2Q8BL

Structure of the malaria antigen ama1 in complex with a growth-inhibitory antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
SIVMTQTPKFLPVSAGDRVTIICKASQSVSNDVVWYQQKPGQSPKLLIYYASIRYTGVPDRFTGSGYGTDFTFTISTVQVEDLAVYFCQQGFSSPRTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1
publication title Structure of the Malaria Antigen AMA1 in Complex with a Growth-Inhibitory Antibody
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2007-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q8bL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q8bL01
4YHMH 4WV1B 3EYSH 4LLUB 1JRHI 4OD2A 5E8PB 2AJ3B 3JWOL 5I1JL 1RHHA 2WW8A 3X11B 2C7UB 1KEML 5MHSD 2Z91B 3VXSA 3DHJA 1SEBA 1MREL 1YEJL 4G8GA 3P77A 1GGUA 5C0NC 2W65A 4WW1A 3DX9B 2N1KA 1T5WA 4LNRB 5BO1H 1OSZB 3CX2A 4Q7DA 5DMIH 3GKWL 3QUYD 2HT3D 3HLAA 4OLUL 3HNSL 4HH9B 4WJ5B 4NSKB 3KG5A 5HHVL 3RX7A 4Q74A 2DQHL 3HC0B 2V2XB 1FL5B 4UDUA 4PLNC 3BESR 3LRGA 4UV7L 2VWEC 2YRLA 1K9TA 3PDDA 3BEWA 1HDMA 3BE1L 3RL1A 4ZUVB 2XACC 5ALCH 1K8IB 3QNXA 1KIPA 4QEGA 4IMLA 5CBEB 5GS0H 1WWCA 1X5JA 1F00I 2O61B 2R2BA 3TPKA 4U2ZA 2NX5A 2Z31B 4L3ED 3VWKC 3VFRA 3S88L 2JELL 5IV2B 1DDHA 1VPOL 3QUXA 2V9QA 4XP5L 1S5HA 1MCOL 4U1GC 1CCZA 2YA0A 1U8PA 4MAUH 4UU9B 3W2DH 4Q6YA 4ZD3H 3F7VA 1OGAE 1J1PH 4QLRA 3CK0H 4GSDL 4WFFE 5HHMB 4YK4C 4P5KA 5B3JF 3TV3L 3F7YB 3PGFL 4L8SA 1KCSH 4LCWB 5IB3A 1HNGA 3L3IB 5F7MC 5IP4A 1A6VL 1KFAL 1Q72H 5CAYB 1ES0A 2NYYD 4WUUA 5JIPA 4KWUA 4UBDC 5HHOD 3C8DA 1GZPA 1QOKA 4WI5A 3WLBB 3MLXH 3QG6A 4PRPE 3U0PA 3L3OB 3QRFM 3UTTA 1OT2A 5TPWH 4XRCB 2YEZB 1J05A 4H0IA 1T22A 1U3JA 4A6YB 5E7BA 1BGXH 1NL0H 3QEQE 1V3JA 3BP5A 3DV6A 1X4ZA 1JN6A 1MCRA 5EU6B 4NKIL 3AS3A 3CFCH 2DI9A 1JHKL 3WIHH 4OI8A 3NGBB 1MQ8A 3U1SH 4JY5L 1LILA 5I16B 1MAKA 1Z2KA 3MV7E 4Y2DD 4L1DA 3WFEL 1KTDA 1FLRL 4NGHH 4XBEL 5GGSB 4F8TA 2VXUL 1QFHA 4KV5F 4G8EB 5EIIB 5I1IH 4LAJH 2XZQH 3D39A 4S1QH 5C9JB 4G43B 1CG9B 3TVMC 2DRUA 4HS6A 4L3CB 3VWKA 4ZUSA 1MPAL 5E4EB 3EGSB 5E4IA 2LAAA 4RIRB 5L2KD 1L9MA 1F5WA 3ULUF 3HMXH 1M7XA 2C1OA 4TQEL 1N2RB 3GGWB 3LKPB 3EFFA 5HDQH 1DQLL 3EOTL 2ZSVA 3RZWA 4OLXH 4KI5C 5F93C 3GSXB 4NJAH 1EA9C 4D8PA 3C6SA 2X4OA 3EO1B 1MRCH 5DHYA 1HQ4B 3T3PE 4LFHG 4XZUA 5E8DH 1BFOA 1W0VB 1YMMD 5ADOL 3ARPA 4JCMA 3PF2A 1UZ6E 5IOPB 3MJ6A 1RK1B 1WFUA 3IFLL 1BQLL 4MCYA 2VLME 4WVRA 5LVEA 1CU4L 4Z7VA 2F19H 4XWGH 1FHGA 2J1KA 5T3XE 2BHZA 2WBKA 1D9KA 3PWLB 5JORA 1T0PB 1IM9A 2PO6A 2QKIA 2GIYA 3TZVD 3ARFB 1MCHA 3U6RA 2GTWA 1VFUA 3B9KB 3O8XA 4ZTPH 8FABB 3MRFB 5I17B 4OGXL 2D03H 1UWEH 4RFOL 1T89C 3IXAA 4PJIA 1BJ1H 3Q5OA 2HFEA 3QUMB 3HKFA 2V17L 4JRXD 5ENWB 3IU3B 4KH2A 5GJTH 1IKNC 3V0VA 3MOBH 3TVMA 2EIBA 4KZEL 2AJSH 1CIDA 1A6AA 2JE8A 3PWNA 4ZNEA 1CDGA 4X7DC 3TN0B 1J0ZA 3QRGL 4UDTB 1P6FA 4OZHF 3BWAB 1PZ5A 3AC0A 1RULL 2BY1A 1EGJH 1XF3B 3W11D 5CJBA 1JTPA 2MKWA 3GHBH 5T5NG 4YWGL 3W39B 1C12A 1GPOL 4ZPVA 4G5ZL 3BZ4B 3LIZL 3TNMB 4PUBH 1G1CA 4R9HA 5CEZD 3RL2B 3HNTL 3RQ3A 7CGTA 1WC7B 5JLZB 2PCPA 4XT1C 1WFOA 4ZUUB 2GHWB 3MZGB 4KDTC 4I5BB 4Z5RA 4J23A 3MUGB 3WBDA 5LJYH 1CS6A 4Q9BA 5IVZA 3QPXL 3LQAC 3DBXB 5FA3B 4Q6IA 5DUML 5BV7C 1S7QB 5EBMA 3GM8A 3VG0L 1S7VB 2IH1A 2IEPA 4S1SL 3G5YA 1WBZA 2Y7QB 1AGEA 3P4OA 3MPCA 4V1DE 4Z9KB 3EYVB 2CIIB 3HPLB 5JW5A 1P7HL 4GW1A 5DJ0B 2CDGB 1CGSL 5MERB 2GJ6B 1GCFA 3WJLA 2H26B 1T89A 1MCDA 4PJ9C 2VDML 1CZ8H 5CUSL 1MEXH 1RZKH 4PRAB 4OSUH 4H0GA 4P57B 3VGAB 1IKNA 3E3QE 1I1AC 3OKLA 2YWZA 2F5AH 5ILTH 4JO2L 4K7PY 4X7CC 2C3VB 1LO2L 2GW5A 4BFGA 3D2UB 4YQXH 5TF1L 4JZJB 1XAUA 5ITFA 1G9MH 1TIUA 5A2FA 1CXLA 4IHOB 4OCYL 1A9EA 4RAHA 4MS8D 1FH5L 4OV5A 1T4KA 4WU7A 3QXWA 4JPVL 3NPSC 4FFZH 4WEBL 5FYLD 3BPOB 4OD1L 1HH6B 2XQBH 2WP3O 4KDTA 1AKJA 3N06B 1F8TL 1W0WA 4MJ5A 4JPIB 2UZIH 3BKYL 3NACL 1D7FA 1S7SA 2HN7A 5DD1L 2OTPA 3REVB 1CWVA 3HPJA 1XH3B 4XC3H 4QCIB 4BZ1L 5IM7A 1HHHA 4PJEB 4IRZL 3HS0B 4MX7B 4JB9L 5JIHA 4S0TD 1I1YA 1XCQA 3OBAA 2YA2A 1PBYA 1T83C 3I6GA 2ERJC 2PF6A 1OGTB 3MRBA 3DETD 2OI9C 5EA0H 1YC7A 4KZDL 4WFHE 3JWDH 4B0MM 3SKJH 4M62H 1CLCA 5HHME 2B5IC 4KROC 4LLQB 1OPGH 4PRHB 3HAEA 4KRPD 4N5UA 5EFIB 1ZLWH 4PJ9A 1GYAA 4LCWE 5CEZL 2R0LH 5E2UH 4E5XB 1QO3B 3MBEC 4IJ3B 4JM2F 4Q2ZA 4PBXA 4TSAH 3RIFF 3ULVE 1G7HB 1I1AA 1MFCL 3DSFL 4RISH 4HWEH 3LEYH 4PYHA 5I75C 1B4JH 4NFCA 2GITB 3CFIC 2EIZB 4MA7L 1ZLSL 4L8CB 5GZNC 4N0YL 