3NP3A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 38
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np3A00
2EIJB 1BQKA 2I7OA 2XYBA 1SF3A 3N2JA 1IBYA 4E9XA 3G5WA 1RKRA 3FQ2A 1NIFA 3ABMB 1JVOA 4P5RA 1ILUA 3ASOB 3WNIA 1RCYA 3S3DB 2UX7A 3WNJA 4F7KA 1DYZA 3FSZA 3AW5A 3QJTB 2HX8A 1W6WA 1NPJA 4NERA 2FJSA 4KNSA 4X4KA 1OE2A 2GC7C 4A2HA 3IN2A 3NJMA 2CUAA 5D4IA 2J5WA 2CALA 2VW4A 2FTAA 1AIZA 4RH4A 5I6MA 4E9YA 1JVLA 4YSAA 4HZ1A 2RACA 1CUOA 1GS8A 3OQRA 3DIVA 3NJIA 2IH8A 4ZK8A 2HX9A 5I5IA 1VLXA 1CC3A 2BWIA 3KW7A 5E9NA 1JZJA 2QDVA 2DYRB 1NPNA 2X87A 2YARA 3AG4B 3NSCA 3WKPA 5TK4A 2YAOA 4P5SA 2YAPA 3N55A 3UADA 1QNIA 3AZUA 1B3IA 3WG7B 4Q8BA 7PAZA 3EH4B 2N0MA 4YSEA 1T5KA 4GP4B 1GR7A 3FPYA 3TASA 1OCCB 4A2EA 4QLWA 2VM4A 1E65A 3NSYA 3PXLA 4ENZA 2IWEA 5B1JA 4UANA 2P80A 5ANHA 3PAZA 1PNDA 5PCYA 2VN3A 1PMYA 5PAZA 2DYSB 2PPCA 3X2QB 1NIDA 3X1FA 1NDTA 2XLLA 3ZDWA 4YSDA 2FQFA 3H4HA 5F7BA 3TU6A 3CZUB 1L9RA 1XB3A 4HCIA 1NICA 1RZQA 4AKPA 3SBRA 3FSAA 4BXSV 1KGYE 2I7SA 2IDTA 1A65A 3S3BB 4GP8B 2H5UA 1M57B 1OOWA 4NAJA 4EF3A 1OV8A 2ZOOA 4A68A 2YXVA 1E5YA 2EINB 5AZUA 2WO2B 3PCYA 3AG1B 3ABGA 2AANA 1A4CA 2BP8A 2IDUA 3D12B 3L45A 2UX6A 4A2DA 1JZIA 3T71A 3NJJA 1BXAA 2PLTA 4L0PB 3UABA 3CDZA 1NIAA 2MTAA 4HAKA 1IBZA 2BHFA 2PPAA 3QQXA 2QPEB 4DP9X 2DV6A 2MRYA 2FQDA 3FSVA 3NJLA 1BQ5A 2XX0A 4DPCX 5D4JA 1ZIBA 3MBWB 3OMAB 4FA7B 8PAZA 1ASPA 1W6LA 1KDJA 1SJMA 4JHVA 2YAHA 4JHUA 2BWDA 3T6WA 2AZUA 2H47C 5FC9A 2GBAA 9PCYA 3FYIB 1MZZA 3SBQA 4G72B 3NJHA 4AI7A 1GSKA 2PP8A 4E9RA 6PCYA 3WI9A 3AY2A 4HCGA 2P80D 5I5MA 4G7QB 1L9PA 2WO3B 1RZPA 1PF3A 2TSBA 1E67A 1AS8A 3GXUB 2DY2A 4DP4X 3ASNB 3T6VA 1SFHA 2WSDA 4YSRA 1AANA 1OCRB 3IN0A 1I53A 3OM3B 4DP2X 2XV2A 1BQRA 1MZYA 2PCFA 1KYAA 2XXFA 1ET8A 2J57A 1TKWA 3ABKB 3ERXA 3NJNA 4E9TA 4DPBX 1J5DA 1UATA 1BXVA 4GYBA 3X1NA 1A4BA 4E9WA 2YAEA 3QJSB 5IY5B 5AFAA 4W9ZA 1ET7A 3X1EA 4E9VA 5EHFA 3EH5B 5B1JC 3CVCA 2UXTA 1PZCA 1CYWA 1ZDQA 3UGEA 2PP9A 3EH3B 4HALA 1AZBA 3NT0A 4M3HA 2GI0A 4K9JA 2UXGA 3IEAA 2FWLB 1J9TA 1JZGA 2UXVA 4YVNA 4AKQA 1PY0A 3NSDA 1EHKB 1ID2A 4BWTA 2EILB 5B1BB 2YXWA 5B3SB 1HAUA 4KOBA 3QJRB 2GC4C 4UAHA 2Y1AA 4DPAX 4NB7A 4UF7C 3H56A 1TU2A 1AACA 1GS7A 4DP8X 5A7EA 1PAZA 1AZNA 1WAEA 2GB2A 2OJ1A 3TBCA 2IWFA 2XV0A 3FS9A 1PCSA 3QPKA 4F2FA 1BAWA 4AX3A 5D4HA 3T6XA 1BEXA 3DKHA 2XX1A 4W1TA 1KBWA 1J9SA 1MG3C 2Q5BA 2BW5A 3S3CB 4TXVB 3PAUA 4HIPA 1SHWA 1ZPUA 1HFUA 1OE1A 1W8EA 2I85A 1SHXA 3V9EA 2IH9A 2XV3A 4G71B 4PCYA 1SDDA 5I6NA 4YSQA 1AZUA 4KNTA 2BP0A 2VW6A 1KV7A 3C75A 4A66A 3RYMA 2XVBA 1CYXA 1ASQA 2YAMA 2PPDA 1NTDA 1BYOA 5LDUA 3NP4A 4DP5X 2FT6A 1MG2C 1ZIAA 2FT8A 2PPFA 4YSTA 2ZONA 3S8GB 3JTBA 2B3IA 3KW8A 1V54B 1XMEB 3QJUB 3V9CA 3T9WA 1KDIA 2BW4A 2VSMB 4DP0X 2W8CA 2W88A 3NYKA 2XWZA 3NP3A 1N68A 4AZUA 4GP5B 1GW0A 4YSPA 2A3TA 5I26A 3GDCA 1BYPA 1WS7A 2Q9OA 1IKOP 4BXVA 1NINA 2AVFA 2AZAA 4CSPA 3UAEA 5B7MA 1JZHA 1M9WA 1ET5A 2ZWNA 4BK5C 1SFDA 4N8UA 4HHWA 5I6KA 1PLCA 3DTUB 3PAVA 2CAKA 1E5ZA 1TEGA 4WTQA 2IDSA 1FFTB 1OF0A 2HRHA 2QPDB 2HXAA 3CDZB 2GHZA 1A8ZA 3H4FA 2Y69B 1ASOA 1OE3A 1WS8A 4KO7A 2E86A 3ZIYA 4HHGA 1DZ0A 1URIA 3AG3B 3HB3B 2X88A 3CVDA 2FQEA 3TA4D 4GY4A 2IWKA 4JKNA 2YQBA 4F2EA 1N70A 5I6OA 1QHQA 2VMJA 1GS6X 1JXGA 1L9TA 2BZCA 4KNUA 3BQVA 2QDWA 6PAZA 2EIKB 4KOCA 3FU7A 1JXFA 2CBPA 2IAAC 4MFHA 1X9RA 4Q89A 3UAAA 1A3ZA 3CG8A 1E30A 1CURA 1WA2X 2OCCB 2CJ3A 1NIEA 2YAFA 4BDVB 1FA4A 2LLNA 2HX7A 4YSCA 3QJQB 3TBBA 1YLBB 1HAWA 3U25A 5F7AA 2AFNA 3EF4A 1JZEA 2BZ7A 3PLYA 4PAZA 3FU8A 1KBVA 1QLEB 1SDDB 3FU9A 3NJFA 1J9QA 1ETJA 2JFCA 2HRGA 5B7EA 2PCYA 1F56A 3JT2A 3FU7B 2XUWA 1AS6A 3IE9A 4G7RB 2J55A 2UXFA 1IC0A 2TSAA 4GXFA 4M4RB 2VW7A 3ABLB 4DP6X 2PPEA 4KO6A 7PCYA 2ZXWB 2HLEB 3NSFA 1PLAA 3CVBA 5B1KA 1GY2A 2VM3A 3BVDB 2DWSA 4HCFA 1ZDSA 1AAJA 4A2FA 2GSMB 2IDQA 2IDFA 3FQ1A 3NJKA 4A67A 4BWWA 4YSOA 5AKRA 4DP1X 2GIMA 3HEIB 2CCWA 2PP7A 1ZV2A 5I5JA 3ZBMA 3FQYA 2JKWA 1V10A 2YAQA 1M56B 4DP7X 1JXDA 3X1BA 1ADWA 2H3XC 1SF5A 4YSUA 4A2GA 2JXMA 1SNRA 3AG2B 3WIAA 2BP8B 2DWTA 1NWPA 2BO0A 2R7EB 1AG6A 2OV0A 3ZX1A 4KO9A 3T6ZA 2VSKB 1L9OA 3MX0B 2FNWA 1OCOB 1AZRA 1PLBA 1XB8A 1JOIA 1WA0X 4WKXA 1TEFA 4KO5A 3OMIB 4E9SA 3QJVB 1BXUA 1AR1B 1V55B 2FQGA 2XXGA 1GY1A 2NRDA 4YL4A 1KCBA 3GYRA 1JZFA 1NWOA 3S8FB 3FSWA 1PNCA 1NIBA 5I6LA 5I28A 1IUZA 1OCZB 2R7EA 1PZAA 1AG0A 2QT6A 1KCWA 1PZBA 1AS7A 1ILSA 3UACA 3FT0A 4YSSA 4AKOA 2XU9A 3IBOA 3WKQA 1GYCA 3PPSA 4BDVA 2HZHA 4QKTA 3OD3A 3NJGA 4FAAB 4N4YB 5I6PA 4CSZA 4BWUA 1J5CA 2B08A 4YVUA 1XB6A 3FYEB 1FWXA 2EIMB 4E9QA 5B7FA 3FPXA 3SQRA 2FT7A 3X1GA 1WA1X 3EHBB 1JERA 1R1CA 1X9UA 5TK2A 3SBPA 1MDAA 5B1AB 2J56A 1AQ8A 1A4AA 1EZLA 1AZCA 1J9RA 2BP0B 1NZRA 4G7SB 4G70B 1L9SA 1L9QA 1AOZA 3OMNB
chains in the Genus database with same CATH superfamily
