2P47B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 2.5a resolution: se5b-tri crystal form with five se-met sites (l4m, m34, m51, f68m, m83) in vhh scaffold.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
QVQMVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRMTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ribonuclease pancreatic
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
source organism Camelus dromedarius
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p47B00
4CU6A 4UUJA 4WTZG 1NBZA 2YD8A 4R2GB 3QA3B 4FQCL 5JZ7C 3IRPX 4EIZC 3QH3A 4LCUB 3K2MC 1BEYL 4R4BB 4KKCC 3QQ4B 4DVRH 2ILLA 3L5WB 1O0VA 1JPFB 1W0WB 4IDJL 2X4UA 3HMXL 3AAZA 4R2GC 5DLMH 3BKYL 3RZCB 1TZHB 1JZ2A 2NY6B 5EO9B 5IESH 3MFFA 4L4TA 1FLRH 4JFFE 1FE8L 5HVHB 3LN9A 1K8IB 3RZCC 1T0NA 2NY6C 5JHLH 4ODUA 4HLJA 1J0ZA 3TM6A 2Y7QA 2GJ6A 1NCBH 1XR9B 3QPXL 3U0WL 3F58H 3CVIH 3QUMA 4LLMB 2Z35B 5CSBA 1JGEB 5HVHC 5CJBA 4PD4K 5EUOE 5GRYA 3FRUB 1Q1JL 1RJYB 1AR1D 4YBQD 3KGRA 4MB4A 1KEMH 2Y07L 4P48A 4I18A 2H26B 3MRDA 2V9TA 1VKXB 1N8ZA 5J0BA 4L5FL 3VD4A 3GGWA 4P4KB 3H3BC 4ZPTA 5GGRB 4MJ6A 3D85A 4HBCL 5JR1L 2MSPA 4JO1L 3GMOB 5ICYA 3UPAA 2O5YL 4YDVA 1U58A 2DQGH 4HW6A 3WHE0 1WZKA 4ONHA 2FX8L 1N0XL 4P4KC 4NQDA 4JFHD 1JGUL 3Q6FB 4LFHG 4HXBL 4E0RA 1I8MB 3W9EA 2XTJE 3PJSB 5CJ8A 4BSWB 4EI5A 2XN9A 1BZ7B 4S10A 5I2IB 3BP4A 5FOBB 4QRPE 2K3TA 2G9HB 3T2PA 4KTDL 1EXUB 4BSVA 1HSBB 5ILTH 1FVCB 2H32A 4O02L 1OAKL 3G6AA 3W2DL 4X5XA 4WW2F 5DK3A 4BH8A 2AJ3B 1MIEL 2E7MA 4HX1B 4QRQA 3RA7H 5HI3D 1HHGA 1T2XA 2AJXH 4OZGF 1OP5H 5DJYA 4P57B 1YQVH 1K3IA 5EH1A 5C6TH 2X89D 5C9KA 1T66D 1Y6KR 2NY7H 1S9WB 1V7NH 5BZWA 1BQHB 2FEDD 4NQEB 1J8HA 4H25A 2P8LB 4XP4L 2AEQL 3JBG7 4F7PA 4M7KH 1CG9A 4LPYA 4HSQA 3G9VA 1BPVA 1BZ9A 1IEBB 3CFBA 4XPGL 4NHUB 1C08A 4NJAH 5IWLC 3QIUA 5ACZA 4UDTB 1EVUA 1KGCE 4MAUH 4QNPE 4U6TA 5GRVK 5IFHH 3H3PH 3IDMA 3SO3B 1NL0H 2JB5L 3T0ED 3DX8A 3I6KA 4PV9A 5C0DB 4G8FA 4QY8B 3QDGE 4WFGD 4ZUWA 3P4OB 3GNML 3R8QA 2W60A 4XNYL 3O3DA 1N6VA 5I0DA 4HUVA 4RFNB 4WIQA 3SO3C 1CGUA 1RIHH 2DWEB 2DLEA 5LWYL 3UBXA 2P24B 1X4ZA 3QPQD 3QUMH 2FX9L 4P3DB 3O4LE 1J05B 4FA8A 5C6WH 2EZ0D 1A9BA 1K6QH 4RFNC 2PO6D 3S3JA 3STLA 2VNCA 3PDDA 5F96H 5D1ZA 5C0BE 1OWWA 3JWDL 4LSUL 5BQ7A 4OKVA 4LVHB 4S1QL 4O00A 3RGVA 4L3CA 4OFKA 3Q5TA 2O93L 4M1CC 3F7YB 1U8OA 3UO1H 1CQYA 1U8KA 5C9JB 3NCJH 5KVEL 3G5ZA 2YEZA 4NC1C 1HXYB 1NCNA 1P7KA 2W0LA 3S88H 1P6FA 2DMKA 3L3KA 1S9XB 4YFDB 5T1LA 1JGLH 4OIAA 1YDPB 2HWZH 4PJDE 1JYXA 4FTVE 4LLDB 4O2CB 4QOKD 3GMPA 5L8LB 2IALA 1KBGL 3TNNA 3B5TA 3WO4B 4Q2ZA 1BQSA 3RDTD 3PXJA 1JYWA 2IH3B 4KJWC 2LU7A 4ELMA 5K33A 3OZ9H 3LMJH 4KAQL 4PY8I 2BMKB 4NO3B 3FB6A 4KKBC 4NUJB 3WO4C 4XCFH 4D9LL 4Q7DA 4CU8A 5CJOL 1MCSA 2XRAL 4PJEF 4JFYA 2VLLA 3BDXA 2EIBA 4N9GA 3FZUD 4HWZA 1SVZA 3UDWA 1MCHA 5DD6B 2VXQH 1T3FA 4LQFL 2GEEA 2UY7A 4GXUN 4N0UE 5D4QA 5H35B 2FL5B 2CRIA 1PEZA 3GSQA 2OMNA 1X3DA 5CWSB 1QKZH 4DN4L 3NCEB 4HZLA 5E70A 3VXSE 5I1CL 1J1OH 5FO7B 5C71A 4PRDA 5IB5A 4E41A 3VD3A 4M5ZH 3MJGX 1NDGB 4Y19E 4YPJA 3VXRD 1JGVH 2OX5A 3PHQA 5GQBA 1U8IB 2CIIA 4RNRA 3U4BH 2Q7NA 1V8HA 4A6YA 3RWHA 1LDSA 1VHPA 4NNYA 3AGVA 2ARJA 1LO0L 1ORSA 4XP9L 4ODWB 2IAMB 1HIML 3RWDA 2JJSC 1A6AB 4HZAA 1ZHNA 4W68A 1J9CT 3ZKMC 2VXUL 2GHWB 1E27A 3A6CH 2MHAB 2IAMC 4D0DA 2Y6SD 1C7SA 1DEDA 1FNHA 4PJAE 4M6NL 4S2SB 3PV7A 3KPQB 1KPRA 1FBIL 4UT6H 2LVEA 4LASL 5AG9A 2YD3A 1AGDA 3JWOC 4WV1A 4NQXA 4NHCL 2XA8H 1U0QA 2NR6C 3MGOB 3WSQH 3I02A 3OGCB 5JHDB 1TJIH 3L7EB 2B0SH 1MFCL 2YD5A 1NUDA 1IAKA 1A6PA 4MS8D 1UWXK 4S1DC 5ID1B 4PGBA 4PJBB 2Q3AA 4YIQB 1TJHL 4B7IA 4L4TE 1MCQA 4K94H 1MQKH 3L3DB 4JO3L 4ZOBA 4I77L 4AZ8A 4K3JL 4PBVC 3HUJF 4RAUB 4J1UA 4YWGL 3MOAH 1A02N 3CK0L 1OCWL 1RHHB 4X7SH 2JIXD 3LQAL 4KGLA 1KLUA 4Z7UB 2GJ6E 1AFVH 3LKOA 4MNQD 2GY7B 3LEVL 4UTAH 1A4JB 5DGRA 2W0PA 3QEQB 5E2TL 1T21B 3MGTB 2FO4B 1YNTB 2WBJD 3DVIA 5E8DH 3G5XB 2LQRA 1MY5A 3OGOE 3BZ4A 2FBJH 1LO4L 1X5XA 1FLTX 4G80A 4WI7A 3K1DA 3VXNA 1IE5A 5DO2C 5KW9L 3PIQA 1TTFA 2OL3L 3QI9D 1EH9A 1H3GA 2VDKH 5DVMA 4M1DH 1SJHA 4LOUC 4QO1A 4KZEL 3OQ3B 2X9YA 4XVSH 4WWKD 4XC3L 3HB3C 5DMIL 4A6YH 2GT9B 4Z7VE 2V2XB 1B4JL 1YEDA 2F53E 3MRGA 1BMGA 2C3VA 4NZTL 2CJUL 2IADB 4HKJA 4XHJC 3RY5A 4UINL 4ERSL 4PYGA 2V7NB 5D96B 3IXTB 5TGBB 5GZND 1DUZB 4QTHB 4H0IA 3RY6A 1QTYT 1FRGL 4QRRA 1KJMA 5LAXA 1HSAB 1PJ9A 2ADIA 5D96C 1ZT7B 4ALAH 3HPLB 5IIEA 1FORL 1I3UA 4E42B 2NY2B 1TCRA 3PGCA 2C1OB 1L4IA 1B88A 2Q1EA 2XZCH 5L7XL 4PTTB 5FYJH 3LPGA 3NCBB 5DJ2A 2ZG3A 1J8HE 3L3OA 1JZ3A 2NY2C 4XWGH 1LO5A 3C5SA 5DMYA 3HE7D 2OR9L 1R3IH 1NBQA 1TVBA 4P59H 1HYRC 3BN3B 1J1XL 4FXGA 5IQ9A 5HHQB 1EHLL 1Q72L 3V6FB 5GGTL 1U92A 3L7FB 1G6RH 2XZQL 2NY1D 4FZ8L 1NGPL 1EHAA 2DQDL 1B3JA 4P46B 5AUMB 4E5XB 3DYOA 1N64H 4BK5A 4O9HL 1YC8A 2C7UA 2YOCA 3SGKC 1GHFH 4ONGL 4ZDHA 1CXHA 5C09D 1NC4B 2ZOKB 4P46C 2ZCKH 1AKJA 1LK3H 4IRZH 1A1MB 1J10A 5B8CB 3DUUA 4PJIE 1KCUL 1XGQB 1PEWA 3EGSA 4PRBB 2O5XH 1T4KA 4HS8H 5GXBB 1KJ3H 5B8CC 3RPIB 1PG7W 4RFOL 2AGJL 2VDML 2P5WE 4W6XB 3VFOB 2FBOJ 2O5ZH 3OB8A 5B3JE 2VABA 3ES6A 4LAJH 3TIEA 1XGPA 3I84A 1WV7T 1PKQB 2CDEA 4KDTC 1DBMH 