4PJXB 4HWZB 2R0WL 1DTUA 5C3TA 5BS0B 3WXWL 5EU6E 1IQDB 3X12A 2I25N 1QLEL 4K9EC 3MR9B 1F58L 2IQ9L 5C8JB 1F11B 3RNKA 4DKAA 1NGXA 1RZ7L 3TO4D 1IGIL 1ZXQA 3D69A 2VXTH 2EDJA 3QXAB 5E6ZA 4AIXA 2HJKA 3KXFA 4NN5C 2DWDB 1TVHB 2F58H 1F4YL 1QR1A 1A2YA 3T4AA 5JZ7D 3UC0H 2CRZA 4TUJB 4NRZA 4DKDC 1MHEB 2M26A 3FQUA 3DRQA 3NA4A 2DQEL 4ONGL 2VLJB 1JWMB 3ARSA 2DM4A 2QHRH 5SWSA 5J12B 5EWIL 3H0TB 4X7TB 2CH8A 2CO7B 2DQDL 5F71A 3I02B 4OZ4A 5DI8A 5IHLB 1IQWL 4KVNL 4JO4H 3ZT6A 4JM4H 3OQ3B 3DXAB 3VFUA 5KVFL 3FQWB 5IEKB 1T83A 2IBZX 4OD3H 1IAMA 2GJZB 5C0AE 3MRKA 2FIKB 3D25B 3U4BL 3V5KA 4CADA 2G60L 2V7NA 1J5OL 1KT2B 4U6VH 4Z78A 4LIQH 2WM0A 3KPLA 3BVNA 4GBXB 4KK8D 4U2YA 2X4TB 3VXQA 5FKAA 5FYLL 1DBMH 3MBEA 5IIEA 1GVIA 3MRDA 4JO3L 2EDRA 5J9PB 5CEYB 3QQ9D 2VE6A 3TBWA 2XTJD 4HPYH 5JTWA 4FTVA 1C5DB 5DD6B 4Q9RH 1UG9A 4P5TC 4KAQH 1CTOA 2F53B 3IAQA 5IK3B 5DQDH 2W07A 5GGVH 1Z9MA 5E1HB 4BKLB 4WFGD 3NFSH 3U2SA 2WLYA 5FKPA 1MH5A 4OGAD 4ZUTB 3T0EB 1JWSA 3LV3A 1NCWL 4ZNCD 4MWFB 4BELD 4TNVF 5HDOA 3P11L 3VXPA 1JGUL 4O2CA 1OSPL 4NNPH 2R2HB 3MCLH 3EJYD 4UOJA 5DD0H 3BD4A 5D6CA 3X3FH 3TO2B 2EEDA 3BGFB 4JFEB 1BOGB 3NIFE 4ZFZA 2QHLA 4NHUA 2EXWD 5JXEC 5DJYA 4C56A 1TXKA 4OCXH 4G9DA 4GW4A 2AI0L 1A21A 3ZDYE 4JHZA 2E8ZA 3HZKA 3LH2H 1R5VA 4X8XA 3DI2B 1A1OA 1P2CA 1PW3A 2YN3A 5B4MD 3VWJC 5HXMA 2NW2B 5HGAA 4HIIB 1G7JB 4DWHA 5DJ8B 1P7QB 4JVPA 4LSSL 4PB0L 1MHPH 3WIFA 4NM8L 3UTOA 4U0RC 2DTSA 4NN6C 7FABL 1AXSA 1BBJA 1JF5A 4U1SA 3QUZD 2Y1VA 1FO0B 1UWXK 1YEHH 5TQ2L 1KC5H 5C2UB 2NXYC 2RJMA 3GRWL 4Z7WB 1U9KA 3OG6B 5EOQH 1MLBB 3Q3GB 2IBBA 1TJIH 2YUWA 3RUGF 4BSWA 5FB8A 3RNQB 2AQ1A 4PPTA 1FNEB 2CR6A 1RZGA 3L3DA 5JDSA 2WANA 4U3CA 5DUBA 4JO1H 4JFQB 1U58A 2R9HD 2HTLD 4NZRH 4ZQKA 4C54A 4XTRD 2QQLH 4X6CF 3BUYA 1GHFH 1AD9B 1T1YA 3O4OC 4QHKI 4N1CA 3HR6A 1FJ1B 2ICEA 1Q1JL 3TNNA 2H1PL 2Z35A 2G2RB 4HHAB 5D71L 4N8CL 1H8NA 3HR5A 2W38A 3ZDXE 1C5CL 5I1CH 4X9GA 5F7EL 2GJ6E 1NEZB 3OKNA 5CP3A 2EDWA 4OZHA 5DVOA 2OK0H 4FXKB 4JG1L 1UM5H 3KR3H 4C55A 2APXA 1LDPL 5INDA 5DJCB 1PFCA 3ZT5A 4YHIA 5ERWB 5JXEA 1R5IA 4ELMB 4OTXH 5I9QC 3FMGH 2VC2H 4PGDA 1T7VA 2V5MA 2XOTA 1RZFH 3VWJA 5I73C 2AK1L 4LLAA 1FGVL 1RHHB 3SEPA 3JV6A 3EOAA 1B2WH 1J0HA 5AZEH 3VXSB 1MCWW 3U7YH 1RURH 1SEBB 2P1YA 2NY6B 4G8GB 4CJ0A 3P77B 3RU8H 4JCLA 4RMUA 4WW1B 5C08D 4M5YH 1QYGH 1PG7X 3X14A 5E99H 3IDNA 4BQCA 1NAKH 4F7EA 1FVEA 4BZ2H 3OJMB 3QI9C 4I9WE 1I8IA 4U6YA 5F7DB 4OGYL 1CDCA 1BJ1J 1R3IH 2EYRB 2QQNH 2ZUSA 4UDUB 4CJ1A 5IB1A 2C4FU 3BEWB 1HDMB 1S7RA 4PJEE 3TBTA 3RL1B 2CUHA 1A5FL 3QAZC 4JM2C 1KIPB 1FAIL 4IMLB 5SX4H 1HZHH 4DUWA 1X5GA 1M4KA 5JHLH 1BJMA 2X2YA 3MLVH 4W6YB 4MXQC 2R2BB 4PD4K 4RFNC 1FV1B 4GXVH 2NX5B 3NOIA 3OGCA 1VFBA 3DVGA 3VFRB 3NFNA 4XNZB 1HINL 1DDHB 2YD1A 3QUXB 1EJ6A 1I3RA 1S5HB 3LVEA 4IDLA 5TH2B 3KPSD 4ZFOA 3O6FD 3RGHA 2JB6A 4M7JL 1U8PB 3STZA 4HS8L 1T6WA 4K3HA 3F7VB 3IXTA 1G0YR 1HIMH 1TZHA 2X10A 5FHAL 3I75A 2IADA 1J8HD 1RUPH 3KWWB 3FQTA 4P5KB 3BGAA 3RY6A 1ZANL 5ANME 4DW2H 3R8QA 5IB3B 2P5WE 4WU5A 5E8OA 3PWPD 1ES0B 5A2KH 4WUUB 2P7TA 4ODWA 5DC4B 4K2UH 2H3NA 2AQ3A 1KLUA 3TJHD 5AAMA 3QG6B 3U0PB 1RAMA 3UTTB 4R0LC 2F8OA 4MB3A 3V5DA 3KLSA 1J05B 3FHQA 1D6VH 1T22B 2BRRH 4LOUC 1RUAH 3L9RA 4B7LA 3RWGA 1R3KB 1U8LA 5CZXD 3BP5B 3DV6B 1JN6B 3QI9A 2WWKO 3EBAA 3T0VA 2OMBA 3JUZA 5D7JC 1MNUL 5MEOA 3QB7C 2VLJE 2IBZY 4JN2A 1DBBH 2HMID 1IE5A 5AZ2H 1G6RL 1N0XH 4H1LA 1KTDB 2GYSA 1SYVA 3TF7C 4HJJH 2HFGL 2EE6A 4JM2A 3OJVC 4D0CB 2E9WA 3DXAE 3ARDD 2AGJH 3FT3A 5I19H 4KDVA 4F3FB 4RA0C 1DBAL 1EVTC 4MDIA 3D39B 3KYKH 1CQYA 2R69L 2XZCL 4HS6B 2VL4A 3VWKB 4ZUSB 4R4ND 1OTSD 1MCWM 5FUOL 1N3NB 3NIGE 1SY6H 1NBVL 3B2UD 4U1GB 1U3HA 1FFOA 3O81A 2C1OB 4M6NL 1O7SA 1E4XL 1UJTA 4GRWB 3QIWD 3EFFB 1W72H 2HT2C 2ZSVB 4JFYA 4JFFA 2F53E 5GRJL 4HQQH 4OCSL 1P84K 3E8UH 4YK4B 2VQTA 4D8PB 3F65A 2X4OB 1KPUA 5JOPE 1UM6H 3I9GH 5BV7H 2ZG3A 3QFJD 5DHYB 3RKPA 3F62A 4YFDB 5IB5A 4XZUB 1BFOB 2XRAL 3I50L 5F7YC 3KPOA 3HZMA 5KSBF 1HE7A 3PV7A 3Q6GL 4MCYB 4YBLC 3U36B 3BDYL 3SGEI 3K0WA 2FATL 3HAEH 2HRPL 3HI5L 4JFEE 3U83A 1EFXD 3CX5K 4M7LH 5JORB 4LVHB 4FMFA 2PO6B 2QKIB 1IM9B 2EO1A 1NH6A 1QA9A 4J3OC 4PRDA 5D7JA 3QDGD 5K93A 5CGMA 3U6RB 2GTWB 1N26A 2P48B 3FAWA 3KPRA 3O9WC 4NZJA 1Z3GL 3LPGA 4NO2A 5KVEL 1F6FB 1NBZA 1II4E 1JPTL 5KZCB 3RGVD 3B5HA 5J6HA 3IXAB 3FRUA 3V6OA 4Z0BH 4KQ4H 2HFEB 4IMKC 