2P47B

Complex of a camelid single-domain vhh antibody fragment with rnase a at 2.5a resolution: se5b-tri crystal form with five se-met sites (l4m, m34, m51, f68m, m83) in vhh scaffold.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
b'QVQMVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRMTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease pancreatic
publication title Toward chaperone-assisted crystallography: protein engineering enhancement of crystal packing and X-ray phasing capabilities of a camelid single-domain antibody (VHH) scaffold
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p47B00
4L9DA 3VWJA 1XCQB 3W9DB 5BV7B 3CCHB 4FQCL 3BDYL 1L6XA 1MCBA 4F3FA 3MRIB 2IQ9H 3VWJC 3PIQA 5DLML 2V2TA 2GSGA 4U1JA 2HWZL 5HDOA 3QO0A 4N90E 2X9XA 3ZLQC 3CVIH 3MA9H 5LGJB 1QFOA 2IBBA 2BVQB 5LAXB 4EBQH 5I1GH 4YDIH 4G8GA 1RUKL 1FBIL 4X5XA 3MZGB 3PGFH 5INDB 3IJYB 2CSPA 2LFGA 1W0VA 5B4MC 1EH9A 3TO2B 5E8DL 2ZUSA 2C4FU 3WIIH 1OL0A 3TVMA 1SQ2N 5SWZE 3SKJH 5JOFB 5GRVK 5CJQH 5GGTA 1T3FA 3O2DA 3A6BH 4YDVA 1I9JH 3TVMC 2FATL 3B83A 4WO4B 1QBLL 2A6KB 4MAYA 5FO7B 3L7EA 1KBGL 1UXSB 3B3IB 3T0DA 1F6AA 3EO0B 1QFWM 2FX8L 4UAOB 2O5XH 4LLVB 3Q5OA 1WZLA 1DBAH 5E6YA 5BV7H 3BAEH 3TNNA 1IKFH 1P7KB 4JDVA 5E8PA 3S88L 3GSUB 1G7IB 4RISH 5EWIL 4FQLL 4XXDB 1F00I 1G9NL 1IT9L 3TV3H 1DQJB 4WFED 3C8DA 4XMPL 1DQDL 5IV2A 2Z35B 5IB1A 4R26L 5HTSA 1FVDA 4YBQC 3NMEA 4MSWA 3X13A 1RZKH 4NP4H 3VA2C 5L6YH 4S1QL 5F1NA 3V2AR 4EKXA 4OZGB 2ID5A 2EDOA 3UCRA 1T7XA 3ARBA 2YD4A 4XPTH 3BVNB 3JV4B 1KCUL 3QNZB 4YUEL 3UTTB 2ATPB 4PGBB 5D96C 1P84K 4X80L 3ARBC 1FSKB 3OJDA 3BWAB 4WI2A 3BKJH 3DROB 2EH8L 2G2RB 5E8OA 4JM2B 2CK0L 4MCYA 4S10A 1ZHKB 2X70A 1PYWA 1A5FL 4PJIB 3O2VL 4X6DE 4Z7OF 4NQTA 3GSRA 4PTTB 4NO3A 3GK8L 1T66D 4JAMA 4HGKC 3TWCH 5MEOB 5DA0B 2ZUWA 4ACPA 1S7VB 3JSSA 2AK1L 4DAGH 3MCG1 4MB3A 2VLRD 4K3DH 3AU1A 3FOLB 4KMLB 4KWUA 3X3GL 4MNGA 5MI0B 1I1RA 4JKWA 4Z78A 5BS0E 2ZKHH 2XTJC 2WK2A 2X7LB 1OLZA 5E99H 3SOBL 1JYWA 2YXFA 1FDLL 1YY8A 4E9LA 2VDNH 3UMTA 5I1EL 3C09B 5D1ZA 1K2DA 1Q94B 3D25A 1A4KA 4S0TD 4L4TA 5JQ6L 3ZE0E 4NC1C 1P2CA 4CNIA 4BUHA 3VFGH 4EN3C 3HG1A 1RUQL 5D1ZC 3AREB 4X7SH 4P48A 4YHZH 4GUPB 4GRLA 4IDLA 4UBDC 3TZVA 5HD8D 1YNTA 4UQ2B 2JCCA 4QGTA 2EDHA 1CD8A 4MGXA 3WSQL 4MD0B 3WFHA 4FXKB 4GRLC 4JO3L 5ADOH 3UPCA 2X41A 4PY7A 1ORSB 3KWWB 1KIRB 5D70H 3TCLA 2QQKL 3EOAA 4R97C 4OCXH 2D7PA 1JWSB 1PY9A 5IHZB 2OQJA 1CS6A 1WCBB 5I8EB 4OM0H 4PREB 2VISA 3HNTH 3TO4D 3NZHL 5DWUL 2L4OA 1H8SA 2R0WL 2F5AH 3VFSA 5EUOE 3HE7D 3NN8A 2C3XA 2D9QB 2NW3B 1UXWA 4U1GB 4JLRB 3H42H 4JZOB 8FABA 1S78D 2EC9U 3GMMA 3WO4C 3E1F1 1KIQA 1MREL 1XF1A 4PJXA 3JTTA 5C0EB 1S7TB 3P40A 3WS3A 4NO0B 2PW1A 3HI6L 4WW2A 4Z7WE 4R96A 5DRWA 4LBEB 5IF0A 1R0AH 3SDCD 4XCCL 1GOFA 4JPKL 1KPVA 4Q74A 4J23A 1AC6A 2C1OB 5KN5B 5C7XH 4WW2C 3BD4A 1QLRB 5DJ0B 4WFHD 1BIIB 1S7SB 2Q7NA 4P23A 4QO1A 5I1LB 2F8VA 1CFBA 4MJ6B 3VXRB 5HPOA 1KEML 3S3PA 3CK0H 4IMLA 3F6LA 1AGEA 5KTEH 2NY1D 4K7FB 4TNVF 5ADPH 4NQSA 4UB0H 4EXPX 2GKIA 5FYKU 12E8H 2RFXA 1CGSH 4JPWL 1C5DB 5HVHC 3KPTA 1MHCB 3LN9A 5HGDB 1L0QA 4NRYB 3RWJB 2AV7B 1NGWA 2AV1A 3EYSL 1W72L 1IQWL 4K3EH 4L3ED 2MOVA 4Y5YA 2JELL 2UWEA 1RUPH 5GRUH 1UKTA 5I16A 6FABH 2WIIB 3FONA 4RFOL 1MIMH 1GGCH 4JHWH 3OG4B 1Q9KA 3A6CH 1PLGH 4IS6A 4Y5YC 2OYPA 2UYLB 3ARSA 3OKEB 1ONQB 3DV6A 3LH2H 3SHSA 2CDGB 3PNWA 1G9MH 4OI7A 2H3NA 2HTKC 5ESAA 4OD2A 3IKKA 3ULUD 4Y2OA 3A67L 2NY0C 3O3DA 3FB7B 4UDTA 4YWGH 5TDPA 5JPMB 3T0WA 4X6BA 3H9SD 1EZVX 5AYQA 3ZYIA 3RTQA 5AWNL 2IPUG 3PWVA 1CD0A 1V7NH 3VRLE 5IR1A 3WFEH 2VDOH 4P99A 2GTWA 4M1DH 1EO7A 1VEPA 1YECH 4XBPB 4FHBD 3WJLC 2DIJA 4YC2B 5GS1A 3LKSA 3T4YA 3MOBH 4M02A 4YEFA 5CJXA 1LP9E 3C5JA 3L3KA 3LV3B 7FABL 3RVWD 4IEFB 4AMKL 5F3HB 5FYKH 1HH9A 2OZ4H 5GS1C 3VFOB 4JFEB 3CDGB 2FD6H 5CJXC 2D31B 4HWBA 4NUJA 2OL3A 4RGOH 4KQ4L 3RIFF 3K4ZA 1P4IH 3T2OA 1OWWA 4HXBL 4ZD3L 3BPOB 2H9GA 3IDIB 4KTEH 1OF2B 2BRRH 1ZWIB 5IHLB 1E27B 2NYYC 3BRGC 1O7VA 4I5BB 3BMVA 4UTBL 1FV1A 1T22A 2JJWA 2VDQL 4FXLA 4JVUA 1MLBA 4H0IA 4BM7A 5SV4A 5IMKB 4PB9L 3O6FC 4QRSB 1MCDA 3GSNA 4LAQL 3HAEA 1DUYB 5D2LB 4F15C 3SDDA 3E8UL 1EXUA 1GAFL 4YHLH 1F3RB 3QPQD 4PJ7A 5IEHA 5FM4A 4OBRA 4KFZC 2R4RH 2F5BH 2XG5A 1MQ8A 3RJDA 4YLQT 2QTEA 5JNYA 3BQUB 5CZXC 2VR4A 5J6GB 3HRZB 3LZFH 3P4OA 5KSAB 3MV9D 4EXKA 5F96H 3CPLB 2OP4H 2Y5EA 1YYMH 4MNQD 3SO3C 5T5FL 1B4JH 1JPFA 5C09E 2R1YB 4I3RL 3RIAK 3WIFB 3EGSA 3U7WH 5FHBL 3VFRA 2CH8A 4LKCA 2VL5B 2XA3A 1KCLA 2Y36L 4K2UH 5FGBC 2RBLA 1JPTH 4TSCL 3U79A 5HVWA 2W92A 2X1XR 2APBA 3MGTA 1G7LB 1FVCB 5SWZA 4X4YA 2J4WL 5HHQA 4HKZA 1YEDB 3RX5A 2HJFA 3I50H 3D9AH 4PGZA 1ZANH 5H94B 2XWBA 5HGHA 4PIRF 3O9WB 3WNOA 1KEGH 4MA7H 5I17A 1NBYA 2CDEB 1BIHA 2W9EH 3CUPA 3EFFA 3EO1B 4U1SA 1HNFA 1FG2B 4G6KL 3UX9B 5E2JA 4P2OA 1P7QD 4M61A 3RBGA 1EFXB 1T7WA 1ITBB 2IAMB 4EDXB 1EDQA 1N6VA 2VLME 4JJ5A 3WUWA 1AXSB 4JPIA 1CD1B 1Q9WA 1OAYH 2YN5A 4P2OC 3S37X 5L0QB 2ZWLT 4OFYA 2ADIB 5B22A 1I1YB 4S1SL 1F97A 3V5HA 1NCCL 4JREC 5HHPB 2GITB 3RDTD 4HC1H 2DQEL 4MJIE 2MWCA 3N50A 5E94A 4G9FE 1E4XI 1B6UA 3GIZH 3V4UL 4F58H 2XKSA 3ULUF 2YD7A 5IFHH 1CF8L 3FOMB 