3NP3A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 38
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np3A00
2FT7A 5A7EA 1AZCA 1SDDA 2YXWA 5F7AA 2XU9A 1WA2X 2XX0A 2FJSA 3IBOA 1E5YA 4W9ZA 2BP0B 1JZIA 3H4FA 2R7EB 4YSUA 2GIMA 1BXAA 1RZPA 1BQKA 1OCOB 1GYCA 3S3DB 1MG3C 4P5SA 4YSQA 1PZAA 4GXFA 2IDTA 3T6ZA 1J9RA 1NIBA 3MBWB 1XB3A 4W1TA 5B1JC 1IBYA 1TEGA 1J9QA 5B7MA 1NPJA 5I5MA 3PPSA 4AKOA 2FWLB 3OD3A 3T6WA 3NT0A 5PCYA 4QLWA 4G7SB 3DTUB 2DYRB 1M9WA 3X1GA 2X87A 3FU8A 3FSVA 4DP5X 3AY2A 1AANA 1E5ZA 2FNWA 1CC3A 3ABGA 1JZFA 2H47C 1BXVA 2VM3A 4AKPA 1SNRA 2BHFA 2PPEA 2BZCA 1AZBA 3FSWA 3T6XA 2XXGA 1JERA 2GHZA 3MX0B 3TBBA 1JVLA 2HXAA 4A2EA 4EF3A 4KOBA 3ZX1A 5PAZA 3FU7A 4Q89A 1V10A 1ZDQA 4A66A 1ET7A 1F56A 4PCYA 3AW5A 1NDTA 1ZIAA 4GP5B 2JFCA 4YSRA 1KYAA 3EH4B 3TA4D 4HZ1A 3UABA 3PCYA 1OE1A 3OM3B 1MZZA 1J5CA 1W6LA 5TK4A 4E9QA 1AQ8A 1JZEA 4DPCX 2BW5A 2IDSA 2UXTA 2PPDA 2QT6A 1ADWA 1BQ5A 3NJJA 5FC9A 4F2FA 2EILB 3S3BB 2XXFA 2YAQA 1ZIBA 2XV0A 2QPEB 3ASNB 2I7OA 1A4BA 1SFDA 2DWSA 2OJ1A 3OQRA 4G7QB 5LDUA 2YXVA 4NB7A 1WA1X 2XV3A 1PLCA 4HHGA 5AZUA 2VSKB 2PCYA 1J5DA 1A4AA 4N4YB 4YSDA 2AVFA 1ZV2A 3TBCA 2W88A 3NJHA 4BXVA 3S8GB 2IH8A 5I6NA 4HIPA 3ZDWA 4BWWA 4E9YA 1OE2A 1RCYA 1PZBA 2H3XC 2MRYA 1ILUA 2XV2A 1N68A 5I6OA 3OMIB 1AS6A 2OV0A 4N8UA 1UATA 1ETJA 2HX8A 3ZBMA 3FPYA 4A2GA 4HCGA 1GS6X 4KOCA 1HAUA 4DP8X 2H5UA 1L9OA 2XLLA 5AKRA 1R1CA 2I7SA 1AG0A 2PPAA 2XWZA 1JZHA 5I6KA 1AS7A 2ZOOA 4Q8BA 1URIA 1YLBB 2J5WA 2FT6A 3SBPA 2E86A 3CVBA 1BEXA 2J57A 3ZIYA 1V55B 2WSDA 2DWTA 3IEAA 3X1NA 1FFTB 5B1AB 1AACA 4YSAA 4G7RB 1JVOA 3NJLA 5D4IA 4BK5C 1ILSA 2CBPA 2CAKA 3IE9A 3QPKA 2B3IA 1L9TA 2UX6A 4BWUA 1PMYA 3C75A 1AZUA 5D4HA 2IDQA 2IDUA 1BYOA 3NP3A 7PAZA 4X4KA 1KBWA 2DV6A 2CUAA 3PXLA 3PAZA 1JXGA 1KGYE 1PAZA 1ZPUA 3JTBA 3NSYA 3D12B 1I53A 1BAWA 1E67A 2GBAA 3UADA 4QKTA 5I6PA 4CSPA 1NPNA 1HAWA 4FAAB 1PNDA 1NIEA 1L9PA 5I5JA 1EZLA 2GI0A 2RACA 1X9UA 1M56B 2J56A 1MDAA 3FT0A 4MFHA 5EHFA 1XB8A 3QJUB 5IY5B 1OOWA 3SQRA 3G5WA 1IC0A 2P80D 1QNIA 2QDVA 3EH5B 4UAHA 3UAEA 1PZCA 4A68A 1TKWA 4P5RA 1JZGA 1A8ZA 3SBQA 4NERA 3TU6A 2AZAA 2DY2A 3KW8A 1JXFA 1SDDB 1CURA 2GB2A 4KNSA 1WS7A 3X1EA 4DP9X 1E30A 2FQGA 5AFAA 1QHQA 1OCZB 3AG1B 4DP1X 2HRGA 1SFHA 3EHBB 1NTDA 2BW4A 5B1JA 3HB3B 2N0MA 5I5IA 2GC7C 3JT2A 2FTAA 4E9VA 1JOIA 1JXDA 3ASOB 3EH3B 4YL4A 1ET8A 4DP4X 3X2QB 3NSCA 1T5KA 3X1BA 3V9EA 2FT8A 1GY2A 3NP4A 3FU9A 2HLEB 2IWEA 3CDZB 2ZONA 3NJNA 4DPAX 5B1KA 1KCBA 4E9XA 2UXGA 4G70B 2NRDA 4FA7B 2YQBA 4KO5A 3RYMA 2AANA 3HEIB 4BDVA 2LLNA 3QJRB 4G72B 4A67A 2YAHA 5E9NA 3QQXA 3TASA 1JZJA 4NAJA 2UXFA 3FSZA 1SHXA 4DP6X 2Y1AA 2IWKA 3ABKB 3AG3B 3QJVB 2X88A 3CVCA 1OE3A 2A3TA 2GC4C 2OCCB 2BP8B 2YAOA 4DP7X 2BP0A 2W8CA 3FU7B 3OMAB 3FQYA 4RH4A 3T9WA 2R7EA 4E9RA 1SHWA 4A2FA 4K9JA 4KNTA 1AS8A 1KDIA 2TSAA 7PCYA 1ASOA 2VW6A 3WKPA 2VN3A 1KBVA 5I28A 2ZXWB 3NJIA 1KV7A 1NIAA 4KO9A 2XUWA 4F2EA 1ZDSA 2AZUA 2B08A 4CSZA 1IBZA 3PAVA 2YAEA 3PAUA 3WIAA 4UANA 2MTAA 3V9CA 4HAKA 4PAZA 2QPDB 2BWDA 3N2JA 3L45A 4AX3A 4YVUA 1ET5A 1OV8A 8PAZA 4JHVA 3U25A 2YARA 1AIZA 1W8EA 4YSSA 2PPFA 3NJGA 1GS8A 2YAMA 2HX7A 2PCFA 3NYKA 4AZUA 1CYWA 2ZWNA 3X1FA 4F7KA 3NJMA 1CYXA 3T6VA 3NSFA 1HFUA 2Y69B 3FYIB 3IN2A 1E65A 4YSPA 1AZRA 2DYSB 5ANHA 5F7BA 1NIFA 4E9WA 3DKHA 1B3IA 2XVBA 1A3ZA 4G71B 4BXSV 1WS8A 4YSCA 3FS9A 3FSAA 3BVDB 9PCYA 1SF5A 1WAEA 1FA4A 4DP0X 1PNCA 1J9TA 4A2HA 1BYPA 6PCYA 3SBRA 3N55A 1DYZA 1OF0A 4KO7A 4DP2X 3FPXA 2UXVA 2PLTA 2YAPA 1IUZA 3QJTB 3CDZA 4UF7C 1AAJA 1GS7A 1VLXA 2J55A 1ASPA 4E9TA 5B7EA 2TSBA 3AZUA 2HRHA 3T71A 2WO3B 2VW7A 1QLEB 2IAAC 2VW4A 5I6MA 2P80A 4M3HA 4GY4A 4HHWA 1M57B 4JHUA 3KW7A 3WNIA 1NICA 4M4RB 1RKRA 2BWIA 4KO6A 2HX9A 5B3SB 1X9RA 2I85A 4L0PB 2BP8A 1PY0A 4HCIA 1NWOA 1EHKB 2BO0A 3H4HA 1L9SA 3GXUB 1BXUA 3QJSB 1TEFA 1AOZA 3ABLB 2CJ3A 1NZRA 1AR1B 2VSMB 4GYBA 2IDFA 3EF4A 3WI9A 1J9SA 1MZYA 4TXVB 5I6LA 3PLYA 1PCSA 1WA0X 1GSKA 4JKNA 4WTQA 2CALA 2JXMA 2XYBA 1PLBA 3ERXA 1XB6A 2HZHA 3NJKA 4DPBX 4A2DA 4ENZA 2Q9OA 1DZ0A 1MG2C 3ABMB 1A65A 3H56A 4HALA 4GP4B 5TK2A 1RZQA 2AFNA 1L9QA 3BQVA 3CVDA 3S3CB 3GYRA 1NWPA 4E9SA 2FQEA 3CZUB 3AG4B 2VMJA 1NINA 2IH9A 2PP8A 2VM4A 1W6WA 5B7FA 2GSMB 4YVNA 1A4CA 3IN0A 4KNUA 3NJFA 2BZ7A 1PF3A 1IKOP 1AG6A 1ID2A 3OMNB 4AKQA 1NIDA 1PLAA 1L9RA 2XX1A 3UGEA 3WNJA 1BQRA 2JKWA 3WG7B 4BWTA 2CCWA 2FQFA 1TU2A 1KCWA 3CG8A 2FQDA 2EIJB 1N70A 1KDJA 3FQ2A 1GY1A 2EIMB 2PP9A 4GP8B 2YAFA 2IWFA 1AZNA 1OCRB 3FYEB 1GR7A 2EIKB 2PPCA 2WO2B 4YSOA 3WKQA 4YSTA 1ASQA 3UACA 4HCFA 2EINB 1SJMA 3UAAA 4WKXA 2Q5BA 4BDVB 4ZK8A 1V54B 3GDCA 2PP7A 3S8FB 4AI7A 6PAZA 3DIVA 3NSDA 1SF3A 2UX7A 1GW0A 1CUOA 3AG2B 3QJQB 2QDWA 5B1BB 5I26A 1FWXA 1XMEB 4YSEA 1OCCB 5D4JA 3FQ1A
chains in the Genus database with same CATH superfamily