3MLRL 3N0PB 3U0WL 3N85L 5C0BA 4GAGL 2XICA 4FFVC 1BWMA 2R15A 3WFDH 3BAEL 3V0VB 1EJOL 3TVMB 1CD1A 3SDCD 3HE6D 3R8BB 1A6AB 3EO0B 3V8OA 1REIA 3BN9D 3HFML 3PWNB 4PIRF 3OKYA 3D5OF 4N0UA 1PZ5B 4P9HH 2FX7L 3N9GL 3WIIH 3SY0A 3MFGB 1RVFL 3L7FB 4ZMAT 4NIKB 1ACYL 2LTQC 1C12B 3BD3A 2H8PA 3C2AL 3QXUA 4ZPVB 2XNAA 3P4NA 2DQGL 3BP6A 2EH7L 1FVCA 3ELAT 2W0PA 4C58B 5HPOA 2PCPB 1NMCC 3A6CH 4LSPL 3LMJL 1FZMA 3K46A 4OLEA 4Z5RB 5DDHA 2ICWI 3CXDL 4F2MA 1DQDL 3LEVL 2ED8A 1A4KA 1M05A 3OKDA 2OL3L 4KQ3L 3W5MA 4NUJA 4OKDA 1D5XA 1PSKL 1AQKL 4WUKH 4P23D 4K3GA 3JTSB 5IVZB 5C07D 4Q6IB 5EBMB 4YDKL 4RWHA 1CR9H 2C3XA 2IH1B 3OZ9L 1TTUA 3G5YB 1WBZB 3P4OB 1AGEB 4K7FA 1UC6A 4AEIH 3QJHA 5C0FA 3AROA 5JW5B 4GW1B 4RFEA 3T3MF 4UIMA 3K1KC 2A9ML 1HEZA 3V4VL 4EBQH 2NMSA 4K94L 4YDLC 5KSAC 1GGCL 4J6RL 5SV3A 4CVUA 3FL7A 3H42L 4IMKA 5T3ZH 3VXSE 3RUGA 4XP1H 4DN3H 4O9HH 2OZ4A 2XYCA 2X1WL 1S5IH 4G8GE 2IPTL 4K9EH 4GJTB 3FO0L 2VKWA 2LVCA 1RPQA 4XB8A 1N5AA 3VFSA 1S7WA 4X6CA 4PGZA 4KKBC 3ULVH 4Y2DA 5GGQH 1F6LL 4Z77A 2ZUTA 5ITFB 1FNGA 4I4WA 5C71A 2CXGA 2W92A 4N1HB 4U1HA 1Q9OA 3HCVA 1A9EB 4KGLA 1FYTD 2GY7B 4OV5B 3GK8H 1T4KB 4GKOA 4R4FL 4WU7B 2DQCL 3IJHA 3P4MB 4LHUG 4X0KA 5J1SC 3GSWA 1OGAD 1BVKA 3ILQD 2QL1A 3AREC 5L2KA 1AKJB 1NAML 1W0WB 3EHBD 4HFWA 1WQVT 3B9VA 3MUJA 1W72B 1RJLA 5A16A 4A2MA 5DHVH 1N8ZA 5M95B 3GIVA 2NX5E 1S7SB 4PJAF 2HN7B 5F9JA 3HPJB 4HWBL 4FQIH 4I0PC 4UILL 1HHHB 4QWWC 5BV7B 1NCBL 3X13A 2ZCHH 1LP9A 1I1YB 1XCQB 1XFPA 4PRPD 3MACH 4HK3N 3IKCB 3CD4A 3BKJH 4UQ3A 4CW1A 3T0BA 3G08A 1F6AA 3HC4L 3I6GB 3MRBB 5L7XL 1YMMA 4JJHA 1MJ7H 3MGOA 3QEQD 4JKWA 3P73A 1A7OL 4TSCL 4CVWA 2WBWB 4XPHL 5IESL 4HX1A 1BEYL 4WY7L 5JW3L 5IFJA 2GJJA 5KSAA 2FEDD 3WKNA 4JQIH 3HAEB 2XA8H 1V7MH 2CMRH 1NCCH 4X5LA 1JHLL 4PJ9B 4FQ1L 2YK1H 2IQAA 3QNZA 1Q0YH 4CAGA 4Q2ZB 4HCRH 1UACH 4WUUE 3OPZH 4U1NA 1I1AB 1OAQL 2E9BA 4GG6E 4EOWH 1YY8A 5T33H 1LHZA 4IDJH 4XVSH 3UTTE 3IU4L 1MIMH 3TBYB 3TM6A 1Z5LA 15C8H 5CP3H 5T1DL 1TENA 4JFPA 4Z6AT 3UTSA 4BQBA 3X12B 1OY3B 3HNVL 4ZO8A 3RNKB 1HSAA 1NGXB 1IEBA 3D69B 2VWEE 3CFEA 4JEGB 1EEYA 2HJKB 3KXFB 3NPSB 3DX7A 3VA2C 2VZUA 4OCWH 5AYUH 4ISVA 1A2YB 1Q9KA 5IT2H 3AREA 4OF5A 3T4AB 3D85D 1BHGA 2EDTA 3CMOL 4NRZB 3MODH 3D39E 4KHTH 1V5JA 2YR3A 4N5EC 3TWCH 2RHEA 2FIRT 3NAAL 4L3AA 1CICD 2EYSA 2AABL 1UCTA 4X7SH 5SWSB 4ZS7L 5IVXA 4OFDA 1KJ2A 5IFAH 4OZ4B 5DI8B 1SHMA 3VH8B 4JRYD 2AKRB 1MI5D 3HMWH 4DVBA 3WCYA 3VFUB 2JJSA 8CGTA 4GRWE 1UYWL 4G7YL 1XR9A 2ERJB 2BNUA 2VXQL 4HT1H 5T3XD 4YHZL 2OI9B 5GSRA 5ALBL 3T2NH 3MLYL 2R0ZL 2B5IB 4KROB 3V5KB 4CADB 2V7NB 4XCCH 4ZTOL 1KGCE 4Y19A 4GG8A 4HF5L 1OP5K 4R90L 4Z78B 3UZVB 3HUJF 1DBJL 3KPLB 3BVNB 4DZ8A 1VFAA 3LOWA 2CK0L 5FKAB 3QQ3A 5DVLA 2EDXA 3MBEB 5IIEB 3MRDB 4NQXA 1OAUL 1SJVA 4P2RE 1CD9B 2VE6B 3TBWB 2J12B 5FYKH 4FTVB 1JFQH 5DJDB 5I75B 1CGYA 1OLLA 1XCTA 3NCMA 4GKZA 4OM0L 1A7NH 4JR9H 4Z7VE 4H88H 4F57H 2IH3A 2B0SL 2NCMA 3IFNH 1WEJL 3U2SB 3KYMA 2QQKL 3GSQA 4UT7H 5FKPB 4KRMB 4LPYA 5HPMA 1MH5B 4FRWA 4G6JH 1BZ7A 5LBSH 1IM3A 4GS7C 1JWSB 4OLWL 2DM3A 4JKMA 2WUBL 5D5MF 2MCPH 3NTCH 3EUUA 4NN5B 3VXPB 3U4AA 4O2CB 4LSVL 1OAYL 4HIJA 4DGVL 5DRZA 2DWEA 4PJDA 1S7TA 1KB5A 3V7AG 5D6CB 4PJIE 3I2CL 2WUCH 3SJVA 4OF3A 4CBPA 4ZFZB 4CMHC 5GISL 2Y36H 4NHUB 5MI0C 5DJYB 2QSCH 4C56B 1LWRA 4G9DB 4GW4B 2DQJL 4P0DA 3TH2T 2C4FT 1WCBA 3SGKC 3GJFA 4OBRA 1JK8A 3HZKB 1R5VB 3P9WB 5JOEA 5JUEH 4ZNEE 4DK6A 1A1OB 1P2CB 1ZV5A 1RUQH 5HGAB 2Y25A 1RUKH 1M1SA 1MRDL 3WIFB 3GMLA 4OFKA 1U8KA 5KSBA 5C7XL 4LSUL 1AXSB 5HDBE 2NY0D 1BBJB 4U1SB 1AGDB 4KI5E 4NO3B 4AT6A 2YD6A 3AB0C 4NFBA 3RZCC 3BZDA 4V1DD 4B5EA 3S3SA 3SDYL 5FOJA 3AS2A 4BSWB 5FB8B 4P5TB 1RZGB 3L3DB 3NZ8B 5FM4A 4X4YA 4ZPTA 5JDSB 4DGYH 2VDNH 4I1NB 3IRPX 1U58B 4ZQKB 5EOCH 3WDHA 3R06A 4FABL 4OBSA 1ZGLA 2ARJQ 3QCUH 1LEGB 4CMMA 3QSKB 1T1YB 1J0JA 3KPPA 1WZ1L 2D4FA 4P46C 2ICEB 3TNNB 5DD5L 1AY1L 2D7NA 2Z35B 5T3XL 5E08H 3LN4A 4HS3A 3HR5B 2RCSH 3V0WL 4GAFB 3SQBA 5I8OH 4OZHB 5C0GA 3CFDA 4O5LH 4X4ZA 1K6QL 5EZOH 1T3FA 3L7EB 1A1MA 4YX2L 5INDB 4Z76A 4Z7QE 1ZGLM 1WAAF 1R5IB 2BSTA 1A0QH 4PJ7E 3VCLA 4G3YH 3SGKA 3Q0HA 3VXNB 4PGDB 2YUZA 1QQDA 1DUZA 3VWJB 3S5LA 2OBGA 4KMLB 2DMCA 3JV6B 3EOAB 2Z31D 1XGRA 4P49A 4U0RB 3ME0A 2ID5A 1E6JL 1PD6A 3K2UL 4HFUL 4NN6B 4Q97A 4AL8H 5JPMA 4N8VA 4NUGH 1PGRB 3BHBA 4NCC1 3RZCA 3X14B 1IRAY 1RK0A 1ZVSA 2NXYB 4NPYA 