3KPOB 4EI5D 3RAJH 5C08D 2F53D 5CSGA 5HHXL 1DBKH 1U8HA 4QXUH 5CJOL 1FNEB 3WFDL 3WXVL 5EU3B 1Z3GH 4QF1A 5JW4N 4ODSL 4RBPK 5D1QA 1KJ3L 2HFEA 2P8PB 3DSFH 4PR5B 3IJSA 3C9NA 3LAFA 5ILTH 2A1WL 4OZIA 5I1IL 3TBTA 4H5SB 1CWVA 1NGYA 1VSCA 4NWUL 4YDLC 4E5XA 3QEQB 1FE8L 4C56A 5J1AB 1CLYL 1YN7A 4LQFH 2EDKA 1EHLL 4X6DA 3GHEH 4TSBH 1J18A 1KIPA 4D3CH 4XI5C 2GK0B 4LHUD 3L3GB 3DBXA 4OIAA 1N59B 1FL6B 1KV3A 4EUPA 1RJYA 2B0SL 1F42A 1EA9C 2GAZB 3KVQA 3IFNL 4BQCA 3ARFD 5F8QC 5DDHA 1KN4H 2AI0H 4QHUA 5KSBB 3L7FA 1U2HA 2HT2C 1BAFH 2W0LA 5ESQB 5BS0A 3QQ9D 1JGUL 3D3VE 5ALBL 3IRPX 4XX1G 1AP2B 1IEAA 4XB8A 2VLKE 3QUYD 5DFVD 4UUJB 1IILE 2EDEA 5F7HA 4KI5F 4I8DA 5ACMA 1NDMA 1U8MA 4MA1B 3BKYH 3EJJX 4PRNA 3MJGX 3HE6A 1H3WM 5ANMA 2WINB 4K7PX 2B2XH 1U8JB 3IKCA 5GS0D 5CJBA 1RZJL 1GHFL 3T0BA 3RGVD 5IQ9B 3SKOB 2Q8BH 1UZ6E 4WFFD 4Z0BL 4LP4A 1N4XH 4F80A 4FFYL 2VKWA 4JFFD 2ARJQ 4O5LH 1IRAY 5ECJE 4K9EH 1YNLH 5JA9A 4JHAH 5B8CA 4IRSD 4NM4L 1A14L 2I24N 5EC1A 1EEQA 1SHMA 5IVXE 3O4LA 1CFTB 4JANB 4U6XA 5IG7A 3GMPA 3PP3K 4ZUWB 5B8CC 1MFEL 1T1YB 3U2SA 5T3XE 3Q1SH 4QRRA 5E56A 2XZAL 4AIZB 1UEMA 2KPNA 1KSRA 1YMHA 4GRMB 5EUOA 4YPJA 1U95A 4P2QD 3S98A 4KRPB 2ICWI 4ZOEA 1A1MB 4JGUA 5FUCC 1NGQL 5I8KH 1YMMD 3OR7B 3VGAC 3Q3GA 4J6RH 1QPPA 4C4KO 2Y5TA 4Z7WA 3CU1A 1RZGA 3G6JB 3NTCL 1JGVL 3STBA 4OFDA 5D7IF 1TJGH 1HCFX 3EFDH 3SGDI 3ZE2E 4DGVH 5JIKA 1MWAB 3C60A 5MENB 5T1DH 5IQ7H 2BHUA 3C5ZB 4Y4KB 1DSFH 1LNUB 5GZOC 5FKPB 2AJYL 4QCIB 3DHJA 1MJ8L 4HMCA 4MZ2A 1CFNB 5TDOA 4RQQA 4CMHB 3SY0A 4PP2B 2IPKA 4PRPB 1FP5A 3DO3A 5E5MB 4JFHE 4L5FH 3ZO0A 4FFZL 2CKBB 2PYEE 1ED3B 1YUHB 2WBKA 3FN3A 1S9YB 2R1WA 4RNRA 4LVHB 4Y89A 5IVZB 3ZE1F 1Z2KA 4KDWA 4X9GA 5H35B 1TQCC 1HQRA 3PDDA 5IGXH 2CLVB 1JF1B 3I84A 5FOBB 4L8CB 4XTRC 1PY4A 3MXWH 1F58L 1OTTD 1JHKH 4WHTA 2IALB 3MGOA 3F65A 1RJLB 4O9HL 3O2WH 1MWAH 3KS0H 4ZFZB 2BCKA 4KRLB 4OCMC 1K3ZA 4MD5A 2R2EB 3TIDA 4KUCD 2Z8WC 2EZ0C 4OF3A 3KPQA 1ZGLM 4JJHA 5GGSB 5DHVB 4UU9A 4WJ5B 2IPUK 3P9LB 2HJKA 1TZHB 5L88H 2X05A 3DO7A 3BN9C 2RJMA 3GSQB 2MMXA 3VMPA 3T1WA 2ITCB 3QFJB 4XCNA 5C0ND 1J8HD 2VXVH 5K33A 2COQA 2VAAA 4FTVB 3WCYA 4P4KA 3SE4A 5BCAA 3BHBB 3QNXA 2DIAA 1YQVH 3KXFB 3HC0B 3O3AB 2YA0A 4C4KT 3MFFB 3QIBD 2CKBH 4WUUA 3SE4C 1HSBB 2VQ1A 3VI4F 2J6EL 4YHYC 1JNNH 2IANE 1GZPA 3U82B 1IAKB 5ERWB 1LP9A 5C0AB 4O58H 2BZDA 1RURL 1RZIB 2K9UA 3KPSE 4HHAA 5CUSH 5GGRB 3VXSA 5KAQG 2DLHA 4TUKH 3RL1B 3BP5A 4OM1L 2L0DA 3DETC 4RIRA 4Z8FH 3KYOA 2YMXL 3ULSB 1NLBH 2FEEI 5DO2C 3LPFA 3UTPD 3H7BB 4PJ9A 2FIRT 4KK9D 3OAZK 2DQCH 3T77B 1HINL 3NABH 3ILQC 4OUUB 4ONGH 1WWBX 3RWGA 4PJ9C 4J3OC 1UFUA 2WUBL 5DHVH 4QRPB 2OK0H 1LD9A 4I18B 5DYOB 1OTUD 1QPXA 3U4EA 1FO0B 1T0MA 5GIRB 4PJCA 5D7JA 4S1DD 2LU3A 4IRJD 4YDJB 3VXTA 3MLTA 3HZVA 2FZ3B 1NC4A 4M43H 5D7JC 1G7QA 4RAHA 1IM3A 4NQCD 4JRXB 5DJCA 3ECBA 2P5EE 5CEZL 4OIIL 5DRXB 2DD8H 5D7LE 4X99A 2YD6A 1IJ9A 4XX1E 2DYPB 2DAVA 3NFNB 5GJTL 1HILA 2YA2A 3F12A 2FL5B 2NXYB 4HCRH 3RUGF 5F9JA 5C09A 3U0TB 5CHNA 4MA3B 3TN0D 2LTQC 3K1DA 5IBTL 1BOGA 3V5DB 1CDYA 4LSUH 2NLJA 4XCEA 5F7WC 3EO9H 2NY5H 4XVTH 5FYJH 3VGGA 1EJ6A 2BMKB 3QWQB 1KB5L 4ZTOH 1FO0H 5FUOH 4LSPL 1C1EL 2EDRA 1MFAL 3Q6GL 3W0WD 4G80B 1R5IA 1S7WB 4BFEA 2VABA 1FORL 3RVUC 1HHHA 1KELH 3RU8H 4JFDD 4NHUB 2WLZA 2M26A 4A2MA 3FZUD 2VLJA 3ZDZF 5FGCB 2WW8A 5MERB 1I85C 1MUJB 3MLSL 2AJUL 3QG7L 1PQZA 5FECB 3BOVA 4GAJL 2ARJB 1FFPB 2FEDC 4OZHB 4E41B 4CVUA 3QI9B 1OTSC 5SX5H 4PY8I 1AIFA 4QOKB 4GKSB 4X7CC 4YHPA 2V17L 2E27L 1SY6A 4HIIB 3N85H 1D9KD 4Z5RB 3CSBA 1NC2A 5I8OH 4GSDL 5DJAB 4MJIA 2Y72A 4LSSL 2DOCA 2EKJA 4P5TA 5DQDH 4G9FA 5JHDD 3IDMA 3TBSA 3EDEA 4KUCF 1UB5B 1LO5A 1E6OH 1Y0LA 3P4NA 4YEEA 4P5TC 2NY2C 5GQBA 1QKZL 1K8DB 3ULUL 1IL1A 3G6AA 3ZKND 4GKOA 3OPZL 2RIKA 3IDYC 2ICEA 3P11H 3QDJE 3ARED 4PRHB 1NDGA 2BDNH 1INQA 1QSFB 5E5UB 3G04A 4M6MH 4YHKL 3KPNA 4P9ML 2EE6A 1SEQH 3MQIA 4CDGC 3O8XD 4ZUVA 1T20B 1FNAA 2Y06H 4JN2A 5JW4R 3MRFB 4H26B 4ENED 3QXAB 4NKDA 4PJEF 1DQQB 4Y5XB 4F9PA 3M45A 4WVRA 1AKJB 3KR3H 5DHXB 2R0LH 1H5BB 3LQAH 3MGAA 4F9PC 4YGVB 4MQTB 3FJTA 1H3TA 1FNGA 3KPPB 4J7RA 2DN7A 3M17A 5JZ7D 5KSUB 1B0GA 5LQBH 3RRQA 3D3VA 4Z77B 3DSNA 5C2UB 5FA3B 2VLKA 1WWCA 2VN4A 1NAKH 4CU6A 4M1CD 3BP6B 1Z5LB 2EEBA 2YKLH 4R90H 3VWJB 3EJYD 2IG2L 2FCBA 1F90L 2CXKA 5EBLA 5DRNB 4XP4L 3U7YH 2NY4C 5I1JL 4NCC1 2Y07L 5GHWH 3TBVA 3BGMA 3F58H 4U1JB 4LGRB 2QHLA 3QO0B 1G7JA 5HJ3A 5EIVA 4HK3N 2Z93A 4L4JA 1KC5H 4XP9H 4G8GB 5ICYB 5KJRH 1B2WL 4RDQF 4LQ1A 3WIHA 2R2CA 1BJMA 5IVXA 4C55A 2Q76A 1VKXA 1E4XL 2P7TA 4QTIH 3VXRD 5BRZE 1WK0A 2N7BA 3TVMB 2FX7L 1X5FA 1F4YH 3EJZC 1UYWH 1IC1A 2X4SA 1INEL 4LASH 2DWEA 4L4VD 2VIRA 4X6CB 1C5BH 3L7EB 3GB7A 4LU5L 1RZ8A 1S7RA 1RK1B 5A2FA 1MOEA 3HC4H 1MHEA 4X98B 3ULVE 1OM3H 3IU3A 3S34H 3CZJA 3OKMA 3TNNB 3TT1L 2J8UB 4PJHE 5E8PB 5I8CA 3SKNB 1F45A 2HH0H 4XPGL 1CFSA 1KCRH 3RY6C 3UYOD 3KG5A 1I3GL 5I1AB 1UB6A 3LHPH 5IB1B 2AVGA 1FVDB 2MJWA 4MSWB 3CFEA 1GPOL 2X40A 2Y7QB 2BSED 4M48H 5F1NB 3MUGB 1QSED 4P9HL 5BJTA 4U6HB 1I8MA 5D96B 4Y4HA 2VRAA 1NFIA 5E70A 3RHWK 3ARBB 3GBMH 3GMRA 5E7FA 1NSNH 2P45B 2UWEF 3VXNA 3KNBB 4GO6B 4L1HA 4PUBL 1SJXA 4QY8B 2YZ8A 1W2KT 4X7TA 4LEOA 3O2DH 