2RD0A 1UCBL 2N7SA 3EJZD 2NY3C 5KVDH 3HI6H 1OANA 1NMBH 1RIVH 1WG3A 3GBEA 3I2CH 4NKMA 2C3VA 2XPZA 3CC5A 1FORH 1XGQA 1J5IA 4NUJB 1E5YA 3B2XA 3MREB 1IVTA 4Y9FA 3DVGB 4K71C 4AGNA 2FEDD 2R4RL 5ANMB 4I0PD 4JFOA 5GGVL 1LLAA 3DGGB 3GXNA 2PW1B 1P6WA 1X5GA 4PRPE 4JDEB 1BQKA 1OCOB 2VRQA 4ZMLA 3VXUA 1AXIB 3DX6A 5FKAA 1N8OE 1JNLL 1VADA 3BP5A 1E50A 1PSKL 4FKEA 2DH3A 1ORQB 1WF5A 3KPSB 4IKNA 2X05A 4DKFH 4K3GA 3GJFB 1P4LA 5KBKA 2H3KA 5C3LD 4FERA 5HHPB 4NQUA 3Q8BA 5BS0E 2J1KA 3VFUB 3DTUB 5HYEA 3P11H 3S3PA 1Z9MA 2ESVB 3TV8A 5DK2A 4GEIA 4YQXL 5CCKL 4JMXA 5D7IA 2XFGB 1MPAL 1NAKL 1JZFA 2Y7SA 1NBCA 2H2SC 5DWUL 5JYLA 2G4EA 1OAZH 5FOBB 1F6FB 5DRWA 5F1NA 3U2JA 1NCWH 1MRFH 2OBGA 1GKOA 3NIDF 3FSWA 3GMMA 3VJ6B 1JERA 3NCEB 4N2MA 3NCFB 3ILQC 3S35X 1CFNB 1RJYA 4LL9A 4HIIA 2QSVA 4NCC1 1MOEA 3P9MB 4ABUA 4L29A 4JFSA 2A4ZA 4TVUA 4NOBA 1FE8H 2OXHB 2UY7A 5F0PB 5C09A 4JO8A 4Q0XL 4RAUA 5T33L 2NQ3A 3CU1A 2CJUH 4GP5B 4YSRA 3UJIL 1RVFL 1INQB 2EH7L 1A02N 1AJ7L 1PEZA 2IGLA 3QPXH 4JB9H 4YPJA 5L6YH 3ATBA 2GFBA 4PI0A 4YHOL 5TK4A 4J3OG 3FAXA 2OCFD 3RUGA 3KPPA 4KMQA 3N04A 3NFSH 2AJUL 1BQ5A 5ICZA 5JZ7C 5DD6B 3LPOA 3FQNA 1RUKL 4K7PX 3V4VA 2XPGB 4U1HB 3EYSH 3NUKA 2Q8AH 3KPTA 1T21B 1AGBB 2OJ1A 4Y4HA 5CFAA 4PLJC 4BFRA 3B5TA 4LRIC 1F11B 4R3SA 2PCYA 5F9JB 5JIMA 1TLKA 4WW2A 3BAIA 2IOIA 4KK6D 1M1SA 4OQTL 3SGKA 4M5YH 1S5IH 1YN6B 2BINA 5LUMA 1RCYA 4YNYA 1O6SA 4NZTH 3OF6A 4QHLB 3SDDB 1YEDA 3LRMA 3ISRA 1G9NC 4JZOA 2R2EA 3QUGA 3MLXL 1NFDA 2VJ8A 4X9BA 5HHOE 1DN0A 2R2HB 1KPVA 4N8UA 1MF2L 4HBQA 1UWXH 1ETJA 2QMJA 3MV8E 4KXDA 4PJDB 5TF1H 5C0BE 4A6YA 1BFOA 4K3EH 2HX8A 2OMYB 3GLAA 5HGDA 1DDHB 1IO4C 4MMXC 4DWHA 1PZUB 5KWYC 1KGCE 5LGKA 5I15L 1SBSH 3IGKA 4XCCL 1HAUA 2HLAB 4MXWL 4HWZB 5HDQL 5LAXB 2I7SA 3CQPA 3IGLA 5ALCH 2V0AA 2V9TA 3MOQA 1TYJA 4C54A 1DVFD 1R3LA 4KPHL 4KK5C 3N9GL 4HQQL 5E99H 3QUXA 2BHYA 3CQFA 4G8GD 2Z4QB 4M5ZL 1E27B 3MTRA 5IQLA 4B50A 3X1NA 3UCRA 3EOBA 4YSAA 4L8SC 2EYRB 4JFZL 5CP3H 3VNYA 5KG9B 3NJLA 4J6RH 3ULAB 1I7RA 3KR3H 4IOFD 1TG8A 4RFOH 3C9NA 3VWKD 2BNUA 2YC1A 1IQDA 1BYOA 2IDUA 3P0VL 4KJWC 1NUGA 5DI8A 3REVA 4ZFFA 1G7PA 2ITDA 3EYQC 3N85H 3GSRB 1YYLH 3FO0H 4MB5A 3O6KL 1CBJA 3PAZA 3QAZC 4JLRA 4TL5A 3PWPE 4HWEH 3EYUL 4PGJA 1TVHB 3SDXE 3FF8A 4PG2A 2WWKO 5FA4A 3OKOB 2BSTB 2FR4B 3H7BA 4FLHA 4KTDH 2VDML 4OI8A 2Q6WA 2LU4A 1WIUA 3H3PH 3N42B 4HH9B 3Q8AA 1GYAA 3QWRA 2D3NA 5EHFA 3BUQA 4XNMA 1XVSA 2AJ3B 5LHDA 2CIKA 3TNMB 3KYNA 4JFED 1CFVH 5I1AA 2IH1B 3WL9A 4PJGA 1QNIA 3MV7D 2VH5H 1R3HB 1DJHA 2FLRT 3INUH 4G5ZL 2B4CH 4G6JH 4CN1A 4MMYA 4QYAA 5I9QC 5IVOA 4FQJH 4YBLB 3WTUA 2EC9T 3U7YL 2B77A 5EU5B 4XWGH 5LXVA 4P3WA 2ZF9A 5IQ9A 4GOSA 1CE6A 1TVDA 2AEPH 4UOW0 3FB8A 4NC1C 2JK5B 4S0TD 4ZNEE 3LS5H 3WCYA 4L37B 4HU8A 5B8CB 5JOFB 4ZQKA 3ULSB 5C08B 3L3DA 1YEFL 1R6VA 2B1AH 4ZFOL 2VDRH 5DK0B 5JYMA 1MAML 5C2BH 4XRCA 2A77H 4BCZA 3I9PA 4NCC2 3QDJA 2J1YA 1CXIA 1JHTB 4FXGC 5A3IC 4FYQA 4YLQT 3X2QB 4O2EB 3P9WB 3ZKXB 2FT8A 3RGVC 1QSEE 4M7JH 5DJYA 5EU3B 1J1XL 2QGDA 3B3BA 4G70B 3A67H 3UAJC 3QH3B 3CPLB 1F5WA 1RK0A 3GXMA 4URKA 4NP9A 4PJHB 1MHPL 1QW8A 1QTSA 4JL2A 4MAYA 5F70A 4XBPA 1FCCA 1MVYA 2L7UA 2DF3A 2QGCA 4FQXD 3KL5A 3MDJA 3QQXA 1HKLH 1JPGA 4JFQA 5D1QD 5IB5A 4NKOA 2AJXL 1DANT 3F7RA 5ISZA 1QW9A 3Q05A 4Q2ZB 1N0LA 2Y1AA 3TBTA 1PL3A 4U1NB 4HIQA 2OK0L 1X4XA 4JKKA 4M03A 3SODB 3O2DL 3O3EA 1U8MA 1CG9A 2BP0A 4KKQA 2SEBA 3LEYL 1LILA 3T9WA 4B53A 4A2FA 1AE6L 1U8HB 2NSMA 4XCYB 3RAJH 1AS8A 3BO8B 2G30A 4K5PA 4QGTA 4RMSA 4ADGA 4NNYB 3R06A 1RUML 3NSJA 1D5RA 3QWQB 4JE4B 5AWNH 4Z7UA 2YFNA 2AJZA 2ITCA 1VJSA 5IROA 3T4AB 4XMKL 3FMGH 2IALA 5C92A 5FA3B 4IEFB 2XZAH 1N7ML 1QWHA 1OY3B 5DD3L 1E2VA 4CADA 5EIQA 2OYKA 1I1AA 4O51B 3CSGA 3MRNB 1AQDB 5FCUH 3RWHA 1AIZA 1M7IB 5E8EA 3AT0A 3MLUH 4FG4A 3U9PH 4MNQA 4MD4A 2OMXA 2AW2A 1CD8A 2OXGB 3FHEA 2K45A 1AXSA 3E8VA 3O4OB 4H5SB 5LBSA 4HZAA 3V7AG 3ZHLA 1P9MA 4HS6A 1Z5HA 3GSOB 3MJGX 3PGFL 4YHYB 3FYIB 2H7WA 4YJZL 1ZS2A 2CBMA 1LJMA 5D5MB 2WZPD 1B3IA 1U58B 1F3RB 2APWA 3TYFB 1MJUH 3C5SA 4KK9D 1Y0LB 4K5MA 3NJXA 1CN4A 3TJEL 4PVLA 2DM4A 4L1BA 3ATAA 1N5YH 3FTVA 3ZRSA 3HOGA 1IC4L 1QTYT 1RLWA 4RMRA 4M62H 1TPXB 1BYPA 3VI3B 2XY1A 1JK8B 5IGXH 3LIZL 3N55A 2B0SH 1D3CA 1H8OA 2W38A 5ACLA 4JFDE 1KGUA 3U4EB 1EHLH 1OTUD 2PLTA 1ZA6B 2QQLL 4PGBB 3DHJA 1ZLUK 4KAQL 4LEXL 1DJZA 2I07A 2LU5A 3SQBB 1ASPA 5DRXB 1DCEA 4D0DA 4OF5A 3G5XA 4Y16C 1A1NB 3LZLA 3JTSA 5LJYH 1RU9L 1T6VN 2PCXA 1SEQH 2HKFL 5L9DL 1PQZA 1HILA 2AERT 2V5MA 1EBPA 1KF9B 1Q1PA 5GGTA 3JWOC 4Y4HC 3LN4B 3QG6A 1MELA 2FYYB 2N1TE 2F54A 2FUQA 4EJ1C 2HFFA 4XI5C 1K3ZA 1OAUL 1X9RA 4LPWA 4WW2C 4N0FA 3WOVA 2NXYB 3SGKC 1LQBC 4EVNB 2BP8A 3OR6A 3GM8A 5EU4A 1IT9L 2IF7A 2VSCA 1HWHB 1FO0H 1URLA 2YK1H 4I0KA 2QVIA 1SXSA 4Y5VC 4B95C 4BSJA 3S36X 1BSIA 2VAAB 5HYSB 2YSSA 4YDKH 5E4AA 3ABLB 2YQ3A 1DQJB 3D48R 5AKSA 1UXLA 4P2RD 4DK3A 1VFOA 2IDCA 3N41F 2HWZL 4LBEA 4KH9A 1PG7L 3RHWK 4UT6A 2BNQB 2XWBA 2XTLA 2XA3A 1I1YA 2EE2A 2X1OA 4ENZA 5C07E 1NCJA 3I74A 1ADQA 2QFPA 1PG7W 1QP1A 4DH2A 1GKEA 3E6HB 2GTQA 2R0LH 2DWDB 1Y18A 3GRGA 1P69B 2D0GA 2PR4L 3CVDA 3QS2A 4PRDB 1J0HA 5KYWA 3MRJA 4NZRH 1UM4L 5F96H 5KUKA 2Z8RA 1ZLVH 3CZUB 2ZOUA 3E38A 4XE5B 1OB1B 2E8ZA 2ZP0T 4UAOB 2XJLA 4FNLH 1DLFH 4IQHA 3GHBL 4HUWA 2RFXB 3NPZB 4XMXA 1JWMA 5L8LB 1GGIH 1XAKA 1I3VA 3DIFA 5DQ9A 3ZZSA 1BQRA 5I1CL 5C0CE 4LLVB 4ZS6C 2J4WH 4AEHL 2AK4D 2MOQA 3T2OA 4O2FA 4UMSA 4IRZH 