5TE4L 5K33A 5KTEH 4PB9L 3IDNB 2EDOA 4WFHD 3IVKB 3TT1L 4F7EB 1FVEB 5HHMD 4U6XA 4MA8H 1I8IB 4U6YB 1H3UA 4WENB 4LARH 2QADD 5L88H 4NWUH 1TCMA 5IB1B 3MNZB 4K55A 4S11A 1S7RB 3TBTB 4LLYA 4KMQA 4LK4A 4UT6L 2ED9A 1JRHH 4XP4L 5D7SH 1KN4L 2OX5A 3O4OB 4KVCL 2ZUUA 2A9NL 4HXAL 2QTEA 3SE3C 1B0RA 3WLWC 5EU6D 5I1EL 3KVQA 1YDPA 3DI3B 2R1WA 3OGCB 1VFBB 3DVGB 3NFNB 1ZKAA 2AJVH 3UO1H 3GBNH 1GGIH 1YNLL 2R29L 1I3RB 4RMWA 3AM8C 4ZFOB 2JB6B 3STZB 1JNJA 5I9QB 2DQFA 3IXTB 1TZHB 4LGRB 3I75B 1A02N 4JY6A 2IADB 4NQDA 5I73B 2C3WA 3FQTB 3WO4C 2IFFH 1JYWA 1A6UL 4PS4L 5I1DA 5EU3A 1QEWA 1J7VR 2R2CA 2UWEF 5DGQA 4WU5B 5E8OB 4IS6A 4MNQD 4PJAA 3RP1A 3G6DH 2P7TB 4ODWB 2Q3AA 3FB7A 5CZVH 2H3NB 4MMXC 3KXFE 1PG7H 1YEDA 1SJXA 1FNSH 2E5EA 3D1MC 5IF0A 3GI9H 1QHOA 1HKFA 4E0RA 4ALAH 4ETQB 3RWGB 1U8LB 3E6FA 6CGTA 2AEQL 3QI9B 1M71A 4NRYB 5C0RL 4FQLL 5KW9L 1EEZA 1WZKA 5MEOB 3CVIH 3B4NA 3MRCA 4Y89A 4YXKH 2DLFL 1AGBA 1FL6A 1OTUC 1JYVA 5EBWA 5SWSE 3MROA 3OAYK 4JN2B 4RMSA 3TJEH 5B3JE 5HYSA 4JDVA 5D7KE 3VXUA 1UFUA 4H1LB 2XZZA 5DURB 1IC5H 1SYVB 3QAZB 1UEMA 4JM2B 3FT3B 5ICXA 1MCEA 4MDIB 2APTA 2A38A 3T2OA 3PJSA 4RFNB 3CFBA 1UKTA 1RFDL 3MC0A 2AXHA 4JZOA 2R39A 2C3HA 2VLKA 1F90H 2B4CL 3B9KD 1DFBL 4S2SA 1G7PA 1FFOB 1U3HB 1FDLL 1AIFA 4X6BA 3FT2B 1AXTH 4HEPG 2NY1C 2AW2A 4FTVE 3BRFA 5IB2A 3M8OH 2EEBA 2YS4A 2JB5H 5HYJA 4JFYB 4JFFB 4KV5E 3ZKNC 5HGDA 1E6OL 3KJ4B 1QNZH 1KPUB 2O5YH 3RWDA 5C0IA 2WZPD 1YYML 2E8YA 4TUKL 1BM3H 1VEPA 5IB5B 1JZ6A 2RGSA 1NDGA 3TN0D 5K9JL 3FHAA 4M6ML 1OP9A 3KPOB 5DMJB 2A77L 3A67H 3HZMB 3MOQA 4A6YL 2FGWH 3S35X 1G6RA 4R0LB 4MJ2A 4IRSC 3ULUE 4B50A 2NR6D 1LEKA 3SQOL 2H45A 2AJYH 5E03A 1MCLA 1VADA 4RGOL 4KK9D 1HYSD 1QA9B 4PRDB 4C56E 1CFVL 5D7JB 5HVWA 1GGTA 3CVHH 2IALA 4APQC 3AFLA 4K3EH 5FYJH 1Y18A 1F4WL 1XGYL 3KPRB 4HJ0D 4NO2B 3W0WA 5A2IH 3HUJA 1UXSA 1NBZB 3OL2A 1T03L 3KJ6L 4NQCA 1ZA3A 2PYED 1SJEA 5J6HB 5HVHC 3FRUB 4PJ5D 2R4RL 3OKKA 5C0BB 3GO1H 5J4MA 2A1WH 4TTDC 2PYFB 1INQA 1CD1B 3AS1A 3NMEA 2ZNXA 4HIEB 5HI3C 3OAUL 2DQTL 2F5BL 2H6PA 1H3PH 1LQSR 1NGQL 1AC0A 5GGTH 2Q8AH 1QBLL 1A7PL 4AYFA 2IC2A 3WV0A 2NQCA 5IHUL 3WHE1 3SY0B 3OX8A 3M45A 4TVPE 5TGBA 5D5MA 2DLHA 1DBKH 2H8PB 4KTYA 4D9RE 3RJDA 5CKAA 2OJZH 2XNAB 1PX3A 3KAAA 3P4NB 5A2JH 3BP6B 1FVCB 1NLDL 2V9TA 1KJ2H 2D7QA 4YHLL 3BISA 4KY1H 4BK4A 5ESVA 4M9OA 3O6KH 3V6ZA 1C16B 3KPSA 1FZMB 3O6FA 2VUOA 5C0DA 1JBJA 3NABH 5DDHB 4F2MB 4HJGA 4JZNA 4YBLB 4PGJA 1A4KB 1M05B 3OKDB 4NUJB 5FGRA 1D5XB 4OZHE 1OCWL 3AMKA 4YDIL 1J8HA 1XF1A 4XMPL 2EE2A 4L4VA 1SVZA 5F6IC 3MRNA 4PJ8C 4NOBA 1JF6A 5DMIL 4K7FB 3QJHB 5C0FB 3ARZA 3O9WB 1TDQA 3FO2A 4RFEB 4WHTA 4UIMB 1HEZB 4LF3A 3F8UB 2I60H 3QUML 1WGOA 3H9HA 3O2DH 4P99A 4S1RL 1U6AL 4D0DA 2EZ0C 1AXIB 1HK6A 2AV1A 3PP3H 3N1QC 3WDIA 5DRXA 3RUGB 4DJMA 2KZ1B 4J3TA 3L3GA 4EDWH 1XF4A 2NY5L 1QSEA 1F4XL 4XPAL 1JPGA 1N5AB 4KK6D 3VFSB 1S7WB 4X6CB 4Y2DB 1BQUA 2FD6H 1EPFA 1KELL 4Y4KD 1VGEH 4Z77B 1DQTA 3FAXA 1FNGB 1ORQA 4TNWF 2YPKA 4I4WB 4WI6A 4G6AD 2XA3A 4PRHD 4U1HB 1UADC 1Q9OB 3HCVB 3K4ZA 2LTQB 1NCAL 1Q38A 5ITBL 4AEEA 5HYFA 3LDBC 1U8IA 3IJHB 5FF6A 4X7EC 3HRZA 4ZD3L 3F7RA 4LASL 4X0KB 3MV8A 5TF0A 1NMCB 1BVKB 1WAAA 1FRGH 5L2KB 5F21B 1PZUB 1AD0A 4HFWB 1RJLB 5A16B 3QIWA 3ZKMC 4Z8FH 5BS0D 1N8ZB 3GIVB 5EIVA 3MV9D 4FQCL 5F9JB 4ERSL 3MJGX 5GS2H 1T5XA 3X13B 1LP9B 1RIUL 4JE4B 4YXLH 4UQ3B 5TPWL 4CW1B 4PJ8A 3L5IA 2UYLA 4YBQC 1F6AB 3CX5J 4IOFC 3ZYOA 4MCZA 1YMMB 1TJHL 1YPZF 5L8LB 3MGOB 3O2VH 3TCLA 4CN1A 2X6MA 5IFJB 4HX1B 4PY7B 4X80H 5HHXH 1A64A 1WTGT 5KSAB 4YDLB 3WIHL 1A7RH 3E1F1 5HVGB 3H7LA 2BSSA 1DUYA 5J0BA 1E4XI 2IQAB 4KTEL 5I8KH 3QNZB 3UAJD 3CVHB 5DVKA 1G9NC 3HB3C 5EOCJ 4U1NB 4NGHL 5IBTH 5C3LD 3MO1A 1VCAA 4ZS6D 1YY8B 3H3PL 3MNWA 3DXAD 4LDOB 35C8L 1B3JA 1Z5LB 5ETUA 1AJ7H 1FCGA 1EHNA 4J3XA 1JVKA 4OCRH 4JFPB 5CGYD 3RGVA 1KULA 4JQVA 1OVZA 3UTSB 3ZE0F 5KS9A 5ACZA 3OKOA 5ID1B 2W1NA 5D8JL 1EZVY 4CU8A 4GBXD 1QFWM 2N4IA 1HSAB 5IHBA 4ZO7A 1IEBB 3CFEB 1EEYB 3SDCA 4KK5C 1JGVH 4JPWH 4H20H 1DEDA 3S96A 3LY6A 1R0AH 3DX7B 3MA9H 1LK3H 4ISVB 3AREB 4PRNA 3W9EA 3U79A 2F53D 3RKDC 3ARWA 1JPSH 3BZEA 5C2BL 5JOPD 1KJVA 1LNUA 2SEBA 5GQBA 4XMKH 5C09A 5CD5D 3T0ED 4HC1L 1FE8L 1LO0H 4JG0L 5CINL 5IVXB 2OCFD 1KJ2B 2UWEA 5BCAA 2D31A 1QKZH 2K7PA 3GIZL 5SWZE 4M5ZH 3T0DA 4P5MA 1IFHL 4DVBB 5KVGH 1T1ZA 3O3DB 2F19L 4MLSA 1XR9B 4BFIA 1I9IH 