35C8L 3DUHA 1XIWA 3WKNA 4FZ8L 2A77H 3KAAA 2NX5D 4GW1B 4YXHL 1MCWW 1NPUA 3V5KA 5CD3A 2X70B 3SO5A 2F9BT 1XIWC 4PJDB 3MOAL 4KZDL 3GSRB 3D85A 4XAWL 3ROOA 1J86A 3H2WA 4DVRH 4PRID 4CKVX 2PYEA 4JAMB 3LSOB 2X89D 1ZLVH 2L7JA 3MUJA 1T21B 3LKPA 2XTJB 1B0RA 1X4XA 1EAPA 3VWKA 4G6JH 4JFED 4F9LC 3BP4A 3UROR 2H6PA 3AU1B 3MRCB 4Z78B 1MPAH 4F2MA 4OLUL 5C0GB 5DD1H 2DJSA 3AVEA 3D1MC 3LKNA 1J05A 3NPZB 3Q5YA 3SN6N 4EN3B 4JFZL 5D1ZB 4MJ4A 3MA7A 3SDXB 3OR6A 1A4KB 2AEPL 1DQLL 1MCCA 4CNIB 4BQ8A 5B39G 3V4VL 5IMLB 1QHOA 3BW9A 5JA8B 1DCLA 3HG1B 5ACZB 5D5ME 5B38G 5K9JH 5HHOD 4GRLB 4TVPD 5I71C 4JKLA 5FFLA 1YNTB 5C0BB 2JCCB 1ULVA 5F7EL 2WBJD 1WAAE 4R97B 4P3CL 3WFHB 4GXVH 2EDJA 4ODUA 4PY7B 4DEPC 4KJWD 4HS3B 3DNKA 2ZCLL 4OGYL 1Y6KR 3PV7A 9CGTA 4V1DD 3TCLB 3EOAB 3SQBA 4DQOL 1AGDA 4P2RE 5CD5C 1B0WA 1XGPA 32C2B 3KPRD 1XAUA 3ABZA 2LQRA 1G0XA 1CCZA 2GI7A 5GS0L 4ISVA 3THMH 2VISB 3BGAA 1W0YT 3DIFA 3P0VL 4YO0B 3WO4B 3VFSB 2V7NA 2QSCL 1LEKB 4M1GL 4PJ7F 4X6FA 2UVFA 5DK2B 2PUQT 5F9AC 3GMMB 2R8SL 2D2OA 1HKFA 4PGEA 1KIQB 1A0QL 1Z9MA 4PJXB 1YEIL 3OAUL 3P9MB 3MRKA 2W0KA 4YHMH 4F7PA 4QXWA 3IDXL 1BEYH 4BZ1H 4QRUA 3VGBA 3WS3B 2BX5A 2VXTH 2PW1B 3DI3B 3I6LD 3S8WA 4WW2B 5C07D 3WE6A 5DRWB 2Y25A 5IF0B 5E2TL 3LN5B 3AGVA 3GM8A 3CFJA 4ERSL 2VZTA 4OTXH 3T0VA 2VDML 5T1LD 5JIHA 4P23B 5A2IH 5D7LA 4Y8DC 5JORA 3T2PA 4D9LL 2AEIT 3QCUH 1KLFA 3P30H 5E0QA 4FQXA 1L7IH 5TFSH 3D39E 4IMLB 1W0WA 1AGEB 3QEHA 4FABL 3PHSA 5HI5C 1BFVL 3MUZ1 3REWA 5HVHB 2OM5A 4NQSB 5K9QI 3JWDC 1PZUB 2RFXB 4HPYL 1NCDH 2YSSA 5C3TA 1SJHB 3TJEL 3UBXG 4G3YL 3K1KC 3QJFB 1T03H 3W2DL 4EVNB 2QHRH 4DK6A 1KJ2A 4Y5YB 5C0CD 4MJ5B 3MYJB 4YHIA 4OD3L 5I16B 1OPGL 1HK6A 1KJVB 1SYSB 1M05A 1Q1JL 1I7RB 1Q9KB 4HJJL 4IS6B 4RGMB 1EMTL 1WEJH 2Z31A 2JIXA 1MRFH 3BZ4A 3NCBB 2H3NB 2NY0B 1D5ZA 3EYVB 2VDKH 5FUZH 2Z31C 1UWXK 2FEEL 1XGYH 4WDIA 1FAKT 3QQ4A 1RJZA 1GXEA 3HZMA 4M6AA 1NUNB 1KG0B 2O93L 1R3JB 4OZIF 1LEGA 4UDTB 1I7UA 3QPXH 3O11B 1A7PH 4NC0B 5TDPB 2VXUH 2IC2A 2DJ4A 2C7UA 4QRQA 3CVIL 3MA9L 3D18A 3S37H 5I1GL 4YDIL 2NY3C 4AZ8A 3PGFL 5KOVC 3FO1B 1BVKB 1EEYA 1CIUA 4CVXA 5AD0A 2VO5A 4WTWA 4XMLH 3ARGD 3H6JA 5GS1B 4DZ8B 1U93A 4DFIA 3T4YB 4NZRH 3WUZA 2DDQH 3C5JB 3WIIL 3QDJA 1U6AH 5F6HI 2PTTA 1LEIA 5D2LF 3SKJL 1HH9B 2HKFH 5CJQL 1B4RA 1WFUA 1NAML 2CJUH 5BZWA 1I9JL 2OL3B 3QIWA 3VXQA 1F3JA 5ALCL 1UM4L 1I7ZA 5CLTA 2DMKA 2O5XL 2FNBA 4LPXA 1DBAL 3MNZB 3QIWC 5BV7L 3BAEL 1IKFL 4AEFA 1FV1B 3PXHA 3O6FB 3BT2H 5IROA 4ONFH 5T1MA 4RISL 3T0ED 2J2ZA 4F15B 2VNCA 1MJUH 2A0LD 3TV3L 5IROC 5A2KH 3GSNB 3HAEB 4BK4A 3TH3T 3LCYA 1S9KC 4KRPD 4JY4A 3LEVL 1RZKL 4NP4L 5L6YL 5IEHB 4JO2H 1ODAA 5LGHH 3GNMH 2AJXH 2B5IC 5LWYH 3NCJH 3FQNA 4I3SH 4XPTL 5EU6E 3SO3B 3P4OB 2B4CC 3BD5A 4PJ5D 4LCUB 3T3ME 1C08A 5CILL 3DYPA 4XPFH 4WRLA 3UO1H 4HWBH 4AL8L 2OL3H 3BKJL 3U4AA 4W70A 1ZT4A 2AXGA 3FFCE 5DUBA 3EGSB 3GKWL 3QYCA 4K7PH 5MEND 1J0KA 3C5ZD 5BRZA 3I6KA 2WUCH 2J1KA 3MRRB 4YZFF 2YWZA 1FL5A 5SWZB 5T3ZH 1K8IB 4HKZB 3PWLA 4WHDA 2H32A 4JFXA 2HJFB 1PW3A 4DAGL 3VMNA 3GSNH 4K3DL 4AT6A 2VUOA 3L5XH 3HAEH 4TOYH 1IE5A 2XWBB 1YEHH 1NBYB 1FNSH 3VRIB 1IAOA 1YEFH 1U8OA 2ZKHL 2PN5A 4U1SB 4HUMB 4P2OB 1Z9LA 4M61B 1JTOA 2VDNL 4LCYB 4KV5F 4TSAL 3CH8A 4JREB 5L2KD 1CICD 4JJ5B 5IB3A 3ULVC 1T6VN 5BO1H 5IJKA 3E3QE 2BVEA 1Q9WB 1P4BL 1X6NA 3VFGL 1YPZE 3V5HB 3IT8D 3KLHC 4YHZL 5IJKC 4JRWA 3MTRA 5HY9A 2H45A 1RPQA 2A9NH 2DI8A 3C8KA 2BVTA 5E94B 2DM3A 3MCKB 2AS5M 1U8HB 1A9BB 4K8RC 4QF1B 3QHFH 4YDLB 1M6OA 4FQQA 5KSBF 4XC1H 5J8OA 4OCXL 3IJSB 3C9NB 3OJMB 5F1KC 1VACA 3H0TA 4GKNB 4XAKE 1BGXH 3G5XA 1N7MH 3QFJD 4N1CA 3HNTL 1MFDH 1MF2H 3MLVH 4FTVD 1YN7B 1VFAB 4X6DB 2F5AL 1QRNA 5J56B 3QAZC 3MLUH 3B4NA 3MRQB 3T0AA 3TPKA 3EYQD 2HRPH 3H42L 4JDTL 5IMMA 5GGQH 1N8ZB 4MD4A 2EICA 2W0FA 3B2VH 5DDHB 1JWMA 4OGAC 2NY6C 3VGFA 4WV1C 3UZVB 4I0PC 3L7FB 5D7KE 1ORQA 1VEOA 5BS0B 1R0AL 1CTOA 2EDWA 5DMIH 1IEAB 1H15A 5C7XL 1VENA 4Z7VB 3SDAD 3IFLL 1JV5B 4Q6IA 4PRBA 2L7UA 1DBBH 1NDMB 3P77B 3PQYD 1U8MB 1OAZH 4RWHA 1QR1A 5FYJD 3VH8G 2GCYA 2C1PA 4PRNB 5I15L 4QRPD 1BD2A 3CK0L 1FYTD 3IKCB 4F7EA 2P8MB 3BKMH 1DR9A 5KTEL 5KS9E 2LU4A 1U42A 3SQOH 1RD6A 5ADPL 2DLFH 4UB0L 3MRDA 1S5IH 12E8L 2FHBA 1RK0A 1KXVC 2WWMD 1CGSL 1HHIB 4OI9A 5SWSE 5B8CB 1CBVH 1OQXA 3EHBC 1CVSC 5F3BB 1BOYA 5HYQA 1PAMA 2QQNH 1J5OH 4P2RA 1B9ZA 4K3EL 2VZUA 4Z6AT 5HYJA 2XRAH 4Y19E 5GRUL 3CFDA 6FABL 4NCDA 3U2SB 4PJCF 5FB8A 4JHWL 3MACH 4TNWK 4EJ1C 5HYSG 2NXYD 2WIMA 3FT4B 5CP7A 3U9PH 1PLGL 3BPNC 4BH8A 1EAJA 1R5WA 1YMHB 2BY2A 4LPYA 1XZ0A 1U95B 1B3JA 2A6IA 1QOKA 3LH2L 5EFIA 1CDBA 3V0AC 1EBPA 3MO1A 3VGAB 2ADGA 2XQYG 3WJJA 4GT7A 2AJSH 5D9SB 2LAAA 4L8BA 4PG9B 4HMEA 4Z7WB 3FQXA 2ITDA 1RZGB 1UVQB 4MVBD 2BRQA 4FXGA 4WWID 3TFKD 3T3PF 2I07A 1JZ7A 5F9OH 3ESVF 3I02A 2X6MA 4YWGL 1DBML 2VITA 1QEWB 3RWCA 3QDHA 4X9IA 5I6XC 4FNLH 5IKCA 3B9KD 1DLHB 1H3PL 5DZOA 5EOCH 1ZLWK 4JO4L 1HXYA 1CE1L 2PYFB 1AGCA 1V7NL 4UILH 3FO9A 5GGUA 2VDOL 4NKOB 3IB4A 1NANH 4M1DL 1YECL 2GJ6E 3QI9D 4QOKD 2W1NA 1MY7A 2YPLA 3D39A 1GRWA 2QL1A 3MOBL 1BX2A 3DVNA 3BIKA 3CSYA 2D7TH 3K8KA 5E8NB 5M94B 1J0IA 2ZOKB 1RHFA 2DQJH 1KYOK 2FD6L 5E03A 5TDOB 3C2SA 3HB3C 3SY0B 2BOCA 3UTSE 