5CD5C 5BXFA 1Q9LA 4E2OA 2A9CA 3GQFA 3B9DA 2ADGB 4IKLA 2FJUB 1BIIB 5TE4H 1JGVH 2OLDA 3WIFA 3U4BH 1XF2A 1RD6A 5CCGE 2CLZB 5JXAL 3EOBB 2X38A 3NAAH 5F1IA 1CK0H 2DYPA 2XNAA 5T1MA 4OH2A 1A2YA 4PMEA 4LCVA 4DEUA 2LU7A 5CEZD 5DJ6A 4DO4A 3IPFA 1HESA 4YHOL 3TBTA 2X28A 5JZ7C 4ZUVA 1JCKA 1LD9A 2AK4D 4KDVA 1MVFA 1M2VA 1PD6A 2HUHA 3GKWL 5FUOH 1CG9B 3OZ9H 2CALA 2VW4A 4PPTA 4TPRH 4L29A 4HZ1A 1UZ6F 1OM9A 5HD8D 3FU3A 2YBRA 2CDEB 1F86A 4WI5A 3ULUE 3KWWA 4JHBA 3JZ7A 4MMYB 5E00A 3WFDH 3LS4H 1BWWA 1HEHC 4NKQB 2XZAL 4EIZC 5T33L 3APNA 1Q0YL 4X9FA 4D7PA 1F2XK 5DR5H 5DJAB 3HKFA 4G43B 3WKPA 5IF0A 2H0PA 3ECBA 3FCUB 1NJ9A 3PIQB 3LNEA 4ZD3H 1YEFL 2HRLA 1AGEB 4KK6D 5C0CE 3GTTA 4PRAB 1KIRB 1W91A 1IKFL 3NEOA 2H9GA 3QO1A 4GMTL 3F05A 3PE9A 2AJUL 3A67H 2OK0H 2DKSA 4RESB 3CSYB 3SOBH 3OQ3B 2P80A 1ZLWH 5KS9A 1PMYA 3R18A 4O2EA 3VWKD 2BNRA 4Z7VA 1BOGA 3MRNA 2ATPA 5IVXE 3VYNA 1UADC 4BFEA 1XIWB 3M8OL 5I1KL 5LXVA 2ZUVA 4QNPE 1RIVH 4QI3A 3SBRA 3W9DA 5I8EB 1RULL 5FGRA 2H0JA 2IDTA 2WSPA 3S3BB 2ZX9A 4PJGB 3K2UH 3BKYH 4OM1H 1D9KC 3CSPA 4FHBD 5LGYA 4K7PY 5D2NA 4JG1L 4L8SA 3S5LA 5T33H 4ZAKC 1N2RA 2YMOA 1EZSA 5DUMH 5GRVK 1NQBA 4JAMB 5HDOA 4AC4A 3MLWL 5IB5A 1T1WB 2VISA 2KDYA 4OQTH 1QSEA 1KY6A 1PL3A 3B7YA 3GI9H 2BNRD 1AP2B 2EDTA 2CR3A 3UABA 3ZW3A 3SHSA 1OY3B 5AW8B 4Y2OA 3VQLA 3GRWL 4JREB 2Q86A 1CD1A 1CMOA 3BIAX 2BNUB 5B1CA 3D05A 3AMLA 3PWPE 2V17H 4XBGB 4DP9X 2AI0H 2F5AL 4K5MA 2X7LA 1BQ5A 4DKEH 4DVBB 4WTWA 3TP4A 2EYTB 4GO6B 5E4OA 4EI5A 5AAWA 3ESVF 4U3SA 2VMDA 1U0QA 4KHXL 4JGNA 2R9HD 2JB5L 1PEZA 3FULA 4Y8AA 5A6MA 1WAPA 3GSQB 4FQ2L 4OLWL 2VR3A 2EZ0D 4OZIA 5D1XA 3TYFB 2ZP0T 3B2UC 3QFJE 1CQYA 1AMYA 2BOCA 4UV4L 4EBQL 3M7OA 2IC2A 5C08E 4QRPE 4L37B 1BIIA 4LSRL 4YK4B 2IALB 2Y06H 3ESOA 1BGXH 2VE6B 3P3SA 1JF6A 3BGFB 1IGJA 2BY3A 3E8VA 4G7QB 3RY6A 2LHAA 4JO4H 4YIQA 1KCRL 2AMGA 1P7QB 1F1DA 2OR9L 2V5SA 4BQ6A 5EIIG 1Q1JL 1JPEA 3T3PF 3R19A 4Z3HA 2NY5L 4PRDB 1INEL 1NEPA 1DJZA 1PQZB 5GS1C 3BWUC 2J57A 4HX1A 5F2FA 5DZAA 1IBDA 4U1LA 4F9LC 3TXAA 3NIFE 2M83A 1D3CA 5MI0B 4JQVA 3TBYA 3H2PA 3BD5A 2QADB 2BZDA 4HIJA 4P23D 3K6OA 1DDHA 2XN9D 3JTSB 4MA7H 2YAEA 4NUPA 4UQ3B 3T0WA 2VXQH 1N3NB 4PBXA 1AGFB 3PWVA 4WFGD 3W9EA 3DVNB 5KUKA 1J0HA 1G7HB 1OTSD 4H8HA 3RTQB 1OP5K 5EC2A 4GBXA 3UAJC 5CKAA 3MLWH 1S5HA 2YSSA 5DEJA 1N0XL 2OMZA 4AQZA 4JMXA 2Z0UA 1YQVH 3E0GA 3WNKA 3PQYA 1GW6A 3LOWA 2QSCL 2YUXA 3MSPA 3OAZK 4WI6A 1H6FA 4TSBH 2XZQH 1DQKA 4HKZA 4ZTEA 3MTXA 4CVZB 4IRSB 1GA2A 4PP2A 1MJJA 1HAUA 1J8RA 4G42A 1OPOA 4RA3A 5DQ9B 5KZCB 1TMCB 3IGKA 1BYNA 3H9SA 4YC2C 4UF7C 3U30C 3GMMA 3SY0B 1AACA 5SX5H 1DJXA 1PAZA 4UTCA 2ZOLB 3OL2A 4Y4FB 2XPGA 2Y7QA 4WLCA 3WHE0 3RFZA 1QVOA 5AOLA 1HCFX 5K9QI 4DN3H 3ZKXC 1JK8A 4XNUL 4JRXD 5IVZA 1I3UA 1DQDH 3V0EA 3ZDZF 4C4KT 5D4HA 1BEXA 3KPRD 2EXYC 1MFVA 1S7VA 2VLJD 2XX1A 2K6WA 4P46C 4MS8C 4KFMA 3RPKA 1HHHA 2EXWC 2PNDA 4KY1H 1NLDL 3RVXD 1JFHA 4JM2B 1SHWA 2Z1PA 5FYJH 1HFUA 1HI6A 1TCRB 2KDGA 4RGNE 1F58L 4K3EH 4N2NA 4NNXB 4EXKA 1MCWM 4KRPD 2EDFA 5DMGC 3U6RA 4KZCA 4HUWB 3HS0B 2FH6A 5I6XB 1NTDA 2ZXGA 4XNMB 4BKSC 3BGMB 2XPGB 1XGYH 5DFAA 3RZCB 3CMGA 4F7CB 4B9FA 1OQXA 3UC0H 3NP4A 4M29A 4MCYB 4GI6A 2IQAB 1I8KA 2PPFA 2D0FA 3PWJB 2G9HA 1C5BH 3JTBA 4ZMVA 3ARFD 4Z6AT 1JV5B 2Q76A 2IFGA 2PWEA 4R2GC 3MXVH 3EJQA 4KXDA 3T9WA 4AJVA 4WO4A 1ZSDB 5CP7B 3MCLL 3P4MB 2D03H 4NJAH 4QXUH 3TEUA 5KYXB 3H6JA 4OZ4B 2HN7A 3R8BB 3PRZA 1C7TA 4KZ0A 5I24A 3KAAA 1A6VL 2CGZA 1QHOA 2EC9T 4I3RL 4C4KO 1AXTL 1IM9B 4BK8A 3AC0A 3IDYC 3X13A 2LW3A 1XAKA 3T4AA 1U41A 5DMKA 1T7WA 1AQKL 3UAEA 5TH2A 4M8QB 1K5NB 1KZQA 4DN4L 3Q5OA 3FTZA 4CU6A 5K69A 3SY0A 4JPSA 4OZHE 1CGYA 2A1WH 5CN1A 1TEGA 1UFGA 3BAKA 3P2TA 4U6HA 5I74C 5IT2L 5ICYA 3QORD 2FL5B 4XVUD 2MEJB 3U48A 5IB3A 1ULVA 1J87A 4JFEA 3N1QC 4PGZA 2WAQA 4PJEE 4GY4A 1MQ8A 5F7EL 3O8XD 1OL0A 2FBJH 3EJJX 2JI2A 1YYML 1CICA 5J6SA 2E9WA 3GFUA 3U4EA 3NA4A 4EIUA 2IBGA 5EMYA 3QIUC 2CK0H 2MNJB 1CDHA 2Y2TA 1KNOB 1XIWC 3DJZA 1F6AA 1MJ7H 1WWCA 3P4OB 3B3IA 2FATL 3I84A 2AEPL 3O2WH 4LMQI 1NLBL 1JSYA 2WSKA 5IHZB 3JWOL 4KWUA 3LX9A 1D5BB 1FYTA 5EZIL 1EXUB 4OJFL 1RJYB 1S7XB 1MRDL 2GQHA 3SOTA 1EJOL 1IGCH 4NPYB 4ZO9A 3MU3A 3L3IB 4W9GC 4N0CD 4S1QL 2J7LA 1TVBB 4NIYE 5D7SL 3OKKA 5EU5B 2BZ7A 4U3SB 4DJMA 1IT9L 2FJFB 2Z0BA 3ABZA 3WIIL 2K8QA 1SDDB 2FJGB 4JO3H 4JKWA 3FB5B 3V8CA 3QEQD 5A16B 1Z9NA 3ML8A 1IBBA 2PCYA 5B7EA 3SE4C 2OXHB 2R39A 3FTGB 4RMSA 4MJJA 2JJWA 1W80A 3OKNA 2W95A 4HJJH 3B9KB 4P9MH 2HLEB 2ENSA 5TH2B 4Z76B 1D5ZB 4OZGA 5LBVA 4YXKH 5BOJA 5B1KA 5EBWA 4Y7MA 4GIOA 1T83A 1DJYA 5BJTA 2EKSB 3QXDA 3WEXA 3REVA 2DM7A 3G6DL 1RJZA 5JO5A 4O2FA 2Z4TA 4YZFF 1AFVL 1ZHKB 2BIPA 3ZKMC 1KB5B 3HZVA 4PJEA 3WFCH 4B9ZA 4F91B 3HJ0A 4P23C 5BS0A 4Y1AB 3V0WL 3MOBH 5F6HI 1MFEL 1FCGA 4RA0C 4ZJ9A 4YXHH 1YYLL 2MQ0A 3BH4A 3JWOC 2IGFL 1SF5A 3BGAA 3KR3H 1YEEH 3K4AA 1UACL 2DIJA 3AG2B 4OZIB 3JWNH 4WGWB 3UPRB 3BH9A 2AJSH 2FBJL 1MFDL 1FCCA 5D7IB 4HD9A 2CIIB 3QCUL 1OCOB 5DHVA 2OAAA 1CI3M 1LO5A 4X7SH 4S10A 2VC2B 3BUDA 2QZQA 1FYTE 3GS4A 4LLYA 2V2XA 2XG4B 5JORA 1ZD6A 3ULVE 4FJZA 4E9SA 1TETH 2HN7B 1I3RB 3RWCA 3GHBH 5F7WC 1F42A 2DI8A 1I1AD 3NZSA 2F68X 2QVIA 2HFGL 1KCSL 1EEQA 3B9EA 1NC2D 3CMOL 4YBLB 4CJ1A 1NOFA 4KVCL 4UIKL 4KKBC 5KEZA 4BZ2H 1R4XA 3RAJL 1TKWB 1XGUA 1YUHB 5DD1L 5MERB 3WDIA 1R34A 1IUZA 2YEVB 3MRHA 3MDJA 4JFFE 1BJ1J 4DKTA 3MRPA 4A6YA 2IOMA 2NY6D 1HHIB 1FFNB 4MNQB 4JY6B 4Y16A 1RUQH 4U3XA 