4W4NA 2YXFA 2ZUSA 4OZ4B 4KXZH 4LCWB 2BNUA 5EOQL 3V79C 2VDPL 1EAPA 5LJYH 2DD8H 3TZVB 4ZD3H 3WDIA 2RR3A 5E6YA 3ABZA 3W82A 1UB5B 2QHRL 2YR3A 1CFQA 1RZKL 43C9A 2FZ3A 4Z0BH 1AI1H 3GMQA 3TZVC 1LVEA 4I2XE 2EC9U 3HG1D 3D25A 4PIRF 4QF1A 3L3IB 3T3MF 1D5IL 4WO4D 1RZJH 1EPFA 1X6NA 2X4NA 3WKML 4K9EL 4F58H 1NGYA 1A7OH 3ARYA 1BJMA 4ELME 5MEPA 3UTQB 5DC4B 2QR0B 1CGYA 1RIUL 5J12B 3P9MA 1HNFA 4FFVD 5D7IE 3HNSH 3HZVB 2VDLH 2P48B 1G0XA 4NO2B 3MV11 5FHAH 3FQTB 1JI1A 2ZSWA 3T77A 3UTSB 3PQYB 5J12C 3VXPB 3SGJA 4EN3A 3AREA 3SKUD 3UPRB 1GGTA 3H0TB 4GMTL 1MCOH 3QDJA 5E8EA 1KT2A 2R2EA 1TPXB 3LKNA 3MRCB 1U91B 3W9DB 4H26A 5KSVA 1SMAA 1E4WL 3IJSA 1EUTA 4L8BA 2PYED 3P77B 4DFIA 1M7IA 4E41E 1JCKA 1TPXC 4XHQA 5F7EL 4GG6F 3FQUA 4ZYKB 4MQTB 1R3LB 3E6FA 3K0WA 2HH0H 4LFHD 2NQCA 1QBLL 1VFMA 4ZOEA 5DQDL 4PGDA 3MFGB 1DEEB 4PLOB 4PJ7F 1DBBH 3GRWA 1T1YB 3RNKB 1VADA 5C07D 5HHOA 4MAYA 1IGCL 3P4NB 3F6IA 1UEMA 4YR6A 1D9KD 3U7YH 3MNVB 2UZIH 2MPAL 3DX7A 3EO9H 3AVEA 1SVCP 2HT3C 2G5BB 1HEZA 1DN0B 5KAQG 1YYLL 4M9OA 1RURL 2DDQL 3RFZC 3D2UD 5JLZA 2P7TB 1RUKH 4U1GB 4HIIA 4BZ2L 1JI2A 2X4PB 1IARB 5DUBB 5FYJE 4OZGB 2GSGA 5D7LD 2HTLD 1FN4A 2BOCB 4U1GC 5HVGB 2WUBL 1I8LA 3M07A 4I3SH 4NDMA 1YYMH 3EOAB 3O11B 2UYLB 3HKFA 2X1WL 1JZ4A 4GOSA 1RMFH 2EIZB 1YEHH 4U6YA 4WI8A 1AE6L 4LRNH 1PKOA 4I0KA 1AO7D 1WBXA 3ILQC 4J4PA 1P53A 2GY5A 1UFUA 4P5TA 4IRSB 5E08L 5HJ3A 2MCPH 1BGXL 1OWRM 3MODL 3X17A 2ADGA 4JZNB 1DVFC 4V1DB 4ZUTB 3I85A 5EZJB 3EAKA 1JPGB 2B4CL 2I9TA 4IRSC 3MGAA 4NIKB 4RRPA 1XFPA 1GXEA 1I3GH 1RSFA 5EC1B 2IFFL 4WY7L 4W70A 2MQCA 4LSVH 1KTLB 1NCDL 4WFHD 2VN4A 3W11D 4CVXA 5HGAB 1D7FA 2AQ2A 4PJFA 8FABA 1SHMA 3ORJA 1T2JA 2XPGB 5I18H 4NRXB 2CO7B 1BOGA 5BVPH 3QUYC 5SV3A 2R2HB 1ORQA 3KPRA 3ARDB 1N59A 5LBSL 3V0WL 1EX0A 1A2YA 2NW2B 3ESVF 5GGQL 5I8EB 1QVOA 1NGWA 5E00A 1FNAA 4N0FB 2DM2A 2OTWB 3ARDC 1N2RB 3T3PF 3QZWA 4Y5VA 1GZQA 1Q9OB 3MRIB 5DJ8A 3BGAA 1MHEA 4P5MB 3L3JA 3CFDA 3C6LA 4IMKA 5HDOA 1SBSH 4LCYA 5I17B 3QUKB 2R1WB 5IEHB 2ENSA 2BY1A 4LGSB 3BD5A 4OLWH 5I1DB 2NY0B 2FD6H 4ZAKB 2VR9A 3IDXL 1IMHC 3T65A 1BX2B 1KIQA 3SKMA 2A9NH 3S96A 1Q9LA 5CMAA 4DTGH 3ARXA 1FC1A 2Y72A 4NKMA 4URTB 2QKIA 3QXWA 1CFNA 4NC2B 4AM0A 5I1JL 2NY0C 1WFNA 4ZAKC 1U8QA 3CSYB 1YEGH 5KS9A 3DUHA 3HZMB 3VGHA 3GSVB 4JLRA 2DLHA 5HYQA 4HWBL 2W9DH 5JXED 4U6XA 5BS0B 3B3IB 1F4HA 2OK0L 4RGND 5M7QA 5C2BL 4PJEB 4CVZA 3QDMD 2XG5A 4MHHG 4JZOA 5L8KB 4PS4H 4DVRL 4XZUA 5C0AD 2YC1A 2YPVH 3QBTB 3ULSA 4MD4B 5E9DB 5A3IC 1VFBB 2BK8A 5DLML 5J3HD 4X5WA 4QCIA 5IESL 1L9NA 3RKDD 1FLRL 1A1NB 2Z31D 4R7DA 5J1AB 2OBGA 5I1EH 3ULUC 3X3GH 1INDH 4GRWH 5JHLL 4PYHA 1MFEH 4ZODA 5DR5H 3AU1B 1NCBL 3VDCA 3ZKSD 3F58L 3CVIL 4G8GB 3TN0B 1F8TH 3V0VA 2P47B 3WNPA 1YEFH 5EIIA 1X5ZA 3EYFB 4WW1B 5FXCH 1G7PB 3SEPA 1KEML 4MCZB 3BEWB 4HGWA 1OP5K 2AXJA 4GAJH 2N56A 4G6MH 3TN0C 3IDJB 4UV4H 3PABA 4NO0B 3RWGB 2PYFB 5GIRB 1CXFA 1PAMA 2F5BL 2GCYB 1TXKA 4NZRH 1BQLH 5JA9A 1UM5H 1S7TB 5L2JB 2BNQA 4KJQC 3TO4A 3MBED 1A7RH 3I75B 2DQGL 2C3HA 5ANMB 2VQTA 3F7QA 2B1HL 4P23B 1JNJA 1F3RB 2D3VA 4MCYB 3T1FA 5IFJB 1T80A 2QLVB 3SCMD 5KJRH 4UAOC 5F21B 3FQNB 1P69B 2R0ZH 4ZPVB 2W91A 3WE6A 3QNZA 1R3HA 2VE6B 4P23C 2FDBP 4JPWH 4FFYH 3S4SG 4OCRH 1Y18B 4MYWB 5ILTL 4ZFOB 3C5ZB 1DLHA 3HLAA 2GTZB 3U36B 2VQUA 3OKLB 2EXWD 5IM7A 3A67H 5EIVA 4BKLB 3FTGB 2A6IA 2DIAA 4NKOA 4F2MA 2VDOH 3D0VB 3RA7L 3MSPA 2Z0BA 4JFDD 4KJYA 2AJXL 5DFVC 3C5ZC 3OXSB 1FFQA 1YQVL 4A2MA 5C6TL 3BT2H 5L88H 4PG9A 4WJ5A 1OGAA 5EBMB 2L4OA 2NY7L 5CIPH 4LEOA 4Y1AB 5TDNA 1ZGLM 1AIFB 1V7NL 4AT6A 2R8SH 3WHXA 1UXWB 5INDB 2Y23A 3DETD 4M7KL 4KRLB 1ONQB 1U8PB 5CBEA 3TFKC 2VLJB 3HTLX 4NJAL 1OTTD 3MUJA 1JVKA 3QFDA 1HXMA 4MAUL 2JB6A 5IFHL 5HHMD 3QQNA 2EYRA 3QFJE 4P2QB 3T0AA 4H0GA 2YZ8A 3OKYA 5LGKA 4HC1H 1NL0L 2X89A 1RK1A 5C0ND 5D5MF 4M6MH 4XI5C 3IETB 5LGJA 2CLZB 1TNNA 4QRUA 1J7VR 3CFJB 1N6QH 1RIHL 2VXSH 4MQ7A 3ARPA 2GW5A 2I07B 2DQJH 7FABL 5HGHA 3QUML 4HEPG 1WZ1H 2HT2C 3KPMA 3O3EB 4LMQI 1IQDB 1VENA 1K6QL 4XPFH 3GMRA 5HDBF 5F70A 5KG9A 4IBLT 1PVHA 3LQZB 1CK0H 5D1XD 2J88L 3ZTNH 4C54A 4B5EA 1IC4H 5F96L 3T0EA 3FB8A 3ZYZA 2FIRT 1EVTC 2VAJA 3QCVL 4U1HB 3V7AG 3RJQB 3VGDA 2AXGB 2HJFA 4I13B 5C0GB 4HIJB 1VEOA 3PWUA 2A38A 3KYNA 1W72H 4JKWA 4XT1C 3UO1L 3TVMD 3NCJL 2R9HC 1KPVB 5TE7H 1KENH 1YY9C 3WN5B 4QHNB 3S88L 1NDMA 4XAWH 1E28A 2P8MB 1A3QA 5IVXA 1WICA 1JGLL 4FQJH 4BA8A 1QLRB 3QRFM 1PX3A 1JHLH 2HWZL 3WN5C 1XF4B 3C2SA 4MGXA 4YXHH 2M8XA 1EAJA 2OJEA 3HZKB 4N68A 3RBSA 1JHTB 2XQYG 5INCA 5DHVA 2JCCA 1HE7A 4XNQA 2E5EA 3WJLA 4GRLB 4GRWE 2GQHA 3OZ9L 1FL3B 2BNRA 2Z8VC 2J6EH 3UTZA 4XCFL 1M6OB 4GRLC 1INQA 2HJKB 4LBEB 4OGAD 1OQOA 4FNLH 4Y16D 4PJFE 5EU4B 4F7CB 2NTFB 5CD5C 2CUIA 4QOKA 3RI5K 3R1GH 1KOAA 3CSPA 2VXQL 4H1LG 5C0EB 1PGRB 3CDGB 1I1AB 2YD2A 2BSTB 2X4RA 4DZBA 4Y4KD 4BQ6A 3RDTA 5D7KE 4RZCA 4CJ0A 5IG7B 1CGXA 1QKZL 3NIDF 5SWSD 2EC8A 2J8UF 1I1AC 4HKZA 5DRWA 2GSIB 3GBMH 3TYFB 1YPZF 1J1OL 1HILB 3P0VH 3O8XD 4M5ZL 2X70B 4ZFFA 3TP4A 1JGVL 1U8NB 1YN7A 2H6PA 3DMMB 3U4BL 3MV9D 1CL7I 3ME0A 2N4IA 1DE4A 4OFDA 4R96B 1MPAH 4ZQKB 2OTPA 4HG4J 2VQ1A 3KHOA 3MLTB 1KG0B 4WGVB 5E7FA 4DFHA 2X4TB 3DMMC 4MSWB 