3WUWA 2RIKA 4E41A 4OZFG 3MMEA 5GSRB 4JFFE 3F6LA 3MRJA 2WWMD 3WE6A 2ZOKA 3PV6A 4M43H 3FRPA 4Y19B 4GG8B 4MSWA 1V7NH 4FQXC 4RRPG 4DZ8B 1VFAB 1X5KA 3QQ3B 1NCUA 3WN5C 4NQXB 4X9BA 5B22A 2X9WA 1LD9A 1P7QD 1UM4L 3SKMA 3OAYH 1R3LA 4GAJL 4GKZB 2Y9RT 6FABL 1WF5A 1NKOA 3R0MA 3V52L 2X09A 2IH3B 3CDGA 4WTZA 2FBOJ 1FFNB 4F9LC 4H26A 1CT8A 1X5IA 5MHSE 3C08L 5I1HL 4C83A 5HPMB 1F2XK 4F8QA 3VFGL 3FT4A 1BZ7B 4GQ9L 1IM3B 1EO5A 3FZUC 3KPRE 3ZL4H 4CVZB 4HIJB 2E7HA 5DRZB 2DWEB 1OWRM 1J1OH 4ENED 3F5WB 4PJDB 3DUUA 1S7TB 1KB5B 3V6OE 1KV3A 3SJVB 1KCUH 3RWCA 1I8KB 2EXYC 4XVTH 3LKOA 5GS1C 5C0BE 4PUBL 3DJ9A 3OJ2C 1MJJA 2H32H 3GSNA 1CL7H 2WLZA 3MRMA 1FYTA 1WCBB 5DFVD 5E95B 1J0KA 3GJFB 4XWOC 1JK8B 4IM8A 1X5AA 2BSRA 4PJBF 3V7MA 5F70A 4N0UE 2NZ9C 2EE9A 1CLOL 1EMTH 2FJGB 3OAZK 3GMLB 4JKPL 5E8EA 3WEXA 4XHQA 1U8KB 4YIQA 2XWBA 5KSBB 1OD7A 5JPNA 3NA9L 5BW7A 1CF8L 1SBSL 2PTTA 3NBNA 2UVEA 3TBVA 4AT6B 2YSSA 2CLRA 2JCCF 2GAZB 2FR4A 3MSPA 4FQXA 3S4SG 3VXRA 1EV2E 4UIKH 5DSCA 3WN5A 1QFWI 1CLZL 3WFZA 5F7FA 1FFRA 3QT2A 1CZ8L 5IEHA 4XPGH 4X4YB 4ZPTB 1W0YT 3VXSD 2JJWA 4U31A 4OSUL 5DFWH 2NY6D 4G8GD 3BT2H 1JWUA 4PBVC 4F9LA 3R06B 2GTZA 1ZGLB 2XZAH 3L5JA 4OKVA 4CMMB 4XAWL 3RWFA 5EIQA 4KXZI 3P0YL 3KPPB 5EULV 4GS7B 3WO3B 1IVLA 1TETL 3LN4B 3O3BB 1MWAH 4HS3B 3ALWA 4HWNA 4J3VA 5C0GB 1QHPA 3CFDB 1T3FB 1A1MB 4DZBA 3RUGE 4Z76B 4FXLA 4CMHB 1NGPL 5GS1A 5MI0B 2OR7A 1EUUA 4UV4L 1XGUA 2BSTB 4NKMA 5EC2A 1YEFL 1NUGA 3VCLB 3RIFK 5F88A 1DLFL 1QZ1A 5IBLD 4M7KH 4X6CE 1ADQL 1QQDB 2CQVA 4OUOA 2Y07L 1DUZB 3S5LB 3VD9A 2EE3A 2KH2B 4EIGB 1ROWA 2A6IA 2NX5D 1J18A 4XNXL 1XGRB 1ULVA 4XC3L 4M1CC 1FO0L 3VMOA 3QUXD 2CDFA 1BBDH 1F97A 5F96H 1UCBL 2YMXH 5JPMB 4N8VB 3SE8L 1L7TH 3BHBB 4TULH 3DMMC 3RZCB 3DYOA 1RK0B 4NP4H 1ZVSB 4NPYB 4RDQF 1MVUA 4MVBC 5L2KE 3AGVA 2AVGA 3UPCA 1FGNH 3ARBC 1MI5A 4MHHI 4U6XB 2J88H 3L1OH 3IFOA 2I26N 5E2UL 2A6JA 4CL7A 2X4PA 3A0OA 5T1MA 5FCUH 5D1ZC 2BDNL 3LN5B 4HWEL 1HQRA 4DQOL 4LLYB 1B4JL 5C0ND 3CXHJ 4W4NA 1E4JA 3OB0H 1K8DA 4OQTH 3UTTD 3CFJA 5FHBL 4EN3C 4LEXH 5FOBA 5GGUA 1YMME 3MTRA 3RVWC 3B3IB 1Z6JT 1B0RB 1EO8H 1YDPB 1IT9H 2R1WB 5JHDB 1ZEAL 2IG2H 3QUKA 5L9DH 2VXTL 3NFPA 1KPRA 3BKCH 5J13C 4HAFA 2E7BA 3GMQA 3BMWA 2X9XA 4S10A 4V2BA 4RX4A 5T1KA 2HFFA 4CGTA 5GPRA 4JY6B 3D39D 4GFTB 4NQDB 1VESA 5I1DB 5EU3B 1QEWB 3UTSE 3VWKD 2AEPL 1O7VA 3QIUC 4IS6B 3A6BL 4PJAB 1A3QA 3HHRB 1U42A 3MA7A 1S7UA 3QDMD 2M1KA 4U1MA 1A7QL 5IF0B 4OV6F 1JGEA 3ZYZA 4E0RB 3RBGA 4POYA 1SMOA 1P5UA 1IZJA 1LVEA 1XF5A 1IAIH 4MGXA 3E6FB 4UNTA 3O3AA 1M71B 4OM1H 1YPZA 4YUEL 1JNLH 4U6VL 2D4DA 4NQVB 1FAKT 5EZIH 1EEZB 1YJDL 4LIQL 5C6TL 1PVHA 3MRCB 4XBGA 4OZGA 1AGBB 1FL6B 1N59A 5EBWB 3V4UH 5KSVA 3MROB 5HYSB 1S3KH 3VXUB 5IVXE 4UTBH 5CIPH 1NGWA 5D1ZA 4UBDD 4UTAH 4HPYL 1ND0A 3QCVL 2DKUA 4PRID 4LU5L 5F3HA 2BNRA 4P4KC 4WW2F 5ICXB 4EN3A 2DIBA 3QZWG 1C7SA 5D96B 4LCYA 4L4JA 5B3NA 3V5HA 3PJSB 3NFSL 3EYUH 1YEKL 3CFBB 1IM9D 4Y19E 2Z91A 3KYOA 4JZOB 5D4QA 2RBLA 1INEL 2IGFL 1WTLA 2VLKB 2KL6A 4F7PA 4S2SB 1U92A 4LSQH 4RMVA 1G7PB 3MCKA 1AIFB 4X6BB 2CJUL 5IROC 4P3WA 1J9CT 5IB2B 2APFA 4J3SA 3QH3A 3THML 5HYJB 1F13A 1NMAL 4JANA 2CSPA 2K1MA 5HGDB 3WO4B 3TVMD 2NTSP 3VGBA 5C0IB 3RWDB 1A3RL 5J57B 5MEQB 4K3JL 1G7MA 1C1EL 1NDGB 1BQHG 4R6UA 5IVNA 1OAKH 4XP9H 4ONFL 4LKCB 3GI8H 1C8PA 4PJXF 4X6DA 5CLWA 5SV4A 4TVSa 2WMPA 5DUPH 5SWQA 3SJVE 2VXVH 3G9VA 2IWGA 1VADB 5DMKB 4KI5D 2CGRL 1XIWC 4OUUA 1KC5L 3UBXG 3GHEL 2IALB 3RI5F 1Y18B 1FZKA 5JR1L 2YXMA 3W0WB 1Q8MA 2C26A 1UXSB 4J4PC 4NC1C 3B5GA 3U82B 4NQCB 1ZA3B 3OG4B 1SJEB 4P4KA 4F37F 3ZHLA 5KSBE 1VHPA 1Y6MR 2AAVA 3X3GL 2YZ8A 2YUXA 3WXVH 1INQB 4ZOAA 1Q0XH 2MHAB 2NY7H 2H6PB 3SPVA 3NH7H 4EUPG 2YUVA 5KAQG 4G6MH 1CFBA 4XPFH 3KPNB 1JNNL 3OX8B 3SGEH 2NY1B 5TGBB 5D5MB 4A6YA 4PYGA 5KG9A 4R96A 3NIGF 2DF3A 1G9EA 4QGTA 4OTXL 5EZJA 1GSMA 2DLIA 2K9UA 3FMGL 3L5WA 1AI1L 4L1HA 4HXBL 3RVTC 5ESVB 1RJZB 3MJ9A 3V6ZB 3KPSB 1UWGL 3W5NA 1N64L 3O6FB 3QWOA 5C0DB 4RA3A 5HYEA 1MCCA 1NFIA 4PJBA 1RI8A 3V0AC 4HJGB 4JZNB 2DN7A 3MLUH 2ZJSH 1H5BC 1BFTA 2OSLB 5EBGA 3IF1A 3B8SA 1J8HB 2DJ4A 4MJIA 3NCYP 4LAQL 4L4VB 1CG9A 2E7CA 3OAZH 3U46A 3PXHA 4WTWA 1XIWA 3ZT7A 3JWOH 3MRNB 1QYGL 5I1JH 5B21A 4JDTL 4APQB 1O5DT 1KEMH 3EGSA 4MNQA 4EI6A 5DTFA 4P3CL 2JCCA 2PXYC 3FO2B 1NAKL 2AXJA 4WHTB 5GS0C 1MREH 1YEJH 4LF3B 5DEFA 4JJ5A 1F4AA 3LKPA 3SKUD 