1T0NA 4F8OA 4HWBH 1GYCA 2CJTA 3W82A 1N5YL 1YYLH 2CDGA 4NDMB 1HSAA 2W59A 1A64A 1KLFA 3ARRA 1J8HA 1YPZF 3T04D 43CAB 2TAAA 3AREA 4O9HL 4Y9EA 1NCWL 3T0BA 2AXWA 3AXIA 3UJTL 3FCSB 1XB6A 2BVYA 3CTTA 2VDQL 3CUPA 2W80C 4MX7A 5F7KC 4FS0A 5FIEA 3UYRL 1JERA 3CH1A 4O2CB 2VDLH 1W0YT 3BFOA 3OKDB 3ATDA 1NGPH 1EZLA 3DUUA 4L4TB 3F12A 1S9XB 3GMOA 3MBWA 5FFOA 4ZMQA 5IOKA 3GS0A 4IDLA 5TE6H 4F8QA 5EU7E 4FYRA 4ENEC 4OCWH 5TQ0H 4EDWH 2W81C 2GYSA 1L9QA 1TPXB 3TLRA 2WWNA 1KELL 5SWZA 4KV5F 3GJEB 2WNGA 3G5WA 3QHTC 4NKIH 5JHLA 3LKOB 4O4YL 2EDDA 3HOGA 4P9HC 4CSTA 2IVFC 3T2NL 5IEKB 1KTKE 4Z8FL 1A5FH 4OVVA 4I4WA 3LYRA 1BM3L 4JG5A 5E9AA 5G4MA 4C8XA 3D4GA 1C16A 1NGXA 5HVFB 1JZ6A 5I9QC 1N59B 4NQCB 2VDRB 5GHWH 2OJEA 2P5EB 4PRHB 3FT3A 2XWRA 3ZXAC 3GMLB 3IN2A 4GG6B 4GQZA 4ZO8A 5D71L 2WBJC 2G3XA 2ZKHH 2WV3A 3GSXA 4GG6F 4HEMA 1RZFH 3EJCA 1FL3B 1SXSA 2F08A 2NSXA 1YEHH 3PGDB 3AREC 4JHWL 4GT7A 3D85B 1NC4B 4ZMAT 1UB5B 2KYIA 5LUMA 2OSLA 2VLME 3B9KC 4KROD 4OV6F 3S88L 1CFQA 4UBDC 4H1LG 4R7DA 1ZXKA 4Y16C 5GRYA 3QDME 5B4MC 2XJLA 1UD5A 4LCCB 3FF7A 4L1DA 1MPAH 3Q48A 3L48A 4NO5A 1EO7A 3B2DC 4PLJC 3CQFA 3LZOA 1IGCL 4PTTA 3FCSA 1MXGA 3NSCA 3I75B 3DMMC 4PSRA 3EFFA 5TF1L 4AYID 4K7FB 5E2TL 4MA7L 2DBLH 5AG9A 1A9EA 2E7BA 1VEOA 2FNBA 2OMNA 1DSWA 3GSWA 1RHHB 5K59E 4EN3B 3HPJB 3EHBC 3M1CA 4BKLB 3ULAB 4YO0B 3D2UD 3SYPA 3UMNA 1T6WA 4KRPB 5ANHA 1FO0A 3VXOB 2DBJA 3MA7B 4HWNA 1FH5L 1OP5H 4K9EC 1X3DA 3DX9A 3TNNA 3CSFA 4WW2B 1IGYB 1BEYL 3LPOA 4NC1E 4XBGA 4C58B 3BYTA 1PG7W 3FB8A 1QNZH 4KVPA 4BXSV 2HLAB 5LGHL 4X9YA 4ZSOA 4AK2A 5GRUH 4EUPG 2Y24A 3RURA 4DPRA 4FP8L 2VDQB 4LEOA 4W9FC 4B9CA 3DMMD 3FUEA 4PWJA 5F72S 8FABB 2E5EA 3MNZA 4YHKL 3FONB 3HE6A 2WIMA 1DJWA 3LS4L 4H2CA 3ULSB 4N2LA 4YHZL 3LNFA 1WBYA 4NS0A 5GISH 35C8H 3L9EA 3P77B 5D1QD 5AKTA 3T71A 3F65A 3NJJA 1W0VA 12E8L 3MACL 2ZTBA 4ODHH 3EGSA 4UZSA 1BZ8A 3TPKA 5CILL 4ECNA 3GF8A 3LKSA 1NLDH 2EEBA 3AT0A 3RWDA 1HXMA 1QSFA 2FQDA 2HFEA 3ULUL 4V2CB 4YPGA 2C26A 2XX0A 3Q3GB 1A25A 3BIKA 4NEHB 1S9XA 3MBWB 1T3FA 1VSCA 3GI9L 3HG3A 1ZPLA 3LRSB 4NM4L 2DQTH 3CQPA 3X11B 3ESUF 3HNSL 3OLIA 5F97E 4JZNB 4IOIB 1W2KT 8FABA 1N67A 3WFEL 1JGLL 2JXMB 4TSCH 3VFVB 4YR6B 4ETYA 1U8PA 3MNWA 5H4ZA 2WKGA 4RRPM 3EYUL 3F58L 2L7UA 5IHUL 4HWBA 2AAVA 4XVOA 3WJMB 1EHLH 1HILB 5IVXF 5HP5A 3BWZA 1N7MH 2GBUA 5I5MA 1I7ZB 2V2XB 2XG4A 3UP6A 5IEHA 3NRPA 4BHUA 4M3JA 2PXYA 3FKUS 4X9IA 3GXUB 1HL5A 1UXLA 2W65B 1FLRH 3MA7A 3T6VA 4YSRA 3ATAA 3DX9B 1AANA 2ALAA 2XV2A 4G8FB 1XH2A 4JFPA 3LRSA 5DD0L 1BBJB 2HG5B 4AYGA 3EDKA 3MUUA 3QG6A 3ABKB 2EECA 3DHJA 2LFEA 2EXTA 5FO2A 4FLRA 4GAAA 4IJ3C 1RHHA 3T0ED 3FO2B 2ZE0A 1AKJA 5CLXA 4Q0XH 3SJVD 3UX9B 4LSSL 4D94A 1A4BA 1IC4H 2PYFB 3U6XA 3QCTH 1H3UA 3S35X 5FDYA 1KLUB 2Z91B 3MXVL 2X1OA 4XNDA 1CT8B 4J1UB 1AGCB 4N2IA 4PJCF 1ET7A 4KZDH 1OM3L 4LCCA 4E9VA 3VGDA 1E50A 9CGTA 3CBKB 2A6IA 4LKXB 4L5FL 1UB6A 5CINL 3P30L 3I85A 2LU4A 1AZVA 1JDCA 5F7FA 4K7PL 1RUPH 3FUNA 4F7EA 3N85H 5GZNA 1AD9A 1IC7L 5ENWB 1LO4L 1MHPH 1XGPB 1YQ2A 4PJFE 5MEPA 3TYGH 3IXAB 3HC4H 4P4KB 5LBSH 1KSRA 2IG2L 5F7MC 4I48A 1U8IB 3EYVA 1SLWA 4DP8X 5A7EA 5IV2A 5GGSY 5EEXA 5ICZB 3U7YL 4Z7OB 2OJ1A 3BSZL 4JY6A 2ZP8A 4Y16B 2MKLC 3FO0L 4NFBA 2B8OT 1UJ3C 2GSGB 1C12A 5FUCE 5SV4A 2UY6A 1XGTA 3R4DA 5DQDL 4H0LC 2CUMA 1YY8B 1BVLA 1MG3C 4WO4B 2B1HH 5AW9B 3VE0A 5JHLL 5MEOB 4HIPA 1R3IL 3TC9A 4GUCA 4HUXA 2XV3A 3DTXB 4FFZH 4G71B 5CZRA 3ZT5A 4BRVA 1AZZC 5HGHB 2RGSA 2ZSWA 3G6AA 1TIUA 2VDRH 2Z8SA 1YN7A 2X3BA 3VXNB 3P73B 3PWLB 1Q0XL 3ELAT 1JGEA 1MIEL 4Y19A 3U1QA 7FABL 3AB0C 3C6SA 2WXJA 4PH8A 4QYOB 4DP5X 4RGOL 4GIAA 5IFHH 3I9AA 1UXWA 1ZIAA 2CDFB 3OKEA 2DQMA 2CZNA 4N2FA 4IBSA 1Q94A 4X7EC 3DSFL 3O41A 4TVPH 3ESNA 2H2SD 2PTVA 4H7VA 3OAYH 1F18A 3GSNH 3QQ4B 1RZGA 4P2CG 2WBJD 3BMWA 3F7RA 2FB4L 3DV6B 4JPWH 4HEPA 4MMXA 5GSRB 3CPLB 1XH3A 5KVEL 4F33B 2ODIA 1H6EA 1C16B 2D7PA 3E6FA 4K0OA 4K3DH 5CMAA 1U8CB 5HGAB 4U7MA 1VKXA 3EYFA 5KYUA 4G6ML 1OGSA 1EFXD 5EU6D 3QXWA 3UIZA 3VFTA 5FW8A 1JZHA 1TNNA 4GW4B 3BKYL 3MYJB 2J4WL 2F7OA 5DZLA 1D5IL 2Z64C 2CAKA 3PJNA 1TYJA 4TVSa 3B7RL 3TYGL 4HGMA 4JFQA 4N6QA 4YC2B 4JO5A 5ISZA 3H7LA 4X0NA 5D5MB 3UCQA 2ZZUT 2QPUA 2R2HB 3P3RA 4NX0A 2B4CC 2UYLB 1DZ0A 4Q7DA 3QWOA 2B20A 2Z35A 2X88A 1WFIA 3P3UA 4FMVA 4GSUA 4QF1A 5D5MF 4L3ED 1GMEA 2XWJA 2XQ0A 3M1OA 3EF7A 5T3ZL 4X9HA 4MB1A 4LB8A 2P5WE 4LLUA 3LB6C 1SZNA 4D9LH 3DUHA 5TDPB 4JGJA 4N0UB 4F3FA 1UOVA 1Q9OA 3BQVA 6PAZA 3TJEL 3A6OA 3EGDA 4NQSB 1PZSA 3WV0A 2BSSB 4EDXA 2HT3C 2UWEF 2R27A 1I7TB 3MV8D 2YPVH 5DWUL 1GYWA 3SGKC 2F8IA 3BGFC 5D1ZA 3WENA 1B2YA 2YEQA 3FMGL 4LPYA 4NUMA 4MAYB 4KUZH 2Z93B 4PLKD 3RWIB 2XXCB 5JOPD 5FLUA 1LL1A 3BO8A 1ZGLB 4G5AA 5IG7A 2C34A 5I1JL 4HF5L 4AEEA 1ZTXE 1MW3A 5D1XC 3AS3A 3LSOA 4R4BB 3FU8A 2ERJB 3ULUH 1UWEL 5DT1H 4ANUA 4D8PB 5CSZA 5DLML 1BFVH 4D9QD 1E4WL 3JT2A 2Y22A 1ZVSA 2ZJSH 5D96C 2UXFA 1RJLB 2HH0L 1T4KB 3Q1EA 4X6DB 3O4OB 1NMCC 1MVUB 3ABLB 4GXFA 4YMPA 1I7TA 4PGDB 5CD3B 3LKNB 4DWHA 2XZQL 2P5EE 3FT9A 3HAEA 4K07A 5JDJA 1DJHA 1M1SA 4OCXH 1BFOB 1KYOK 4FDWA 4Y4FA 4ETQA 5FPIA 5GRJL 4FA6A 3RTQA 4AQAB 1FN4B 1XF4A 