4AENB 5B21A 1C16B 2XV6B 3QP3A 3DI2B 3OAYK 5I15H 3A6CL 3SDCD 4XWOC 4XP5H 1UM4H 2HFFA 4I4WA 5AAMA 4LLQA 5HYJD 5CEXA 5ESQB 4UT6L 2H2PD 4PPTA 2BP3A 1MH5B 3WUWA 4F57H 2X4OB 4QRTA 5EUOF 4M4RA 2XA8L 4UT9H 1X4YA 4PG2A 1QO3A 3WSQL 4QHKI 2NY3D 1TJIL 2B0SL 1RZGB 1HQRA 2RJMA 2AABL 1G1YA 5AEAA 5HYSA 2VZUA 1ZGLP 3CPLB 3CSBA 2VC2H 4K94L 3S3PA 4CVWA 1MQKL 1P7QD 1QP1A 2CDGB 4DAGH 2BVPA 5HHXH 3BW9B 3MOAL 4GG6B 1KXTB 4X7SL 3DO7A 5I1AB 3B6SB 2OCFD 3F12B 1AFVL 2VL5B 3AS2A 4OI8A 1IAMA 4NO5B 1A14L 4UTAL 1L7TH 1MHHA 3G04B 4HUXB 4PJ7B 3QULB 4AY0A 5FF6A 1F45A 4K8RD 3S4SB 3RWFB 5ID0B 2VZVA 4XX1E 3LEXB 2F8VA 3WKNA 5CZXD 4N8CH 1P4IH 1DP0A 2PTTB 4X9HA 5E8DL 2R0WH 5JMRA 4JFZH 4GBXA 2FBJL 4JZJB 1MREH 2YKLH 4B0MM 5C8JA 2JIXA 4WU7B 2GJJA 3UC0H 3VCLA 3SE4C 1C7TA 3DSNA 3FQXA 4IS6B 4MNQA 1U3ZA 4JZJC 2VDKL 4M1DL 1XCTA 4UTBH 3MJ9A 1FAIH 1PBYA 1N6UA 3MO1B 4XVSL 1BBDH 2GAZB 2WBJA 1DJSA 1I9RH 2RIKA 3MA7B 4ZUSA 4A6YL 4IOSD 4O51A 1XF5B 4L4VB 3CC5A 4YX2H 4I48A 1ZA3A 5F3HA 2FEEI 5F8QC 4X9BA 5FA4A 4CUCA 5EA0H 3GKZA 2Z92A 1R5VA 5CEZD 5EORL 4QNPF 4HK3J 4IRJB 4JFHE 3R06B 3F5WB 3RY4A 1OY3B 1F58H 1J5OH 2VISA 1I1YB 3E1F1 4TULH 3JWDC 1K5NB 4LPVA 1ZLWK 4ALAL 4WWKA 4N1CA 5T1DH 2B39A 2XZCL 5FYJL 4GAGH 4JHWH 1JTOA 1NFDE 3ECBA 5MENB 3GI9H 3Q3GB 3VFVA 3X14A 4PJ9B 5IB1B 1IM9B 3JTTA 3QUZD 1BFOB 1CVSC 1R3IL 4WNQA 5L2KB 2YRZA 3H6JA 1G6RL 3O6KH 4XVJH 4X6DA 4PJ9C 1PYWA 2DQFA 3S5LG 1VPOH 1JJUA 1N64L 1T04A 1WWAX 5ADPH 2A6DA 3D0LA 2GFBB 3L5XL 1IM3B 1TZGH 1GHFL 4Y89A 1A7QL 3UYRH 4OIBA 4GFTB 1BQUA 2ZCKL 1KYOJ 3VFNB 5IEKB 1LK3L 2IBBA 4IRZL 4TNWF 3RL2B 2KQNA 3HAEA 2EE9A 3HE7A 4KK9C 3UJJL 4LLUB 1EHNA 1KEGH 3VFSB 1HH6B 5EU3A 1KB9J 2O5XL 4HS8L 1AD9B 1KJ3L 4P2CG 1Z3GH 4PJDF 1JK8A 4OGYH 4WFGE 1CDGA 2O5ZL 1D6VH 3PDGA 2X1OA 4HS3A 1N5AA 4LF3A 4U1KB 5C09A 2F8OA 1NJ9B 1DBML 1X9QA 4WEBH 3RWJA 4HHAB 1IGFH 1FG9C 3OKEB 3NZ8B 2DD8L 1XF2B 2CK2A 3NFPA 3FHAA 4ZD3L 2C4FT 5H37G 3JTSA 4TSBH 3OHXB 4PB9H 4XNMB 4H1LB 4UNUA 3M8OH 1EO8H 4U6VH 4Z0BL 1AI1L 2FYYA 1XGUA 4M7JH 1I7ZA 4KVNH 3ARBC 1RZJL 3ROOA 2D7PA 1T5WA 4U1JB 4OFIA 3NFNB 3INUH 4FN0A 1NANI 1A7OL 4X8XA 1J88A 3OG4B 3QIBD 4FQIH 1FG2A 4UQ3B 3JSSA 3TIDB 3VFRB 1T89A 2BSRA 3MJ8B 3C5JB 1ZT4B 1IGTB 2D7TH 4ZXBB 3SKOA 3HNSL 3IDUA 4LEXH 4JRYB 1GCFA 2VDLL 2F5AH 4QOKE 2HP4A 5FHAL 1QSEB 5F7DB 4P2RB 3L6FB 3SOBH 2L7JA 1FNFA 3OX8B 4ZXBC 4WO4A 35C8H 3CUPB 5EN2B 3QCTH 2VLKB 4G7YH 1MCOL 2Y36H 3GSWB 5GS3A 1FZMB 3MREB 4MA8H 3AXLB 1WTGT 4UNVA 3MRRB 4HDIA 3CGTA 5ALBH 3MZGB 4U1SA 4LLYB 1ZVSB 1JF5A 4N90E 1JRHI 4PJAF 3HPJA 1U8HA 3BKJH 3KDMA 3EDKA 3IXAA 3O2DH 3DURB 2HH0L 4XCCL 1GIGH 5DMGD 4TUOB 4PLNC 4WUUB 2OM5A 3HAEH 1QFHA 4ODHH 1DBAH 2HFEB 4PGEB 1R24B 1DBBL 5FM5M 4PR5A 3BO8B 1FPTH 1K85A 3QXUA 1KB5A 5IMMA 4MNHB 1MHPH 5L0QB 3QQ9D 3BRFA 1F6FB 4NSKA 3NABH 5FK9B 1CD9B 2YN5A 3U7YL 3L3HB 5JORA 5E4EB 2V7HA 3EO9L 4XBGA 3DV6B 1SJEA 5GHWH 3QR2A 5L0QC 3U0PA 2OL3B 4EJ1C 5T1MA 3VXRE 1I4FA 5E8OA 3S35H 2PTUA 5ICXA 5E4EC 3IVKA 1CBVH 5GRZA 4PY8J 4GUPB 2WINB 5IROA 4N1EA 3RAJH 2PCPB 2VUOA 5C07A 3VI4E 3MV8D 5B4MD 3D39A 4Z7WE 4I3SL 1YYML 1OOAA 1NCCH 4KY1H 2F54B 2WIIA 1RMFL 2AJZA 3WXVH 1QEWB 4CMHC 1QR1B 2NZ9C 4LRNL 2EH8H 3N85H 1WIPA 3D2UA 2NY6D 1CN4A 4LPWA 5BVJB 3MUZ1 6CGTA 2DLTA 3QWOB 2WBWB 5DD3H 4R9HA 4KH2A 1J1PH 2MCPL 5D7LA 3K74B 1AQDA 4XCEB 3WEXA 2YWZA 4EUPA 4G9DB 1YNKH 2BVQB 5GGUB 2EDBA 4HCRH 3MLRH 5SWZB 3HNVH 2AQ1A 5D5MB 1I3GL 1EFXA 1U8LA 1CFSB 5MEOA 4R8WH 4GLRI 1KB9K 5EU6B 3I6LE 1DFBH 4JFOA 4Z7VF 4LSVL 2NMSA 5F88B 1X5LA 1AO7A 5I75B 1PZUB 4G6AD 3OR6A 1UWGL 2XWBB 2M2DA 4UU9B 5I18L 5BVPL 1LNUB 5D7SH 3RVWC 5I75C 4MJIE 3IJYA 4NFDA 5J7CC 2P1YA 2R0LH 5ITFA 1H5BB 5ETUA 1IKNA 3O6LH 3WHE1 3OMZA 3U48A 2ADJB 1SM3H 3CAFA 1CXLA 1U8JB 5T3ZH 5K93A 3WCYA 4G9FA 5D2NB 1I3RB 2W59A 1H5BC 4OFVA 3EO0A 3GFUA 1SBSL 1X7QB 1XCQA 3S5LB 3VH8G 5IF0B 2LFGA 1T0MB 5D2NC 5MEQA 5F9AC 4OLWL 5A16B 2FD6L 3LKRB 4GAYA 2A9NL 5KSAC 4H5SA 2K1MA 2XY2A 4N8VA 5DD0H 4DTGL 1P1ZA 5CKGA 5BRZB 5T5NF 1W8OA 2H3NB 4I9WD 3DIFB 5EPMA 1YEGL 4WDIA 4PJIF 1B2WL 1PD6A 4GW5B 5E24E 4R0LA 2W9DL 2QEJA 4LPTA 4NQED 5JDSA 2I60H 5KANI 4IOIA 4D9QD 1RUMH 5KVGH 3ARFD 1RZKC 4Y0GA 4PJ5E 4QLRA 5F7LB 4NQCD 2C3WA 2X4QB 3CFIC 3RI5F 2J5LB 5I76A 2KZWA 4PS4L 1A3RH 3ARZA 5B3JF 2YPVL 3O81A 4WFFE 4AIXA 1IGJB 3STBA 3CXDL 3GSXA 3JV4B 2RCSH 2J5LC 2J8UB 2I26N 4K07A 4K9EC 3VA2C 1NUNB 1S7SB 1YPZB 3BVNA 5ESVA 4BFEA 5JXEA 5I1EL 3F7RA 5EFIA 3DXAB 3MCKB 3X3GL 1INDL 5IK3A 1MFEL 3FO1A 3ZKNC 5FUCC 1YC7A 4M48H 5C2UB 4HLZG 5TDPA 2A6JA 1BFSA 3BD4A 2VR4A 1OW0A 1F8TL 4MDJA 1G7IB 4ZS7H 2HRLA 1BAFH 3QAZB 5DVOA 1F00I 5F1IB 5I66A 3T08A 5BOZG 4GAJL 3MV7D 1XZ0B 2Z31A 4UV4L 4ELMF 3KPSE 4JHBA 4NZRL 5DURD 3QAZC 1A5FH 3L5JA 1UM5L 4JFFB 5CJ5A 3S35X 5C7XH 3FOLA 2ZNWA 1CLOH 1A7RL 3BUYB 4JQVC 4KRPD 5D7IF 4FG6D 2Z8SA 4G6KH 4GW4B 3KAAA 4ZS6D 3ZO0A 1FDLH 4LLWA 1Z5LA 5KJRL 1FNEB 1EEUA 3OG6B 2R1XB 2R0ZL 4HV8A 2NLJA 4JAMA 4OBSA 3ROLA 4JEGB 5BZDA 4NOBA 4JPWL 5TQ2H 4FFYL 4XH2A 1ZWIA 4OCRL 2AEPH 4Z76B 1A6UH 3TYGH 1JN6B 4MA7H 3L95A 4C83A 3VFPA 3BP6A 3OKOB 1G7LA 3A67L 3DV4B 3RWIB 2VDOL 5IVZA 1R5WB 3GMNB 1KPUB 1NAMH 4JN2B 4POUB 