2M2DA 3AT8A 4Y2OB 1B6DA 1NCBL 4HKXB 4TVPD 1S3KL 3II2A 4YSOA 4A39A 3VXPA 3DDGA 3H2WA 2WXMA 4Y1AD 4PG2C 3MUGB 1XCTA 4RAHA 2L7QA 5CINL 2Y06H 4BDVB 4XCNA 1EO5A 4N2HA 3VW3L 1NKRA 5JTWA 1YCSA 4QJ3B 3O0RH 4JCLA 3PJSB 2UX7A 3BI9X 2BP3A 2KPWA 4N9OB 1Q9OA 2DQEL 3CSBA 4JZJA 3VFOB 1ZK5A 1LMKA 4M93C 5D4JA 3GNML 3A6CH 1UWEH 5EO9A 1KBGL 5CUSL 1QBMH 5IB2A 3PQYB 4F7MB 1MH5A 3ZO9A 4RZCB 5BZDB 5LGJB 2OZ4A 3CLEH 4PJEA 4KITB 3UXFA 2DAVA 1JZIA 5E4OA 1XZ0B 3CIAA 3HHSB 2CK0L 2VKWA 4B9GA 2IPKA 4M4RA 4CVWA 1NSNL 1S78D 1WTLA 3H53A 2O6EA 3MLTB 5E2JA 4FFVC 4MA7H 4LF3B 1XF4B 2BNRE 3K91A 5C0RL 1NIBA 2I5YL 4OTXL 1JZ8A 3VI4E 3DOSB 1C5DA 2WTOA 4LBAA 5KZCD 1B0GA 2VERN 2WUBH 3M45A 1OCWH 2IH3A 4ACPA 3OD3A 5EUKB 1D5ZA 4W68A 5FUOL 4A7SA 3KPNA 2DYRB 1M9WA 3NESA 1SXBA 3QJOA 2XZQH 2X1XR 5FDWA 5HYSG 5BOPA 4N0CD 1WZ1L 3UCQA 1BVNT 4F92B 1FSKC 5F1OB 3D39D 3IDNA 4AKPA 1MFCL 4MJ4A 3I84A 4GAAA 4MAYC 5DUJA 5ANME 4JS7A 5FOJA 4HIHB 5HDOA 3FU3A 3VXSA 1P7HL 5D2LB 5IT2H 1QFWM 2ZCLH 3AM8A 4MMXB 2ZUXA 1V10A 1YEGL 3TCTA 4HKBA 5GHWH 5E94A 1ZS8B 3IGFA 1KYUA 2JIXB 3QA3A 2CDGA 2D2CC 4JFPA 4LFHG 3WGVB 2WXGA 2EVFA 4JNXA 3DGDA 4K7FB 4XODA 3RLSA 4AM0A 4UZUA 2GTWA 1I8KB 1LVEA 3WD5H 2K6ZA 3BVNA 1FHGA 2ESVE 3QZLA 1S7RB 4URTB 2R0ZL 4B96A 1JZEA 1K9TA 2WBJA 4B9CA 4IRJD 3Q6FB 2J6EL 3NJJA 4FZEL 3EBGA 2EILB 3O3AA 2X4SA 4TUKH 5IW3A 4F2FA 3ZKSD 3O9WA 2OM5A 2IPTH 1DBMH 4HBCH 3UJJL 4PVNA 1RK1A 4APQA 1SY6A 4CVZB 2XFXA 5J11C 2H1PL 1BF2A 5AYQA 5CBEB 4RWYH 2X4NB 3EOTH 3F5WB 4QHKI 3RZCB 3HFFA 3V4UL 2VR8A 1QI5A 4HFWB 3ZKMD 5C0IA 5C6WH 1XF3A 3ARPA 3OLGA 4M6MH 2B1OA 2YEZB 5DLLA 1Q9KA 3BAEH 2N0KA 3CAFA 3PGCA 2C7FA 2ZWZA 4PW9A 5E5RB 8CGTA 5DJ2A 5SWSD 5EOCH 1OAYL 5JUEH 3OAUH 4PLKD 4AT6B 1YC7A 2RQEA 3TEZA 4M61B 2OV0A 3T5WA 2Q2EB 1P9MC 1KWKA 1G1OA 3G5YA 3MTXA 1R17A 4BFGA 1W72A 1ZVSA 3QXDA 2VDMB 2AABL 4WV1C 3ZDZB 1X7TA 4N0YL 1DVZA 5SWZD 5F1IA 4F7PA 2FX7H 5IJDC 5F89B 1AD0B 4OKVB 2WHVA 1X6LA 3Q48A 4NKDA 4PJ9D 1ICTA 4GI9A 3IRCA 4P48A 5LG1A 3KLDA 2YKKA 1CLZH 1RULH 3IJYB 2Q3XA 3NPSC 3ESVF 3OXSB 3TT3L 2HVKA 5F7EL 3MNWB 4G7VH 3F58H 2BSED 4P2OB 3VFWB 4G7RB 3WO3B 3PDOA 1NQBA 2CNYA 3K2UL 4JQVA 3RL2B 3VMPA 1NJ9A 3RVWC 5DD5H 2VUKA 1EEZB 4RX4A 4G8EA 3WIHA 1HH6B 5GRJH 3RX9A 3NP3A 1COBA 4PJDE 3FQTA 5ADOH 4ZFOB 3H9ZA 7PAZA 4C4UA 2A99A 2W65A 1HH9A 4M6NL 2ODHA 3RGVB 3ISYA 4XVJL 1QVOB 1JYXA 4OGZA 1FQ9C 3OV6A 2EUWA 1EJFA 5T3XL 4QHMA 4JQIH 2PYFB 5FIEA 1OOAA 2VXQL 3MOBL 5GRYA 1U8OB 1GCYA 2H6OA 1BG1A 5IHHA 3NFNA 1LO0L 3GSNA 5DVOA 1D5IL 1X5HA 1G7LB 2ALWA 2BY3A 4MFHA 3UIYA 3QJZA 3LVEA 4Y4FD 3UTZB 5AVXB 5JHLL 3DXAD 1XB8A 3LDBC 4P3CH 4PP1D 5CZKA 4E41B 2X42A 1N6QH 2WNGA 2NY2D 1Y6KR 1NGQL 4KKBD 1H3PH 4RAVB 2XWJA 3FCUB 2YGOA 4R2GB 1DANU 3SKJH 3AACA 3MBEA 4ERSL 4GG8B 3HE6A 3O8XD 4OCSH 4PGCB 6TAAA 1TZIA 3V0AC 2EDJA 3WNMA 4NKMB 2E6QA 2WQ8A 3OJDA 4RESB 3CC5B 5GGUA 5LGHH 1XGQB 1CGUA 5DQJA 2RCSL 4DKEL 3K71A 3I6GA 4JY5L 1F13A 5FW6A 3MQIA 4HU2A 1EJOH 3TV3L 3P0YL 5E2TL 2JMRA 4RBPH 3DX4A 3L4XA 4QHUB 3VXUB 2B20A 4X4ME 4P4KD 3NSCA 1T5KA 3OB0H 1N9PA 4OGAD 3RTQB 1A3RL 4JRLA 1A6TB 4L1TA 2ZONA 1I1RA 3P4MB 3OKEA 1P4LB 2MNJB 5KBNC 3TLRA 4KDWA 4PI2A 4XPHL 4LCYA 5F7NC 3W39A 4Z7WF 1S9XB 5DXWA 4JREB 3QEQD 4LHUD 4HIXL 4L4VD 5HP5A 5ESVA 5CEZE 1E9PB 2YAHA 3PABB 5E9NA 1T66C 2FBRA 5D7IB 4ZI8A 5F0MB 5E9DD 1SUHA 1WFJA 2Y1ZA 3S3JA 4UOJA 3GJEB 4GQZA 1L7TH 2HFEA 3ABKB 1JPEA 2X6UA 1LP9B 3AG3B 3MRRA 1A7RH 5C08E 2GI7A 2NZ9C 1E2WA 1RJYB 1EGJL 3MCG1 1JGLL 4HIIB 1KJ3L 4JZJC 1QFUL 4I3RL 4L29B 1EANA 3CFUA 1WK0A 2H4EA 4KKRA 3TESA 2UY7B 1OAXL 5C09B 4RAUB 2RTTA 3HMXH 4U05A 1KDIA 5GIRB 1GC1C 2JJWA 2R1XA 7PCYA 5FF6A 3S9DB 3BDYL 2D7QA 3M8OL 3EZ8A 2FB4H 4NWUH 1CE1L 1A4KA 4GSRA 2GIYA 3FTWA 4PJHE 2R1YB 4M6OL 2E9JA 5C0AD 1I3UA 4HMCA 4ABVA 1MJ7H 2VDNL 2B08A 2GFBB 4M1GH 4LPYA 2YAEA 3JV0A 3WIAA 3KPPB 3MLYH 1JMXA 4HAKA 3MV9D 2HN7A 1CTMA 1TJGL 4PJCF 5CKAA 2WZAA 5ICZB 1CZ8H 2QPUA 5KOVC 3MLRH 3V4VB 3ORJA 3T0DA 4AZ8A 5KSUB 4WEUD 1F97A 4M1CC 1BBJA 4GLRH 3BZEA 2BVUA 1LGVA 3R7RA 3A4EA 5GZND 5JHDD 1DBJL 2PPFA 3NJGA 4JANA 4R3SB 4WW2B 5T3ZL 1UD4A 1P7KA 3V4PA 4G6KH 1FAIL 3U1QA 3CDFA 4HJJL 4K3JH 1QOKA 1O6SB 1H8SA 1XX9C 2QQQA 3QCVH 4JZOB 2R2EB 4PGDA 3ECBA 3DX7B 3J7HA 5AL8A 5F9WC 1PEWA 1NFDB 3FS9A 1ZE3H 1XTLA 5JW4M 2A73A 1DN0B 1V27A 4X6CA 1KPVB 4LEOA 5JR1H 1SF5A 1EVUA 4A6YB 2VL4A 4KVNH 1BFOB 2IFFL 5HGDB 5JIIA 1JRHL 4JRWA 4JFHD 4W4OC 5MI0C 4K7PY 1FYHB 2V8MA 1CLCA 4LOFA 2RB8A 1EAOA 1UWGL 3NH7H 5IW1A 1QPKA 3AVEA 3G04A 1R3LB 1UH4A 4YHPA 3ULVE 4AITA 4UNIA 3BAWA 3QUXB 3V52H 5LQBH 3QARA 4Y88A 2YZ8A 4HEMA 1ERNA 2WBJC 3EOBB 3TA3A 1UCBH 1BZ8A 2X4RA 5F44A 2IAAC 2CBTA 3O9WC 4GSDL 3ARBC 2J21A 4APQC 3KS0J 5C1MB 2R4RH 5GGVH 2YC1B 1IQDB 2O30A 2HX9A 4NM8L 5DI8B 3REVB 4XTRC 4ZFFB 1G7PB 3SDAD 4ALAL 3VI3E 3D2TA 4JLRB 3EH2A 1VPOH 1AVAA 2O5YL 2WXIA 1FC2D 4PCSA 3C60C 1FBIH 4HGMA 5EUOA 3W38A 1RUAL 1MCOL 3OAZH 5IVXF 4PS7A 5E6YA 1DQIA 5FA4B 3H7BB 5J6GB 4XN7A 3THML 1AOZA 4OFYD 1BECA 1YJDH 1I8MA 2Q6WB 4HOZA 3U79A 2HVJB 4XNMB 1G94A 3NVQA 1Z32X 2CO6A 4ZOEA 3KYNB 1FVCA 3U7WL 4AV5A 4QGYA 5I1AB 3T4YB 