3FQ1A 1PSKH 2JQMA 3PG2A 1TVDA 4WEEA 1P7QD 4MZ2A 4ZAKA 3UTZA 4L8SC 4NOFA 4I0PB 3IXTB 4P59H 2BSED 4PUBL 1U8OB 1YECL 1UJTA 4JKPH 3UBGA 2VLRA 5F89B 1ZVHA 5C6WH 3ZMEA 2K45A 5EA0L 4RAHA 5IW1A 5LBSA 3DJRA 3FUFA 3NH7H 1D6EA 5FUCC 4ZS6C 5F0MB 1AG6A 3MLSL 4LQFL 2NW3B 4F20A 3CVHH 1Y6NR 4MNQA 3FQWA 1U8NB 3G04B 5E8EA 5DJ8A 2X4TB 3BN3B 2IO5A 4FCAA 3U0PB 3TV3H 2CKBB 2OMWB 2R51A 5KYXA 2D7TL 2PW2A 4XVTH 5TTRA 3QJVB 3K1DA 2E7HA 4N9OB 4OZHA 1CDGA 2EUZA 2YKKA 5E2TH 4Z0XA 5C0DA 4L23A 1XIWA 3E8UH 2WUCH 3QIUA 5J12B 1IEAB 4YL4A 1NWOA 4UM8B 3DK0A 5DMKB 4XP1L 4XTRC 4M8QA 4WJG3 4HF5H 1BZOA 3B4NA 5E99H 5GGRA 1IM9A 1RZKH 1T1WA 3CLFL 4IIQA 1X5IA 2AP2A 2PETA 4FQ1L 2XBZA 4OKVA 4WKZB 4YDJA 2F5BL 1QVOB 1KTJA 1KXQA 3FFCB 4JVPA 1PG7X 1H3PL 3KYAA 1ORSB 2JJUA 2G0LA 3OKOB 4YWGL 1ADQH 1FNEB 3QUXB 5T3ZD 2XVKA 2JLPA 5JW3H 2VXUH 5EWIL 1RIVL 3MROB 1RIUH 5GJSH 3GRWH 3BLPX 4GAJL 4WNQA 2EIMB 3BT2H 4ZXBD 1QMUA 1QOKA 1NAKH 1JPTL 2NY5C 4JHAL 4JO2H 5CU5A 3LKPB 3J7HA 4DIXA 4POZC 1AKJD 1EK3A 4YHYB 4BKTC 4DERA 1ZEAH 2W9EH 3GGWB 3E8UL 4Z76A 4WUKH 4ZW8A 2R2CA 4UYQA 1WT5A 2V5YA 2G9KA 4I48B 2ITFA 3HAEH 4E9XA 5C9KA 2ADYA 4U1NB 1Q94B 1AP2A 4X6CA 1J48A 4Z7WF 3ABMB 4RX4D 3QAZC 3T4YA 4X6BB 3ECWA 2WXFA 3QJFB 4P5RA 1DJIA 5J4MA 5I1HH 2Z7WA 1TMQA 2X89A 2ARWA 1B4TA 4H88L 2VDLB 4NO0A 4LGSB 1CXFA 4HMCA 2YK1H 4NPKA 2WLZA 1VADB 4M8RA 5HXMA 2VN4A 1RK7A 5H94A 3GXNA 4R4ND 1WD8A 2ADFL 3QIUB 3ULVD 3RVTC 4OJYA 3QUXC 1JF1A 1XQ4A 4O4YH 1S7UA 5D4IA 3RGVA 3T3PE 1JNHA 2LAAA 1TZHA 4JVWA 3MHZA 1C8PA 4J4PA 4RH4A 3S35L 3SYCA 1KIPA 2XC8A 2YPVA 1WWAX 4GKZA 3SPHA 3N1FC 5EIQA 2D0HA 5HYSB 2BJMH 2HMIC 5MHSD 1AYRA 2P3YA 1Q9WB 2DOCA 2UV3A 3B6SB 1FZOB 4TRPL 1T2XA 4MQSB 1MH5A 1COBA 1YPZB 5JQIB 2A0LD 5DJ6B 2F7QA 4FNTA 5E1HB 3RWJB 5H2BA 4M7ZB 1V3JA 2QQNH 4Z3GA 2ZIDA 3K74B 4UOZA 4L1SA 4N2EA 2VZSA 2BSBA 1IVTA 1EA9C 4PW3A 4Y4HA 3T0DA 1EHLL 3EW3B 5FFLA 3CZFA 5BRZA 3SODB 3UPCA 2GTWA 1T5KA 5I0DA 4EDXB 1IJNA 2YUZA 3F6JA 4HFUH 5I82A 1KBBA 5CLTA 3N06B 5L6YL 1H0DB 3LVEA 4MA1B 4PJ7B 3UAJA 2XKSA 3PAZA 5HHME 4ONHA 1HE8A 1OK0A 3VJ6A 1M4KA 1QYGL 3WIFB 3X2QB 1E4HA 4PRIE 5LCVA 1UD2A 4MAZA 4H0IA 4YSDA 3UPAA 3AS1A 2Y5TA 1BQSA 1WZKA 2VDPH 1WQVT 3O6LL 2HFEB 2ZSVB 3OG6B 2NDFA 4OSUL 3MRBB 1KFGA 1UWYA 1E90A 1LDPH 4M8VA 2OMXB 4YNYA 3ETBF 2D3JA 4U6XB 2XN2A 5AAPA 1E5YA 3RVUD 5F1OB 4NRYB 2WN3A 2EEAA 2G5RA 4G1EA 4LRNH 5FCUL 5JW4N 1XCXA 3RY6C 4PJ5E 4X5LA 3FQRB 1NIAA 3SZ6A 3BZEA 1CIDA 2BNQD 1DANT 5E7BA 3LIZA 4YE4H 4V33A 5SWSB 5A3IC 3EG9B 1X5ZA 3DOSA 4NQCA 5ACLA 1XZWA 2ZX5A 4GS7C 3RWJA 2QQKL 1U91B 1U8MA 2QSTA 5KSAD 2DD8H 4AITA 2PCFB 1YG9A 1U92A 5DJ2B 4JHUA 1MFBH 3K80A 3RWHA 4EI5C 3ZHLA 4PJ7E 5MERA 1NM9A 1RUKL 5CEZL 2WQXA 3LNIA 2PYFA 5EO9A 2P24B 4MYWB 5CF3A 5E6IA 3GBEA 5C0BD 1TJGH 5TJWK 3BQUB 3CIQA 2X0WA 3KPTA 1ZSHA 2WMPB 4X7TB 2R8SH 1QFWH 4P5MA 5DK2A 4QAWA 4CN6A 3TIDB 3D39A 2DKUA 2P8MA 3FQUB 3VH8A 3RB7A 4GO8A 4LE8A 4B0MM 1CZ8H 3P2DA 2PCFA 1VEMA 2JIXD 3BH8A 4KQ3L 5DJ2A 5GGVL 2CO7B 5IM7B 5L7XL 4QTFA 5JXAH 1ES0A 3Q05A 4RQQA 2VIRB 5KJRL 5G4OA 1EBAA 3FUIA 2BVTA 3QUMB 1F3RB 1EEYB 3FB7A 5DWPA 4CL7A 3ILPA 4NCDA 5IB2B 1BF5A 3A6BL 4LLVB 1SEQL 2ZKHL 3Q2CA 3KM2A 1I8AA 4QKXB 4NHCH 2P8MB 4P48A 3C09B 5A2AA 5ACZB 1HKLH 4S1SL 3P9MB 1YNTF 4JRYA 1OGTB 4JDEA 1TITA 5HHXL 2WOBA 1RPKA 4N0FB 4AENA 3GZKA 6CGTA 1MLBA 1A9EB 3E1F1 5DVOA 4UI2A 1OAQL 2YXWA 5AYUH 2NYYD 1SUJA 3NIDF 1XGRA 4I87A 3OZKA 5KN5A 4EUPB 5C8JA 1S3RA 1ZA6B 3VWKC 3RWHB 1KCVL 1GYAA 1OAZH 4XMLL 4KHTH 4IIQB 3QUXD 4MA1C 1IQDB 2D9QB 2OXGB 3QCUH 4QRRE 2YRPA 5IVXB 2R69H 4QOKD 4YXKL 1I1CA 3QPKA 3LPGA 5T1MB 2RALA 3CC5B 3FB8B 4FKKA 1G7LA 5C07A 5T3ZE 1AOZA 2CR6A 4PY7B 3WKMH 3BHBA 4FQJL 4FQQB 4OIBA 4IRJB 1WTGT 5GGTA 1E9OB 4TQ8A 1ZV5A 3IYLW 2HTKD 2RQEA 3D25B 1E2WA 3HB3C 1ASQA 1AXSB 4IS6B 3EFOB 4EN3A 5LDUA 4LL4A 4Q9RL 4P4KD 4GBXD 1YVLA 3WXVL 3Q5YA 1A7BA 1HZLA 3K2UL 4FI7A 5F9WB 1JFQL 4JFOB 1QHPA 5LG6A 3KW8A 1V54B 1XMEB 3MFGB 5AVQB 1KULA 4EO5A 4K73A 1U8LA 1VGEH 5EIIB 4LBEA 3NYKA 3BAXA 1AHWA 4XE0A 4HIIB 4Z7QB 1N68A 2B0SL 5ABAA 2PO6C 3SDCC 2P49B 5L2KD 4K7PX 3Q01A 4KK9D 2BRRH 1H8LA 5CIPA 1XD0A 5SWSE 1OT4A 1A3LL 3BD3A 4DQAA 1NINA 3EOYG 2WQVA 3MBED 2E9IA 1SLUA 3MLRL 4GRWB 4NKMA 3MRRB 1AJ7H 2VSCA 1ET5A 3RHWF 1S78D 1XF5B 2QKIC 4XTRD 3WO4B 1ZT4B 1Z5YD 2JLLA 3GUFA 4HQQH 1CE6B 4NT6B 5IEHB 3T77A 3A6CH 4JQXA 5FF6B 1UM6H 3WJMA 5A3ID 4S11A 3AU1A 1FRGL 3H4FA 1A8ZA 4GXVL 3RQ3A 1KLFB 2RA1A 4XI5C 4XMKL 2WN2A 2GBVA 5LGJB 4Q52A 3HB3B 1VZIA 4L4TD 3ZO9A 4P2RE 2OI9C 1NGPL 4JKNA 2F8XC 4LP5A 4F9PA 4MDIA 2EDOA 3IDJB 4WK2B 3F7PC 3QNYA 1EJ8A 3ZTJG 5E56A 4D0DB 2P52A 2Z4QB 4WWKC 1EXHA 4AV4A 3CSBA 3SYQA 1AR2A 3QZWB 4GUPB 4JX0A 1GGYA 4GAGL 3QDJB 4YGAB 5AAMA 1F6FB 5I73C 1DL7L 3UAAA 5D1XE 1Q1PA 2R0LH 1IGTB 5FUOL 1CURA 3C6EA 1A3QA 2VABB 4JLRB 2R56L 3BN9C 4AMWA 1UA3A 4ESKA 1GCYA 4ANXA 3WIIH 1YA5A 2CO1A 2X2UA 3HS0C 4IKIA 4PVLA 3K0WA 3QA3A 4Q9QL 3ELQA 1I1YA 4LBAA 3MMEA 2YC1A 3OX8B 2HG0A 4WHDA 3I02B 4Y5VB 1S7WA 1WFJA 3NZ8A 4HHAA 1I1AB 2L3BA 4I8DA 1V3LA 2JFCA 5CZKA 3KS0H 1F56A 1WCBA 1XTMA 4JB9L 5C2BL 5JQ6L 3K8LA 1ML0A 4P2OA 