3H9HB 3VW3L 1R3IL 4D0DB 5HVHB 4KDWA 2AV1B 5DRXB 4ODVL 5CSGA 3GKWH 2HJFA 3L3GB 1XF4B 3BMVA 1QSEB 4OLUH 4XNMA 3HNSH 1JPGB 3T0WA 4FQJL 3RFZC 3FOMA 5HHVH 2GY5A 4HJ0C 2DQHH 3LZFL 3Q48A 4FFYL 4YNYA 5IOPA 4GXVL 1F45A 2ZUWA 3BE1H 1ORQB 2YPKB 4CDGC 2X4UA 3WHE0 5IMKA 2CK2A 4CVXA 4PJ9D 4N0FA 2R23A 2Q7NA 4IOSD 2HJLA 1CGWA 4P2OC 1GAFL 1U8IB 1TQCC 5FF6B 1I1AD 3HRZB 4RSVA 3MV8B 3O4LA 4XGZA 4Z7WF 3KNBA 4UUJA 4PP1C 2IAMC 1ZLUH 4LDEB 3S88H 3H9YA 2ITCA 3WL9A 4KTDL 1X4XA 1RUPL 3FFCA 1MFNA 1AD0B 2JELH 4DN4H 4OZIF 1VPOH 1QTYT 4Y0GA 4XP5H 2XG5A 3QIWB 3PXJA 1KYOK 3V6FA 4K8RC 4QTIL 1T5XB 1MLCA 5F6IB 1GGYA 1FYHB 4GSDH 3T8XA 2DBLL 1S9VA 5E2WL 4CN4A 4PJ8B 2UYLB 2VL5A 3DPBA 1I3UA 3TV3H 3PGFH 2FYYA 5GRYA 3U30C 4MCZB 2IPUK 1TTGA 2PXYA 4OT1L 1A6VH 3TCLB 1KFAH 5FO8A 5I6XC 1X5ZA 3U4EA 4NQDE 2EDYA 1R3HA 4K7PL 1RIVL 4NO5B 5DZNA 5GSVA 2G5RA 4ZSOA 1YEIL 3GJFK 3GBML 2BSSB 4NFDA 5SWSD 1DUYB 4ELMF 1PY4A 1UEYA 4PJAE 4HJJL 3MO1B 3R0NA 3MNWB 4PV9B 4FQPA 4U6TA 4NKIH 1JHKH 3D9AL 3WD5H 4JY5H 4ONHA 5ICYA 5D7LA 5ETUB 4WW2C 2BFVH 2PYEA 3WFEH 4WIQA 4KROD 5KS9B 5ACZB 5B38A 3OKOB 4PJ5A 1FLRH 4XBEH 5IVOA 1SY6L 3BP4A 4EDXB 2VXUH 3LQMA 4P2OA 3F12B 1A9BA 1S7QA 3MBED 3LDBB 1DEEA 3VXUE 1P4LA 4H25A 3B8YA 3DUSA 5HSFA 1JGLL 1S7VA 3EZ8A 3RDTC 3S96B 3PL6C 1ZT1A 4FTVD 3A6OA 2CR3A 1W72L 2IAMA 5ABDE 4PRNB 3W9EB 3MLSL 4W6WB 4MYWB 1VEOA 5DJ0A 3K74B 1MPAH 5GZND 1CGTA 3E8UL 5MERA 1W8OA 4E9LA 1UM6L 3BZEB 5GRUL 5T3ZD 3EJZC 3LQAL 1U36A 2P46B 5BV7L 1KJVB 5L0QC 2SEBB 4NC0B 4Y16C 5C09B 4FOMA 2GT9A 1SBBA 2VLKE 4KRLB 3JSSA 1MFAL 3EOTH 3P4LA 2UWEB 2D31B 12E8L 1BIIA 1YNTA 43CAA 1TITA 3N1PC 4P5MB 1JP5A 1YQ2A 4QHKJ 5M94B 1T1ZB 1Z9LA 4BFIB 5JW4R 4E41B 5CCKL 5D7IF 3FONA 3NCJL 4UNVA 3MMEB 4I8DA 1RZIA 5HYJE 3MRJB 4JFOA 3ARGC 1GH7A 5DC0A 5ADOH 4C56D 2ZOKB 3PV6B 3P3YA 2NW3A 4MSWB 1WVZA 1PYWA 3IFLH 1BQLH 4PR5A 2R56L 2ILLA 1CU4H 4PLKC 4PJCA 2W0LA 1FFPA 1LD9B 2D7TL 3SKMB 2VTFA 3HMXA 1R3LB 2J5LC 4Z0BL 3FN3A 4LP5A 1JL8A 4R4BB 4XI5C 4N9GA 4WW2A 3CDGB 3WFDL 1H3VA 2NXZC 4H26B 4OGXH 1CT8B 1BD2A 1KPVA 2HKHL 4FNLH 4C83B 1SJHA 3FT4B 2IAND 5TE6L 4GRLC 2BY2A 1KCKA 3AVEA 2YD5A 2V17H 3HUJE 4HSQA 1H9VA 3RDTA 4HUXA 4TVPD 4NQCE 3PL6A 5C08E 3QR2A 5FDYA 3DUUB 5EUOA 4P5TD 1NC4A 4XXDA 4Y4KA 3RWCB 4JQXC 3HE7C 3LKOB 2FWOA 3TH3T 3ROLA 3QRGH 4PRHA 1YC8A 2VOTA 1MJJB 3ZLQC 1RULH 3GSNB 2XKSA 3MRMB 5DQJA 1FYTB 2L7JA 5ECJE 3IT8D 1IC4L 5EFIA 1NGYA 4MNGA 4Y16A 4E5XA 2ATKA 3A6CL 2BSRB 4HG4K 4MQ7A 3ARVA 3ARRA 5E6YA 5D2NC 2X5PA 1GPOH 1G7HA 4D0BA 4G5ZH 1VERA 2XTLA 3LIZH 2Y5TA 1XGTA 1BECA 3VFOA 1QUNA 3QFDA 3BIBX 4WUKL 3QA3A 5E8EB 3WEXB 4ODHL 5D5ME 4YIQB 2XWBB 1IKFL 2XKUA 3EYFB 3NZHL 4PJXA 4PBWD 5BS0A 1RZKC 1BMGA 5JXED 3ARGA 2PTTB 3MV9A 1AP2A 3TBVB 2YSSB 4MD5A 2CLRB 3L5HA 4FQXB 3VXRB 5C8JA 2E9JA 4LLWA 4OF0A 5ELIA 5DSCB 1S9XA 3WN5B 1N4XL 3ALPA 4R26L 3O3UN 4NN7C 3KPSE 3VWJD 5IMLA 3RTQC 1MFDL 5DUMH 1RY7B 5CMAA 3VG0H 3TCXA 5IEHB 4S1SH 1G9MC 3B2VL 1EGJA 4XP1L 3ZE2F 1J8HE 3TESA 1JWUB 2GTZB 5GRWA 1TVBA 1CGSH 4LSTL 2ZCKL 1T1WB 4KHXL 4OKVB 1AO7A 5DFTA 3RWFB 2NXYD 5AEAA 4GRLA 2VDMH 1CGXA 5CUSH 4LLMA 3QWRA 4LCIL 3RBSA 4HZLA 3JVGC 4WGVB 1DJSA 4NDMA 3PUCA 2I5YL 4JO2H 2CD0A 1PJ9A 4DZBB 4NKDA 5EN2A 4JQXA 1LO2H 2YZ1A 3HE7A 4EVNA 3D0VA 5GS1B 3BPLC 5FGCE 1RU9L 5TF1H 1XGUB 5EC2B 4NKMB 4QTHA 2Q7YA 3G6JF 3BQUC 2X4TA 5F88B 5DJZA 4OCYH 1EXUA 4ZDHA 5IFHL 3F7QA 4M6OL 1QSFA 1UVQA 1FH5H 2F8VA 2A6IB 3JWDC 4JPVH 4XP6L 1KB9J 4BFEA 4WEBH 2H2PC 1FIGL 2OR8A 4OD1H 1AHWC 3BJ91 2CDFB 4POUB 1F8TH 4BKLA 5D1XC 5CJOL 3MACL 4C4KO 1HKLL 4AY0A 3BKYH 3NACH 3MV8E 3T0EA 4TVPL 3O3EA 1WAAE 4O2FA 3WJJC 1A6WL 1MVUB 1CLYL 4BZ1H 4B7IA 3RTQA 4P3DB 5GIRA 2XA8L 4JB9H 5CJ8A 3IFOB 3UTQA 4HAGA 2AERT 4RGMC 4YZFF 2A6JB 3LEXA 2X4PB 2A74A 5T1MB 1HQRB 4FQHA 2EEAA 3WFCL 3VGHA 1K8DB 1LE5B 3CFJB 3FJTA 3PNWB 5FOBB 15C8L 5CEZH 2RAMA 5GGUB 2NW2A 2VDKL 5DJ8A 1WBXA 4NO0B 2CKBH 3QI9D 3JVGA 2P4AB 1T2JA 3MJ7A 3O6ML 1MFCH 1NSNL 3DSFH 4LCUA 5F6HI 2NPLX 3RVXC 4M48L 4MA7H 3QUKB 1ZLSH 3CU7A 3BDXA 1LE9A 3NFPB 5F7KC 1KPRB 1N5YL 1X9QA 4N90D 4N0YH 1MY7A 5DURD 5HHQA 1V05A 4JDZA 2R0WH 4OCWL 3GMQB 5AYUL 4JM2D 3S9DB 3WXWH 3TGXA 4TRPL 5T1KB 1R3JA 2IQ9H 3TWCL 1KENL 1EHLL 1RZ7H 4MXQD 5KVDL 2DDQL 1ED3A 5ESQA 4OZIA 4X7SL 2BVUA 4W68A 1F4YH 1I8LC 4U7KA 1AHWA 3HG1A 3VDBA 3MA7B 1S7UB 2FH8A 4P59L 9CGTA 5D1XA 4MQSB 