4KJYB 5DVMA 1RFDH 5T5NG 1P4IL 1ZSDA 5TDNA 3JWOC 4BSJA 1XF4B 5I66B 1TQCB 3LEXA 4KTEL 2BRRL 1K85A 3KLAA 3VXUE 4RNRB 1A6VL 4S1RH 5DJ6A 1VPOH 1AR2A 4KZEL 5GGSY 1WUNT 4B50A 2A83A 3CJJA 3QCTL 4F8TA 4PBWD 4UINH 4WHTB 1MCQA 5MP6H 4D9RE 2F8OA 3C6LA 2BCKB 4X6EA 5FO8B 3VFTA 4MD5B 4OV5A 4Z95L 1EO5A 3O45A 5LG1A 4ALAH 2R4RL 2F5BL 4PP1C 3STZA 4UU9B 2HJKB 4AEIL 1E0OB 3D0LA 3LZFL 4X9HA 3MNWB 4Y2DA 4ZDHA 4KU1A 3DO7B 2H1PH 4MCZA 5F96L 1JF5A 5GGRY 2OP4L 1IAIH 4K23H 1YYML 3TLRA 3VGEA 4GOSA 3MR9B 1B4JL 4Y2DC 1OAXH 1MSPA 1T7YA 3OL2A 4YHYB 5J4MA 2VH5H 5CIPB 1LO3H 3JWNC 3U7WL 1XCTB 2VQ1B 3B9EA 4P59H 3H9YA 4K2UL 3CXDH 3MBEA 3G08B 1LP9B 1JPTL 3KYMA 4BSWA 4HHAB 1J1OH 2R2HA 3BP5B 3NGBC 3MBEC 4XP6H 4TVPL 3FKUS 5H2BA 3JUYA 5LCVH 4RIRB 4HIJA 4ZUSA 3ORJA 1ZANL 4U1IA 5KANI 3RNQA 1NGXA 2G5BA 2AW2A 1KEGL 4MA7L 4PJ9B 2W9EL 4AEEA 5D93C 1DQML 2ERJC 3RI5F 5DS8A 1TIUA 4G6AC 5EOQH 5EBWB 4LCWE 3H3PH 5BVPL 3F5WB 3TF7C 3TPUA 2X4UB 1AY1H 3K7UA 5TPWH 1YEKH 1MCPH 3GM0A 1T0MB 4HKXB 3QXUA 3QIUA 4GXUN 5D7JB 1GZQA 1IGYB 3NIGF 5D2NE 1JZ5A 2LV4A 5IWLA 3VXPB 4Z7OE 4KY1H 3MLTB 1OSPH 3VXTB 3HZVB 4O00A 4HC1L 5DA4A 1G7QB 1T5WA 3DURA 2QADB 5CIPH 1UG9A 5IWLC 4OCWH 5BVJA 1X5LA 1P6AB 5EIIB 3KYKH 3LQZA 4X99B 5EU6A 1DBKL 1KPRB 3OKOA 3VGHA 5DUMH 1Z3GL 4YBQD 2VXSH 2D0HA 5DURD 2LTQB 3DSFL 4YGAB 5ILTL 3U36A 3ESUF 5F9JB 5C09B 1KXQE 5B39A 5CZVL 4OUOA 1QLEL 3FFCA 1BOGB 1FPTH 4LVEA 4LQFL 3FO0H 4XCEB 2F54A 3GHEL 4TSBL 5B38A 4D3CL 4EIZC 4F7CA 1DQTA 1E28B 4ZAKC 3V6FB 5C70A 4QEGA 1ACYH 1GOGA 5I1HH 2Q1EA 4NM8H 1U91A 2DQFA 2F58H 3HLAA 1BZ7B 3IJHB 5DFWH 4P46D 1IVLA 1UM5H 1R5IB 2G75A 3L95A 1KN4L 1BQHG 2AI0L 1CQYA 5MEQA 1HHHB 4U1NB 5KVEH 1BAFL 5LKNA 43CAA 4UMGA 3SE3C 1IGTB 4OT1H 4WY7H 2X10A 4XC3L 1TNNA 1PQZB 2NY7H 4UT7L 5EO0B 4O51B 4GBXC 4TTDD 3GSVA 3BKYL 3CU7A 4OF8A 1Y18A 1U3HA 1LILA 2EXWC 4UTAH 2EYSB 1NQBA 1VERA 2XTJD 4TTGA 1KT2A 3VD9A 3E3QC 2B2XL 5DMGC 2ADFH 2ATKA 2KUTA 1U3HC 4MJIB 2IMNA 4P5TB 1JBJA 4G9FB 1HOCA 1WZKA 4QXTB 3IDMB 1S7UA 2NY2B 3TBSB 2Q8BL 2DQHH 1N4XL 3X12A 1LO5B 4OZFB 3P4NB 4O5LL 3G5YA 3IDYB 4K9EL 1YNLL 4EN3D 3P0YH 3W11C 2D7NA 5DVKA 1JPGA 1GOHA 2R0ZH 4NZUL 4MWFA 1IL1B 4UBDD 3CDFA 1PGRB 4JQXA 5EA0H 3U4BH 2ICEB 1F11A 3CFBA 3U48A 1NDGB 5D6DC 5AZ2H 4L8DA 1WC7A 5C2BL 4QXGH 3Q1SL 1PSKH 1DVFC 3G04B 4JQXC 3GMQA 4HLJA 2M1KA 4ZOAA 5C0BD 4ZYKB 4ZUVB 4J12A 3WLWD 5HDQL 4NKDB 4WFEE 3LB6C 2CUMA 1FLRH 2H41A 4P57A 5DC4B 4OAWA 4RWYH 1LDPL 1SY6H 3UBXA 5F7YC 2FB4H 3ARDC 2AXFA 1FNGB 5DD3H 4NT6B 2DQTH 3M17B 4GKZA 1B0GB 4JZJC 4I77H 4ZO8A 1UKSA 3TT3L 1AH1A 2VLKB 3MRMB 4NN6C 1NUDA 4OZFH 2NY4B 4DGVL 4ODXA 3GGWB 1WTGT 5IQ7L 1A6PA 1JPST 2CMRH 1MAKA 4Q9BA 1ZHLA 2CUIA 2P8LB 1S7QA 4LDOB 4KK5D 3LKOB 4KDVA 5EH1A 1CGVA 1G7JB 1KCKA 2Z93B 1R3HA 3BPCB 2IPTH 3HI5H 2OJZL 2OXGA 1CVRA 5H37H 1A6UH 2MCPH 3WD5H 2VLRE 5F88A 1RY7B 3WNNA 3MMEB 5HPMA 5IVXB 4KJQC 4L5FL 1VKXB 2FIKA 1J11A 2P7TB 1JIBA 4LPUA 2EE3A 1RUMH 4PS4H 4X5WA 1KYOJ 1JI2A 2VJXA 4XZUA 5A2JH 1HE7A 2X4SB 1Z9OA 5IGXL 3ZKXB 2KQMA 2XQYK 4B5EA 2DWEB 3PHQB 2VIRB 1H0DB 5JPNA 3GB7B 1JHKL 1RZ8B 1NLDH 1S7RB 3PHOA 1MHEB 1NGZB 1WBXA 3PDGA 4U31A 4X5LA 1MWAL 3O41B 3IU3B 1QVOA 3OKMB 3E6FA 2P1YA 3FRPG 1UJ3A 5I8CB 5JTWA 4YAQA 4XNXL 3MV8D 5IBUB 1K6QH 2HTLC 1CFSB 3HI1B 1A1OA 2O26U 4XPHH 1J7VR 4PV9A 3VD3A 5L88L 2W60A 2VQUA 1NBZA 2W9DH 2CDFB 4P0DA 3OTTA 4PJDF 5E9DD 3VE0A 1S5HB 3NIFF 2VXVL 2YK1H 3FRUA 3QUMB 3QWOA 4YK4C 1FGNH 5BJTB 3WIHH 4HZLA 2NY0D 4PLKD 1NFIB 3V79C 5EB9A 1MQKH 3FMGH 3LKRA 1IMHC 4MXWH 1IC7H 1MAMH 3RZCD 2NTFA 2GJ6A 1LE9B 3VI3F 3GMRB 2CKBL 3DARA 1I9RH 4D0CB 1JNNL 4LKXA 3VXNB 5T3XH 3R8BB 1YA5A 4O58L 3RWIA 3O6LH 43C9B 1X5IA 3CH1A 4X7TB 5I19H 2XY2A 4LEOB 4TUKL 1UC6A 2BHZA 1XIWB 1EZVY 1OD9A 3HFMH 1QRKA 3HS0A 4PJFA 2BC4A 2C3VA 2Z4QA 3V5KB 2PR4H 3L3IB 4Z8FL 3UTSA 5HVGB 1NLBL 3RA7H 4NQDD 2IQAA 3ROOB 1I1AA 2DQCL 1N5YL 4X9BA 3WEXA 3NABL 1G7MA 2PYEB 2KL6A 3SKMA 3ARPA 3VXUA 2GK2A 4ONGL 5CP3A 1KCVH 2OK0L 5C86A 1I1AC 3SJVA 2ZOLA 3B6SA 3LKPB 4WFHE 4YIQA 3IXAA 4KKAC 3AAZA 4YPGA 5HI3C 1EAPB 2GTZB 4D9QD 2DM4A 1DANT 1PKQA 3BP4B 2H6PB 4KDTA 4PJBF 3WBDA 5C8JA 4F2MB 5EORH 3QUMH 3DTXB 1AHWC 3K3QA 1UCBL 4G42A 1CLOL 2X1WL 3LMJH 1ZTXL 1HHGB 2OSLA 3OF6D 4LSRH 1OB1B 4OKVA 2GSIB 3CFIC 4ZSOE 4YFEA 5TQ0L 1YJDL 2VDRH 5I71B 3O6FD 1UA6H 4NWTL 3F6IA 1CQKA 5T3ZD 1J0JA 4H88H 1FFQA 4M9PA 4QTHA 5GS3A 2D0FA 5ITBH 3HPJA 2PXYA 4DEPB 3FFDA 2UZXB 5D1XC 4P5KB 5ITFA 3UP1A 5CZXD 4ODUB 1D6VL 2FYYA 3UJIH 4LSUL 1G9MC 2PXYC 1P5UA 3EO9L 1ND0B 2NY5L 3RHWF 5I2IB 1MHHA 2DLIA 2IANB 5FYJL 1M71A 5ID0A 5DR5H 1AGDB 3KPSB 2E7CA 5L9DH 3TJHC 1XGPB 1Z9SA 4AH2B 3T8XB 5FUOL 4RMWA 5FIEA 3QUXC 5DEGA 4ISVB 2FWOA 2QQQA 3VFNB 2OS7A 2Z8RA 4NNXA 3ULUE 5GGVH 3KPLA 4D8PA 3UPRB 1KELL 3RU8L 15C8H 5IP4A 1P4LA 3ROLB 2V7NB 2EIZA 5F9DC 5TQ2L 1E4KC 4X6FB 1FZJA 4XMKH 4LCWA 5KZCD 3SCMD 3CLFH 3H9SE 4ZXBA 1BFOA 4J4PA 2OR7A 4IOFC 3MRKB 4MX7B 1ZHBA 2PO6C 4ZXBC 4J4PC 3IDUA 4U0QB 3UYRL 4L8SA 3OKNA 1XF2B 4ELMA 5I8OL 1KLUA 3DV4B 2BJML 1NCBH 3C87A 5DQDL 5D2NC 4NNYA 3R4DA 2P5EB 4Y4FD 2CQVA 5LGKA 1UADC 1E6OL 5D7LB 1FNFA 4D2NA 1M7XA 3PGCA 3B8YA 4BYHA 3DVGB 3HPLA 3PWPD 2PCPA 2R4SH 