1NC4A 5DJXA 1YUKB 1L0QA 2PPEA 2MCG1 2Z8RA 3UOAB 4K8RH 3QQ3A 3GUTA 5KG9B 1W72L 2HSIA 3GTVA 4MA8H 5I0ZA 1UT2A 2Z7YA 4LLMA 2GW5A 1E8YA 3BP5A 3ULVL 1T22B 1F8TL 4OZIE 4OD2B 4OF3A 4A67A 4IBZA 4W9KC 5J9PA 4JM4H 5AKRA 4FMKA 2OTPA 3CPLA 3FRPB 1TTRA 1JWUB 2IAMD 4FLQA 3S36L 3O6FA 1V3KA 3DTDA 3FB6B 2JCCA 4B27A 3F8UB 2JKWA 2YPVL 4LSPH 3O6KL 5CFHA 2FUQA 4Y2DD 2EC8A 3RA7L 5ELIA 3BAEH 2H3XC 1F4XH 3MI6A 4APXB 2I9LA 4M6ML 4PRID 2W07A 3HBGA 4ZUWB 4JFDD 2DWTA 3DX1A 3H0TA 2PXYD 4KO9A 4ZFOB 3WNOA 1K4DA 2B15A 1IAOA 3GWJA 2EXSA 3AQDA 2ZF9A 2CLVB 4IGBD 4X0KB 4MMZB 2VT0A 1WA0X 4OD3L 5JPNB 3WTTA 3V0VB 2DQGH 3F7VA 4KKCC 1VEPA 4PHXA 4Z5RA 1KB5A 1GHFL 3HFFA 1QNZL 4Y2DA 3G9VA 5D7KD 5D7EA 1G94A 2UY6B 5EH1A 1D5MB 4LARL 1GY1A 1P9MA 2YD0A 1IRAY 2FH8A 4Z77A 1NBVL 3MJ8A 5ISZE 1SOXA 4I77H 1JWSB 3L1OH 3CDGB 2V2WB 4ICXA 4MQXD 4N0CC 4NKDA 2EEDA 5IFJB 3QDMD 3MLYH 1JYVA 3HC0B 1SOKA 1INEH 5IV2B 1NEUA 4PI0A 3OVUB 2I9TB 2XU9A 3BKCL 4I1RA 4KZEH 4I0PC 5DHVH 3IGLA 4MAYA 3Q2NA 3RWIA 3SDAC 4WI3A 3PPSA 2PWDA 2YGNA 1CTMA 2MNUA 5EFIA 2PCXA 5DMYA 4QRTB 2EE3A 2A9BA 2G2PA 5EF0A 4JM2A 4PJBA 1FWXA 5B7FA 3RGVC 2H6OA 1F90L 2V7NB 4OCWL 1JWUA 4I1NB 4NO0B 1LEKB 5GS1B 4Y5XA 5CNHA 2JJVA 2XWJB 4Q6IA 3HE7C 3RNQB 1R47A 4AQEA 4NJ9L 1E9PA 5AKSA 1OAXH 1X5YA 3L5WB 3WIHL 1JGEB 1QI3A 4WWPA 2V9QA 3GMNA 3RVWC 1ETB1 3D2TA 2HWZL 1JGVL 2XI9A 2ZUXA 2VUYA 1A6UL 3C08H 2G3ZA 2I7OA 5KTEH 4U6TA 1M7DA 2CK2A 4TUOA 1S7TA 3WHXB 1H5BB 4HU8A 3NRQA 3QRGH 1TF4A 1XV8A 3LDBC 1WC7B 2A83B 1G1YA 5DD3L 1OB1B 2P44B 1D9KD 2UX7A 4G8FA 5EUOA 3WNJA 4FQ1H 1U2YA 3FSZA 4FNLL 2VLRD 1QPXA 3QJTB 1HOCB 4CN1A 3H9SE 1LO3L 3V4UH 3RNQA 2CPCA 2ZOTA 4LKCA 1U8JB 5CJXA 5DJZB 5E4EB 1KIRA 3GTNA 3S3JA 3ZL2A 2Y36H 1T6BX 3JTTA 2Q3AA 4HWEL 3ROOA 4KJWC 3GPSA 1EAPA 3DIFA 2YMXL 3IDGA 3TEWA 3Q6GH 3D3VB 5F70A 1ETZB 2R29H 5B38G 5I66A 3DIVA 4Z1PA 2GCYA 4NO2A 4HKBB 4ZAKB 2EUVA 2UYLA 1H3XA 5EUOB 2DQIH 1DE4B 1J0JA 1NPNA 2P5WA 2VWEC 2X87A 1FN4A 4ORZC 5IR1B 3E9UA 3OKLB 2OMYA 4P9ML 3P4MA 2BXYA 4P46B 2ZCLH 4HUXB 4JGMA 2YAPA 2NSQA 2AJXH 1Y6KR 4OF8A 2XXMB 3B2VH 3H2WA 4FQXC 3ARWA 4E41B 1H3GA 4FTDA 4JBSA 2IOIA 3N85L 4F57L 1AJ7L 3FU6A 2DEWX 5DZPA 1G7MA 1AKJB 2FRGP 4G7VH 3KCWA 2YK1L 1JS4A 2B1OA 2P1YA 3RPBA 2CD0A 4JY5H 1PNDA 5C07D 2UZXB 3US9A 1KN4L 3R1GH 5HHQB 3GJFB 1Q72L 4JJ5B 4HK3J 1W9XA 3LKRB 4HWZB 4N90D 3H4HA 5DEGA 5GRWA 5E4EC 1GZPA 2UVEA 1IEAA 1TEYA 3PP3H 2YQ2A 2ALWA 5KVEE 5AYUL 3GSNL 4I2XA 5JIHA 1TTUA 3RWGA 1T0PB 2I7SA 4ONGH 1LP9A 1RQ5A 1AO7A 1SRDA 4XXWC 3BXNB 2A6JB 2WWMD 1XCQA 3C9NA 3D85D 3WFZA 3H1ZA 5JMRA 4U6VH 1WPCA 1DQJB 2I9TA 5JOEA 3ETBJ 4NYLB 2G60H 3E1ZA 1SXBA 3U79A 3PDOA 1JZIA 1OP4A 2DQFA 3JWNC 2HPOA 1D5BA 1CXLA 3AT9A 1MLCB 3H9SD 3KPOA 1D5XB 3QQ4A 3NIGB 5I8KH 4PBDA 2OZ4A 2MQ3A 3JWOH 3SKJL 1T80A 1R0AH 4IEFB 3BUIA 2YN5A 3A5VA 1SJHA 3L9RB 4FA7B 2FEJA 5A40E 4AM0A 1QFOA 4FA8A 1HC1A 1KDJA 2WLIA 4N0UA 4F3FB 4RNRA 2L0DA 5C7XL 1N64L 5AVUB 4L4JA 2AZUA 4DZ8A 3RGVD 5FC9A 4P99A 9PCYA 2R15A 4PJDA 1KCUH 3DX0A 4DNLA 4APQD 1GSKA 2X4NA 3QWQB 2BDNL 5FYLL 3ZL1A 5FGBA 3KYMA 4Y19D 4H8WC 1NKOA 1WF5A 5CHNA 3VB9A 4N6RA 5EO0A 4RSVA 3QUML 4NZUL 4FQJH 3DECA 4U31A 2BFVL 3E38A 4KJPD 1LE5B 5C08D 1NFAA 1DLFH 1NMBL 1T1XA 2V5MA 3UTTB 5KYNA 1JVKA 3UZEC 3OM3B 1HL8A 4M6OH 5J9PB 2FJHA 3KVQA 1OZUA 1KYAA 3T3MB 3ZZ1A 3A4FA 2V2WA 2NXZB 1G7IB 2JKJA 2V7HB 3KPLA 3QHFL 1HSBA 3TM6A 1AQDB 5CMAB 4OZGE 2B59A 3WEBA 2CCVA 2IXQA 1DQVA 1BXVA 3AROA 2EH7L 3H9SB 3NG5A 5BUGA 2G9HB 3RGBA 1MCOH 4PFEA 1ACYH 3NGBC 4H26B 2ATPB 4OCYH 5CLWA 2YA2A 3KBPA 1LEIB 3EH5B 2FIRT 1OWRM 4YHNA 1I7UB 3NIFB 2VQTA 4KH9A 1T5XB 1NOAA 4WW1B 4KTGA 5AENA 2IANA 4A7SA 2VJXA 3Q3GA 3PJSB 4OQ1A 1UG9A 4NC0B 4ZOCA 2EICA 2X4OB 4BIKA 4BCZA 4KOBA 2HH0H 2B77A 3ECBB 5ADOH 4JZOA 3APDA 3CHOA 5E6SB 3DXAA 1BFVL 5DJ0A 5IW3A 1QSEB 3IFLH 1Q9LB 1LWRA 4A6YB 1QQDB 3R06B 4G59C 4I9XA 4KDTC 4QNPF 4N25A 4AZ8B 3O45A 5CGTA 3TBWB 1JNJA 4NN5B 2Z6FA 3IT8D 1KYUA 4TUUA 2GUYA 2FR4B 1AQHA 4WFEE 2AJSL 4ZOAA 2A6IB 4F2FA 2H8PB 1V7NH 3DKHA 3GSNA 1GZQA 4EVNA 4RGND 5IQOA 2XWBA 2AHIA 1U91A 1JWMA 4HT1L 5FK9A 5CSBA 4CVUA 3HC4L 4K2UH 1D5RA 3U7WL 2GJ6A 3PJSA 1VACA 5C2BH 4J5VA 5KOVC 4CBPA 3DX7A 2CSPA 2A5UA 2R23A 1BPVA 2EYRB 4YSQA 2D7MA 3DUSB 1AZUA 3GMRA 2VW6A 3C75A 2UZYB 1SEBB 3F7YA 1HE7A 4BZYA 4KK8D 2Q87A 1NCOA 3ES6B 4HUMB 4ODVL 1E9QA 5BOZG 1O7VA 1T2QH 3DVNA 4OLXH 4UB0L 2VITA 2PCPB 4Q56A 2FO4B 2K6ZA 2CG9X 3T08A 2V2TB 1XF2B 2X7LB 1E0OB 4DVBA 4NQVA 1J1OH 1IEBA 3AM8C 1BZ9B 2VN5A 3I9GL 2W88A 1PD0A 3X14B 3KPLB 4AK1A 1TFHA 4ZI8A 4AVIA 5D1ZI 1YNTB 2NY2C 4E68A 5JXEC 2R69L 3IDMB 4F1ZA 4S0HA 3QNXB 3VI4F 4BH8A 3HPJA 4JO2L 3CVHL 3QUYB 1H0DA 4LVNC 1UWXH 4PJ7A 4PJXA 2B5IC 5L8JB 4JAMA 2FUTA 3JVGA 2EDMA 3KPRA 2R29L 1QI4A 3WDHA 4WNJA 1ZK5A 4YN3A 1OAKH 1WHOA 4KRLB 1UB5A 3OF6D 4H8VA 4R5TA 2BVQA 4A2LA 1R46A 1E5ZA 1GKOA 1SBBA 4LQ1A 4WO4D 1HJBC 3TNNB 1HIML 2QPDB 3OZ9L 4NQVB 4ERSL 1QUNB 3BVUA 3F2LA 1RLBA 4Z7NB 2NLJB 3P9MA 1NL0H 4DAGL 4J39A 3O4LA 4OKDA 4I18A 3V6ZB 3VFRB 3OKKB 4U1HA 4UNUA 1FFRA 2IWKA 4DFHA 4YUEL 5F7DB 3MMEB 1JDDA 4KKPA 3BH8B 4KQ0A 1LE9A 1FH2A 