2ADJB 4U1MB 3TYGL 4OFVA 5HY9B 3QHFL 2DQEH 1JGEB 4NNXA 4AMKH 3WJJA 5EWIH 2ZOLA 1XF5B 4JFFD 2DQDH 3O3AB 2R1XB 3VD4A 1YPZB 1B6DA 1IQWH 1KIQA 3D3VB 2APVA 3VE0A 4P9MH 4KKCC 5MEPA 4XBGB 2J8HA 4OZGB 2J6EA 1N59B 5DJCA 5C09E 5KSVB 5MP6L 2VZTA 2NY0B 4YLQT 2VISA 4QHMA 2UWEE 1NGWB 5EG6C 1JJUA 2LE9A 5D1ZB 3C8HA 4ELMA 1ND0B 3B6SA 1S7XB 4WWKC 2VITA 3BRGC 3U4BH 1FPTL 5F3HB 2BNRB 4O4YH 2W0FA 2G60H 1A7NL 3V4PL 3B43A 3O2WL 3C87A 2I07A 2ZSWA 4EN3B 2E6PA 4KI1A 4DTGL 4E41E 2ADFH 1VEMA 4ZODA 2Y6SC 4LOUD 4LCYB 1QRKA 5FYLH 3IFNL 3V5HB 4JO3H 3T08A 5DK3A 2PKDA 25C8H 2K3TA 2ZUXA 32C2A 5D7JD 4NZDA 3KYOB 4Y2OA 3C8KA 4ZFOL 2DI8A 4F7PB 5C07E 3DGCR 1WIPA 3KPRD 1U92B 5J13B 1RSFA 3NTCL 3MCKB 5I76B 3MQIA 4YHKH 2UV3A 4Y4FC 3SE9L 5C9KA 2A83A 5KANI 4X4XA 1CD8A 4KKLC 2H9GA 5JXAH 4X5WB 3QH3B 3B9AA 3EDJA 2DLTA 5C0BD 1HWGB 5I15L 5IUSA 2XIDA 4JANB 1NCWH 2BNQD 4FQ2H 3F58L 5F7DA 3P11H 2EYRA 4J7RA 1JGUH 3IS0X 1G7MB 1I8LA 5I1LA 2M2DA 3QIUB 3IDXH 4K23L 1ZVYA 1IEHA 1A1NB 4AEFA 5L2JA 1QBAA 3OHXA 4PG9B 5CFHA 4X6DB 2AI0H 2HT2D 5SWQB 4JPKH 2J3SA 1FV1A 5D7IA 4FZ8L 2D3VA 5I71C 4OUUB 1Z0NA 4O2EA 2E7LC 2AJZA 1B0GA 3QG7L 4LSSH 2V5SA 4PB0H 1FYTE 1FZKB 2WK2A 1HHIA 4FXGA 5TH2A 3RWHA 3RVUC 3WNNA 4JN1L 7FABH 4JY4A 5GGVY 3ZTJG 4WWKA 3HC3L 3VG9C 4P4KB 5ICZA 4I48A 5I30L 4DGYL 2VZ1A 5I1KL 2VNCA 3GRWH 3KWWA 3MOAL 5EOCL 2VR9A 3WNPA 4N0CC 5F9WB 2VMFA 2QADB 1Z9OA 4TPRL 3SPVB 3VXRE 1DP0A 3O9WD 5F9OL 5IGXH 1KACB 5D70L 1QPPA 4R97C 5IJVA 3IJSA 2J2ZA 2AXGA 2CKBB 4X4MA 3MLWL 1W8NA 4XCNB 3JUYA 5KG9B 4R96B 3TLRA 1R3KA 2VQUA 4ODTL 1UA6L 1P4BL 4FFVD 1Q1JH 5EZJB 4GMTL 4K8RH 5D71H 4N8CH 5I8EA 3L5WB 5DRWA 3VGEA 1C5CH 4HPOL 4JFDA 3QJFA 4JG1H 3UYPA 5FFLA 1I75A 3QWOB 1LDPH 5F8QC 2Q1EA 1NFIB 4PJBB 2CIKA 3NPZB 1KF9B 4D0CA 1CK0L 4LFHD 1X3DA 4F3FA 3L5XL 3IF1B 1NQBA 5BZDA 4MJIB 2CDEA 3RWEA 1XR8A 3U46B 3HZYA 2FSEA 1XIWB 4QOKD 1MIEL 2G5BA 1OHQA 3WYRA 2E7LA 1FGVH 4X6FA 1N3NA 2EC8A 4MNQB 4EI6B 2N7BA 5DTFB 4YR6A 2JCCB 1JMZA 3NCFB 3QDMA 1N6VA 4FS0A 5DEFB 1LO4L 2PN5A 4JJ5B 3N50A 1KIRA 4LARL 3QISA 3SCMC 3SN6N 5L6YL 3DO7A 3OXRA 2HYMA 2HJFB 4CDHA 1WZMA 4XNMB 1K2DB 2IPKA 3IRZA 4ETYA 4J12A 4FFWC 3FOMB 3EW3B 4X83A 1BJ8A 1FP5A 4XBPA 4ODSL 5JQHC 5HYIA 4YNYB 4JRYE 1KCLA 4MAYC 4PRIA 1MI5E 3U36A 2P43B 5KSAD 1A5FH 2X4UB 5FK9A 2AJVL 1U3ZA 5IMKB 1FAIH 4CVXB 4N0FB 2R23B 4MXWL 2HJLB 5C0JA 4I3SL 5FUCC 5HD8C 5H94B 1YN7A 3HTLX 3DYPA 1DE4A 4KKAC 3O4LB 4XGZB 3KNBB 4UUJB 1K5NA 1DSFL 1WWWX 2ITCB 1IJ9A 4KKBD 2Q76A 4QF1A 3WL9B 3G6JA 5B8CC 3FFCB 1HINH 1F3DJ 2IFFL 3C5SA 3WKML 3D87B 4HW6A 4R2GC 3UTSD 4M7JH 1H5BB 3V6FB 3G6DL 5FHAH 3RIAK 1MLCB 3CPLB 1D5IL 1J8KA 4AEHL 1Y6KR 1PG7L 3T8XB 1S9VB 3EO0A 2VL5B 3LHPL 5K9KA 1ZANH 2FYYB 3ARED 2CXKA 2PXYB 3H9SD 5FO8B 1NEZG 4DCQA 3U4EB 1J10A 2C1PA 2NY4C 2FH6A 2B20A 4OJFL 5TJWK 1EAPA 3L7FA 3SBWC 2OZ4L 1JNHA 4D9LL 1R3HB 2P8LA 2ZUQC 4YXKL 2WIIA 5GSVB 3SCMA 3UPAA 4ZSOB 3U7WL 3CUPA 4KMTL 4HMEA 4U3XA 4I0PD 1N6QH 1XGQB 2EIDA 4QWWD 4L29A 1H3WM 3CNKA 4ZO9A 4PFEA 4EXPX 4YXHL 1HCVA 1MNUH 3QDJA 1MELA 5DZLA 2VYRE 4ONHB 3VGDA 5ICYB 5D7LB 4HUMB 4XVJH 1PLGL 4MAYA 2PYEB 2Y06L 1YPZE 1CXKA 5B38B 2HFGH 4PJ5B 4Y19D 5BMFL 2Y5EA 1T04A 3JTSA 3BP4B 1F90L 4M7ZC 4OZGE 1RZJC 4O58L 4OZFH 4P2OB 1A9BB 4QRUA 3SKNA 5KOMC 5EC1A 1DBAH 1DEEB 1KCRL 1P4LB 1TQCB 3DUSB 3JXAA 4H25B 4RGNC 4OCMC 3MBXH 3DLQR 1FG9C 1GZQA 3M8OL 4XH2A 1ZT1B 2R69H 2XZCH 4M8VA 1G6VK 2BNRE 2IAMB 3CSGA 2XFXA 2IF7A 5B8CA 2EDLA 4TSBL 1NBVH 1E27B 1F02I 1IC7L 4HEME 5GXBB 5GRVK 1QNZL 2RB8A 4M6NH 2ADIA 1E4XH 4HBCL 2FO1A 2GT9B 4JAMA 4LCCC 3ZE0E 5CBAA 1BIIB 1YNTB 43CAB 5EU4B 5GRJH 3UTZA 3LN9A 4OCSH 1N7MH 4UT9L 3DRTA 3SGJC 1MCSA 3FONB 3U30B 3SJVD 1IGML 4WV1C 1RZIB 2P5EB 3I6KA 1IMHC 4JFOB 2X4NA 4N5ED 3SBWA 5DMGC 5CLTA 3I50H 3CVHL 2NW3B 4K3EL 4N1EA 4GXUN 1PYWB 3Q6GH 4PR5B 1C08A 4UINL 3BDYH 2AP2A 2R0KH 3JV0A 4PJCB 1SM3L 1SY6A 3P4MA 2FATH 5DR5L 4JGJA 1FFPB 3GFUA 4P9HC 1L0QA 2WQ8A 3GZKA 5F1KC 1UB6A 2ZP0T 2ZKHL 3GO1L 4N9GB 4WW2B 2A1WL 5E9DA 1W72A 1Z3GH 1KPVB 1BD2B 2JJUA 5GS2D 2P45B 1JPTH 4YPJA 1SJHB 2ZUYA 2Q8AL 4GMSH 3MLRH 5IBUB 3N85H 4GAGH 3IKCA 4MNHA 2P44B 3RDTB 3T2PA 4HUXB 1CGUA 3BAEH 3PL6B 4KPHL 4XNQA 5H35A 5DVMA 2QLVB 5J06A 5EUOB 3UEZA 1NC4B 4XXDB 4Y4KB 3QCTH 2WV3A 4OB5L 1R5WA 2FWOB 3LRSA 3ROLB 1K3ZA 3TIDA 5IQ9A 1KJ2L 2E9IA 2FX7H 2QSTA 3N9GH 5DQJB 4LVNC 