5HGDA 4WI5A 2VKXA 3SCMA 1H8NA 2XWJA 5IBUB 3SDAC 3HG1E 2AV7A 2X10A 1EJOH 3BT2L 2ED7A 5L88L 1Q38A 1JF1B 2FCBA 1B0RA 3KS0H 2APTA 3P40A 4PLKD 2R8SL 4APQB 1LEGA 3LN4B 1BVKA 3LS4H 2AJSH 3BZEB 1I8KB 5E99H 5K9QG 5FYLD 3Q1SH 2XWTB 4JFDA 4APQC 3AFLA 4PJHA 4IHOB 1PZ5B 3QO0B 1S9VA 3TBSB 3W39B 1WFTA 4XAKD 3OKDA 4HC1L 4CAGA 3DO3A 5HYFA 5T3ZE 3IDGA 3RZWA 1JNHA 1CXIA 4M6ML 2WWMD 5GISH 4JKMA 2B4CC 5CHNA 3ZKMD 4JFXA 4Y5XC 3UCRA 1N6QL 2VXSL 3NTCH 2DQJL 4NM4L 1JE6A 1U93B 1WZ1L 3AY4C 1RU9H 2PYEE 5I19H 5JOEA 4QHLA 4XPFL 3ZDYE 5IW6A 5C3LD 3ZYIA 1JWUB 4JO2H 1CK0L 3BYTA 5I74B 3ZTNL 5IKCB 3P4LA 2I25N 3F7VA 3MRJA 5HGBB 1OGTA 1OAZL 1QG3A 2NY4B 4Q58C 5C07E 1S3KH 3TH4T 4WENB 2G75B 3QDGB 4ISVA 5I74C 1MFNA 5T1KA 1W72L 1ODAA 4S1DD 4DKAA 5TE7L 1KENL 4OCMC 5HYEA 3GSNB 3WL9B 4XAWL 4Y4FB 3O4LB 4YDJB 3NCYP 4DZ8A 1EHXA 4FQJL 5D1XA 1JHLL 3QSKB 5C0JA 4YXHL 4Y4FC 5D7LE 1FZJB 1WAAA 4N0CC 5C0BB 3S37H 3E3QE 4KRNA 3TVMA 2XG4A 1HHIA 2EDDA 4UI2A 1M71A 2BOBB 1GJIA 3KPOB 2VUYA 2J6EL 1XF3B 1AO7E 4OCSH 1RY7B 4M43H 5K9OA 3VH8B 4FNLL 4W6WB 3UBXG 3GUTB 3LPFA 3IFPA 2R2BA 4NRZA 4LMQE 3MLVH 1LILA 4U4BA 4JY6A 2NNAB 4PJDB 1CGWA 4WU5B 4KI5C 4MA3A 2Q6WB 4F7TB 3REWA 3GK8L 5CZKA 2VIRB 43CAA 1SYSB 3EFFA 1RK0B 3WXWH 4BJLA 3GBML 3TNMB 4CL7A 3BGMB 2A1WL 2FJFA 4D0CB 3H7LA 3P0VL 3TBVB 4JRXE 4WFHE 1CDUA 2IQAB 4Y16A 1D5ZB 3UTTA 2FO1A 4Y4KA 2VXVH 2I9LB 1OT2A 1MPAL 4N5UA 4PRIA 4N0UB 1LE5B 5CKAA 1K8DA 5SWSA 5BXFB 3BFOA 2AJVH 4P5KB 3BN9D 5IP4A 4U6HA 3WFEH 3DGCR 3VXSB 3FFDA 2NW3B 2NY2D 3O8XA 2WWKO 4AH2B 1FNGA 2LU3A 4XP5L 1UM4L 4LK4A 5IJKC 3JVGC 3DUSA 1F90L 2DMCA 5DHYB 4Y19B 4ETQA 1KSRA 3FT2A 2W65A 3K7UA 4Q6IB 4Q0XL 4F57L 1U6AH 4M8QB 3KYOB 3DPBA 1QYGH 5JIKA 1A4KA 3NCCB 4UT9L 3BH8A 1VFAB 2OP4H 3U2SB 3SDCA 5E8PA 4EOWH 1Q94A 2OSLB 2VB5A 4OD2A 3D9AH 5C0CD 5GS1B 5J11B 2AV1A 2CK0H 1IQWH 2W0FB 4LCWE 4OAWA 4NBZB 4KTYA 5HYJA 1CFTA 2VC2L 4G7VH 1HK6A 2M26A 4DAGL 4Q9QH 2ITCB 3NAAH 5GS1C 5HHXL 5J11C 4PJAB 3PWPD 4ZUVA 2QBWA 1HI6A 3LHPH 3QDME 2R4RH 1YEJH 2OTUB 3BHBB 3QO1A 2A0LC 5FM5O 1L7TL 1NBZB 5C0AE 2MMXA 3QH3B 1KIPB 2HLAB 4NQSB 4MDIB 5DS8A 4LHUD 5EO0A 1MCPH 4X98A 3HI1B 4N8CL 4RA3A 4UOW0 3JV0A 1P4IL 5I73B 2R0WL 3AAZB 4JFZL 1P7QA 3EYQD 1MREL 4Z7QE 5I8CB 2EEBA 3MFFB 4L4TB 4KJPC 1QA9A 1FL5A 1FV1A 4QHMA 3UC0L 5I73C 4M6AA 2YD4A 2DMBA 1T0NB 4XCYB 5A1AA 1MJUH 3BX7C 4ODUB 3UXFA 3NPSB 2GJ6B 4TVPH 5EZLB 3QUMB 3IU4H 2ENYA 4UTBL 5F1OB 1BBDL 1KN2H 3VXMA 3BDYH 1NGXB 3NPSC 1F11A 3EOBA 4YX2L 4R7NA 3RWCA 4I18B 4Q97A 1JZ5A 2X1PA 3MRDB 4PRHD 3LKQB 3PNWB 4OUOA 4PJCA 2EIEA 1XR8A 3GGWB 4JM4H 5B3NA 5EA0L 4KKLC 3V5DA 4ZPTB 3MMEB 2Z93A 3ULUH 4MJ6B 3D85B 5HHVH 2IBGA 4I18C 1NEUA 4HPYH 2ZZUT 2YA0A 1U58B 4AIOA 4ONHB 1F58L 1J5OL 2Z8RA 3GKWH 3S37X 4TULL 1J86A 4NQDB 3C8HA 3GJFA 5EBLB 5T1DL 4E0RB 2XY1A 4L8CA 4EI5B 1FL6B 4R90H 4GAGL 3BP4B 5D2LE 4JHWL 4ZFZA 1M05A 3GI9L 4G6FD 4Z7VB 4FS0A 5DD1H 4BSVB 4EI5C 1REIA 4K23H 3MNZB 3G6AB 3TO2A 2CKBA 4X5XB 3EBAA 3O6KL 4XVJL 5HD8D 4BH8B 1QBMH 3DROA 4QRQB 4JFPA 1VPOL 5SWQA 4KMQA 3RVUC 5DJYB 5ADPL 3O41B 3Q2CA 2DRUA 3UYRL 2ORBH 1EFQA 4U7KA 5DK2B 4UV7H 1J8HB 2VOTA 4F7PB 1I7TA 1KEGL 1CG9B 2ZPKL 3CFBB 4CMMB 1XGTB 5HHME 1Z3GL 4ODXB 1UCBH 4HIHA 3QIUB 4Q9CA 4OGXH 5ACZB 5JUEH 3G08A 4BZ1H 4OGYL 4UQ2A 1BJ1H 3D1MC 1QSFD 1CE6A 3QIUC 3DX8B 4GRWF 4WEBL 1IGFL 4XRCA 2W60B 3ARTA 1KJ2A 4KHXL 2Z91A 3O3DB 12E8H 4HUVB 4M62H 1LGVA 3D3VA 5A2KH 2E8ZA 3RX8A 3KYMA 3UBXB 4PJIB 4K8RH 3N1QC 4TSBL 4PB9L 4F8TA 3UYPA 2Q86A 3M8OL 4PJFF 1EO8L 3X12A 4TTGA 1A9BB 1H3PH 4U6VL 4HH9A 5D7JB 3P9LB 1QHPA 3MRFB 1UZ8A 4M7JL 4TRPH 4P4RA 3SJVD 4HKBA 2JK5A 4KVNL 2XQBH 1ZSDA 1ZT1A 4MB5A 2J8OA 1WAAE 2P5WB 5D1ZB 5D7JC 1RPQA 5BQ7B 4OKVB 3INUL 1FZOA 3KWWA 3RGVB 1TLKA 1JF6A 4L3CB 4GW1A 3EOYG 4FQIL 3IF1B 4LVOB 5D1ZC 2BY2A 2VLRD 3VDAA 4BH7A 1R0AH 5CS7A 1CLZL 2ZUUA 1ZE3C 3BAEH 2YEZB 3G5ZB 4FQQA 4LCIL 1P7KB 2D7TL 3ZTJG 3BPLC 3RGVC 4LEXL 3FT3A 5T1LB 4U0QB 4YGAB 1BBJA 2F5AL 4LVOC 3UP1A 3L1OH 3SOBL 4PJGA 2VSDA 4I2XB 35C8L 1HKFA 3GMPB 2IALB 3CVHA 3QCTL 4G7YL 2Y36L 5EUKA 3TNNB 4MA8L 4Q2ZB 2CKBH 3QIBA 3SKNA 4XNUH 3J7HA 4D8PA 2Y9RT 4LPXA 1C1EH 3U83A 2OZ4A 4ELMB 2EDNA 5EWIH 2GYSA 2E9WA 4ENEC 3FB6B 4TVPE 1FFOA 1OSZB 1E6OH 1MCDA 3BKJL 1QFPA 4JPKL 4RA0C 3MJ7A 3O2DL 2ZNXA 5D7IB 4LPUA 1GIGL 2VLLB 3BISA 4JY4A 5MHSE 4N9GB 2HFGH 4HFWA 4ODHL 5SX4H 4HWZB 1DBAL 2MTPA 1CTOA 2YSSA 3V52H 1SY6A 1FPTL 1Y0LA 1MHPL 3RVTD 3HI5H 5SWSE 2NY0D 3DJ9A 3O6FB 3NABL 3ZT7A 4GKSA 5JW4M 5E9DE 3ULUE 3OKMB 4U1MA 4F80A 3FRPA 3UDWC 1QBAA 3B2UC 1IEAA 2ZG2A 5GHWL 1WSST 2R1YB 4Z77A 3MOQA 3O6FC 4TTDD 3S35L 3KLHC 4E41B 4YDKH 4LGRB 1EDQA 1IGYA 5I8OH 1CBVL 4WHTB 3MV9E 3O45B 3REVB 4POZC 2CIIB 5BS0D 4RNRB 3RAJL 3SE8H 4A6YB 1DLFH 5LG1A 25C8H 2HG5B 2EDEA 3KS0J 3RWHB 3WJJC 4NNYB 4KHTL 4PY7B 1NCCL 1ORSB 4KK5C 3PWLB 4KY1L 3WXVL 4PTUB 2YD1A 3X3FH 1A6VH 1KLFA 2FGZA 2EH8L 3WBDA 1DQMH 3P73A 5E94A 3W0WD 1GGIH 5IVNA 2NXZB 4FQ1H 4DKDC 4D0DB 3MRBB 1T83C 5DD3L 1J1PL 2WSKA 1T1WA 3QUXB 1T1ZA 1T7WA 4MJ5A 1MVUA 3WFDH 1H3TA 1KPRB 3ZE2E 1YNKL 3MV8A 1P4BH 5DWUH 1NUFA 1QQDA 2NXZC 3MLRL 3HNVL 3QA3A 1AGDB 4HCRL 4WV1B 3QUXC 2FHBA 4ZNEA 4NQXB 