4XAWH 3MNZB 4N20A 3UPRA 1CL7I 3VTMA 1M9SA 3ILPB 1FGNL 1LK3L 2OR8A 2XWTB 1XDTT 3DRTB 1IM9D 3CDYA 5CP3A 1LM8V 2A0LC 5JLZA 4RZKA 2WIIB 1RUPL 3F5WB 1QLRA 4Q58C 1N26A 4UV7L 5FXCH 4CADB 4H5SB 3D09A 3C5JB 3ZDXE 4YSCA 1BSIA 5L4JA 3TBBA 4LOFA 1SQ2N 5I8CA 1A6ZA 1FFQA 3RWFA 5JO5B 4KROC 5GJTL 3HS9A 2B5IB 3MJ9A 3NESA 4BCYA 4NQQA 4KZDL 2WLJA 4GFTB 3RDTB 1UWGH 1QP1A 1RMFL 3OLDA 3LEYH 3S7GA 1NDMA 4KMLB 3T0VA 3WUZA 2H0FA 3M86A 4YXHL 4DHLA 4I5BA 2P8PB 5EO9B 2ZYIA 5HVGB 4M4RB 1HILA 2ZQKA 3DX2A 4U1IA 2YKLL 2EDWA 5IVXA 2ARJB 2I5YH 4QHNA 2WKLA 3L4YA 5LAPA 5TQ2L 4FADA 2AQ2A 3L7FA 4HCFA 4ACPA 3NA9H 4HUCA 4H25A 4H88H 2PWFA 3ISRA 3CUPB 4MX7B 2YOCA 1IL1B 2XN9A 2YOAA 3MR9B 3VD1A 4DGYL 1OLZA 1RK1A 4UBDD 1HHJA 4NZRH 4XMVA 5TDNA 3UJTH 3BDXA 4X6EB 1JNNH 5AOKA 1F4HA 4OB5L 4IEFA 3O6LH 1SMDA 4K3JL 4DP7X 2I60H 1QO3A 3VFWA 4LIQH 5I16B 4XBMA 3Q0HA 3VXUD 4CUCA 2A99A 3MRHB 1NWPA 1VFUA 3IJ9A 4HK3N 3QEHB 4HUWA 2NY0D 1B4LA 4L3EE 4PJFA 4WY7L 4NAMA 5T5FL 3GM0A 3LRLA 1MQKH 1G1CA 1K3IA 4HOXA 5ITBH 4QLRA 1IAIL 5C0EA 1QLRB 4KO5A 1BHGA 4GKSA 1WZMA 3EG9A 1R6VA 4KKQA 1L9MA 4OGYL 3MACH 1RLWA 1NBYB 2NRDA 1HH6B 4J3OH 1SVCP 2FATH 3Q8CA 2VAAA 4FQQA 3SZKC 2Y1ZA 1FFOA 3VGFA 4MDJB 3WJLA 2VJ0A 2WWOA 1O7SA 3WN5A 4PREA 4YHOH 3CHPA 2WINA 3TIEA 1FC1A 1XF3A 1KXTA 2QT6A 1BMGA 3O3DB 4YNYB 2OSLB 4M62L 4YSSA 2H6PA 3NDZE 5CP3H 3PNRB 3WKQA 3MKKA 1VERA 3B9KA 1OAUH 3K91A 4NKIL 4JMNA 2IMMA 1NCDL 1J5OH 4D0CA 3BUBA 4Q74A 5DCCA 3EFFB 2FYVA 2MHAB 4ORGA 5I1EL 2OMZB 3ARFC 1R1CA 1ORQB 1QACA 4QT5A 1NGXB 3SBPA 1M7XA 4AIXA 4WWID 3T3PB 2V0AA 4KVNL 5TDOB 2J72A 2NY6C 1CLOL 4J3OF 3H9YA 2NXYB 4Z7UE 1EMTL 4KKLC 3SIKA 3S2AA 4LCUA 3WY4A 3QQDB 1FYTB 4X7CC 3BVWA 3ZPDA 2J6WA 2W94A 4Q0XL 5IHZA 3TA3A 3VFGL 2DQHH 2O6CA 4ANKA 3RVXC 1R19A 1OSYA 3FQXA 2YGQA 2AKRA 5I1IH 2P8LA 5E6UB 2AEWA 7CGTA 1CZ8L 1KT2A 5E9DA 5AZ2L 3KLHC 2UUDK 3NOIA 3RL2A 5K59F 1B9KA 5F9OH 3LKPA 3QI9B 4LDOB 2XV6B 1EZVY 3BWSA 2ZXEB 4HV8A 5C0RH 1MW1A 2GITA 3DJSA 1ZT1A 2DRUA 2JCCE 2Y7MA 3PY9A 2YRBA 1SXAA 3ZRCC 4RFOH 4KY1L 1WJ3A 1QTSA 2XQYA 3GMPB 5AWNH 3OPZL 3HZMA 1FAIH 3MAWA 3SDXB 5D6CB 2P24A 4XP4L 5E2UH 3F6LA 3NJIA 2IH8A 5JORB 2HX9A 5JA8B 1SMAA 1HK6A 4OQTL 4MCYA 1TCMA 1WICA 1ZE3C 1JZJA 2ILLA 2XRAH 4UUJB 4OW6A 5E9NA 5FW7A 3QUKB 1B88A 2RD0A 4HKXA 4UZGA 3KWUA 2F1BA 3AG4B 4QF1B 2A38A 1PZUB 5IVNA 2DWDB 5HHMB 1MWAA 1X7TA 3RDTC 2HUEA 3LZLA 1HNYA 3ZR5A 2YAOA 3SPVA 1G9NH 4QOKE 3QFJD 1TOXA 1QNIA 3WAKA 5HPMB 1XBDA 1CF8L 2X4SA 1DBBL 5HDQL 2JWYA 4LASL 1A6TA 4LDEB 4QXTA 3GBNL 5T1KD 4DETA 5AD0B 4B5ZA 3VXUA 4C4BA 3QGVA 2VR7A 5IBUB 2UWEB 2IGTA 4GMSH 4YXLH 5BCAA 2JKTM 1AXTH 3QIWB 5PCYA 4U2ZA 3S5YA 3P3YA 4HK0B 4MJ6B 3D3VE 4E42B 1BVNP 4OFQA 5GGQL 5BJTB 1RUML 4XPAL 4L1HA 2CHNA 3P4NB 5LGHH 4LOEA 1L9RA 3VI3F 2C1PB 4ATTA 4F57H 1EH9A 3GSVB 3KPQB 4ZTOL 3ISWA 1B6UA 1TQBC 2BSEA 4FNSA 2E9BA 1KELH 3KEHA 3WKML 4UCFA 3S48A 4XWOD 2Z7ZA 3QI9A 3TV3L 1V8HA 3T4AB 1P6WA 2F7IA 3ZGIA 3C6LD 4GKNA 4LLWB 3SCMB 3ZYIA 4F80A 4BFKA 2F8OA 4X83A 4KXBA 3RHWK 3TJHD 4AM0Q 5KVFH 3V4PH 2BOBA 2UX6A 1NMAL 1T83C 2P47B 4FXGB 3CN3A 1DQQA 1RUAL 4MZRA 3VA6A 1HT6A 4U3HA 4J2XA 1BX2A 3CU1A 5EO0B 5ALCH 5CAYB 4NCC2 1A8JH 1IM3B 2HCZX 1U8OA 3VXMD 1NLBH 1RU9H 3HZKB 3GIVA 4FOMA 4Y4HD 2VLKD 3THMH 3N40F 1ASPA 3T8VA 4KKCD 5AKVA 1GL4B 3L95B 1ZHBA 1D6EB 2O6FA 4QUOA 2J73A 1F90H 4CAGA 5C70A 2NUPB 1H5BA 3ZHNA 1MVUA 5LBSL 2H0EA 1MJ8H 4JRXE 3N42B 2IH3A 1N0LB 3V0WH 2VO5A 2X4UA 1Y7VA 1XF5A 2NY7L 1P5VA 1YMME 1L9PA 2WO3B 5TGBB 4Z5RB 1DQIA 5TF1H 2TSBA 3VXRD 1NAMH 4AJYV 4HKXB 4FLHA 3LIZH 2O72A 2DY2A 4KZEL 4DKAA 1ZANH 1QEWB 1SFHA 4X8JA 4BZ1A 1RV6X 2FJFA 4K4KA 4GUQA 2QGEA 1Q90A 4UM8A 5E9DD 4BGDA 4RDQG 2VDMH 2Z8WC 4IRZL 1SMOA 1GGIL 4FQIL 1K3ZA 2NW2B 2FIKA 2N01B 3NJVA 2ORBH 3BSGA 1JBJA 4OJEH 1MCWW 2E27H 2ZT9C 1VFOA 2WTPA 3IDGB 5F88A 1QBAA 4LT7A 4G7YH 2YEZA 3HC3H 2WQUA 5D72H 5LLIC 2G5BB 5HHQA 2ZWKA 1TQCB 2BOBB 4YX2H 1E6OL 4L18A 1A3RL 3AS2A 3KYKH 4OD2A 2IJ0C 2R59A 5JHMA 3KLHD 1FZKA 3S5ZA 1J7VR 1XF1A 3QULB 3B2XA 2QQLL 3II2A 4PVMA 3RVTD 1W72A 4AH2A 4TVUA 15C8H 2QADD 2QR0B 1J9TA 3GIVB 4QRRB 4YDVA 5JNYA 3ZUCA 5CLZA 4P2OB 3AY4A 2R2BA 1YECH 1RURH 3AAZA 4DCQA 3NCEB 4GW4A 4DPAX 4OZIF 3B7SA 5AVXB 4G83A 2ZXDA 1RK0B 5HHNA 5TE7H 5FUZH 3D5OF 4HJ0D 4KXZI 4XX1E 4I88A 1ZWIA 1F8TH 4LOUD 4D2NA 4DGIL 2HB0A 5DD1H 4OLYL 2JJSC 3NPZB 5DVNA 4PS8A 3QXAA 1UHVA 4P2QD 5TGBA 4KK5D 4XP4H 5E2UL 1X7SA 2GEEA 2Y1VA 3BIKB 5DK2B 2L7QA 5IT2H 4ODXA 4O02H 4PB0H 1SJEA 2BNQA 4GO9A 4UT7L 1KPUA 4UWQB 2NY7H 4JPIA 2VXUL 3O6FB 1K85A 1SHXA 4Y7OC 5IBLD 2VRAA 2CGRH 3G6JF 2WANA 3EZJB 3MRJB 4G9DA 3HRZA 5I6NA 2VN6A 2VDOB 3AWEA 2OYKA 3EOTL 3G6JB 2X70A 3RX8A 3V7AG 2DKMA 2W9DL 4Z7QE 3EYFB 2QVMA 4ZW6A 1JPGB 4D8OA 2CDEA 2R0ZL 2FT6A 1BDYA 3MBEC 4QRSA 1UOKA 3UTQB 3DC0A 4QDGA 3VFMB 3NZHL 1EERB 1OCWL 1RURL 5ABDE 2WVVA 4X4XB 2GIYA 1IAIM 5J6HA 2YD8A 2OYLA 2ITEA 1SJXA 3D30A 2BW4A 3IFPB 4R0LA 5KSUB 3NIFF 2QGCA 1XX9C 4IRJA 5AB1A 3P0VH 2YBGA 1QLFA 2VN7A 2FBOJ 2A6DB 4Q2ZB 1F5WA 4H20H 4ODVH 1Z1WA 1E9PB 4YSPA 3TJHC 1P4IH 2HTLD 4ZUVB 4GIPD 4HFWA 1KC5H 1WE5A 2Q9OA 1RVFL 1UOWA 