4PJGB 3WL9B 5DFVD 3W11C 4UT9L 3QO1B 1FNFA 4LO9A 1MPAH 3WJJC 4GB9A 1CXLA 4PTUB 2CKBA 3D6GA 5DHMC 3CFQA 3QS3A 1Z6JT 4JJ5A 3T0EC 1PLGH 2AXFA 3DV6A 3NZUA 4GKLA 4DAGH 1HSBA 3UTQA 2UYLA 3FFDA 2X9YA 3QUMA 3GTVA 4LDOB 4DSYA 5B39B 1CE6B 1EH9A 2JE8A 1M1XA 3FB8B 2NY0B 3GYRA 4GMSL 2WLNA 2WIIB 2VO5A 2O26U 1IGML 1WISA 3HNVL 4PS4L 4XNYL 4ZQKB 5T33H 4JQVC 3L3DB 1JXKA 3G5VA 1LXMA 4RMUA 5CJQH 3BGMB 3UJIH 4KZEH 2EH7H 4PJ7B 4KQ0A 4NO0A 3ZLQC 3UGEA 5L4JA 4BHUI 2N56A 4P5TA 1F2QA 3HA0A 2EXYD 3E8UH 2OMVB 1I4FA 4LSUL 4MS8D 5DJYB 2BNQE 4IIQC 4JR9H 5D2NC 5AAWA 1RUKH 2P8LA 2IPUK 5ID0A 4TOYH 2NNAB 5IUCA 2E9GA 4QHKJ 4BRJA 2Q5BA 4PP2B 3HZYA 5KYYA 4MAYB 4KU1A 4QWWD 4XBPB 2PP7A 4PHXA 4QTHB 4NFDA 1JPGB 5IB5B 3BN9D 2QDWA 2XN9E 1I8IA 4NKOB 4FCAA 5MHSE 1ZLEA 3KL3A 4OQTH 1ZT1A 1N0LB 2KL6A 3TBTB 3LKPB 3CFBB 2VR9A 4J3OF 3FTXA 3OB8A 4FNRA 1EV2E 4QRFA 3RJDA 3L1OH 1IMHC 3MLXH 3KEHA 2BP0B 5I74B 2SEBB 3MRHB 3ZDXF 2O5XL 5CJBA 3GC3A 3ILPA 1M3JA 5DS8A 1IQWL 3C6SB 3VFTA 4WJG3 4PJIF 3WFBL 1MF2H 2WGXA 3ABZA 4WFGD 1FP5A 4OT1H 4HWUA 4TNVK 2BK8A 3ZMEA 1G6RH 3EJCA 3TF7C 5E8NA 3A4DA 2YRLA 4WI7A 5I15H 4HWBL 5BUPA 2BIOA 3EG9A 4U3HA 1PZ5B 2P5WA 3O4LD 1XB3A 1I9IL 2Q3AA 2D03L 3QBTB 2AJZB 4MQ7A 4MXWH 4XAWL 5FAAA 2ITCB 2PXYA 2X6MA 1NPJA 3HS0B 5J11B 1EEYB 4U1KA 5F7DA 3LHAA 1D6VH 2IALB 3L1EA 3N9GH 4LLMA 3RILA 1ZANL 3BUBA 2QFRA 3D08A 1F3DH 3QUYD 1AY1H 3K1KC 4K94L 4M5ZH 4CADB 3PIQA 2ZXDA 1I1AB 4I5BB 3PQYE 2DQDH 3VYOA 2VC2L 3GK8L 4XP9L 5E8EB 5KVFL 1YVLA 9CGTA 3GBML 4MNQB 4MD4B 3BX7C 4DKDC 2OMXB 2OTUA 4MVBD 4D8OA 1JF1B 4AGMA 2G75A 4X9IA 2A83B 4IRSC 4LHQB 3RDJA 5EZIL 2E46A 2LVEA 1UZ8A 4HS6B 4JGMA 4NUGL 4LDLB 4J3XA 2G0LA 3C8KA 3CD4A 1NC4A 3O6KH 3ARDD 1DO6A 4PRPD 3FT3A 4ZUTA 2X2UA 2H32A 4JPKH 2OL3L 3BUDA 3OZ9L 1S7SB 2EUVA 2P42B 1PD6A 1I9JL 4KHXL 3CX2A 3RJOA 3H55A 5B39G 4P57A 5SX5H 2PMZA 1PFCA 4ZAKD 4FN0A 4DZ8B 1DQQA 3NGBB 3EZJB 4NRZA 1G7MA 2UXTA 3MLZL 2LLLA 4M5SA 3KPOA 5JQ6L 2OULB 4FZ8H 1E43A 3SY6A 4G5ZH 2I07B 1FFQA 3TP4A 2F58H 4D0DB 1MHEA 1NUDA 4LCCA 4WWKD 5ESQA 2QTEA 3G5XB 3V6OC 1M6OA 3MOAL 1WA1X 3G5ZB 5FPIA 3P73A 5D2LE 1A4AA 3JTSB 5C0EA 1ZV2A 4FKHA 2QZQA 4UTAL 1PQZB 5I6NA 4M00A 1HILB 5DJAB 4LHJB 2N4IA 4XNQA 6FABL 4LARL 3QZPA 3ZXAC 2F54B 2WIMA 1T7WA 2HFFB 4MS6A 5JO5B 3BYTA 3WFDH 4LEEA 1YPZB 4N0FB 1N68A 3D4GA 1QSZA 3OR6B 4HS8H 5EU4B 2F1BA 1PU0A 3WLWD 2E27L 5FR3A 4KUZL 1CPUA 4DETA 2YSSB 3M1CA 4EZMA 1FI8C 4X83A 4AEEA 1P4BL 4KY1L 4LLAA 3ARGB 2FLBT 5LDSA 1BFSA 4WUKL 1CXKA 1P7BA 3ECQA 3MNVA 4LE8A 4M43H 3RB7A 3U7AA 5F7HA 2HYMA 1MQ8A 2BX5A 3EGDB 4LBEB 3SBPA 2E86A 3NEXA 1ONQA 2YO3A 1UH3A 4IBLT 1HK6A 3LB6D 2WSDA 2XWBB 3NAAH 4I7ZC 3RPBA 1BQUA 2OZNA 1W16A 5F72S 4OV6F 4H44C 2XWCA 3SDYH 5I5RA 3JT0A 1Q9WA 2R4SL 12E8L 2ORBL 3UERA 1EDQA 2WXNA 3FTSA 4B9IA 5KYWB 3JYCA 3LEYH 1WBZB 4NQQA 1A7NH 3TA3C 2VN5A 1AE6H 1BAGA 2P8MB 2J44A 3CVHL 2X0VA 5HHOD 4PJDF 3KZ8A 2CXGA 2DV6A 4G5AA 3MV8D 3NSYA 5C0BD 2OQJA 1G43A 4PSRA 5GS0L 1RUMH 1CXEA 1S9YA 1N3NA 5DQ9B 3DIFB 1UT1A 5CU9A 3BAYA 4MQTB 4UBDD 4XMKH 3P2DA 3B7SA 4ZO7A 3W0WA 2BOLA 2XQ0A 1W2KT 2WXRA 4O2FB 3VWKA 4CMHB 4ONOA 3MUHL 3FT0A 3TBWA 4AH2A 2ATPA 4X42A 2WWMC 2E8YA 1XCTB 5BV7C 3KG5A 4G1MA 4M56A 4XCNB 2LHAA 1F3JA 2C4FT 2PCPA 1J5OH 1IC1A 2G9HA 1Q9OB 4M8VA 4N87A 5HI4D 4JZJB 2DQIH 3CHRA 2R1WA 3GS4A 4WO4D 4KKAD 5EO9B 2XSKA 3A3YB 2HMIC 1MH5B 4AQZA 3ECVA 3PGFH 2E76C 4WI6A 2A9MH 3C09C 3UTOA 4PJEB 2EH8L 3MV7A 1AQKL 3DARA 5DDHA 1OO2A 2WNKA 3BEVA 3F6IA 32C2A 5LCVA 8FABA 3PWPD 3TJEH 5AD0A 1XGTB 3QIWC 3BJ91 1LYQA 3O11B 3HE7D 1OGAE 25C8H 4BGLA 5I19L 4WK0B 3LIZH 1CLYH 3IKCA 3QYCA 4E41E 2HKHH 5C0ND 2VDNB 2MCAA 4IS6A 5TF0A 4LL1A 1C5DB 4KXCA 1BX2B 1HEZA 2QQLH 4X7CC 2EIBA 1B0GB 2Y6SC 4MBOA 1NLDL 4J2QA 2IH3B 2UXGA 4LEXH 4UQ2B 4JRFA 1D5ZB 4G6FD 5I1KL 1QAWA 3I9GL 3KPNB 5CGYD 1THCA 2BMKA 4P5TC 4EDWL 1H3GA 4C83A 4QRRD 1JFQL 2Y7OA 4G72B 3U4BH 5FDWB 5GGQH 4HD9A 5AAWC 1H3VA 2E9BA 4M8RA 3K0WA 4J3BA 1HQ4A 2QHRL 4KWUA 5L7XL 2X6VA 4NENB 1EFXA 5L9DH 5AOLA 4PJ5A 3RIAF 3WEBA 2I25N 4AL8L 1EWHA 1JGVL 1USQA 1IM3D 2IAMD 4RWHA 5TE7L 3VXSB 5D7JD 3CN2A 5F8RC 5G55A 1U8IA 4WEBL 4OJEH 5FWQA 3OMAB 4RH4A 4W81A 5E95B 3VQ2C 5JPNA 4G1EA 4IHBA 1IT9H 5D1QA 5E94B 4JN1H 4KZCA 2BHUA 2JB6A 4JFPB 3WKPA 2HFTA 5AVUB 1KV7A 1T22A 3MBWA 1QSED 4OJDH 2GTWB 2D0HA 4U31A 3BVNB 5FHBL 3ME0A 5AVZB 2YJQA 2V7NA 4XPBH 4H26B 4LK4A 2HWZH 3EBHA 4PJHF 1CT8A 2WBJB 4PAZA 3QDMB 3FHQA 5D7IE 2K8QA 3O3AB 2OMNA 1ET5A 2X4SB 4XB3A 5EDXA 4EMZA 3LEXA 8PAZA 3RZWA 5FLUA 1RK1B 4APQB 1KYDA 4LAQH 2PXYC 2YOAA 2XFXB 1LP9E 3TVMD 3MZTA 4CKVX 3QI9D 4YLCA 4I0PC 3MMEA 4ESKA 5CBAB 4TRPH 3IFNL 3EHBD 5C0IB 1J87A 2WQVA 4KK8D 1UM4H 5HVGB 1CYXA 5C0DA 5E1AA 5CN1A 1WPCA 5CSZA 3PGCB 4N0UA 4PRHA 3CFDA 3V0JA 5T1KA 3GHBH 3FT9A 1HXKA 2XWRA 5FK9A 3G5YB 4R7NA 1WUZA 2NYKA 4E42A 4F8LA 1W72B 1ZVSB 3GSQB 5FHAL 5M94B 1PNCA 4BM7A 6PCYA 5HVHC 5LAPA 1I31A 1NUNB 2QSCH 5F1IB 1AGDB 4F7PB 4KO7A 3RGHA 4DP2X 4BFKA 4N2CA 4KKZA 3FPXA 3GINA 2JELL 2IQ9L 3VW3H 3OG6B 4NKDB 1KEGL 3VQ1C 3UZVA 2R69L 3ULVF 2FBOJ 2CCVA 2GYSA 1TZGH 3WFHA 5E1IA 3DC0A 2HVKB 3DIDA 4HCRL 