4MX7B 4R4BA 4JVUA 4GKZA 4R8WL 1UJ3A 3AS0A 4X6CE 4OQTH 1JPFA 1DFBL 1TZHA 4WV1C 1G6RB 2B2XH 4DEPB 1MCKA 2IPUG 5EO9A 4P2OD 4X4YA 1OM3L 4NO0D 1IRAY 4PGBB 1J8KA 2OS7A 3WD5H 5IMOA 5D7SL 3QDHA 3WLWD 4DEPC 3QIWD 4ZOCA 1QUNA 3IFOB 1XR9A 2OZ4H 4LLMA 1CTNA 2Z35A 1JGEA 1EEZA 5JIPA 3S9DB 2R0LL 3LKOB 3O6LL 1HYSD 3W81A 1S78C 1S7XB 2M1KA 4PREA 1NFDF 2H26A 5T3ZL 1E4JA 1RUAL 5ACMA 2PXYD 1MHCA 1K3ZA 4R97B 1KC5H 5D6CA 2CD0A 4QHKJ 3PF2A 4PJCE 5DFVD 2PF6A 5BW7A 3GMOA 4NJ9H 3O9WB 4G80B 2IC2A 3QNXB 5DDHB 4P2QE 4R97C 4HWEH 1OF2B 3U9UB 1L6ZA 4BSWA 3O9WC 3Q0HA 4R4ND 5DD0L 2IMMA 1BZ7A 1SJHB 1MLBA 2FB4H 2G9HA 3MJ6A 1TDQA 3T1WA 1OTSC 4PP1D 4RRPG 4C4KO 3OB0K 5TH2B 1LEKA 5DZLA 3V0AC 1YEDB 2I60L 3MRGB 4RDQF 2C3VB 2WNGA 3ZL4H 1RUML 1F4AA 1CGSH 5KVGL 2AJ3A 5TPWH 5ISZD 2DAVA 4NWUL 4MMXC 4U1NA 3THMH 4Q9RH 1A3RL 5JPNB 5KVDH 5F9DC 2PETA 1KJMB 5LAXB 5FDYA 2ADIB 2DL2A 1RZJC 5F7FA 5C1MB 5IIEB 1VEPA 2RCSL 5KOVC 4BUGA 4YHNA 5HPOA 1BM3H 1OP3K 3RY6C 5IWLA 4NQEA 3WV0A 2P8LA 2BY3A 3FB5B 5DJ2B 5CP7A 4O2EA 1H0DA 3L3OB 3ARFA 3QZWG 1IEBA 1LO5B 4GRMB 1U9KA 3OAZK 4M48L 1ETZA 2VXTH 4OCWH 4XP1H 5DSCB 5IQ9B 1GGCL 1U92B 5KN5A 4ZS7L 1QFWH 1BAFL 3FO9B 4CN4A 4QY8A 1CGVA 3P4OA 4WTWA 3O0RH 3WFCH 2NX5D 1UH3A 3R4DA 4ZDHB 2V2TB 2V5TA 2AJYH 3C60B 2P24A 1A5FL 1AKJB 4OQ1A 1TCMA 1J05A 4ODTH 5C7XL 3DUUB 4RFEA 1CLOL 4Z0XB 1BOYA 2HT4C 3OV6A 2PR4H 4G6KL 1F13A 2W38A 3C60C 5TFSH 1IAIH 1T4KB 3VJ6A 4MD0A 3ILPB 1J12A 2CH8A 4PRNA 5E8NB 3KYAA 4A2LA 3MV7A 1EBPA 5TQ2L 3R0MA 1T7ZA 2VABB 3TIEB 4I0CC 2ZCHL 3ZE1E 1XGPB 3TV3L 5C70A 2CDEB 1A6UL 1ADQA 3HI6H 5MP6H 3TYGL 3WNKA 4MA7L 4JM2D 2DICA 5C9JA 4CW1B 1MY7A 5CD5D 4M3JA 2KH2B 1S9XA 3T0WA 1NAML 3T0DA 4LGPB 1YDPA 2SEBA 4LARH 4WHDA 43C9B 1E4XI 2FZ3B 4LLDA 4O2CA 1EJOL 4PJGE 4LDLB 4KQ4H 5F7HA 2R29H 3KLAB 1BVLA 3LZFH 2V5RA 3FKUS 2WP3T 3LS4L 2AJSL 4J12A 2IH3A 3QJFA 2EYSA 2X4NB 1B9ZA 1KCVH 5TDOA 5E99L 2BMKA 4NO3A 2WM0A 2KBGA 2BJMH 3Q1SL 1FO0A 5CFHA 1QLEH 1O7SA 1YJDH 3HFMH 1Q0YH 1ZHKB 1FFNA 4WUKH 4U7SA 3M17A 3VI4F 5H35A 5DQJA 3IDNA 5HYIA 5GISL 3T77B 5F1KC 4Z7WF 4H1LH 4B50A 3NTCL 3SN6N 1NGQH 2D03H 2WLYA 4GO6B 4OGZA 5E8EB 1KT2B 1RU9L 2R2EB 1DZBA 4XTRC 5I19L 5JW5A 3AREC 3K80A 5KSVB 3A6BH 4JO2L 3MYJB 4L8BB 4KUZH 4QHUA 5F89A 1M7IB 2H41A 3LAFA 5FB8B 2CMRH 1U3YA 1U8IA 5F8RC 3FQUB 3TJEH 3E0GA 3QFJB 3DHMA 2JJSA 2W9LA 3PWVA 1S3KL 3FB7A 4PGDB 4K7FA 5HHOB 3RVXC 4MAYB 4G43B 2CUHA 4ODBD 1T5XB 3OJVC 1OD9A 4ORZC 5GSVB 1N3NA 3DX7B 4MQXD 1S7QA 4PRPD 4DKFH 3CLFH 5IHZA 1FIGH 2V9RA 4MAYC 1MWAA 4S2SA 2R56H 3KYKH 5JLZB 1ADQH 2NXYD 5CGTA 1RV6X 4X7TA 3V2AR 3MV8E 2DTSA 1FZKB 4HGMA 1UKSA 1FN4B 3FT4A 4XNXH 3AS3A 1H9VA 3BH9A 5E6ID 5B39B 3OGCA 4BFBD 4NDMB 2EIDA 3DTXA 4W6YB 1JZ6A 4OCSL 3OKKB 4U6YB 4M43L 4G3YH 1I8LC 5HDQH 1A6WH 4LSSH 3L3DA 1WBXB 3MLVL 4RAUA 2AJUL 4C56D 4RDQG 4L29A 4N9OB 3KNBA 5HJ3B 1DANU 3VWJB 3ZSSA 1OLLA 4WEMB 3VD9A 4PV8B 3OR7A 3WLBA 2ADGB 1UWXH 1VDGA 1A4JA 4QRRD 1CD1B 3WXWL 4GRWB 3DBXA 2AVGA 5EBWB 3VWJC 1T21A 4X4ME 4MNGA 3TCLA 3SE3A 1NKOA 1YNTA 5MENE 1AY1H 2KQMA 3G5XA 5DEFA 5C0RH 2Q8BL 2IPKA 3CH1B 3QHFH 4CVXB 4PJFB 2VXVL 3RIAK 4DCQB 1ORQB 1ACYH 1N59B 4IRJD 3SPVB 2AJVL 1K9TA 2FEEL 3WFEL 4CN6A 1QVOB 5IHUH 5E00B 4X80H 2XKNB 3QZWB 1GZQB 1N4XH 2IADA 3CFDB 2P8PA 5IBLD 4X6FA 4PJ9D 4ZO8A 1S9KC 2V7NA 2WZPD 3FAWA 2D0HA 5TGBA 2OMBA 1DUZA 5L2KD 4QTHA 1YMHA 1U6AL 1QYGL 1CR9H 4IMKC 4O5LH 1HSAA 5HI5C 2OP4L 3HPLA 3SKMB 1AQKH 1KIQB 4I9WE 4EOWL 3D9AL 1Q9LB 1NMCB 2CK0L 3HRZA 1GGYA 5CMAB 1IQWL 2J8HA 3EDJA 4NKMB 3NZHH 2QKIB 3RQ3A 3IS0X 3OXRB 4W81A 3V7MA 4G7VL 1X5YA 5KS9B 3NAAL 3MXVH 4JCLA 1NMCC 4JLRB 5IVOA 2EDXA 5HYQB 2R4RL 1YEJL 1YUHA 5HHQA 5CIPB 3V6FA 4NQCE 1QD0A 5DRNB 3L7FA 5DA0B 3KXFD 4CVZB 4UB0H 4E5XA 4PJXA 5B22A 5C0CA 1IFHH 4XZUB 1MCPL 3KPTA 5IBTH 5IB3A 3ULSB 2QSCH 3BMVA 1DSFH 2FIKA 4HUUA 4X5WB 1A1MA 4QCIB 5B8CA 3S36X 2XKUA 3PWPA 4R7DB 3TH2T 3WO3B 4EXKA 4CNIB 2DKSA 2ZUYA 3RPIA 4D94A 4TVPL 1S7VB 3IU4L 4LDEB 1BECA 4LHUA 2YD9A 1KN2L 3V0VB 3BDYL 3VXTA 3WUWG 3MV7E 5TF1H 3QCUH 4OF6A 4HGWB 1K4DB 4OZ4A 2CIKB 1BLNB 3QDJD 1XEDA 3PABB 4JM4L 4WI4A 3ULUL 5HHVL 2EKSA 4NBYB 5I0ZA 4HPYL 5F7WC 1H3VA 5HYSG 2AEIT 3BP7A 4KUCD 4Y4HD 5H37H 3IT8D 4D9RD 2DBJA 3GKWL 3WNOA 3T1FB 5BO1H 1LQSR 1D5XA 5IGXH 2ARWA 1R3JB 5ADOH 4R90L 3MLZH 3WE6B 1WZMA 3QNZB 1R3HB 3BZFB 3X11B 1RVFL 1AR1C 2ICWI 1ZLUH 5DD1L 4YBQC 1WK0A 3P0GB 4PJBF 3ZDYF 4K23L 3UTQA 1DLHB 3HLAB 1JMZA 4TOYH 2A74A 3JV6B 4YHLH 5IM7B 1KUMA 1QBML 5JW4Q 4F2MB 5DD5H 4KJYB 4XPTH 5FO8A 1FGNH 4JG0H 1KTDB 2P5ED 2XOTA 3K8KA 4G5ZH 3VXPA 5AD0A 4R26H 4OCXH 5IR1A 1QBBA 4TYUA 3IKKA 2ORBL 3UPRA 2YUZA 3H0TA 4TSAH 2Q20A 4WJ5B 3RTQD 4LEOB 1MCJA 3VU2A 5I1LB 3EFDH 4UV7L 1KCKA 3OF6D 4M6OL 1ZLVK 3SO5A 4AL8L 1NGZB 5CBEB 4LRIA 3FCTA 1F97A 1UCBL 5JUEL 4OGXL 3ZDZE 4J4PD 4BZ1L 2DI7A 1HXMB 1S7RB 1R3LA 3IS1X 4ZFOL 2JB6B 2COQA 5HI4D 1QSVA 3BZDA 3GJFK 4N0RA 3I6GA 3UJTH 1DEEA 4WWID 5HI3C 1RJLA 4F37K 1T1YA 1UCTA 2XIDA 3RNKA 5LXGH 3AROA 1WCQA 4QRUB 12E8L 4M62L 1G7JB 3N9GH 1UGNA 3MNVA 4MQ7B 2EDHA 4K8RL 1T66C 2CDFB 4BFIB 3DSFH 3H2WA 3KPMB 4PJ8D 4JFEE 2FEDC 1H3PL 3NFSH 1C5DB 1FNSH 4WW2A 1I1FB 4TRPL 5F7NC 