2XZZA 4HXAH 3P11L 3QEHB 2HAZA 1RULL 2BDNL 3VH8A 2AERT 2VQTA 3REWB 3RX8A 4MAUH 1RHHA 4M6ML 4KI5E 2DRUA 1SEQL 1Y6MR 2Y06L 1RAMA 4L9LA 2YPVL 2IBGA 2XG4A 3PWNA 1CDJA 4HUXB 3B9VA 1QLFA 4APQA 1KXTB 4GQ9H 3KR3L 3OB0K 4YHIB 2R0LL 1L9MA 3BP7B 1DEEA 1DJSA 4G8EB 4XWOC 1BZ9A 3FCTA 3CFCH 4M7LT 4D0BA 2JJTA 3EOTH 1OVZA 3AY4A 3NCCB 5LQBL 3GIVA 5GS2H 5J3HD 1PZ5A 2Z31B 1WF5A 2ZJSL 2JIXB 3MV9E 1NAKL 1D5ZB 3O3UN 1DTUA 3AY4C 4YNYA 5HYSA 4LSTH 5ISZE 1EGJH 4MNQE 2YKLL 3D0VA 4WDIB 1ZT7B 5A16A 2Q8AH 3HZMB 3JWDH 3CMOL 5EG6C 1M7DA 3U7YL 1WV7T 2WM0A 3SE8H 3GHBH 5IT2H 1I7UB 3DX9A 5GHWL 1I75A 1MJ7H 3F58L 5M7QA 1I3UA 1IGMH 2C7UB 4QRQB 2CLZB 3PG2A 2HMIC 2OR8A 5I0DA 4M8VA 1MCNA 1U8LA 5DTFA 4DGIH 1HQ4B 1Q0YH 5HHVH 1D5XA 5KJRL 2Y1VA 3KLDA 4OIBA 1EEYB 1ETZA 2FSEA 4O4YL 3P3YA 4CADB 3MV7D 4K7PY 3I2CL 4QTIL 4HUVA 5IESH 3QDJB 3S36L 1BREA 2PTTB 4ZNEE 1LEIB 1HHJB 5D7IE 1F4YL 1C12A 1UYWL 4P3WA 4LASL 4Q2ZA 4LLQA 3V6ZB 3K80A 2FBJH 3D69A 3I3BA 1RIUH 5TH2A 3TA3D 5DJYA 5IB4A 1WLHA 4GMTH 3QIWB 1HHKA 5IB2A 3LS5H 4DW2H 1C5BL 2O5ZH 1F3JB 3UAJC 3HC4L 1I7ZB 4OLYH 3G9VA 2YBRA 3OG6B 5E00A 3S34L 2OCFD 5IB5A 4HH8A 1KB9K 2HH0L 2NW2A 2R69L 1KCRL 3ARYA 5F93C 3VG0H 5C08E 2F53E 4KAQH 1F3DH 3MODH 3DMMC 3O6KH 1HSAA 4HK0A 1PEWA 5BQ7A 4LK4A 2B5IB 1HIML 4G6FB 4JFYA 4YHNA 3DECA 5DJ8A 4M48L 1SEBA 3ZE1E 3UC0H 1P1ZA 3FQNB 1MHPH 1CL7H 4BQBA 1MCRA 1A3RL 1NSNL 3UJTH 3NPSC 5JDSA 5EOTB 2YUWA 3RVTC 5IIEA 3O2DL 2V2WB 2MPAH 4R2GC 2A77L 4LLYA 1FLTX 4ZFGL 1S9WA 3BH9B 1IEHA 2AXGB 3O6MH 5DUBB 1T66C 3S96A 2VLRA 4AENB 4H0GA 3OKDB 2EE9A 1YEEL 1VGEH 2WQRA 3FQUA 4DVRL 3SGEH 1QBBA 3NAAH 3I6KB 4RDQG 2EYRB 1FL5B 1CGTA 4HUNB 3PWLB 2H32B 4KRMB 3QG6A 4N0CD 2J6EA 4ZPVA 4Y0GA 4HWEH 3BDBA 4H8WC 4G6JL 1A6WH 5HXMA 2I60H 2YXMA 1NANI 1IAOB 3MLXH 3ZKSD 4YX2H 1MPAL 3VI4E 5DD1L 3MROA 2B4CH 4DCQA 4PJHB 1I8KA 1HYSD 3T65A 5IB3B 1H3UA 2E7MA 1OW0A 4WFFE 3N1GC 4XTRD 5D8JH 4ZFFA 3R1GH 2Z91B 5HD8C 4LGPB 3E6HA 4DKFH 1OW0C 1QFHA 3JV6A 4XNMA 5K9JL 5EO9A 5HY9B 3AM8A 4XNZB 2V9RA 4M6NH 3LVEA 1YNKH 4GXVL 4OJFH 4OLWH 3AM8C 4Y16D 1J87A 4ZNCD 2CO6B 3TO4A 3BN9D 2AK4D 4J3SA 4RGND 4XGZA 3QT2A 1M6OB 4FQQB 2IADA 5DT1H 4P2QE 1CXHA 3HE7A 1OT1A 1T89A 1U36A 2H32H 5BXFA 3TO4C 4QHLA 1YY9C 1T4KA 1LO2H 3IXTA 1DE4B 2H8PA 3N1PC 3IFPA 3FT2A 2HFFA 2VB5A 2RHEA 3QAZB 5KVDH 3THML 4Z7VF 1T89C 4QRTB 4LIQE 2XICA 1S78C 1YMME 4RMSA 3ULVH 3EYOA 3QUZD 1JP5A 3GSXB 5E2UH 1MIEL 2BERA 2YEZA 2X2YA 3ARWA 2XKNB 3SDCA 2FLBT 1GGBL 2NY6B 4XVJH 4WV1B 1TENA 4I0PB 1KTLA 4ODHH 3WLBA 2ZSWA 1IAII 4GW5A 1JZ2A 3RUGE 2XI9A 3OJVC 1VESA 1U8PA 2DKUA 2P4AB 2W0FB 1ZK9A 1JWMB 5J9PB 4N9GA 2VXTL 1T1ZB 5AYUH 3DVIA 1ORQB 1EIBA 3EIFA 4LCCA 3L3JA 1X5HA 3V7MA 1LGVA 4GAYA 4K8RH 3NA4A 3GJFK 1H15B 3MLWH 4K55A 1BQHA 3G5ZA 5FK9A 4LCCC 3BXNB 4ZSOA 4UT9H 3PE9A 3QCUL 4I0CC 3P30L 3RWDA 1L7IL 1BVLA 5D5MB 4EZMA 4XCFH 4F7EB 3MOQA 5E2WL 1J1XH 3IS0X 1MVUA 4RX4D 3WN5C 2YC1A 3ZDZE 4PJAB 3PL6D 4L3EA 3DVFA 3CC5A 1TJIH 3PF2A 3EKCA 3TBYA 1HCVA 1I1FA 5DSCA 1JRHH 1RK0B 2QKIA 1NCDL 5F70A 4WGVB 1QO3A 4HIHB 5HYQB 1G9EA 1QSZA 1P9MA 1A2YA 1T03L 5D71H 3U0PA 4P2RB 1AGFB 4R0LA 1XR8B 1JK8B 2QHRL 4G8IA 2HP4A 3BPNB 4GFTB 3QUKA 4KUZH 3CFDB 1XGQA 2HLAA 4LPCA 4ESKA 4PJGA 4IMKA 4ORZC 4LAJH 1DLFH 5HHME 3S4SB 5CP7B 4JHZA 4BH8B 4MYWB 4UIKH 1XZ0B 4XP5H 2A6IB 3RKPA 3BSZH 3HUJA 1JGEA 1WEJL 1R5VB 4GH7B 4PJ8D 3ULUC 1FCCA 1MRFL 3GJEA 1KTRL 1PG7X 3MO1B 1II4E 2J88H 3QRGL 4HBCH 1JN6A 2IH1A 3MV11 3H9SA 4WWKD 1J8HE 1A7BA 4KMTH 5FUZL 4BZ2L 1B90A 1RV6X 5K9OA 1QQDA 2XZQH 4L8BB 2ENSA 4MNGE 5I6XB 1Q9OB 1XR9B 4HT1L 3FQXB 2DMCA 4M3KB 4TVSa 4FXGB 2XIDA 3QPXL 5KG9A 3I02B 1KFAL 2VZ1A 2NZIA 3GI8H 3FB8B 4PJEE 4N68A 2FEDD 1EK3A 5IKCB 2EDTA 4IIQA 4M4RA 3IF1B 1WIPA 1OTSD 2F74B 4L4TE 3S37L 1AGCB 5GGUB 1UWXH 2BSRA 2UY6A 3TP4A 4DZBA 4XMLL 4YBHA 3QZWA 1MCEA 3D39B 3UTPE 5C3LD 1A1NA 2A6JA 2P5WD 4NZRL 2SEBA 1BX2B 2DDQL 3DVNB 3BIKB 3LIZH 1RJCA 4MQXD 1U6AL 2CLRA 3ZKMC 1S7XA 1F8TH 4HUUB 4MQSB 1OD7A 5GRWA 2V9TA 1U8NA 3L3DA 2CJUL 2BOCB 3VXMD 1NL0H 4U2YA 2DM2A 4TYUA 3NACH 5E08H 1ZSDB 4MXQD 2C4XA 5TDNB 1MCOH 4KI5C 3AB0C 4PBXA 2EYTA 2P44B 4HFUH 4YFLI 5JXAH 3TIEB 4NQXB 2DWDA 4EI6A 5DJ6B 5E4IA 4NQCE 4CU8A 2YRZA 2OR9H 1G7PA 1NMAL 4FOMA 4TNWF 3BZDA 4LDEB 1I7TA 5IM7B 4ZS7H 2X4QA 3G5VB 2WWKO 3MV9A 3BZEA 2MQ3A 4WI6A 4YBLC 4X6EB 3VFTB 3VFPA 1LO0H 4OV5B 1QBAA 4MNQA 4JHBA 3C2AH 3O45B 5LGHL 3GNML 4FQ2H 2AJXL 2O61B 1JPSH 3NCJL 2AKRB 3F7RA 4I3SL 4I18C 4L3AA 3D0LB 3FL7A 4XRCA 2ICCA 4Y2DB 4ZDHB 1AO7D 2A9MH 5C9KA 4FQCH 4KK6D 4MCZB 5F7LB 4AY0A 4HAFA 3FRPA 1CDIA 3JWOH 4ZG1A 1MRDH 1WBYA 2DI9A 4XPFL 2WLYA 4HWBL 4BSVA 2OL3L 4CAGA 1XGUA 2HWZH 3RVXD 1A6TB 2NY4D 3GMNA 3W0WE 2MCG1 1UM6H 4JFDE 4P2CG 1QA9A 3RNKA 4PYGA 3SKUD 3IAQA 3NGBB 3MBEB 2EH7H 2EDDA 2J7LA 3DWTA 3KYMB 4QWWC 2WUCL 2XXCB 1D5IH 1MLCB 1P7QA 5D7IA 5T3ZL 5J06A 3GKZA 4JG0H 1SM3L 2R2HB 3FO2A 3UDWA 5DEFA 5E24E 3GMLA 5H2BB 5D93B 2ERJB 3FQRA 3DUSA 4ZUSB 3GSNL 1LO4H 4M7JH 3L5XL 4RMRA 4TOYL 2G5BB 5E4EC 1AQKL 1YEHL 5HYFA 4P4RA 2BY3A 4OCSL 5DRZA 4R6UA 2UWEE 5K9QG 3RDTA 5HBBA 3CMGA 5JHDE 3TPUB 1LVEA 2FX8H 2IMMA 3QP3A 5BO1L 4HJGA 3RDTC 4Y88A 4EI5A 3QIUB 5C08A 2F53A 3L3HA 