3FUJA 4QRUA 2Z31B 4YDNA 1MWOA 5GIRA 2AVFA 5ADPH 5D1XB 4UNIA 4UT9H 5F3BB 5BS0D 2BHYA 3PWNA 2ZOKA 3V4PA 2EVGA 2RIKA 4NN6B 1DO6A 3AQZA 1C08B 3T2LA 4BCXA 1ADQA 3ILDA 2HT2D 3ARTA 3ETSA 3MNDA 4OZFG 3PAVA 4IKNA 4ZS6D 1U8HB 4LLAA 1YC7A 4J3TA 1DBML 2DQGL 4P3DA 3ECUA 3CDZB 4LF3A 2OQJA 3MJ6A 4OLZL 2Y5TB 2Y69B 4MB3A 4MMYA 5CEZH 3VI4A 2AABL 3ZZQA 3KBEA 5GGQH 1C12B 1MCBA 3CVDA 4S2SA 5GRVL 4AXWB 1G4MA 4MDRA 4R4BA 4HIEB 4FNLH 2HT4D 4HS8H 4FXTA 2BZCA 2UUDH 5DJYA 4UAOB 2MFNA 5EOCL 4BH7A 3BEWA 1NEZB 1K6QL 2QDWA 1OHQA 2XA8L 4GSDH 4HUUA 3SDDA 1M7IA 1F3DH 4W6XB 1A3ZA 4XN5A 4ZPVA 1O0VA 5F6IC 2DTMH 5CEXA 4ADJA 1DUYB 2C3HA 4HXAH 4FXKB 3BAYA 3O3BA 3V6OA 3X3GL 1T66C 3GT6A 2FO8A 2ZNWA 3KWWB 1KG0A 1SOSA 1UB6B 3H9ZA 1HAWA 2BS71 3IDYB 1BOGB 2GVYA 1WDAA 3QCVL 4BZ1H 4C54A 2VR4A 3I6LE 3CFKA 3H42L 5FA3B 1E27B 1FSKB 3CZNA 1ACYL 5CJ8A 1PIGA 3R7RA 1XGZA 3HAEG 3DGCR 2B1AL 3ZQWA 1RL1A 2GSIA 1JE6A 3QDMA 4YBHA 2F19L 3TJPA 3IE9A 1FNSL 3RB5A 5KTEL 3ZTEA 2HT4C 2VXQA 2XQBL 3L3GA 5DSCA 2ETWA 1GZHC 3MGTB 7PCYA 3IJEB 4R7LA 2NSMA 2F5BH 3CVBA 4GG6E 3NDYE 5D5ME 1RVFH 4ELMA 1Z9OA 1AAJA 3WFEH 2IDFA 3PFQA 1LTXA 3VXMB 1VPOL 3O3AA 4BWWA 5L6YH 2GJJA 4ZSOE 4L48A 3V0IA 1MI5D 3T2OA 4EKJA 2O61B 2Q2EB 1CLVA 4XHJC 3BVNB 2JKIS 4JL2A 1E28B 4TNFA 1JV2B 1ZV2A 4J23A 2R23B 5CJQL 2Y7SA 2JJTA 1NBYA 4QHUB 1OOAA 2X89D 4HIXL 4RQQB 4Z95L 1QTPA 5LBGA 3VA2C 1NJ9B 3PIQA 3GGWA 4AGQA 1EHAA 5IB4A 3QZLA 2AJYH 4X80L 5DS8B 3UTPD 4Z3JA 2OV0A 3D07A 3T6ZA 2CDFA 2DJUA 2V37A 4WEUD 3PP4H 3CVHB 4E0RA 1K72A 5L9DL 3MOAL 5CM1A 2LFGA 4FGMA 4P5MB 4WI0B 3QCTL 4HXBH 4ZODA 3ZE2B 2D7QA 5H94B 2G5UA 5DHXB 4WU5B 1KCBA 3Q6FA 1V7NL 1CG9A 3Q1SH 4ZBJA 3FSWA 4XPGL 3KDMB 1H6UA 2FX7H 5CJOL 1MAJA 2JVUA 4XZ4A 4O5LH 4N2CA 1O6SA 5FO8A 4PJXE 1VRSA 3WTWA 1EJOH 4WHYG 1Z3GL 3O0LA 2L7JA 3IBOA 4DOHB 5DDHA 4XO9A 2QPSA 4M6AA 3OD3A 3DHPA 2I60L 2AXGA 4AYDC 3EUDA 4MCZB 1EWHA 1LO4H 1MHPL 5I6PA 3ATBA 4HDIA 3BEVA 4BWUA 5FOBB 3W39A 5HGBB 3WFCL 2WQWA 3B9AA 2XSKA 5BRQA 1ZHLA 5K9JL 3FYEB 1QRKA 15C8L 3BHBB 4PV8B 3O9WA 2FT7A 2CRMA 3UBXA 4QXWA 1X9UA 3KVDD 1H8NA 5DJYB 4BH7B 3ULVF 1JHTA 4NBXB 1A4AA 2BP0B 2EO1A 3JV4B 3QO0B 4MNQD 1SYSA 1N6UA 4AM0B 4LGRB 4XN4A 3IDMA 5AVWB 1OTTD 3L3GB 3MRFA 4RFNC 5DSCB 3IGAB 3CFNA 3WXWH 4M7ZC 1Z0MA 5HDWA 4LFHG 4JUTA 2XYBA 5I17A 2D03L 2BVPB 2W9LA 2AV7B 1IBYA 3N2JA 4JDTL 1IC7H 1U95B 3ZHKA 3N1MC 3BVXA 2BWQA 2RCSH 5C09B 4X4ZA 3IKCA 4XNQA 3CFKB 2IWGA 4KXCA 3D0VA 5IREA 1PJ9A 4YGVB 5BZZA 3AW5A 4UILH 3K3QA 4R97B 4WEBL 3WTYA 1T1XB 2HG5A 1W6WA 4N9GA 2QHRL 1A7OL 1CU4H 3JV4A 4OFIA 1L3NA 4PU2A 5E0FA 3DIDA 4AYEC 1R5WA 3BDBA 3WSQL 2WBJB 2ICWJ 1BAFL 1E5CA 5HSFA 4J28A 4JZJB 3W11C 3ZYJA 3O8XA 1DVXA 2HMID 1ZVSB 1DEDA 2CNZA 2HVBA 2JF1A 3CN1A 4M6NH 4NC1C 4EI0A 3G3LA 1U8NA 3LEYL 4APQA 1XR9B 1UD8A 1WBXA 4FQCH 3VTAA 4NQDE 4NZDA 5ECGA 5EO1A 3VU1A 1BF2A 4WRLA 5DDHB 4LVHC 1ZRUA 5EBWB 4AGLA 4DK3A 1BQHB 2BWIA 4ES8A 2H3NA 4P5TC 3D0VB 1Q0XH 3GZQA 1L7TH 5I1AB 2PABA 1WAAA 4YH6A 1CLCA 5ECJE 3QYCA 1MI5A 1I7UA 1JN6A 2N3JA 3NH7L 1QR4A 1NGWA 4F58H 1TPXC 3DURB 4KJYB 1NKGA 1KCRH 2E3VA 1G7QA 4FXLA 1FYHB 4FFWC 2A1WL 4LP4A 5D1XD 5BVJA 1RZJH 3ROLB 4GEJA 1ZVYA 2X4OA 1N5YH 3FPYA 3MJGX 2F7PA 2QSCH 3Q8EA 1IO4C 1YPZE 4J8RA 2EIBA 2Z31A 4I0CC 4Y16D 4QRFA 3N43F 5C09E 5B1JA 1A7PH 4NPYA 1G1KA 3UO8B 2A9NL 5KVGH 5E8NA 4MJID 5F7EH 5F3FA 1F1AA 1QRNB 2ISDA 2BH0A 5DS2A 2M8XA 5IWLA 2IPUG 4X6CB 4A55A 5ID1A 5KSBE 3O2DL 1B2WH 1LEIA 1J12A 4G2AA 3TU6A 3TH4T 4WNSA 4B9JA 3W1ZA 3HE6D 1NC2A 3TVMC 4AKPA 1I3RA 3KL3A 1IE5A 3UO1H 1R5VB 1N8ZA 3QQNA 1JWMB 1MELA 5H8DA 1CD9B 2HVKB 4PM1A 2PR4H 3PPEA 4WW1A 5LQBL 2EIZA 3OLEA 4Y1AA 3MO1A 4YHMH 2VOTA 4EF3A 5IROD 4ZMXA 2YR3A 3L95A 4LVHB 5HJBA 3ZE2E 3BWAB 4B7IA 1K8IB 2H1PL 2WO2B 3FTUA 1WTLA 4ODSH 4UQDA 2NNFA 5D7KE 5HJDA 5T3ZH 1M71A 2AANA 2W1NA 3F83A 2IDUA 2AQPA 3GO1H 5C7ZA 5EULV 1B9ZA 3QXDB 3RVVC 4A2DA 4ELMB 5FM5M 3PWPD 1BVKA 5L2KE 1BV8A 1HDMB 2UVFA 3MROA 1N8OE 2ZWLT 3DDFA 5CJXC 5JW5A 5IHHA 2B7DT 4ZMZA 1WAAE 3RWCB 2VQUA 3NJLA 2EKJA 4ALAL 5DHYA 4XNAA 4XNUH 4YHIA 2ATKA 1EFXA 5CINH 3RUGF 1IBHA 4N2MA 2X0UA 4YHYC 1GGBL 4JM2F 2B4CH 2CO6B 3FYIB 4A6YH 1J0KA 1UGNA 2WTRB 2AK4A 3MRGA 4PS4H 2WLMA 5AVSB 4E9RA 4WJ5A 4TLUA 4JR9H 5J5EA 3ZQ9A 3ZYOA 1KYDA 1MFUA 5F8QC 1WUZA 2QV4A 3FK3A 3PHQB 4NNYB 4PW9A 3TS8A 2MOGA 2OZ4H 4LOUC 1BQHG 4BQCA 4C83B 3FW6A 5IFHL 1MNUL 3FQNA 3U2SB 4PJHA 5FYLD 1FORH 4Y5XC 2YPKB 3ULVH 3MV8E 5EF3A 3EAKA 1CBJA 2W9DH 1Z3RA 1I85A 5FFGA 1DDTA 3IU3A 2EDXA 4JG1H 4PYHA 4KJWD 1VFAA 2ZCKH 1S9VB 1H8OA 1I1AC 5ETUB 4U1GC 1U21A 4R2GB 5E2VL 3P02A 1NAML 4AMKH 3C9NB 3TX4A 1AKPA 4X6DF 2VERA 1UKSA 1P1ZB 3JV0A 5F1KC 4X5PA 3S3PA 1ZTXH 3CFUA 3SDAA 2ZWZA 4FEIA 5EFIB 1NBQA 3GJEA 3J27A 1K9TA 2BCKB 3QEUB 4IMKC 1VFBA 3WXVH 3EXLA 2B4CL 1DVFB 1PFCA 4A6YL 5IMOA 2AERT 1EJFA 2DQDH 5CZXD 2UXGA 4B9KC 4X5QA 5IB3B 3OKDA 3VD0A 1TQVA 4WTZA 1P9MC 3Q1SL 4Z0XB 1EHKB 3LEVL 1OEZW 1I9IL 1OGPA 3ARBD 3JUZA 1WWWX 5C9JA 1T4KA 1INDH 1EEZA 1P7BA 4L4TE 3FZUD 3S37X 2KS0A 3LKQB 4JDVB 3UTSD 3WEMA 3TEZA 2P26A 3PV6A 2BOCB 1BVKB 4FTVE 4XP6L 4HJEA 3STZA 5CEZE 3S34H 