1ZA6A 5F9OH 2A83A 2XQBL 1QSFA 2X9XA 4JGMA 5D72L 3T0EB 2EXYD 3FB8B 3KPRD 5H94B 2JLLA 1X5AA 1T6VN 5I1KL 2HJFB 2HA1A 4X6BB 3QISA 2VTFA 1EO5A 3PWUB 3QXVA 3T0EC 1CT8B 3HR6A 3BAEL 4ZFGH 1NDMB 2LAAA 3DGGA 1A7NH 2PO6B 2H8PB 3N06B 3HAEG 3QPQC 3BP5A 3C6LD 3SJVA 1XH3A 3L1OL 4PFEA 2EZ0C 4YXKH 4K55A 4H0HB 1T1XA 2OJEB 1WC7B 2PO6C 2XNAB 1BD2D 1A8JH 1ZVYA 5EZJA 4XBEH 5INCB 2JCCB 4XNUL 4CKVX 4PLJD 4ODVH 1C1EL 5EC1A 5DQ9B 3RIFK 2A73A 4MJ2A 5EWIL 3UTZB 2EDQA 1HHKB 1E6OL 3WJLC 3BRGC 4NRXA 3BJ91 1KULA 2HFGL 2R2HA 1WCBB 4QOKB 3V52L 3ARDA 4RMTA 4XPAH 4H20H 5J06A 3WFHA 1MFDH 1NBVH 2X4RB 3RHWF 4DZBB 3HI5L 3HE6D 4ORGB 3RDTB 4Q9BA 4NGHH 4N0FA 2FECI 2J7LA 2OTWA 5KTEH 2I24N 3JV5A 4XMPH 4KDWA 4HKZB 5DRWB 3MRIA 4P5MA 3RDTC 4F7MB 3PGFH 1V3JA 5FKPA 1MCRA 4YDKL 3BSZH 4RWYH 4ZFFB 5BV7H 3FN0H 5I8OL 3WIHA 2VL4A 2IMNA 1FYTD 4HT1H 3QUKA 2H6PB 4N1HB 3VMPA 1DLFL 5IEHA 1AGBB 25C8L 1VA9A 3GM8A 5I1DA 4FRWA 4ZAKA 2XKSA 3FZUC 3NN8A 2VQ1B 2FH8A 3U9PH 3G6JE 4XNZB 3VRIA 3X3FL 1A6VL 3U0TA 3CSYA 3B5GA 2VDRH 4Z7QF 1DQML 1GGIL 4EIGB 3HZMA 1JPST 4FQ1L 4XNZC 3D18B 4OLZH 3VXRB 5D71H 5BJTB 4WFEE 4WHYH 5BS0A 3B3IA 3DXAD 3SDDD 3S8WA 2QSVA 3WFDL 3H8NA 4PJEA 2BNQD 4GKNB 5DWUL 3TO4D 5DRXB 4IEFB 3EW3B 5KVMC 2A2QT 4L3ED 1VEMA 4PJXE 4Z7WB 1FQ9C 4MB3A 4OQTL 4NYLB 3QEHB 2OYPA 2AAVA 2D7NA 2B2XL 3W0WA 1HQRB 5DC9B 3VI3E 1T22B 3T09A 3FQWB 2ICEA 1C12A 3PWPE 4PG2C 4LSDA 5IOPA 3WD5L 5CINH 2YXMA 5LQBH 2BVPB 2BRRH 5IB2B 1Z0MA 2Y6SC 3K1KC 2OZ4L 2YPLE 3VG0H 4G8GA 2OXHA 3M45A 3EHBD 1MI5E 4HLZH 2IWGA 1MHHB 4IDLA 3E2HB 3EYFA 1N26A 1G7PA 5HVWA 1LE9A 1F5WA 5D2LF 5FF6B 3BEWA 3HC4H 4NZJA 1EERB 4P2OA 1OGAD 4ELKA 2NCMA 4AIZB 5E7BA 1Y6MR 4NO0A 2E27H 3ZT6A 3PG2A 1KC5L 3E2HC 1F4WH 4OF3A 4X4ZA 4ZO6A 4H8WC 1S7TA 4NJ9L 1PX4A 5L2JA 2FATH 3QIWA 2CR3A 5C8JB 2JIXB 1Q9WA 5HXMA 1LO3H 4HWEL 4S0SD 4MJIB 3VCLB 3FQXB 4MNQB 4NWTH 2E8YA 4RCAA 1ITCA 1XCTB 2FB4L 4NPYA 3AS1A 3DVGB 4EUPG 2Y1VA 2XTJD 3WIHH 2VE6A 4K3DH 4KGJA 2PXYA 2WBJB 4PRHE 4UBDD 3LVEA 4QRPD 1Y18A 1UKQA 1PSKH 1E4XH 2YUWA 3CH8A 5AZ2H 2GTZA 4I48B 4GXVH 4NC0B 5F3HB 3U36A 4YZFE 3ZL4L 4RAVB 3RRQA 2BC4B 1CGSL 4JDTH 5FA4B 2WBJC 3FTGA 5TPWL 5C0IB 3QQ3B 3HUJA 1R5VB 3ULVD 3QXAA 1I85A 3PHOA 3THML 4PGCA 3QI9B 4Q9RL 3OXSA 1JIBA 3L5HA 2VISB 4DOHE 4Y2OA 4WWKB 1NCUA 1BM3L 1RULH 3QHTC 3QI9C 1JWMA 3WMSA 4OLEA 3K46A 3O3BB 4B53A 3VXOA 3T2OA 3ECBB 3AM8C 3RVVC 3VFVB 4WWKC 1U8PA 2QADD 3I50H 3T8XB 3JTTB 2Q76A 2IEPA 1OT1A 2VLJA 5ISZA 1CVRA 3BE1H 2VXTL 4OCWL 4WNQB 4XP1L 2EEAA 2OQJA 4PJ5B 4P3CH 2ITDA 1QFWL 1FIEA 1UADC 3C9NB 3BEVA 1PYWB 1MVFA 1WAAF 3GSUA 2AW2A 5GZNC 2CLZA 1T04B 3D0LB 3WFCL 1HWHB 2K7PA 3CFJA 2HMID 3U4EB 2NY4D 3K2UH 5A2IH 3GMLA 3BXNA 4OF0A 4N8VG 5GRVL 5DJ0A 4ODTL 3HAEB 4UIMB 2BNRD 3HE7B 3HCVA 4KI5E 2AI0H 2NY5H 4Y4FD 1VB9A 2ICCA 4KPHH 4AQ1B 5TFSL 3LQZA 5EU3B 4JY5H 1IAIL 2NY1B 4Y88A 1JK8B 3HE7C 4XB7A 2H32H 4OV5B 5FM4A 2NX5A 2BY0A 2NY1C 5KZCD 1N5AB 3U7WH 3HI6L 5MP6L 3B5HA 3HN3A 3AMLA 3RWJB 3KPSB 3TH3T 1QFWM 1KCSH 1J0IA 2P8MA 4F7EB 4AQOA 5DC0A 1PDKA 3NFPB 1WVZA 2W07A 4LARL 1WTLA 5DFTA 4NT6B 1QRKA 4KQ4L 4RMQA 2R29L 1F4XH 2MOVA 1QACA 2CLVA 3LZFL 4FTVD 1G9NC 5DJXA 3ULUF 3TA3D 4GRLA 4JM2A 3ROOB 1T5WB 5FDWB 1MJJA 4NFBA 1FL3A 1IAIM 2VLRE 3OWEA 1MAKA 4U1LB 2BJML 2X7LB 5ENWB 2BSRB 4HMCA 2DLFL 1QLEL 1YJDL 3HFML 1Q0YL 1CLCA 4HH8A 4PGZA 2QQLH 3SKOB 4OD3H 1OAXH 4WUKL 2GK2A 1T89C 3HG1B 1MAMH 2ESVE 4OT1H 3DX9A 4Y8AA 5C08D 2QL1A 5CJXA 2V17H 3BI9X 4WO4B 4XXCA 4IJ3B 2D03L 3TYFA 2YA1A 4HDIB 4WO4C 4YEEA 3A6BL 4QYOA 4NNXA 4IJ3C 4U1SB 4TVSa 4JPIB 1NC2B 1Q9KB 4KUZL 1RJZB 1U8NA 2CMRL 5CSZA 1U8HB 3KHQA 3KDMB 4JHAH 1BIIA 3EJYC 3TJEL 3ZE2F 4OZHE 5J8OA 3Q6GH 5F7MC 5FV2A 4R96A 4ZQKA 4FFVC 5IQ7H 5C6PB 3MLTA 2FLBT 2HAZA 4MSWA 4X6CF 5IMMB 1KB5B 1XF1A 3GDBA 5IW1A 1C16A 4NSKB 5F97E 5MI0C 5EOTA 5JORB 2V7HB 4XBGB 5GGVY 2ICWA 3V8CA 1SJEB 3ZKQD 4L8DB 2PYEB 4PRAB 4DKFL 3CLFL 4P49A 1FIGL 4GBXD 1JYNA 2R56L 3KYKL 5E8OB 1TVDA 2BCKA 1ADQL 1QRND 5ICXB 2P42B 3IVKB 1MH5A 1CIUA 2FLRT 3EIFA 3OAYH 1DQQA 2DQUH 2X4OA 4XNXL 2DIJA 5C07B 4QGYA 5CLWA 3CZFA 1ZXQA 4YNYA 4TPRH 1D9KB 1RZGA 5DVNA 5KAQF 4M7ZC 2AJZB 4PRPA 2ZOLA 4TUJA 3MXWH 3A6OA 4IIQB 3CPLA 4PJCF 5HDQL 1A6WL 4LSSL 3D2UB 1XMWA 1D9KC 3FONB 1UACH 4UOW1 5IB4B 4BQ8A 5I1AA 4U0RB 4IIQC 5D7LB 2MKWA 3SGDI 3WEXB 5I9QB 4NQDE 4OZIA 4OIIH 5JO5B 3CU7A 4NQUA 5E6IA 2QV2A 4PJ7A 3QULA 4M7LT 2XN9E 3RWFA 5ID0A 1U8LB 4U0RC 5J1SC 1PY4A 2HTLC 3LEXA 3CD4A 5I9QC 1UH2A 1MEXH 2PTTA 1AY1L 4HUWB 3E3QC 2IAND 1UENA 2HFTA 1AO7B 5C0RL 3QHFL 3OR6B 4C56A 1EEQA 1GZPA 2BHZA 5TE4H 4WU7A 1CI5A 4PP2A 3IDIA 4NCDA 5I16A 1ACYL 3GI8H 2V2WA 1L6XA 2V5MA 2EDJA 1NUGA 1FVEB 5DJ6B 4WRLA 1M7XA 5IHUL 3MO1A 3MCLH 4G6JL 4X80L 2Y5TA 3MA7A 4YGVB 4YHPA 3ZYJA 3D87B 4L4VA 4KMTL 4JRXB 5GZOD 4OI9A 1N4XL 4QXGH 5FV1L 5F9JA 1GPOH 1IEHA 1R3KA 2F53D 3TT3H 2DJUA 1IJ9A 2DI8A 4JO1H 3VFGH 4IRJA 3W11C 2O5YH 3R06A 3BOVA 1ZANH 2C9AA 1CR9L 5MEQB 4MD5A 4O5LL 1I1YA 4FQHB 2FJHB 3QG6B 4GAYB 1AQKL 5IW3A 5DJCA 4FFWD 1P1ZB 3CMOH 3NZHL 1NAMB 2AEWA 1B6DA 5EPMB 1V7MH 1FP5A 3BWAA 4PJ9A 4WDIB 5IB1A 3MXVL 2LV4A 5FAAA 3LSOB 4R0LB 4RMWA 5JDSB 4Z7NE 1ZLWH 5L2KA 