4ELKB 4ETYA 4FQLH 3QJHA 3QFDA 1NGPH 4LLWA 5DD0H 3UTQA 2VZVA 2X1OA 3HA0A 1IT9H 1ZEAH 2A9NL 1FFOA 2CGRH 4R26H 5FF6A 2J5LC 5GRXG 5BVJB 4HS8H 1ZAGA 2HVKB 5GZND 1A9EA 4I4WB 5C9JA 5EU6B 4RFEA 3QHFL 1S9VA 3GSWA 1T6WA 1GSMA 5D7SH 4CVWA 1U92A 4LHUA 4KHXH 1BGXL 4N0FA 5DMKB 1N7ML 1GC1C 1ZA3B 2X4RA 3U9UA 1A4JB 4POZC 2P48B 2YWYA 1IZJA 4L3CB 5DJXA 5B39B 4XWGL 4ZAKB 2FR4A 3ARFA 3CD4A 3GJFA 3FFCB 1MFDL 5A1AA 1LQSR 1N3NA 4M5ZH 3MLUL 4F7CB 2YZ1A 2XY1A 2NPLX 2HRPL 3NFSH 4WIQA 3T1FB 1U91B 4MQ7A 3HLAB 3QUYA 5GGQL 4JRYD 4KQ3H 3QQ9C 5F89A 3L95B 2G75B 3B2VL 4OFVA 2FX9H 4ZUTA 3QUYC 5DFVC 4GBXB 2I9TB 2V7HA 1NCUA 43CAB 1U8KA 1FYHB 2CRMA 1L0YA 5LXGH 3FHAA 4ZUUA 2XV6B 3V6BR 2V2XA 5HHNA 3RGVA 1CN4A 5EU4A 2LU7A 1TNMA 3QH3A 2OTWB 3GSVB 5IEKB 4QYOB 3VFVB 1OAZL 4JFFA 1U3HB 2ICWJ 5I9QC 1MRCH 2RB8A 4JN1H 1UH4A 3RGVC 1U8QA 1YPZB 5I1EH 4IRSA 3T4AA 1X4ZA 4NN7C 4YQXH 4HJ0D 2ATKB 2VC2H 3B8SA 4JFQB 4CU7A 4PJFF 4PJ7E 1CK0H 1RUQH 1P69B 4IRSC 3SQOL 2DLFL 4W4NA 1S5IL 4R4NC 3G5YB 3GRWL 2CIIA 1CBVL 4L4VE 4MDJA 1NCTA 3WSQH 4P2QA 2BNQD 4JO3H 3SBWA 1KPUA 2QQNL 1DVFB 4PRAA 1J5OL 5DJDA 3RWFA 3MLZH 2ZSVA 1F11B 5EPMB 2XRAL 1JFQH 4L8DB 5DHYB 2X4OA 4CVZA 3SBWC 1VFBA 4NKMB 3GMQB 4K07A 3M07A 1ZGLA 1YMMA 3U9PL 2PTUA 2QR0A 4F33A 4IOSD 1MCLA 4Z76A 3ZDYF 4NKIH 5I1KH 1TFHA 2CIKA 3QB7C 1GYAA 2I25N 3MLYH 3NZHH 1AJ7L 1PG7W 2D0GA 4P57B 3ARDB 1BJ1H 4OAWB 2IAND 3B5HA 1AXIB 4KKLC 3RUGA 1AFVH 3KPSD 4JZJB 3UBXB 1QSEE 3HN3A 2AXFB 4NN6B 4HX1B 2D4DA 4XP1H 1K3IA 1P53A 5DMJB 5F9OL 2BVOB 4MAYC 3JBG7 1XGRB 2KDGA 5EOCL 3F7VA 2UY7A 3NIDF 4JKKA 3MRPA 4ODXB 4LNRA 2IBZX 4UILL 5C6WH 2NX5E 4KKCD 4FN0A 3ZYOA 5EC2A 2YHGA 4LLUA 5F1IB 4GJTB 3QO1A 3MX0A 1S7QB 2H2PC 1EFQA 1HWGB 2D7TL 4PRIE 4DN4H 5KS9B 4WEUD 5HGBA 3WS6A 1R3HB 3WYRA 1ZLWH 2HFTA 4ZS6D 5GS2D 5J12C 1QG3A 2P5ED 5SWSB 5F88B 4FZEH 1RFDL 4QHMA 4QHNA 5K93A 3WS6C 5HPMB 4M4PA 4OZIE 4R4BA 2FIKB 3KJ6L 1NFDA 3ZL4H 4NGHH 4X5WB 1JGDA 4Y19B 3L3OB 4C56E 1FFNA 1OTTC 3KDMA 3QHZH 1LE5B 1H8NA 4M7LH 2CD0A 5B3NA 3MUY1 5JPNB 1MFCL 3IAGC 4ELMF 5JO5A 4RFOH 4M62H 4U1KB 2QSQA 4UINL 1BBDH 1WBXB 5FXCH 3BEVB 5MP6L 3CZFA 5E6ID 5EZJB 4E0RA 5HHOE 4TVPE 1NAMA 1QVOB 1J8HA 3E6FB 5IMOA 4BUGA 3LS4L 4YAQB 5D2LE 3W9EA 2Y23A 1T5XA 3CDCA 3QNYB 4ODWA 4PV9B 1TZGH 3QIBA 1XCQA 5JUEH 3W9DA 4YK4B 2H1PL 2AGJH 3CCHA 3TNMB 4V1DE 2YA1A 3VE0B 2C3HA 4PJEA 3MJ6A 1IAIL 4K23L 1WGOA 4XPAL 4JY6B 3FRUB 1MI5B 3KPRE 2GY5A 3QIBC 1OAXL 3QWOB 5E6ZA 1I4FB 3GMOA 3HZKA 2EDQA 1LO3L 5ANME 3LKRB 2NTFB 2GJ6B 1J0YA 5AWNH 4DTGH 2DLEA 2DTMH 5JW3H 4NHCH 3GZKA 3CXDL 4LKXB 3RWIB 5INDA 3CH1B 1DP0A 4W6XB 5BMFL 1J1OL 2HG5B 3TO2A 4F8QA 3TZVC 3O4OC 2FGZA 1DN2A 4XP6L 2NY3D 5LCVL 4FQIH 1PJ9A 3UTSB 4PD4K 2C3WA 3QQNA 2IQAB 5GGVY 4IRJA 4XXCA 4U3CA 5C07E 1I1AB 3O4LE 1CGUA 1C5CH 3WEXB 4KQ4H 5EOQL 4JZNA 5FO7A 3SKMB 5DQJA 2H2SC 4IRJC 4XXCC 3B3IA 4QRRE 4ZD3H 3EO0A 1AY1L 4NQCA 1L7TH 2ZOLB 3B6SB 4NQED 1AHWB 1MCPL 4YIQB 3IXAB 3V7AE 4UTBH 2DLGA 4UV7L 5T1KD 3GSUA 4J3WA 3VJ6A 3PP4H 5C8JB 5CEZD 2W65A 2M8XA 1F13A 4KY1L 1OSPL 4G42B 3MRGA 1DQJA 1F2XK 4TPRL 1MCKA 4YZFE 2QV2A 1T2QH 4LAQH 4IDJL 1AD9A 1GAFH 2QQLH 3TN0A 2OMBA 3IS1X 3BZFA 4HGMA 1S8DB 5DUML 1MVFA 2R1XB 2NR6D 5D1XB 2VXSL 3TN0C 1DEDA 4QTHB 3E2HC 4KMQA 3JVGA 3P2TA 5I0ZA 3HPJB 2PXYB 2ATPA 4PGBA 3FFDB 4PY8J 5C0CE 1A8JH 4KV5E 3MJ8A 1TVBB 1CGXA 4G6FD 5ITFB 2FJHA 3W0WA 3BWAA 1FPTL 1VB9A 1GGIH 3FO0L 3DROA 2G2RA 4JFDA 4P23C 4ONHA 1AD0B 2IFFH 3QUXB 4HEME 5BZDA 1M71B 5CP3H 4PLJC 1ACYL 1IGIH 4PJIA 5FHBH 4NNPH 5I1HL 4NM8L 3HMXA 5ID0B 5LBSH 2F58L 5E8EB 1G6RB 1INDH 4X0KA 5T5NF 3VCLA 1NCWH 4PTTA 1QR4A 1FRGH 5CBEA 3WHXB 3FZUC 1HH6B 3UPAA 2FWOB 1J8KA 5IW1A 4LL9A 1FZKA 3L5HA 4NNXB 5FO9A 4JGMA 3KPLB 1X5KA 2DQDH 5MEOA 1OSZA 1IM9B 5KVEL 2EIZB 4YH6A 5CWSA 4N0YH 2H26A 4OT1L 1FZJB 1D9KA 4WY7L 1OQOA 1CL7I 1G7HA 5KSBE 4JM4H 2NY7L 2PO6B 5JHDA 4ZXBB 1BFOB 2X7LA 1D9KC 5E2VH 1BLNA 1YDPB 4OGXH 4MB4A 5KBNC 2Z0BA 4UTAL 1ZHBB 5D2NB 3KGRA 2I9LA 1Q94A 3V95A 3EYFA 3OKNB 2ADFL 5F21B 4RGMC 4NPYB 2A6DB 4S1SH 2MFNA 5EDXA 3SGEI 3CNKA 3HNVL 3AREA 3ULVD 5DZNA 2DQHL 2BNRD 5CGTA 2DBLH 2OJEB 2QLVB 4RMQA 3P0YL 5JW5A 3O8XA 1A6AA 3V4UH 3KLHD 2R0ZL 3OV6A 1LWRA 4D94A 1ZS8A 1G6RH 4FXKA 5TGBA 3UTZA 3HPLB 4Q97A 1ORSA 2PCPB 4OFPA 3U4BL 3O8XC 3QULA 2DKMA 3VH8B 2Q6WA 4ENEC 2E3VA 2APXA 1KIUA 1PSKL 4H25A 3OGCB 3MNVA 1F4XH 3WL9A 3V52H 5IHZA 3RTQC 4LRNH 3DXAB 4WU5A 5SX4H 4WUUE 3T0EE 5I8EA 4WENB 2EO9A 1N2RB 5B3JF 1IKNA 1GVIA 3VXSE 1JNHA 4Z18A 1EHLH 1FLRL 1PVHA 1QFUH 4YHOH 4LDLB 1DDHB 3BDXA 5JZ7C 1CXFA 1O7SA 4U0RC 3STLB 1RQ5A 1BZ9B 3FCTB 2FB4L 1GGYA 3FT3A 3BPLC 1C16A 3DGCR 1YYLL 5CGMA 4NQVA 4HKBB 2ESVD 5GSRA 4I77L 4YFDB 1PZ5B 1S7TA 3EJYC 1Q8MA 4PJ5E 5F7MC 4FQHB 4LBEA 1A3LH 5HYSB 5KANG 1JL8A 1MNUH 3D0VB 2YR3A 2C1OA 5FV2A 5J6HB 4WCYH 3MJ9L 4I0PD 4PJCE 5A16B 2CMRL 4XNYL 5DVOA 1M7DB 4BH7A 4OI8A 1QFWH 4LFHD 5KVMC 3DX9B 3O81A 3X14A 4ETQB 3VXRA 3SDYH 2Q86A 3S5LB 2FECI 2J12B 4IHOB 3SDDC 1WBZB 4MLIA 2IPTL 5DTFB 1U8LB 4R7NA 2DICA 2MCPL 3WD5L 1OAQH 4L4VA 1ETZB 3NZ8A 1NFKA 2FSEB 1QHPA 1IGFL 2NXZD 1G6VK 4HUVB 3T3PE 3Q6FB 1X6LA 1C5DA 1RUML 4NM4H 1A14H 4ZO7A 3F62A 1MHCA 1ZVHA 2BSSB 