3NABL 2DYPA 3GNMH 3NCCB 4BFBD 1HXYA 1A64A 3QWNA 5I0DA 4HKZA 4AV4A 3RE0A 3PDOB 3TEXA 3X13A 2FHBA 2WKOF 5IB4B 4FF9A 2WBXA 3OXRA 3UP6A 1O75A 1NJ9B 3ESOA 1BDYA 5D5MF 3AXLA 1AKJD 1G9ML 1CICD 4G8EB 1YEIH 4L4TB 2CK0H 2PUQT 4KX9A 5AOZA 5GRXG 3FQTB 4JK0D 4DGUA 1NSNH 3KE0A 1FFPB 2KLSA 1HH9B 1CTOA 4QJ4B 1HI6B 4ELMB 3VO0A 3QORD 3VI3F 5C0RH 4OTXH 5EA0H 1YNTB 3VG0L 4UNUA 4JFDD 3GSNB 1JWUA 2BVEA 4BH7A 2WNXA 4OF8A 1SMAA 5FUOH 1MWAL 1YNLL 4RIRA 5E9AA 1G9NL 2VLMD 4KK6C 1MI5E 4FFWD 1GOHA 3CXHK 1J10A 2NUTA 4JKNA 2QQNL 4Y2DA 1SLXA 2CALA 5D1ZB 5DS1A 1ZJBA 4DPBX 2QSTA 5HJDA 1E6JL 3MNZA 2XWJB 2ZWLT 4JO1L 4OJFH 3FN3A 3FNKA 3MBEB 3CSYA 3HE6B 4FG6D 2CZNA 2JB5L 2FO4A 4P2RA 5JIPA 3BQVA 1CFBA 3I3DA 1MFUA 5GGUB 3OJDB 3KPRA 3BUYA 5FO2A 5DQJB 3MXVL 1QO3A 3K71B 1T7ZA 3I6GB 2IJ0C 5JW4R 2VRAA 1GGUA 1KLUB 1M05B 3EFFA 4HUMB 1YSOA 4XN1A 1DVFC 5ERWA 4RVBA 3VFVA 4Z7VA 2XX1A 5HYFA 3VH8A 2YD9A 3VB9A 1JXJA 4DUVA 2R0ZH 4MDIA 4I3GA 1TQBC 4G6MH 4PJGE 4F2MA 5KYXA 2VJ0A 4ZG1A 4EI6A 1E0OB 3OKEB 1C8PA 5K39A 2DQHH 5DUPL 1P6FA 4FLQA 3UJJH 4LCYB 2KUTA 3LZFH 2IPUG 3PHQA 4IOFC 2H1PH 4QT5A 4ZK8A 2J25A 3O0LA 4ODHL 2WB1A 5C07D 3VWKC 2WZ5A 5CLYA 2EDNA 3VG9B 4MYPA 3O81A 3OJVC 3QJQB 5B1BB 2VWEE 4CC0A 4NHUB 2FT7A 2HFEB 1MFDL 1SDAB 4P46D 3WDHA 2QKIA 1FVEA 5A40E 1OAYH 3FONB 2FJSA 3IBOA 3T04D 1R3IL 3SZ6A 4PJ7E 4JHAH 1OXYA 1ZV9A 1M9SA 4FS0A 1JTTA 2NY4D 4D7BA 1BXAA 1T5WA 1ORSA 1UOVA 3CGTA 1GYCA 3AQDA 2XIDA 4N1CA 4CKQA 1MFNA 4YFLI 4J12A 5BQDA 2AABH 1EMTH 2ICWJ 3FUKA 3RIFK 3ZRCC 4ELKA 5DJXA 4CMMA 4N0YH 4QEGA 1DLHA 2EDXA 3ECWA 3T6ZA 4PJXA 5B4MD 5HD8D 1A4KB 2ZXAA 2JLLA 3WJLA 3LKQA 2DBJA 4GRWB 5I1IH 3ZHNA 2FWLB 2VCOA 4ES8A 4I48A 2P28B 5I2IA 1R33A 2RQ8A 2GIXA 1O7DC 1JZ7A 5F7EH 3FCGA 3L4TA 4Y89A 5D71H 4AZ8B 1FVDA 2JTDA 4D8PA 4HYTB 1AANA 4FNTA 3OGCA 1BBJB 4XPAH 1ZRUA 4F7EA 3BZEB 3TJHD 3DI3B 4FQHA 1IZKA 3IWUA 1UA3A 4J3OD 3KD4A 3MLVH 4JANB 3QZWA 4ORGB 4TUUA 2DLIA 2DQJL 5CNHA 5D1ZI 2ETWA 1P7KB 3ETSA 1SNRA 3V4PB 5J9PB 2YPVA 5B22A 3EXJA 5MERA 3QXUA 2D7TH 1VRSA 3VFSA 4PGDB 1R3KB 5ICYA 3ECBB 4M6NH 5PAZA 4IDLA 2BJMH 4PBWD 2VN4A 3HVDA 3BE1L 4XVJH 3ALXA 5LO7A 1CFTB 1IAIM 3UG4A 2A73B 3OLEA 4X6CB 3MOBH 1MRCH 2HRPL 3GM0A 4HPOL 2BNRD 1SQMA 5B38B 2BVPA 2UZPA 4JJHA 1OB0A 2OMTA 2WVVA 4FFYH 4U6VL 2CKNA 3GBNL 4XO4A 1VACA 4FQXC 5JPNC 2FGWL 5D1QC 1XXFC 2WTRA 3F85A 4W9CC 3KPQA 5IW1B 2ADIA 4YBQD 4YXKH 3G04B 1RHFA 4YHPB 5A7BA 1NGQH 2F2HA 3HVNA 1NL0H 4RSVA 1MCDA 1DTUA 1QRNB 2CRZA 3ZYIA 5B3JE 2CIIB 4UQEA 2VLJA 3MJ9L 1C1EH 2YXVA 2D3LA 2X12A 3PWLA 5E6SB 5FKPA 2VITA 3TA3B 2X4RB 1GPOL 2VSKB 2J5LC 5D2LF 2EVGA 1KN4L 2RCSH 4HIPA 4DKEH 1JYNA 4IRJA 4BZ1A 3HI5L 2EDMA 1Z9OA 2FX8L 1D7FA 4N0RA 3FK3A 4JFXA 1X3DA 2HG5A 3BGFC 3KPSD 4WUUA 2XQYA 2AAVA 4UINL 4NSKA 3SPVA 1I3RA 3VD9A 3PV6A 4GI6A 1FJ1A 2ESVD 1I8MB 4CGUB 1UB6A 2V7HB 3BP7B 4GPVA 1OD9A 4HT1L 5AUMA 4UOZA 5I18H 1RHHA 1WAAF 2KMWA 4UTBL 3FFOA 3PWNB 5HGAB 1AS7A 2V3DA 5AYUL 2CO6B 4HIXH 1EJ6A 1S7VB 4NQDB 5CWSA 4ZW8A 1FVCB 5CM1A 3CVBA 1C9SA 5MEOB 4OI9A 3SYCA 3HKFA 3CLFL 3G6JA 3FO9A 4FDWA 2BOBA 3QDGA 1V3LA 2B9BA 3C09B 4RMWA 4Y4KA 4JAMA 4Z7QB 1UVQA 1JVOA 1PG7X 4CW1A 4KK9C 1BVKA 4PWEA 1QD0A 2A9NL 2AXFB 3DV6B 5ILTL 4PGEA 1HSBB 3UTQB 2UYLB 1EGJH 3QUMB 5ITBH 4JGNA 1JGLH 1YPZE 2KLRA 3P1VA 1KJ3H 2NY5H 1QFUH 1M1XB 1EAPA 4MAUH 5T3XE 1LE9A 2NZ1A 4PWHA 3BSZA 4ZMZA 2VDKB 4EDXA 5MEPA 4XR8C 3P0GB 1H3UA 1V3MA 3IDXH 3L16A 3Q01A 4H8WC 4Y8AA 2P26A 3G5VB 3T0BA 3BDYH 4IBWA 2JSFA 5FW8A 2GHWB 1BD2A 3M8OH 4MNGA 5B1CA 4A7GA 3ZDZF 1KPRB 4PVBA 3N50A 3N0PB 4NO0B 2XCMC 4G59C 1CE1H 3BW9A 4R7DA 3D4CA 1DVXA 2QBWA 4NRXA 4BQ6A 4EQ3A 1SOQA 2EEBA 1JI2A 1I4FB 1FZJA 3D87B 3JWOL 2YUZA 5CU5A 1OPGH 5ID0B 5AKVA 2VL5A 3LKOA 3MLWL 1OL0A 3IGAB 1KTJA 5KYYB 4X6DA 2HTLD 4YHZL 3CFJA 2WBWB 5B38G 3E0GA 1PZCA 3F8UB 5E6UB 3WTVA 5A3ID 1O7VA 5HVFB 4J3OH 1FV1A 2C5DC 3QHFL 3SDDD 5T3ZH 2QGBA 5EB9A 4DFHA 4G8AC 1JZGA 4XAKE 1ZT1B 4XVSL 5D96C 1HHJB 2AZAA 3VD3A 2Y25A 1N59A 1NAMA 2JJTA 3UL4A 4Y2DC 3X1EA 2J1WA 1E30A 5E5LA 3KWVA 1LK2B 1MQKH 1QFWH 2FQGA 2V2WA 4J27A 1QSVA 2YD0A 4XPGL 4C4BA 4AYEC 2ZAHA 1NGZA 2J73A 1OT4A 5D1XB 3ILPB 5DS8B 3VFTB 4JY4A 4OVVA 4XXWA 2CLZA 5DD1L 2FTAA 2IFFH 5K9OB 2XN2A 1IAKA 1JRHH 1JXDA 1JOIA 3O8XA 4PV9A 5I73B 2VDLL 5E8NB 3MO1A 2JCCA 2P5WB 3VCLB 1E9OB 4MQ7B 2PXYB 1TZ8A 2QPFA 2IGFL 4LSSL 4U1KB 5F7DB 4H4NA 3BKYL 4O02A 3ZL2A 4PG9A 3GZPA 5D8JL 5HGGS 3RWGB 4IOSD 15C8H 3SGEH 3HEIB 1AH1A 1DZBA 1OSZB 3PIQB 4NPKA 1KMGA 2XTJB 2WQRA 1BLNA 1KUMA 4PEEA 4W4NA 2UZIH 2KERA 3QJFB 4TLTA 1FGVL 2OTUB 1DL7H 2YMOA 4UI2A 3WSQL 1UGKA 5AQ0A 2G75B 3D5OF 3F3HA 2GC4C 3WY3A 1AGCA 4NM8H 3GKWL 2X2JA 3QEQA 4JM4L 1NC4B 1IFGA 3CBKB 3FT3B 5HVHB 4ZUTB 2O5YH 2H32B 2QKIC 4AMKH 1PY9A 3H9YA 1RUAH 1L7IL 2QPSA 1S7UA 5D72L 4GT7A 2F5BL 2NW3B 2AP2A 3ZT6A 1NDMB 3CFTA 4N3UA 3THMH 4D3CL 4XOCA 3A6OA 3CK0H 3QXVA 5IF0A 5EU6B 5CCGE 3QP3A 1DQQB 2CGYA 5IFAL 3VX0A 1G7MB 2MTAA 2V5RA 2BWDA 4HF5L 1BF8A 4YVUA 2G5UA 1C16A 5T3ZE 3CN0A 1G7HA 2ZXEB 2BCMA 5D7IF 2KQMA 5CEZD 4QRPA 3HS9A 1MHEB 4DEPB 4LCCB 5ESQB 3WJLC 1K8DA 1M6OB 3VXSE 3P73B 3WFZA 