1UM6H 3UTPD 3WFZA 4UB0L 5DRZA 4R0LC 2VJXA 3QG7H 1IFHL 5FGBA 4CADB 3C8DA 4MZ3A 5I71B 1UKTA 1FVDA 2BSSB 5IBTL 1IM3A 3DRTB 3ZE1F 4YAQA 1F3JA 4KZDH 1ZEAH 2QSCL 2ZCLH 3GSXB 4YDLB 1CLYH 1DSFL 3C87A 2EICA 5IEKA 3RL2A 1B0WA 3BVNB 2E6JA 5I71C 5ESVB 1UA6H 1CQKA 5KSBA 1KIUA 3H9SD 5EFIB 4LLUA 4YDLC 5IK3B 4OM0H 3KXFA 3HMWH 4I5BA 3QDMB 1A6TB 4M9PA 3FO1B 1ZLUK 5IFAH 3UZEA 5F9WB 4HS6A 4PJGF 5E1AA 5JXEC 4RGNC 3V4PH 5C0AB 4LDOB 1TENA 3CDCA 4U1KA 2NX5E 5TF1L 3BQUB 4I3GA 3QCUL 2P5WD 1R5IB 5DYOA 5IMLB 5F9WC 2IH1A 4HHAA 3U6RB 3FO0H 2Z31B 3O3UN 3OKEA 1XF2A 1IBGH 4KI1A 3BQUC 5J3HC 3OHXA 4YHZH 4XNMA 1CXEA 3RKDC 1FJ1A 2Z31C 2C4XA 2GITB 4EDXA 5BO1L 4XXDB 1Z5LB 3CX2A 5IGXL 3EYOA 5ADOL 5I1GH 1D6EA 3MLZL 2NLJB 4JAMB 4U1JA 1KJVA 2JJWA 1NCAH 3NFNA 2R23B 4XH2B 3BKMH 1ZWIB 3ZKXB 3VWKD 3Q48A 3TIDA 3VFPB 3VFRA 4C83B 3P4MA 3MJ8A 4TOYL 4X99A 2LE9A 1A64A 3C5JA 3KPNB 3MBEB 1G7LB 1NFIA 3RX7A 4YHLL 4Y4HA 4FP8L 2D7MA 3ZKXC 5DD5L 4I0PB 3ZTJH 4EDWH 1FGNL 3H9ZA 5F7DA 4JG0L 4P2RA 3SCMB 1W8NA 3MBEC 4QRSA 4G5ZL 4G42B 2NZIA 3OX8A 4R26L 1P4LA 4OCXL 3CUPA 1D3CA 1OAYH 4I0PC 4TSAL 1B0RB 4O2FB 1KLGA 3SCMC 5D2LB 3D39D 4MLIA 3EFDL 3O6FD 1LEGB 3MRRA 4LPCA 1YEKH 1G9MH 1BVKB 3MROA 1KELH 5EDXA 3V95A 3ZZ1A 1CICD 1ZVSA 4YC2B 5FKAA 1FFPB 4GG8A 1PW3A 4JFDB 2OXGA 4PJHB 5I1HH 2P5EA 1S9VB 4P9MH 3IJHB 2EXWC 4TUOA 4YC2C 1RFDH 3FO2B 3OKDB 3VGFA 3UJTL 1R24A 5E6ZA 4XPHH 3L3GB 3BO8A 3RTQA 2YK1L 2C5DC 5LXGL 3OF6A 5FK9A 3N9GL 3GBNH 3VFMB 3CU1A 1EFXD 3PL6D 4BFGA 1ES0B 4HJGB 1DN2A 3T0VA 5LGHH 3DSFL 3WYRA 3CJJA 2OL3A 1VACA 4X6EA 3NFSL 5IW6B 1DVFB 1FNSL 2WLZA 5M95B 5HHMB 3DETC 3WS3A 4WCYH 2OI9B 3QJHA 4WEUD 5F9OL 5EU7E 1TTUA 3QUXD 1OTTC 3T0XA 4YO0B 2PCPA 3F7VB 1DR9A 5DJZA 4S0TD 2Q7YA 2OI9C 5J9PA 3LDBB 1A9EA 2J3SA 1SEBA 3JUZA 3QB7C 4XP9H 1HIMH 4V2CB 5JOPE 1QEWA 3QUYB 4PJ8A 4ONFH 3GB7A 3B9KB 5GSRB 4ZFGL 1OAUH 5EC2A 5EOCH 3OKNA 2B1AH 3LDBC 1DQTA 5BVJA 4NNPH 4G9FD 4DZ8B 3QWOA 5D1XB 3UEZA 4QWWD 4DN3H 3PV6B 4LLVA 5DUPH 4JREB 4YXKL 3B9KC 5C0JB 4POYA 2R39A 4XCEA 5JW4R 4G9DA 5GGUA 5D1XC 1R6VA 4OZIE 5DGQA 4XBEL 5D5MA 3BIKB 4JREC 4Z8FH 4ODVL 1X6LA 2X1QA 3TVMB 2VDQH 1EUUA 5EU6A 1M71B 2B20A 5F88A 2MCG1 1MFCH 1MFBH 5GGTA 1EIBA 2XWBA 5KVFH 3GRWH 1M4KA 3TVMC 2EECA 4C56E 3LB6D 3V4VH 3GSNL 4NRZB 4PB0H 3O9WD 4XPAL 1BD2A 3BIBX 2E7LA 1MFDL 5T3XH 1NBVL 4HJ0D 3LQAH 4QRRE 5KANG 3REWB 2ATKB 3PXHA 4Y5YA 2HKFH 3STZA 4NGHL 5KTEL 3EFFB 4XMPL 4I8DA 3I2CH 3C08H 3NA9H 3QEUB 1U8JA 2FJFB 3PGFL 5D2NA 1I3RA 3BSZL 4RWYL 2HTKD 4Y16B 3FN0L 5AWNL 4K3EH 4HT1L 4OSUH 2NYYD 3SQOH 2VLMD 5IF0A 1RUQH 1T0MA 4ZO9A 4OGAC 4Y4KB 2E6QA 3HE6A 3WS6A 1OB1A 4Y16C 2YMXH 1I9JH 4E9LA 4EBQH 3U9PL 1K8DB 5SWSB 2IPTH 2BX5A 5BRZA 3NOIA 3TEUA 4U6HB 2H3NA 4Y4KC 4FQLH 3PDOA 1IKFH 1MSPA 1AGEB 2VDRL 3O8XB 4X9IA 4GW5A 3G6DH 2WBKA 5DMIH 3PP4H 1FNGB 2X2YA 4MXQD 4OLZL 4OZFA 5J89A 5D71L 1FYTA 2GIYA 3EO1B 3FT2B 3MV9B 3HR5B 3O8XC 2W65B 1WF5A 1BWWA 2X4QA 4NKDA 2JKXA 1G7HB 1EA9C 4K3HA 1A4KB 5FGSA 8CGTA 5DK0B 4BQ9A 4RBPK 3JV4A 4QXTB 5J6HB 1T2QH 1KCRH 1PLGH 2J8UA 4F9LC 2AV1B 5EU5B 1S7SA 1YPZA 5B38A 4OAWB 3FRPG 3DXAA 2XXCB 3MCKA 3SDDA 5KSBE 4LSQH 5CINL 4UAOB 1HCFX 4ZUVB 1UB6A 2BRRL 3KXFE 5TQ0H 1HI6B 3TBYA 4HD9A 1J1XH 3KG5A 3VG0L 5FUOH 1OL0A 4ODSH 4L3EA 3ZYOA 1G7IA 3MRHB 2XZQH 2E7HA 5E5RB 2H2PC 5DTFB 4JJ5A 2NY3B 4HF5H 5F1IA 1G0DA 3HC4L 4X6CB 1U3HB 5DS8B 2VAAB 4JQVA 5EO0B 1XIWD 3U7AA 2E27L 4LKXA 4WVRA 1F4WL 3FOMA 2NY3C 3GIVB 3HS0A 2X1XR 1QLFA 3RUGA 1U3HC 1HDMA 2FATL 5KSUB 4AEIH 4TSCH 1WWBX 3BUYA 1JWSB 1KCUH 1LWRA 1FL5B 3O3AA 4YPGB 1LO3L 4QHMB 4RWHA 2D31A 2Z4QB 2YBRB 1FNEA 4KROD 2R1XA 5EUOA 5DEGA 5DMKA 4HAGA 3WIHL 4K3DL 2D4DA 5FYKH 3H9YA 3PP3K 3QDJE 4KK6D 4U7MA 2OR7A 1JL8A 1PSKL 3EOBB 4K8RC 4R7NB 5EIQA 5AZ2L 4GXVL 4JDTL 2P46B 4NUGH 4PJCB 5CZXC 1J0HA 3RWIA 3ZDZF 1LK2B 1A6ZB 2Z93B 1R5WA 2ZP0T 4D9RE 4JN2A 1S9YA 2RQ8A 3H3PL 2ERJB 1FH5H 4IOFD 1I1CA 3LY6A 3VFWA 1YEIH 2R69H 1RULL 4L8CB 4XTRD 4HPOH 1AP2A 1AGFB 4QRPA 2ERJC 2OR8A 3LN4A 2BZDA 5HHOE 5T1KD 4ZFZB 3HC0A 4JQXA 5FOJA 1I8KA 3I50L 5T3XE 3BE1L 3CCHB 5ALCH 1S5IH 4IHOA 1D5BA 5CP3A 4YLQT 1PZ5A 3QO0A 4P3CL 2CKBB 3VGAB 3TBSA 2P5EE 3DROB 2DYPB 5SWQB 1WIUA 4HXAH 3EYSH 3VGAC 1J0JA 3K2UL 1A7PH 2ED9A 3B43A 1BREA 4GMTH 4F8QA 1E4KA 3C09B 1DQLH 3QUZB 3BD3A 1ZS8A 2AI0L 2NY5L 4EZMA 4LIQH 5FFLA 4M61B 1JWUA 1YEEH 4U31A 4JY5L 2E9IA 2ICWJ 1FYHB 3C09C 5IKCA 1TNMA 3QUZC 2HKHH 4HIHB 3MACH 4U3HA 5HSFA 4UQ2B 3B4NA 1QBLH 3QRGH 3Q5YA 2G75A 3UAJD 3U7WL 2YHGA 2J2ZA 1RAMA 1AXTH 3LMJL 4NN5B 1IGCH 1S7UB 2Z91B 3U79A 1KCSL 3M1BA 4KKNA 4GQ9H 4Y4FA 1ACZA 3O4LA 3KYMB 4YDJA 2K9UA 2VITB 2ZKHH 2F15A 2QSTA 2Q86B 3X12B 4NN5C 1KIRA 2DDQH 3UTTD 4HH9B 3K3QA 1UZ8B 3WIFB 4P4RB 1F4XL 3KPRE 3LN5A 1FZJA 4QT5B 1NQBA 1ZSDB 4R4FH 4PRID 1E0OB 3VRLE 4CN1A 2LTQB 2JELH 3MZTA 1MUJA 2WUBH 1FZOB 3KPOA 32C2B 3VW3H 1XF3A 4XVUD 5GGSA 5BMFH 3SGDH 2LTQC 5IT2H 4FQQB 4M93B 5CGYD 3GUTA 2QQLL 4OD3L 1OAXL 4O4YH 1WBZA 1C5BH 5D1QD 1T0PB 3OJDA 4OT1L 1MAML 4FTVA 4PJDA 1CZ8H 4U1IA 4WU5A 4HMEA 4PJGB 4M93C 2V17L 3TA3A 4Z78B 4I3RH 1CD8A 2C1PA 3G6JF 3ULVH 3IDYB 1RK0A 3TNMA 4D8PB 3BGMA 4WY7H 4HBQA 1BF2A 1MJ7H 3IDYC 