4NRYA 3RWJA 2AV7A 5JOPD 2XKUA 4KVCH 4M7KL 4Q2ZB 2LE9A 2VZOA 4PG2A 3TGXA 5L2KE 3EHBD 4N0UE 2YD2A 4GAGH 5TH2B 5IB2B 2WIIA 5LVEA 2ORBH 2YBRB 4MJ2A 3ZZ1A 2AABH 5E00B 1LK2B 2UYLA 4GRWF 3X11B 4GG6F 3DMMB 2CDGA 1QSEA 1ZGLP 2NW2B 5L7XH 1K6QL 5SV3A 2FRGP 5CSBA 5I74C 2VLJE 4XPHL 5AEAA 1JVKA 4J3TA 1NGQH 2W9DL 1JRHI 1LK3H 2KZ1B 4PRDA 4HK0B 4XCYA 3FB7A 4JFYB 5DJ8B 4YHNB 2YK1L 4TRPH 3RWEA 3NA9H 3RY5A 1FGNL 3OZ9L 1HKLH 2IGFH 3NPSB 3SPVB 3WIHL 2NX5A 2BY1A 5CKAA 4K94C 3VXOB 3FMGL 4MXWL 1IC7L 1MAML 1S9XA 4FTVE 5GSVA 1D5BA 1YEJH 4R2GB 1I9RL 4NN5B 5JDSB 4LLMA 5T3XL 4PRIA 1DUZA 3O6LL 4UT6H 5IIEB 4LNVA 4G5ZH 5ICXA 4HS6A 5I19L 3A6OA 4GXUM 3W5NA 4PJGF 1CYGA 3BH8B 3HFML 4U1LA 2X89A 4KKBC 1IBGL 5L2JB 2XN9D 3LV3A 5CGYC 5F6IC 3A0OA 1S9WB 3HUJF 2VLRB 5F3HA 4OD1L 2FDBP 2KQNA 4JFEA 3MRBB 1MJ8H 3BRDA 4UI2A 4M6OH 2D31A 4FG6D 5C0DB 3I3EA 4NYLA 1HWHB 2G9HA 5D1QC 1F4HA 3OKLA 1KCVL 1W8OA 4PD4J 4D0DA 1JYXA 2A74A 4KGLA 3AC0A 3QG6B 1KN2H 1ZWIA 1E27A 3I75A 3PQYE 2K3TA 4ZPVB 5FYJE 1T7ZA 4XVSL 4QRPE 5DF0A 5J57B 1RMFH 5EORL 2BK8A 3QUML 3QDMD 5A40E 5IMKA 1L0XA 4F7MB 1FYTE 4DWHA 5HHOA 3MROB 2JB5H 4HWNA 4DCQB 4HH9A 2VZ3A 3LMJL 4JDZB 1H9VA 4LSRL 5D2LA 4KROC 2WBJA 4NIKB 5IJVA 4MDIA 2VDRL 3K8MA 1UA6L 2F19H 2WBWB 5IUSA 1ZMYA 4H88L 2WBJC 4V1DA 4FQ1L 1PG7H 2EKSA 4MA8H 3P9WB 5EO9B 1HN1A 5J6GA 4OB5H 4JGJA 2R9HD 5TF1H 5ITBL 1JHLL 4KJWC 3KPRA 1WZ1L 3VA6A 3CPLA 3H9HA 2Z8SA 2CXGA 1LDSA 3TO4B 2FJFA 3UJIL 2VL4A 4HC1A 5D4QA 3NIGE 3D2UD 4H8WH 2YUVA 3HE6C 5BXFB 5DR5L 5L9DL 2VL5A 1T4KB 2ZP0T 4Q0XH 2H8PB 3FT2B 2J6EH 1KENH 4XNUH 2HFFB 1ZA6A 1RURH 1FZOB 4FMFA 15C8L 4I48A 3EYOB 4OM1H 1X5AA 5C07A 3REVB 5C6TL 3I6GB 4K71C 5H94A 1XH3A 2OMNA 3MRNA 4XMKL 1KTLB 3BISA 4PJAF 3RVVD 1FG2A 4GW5B 5INCB 5T1LA 3T2NH 3HNSH 4HKJB 3HC3L 1EFXA 4N9GB 2WUBH 1ITCA 1AXSA 1CD1A 4LCCB 3L3JB 5AUMB 4G6AD 5FCSH 2ADIA 1WVZA 1NCBL 1BQHB 3G5ZB 4XB7A 5FK9B 5C0JB 4ZSOB 3NFPB 3WN5B 3QXTA 1D3CA 1BVLB 3CLEH 1OGAB 4HFWB 1EEUA 4YXLL 2XNAA 1MVUB 3PWUB 2EC8A 2R4SL 4HXAL 1FNEA 2V5YA 5EU3A 2QBWA 5C0CA 3TBYB 1I1FB 5DSCB 2QKIB 1X5XA 3C60C 3N06B 3ZSSA 2KZWA 2ZPKH 3GUTB 4OLVH 1A2YB 3DGGB 3U0PB 1Q72L 4F57L 4UOJA 4GQ9L 2HT3D 3QUKB 4RMUA 1XGQB 1N59A 4G8FB 3CFCL 3RI5K 1C1EH 2VMFA 3EOTL 4ZAKD 1R3LA 5F6HJ 1JGEB 1FORH 5ELIA 5KSBA 3RL2B 2IFGA 3GJEB 4GG8A 3BUYB 1JN6B 3H9SB 1ZVSB 4LSTL 1JZ8A 1EGJL 3OB0H 4WFGD 5K9OB 4ODTH 1AP2A 3QG7H 5L8JB 4UUJA 3UYPA 2Q8AL 4ZPTA 3HR5A 5CLWA 4W6WB 4CJ1A 1UACL 1JF6A 1MEXH 3GHBL 1IQDB 3ARGA 5IT2L 3N9GH 3ZTJH 4GBXD 1N5AA 1L9NA 4JFPA 1IGML 1U3ZA 1IC5L 3ARGC 1T1WB 2BVPA 4GSDH 4DGIL 1Q0YL 5HHVL 2BSRB 3O3BA 3BE1H 2XXMB 3IFOB 5J13C 3QZWB 5DMGD 3QDGD 4NRZA 4HF5L 4MHHG 4PYHA 5IESL 4JEGB 3V8CA 5FYLE 3ULUH 4OLXH 2FH8A 4OKDA 3ZDXF 4ODVL 1S7XB 5FGSA 1KNOA 1J0HA 1CFTA 4JANA 1U8NB 3W11D 3AB0B 3L3DB 2FBJL 4S11A 4P4KC 1RIUL 3T0EA 1BMGA 1T1YA 1CDUA 4GMTL 3LS5L 4DW2L 4F7TB 4BFIA 5A3IC 4XBEH 4UOW1 5J0BA 3T0EC 4GRMA 3FQTB 1DVFD 2Z92B 4EI6B 3OSKA 4MS8D 3DX7A 4YR6B 3ARUA 3R8QA 3DUUA 1G7PB 3VG0L 4YBLB 2R29H 4KAQL 4LEXL 1I7TB 3MODL 3KPMA 3LB6D 3OR7A 4UDUA 2X4QB 3MV9B 4PJ5A 4UQ3A 5ISZB 4MNQB 4FQPA 4HBQA 4U6YA 3VD4A 3ARDD 3FN0H 4Z9KB 1MHPL 4HWZB 4JY5H 3VGDA 1CL7L 4TULH 1MWAA 5TE4H 1E4JA 4WO4D 5F1SA 5MENA 2FO4B 1EO8H 2RR3A 3QA3A 3C5ZA 4LVNC 1CFQB 1CGWA 1WBYB 5A43C 2XOTA 2BP3A 1K4CA 2MPAL 2A2QT 2Y07H 4BSVB 1XGUB 2VXQH 1CIDA 2QADC 3GMNB 5IBLD 1OOAA 4R8WH 2HA1A 4Z7UF 5DC9B 4ZQKB 4QCIA 4X83A 4P5MB 1VGEL 3RNKB 4QGYA 4Y1AB 1AXTH 2E6JA 3EDKA 3NAAL 1CE6B 3JV0A 1B2WH 2HLFD 4PJDE 5D7IB 1SBSL 5E4EB 3FO2B 5DEFB 1CXIA 3NIFE 2JK5B 5DJZA 3AMKA 4NRXA 5L2KA 2CKBA 1CICA 1ED3A 1YUHA 2X4PA 3FQRB 1DL7H 2BXYA 4N0UA 3DUSB 1S9YA 2FX7H 3HAEG 3OX8B 4S2SB 1A6WL 3LDBC 4KJQD 2NNAA 2I60L 2FGWH 2JB6B 3ILPA 3VI3E 2K7PA 3UTTD 3MLXL 4YX2L 5SWSD 1JF1A 4YE4L 5DRZB 5FOBA 1WTLA 3KS0J 1HZHH 3IGAA 3RDTB 1Y6NR 1RI8A 2B4CL 5ESVA 1AQDA 1RJLA 5DEZA 4HJGB 4Y19D 1T2JA 4JM2D 1N26A 5D8JL 4ZFZA 3HCVA 3R1GL 2R2EA 5C08B 2F53B 3L3HB 4ORGB 4X4XB 3WNKA 2J5LB 4XPGH 3QJHB 3QFDB 4CUCA 1VFMA 4AQOA 5DHVA 4WJ5A 3P9LA 4H1LB 1FFOB 5FF6B 3GSQA 3UBXI 3NCYP 2ITCA 3QFJA 1YNKL 1A9EB 2BSTA 5C9JB 4OJFL 4OLWL 1NMBH 4FTVA 5C0BE 4NO5B 1NFDF 4RFEB 5DT1L 1TVHA 3GSWB 4V2BA 4PJBE 4KRNA 3KXFA 1L6ZA 1U92B 4W6YB 4LHUB 4N0FB 1HSBA 5I18H 3PXJA 3U9UB 3HR6A 5KVDL 5ERWA 2FR4B 5GGRA 4QT5A 1MI5D 2OLDA 5FCUH 3I3DA 1YJDC 3ULVL 4CL7A 4NSKA 5J11C 5E2UL 1V3JA 1ZLSH 3BIBX 2FECL 4XVJL 4DUWA 3MOAH 3QUYB 1OP5H 2OI9C 4KKNA 3SDAA 3C6SB 4DKEH 4FMKA 3T77A 4L29A 3PQYA 4KTDL 1LHZA 4ZUTB 4OUUA 3H3KA 3MXVH 4UIMB 3SDAC 2V7HB 4QRPA 5AYUL 1U58A 1WICA 1A7RH 4H1LH 1O5DT 1SMOA 1U8KB 5DYOA 2ZG3A 4JR9H 5GIRA 5DK0B 1FHGA 1FYTA 4K8RL 2HVJA 4ZUUB 5I9QB 3MLWL 5HHNB 3RGVB 1YZZA 2GYSA 4NN7B 1GC1H 2FZ3A 1F5WA 4JQIL 4LLDA 4OV6F 4CBPA 4IRSB 5IFJA 5DVLA 3T4AB 4WW1A 5DRXA 2AP2A 2AEPH 1DQLH 4KJPD 3DRTA 3V4VH 1AR1C 4JVWA 2R2BA 1E4WH 1TJIL 4H0HB 1A64A 1KGCD 3CVHL 4F3FB 1JRHL 2XTLA 2CIIB 1J9CT 3K8LA 3PIQB 4MA3A 4MDJB 4NO0D 1M4KA 2V2TB 2GSGB 4P2QB 3HRPA 5DJDB 4ONOA 3RWFB 2OTUA 1URLA 5D1XD 1A6ZA 4KUZL 2X4OB 4CVZB 2EDXA 3SGDH 4X5XB 3VFMA 2JE8A 2BMKA 1ZGLB 3MV8E 5C92A 1YMMB 2QR0B 4F33B 