4A7TA 3JVGA 1DBBL 5C0AA 5C08D 5D7LA 4Y1TA 1S78C 3P69A 5HJ3A 2YEVB 4WHCA 1IGMH 2DWXA 2Y69B 1IKFL 3HNVH 4PS4H 3QQDA 1AZRA 3HG0A 3LV3A 1MRDH 3HZMA 1SEBB 1J88A 4XP6H 2JLPA 1O0VA 1IAIL 1Q9LA 3RHWF 3DO4A 1QEXA 2DJMA 4M1DH 3NIFB 1TIUA 5C6TL 5AAMA 2YA2A 3OX8B 1UJ3B 1PDKA 4O9HL 1F4XH 3RVXD 3QDME 1ZLWK 4DP0X 3BVXA 3RUGF 1UACL 3MUUA 2FATL 1AHWA 2VXSH 4FTVA 3L08A 1OSEA 2YD6A 4LXFA 4N0CC 4XMLH 5IQMA 2YQ2A 2NLJA 3IJSA 4ZW3A 1KSRA 1AAJA 1ONQB 1OAQL 4JRXB 3WV0A 4K23L 3K8MA 3CWGA 4WW2F 3ULUE 3GSVA 3IU3A 4MKMA 1UA6H 3JVFC 4OZGA 1QSFE 1EDHA 3H6JA 3N06B 3IFOA 2DQMA 3O2WH 4OSUL 4FXKA 5E8OB 3FQXA 5L0QB 1K2DB 5F6IB 2F53E 5AW6B 1ECYA 3Q3GA 4V11A 1NFDF 2YEQA 3IRZA 4HETA 2I69A 3FOLB 1XDTT 4A37A 1UFUA 2NR6D 4BINA 4L0YA 2WLZA 4XP4H 4F57H 1PY0A 2ADYA 4IRJC 4LLUA 3IBEA 1JN6A 1EHKB 2OQJB 3GIZL 3OLIA 1AIFA 1S9YB 3H9HA 1N3NB 4HWBH 4RSYA 1O9VA 2DI9A 5C9JA 1BW8A 2D03H 4XAWH 4UILL 1X4ZA 3W0WB 2XZZA 1VF5C 2Y7QA 1J1PL 1SOKA 4P49A 1AR1B 1GAFL 5IKCA 1ZANH 3TBWB 4AH2B 5AW0B 4OZFH 2OYLA 3ULVD 2WCGA 3S88L 3ZKMC 4N2NA 2KYIA 2DRUA 3HHRB 4X5PA 4G1MB 4HC1A 3T3MB 2VC2H 3GK8H 4WFHE 1F3JB 1FFRA 2CR3A 2JXMA 2PCPB 4WTQA 4XP9H 3LZNA 1E9QA 4Y8DC 5KVFH 1EFQA 3SQOH 2B39A 2HG0A 3L3OC 4L1LA 2G9HB 4C58B 1WO2A 4UM9A 1A65A 4L4TE 2R1WB 3Q8EA 4ODBD 5EZIH 1J8SA 4NUGH 5CCJA 1C7TA 1TNMA 2CRIA 1N12A 1UFGA 5KSAA 4JG1H 4ELME 1XGYH 4Y4KC 5ITFA 2HPTA 3VSTA 3L4ZA 3QVAA 1S7WA 3BPOC 2P47B 5DDHB 2VM4A 3BEVB 2PWFA 1B4JH 1NC2A 32C2B 2OL3H 4OD1H 3HG1B 8FABB 5EG6C 5AD0B 2CO1A 2IC2A 4OBSA 4YK4C 1XHHA 3ARSA 5AVYB 2ZAGA 2OJEB 2Y2TA 1P84J 1JUFA 3S97C 1IAOB 4I3SL 3FQUA 5I6XC 4TULL 3CG8A 4EUPA 5C0GA 2E7CA 4IS6B 4NPJA 2IQAA 2VISA 5KJRL 1HEZB 1AGFA 4QCIA 4CNIA 4QXGH 5JQ6H 2JTYA 4PJGF 2VZ3A 4EPSA 4M8QA 4G8IA 2XQYK 3ZW3A 3AMLA 4F9LA 1U8JA 2BMKB 3UG3A 3ILDA 3UBHA 1RZIA 1NCAL 3DIVA 4YDLC 4OF7A 5IESL 1WEJL 4ZMQA 4G43A 4UTAH 1EFXB 2NXYD 3QHTC 4PJ5B 3QXWA 6FABH 1QBAA 4LARH 1V3KA 3TBVA 4RGOL 4GG6B 3DECA 2WMPA 5IIEB 3H4FA 4G3YH 3DTXA 1J5HA 1A9VA 1J9CT 4PJ7F 3JWNH 3LNGA 4OM1L 1H15A 2JJTC 2WNWA 3U9WA 4Y4FC 1KULA 3BKJL 4PP1C 2VXVL 2JB6B 1P4BH 4KY1H 1HQRA 1RZ8A 2OJZH 3W9DA 2NY2C 1T22B 4KI1A 2Y7NA 4XNBA 3B7RL 3MBWB 4KKBC 2Q10A 2BNQD 4PB0H 5B7MA 2V7NB 4ABQA 1CT8B 1G5GA 3O8XC 2YPLA 3VGBA 4A2LA 5AW9B 3T6WA 5C0FB 2V5SA 4LFHD 3R8QA 1R19A 1TMQA 3D0LB 3CZEA 3LEXB 4JVUA 1MIML 3UPCA 3IDIA 4ZD3L 2F0CA 1QFHA 5MHSD 3HG3A 3POHA 2R4SH 3MMEB 4UQAA 12E8H 1HKFA 1U8QB 4DGYL 5E70A 1YEKL 1HNYA 2EE0A 2XHNA 3D52A 5J12C 2GK0A 4YDIH 5C0DB 5E1AB 5CSZB 1W8NA 4PRHB 4NWTH 5HVWA 3CFDB 1TTBA 3O45B 2CGZA 4MCZA 3CVHH 1BFTA 4OGAC 4Y2DD 4GSXA 4LCIH 1MLCA 4MZIA 5T1KB 4U1JA 4PVMA 5DK3A 3ZZQA 5BUAA 1CIDA 4NUMA 5DEFA 5BZXA 3OPZL 5GS0H 3ATDA 4GO6B 5FK9B 4NJ9L 2VOTA 4R7NB 3MA7A 1NDTA 1ZIAA 1SLUA 4POZD 4Z7UF 4B5EA 4E42B 4U1IA 4GAJH 3QIUA 4HZ1A 5D7EA 4AQEA 2BDNL 4BKTC 2WZ0A 4TTDD 4MJ2A 4GAYA 4BFFA 2ZUSA 4PJAB 4E9QA 3TCXA 3MRIA 1XL4A 3E2HB 1IC7L 1BQHB 3BKCL 2W60A 1RJLB 3MKGA 4CVXA 4JPQA 4KI5E 1ND0B 1KLGA 3DX2A 3FW6A 2GJJA 3SYOA 1R5WB 2G2NA 3S3BB 3TN0A 3UZVB 3IU4H 3KHQA 3PQYD 1FZKA 4MJJA 5EC1A 2K3HA 5H35A 3TIEA 3OR7A 4J8RA 2FWOA 2V2TA 5FO9A 4NN7C 1GC1L 2DYPB 3OKMA 5B3JF 2QTVA 1SOSA 4HKZB 2DLTA 3CZKA 4NQSB 5HDBE 1BCIA 1IGYA 2F68X 3X13B 3VYNA 3OXRB 1B0RA 2EUXA 4BXVA 2IH8A 1YEHH 5BS0A 4RCAA 1DCLA 1NBVH 2V33A 3AB0B 2EH8H 3AXLB 4GKSB 1C5BH 4Q58C 4OU3A 4B60A 2EVHA 1E90A 4FC3E 4X6CE 1AQKH 1BOGA 3BWZA 3NDZE 4K4KA 4N25A 4XHJC 3JVGC 2BSRA 2DS4A 3EO1A 3BOVA 1F1AA 4UOW1 5I6OA 5T1LA 5I19H 2BS71 4LZKA 1CXHA 4MB1A 4N1EA 1XH0A 3CVIL 4NO5A 3APFA 1AFVL 3L13A 3FU5A 4O00A 2WD0A 4JG5A 4NIYE 1GS6X 1NLDH 1JWUB 4BELD 5I1JH 4YMPA 1XSOA 1OW0A 5KTEL 1QRNE 1DQMH 1AG0A 1XSKA 2XWZA 4NNXA 1A6WL 5AAMC 3ZQ9A 4HEME 4KQ4H 5D96B 5FEBA 2BWQA 3L5XL 1JFQH 2NUTB 4R7XA 2DWTA 1U2YA 3LZRA 2QHRH 4WGKA 4AE1A 3N6YA 1KLFB 3QFDA 1ZAGA 3T0VA 1BIIB 2UWEA 3B37A 3CFMA 4UQ9A 5KVEL 3CSYB 1HZHH 5BZWA 3KXFE 4CBZA 4AL8H 2FO4B 2YBGA 2BIPA 1U0QA 1ML0A 2CAKA 2WCPA 2JIXD 1F18A 2OLDA 2I9LA 3KPRB 4GS7C 3BUYB 4WEBH 4Z77A 3OZLA 2UX6A 1YPZF 1MCEA 1NLBL 1QO3B 3BGAA 4XNUL 4KK5D 3TH2T 3DX8A 1IC5L 4FXKC 4KKCD 1TZHB 4OLZH 3EFFB 4R4ND 3UTPE 1F4YL 3K74B 5ERWB 1FRGL 1MLBA 1XH3B 3KLAB 4H1LH 3D12B 3II3A 4IHOA 1UUSA 3VFVB 3ATFA 3VH8B 4ZW5A 3SKNA 5FO8A 4XNDA 4BFIA 4NQDE 1OPOA 1OM9A 2FE0A 3WHXA 2EO9A 4MDIB 3STLA 4F2MB 1SY6L 5KYXB 1X9UA 2A9AA 4S1SH 1KPUB 5CZXC 5K39B 5EIVA 1OP5H 2QLYA 1A7QL 4KJWD 5HHOA 5IEKA 3RZCD 4Z7NB 3KGUA 5IOPA 2JKNA 3VGGA 2IV8A 1H6EA 3S5YA 5J06A 4QT5B 5E2UH 4ZTOL 1KZQA 5C0BA 3FCBA 3CX5K 3FU6A 5TE4L 3CNKA 1CDCA 3DSNA 4BSWA 4FG0A 3PHOB 1PFOA 2DY2A 2MNUA 3BIKA 4FOMA 4UQDA 5J0BA 1BQHG 2QKIB 2NTFB 1VFUA 2VABA 4XX1G 1FVEB 3RWIB 1JGUL 5HI5C 1OCZB 2WWOA 5EBLB 3K5SA 4Z7AA 1ORSB 2VDQL 2ARJQ 2MEJB 4WI0A 3EH3B 3ASOB 1VENA 1J0JA 2EDKA 4PY7A 4WO4A 4ELKB 3EOAA 4ILDA 4CMMB 4C8XA 1KB5L 1DLHB 2DJSA 3KMDA 1RERA 1ZTXE 2TRHA 3N3EA 1HHKA 2H1LM 3IXAA 3LKQB 1BMWA 1BZOA 5DFTA 4P2OD 4I48B 1XGRA 3PWPA 2XYCA 4MCMA 4Q97A 5I2IB 4KX8A 4FQQA 1IFHH 3SDXA 3NABH 5E8DH 2RAMA 1FVDB 4K8RD 4D8PB 4A67A 4F33A 3OGCB 4F7EB 