3SPCA 1U42A 2E9GA 5C0CB 1XF4B 3VO0A 3VFPB 3CCHA 4H13C 3ZKXB 1PCSA 3FT4A 2NX5A 5EB9A 5AVTB 5IMOB 3DVIA 4LCWB 1TJMA 4URKA 1IBGH 1FG9C 3PHQA 4QRTA 3CFJA 4U1GB 5DZOA 2HJFB 1YYCA 4PJHE 3SBWC 2GK0A 4W81A 4B6ZA 1KEGL 2F19H 5K33A 4F37F 3O6FC 1HQRB 3TO4C 1DQMH 3C12A 2VDKL 3A4EA 2VLMD 5SX4I 3OAUL 4JFXA 5A2BA 3HVDA 5I1LA 2YPLA 5E70A 3W0WD 4E5XB 3SCMA 3IDUA 3VXTB 4PIRF 4IBWA 2Q6WB 3HG5A 4ZFFB 4KROB 2IH1B 1EXUA 3M6DA 3EFDL 2X6BA 1DBKL 3MV7E 2W5PA 5EG6C 4WWKB 4LHUG 1KPRA 2B3IA 3AADB 4XPBH 1EBPA 1VZHA 4LAQL 5K93A 1FRGH 2DBLL 4GXVH 2QFRA 4OGYH 3W3BA 5DO8A 3WTVA 1IGMH 2W38A 3EO0B 3ZN6A 2MCPL 4DP0X 4RGMB 4Z7OE 3EDEA 3KMDA 3HZVB 4GRLD 4PJ5D 3BZFB 3G6DH 2WINB 4UU9A 3TIEB 1QA9B 3SOBL 4TM9A 2Y6SC 3HPLB 1PLGL 3HS0A 4K3HA 4WY7H 5DYOB 4ELKB 5GS2H 2HRPH 3GKZA 5IQ9A 3T5WA 1J5IA 4FQCL 4FXGC 4DO6A 3ROOB 4JRXA 3BP6A 4KUZL 1EAPB 3OC8A 1O9ZA 3FQXB 3CFBB 4HXBL 3VRLF 1QBML 2D8KA 3MLUH 2IDSA 4D9RD 4UIMA 1B0IA 4UOW1 5BQ7B 2G2NA 5DJDB 1I9JH 1ASOA 5FKAB 5H4YA 4ZYKA 3O0RL 4CMMA 5LNEA 1ACXA 3BP4A 3SE8H 4LLQB 4RZCB 3IDNB 3EFDH 1ZT7A 3TA4D 2NNRA 4KVNH 4R5VA 4O5LL 3S97C 2RAMA 3MQIA 4HJSA 3KZ8A 1GS6X 1LNUB 4QWWD 4K3DL 3W0WB 2EVIA 4XNBA 4U7KA 2WP3T 2LQRA 5F8RC 2MQCA 4WAFA 4GW1B 3N9GH 2W0FB 3WNPA 4OGAC 4POYA 1W0VB 4IBVA 3NCWA 4NN7B 1IC5H 2QKIA 1MJ7L 2I32A 5JQHC 4LCWA 1YAZA 1X5FA 3FAXA 5E1GA 5KYYA 1IX2A 4Z3FA 3B8SA 3GIZH 3H53A 4J3SA 3EF4A 3WS6C 1IB5A 5E6YA 3WY2A 2XACC 1R9FA 4XPTH 4D0BB 5C0AE 4JFPB 4HJUA 5JPNC 1FG2A 4DTGL 3U4BL 4RWHA 2AQRA 2VH5L 1QW9A 4G6KH 4YAQB 2A6JA 5H35B 4X4YA 2QPFA 4L0ZA 4YLCA 3RL1B 4UM9B 2OTUA 4PB9H 1U30A 2VDPL 1XGPA 2D4DA 3F04A 3ARBB 1HQ4B 3PV7A 5KVFE 4TVPL 1CDIA 4D9QE 4BFRA 3ZRFC 4NI6A 4CU8A 2NNCA 4ZUTA 1H19A 1WEJH 4XXDB 1FGVH 2A7BA 1TZGH 4NQED 4PG2A 4N8VG 1AO7E 5TE7L 1UQSA 1AD0A 2OP4L 2ZCHL 1QASA 4WFFE 5LAXB 3CXDL 3NK3A 3ZBMA 3DO4A 4IMLA 1BVLB 1HX0A 2B16A 2R4SH 4KKLD 3MUGB 1PKOA 4LOVA 3V95A 3ZQXA 1QFUH 2B2XH 3LZFL 2J6EH 1JFQH 3VD7A 4N2HA 1CDUA 1OALA 1UA6H 1IAIH 5DTFA 3GMQA 4DESA 3UAJD 3H42H 1KJVA 4UYPA 5L2JB 4UDTA 5KVFL 1ZLSL 3U6XS 4ODWB 4JG0H 1KBGL 4Z7AA 1HHKB 4MNGE 4U1KA 2DEYX 4PCKA 5EOTA 2I26N 1WO2A 5C07B 4ZSOB 1F02I 1MCDA 2Z34A 3QXTA 1FNGB 4G1MB 1IBGL 2OMTB 5D7LE 4MVBC 2PTUA 4OLXL 1G6RH 3SPVB 3VI3E 1VPOH 2R7EA 3ZMNA 4MQTB 3GSOB 4F1SA 3ULUD 4PJFB 2YWZA 3UACA 2E4FA 2ZUYA 2V9RA 2VABA 4JLRA 4OCRH 4KXAA 3VWJA 2HZHA 2BVPA 4FNUA 1HZKA 1T1YB 1OHZA 2GJPA 4H8WH 1YEGL 4IIZA 5HHOE 4FNQA 3RWDB 5SWSD 1H8SA 5D2LA 4KKZA 5GS0D 2NMSA 1NCBH 3EGSB 5J6GA 1NCCH 5DT1L 3SPIA 1E5AA 2HFTA 4OIFA 3ASWA 3PHOA 5BPPA 7FABH 1YJDC 4B41A 3GMRB 1M05A 2F54A 4NN5C 3QFGA 1FLTX 3CLWA 3WY3A 3S6CA 2VDLL 3X11A 4LEOB 2JTDA 4R6UA 5CIPB 1S8DB 4MKTA 4G70B 2DW5A 1X9QA 2XFXB 3QI9D 3QIBC 2ZG3A 4NN6C 3ZTNH 3NIDE 3Q6GL 1LDPL 1RSFA 4FFVC 4HH9A 4O51A 4WCYH 3DWTA 2CDGB 4XN2A 5E6IC 5KSBF 5ADOL 4B0MB 5E8DH 1NOLA 2QSVA 3LH2H 4NT6A 2A77H 5C0ND 1ADQL 4L9LB 3UGEA 4LCYB 4K71C 4ODWA 3LRGA 1DP0A 3BVNA 2WLKA 2BHZA 3OJVC 3R1GL 3U9PH 4NO3B 3GLZA 3IETA 4F7KA 5K1NA 4HEPG 4EOWL 3M17A 1FVEB 1MIEH 2HX8A 2J3SA 1JI1A 3DPDA 3UTTE 4FTVD 5I9QB 4MXQD 3QNXA 5AUMB 4BH8B 1CK0L 1KFAH 5KAQF 2FD6L 3Q5TA 2OMTA 2Y25A 5TPWL 2D4FA 3ARGD 4NKDB 4JPQA 1BQLL 4LPVA 3BAWA 1P7HL 3KYNB 4NN7C 4NZRL 5HHOB 3GEWB 3CVHA 1JVLA 2D7TH 2R1YA 4E0RB 4ILDA 4RDQF 5E08L 1CU4L 4U1KB 3SEPA 1QFPA 4WV1A 4ZK8A 4JY5L 4YZFE 2N59A 3HG1A 5AW7B 5I5IA 5IMMB 4JM0A 3KW7A 2CA4A 1ZVNA 3LIUA 2AJUH 3A67L 5D2LF 3F6IA 5I1HL 4NQDD 4Z7UF 5I71C 4U1HB 4OAWA 4UMGA 5D2LB 4W9HC 3ME0A 2CXKA 3QR0A 2ERJC 3HR6A 3TGXA 3P2BA 4F7TB 5D7HA 1FUNA 1I8UA 3D18B 1QFHA 2ZX7A 4Q8BA 5KBNC 1G6RA 4QRRA 5KN5B 4WUKL 3I3BA 2XICA 4F7PB 5IWLC 3B3IB 2C9AA 1Y18A 3HFMH 4GRWH 3UERA 3NCBB 2VM4A 1E65A 3K2IA 1OQOA 3TCTA 2G60L 3QIBD 4HG4J 5KBPA 2HAZA 5DC2A 5L4MA 5FYLE 3GRGA 3TT1H 4PYGA 1PYWA 4XMXA 1P84J 1X5GA 3GM8A 1SEQH 2X3AA 3B56A 4TUJA 3TBVA 3WTSA 2PTTB 3QIUD 5I18H 3Q6FB 5E8DL 1E28A 3MRJA 4G9DB 3QB7C 3A6CL 4UQAA 1EV2E 3EJRA 2DL9A 4O02L 4PB0L 5ES4B 2ZCHH 1X44A 2OP4H 5DGRA 1YEKH 3X3FL 1ROWA 4X8XA 4Z7QF 1GOFA 5GIRB 2YXVA 1DEEB 1V05A 3F01A 5F1SA 4DK6A 5F3BA 4W6WB 1NEZG 3L16A 2GUOB 3QH3A 2ESVB 4F92B 3LQAC 1E8XA 3IFOA 1KJ3L 3L7FB 4V11A 1BXAA 1XR8A 2O26U 3N40P 4OIIL 3WJJA 2R8SL 4NOBA 3G7TA 4N1HB 1D7DA 2Z7UA 4JZJC 4GSQA 4PVBA 2C5DC 4G8GB 1MFEH 3MREB 5E8PB 4Z7OF 4TULL 4EI6A 3LS5L 1JD7A 5AW4B 4X4XA 5J6HB 1JGUH 4QHUA 1NCTA 2OA9A 2PYEB 2JQZA 3C87A 3JWNE 4XN7A 5EOCJ 3D69A 3VSVA 4OZFB 3SGJC 5C0BE 3C5XA 1GJIA 3BKML 4J27A 5I15L 1MZZA 5JUEH 4IOSD 1G6RL 2P42B 3WS3A 1CGWA 1MCOL 2ZKWA 4HS6B 4X5XB 1ND0B 1WT5C 3UO1L 1RU9L 4N22A 3KGSA 3HHRB 3OKNB 4OZGF 5AEAA 3QEGH 1OSPL 3CAFA 4JB9H 2AQSA 3LDBB 3MREA 5E8PA 2AXGB 4Z7WA 5L8KB 1NCHA 2O5XH 2UZXA 3AS0A 3O4LD 4B97A 4DP4X 2EE0A 4JKKA 4WWNA 1HHGB 4NQDA 3QHFH 1VDGA 4CRPA 3UTOA 1MZYA 3WBDA 1AC0A 2VCOA 1EHNA 1QLFB 5EF1A 3ERXA 4DSYA 3WFBH 1WRFA 1UZGA 3KPNB 3QDJD 5ACMA 2JB6A 3VFOB 1N6QH 2ZKYA 5AVVB 3FN0L 3FTWA 1RIHL 1E4JA 3V4VH 3VG9B 1BWMA 1TZIA 4XNYH 4Y2NA 1S7UB 1ND0A 4B95C 5CEXB 4QHKJ 1XCTA 2LTQB 1I8KB 1MUJA 2ZOKB 3IMWA 3UGUA 2APSA 3V5DB 4Q97A