5KS9E 4KMLB 1D5ZA 1NCDH 5DXWA 5CCKH 2FHFA 1FFOB 1X5KA 4JHAL 5ABDE 4KK8C 1IAOA 3TPUB 3MJ7B 3Q6GL 1F4YH 5FYKE 5HI5D 5C08A 1UJTA 2IBZY 1MCWW 2I9LA 4M02A 4OBRA 4HEME 5IQ7L 2YSSB 4YE4H 4OLVH 4PJXF 5IJKA 1Y0LB 4P5KA 2VKWA 1ZGLA 4U1MB 2NW3A 4HIEA 1GOGA 2N1KA 3MRQA 2ZUTA 3VI3F 3IFLH 1BHGA 1U2HA 3VXUD 2APWA 4MJ4A 4Z77B 1JUFA 5DHVH 5DHYA 1FYTE 2D7OA 2Q8AH 1KCLA 4Q6IA 1IGYB 2VO5A 4EI6B 5DI8B 3BUTA 1G0YR 2DQUL 1KACB 4MVBD 4M8QA 4F3FB 1I9IH 1W0VA 4KV5E 1VFAA 5HVFB 2PW2A 3PHSA 1N0LA 1O7VA 5DMGC 3U2SA 1CYGA 4TPRL 4PGJA 5GS1A 2OSLA 2P43B 3VXMD 4GJTB 3RNQA 2W0FA 3MXWL 4X9FA 3QQ9C 3JUYA 3P73B 5E94B 1QRNA 2ITCA 1UACL 4PJAA 2BNQE 4XB8A 4FQPA 4BQCA 5JQ6H 1T1WB 1T1ZB 1SYVB 4N0YH 2X4SA 3H9HA 1MVUB 4YDIH 3MV8B 4OIIL 3UZQA 4YHIA 5JW4N 4BQBA 4L3EE 1QQDB 4Q6YA 2IBZX 1HOCB 1KIPA 2HLAA 5DVLA 4NQSA 5JA8B 4LIQE 4W4OC 4MDIA 1CFVH 1Z9OA 3B9AA 2EDFA 1PQZB 4D0BB 4GKZB 1UJ3B 3HI1A 1MEXL 4KC3B 3FMGH 4LAQH 5B4MC 2R4SH 3X13B 3U30B 5TE6H 4RGMB 5GRXG 4ZTOH 4CDHA 3HC3H 4YZFF 5I8CA 4X4YB 3DLQR 5TE4L 3RUGE 1UJ3C 2ZUXA 3C8KA 4KKAD 3F6LA 3U30C 1OTUD 4S1RH 5EG6C 3EDDA 5I6XB 4RGMC 5IMOB 4XCYA 1DCLA 4XGZA 2AK1H 3GI8L 3EDFA 4OF5A 5E2UH 5EZLA 5DHXB 1EEZB 3CLEH 5I6XC 3MCLL 1OGAE 3SBWC 2IANA 1NGXA 5EOCJ 4PREB 2MQ0A 3GSRB 1MF2H 3LKQA 3PNWA 4XWGL 1HINH 4QXGL 2P4AB 1MHCB 1GPOL 3P11H 3TT3L 2F5BH 5D6CB 3MMEA 2CSPA 4P59L 4C59B 1IGMH 4FXLA 3VFGL 5ESAA 4G6AC 3DRQA 1ZANL 2DKMA 3RL1A 2YN3A 2B1HH 4LP4A 3FQRA 5EBLA 5BW7C 1ED3A 3P30H 3V5HA 3CMOL 1JHKH 3T2QA 5GS0D 1FL6A 3EJJX 1XGRB 1MLBB 1V7ML 5CBAB 5T5FH 4Z7VA 1OHQA 5IV2A 2F53A 3OL2A 1LEKB 3D3VD 4KI5F 2WV3A 2ZUQB 3ARGD 2H2SD 4H8WH 3MNZA 4J7RA 3VFTA 2WAHA 1UM6L 3ULVE 2MJWA 4JN1H 1WWCA 1XT5A 2ZUQC 4U1NB 3QG7L 3T0EE 4HKXB 4LSRH 4FHBD 3O41A 1U36A 4KZDL 1ZEAL 2ZCLL 1CLYL 1MFAH 5CD3B 5DK2A 4YHNB 2ZSVA 1UA6L 1UQSB 5HPMB 5CP7B 4O2EB 1H0DB 3MJ9H 2XACC 3MRNA 4OM0L 3HMWL 4RIRB 5GGSY 3ARFB 5IVXE 5MERB 1YJDC 1CU4H 2DN7A 4CMMA 1XGTA 5IFAL 4ODXA 3ARBB 4NQCB 2FGWH 1AXIB 1ETZB 5DZNA 5DT1H 3V4PL 4M03A 5KN5B 4FZEH 3ARFC 4CVUA 1DDHB 4QXUH 3H3KA 4U49A 4OD1H 2JCCE 3EOTH 4Y2DD 3FO0L 4F58L 2UUDK 2UVEA 3ALPA 2C4FU 3H9SA 1IBGL 3VXQA 2BNRE 7FABH 4PJIA 4ZUUA 4YHZL 4NRYA 3MRPA 4RFEB 5D7JA 3FAXA 3DX6A 3P9LA 3MRFA 3TJHD 1A47A 3DVNB 1RUPH 3R8BB 3JXAA 1WBYA 3VJ6B 2J88H 2Y25A 1AGCB 3FHQA 1J87A 4MD0B 4RMUA 5I1GL 4PRNB 2P5WA 3QCVH 1YMMD 3UYOD 1GAFH 3DOSA 3MV7B 1NCAL 2VSCA 4J3UA 1VCAA 1KFAH 1TFHA 3VE0A 3BKML 1L0YA 5DURB 3IF1A 3FFCD 3BGFB 2DWDA 4LVHC 4KRPB 5K59E 3MPCA 3EYVA 3TGXA 4LNRB 2HLFD 3UJIH 3C6SA 4OZHF 4EDWL 1U41A 2XQYK 3BGFC 2BVEA 1CF8H 2SEBB 4KRPC 5C0FA 4NZUH 4FG6C 5E5MA 3U46B 4I2XA 1MCLA 3CIQA 3LKPA 4L8SB 3VD5A 2F9BT 1OAYL 3LV3B 4ZS6C 4EEEA 4Z18A 2AK4D 5A2LH 1BVLB 2YPKA 4LHUG 3VWKA 3S34H 1YEKL 1G9ML 1MLCA 1LP9A 1RIVH 1W2KT 2UZIL 3GSOA 3A0OA 3QJFB 1KELL 2EYSB 4L8SC 5TDOB 1RZ8B 1HQ4A 3LD8B 1OSZA 4NN7B 5F3BB 1INEH 1RUKL 1FO0B 3MRMB 5I1HL 3MV01 3OPZH 1I7UA 1S8DB 4N90D 2D4FA 5D7IA 2FECL 3MLWH 4P9ML 4BSJA 5JZ7D 2O61A 1RFDL 5K9JH 2WQRA 1FFNB 3LD8C 4KKCD 5C08E 1NH6A 3M17B 2YUXA 4NN7C 1WFUA 4XPHL 4CMHB 1NMBH 1YECH 2HVJB 4FQXB 1P5VA 5DQJB 3IDNB 1QNZH 4R2GD 1T7XA 5AYUH 4J6RH 1G9NH 3TWCH 3O6FA 1G84A 3GMMB 3GBNL 3OKMA 4L1DA 1L0QA 4KTEH 1YEHL 1CICA 3QXDA 5LGHL 4FQXC 2R1YA 2E7CA 1V3KA 3P9WB 4Z5RA 4PLKC 3RZCD 5D6DC 5JW5B 5A43C 15C8H 3D69A 3WJJA 4J3VA 4HWNA 4WCYL 4QHUB 5F89B 4WHTA 3O45A 3REVA 3GJEB 1IILE 2HG5A 1ZLSH 4KRMB 4JKLA 3TBTA 1TETH 3PWVB 4PY7A 3FB7B 1F3DJ 2YRLA 3HNTH 3PL6A 3PWLA 4NQTA 1T83A 4PTUA 2WWMC 1YNLH 4K7FB 4ONFL 4JKPH 4NP4H 3NH7H 1OAUL 5EOCL 2B1AL 3N50A 1EBAA 4FXKA 1F2XK 1NEZA 4NNPL 4ZSOA 1N3NB 4JFEB 1S7QB 3RJDA 4DK6A 3MRBA 1QRNE 4DN3L 4P4KD 5DUPL 3QUXA 5IHZB 3BWUC 4V2BA 1MWAB 2L0DA 1W0YT 2WUCH 4DUXA 4X7TB 4MNQE 3IKCB 5I8KH 4Z8FL 1GH7A 4MX7A 1BVZA 2AERT 3FT4B 2VDQL 3BH9B 1UVQB 4Y7MA 3O6MH 1MFBL 4RAHA 1G6RA 1SJVA 3I6LD 2AABH 3DTXB 1ZHBB 5KVFL 5EO1B 3GRWL 2ATPA 4EQ2A 1JPTH 1KB5H 5J6GB 3V4VL 5KSAB 5HHNA 5AYQA 4PB0L 2G2RB 2P45B 5IJVA 3IFOA 5T3XL 4L29B 4KQ3H 3KNBB 3IGAA 5IHBA 4MJID 4XCNB 1IL1B 4XBPA 3OR7B 2HVKB 2HKFL 3WLBB 1A14H 1VESA 4PBXA 4BK4A 4ZTPH 1S7XA 5E03A 3I2CL 3DBXB 1AC0A 3C08L 3NA9L 3IU3A 1AC6A 2IANE 4MNGB 4WHYG 3TCLB 5HGGS 4EVNB 1DQJA 3V6OA 3SDXA 1JPSH 5DEFB 4Z7NF 4RMRA 4K3EL 2IPKB 4OSUL 3O9WA 1UWEH 3SQOL 1RUQL 4UDUA 3QNXA 3SE3C 3SY0A 2V6HA 5DDHA 1AHWA 1OF2A 1J0KA 1I1RA 4QXWA 4X6DE 2ED8A 2YMXL 3U9UA 3BYYA 1I9JL 4HGKC 4EBQL 1YN6A 4OCYH 2IPTL 3MTRA 4ESKA 4FQLL 3RVVD 1IKFL 3J8F7 1GC1C 3MC0A 2QQNH 2AKRB 2GJZB 1UXSA 1QSZA 3G6DL 4EUPH 3PP4L 1MIMH 1HZHH 5TH2A 3TCXA 5CUSH 3D6GA 2VZ1A 2P8PB 4X6FB 5HHPA 1UEYA 5DR5L 2X9WA 4BYHA 2KPNA 2XI9A 5EORH 1YMHB 4PJ5D 1YEFL 5JPNA 2Y4SA 3ET9F 3OB0H 1TVHB 1MCIA 4M1CD 2B8OT 4GSDH 3G6JB 3MUGA 1T2QL 1KCRL 5C09E 2HRPH 1FCGA 1PLGL 4G6ML 4WFFD 4LL9A 3HRZB 2IF7A 1WFOA 4DVBA 3LCYA 4X4XA 4UNTA 1VFUA 3BN9C 2VZ3A 1BQLL 3KVQA 3FB5A 2FWOB 4LSQL 4J8RA 4N5EC 1Q8MA 5JPMA 4GRMA 4O58H 1I75A 5TQ0L 2YUVA 3UTPE 1YUHB 5DSCA 2BVOB 5FUOL 1RZIA 4ODSL 1FCCA 1ZV5A 2HN7B 1OP3H 1KTRL 3FO9A 5FECA 4K7PH 4HF5L 4PJXB 4KJWD 5C0CB 3R0NA 1PG7H 4JM2F 1VGKA 4KKBD 3L5XH 4D