3JWDL 2MKWA 4LKXA 3KBFA 1ACYL 1MCFA 2CPUA 1IE5A 1JZ3A 2OW7A 5DSCB 4XVTL 2OYMA 1L4IA 4PJEF 4HGWA 5D1XE 3RGVD 2UZXA 3ZSTA 2FD6H 3CVCA 1AKPA 3ZTEA 4ZOBA 5MERB 5F7MC 2NSXA 1C8QA 3L2NA 5EZOL 4JVPA 4H0HB 2CWRA 5ICYB 1UCTA 1NPUA 2EXYC 4NBYB 5JOPD 1RUPH 5F3HA 1S8DA 3VUAA 3CFNA 4WCYL 3K6SA 2A9CA 2QADC 2D3JA 3CXHJ 4BD4A 3WS3A 2BVPB 4LMQI 4E41D 3VG0H 1KBVA 1WP6A 2OMTB 3U6RA 1QI3A 4QWWC 2CH8A 5HHMB 3MRFB 3VXME 2IBGA 1VACB 2E5EA 4KO9A 4OLUH 4ZNEA 1GGBH 1MN4A 2IAMA 2AZUA 3UC0L 5EO0A 3WAJA 4WKZB 2WTRB 1YNLH 2QL1A 2XN1A 1G9NH 3WO4C 4NQTA 2XTJE 3IMRA 2ADIB 1FH5L 4JDVA 4KJPC 1PD0A 4R2GD 1WFMA 4X99A 3ZUCA 4HAGA 4JO1H 3D4YA 3VH8G 2OMZA 2VLJB 3TGXA 3FQWA 1SRDA 3B5HA 1U95A 2C3HA 3PWLB 5FKPB 2GBUA 2VITB 5D9SA 1LWJA 3P30L 4MCYB 2D4DA 2Y3NA 5ETUA 2PCFA 4AQOA 4AZUA 1MCBA 1U93A 1NCDH 2VDPB 1WGOA 1CF1A 1P53A 4Y7OC 1AXTH 5E0FA 2Z31B 3K6DA 3VXUD 2DYSB 1WQVT 1BVZA 5IVZA 3RTQD 4F20A 3KYAA 4G71B 1ULVA 4JFXB 4OB5H 2HG5B 5EU6E 3GTTA 4WUUB 3WKYA 1DQKA 1QWUA 4XVOA 1A6ZA 3VGAC 4NSKB 1A9EA 2W0FA 3SPVB 2NX5A 1I3RB 3IXTA 2CRYA 1DDTA 1WIPA 1UB6B 2Z1PA 5AUMB 1DVUA 1QBBA 3IAGC 1RHHB 5MP6L 5CD3B 1KJ2L 3Q8CA 4LSPL 4MVBC 5HXMA 2J1XA 1A6PA 3QIUC 5ALBL 5EOTA 5CWSB 1L0QA 4ODHH 2K78A 4ZFQA 1ZD6A 3MUY1 3P2BA 4GFXA 1GIGL 3FO9B 3O2VL 3QDGB 4DIXA 1WWCA 4ODUB 2GJ6E 2HRHA 3TH4T 4X8XA 4Y4KB 1O5DT 4JAMB 1GTFA 3ARDC 1UVQB 3ULUF 3TN0C 3AWGA 4PMEA 3IJEB 1BVKB 4PGEB 5C09D 3D0VB 1R3IH 4CAGA 3VRLF 2PN5A 3NIFE 3QQ4A 3PP3K 4OI7A 1LE9B 2Y5QA 1WZLA 5IB1A 4R8WL 1SOXA 1YQ2A 2ZWKA 4AQ1A 3LHPH 1PD1A 2EXWD 1IBBA 5DGRA 3HR5A 1BD2B 4NP4L 2BO0A 3HG4A 1IILE 1X6NA 1UOLA 2KT6A 3L7FA 1YMMB 2OMUB 4RA0C 3BW9B 4R7DB 4YWGL 4GW4B 4NRXB 2WXFA 5EDSA 4WWKC 4J5VA 4JRXE 2IDFA 3EF4A 1O5PA 1XIWB 2C9SA 2VL5B 3D3VA 3LKOB 3P4OA 5FUZL 3EF7A 2OR7A 3KNBA 4L8DB 4Z7UB 4DGIH 1HN1A 1ZSHA 2MCG1 2IANA 4H8HA 3ARQA 4X6DB 1A14L 4W9EC 4FNUA 5AENA 5IHUL 3MBXH 2PTTA 2Z35B 4U1LA 3QNYA 1D2PA 1OW0C 1UB5A 1CBVH 5ABAA 3OF6D 2DQJH 4H88L 4TNVF 1U91A 4QJ5B 3L5WA 1KENL 2DLFL 3ABMB 3IDYC 5EEWA 4JFDA 3MCYA 1GOFA 5F7YC 3WIFA 1ACZA 1NAMB 2BP5M 1E8XA 2JKSA 3BP4B 1ZV5A 1NWPA 2V2WB 3BE1H 5ESAA 4IDJL 1RIUL 4DO5A 4JY4B 4LU5L 4KROC 2CLZB 2HRPH 1NMBL 2DDQH 3HI6L 3I2CL 1NFIA 4HPOH 3W0WE 1T1YA 4FQ2H 3ZR6A 1FORL 4FLRA 1IKOP 1YNTF 1P1ZA 3POCA 2D7OA 1R46A 5I75C 3MO1B 2FGWH 5FYLL 3LB6C 2JCCB 3QUXD 1UA7A 4FTDA 4TSBL 3WTWA 5CSBA 2ED6A 2X4OA 5TDNA 3RPIA 1UG9A 4MASA 4O02B 1SJMA 2XQYG 1V54B 2DIAA 5J12B 3KYMB 2DI7A 3MJ9H 4W9HC 4DKFL 1TR7A 3NIGB 5AVVB 4POUB 5DR5L 3AG2B 3R18A 2K6YA 1FWXA 1XMEB 4F7CA 3SGDH 4L8CA 1X5LA 4BA8A 1KN4H 4ZS6D 3WXWH 3P11L 4GUCA 2RH0A 4B5ZA 5CEXB 3VVVA 3HI5H 1ZLUH 2XIBA 3HG1E 4TQHA 2AMGA 1AGCB 3HBZA 4QRUA 4UBDC 1BMGA 4XC3L 3ZT5A 2JWYA 1MJJB 5BV7L 5C07A 3KJ4B 1NCWL 1MRFL 1AP2A 3IF1A 4YGVA 3AUWB 3TZVA 3EW3B 2MCPH 3Q2LA 3QWRD 3M6DA 1YUKB 4P46A 4HT1H 3ZTJH 4C4KO 4CSSA 4UUJA 5IF0B 2LFEA 5EH1A 4PBVC 4WGVB 1TEGA 1H6TA 1TQTA 2H1XA 5CN2A 5AYUH 1SJHA 3C6LA 1FNSL 2ZP9A 5FX3A 4M6AA 5L4IA 4HK3N 4DTGL 4WO4C 4KKAC 3ESPA 3O3UN 4BQCA 1W0WA 1LDPH 1C16B 1TQUA 5F7LB 3QPXL 5KW9L 4QRPB 3WNNA 5L6YL 4CL7A 4PJ5E 4QYOA 3AY2A 5C0CA 1F1DA 2CGRL 2NY0D 1K8DB 2AJYH 5D93B 3GI9H 3ABGA 3NFSL 2A9NH 4GG6E 1Q90A 1HIML 2BOCB 4JGJA 1GZPA 3J07A 5D7LB 5HDLA 3EYSL 2G3ZA 2Q8AL 3HE7C 5AW1B 2XXGA 2N3JA 1KEMH 4N86A 2H9GA 2EACA 2OPCA 4XMWA 5F6HI 3ZL4H 5INCB 5CSGA 4KOBA 2DM3A 4L3CB 3HZMB 3ZX1A 3FU7A 3FOMA 5BJTA 1WFNA 4P2QE 2OR8A 4L1HA 1IJ9A 1Q9LB 4M5YL 1KV3A 4PCYA 4HUXB 1ZXQA 4KZDH 5AW8B 4ENED 4KMTL 2ZKYA 3CMGA 2XTSA 5J57B 5CGYC 1PDKB 3V4VH 1SVCP 1BJ1J 5T5FL 1HL8A 2E7LA 4MAYD 4NZUH 4GRWF 1U3JA 3JWOH 1AHWB 4FTVB 3DOIA 4EO5A 5DMKB 1FO0A 1XF1A 3D69B 3PXHA 3MROA 1IM9A 2PPDA 4P8QA 1JPST 2NLJB 4K3EL 4AC2A 3IJSB 1OHQA 4KI5F 5DJ0A 2P8PB 2QPEB 1SBSL 2IAMC 4J3VA 1OM3H 2BNRA 5D7JC 3RX8A 2HKAA 1QLEL 4IM8A 3GSVB 3W82A 5CJ5A 2MQCA 4MX7A 1XR9A 2XV3A 3VI4A 4XC1H 4OZGB 3VGFA 4FXKB 3VFNA 1WWAX 5E99L 3WHE0 3TBCA 2VMDA 2W88A 3CXDH 1TCRA 4HH8A 1OAJA 5AVQB 4UT7L 3LEVH 4GIAA 3Q3GB 3MU3A 1CLOL 1SBBA 4AM0Q 1HHIA 4PV8A 1PZBA 3UH8A 3WMSA 3KLKA 3PDDA 4U6YA 4X6CF 2VRKA 4R5VA 4W6YB 3VWJA 2K6WA 4NUJA 2KKQA 2QR0A 3HG2A 4BZYA 3MREA 5IROD 1XH2A 2VDLH 4RFOL 5JXED 4LLUB 1JN6B 1WWWX 2YQGA 5CIPH 4EXKA 4PJAE 5ANMA 3H9HB 5GJSH 5J7CC 5C9JB 2KI6A 4XX1E 4JDEA 4AIEA 5AEAA 4KDVA 4LPVA 2Y7QB 1I1AD 3QI9C 5AKRA 2H8PA 1HS6A 5D8JH 1FF5A 1IFRA 3EHBC 3N1QC 3B56A 3BPCA 2F7OA 1QMUA 4MNQD 4P2AA 4KK8C 1JD7A 4AMWA 5IQ7L 4I9XA 1BEXA 3GJFA 3DX1A 3VGHA 4V1DE 5HHPA 2JXMB 3H3PL 1E9QB 4LGSB 4FMFA 1KBPA 1NGYA 1FGVH 3W56A 4IBQA 4YGAB 4UM9B 2ESVA 2VLLB 4HS3B 1VKXA 5CF3A 2B4CL 4G6JL 3D0AA 1CLVA 3L3KA 3GKWH 3IE9A 4GW5A 3TCLA 5K59E 4FQJL 1QNZH 5KSAB 4BWUA 5BO0D 3JBG7 5ITFB 4E0RA 2WLKA 1S7WB 5KVMC 1FL6A 3APNA 1PTZA 1L7IH 1NC2B 3VCLA 3Q2CA 2XZCL 4HISA 4XWGL 5D72H 2VDQB 2X1WL 3PXLA 4DOHB 1XBRA 1KGXA 1A22B 3P9MA 1C08A 2XKUA 3QNZB 1FG9C 1YNKH 3MFFA 1JUFB 4O58H 3ELQA 2Q3ZA 3UADA 2A6JA 4QKTA 4OR1A 3KYKL 1HAWA 3LX9A 4FAAB 3B8SA 3J2PA 4JO4H 4AQ1C 5C0GB 1EEQA 5IFAH 2ERJC 3VD2A 1OIOA 2IQAB 2VISB 4PBDA 4X2UA 5C2BL 4HF5H 