB 1D2PA 1I8KA 3SPVB 5AUMA 4HFWA 4GKNB 3DGCR 2HFEB 1FZJB 4LL9A 1T66C 2AEPH 1DZBA 3QDJD 5CZRA 3LS5L 4WI5A 2VRKA 4BK5C 4AKPA 5ACLA 3SJVB 5DJ2A 4TVPH 3QUHA 4D3CL 1IT9L 4PHXA 4L8CB 4RETB 3VO0A 4NGHL 3BAIA 1OWRM 1U8JA 4RMVA 1PZDA 1XR8A 4UNTA 4YDVA 3PYCA 4WFFE 3EOBA 4DZBB 3WFBL 3PCYA 2VLJB 4TTDD 3PABA 4FKHA 1KJVB 3U9WA 2OXHA 5I24A 5GGVL 1YNLH 1LP9B 3L16A 5C09A 1WFJA 5KN5B 3BP5A 2ZTBA 2HH0L 3CHRA 3RDTA 3D0LB 3K2IA 4M4RB 2DLTA 3NJHA 1U8LB 2MHAA 1RXLA 2BINA 5CP3H 5CGTA 5IGXL 4YFEA 5C0RL 5IP4A 2OR7A 1R24A 4OUUA 4A68A 3PGDB 2HRGA 3AS2A 4PJCA 4N8CH 3SEPA 3TPUB 1U8MA 2GUOB 4J3TA 3K4DA 3DPBB 5FPIA 1EHXA 3BUYB 1JZ3A 4R26L 2X2HA 4YL9A 3CSGA 3IJ9A 1T2XA 3ARDC 4IKLA 2A1WH 3V55A 4MD0B 5T1KD 5IHLB 2XKSA 3TNMA 1OT2A 1AOHA 3QZPA 2VERA 4XTRC 3SYPA 3DSNB 3DX7B 2YD1A 4QKXB 3FO2B 1MWAA 1SOSA 2E6QA 5HYQB 2XVLA 1KB5H 5JOEA 3SKJL 4I3RL 1KCKA 3EJZD 3D0VB 3PWPB 1IC5H 1R9FA 5JIPA 1KCRH 1GHFH 4JKWA 3EDDA 4HS6A 4G8EB 4JRYE 2EILB 2BP3A 2Y1ZA 1D5XA 3WCYA 3SE9H 1BGXL 1CICC 1VA9A 3FCTA 5CSBA 3MROB 5I0YA 3ZDZF 4H1LH 4JHUA 5HDBB 4WGVB 1HE8A 1L7IH 2IH3B 2FIKA 4P05A 3BAYA 4XP4L 5E1AB 3QZNA 2UZYB 4G2AA 5EUOF 5T3ZL 4Q2ZA 4HIEB 3NN8A 3QORD 4I2XA 5AVTB 2DV6A 4D0BA 2HG5B 4JHVA 5KVFH 5EZOH 4P5TD 3QH3A 4Q9QL 4OUOA 3NIGE 5B38G 3QS2A 3D08A 1ZPLA 2LABA 1F4WH 3FTUA 5BVJA 3Q1SL 2XV6B 1K85A 4MNQE 2MQGA 3V4VA 4ZS6C 5EDXA 4FZEH 4LLVA 1UURA 3UBGA 5B7MA 2C5DC 3AM8A 1ZJAA 5MEPA 4NZ8A 3N6YA 2V37A 1OGPA 4MS6A 4PRID 4ZDHA 4E9YA 2A83B 2DEXX 3KLSA 1UWEH 4DNLA 1ZVNA 4OT1H 4JB9L 4FFVD 2CGYA 1MRDH 4MMXC 3WN5A 4I1RA 4H4NA 3AT9A 3I9IA 4QPEA 2HFTA 5J7CC 4NQXA 4KVNL 5TQ2L 2YOAA 4E36A 1WHPA 4TMPA 1KSRA 3SQOH 1F1GA 4NQVB 4WW2C 5JO5B 2D7MA 1QBBA 4NCC2 5D1QE 3CH1B 3IKKA 4YJZL 1OWWA 1SPDA 5CN1A 3G9VA 5D1ZC 4OZHE 3BIAX 4BK5A 2F08A 4JFDE 3UL4A 1TQUA 2W59A 3HNVH 4Z0XB 2XRAL 3Q2CA 4MTMA 2ZOLA 1IC0A 4NIKB 1FAIL 4RGNC 1GPOL 4JUTA 3T6ZA 5T3XH 1KBVA 1ZSDA 2KL6A 4BFKA 5IVXA 1A6UL 2ATKB 2MNUA 4XE0A 4WFEE 3WMSA 4ZOAA 1CIDA 3KM2A 5FM5M 3NIDE 4QRPD 5CP7A 4QKTA 5IQNA 2OK0L 4UUJB 4AE1A 1NFKA 5DHMC 3VXPB 3US0A 3MRLB 2AXGB 2XG5A 4LU5H 2UWEA 1HH9A 4KKAD 3NSDA 1UASA 1Z9SB 1OCRB 5JR1H 4PCYA 4NO2A 5E9AA 4AQZA 1DCLA 2B4CC 1FBIL 3O3DA 3OXSA 2BWIA 2G3NA 4EXKA 3BWSA 5TFSL 4AKOA 2HT3D 4WU7A 5E56A 3PWNA 4FFYL 4L9DA 3MLXL 3QG7L 4ZSOB 5BZWA 2E5EA 4KTYA 3ARDA 4OAWB 3UTOA 1Y1UA 1T2QH 3RI5F 3ENEA 4TOYH 3LH8A 2NSXA 4XMPL 2IV9A 4L4TA 1TFHA 1ND0A 3GNML 4L37A 3SGEI 4G7VL 2BS8A 3DX0A 3WE6B 3JVGC 2FQEA 4FN0A 5K9JL 5ALBL 2J2ZA 4GXVL 3CPLA 5E94B 4I48B 3OZ9H 1JGVL 3JWOH 3QISA 4EN3D 4AW7A 5C0IB 4KTEH 2HRHA 6CGTA 5IJBC 2ZPKL 4B9KC 1SHMA 1TQVA 3N04A 3W37A 3VFGL 4HOXA 1IBGH 5ANMA 1HCVA 2O26U 4KGJA 5HVHB 4N2EA 5KW9H 5DFTA 3FUIA 5DJCA 3D3VD 3EGXB 4HJ0D 4V1DD 4LLDB 5HI4D 3HC4H 2O6EA 1SYVB 4FQJH 2AK1L 2DQDL 1UUNA 3QZWA 4OJFH 3GXMA 1EA9C 1ZLVH 1I7UA 4AYGA 3I75A 5GRWA 4Y1TA 2FB4L 4RNRA 1K5NA 4YHKH 1DVTA 3GMPA 5D1XC 1MHCB 2B2XL