5JOEA 1ADQA 2Q87A 4UIKL 1W0VB 4XP5L 3AXLA 4G80A 3BSZL 2CIKB 4HUWA 2VTFA 3P0VH 2APTA 5E9DE 1DFBL 1BPVA 3QUXD 4KXZH 4NZTH 1T3FB 3B9KA 2YD9A 3QQ3A 4MVBC 3TFKC 3RUGB 4YDVB 4OZGF 3W5MA 2XZQL 4MAYB 2X44D 3VMOA 4OZHA 1YEIH 3B9KC 3OAUH 2YD8A 3QI9A 1F6AB 3ZKXC 3IDXH 4R4FH 1X3DA 4QOKA 1IM9D 4PPTA 3DHMA 3GI8L 1TJHH 4JDVB 5C0IA 1Q0XH 2DB8A 2DQUH 3MRPB 1IFHL 1PX3A 5DJAA 3OQ3B 4JM2F 2PO6D 1VFUA 3WFCH 5IV2B 1MJJA 5EC2B 5FYKD 4PJIF 4LLUB 2VDMH 1FGVH 1T80A 3QO1B 1PD6A 4NQDE 3OMZA 5J12B 3X13B 3LIZL 1X5ZA 3ME0A 4LIQH 1K8DA 1V3KA 4P3DA 3V9FA 4EQ3A 4ZO6A 5DZLA 2OXHA 2PF6A 4WUKH 4PRHA 4NC2B 4FABH 2B1HH 3BKCH 1FC1A 1BFVH 1NL0L 3U0WH 4D9QE 4QHMB 4QHNB 4Y4HC 5E08L 4M8QA 1MCOL 1ZT1A 3H3BC 4J1UA 5GGTH 3OJDB 4OZ4A 4HFUL 2VLLA 1BWWA 4N5EC 3FB5A 5JXAL 5E8OB 3QXAA 1FFNB 4MCYB 4U7KA 1DQQA 3KDMB 3W2DH 4Y5XA 1JGLH 1PYWB 5HHMB 2DLTA 1QRNE 4Z7QF 4OD3H 1JCKA 4LF3A 4R7DA 2AJVH 4NO3B 3DXAD 4YGVA 4ZS7L 1Q1JH 3S6CA 5T3ZE 4OQTA 1OAUL 4M93C 5CINH 3NH7H 4E0RB 1LO0L 1J8HB 1EMTH 4Z77A 4XWOD 4Q9CA 3C2AL 1A7QH 3W9EB 5TF0A 1T5XB 1IC4H 1JPSL 3BP6A 1Z5LA 4MNGB 5DUPH 2ZCKH 4ODWB 2DQGL 2G60H 2Q7YA 3QIBB 2A9ML 5SX4I 5JMRA 3VW3H 3VWKC 5JHLL 1YY8B 4WI7A 5DRNA 2WP3O 3L5WA 4PJEB 3JWOL 1CZ8H 1MRDL 5CAYB 3DX6A 2GFBA 1K2DB 4WGWB 3D25B 5ENWA 4ZFOA 4L4TB 4I2XE 1P2CB 3GMOB 2AEQH 3HZKB 2WZPD 5K59F 4CW1A 1SYVA 1UM6L 1BD2E 2PETA 3TZVB 3O4OB 5ICYA 2EH7L 4OBSA 5IK3A 2HMID 1D5IL 4FQJH 4JG0L 3VG9C 2CRYA 3K2UH 4KVNH 1LO4L 4XVUD 4M7JL 3MYZA 4G7VH 4Q9QH 4IRZH 4HGWA 3UZEA 4GMSH 3BQUD 4IRJB 1NAMH 5KSAD 2WV3A 1QFWI 2OQJB 5IVOA 4LMQE 5HYJE 3ZT7A 4X6CA 4JZNB 5DQJB 5KSVA 5ALCH 1RK1A 1UM4H 2XFXA 3BWUC 4NQCB 4X98A 4NZDA 1HXMA 2JLLA 2J8UA 3NN8B 3UAJD 5ID1A 1UXWB 3SKNA 3VJ6B 8FABB 2W65B 1NGPL 2X09A 5DD0L 4POUB 1ZEAL 3MRGB 3PWPE 4W81A 4AM0A 5I1AA 3JTTB 2CGRL 1DZBA 3S7GA 1AD9B 4HS8L 4A2LA 3TN0B 3LEVH 1JNJA 2Y7QA 3BZFB 4R96B 3DMMD 3E2HB 3MUGA 4N8CH 4FS0A 4U6HA 3QEUA 1JYNA 1KPVB 2APVA 3O9WD 5D7SL 1REIA 5I76A 5J7CC 1Z0MA 4GLRH 4KHXL 2AXHA 2MKWA 3KJ4C 3KNBA 4QY8A 1EFXD 3MJ8B 2IAMD 3ARZA 2FJHB 5CILH 4P46A 3W0WB 2CR3A 2UVEA 4M5ZL 4AL8H 5HI4C 1FVEA 4X8JA 2YPLE 4GW1A 4JFDB 4ONHB 4J3UA 2NQCA 5BZDB 3RVTD 5AZEH 3NFSL 4OCYH 4P46C 3GKWH 3OJ2C 4P49A 2QJDA 4FQXC 4PJDA 4R2GD 2WP3T 4X0KB 3HMWH 3SE9H 3VCLB 4A6YA 3KYNA 4IJ3C 5GISH 3CDYA 5CBEB 4KQ3L 5IW1B 1FZKB 5FO9B 2FX9L 2P47B 3LSOA 1OSZB 3EZ8A 5C0RH 2AV1B 1NGWB 4TTDC 1T21A 4RA3A 5CWSB 2H26B 3QEGH 1D9KB 5LXGL 1U0QA 1G7HB 2UWEB 4RCAA 1X7QA 3MRCA 3FONB 5JHDB 4EOWH 4HLZH 5C0GA 3QEQD 3VRJA 1BLNB 4Z7VE 4TSAH 1MRCL 4JN1L 3DV6B 4RSVA 4EN3A 5AG9A 2I9LB 3PNWB 3SDXA 3EYFB 4YQXL 1P4BH 2VC2L 3MV7E 5HDLA 5IMLA 1FAIH 3M1BA 5ESAB 4OD2B 1CK0L 5ACZA 1MFBH 5E1AA 4N9OB 4DUXA 1ZKAA 1TITA 2D9CA 1JUFA 3O3DB 5DMYA 3S36X 2IQ9L 5C0BA 5JW5B 3O8XB 1A6AB 3HMXH 1ZS8B 4PJBA 5TGBB 1E6JH 3UTZB 4X6BB 4HS3A 3R0MA 3MLZL 3RTQB 5C0FA 3PWVB 3QULB 3X3FH 4EBQL 1JFQL 1JI1A 1AE6H 2Q6WB 5IR1B 3WLWC 2GTWB 4H25B 4RZCA 1I8LA 3MNVB 3WL9B 32C2A 2DIBA 5E1HB 4WU5B 3ZMRA 1RIVH 3LKSB 1AI1H 4NKIL 5I1KL 5HDBF 3L3KB 1I8LC 1KF9B 4U0RB 1YY9D 3MLYL 1JNHB 4YO0A 4R9HA 3BPLB 4J3VA 1LEKA 5FUCE 5DK2A 4JDTH 1AFVL 3A6BL 4NUJB 2HN7A 4MZ3A 4FFVC 3FT3B 1C16B 1OLLA 3P9MA 4NQVB 1FNLA 4XP1L 1T1XA 5GSRB 2GIYA 2H9GB 5EUKA 5FM5O 2DL2A 1OP3K 1T22B 4OZFG 1EHAA 3LN5A 1MLBB 1EVUA 3GBNH 3K4DA 3S3SA 3RWHA 4KK5C 3IFLH 2UZIH 4M03A 2XYCA 4BH7B 3SDDB 3T09A 1EXUB 4X4MA 5I15H 1FFRA 3O0RH 3X14B 4PJ7B 4DN4L 2Q86B 2X42A 4O2EA 4WI4A 3VFWA 3DI2B 4HAGA 5H37G 5JNYB 2JKXA 4R7NB 2YD3A 2ZZUT 4FZEL 4L4VB 3NZ8B 1VADA 4J8RA 2C3GA 4WEMB 2JJUA 1CXEA 1ZOXA 1SVCP 5CEXA 1SJHA 3ZL4L 4NGHL 1JPFB 3RQ3A 1UWEH 1OGAD 2IJ0C 5JMOC 3QJFA 3H9ZA 5GXBB 1XF3A 3QHZL 5HGAA 4EVNA 3MV8A 3VFRB 1M7IA 3K2MC 2F54E 4LKCB 4M7LL 4MJ5A 3MCLH 3MYJA 1PEZA 1VA9A 4NJ9H 4M62L 4Y4KD 2LVEA 1KJVA 1SYSA 1I7RA 3MGTB 1BBDL 4NOFA 3TWCL 1KCSH 4MXVF 4X4YB 5E9DA 5HHQB 5I74B 2W0PA 1HYRC 1QSEB 3CGTA 1CFVH 5HGHB 3EYVA 5I17B 2MHAA 3RZCA 3CUPB 3EFFB 5E99L 1TZGL 5JUEL 2AK4E 4RGNE 1R24A 2AGJL 4PRDB 4PRPD 4XCYB 4PLKC 1KG0A 1R3JA 3HKFA 3RZCC 1A22B 3S35X 3O11A 3RWEB 4JPIB 3WUWB 1ERNA 1DBMH 1UJTA 1DN0A 2NX5B 2YD1A 2OTPA 4OF6A 3K74B 1H3PH 3N1MC 1S9XB 4JO4H 1CE1H 1EPFA 1WIOA 4K3HA 4X7SL 5GSVB 3WJLA 1D5BB 4DTGL 4JO1H 5JW3L 2DTML 1KULA 4NQDA 4NHCL 4LLMB 4Y8AA 3BEWA 1BVKA 1QYGH 3FO1A 1DUZB 4PRIB 5F6IB 5ICXB 4HS6B 4Z7NF 4LOUC 4TN9A 4HMDA 4JFOA 2EXYD 4U1LB 4DZ8A 5ADOL 5MHSD 3OB8A 1D5MA 4XNZC 4FQIL 5D70L 4U6VH 3FN9A 5D1QB 2HFEB 3GI9H 3KHQA 4C54A 4OZIB 3JTSA 3TBTB 1C5CL 1NGYB 2R0KH 4NYLB 1UWGH 1VEMA 5IBUG 3ZKMD 2G9HB 4E5XB 4C56B 4OM0L 3HHRB 3OKLB 4KC3B 1RU9H 4D0DB 1L7TL 2A74B 3OF6A 3MNZA 3I75B 1KIPB 3QWRD 1TLKA 3KXFD 3O6FA 1A6VH 3N1FC 4KI5D 4GW4A 4K94H 4KZEH 3DBXB 3PP4L 4KROB 5EZOH 4EUPB 1RJYB 3B2UC 3QCTH 3AS3A 5C0AD 5HHOB 2C9AA 2CK2A 4HH9B 3RKDD 1T2QL 4X4ZA 4QHUB 2WBJB 2QQLL 4DVBA 4MDIB 5IJVB 4S0SD 2V5TA 5GRJH 3MSPA 4Z95H 5DFTA 1QNZH 4JE4B 1OP9A 3X17A 4V1DB 2EKSB 3MRHA 5FDWA 4N8PA 4AEIH 5FV1L 5I75C 2I5YH 3KPRB 3GSOA 4I2XA 4LCUA 3HE6B 4I9WD 5ISZD 2EEDA 3H9HB 4KK8D 4U7SA 5ANMB 4Q6IC 1K4DA 2FJFB 1GGIL 3BGFC 5DD5H 3GO1H 5JXED 3QCVH 3WNMA 2IFFL 5FGBA 1CR9