1AGFB 4QCIB 1INQA 2A77L 4G42A 4CNIB 1XF2B 1B0WA 1UXSA 3A47A 4TUJA 2AQSA 4I1NB 1KTDB 5GSVB 4Z23A 3G6DH 3L6FA 4PIRF 4Z7QF 1CICC 2O6FA 4M7JL 3X14A 1QA9B 1HC1A 2BERA 3VAEA 5KVGH 3FB5A 4FABH 3LQMA 3PWUA 2F54D 3KPRE 2FX9H 4GQQA 2CG9X 3IDGA 3HBPA 4G43B 5I71B 4NUQA 4BYHA 4B3VA 1JDCA 2P5EA 4LMQE 1RSYA 2EEFA 3QORC 1JNHA 2J12B 3TBVB 2QADB 1EIBA 1U6AL 4CU7A 3LXUX 3AU0A 4P59H 2WMPB 5I30L 1IAIH 2X41A 1CU4L 3DTXB 3L3IB 4YX2L 1H15B 3ARGD 4O9HH 2A74A 4N5ED 4GRLA 4ANVA 1U8KA 5DQDH 3CFEA 4ZMWA 4P23A 2GBTA 1CL7I 1HQRB 1ET8A 1RZ8B 1UACH 1V05A 2CLVA 3DV4A 4P4RA 3W9DB 5BXFA 4Z7NE 3NACH 2FO1A 3SPHA 1OTTC 4DPAX 1GXEA 3TFKD 3MNMA 4FG6C 2YPLB 1IGJB 1OAQH 5AWNL 2L0DA 4K23H 3MLPA 4ZX6A 3LOWA 3QJRB 1SJXA 3IDIB 2ZG3A 3KLLA 4AIXA 4KVPA 3AS1A 3C5JA 4OSUH 1L3WA 4NAJA 1BEYL 3C8HA 4GSQA 2IGTA 2DM2A 1AYRA 1E27A 2GK0B 3VNZA 2WLIA 3ZPDA 2EYRA 3K6NA 4MCZB 4IOSA 5FGCE 1WIOA 2W8CA 2CUHA 5SX4H 4U1JB 4AOFA 4F93B 4WF7A 3GIZH 5DEFB 3LZPA 5TFSL 1UENA 4C56E 2FEJA 2TSAA 2R56L 3QUZA 3MA7B 4MD5A 1JV2A 4U1IB 3QIUB 2EO1A 1E4JA 3CUPB 1VZGA 4RDQG 4PS3A 3DJ9A 2UZYA 3S88H 1TVHA 2NZ9D 3Q5OA 5GJTL 2A1WL 2FECL 2ZIDA 4RGNB 5IBTL 3MRIB 3JUYA 3OKOA 1ITCA 4DKAA 1LEIB 1N5YL 2AV7B 1KLGB 5LBSH 2NNCA 4P46C 2KDGA 3TN0B 1TNNA 5EC1B 1FZKB 4Z7OB 5L2KA 2Z8VC 2B0SL 5H35B 4X4MA 3OR7B 4J8RB 4TVSa 1OSYA 5FO9B 4GBXB 4H25A 3C6LC 3OKMB 3U36B 1GW6A 5HSFA 4LQFH 1IGYB 1UD8A 3DX9A 4WNSA 3ARUA 3KWUA 3QZOA 3UYRH 2D9QB 1B0RB 2AVGA 5BS0B 4IBUA 3WDJA 3MX0A 2N1KA 5E2VL 3CC1A 1LEGA 2PF6A 5HD8C 3BLPX 4WJKB 2BSRB 1S9VA 3IMSA 1NBZA 4X5XA 4DKTA 3EO1B 1QLFA 4N2IA 5HHME 2JK5A 4JFYA 4Y5XA 5T1DH 4M1CD 5T1LB 2VDOB 5I1DA 5DGQA 5JOFA 3SN6N 4TULH 4HFUH 4AJ0A 5C08A 4ZW7A 1RPKA 4NO5B 5DMGD 5DA0B 4A2HA 2OMBA 2P4AB 5CFHA 3K3QA 3CSFA 3TJHC 4OF0A 4KDTA 4JQIA 3FDWA 2F1AA 2Z6FA 2YK1L 3EDDA 4NNXB 3DJZA 4O2EA 2ZX7A 2VLJE 4F8OA 3SZKC 3BXNA 3IDYB 5DT1H 4L18A 3MGTB 4HK3J 5GGTH 4OZIA 3D9AL 4U1GB 1WEJH 3AQYA 4BUQA 4AC4A 3VXSD 4UQ3A 2R2BB 3QFDB 5DC2A 4TSAH 1JDAA 4G11A 2UWEB 5BZWB 4DN3L 4FQIL 4XOAA 4KROB 3CN3A 4GT0A 3TL5A 2I9LB 4WUUE 3WBDA 2DQTL 4Q2ZA 1WFTA 5DHYA 4MNHA 4HJ0D 2VAJA 3VU1A 5I75B 2LTQC 2EIEA 3MGAA 3NIFF 4LSQH 2R0LL 3DX8B 5J13C 1Q72L 2NNFA 4H8PA 4S1QH 1EZUA 4LVOC 4MJ5B 2YR3A 3LY6A 4YBQC 2E9IA 3SE3A 5GPRA 5F96L 2WBJD 3QDMD 1IGIL 2X44D 3F04A 1J8HE 4IHOB 3W9EB 4UT6H 5JOEA 4BFIB 4XCYA 1ZHKA 1CB4A 1T4KA 3L81A 3GRBA 2WQAA 3WHXB 4FNLL 1DLFL 4APQD 3STLB 2P24A 4YDZA 1ADQH 3QDGE 2YUXA 4TXVB 2NR6A 5IEKB 1QFPA 4UIKL 4XH2A 1CK0L 4KRNA 5IOPB 2ZCHL 2J4WL 3MRDA 3BSHA 3ULUD 4J4PA 1PLBA 1BOYA 4IRZL 2IWGA 5F6HJ 3UBFA 1YEKH 3DSNB 4BSWB 4YEEA 2Y06L 3BIKB 2NDFA 3WN5A 3MODH 2F5AH 3RVTC 2BVYA 5IBLD 2VABB 4N2GA 4YH6A 3V6FB 3GD1C 3GSUA 3KM1A 3GHPA 2FQEA 2IXQA 2NY1B 4H5SA 4RNRA 2O93L 4WEEA 1UWEL 3OPZH 3WDIA 1QBML 1YMME 2A4EA 4NJ9H 4PWJA 3W11D 2CD0A 2NY7L 4Q7DA 2AITA 4AUJA 4I2XE 3IN0A 3STZA 3NJFA 3WMQA 4M3JA 1UURA 2BDNH 4WI0B 2CA3A 1HE7A 4PY7B 1A0QH 2XRAL 5JIHA 5TQ2L 3CSPA 1KJVA 3EOAB 2AC0A 1Y0LA 4BSVA 4N1HB 2Q0ZX 2FQDA 3HMXA 1DP0A 1PKQE 4QRSA 1GY1A 3BKCH 1YO4A 1HHKB 2YXFA 1L9NA 3T3MF 3GBLA 4FFTA 4X5WB 2YOCA 1ZLVK 1U42A 1XGRB 1KT2B 3B6SA 4H8WL 1GC1H 3SDXB 1ACXA 4NX0A 3IJ8A 1SF3A 1LD9B 4PGBA 4PWIA 1OCWL 4R5TA 4L4TD 3SQBA 4N9GA 2CBOA 2VERA 2P44B 4XZ4A 1T0OA 5A7EA 4LIQE 2UZXB 1KGIA 4TV3A 3GJFK 3B7TA 3SE4A 2XX0A 4LCWA 4W9ZA 5JORA 4ZUSA 3NG5A 1ZEAH 4G7YL 3EGSA 2JCCE 3ISWA 3LH9A 3S48A 1QR4A 2FYYA 4YUEH 3K6SB 2H3NA 5KSBB 3BZFA 2VQTA 1AFVH 3WS3B 3RNKA 3EYVA 3U6RB 1CGSL 1T7XA 2HTLC 2VN6A 4U3CA 5DJZA 2K70A 3FQRB 5K33A 1T89A 4W1TA 5GHWL 3PG2A 1IBYA 4IU2B 5D1ZD 4L1DA 3ZKND 1A6WH 5EO0B 3GGWA 2VAAA 4KQ3L 1KXQA 1Q0XL 3NIGE 5H37H 3MBED 1ZGLP 3C08H 3HE6D 5GRVL 4UDUB 4X99B 1JYWA 3ARRA 3GI8L 4B7LA 3FU8A 3WEXA 3E3QE 2XVKA 3QC6X 4JHWL 1U95B 1MW2A 1BXVA 4OCXH 1T20A 1P1VA 4NO3B 3SJVA 5ETUB 3EADA 2PCFB 4F8NA 4GG6F 3WTTA 3L9BA 4OIAA 3BP6A 5C7XH 4XNUH 3QNFA 5ADPL 2HXAA 1IC5H 4A2EA 4TQEL 4B9FA 5IVZB 5I8KH 3M17A 4PRDA 3ZHKA 3CE1A 2XN9A 1TQSA 4M6ML 3WGUB 1FFOA 1EZVX 3KBEA 1A6ZB 5EOCL 1ANUA 2W0FB 4KJQC 5JUEL 4HHAB 2DKMA 2NX5B 1ZGLA 3IXTB 2WVSA 4HXBH 2VXTL 1SY6H 1OE1A 1RUQH 2IADA 3MXWL 2ZAIA 4UV7H 1UXMA 4QRPE 3QULA 2X09A 3OGOE 3VTTA 1GZQA 3QUZC 4FULA 4ZTOH 2X6AA 4Y2OA 1JV5A 3N43B 4HKXA 3A24A 5TE4H 2QGEA 1SPDA 4XBGA 5I16A 2FX7L 2C26A 1DSWA 1SFDA 2DWSA 1D9KA 3OQRA 3T6QC 1EK3A 4N20A 3MUZ1 5AZUA 4YN3A 3HTLX 4QOKB 1J5DA 4IGBA 3PJSA 2GQHA 4YXHH 4N26A 1CLZL 1RULL 1W72H 4OFVA 1B4LA 1KGJA 1MCWM 2YGNA 1TQCB 4XNZB 4BWWA 4G7VL 3F58L 4PJFA 2NPLX 3R1GL 2H3XC 4Z8FH 2AAAA 4KTEH 5I8CA 5IB1B 1RY7B 5FYJD 4ZO6A 3IMWA 4N28A 4K9EC 2AF2A 4RZCA 3N40P 3HR5B 4YBLC 3KWTA 3OMIB 1BAFH 5IMOB 3VXTA 2W81C 4KGJA 4PJ6A 1DFBH 1KB5H 5EIIA 1XZ0A 3HHSA 3SCMA 4ZYKA 3L7FB 2JKRM 3ZBMA 2VDRB 4OCYL 1X9QA 3EGXA 4GI8A 4Y5XC 4LF3A 4KI5D 3WIIH 1XF4A 1U33A 1QYGH 2FK9A 5AOJA 3P4OB 3D3VB 5KVEE 3KNBB 5IOKA 4NQCA 3H0TA 4OZGE 4YO0A 4GIPD 1TEYA 2IANB 5M95B 5C86A 3WIHH 1YN7A 2PTTB 4U1LB 3QNYB 5EUKA 5ICUA 1UB5B 5CLTA 5JXAH 1KCUH 5J1SC 1U91B 4P3CL 3D05A 3ZKXC 4KXZH 4FG2A 1CMOA 1VCBC 1N6QL 2IEPA 4BK5C