5A3IC 1RVFH 1NGYB 4MNGB 4Y16B 2ATKB 3O6KL 4MQ7B 2VN7A 1ACYH 4LCCA 2XI9A 5JO5A 3C2AH 4D0BB 4HKBA 4NQTA 2DQGH 1XGTB 2Y5TB 3VFOB 2EH7H 5I1AA 1GJIA 3QFDB 4Y4HC 3QA3B 2FB4L 3DX8A 4MA3A 5TFSL 1OAZL 3TBYA 1DANU 1G0DA 2OR9L 4TNWK 1F2QA 5FM5O 4L9LC 4WCYL 4LSPH 4DAGL 2J6EH 3ARGB 1CXIA 5J8OA 3MV9B 1AP2B 4YJZL 5I18L 4MD5B 1JTTA 1JPFA 1EAJA 3J7HA 3CXDH 1DQDH 3LEVH 4LLWB 2OL3H 4KQ3H 1S9XB 1PSKH 1AQKH 4LL9A 4ZO6A 2D2OA 2I60L 5IMLB 4JKKA 3ULVC 4M00A 5CMAB 4YDKH 4PJBE 4U49A 1ERNA 2J5LB 2XWJA 3CAFA 2JJTC 3OZ9H 5J3HC 3S3JA 2VKXA 4EDWL 4MJIE 3QPQC 4KJQD 2NXZB 4OLZL 1TPXC 2A9MH 1TVBB 3P2TA 3V4VH 3MV01 4K94H 3RZCD 1HWHB 1AO7B 4S1DC 1GGCH 4J6RH 4ORZC 1GOFA 4GRLB 4HIHA 4MNQE 4LLMB 5E2TL 3VH8A 5HI5C 3H42H 1RIHL 2JCCE 3UJIH 1KB5L 2AKRA 1T0MA 2P47B 3C5ZC 4HZLB 1PQZB 4NC1E 3FO0H 3IDIA 5E2VL 4NDMB 3EFDL 3TYFA 3PWUA 4NKDB 5EN2B 3HE7B 3ZDZF 4OI7A 4EVNB 3D0VB 4M1GL 2BRQA 4MZ3A 4QTHB 4W81A 1GC1C 2Q7YB 2Q87A 3ZE1F 5DJZB 3DTXA 3UYRL 5E4EC 1ONQA 1EXUB 3PHSA 4P46D 3B9DA 1D6EA 5FO9A 1QSFB 1UVQB 4ZDHB 3S34L 1VACA 2Q8BL 4R4FH 2DQCH 1I7RA 5DJDA 2HLFC 1QBML 4PJHF 4GLRH 4QRPA 5JHDD 4UB0L 2X9YA 3BH8A 1AR1C 5FGBC 2X05A 4G9FA 1NAMH 1NFDF 5KN5A 1H15A 3FQXA 4Q9QL 5BRZB 2ITDA 3O3EB 4NNYA 5INCA 4O2FB 1I9JL 4HWBH 2FGZA 3FFCE 4NQDD 4UILH 3RTQB 4POZC 2EDQA 1NCBH 4FP8L 5GIRB 1K85A 1EEUA 3UTQB 2JJTA 2F54A 3GMMA 3HC4H 3LEXB 2VDQL 5D93C 2A74B 5L7XH 4LPWA 1NMBH 3V95A 4FQHB 4XPHH 5IESH 4WY7H 1BEYH 5JW3H 3LB6C 1ZVHA 2ICCA 3ARFC 4GRMA 4HWUA 1U8QA 1JHLH 4FQ1H 1AJ7L 5DS8A 1WBXB 5E6IC 4UAOC 3C5ZA 4QHNA 2HKFL 2EDNA 1OAQH 3MJ7B 5AD0B 4LCUB 1QLFA 4IRJC 5DHVA 4ZSOE 4LRIC 3Q6FA 1LE9B 3IU4H 4UI2A 3VXUD 1AGDA 3BPLB 1N6UA 2MWCA 5HHQB 4NO3A 2WINA 4JDZB 1R0AL 5B39A 3QULA 5MENA 3BQUB 2IANA 4OIIL 2CRMA 5TQ0H 3OXSA 2NY5C 1R3JB 4WDIB 1JI1A 5GJSH 1JPSL 5D7LE 3UCRA 4Y7MA 1WCQA 4QGYA 5E0QA 1QFPA 4D3CL 2PYEE 3WLWD 1IAOA 4I18C 2XV6B 5ESQB 1ED3B 4P5TA 4OZIB 3NZ8A 4O02L 2QV2A 3U9PH 4PJ5E 1WUNT 1KUMA 4CNIA 2VLKD 1AHWB 3HG1B 5FGBA 1QKZL 2X40A 3CMOH 4DEPC 5DK2A 2VZ3A 5D1XB 4YHNA 1AH1A 5KVGL 4HIXL 4HCRA 2LU3A 1LEGA 1X4YA 2R8SL 1CDJA 2AEWA 3NAAH 5EORH 2E6QA 4NNXB 2AABH 2Z8VC 1QACA 5HYJD 2ZOLB 4DGIL 2R4SH 4ZS7H 2DQIH 1I3GL 1WSST 3WNMA 5BXFB 1KIQB 5H37G 4LBEA 3VE0B 3L7EA 1OL0A 5MEPB 1UYWH 4G7YH 3JBG7 3FTGA 2VXQH 2RQ8A 2VISB 4YHZH 4QHMB 3B6SB 5ADPH 3MLYH 4XCFL 2R0ZH 2VITB 3ESUF 1JHTA 1UT9A 2W0FB 4J1UA 3VXNA 4ZTOH 2I07B 2ZSWB 4HF5H 4R90H 1E4WL 4PJGF 2WQRA 1DBJH 3ZHKA 2CK0H 2V6HA 3O41A 1OAUH 5E6IA 3WNLA 1IBGL 1UKSA 32C2B 3REWA 4IRJA 1HXMA 3C8KB 1LP9F 1YECL 4LRIA 1OTUD 3H6JA 2NY3C 4OM0H 3ZL4L 4Y88A 3W0WD 4N8PA 4PJCE 3T1FA 2B0SH 4NQCD 3GNML 1WEJH 2X70A 2A83B 4X4XB 3TT3L 5J89A 1T7YA 1KCUL 2H9GB 2QQKH 4XVTL 1KN2L 3IVKA 4LLDA 4OLWH 1P4IL 2VDPL 2NZIA 2WUBH 1CL7L 5EU7C 3VRIA 3MRQA 4YE4L 1BD2E 1Q9WA 3P9MA 4LSVH 1OAYH 5T5NF 1T2QL 3ZZ1A 4DGVH 1FBIL 5I1LB 3MNZA 2AS5M 3BKML 3I2CH 5L2JB 2YC1A 3OHXB 1HNFA 4NWTL 1RJYA 1TVDA 5GISH 1J1XL 2NY1D 2DQJH 4MQXC 4CU6A 5EUOE 1Y0LA 1BWWA 2NNAA 3C5JA 3KLAA 4EUPH 3ISWA 4Y5VC 5FO7A 4IIQC 1BF2A 5LXGL 3OF6A 4HK3J 5D7IB 3ZKND 4O2EB 4PRHE 2OTWA 2OMNA 4G6KL 2AJZB 1B0GB 1MRDH 5HGBA 2BMKA 4MNGE 2VXSH 1HHIB 4FXGB 1ZLVK 5C7XH 4LSUH 3RWHB 4JY4B 1WLHA 2MTPA 4HUUA 2VUYA 4WWKB 2WNGA 2KDGA 5ICZB 1CE1L 4I48B 4IRSD 4JREC 4DKFL 3HZVA 3N1MC 2N7AA 4PJXE 4L4VD 4HMCA 5BS0E 3SDYH 5IVXF 1WK0A 3RA7L 4YEFA 3UDWC 3MV9E 5JA8B 3EDKA 1OOAA 1J88A 4APQD 5E70A 1QFUL 1P9MC 3W9DB 1WISA 4H8WL 4D94A 4AENA 5IJVB 3IJSB 2AXGB 4ETQA 1DQML 1VA9A 1JMXA 1WZ1H 4NRYA 5DD5H 1AY1H 1QSED 2Y23A 4TTDD 5T3XH 4PY8I 2X1PA 5C0CD 5HI3D 5I8EB 1YQVH 5DRWB 4JFDB 3QJFB 4XPBH 1AO7E 3IKKA 1K6QH 4YX2H 5JOFA 2CIKB 5IW1A 5BVJA 3TA3C 5M7QA 2EDKA 1RJCA 3LKNA 3MRRA 43C9A 5BZDB 4N68A 2CDEB 1X5YA 5LGHL 4Y5VA 3RWEB 1I3VA 1XR8B 4IIQA 4LVOC 3HZYB 4HKJB 2FSEB 5I71B 2G5BB 4X6FB 3MV8D 4NP4L 4W70A 4GXUM 1INDL 1B90A 3MUZ1 5J12C 4YR6B 1U8JB 1E6JH 3K2UH 4HFUH 2F9BT 3QDMB 4PJDF 5IQ7L 3GKZA 4WFEE 1QSFE 3FT2A 3L1OL 1YZZA 2VLLA 1KIRB 1MCPL 2VO5A 3VG9B 3WSQL 2RFXB 3DO7B 2VDOL 3OXRB 4PGEA 1VSCA 2I9LB 4PB9H 3KPQB 2IPKB 1IGJA 3TT1H 1RZJH 3UDWA 5EBLA 5DF0A 4PJ8D 4X98A 3DSNA 4XBPB 1CD0A 1IGCL 3T0EE 1PG7W 3K4AA 4B41A 1P9MA 4PRIB 1PAMA 1T66C 4I2XA 2ZG1A 3O0RL 4R0LA 3U0TA 5FK9B 4R97B 2EZ0D 4UT6H 3DIFA 2MOVA 4XNUL 1WICA 5C0JB 3GMPA 1NLBL 4XP4H 1YN7B 4LDLB 2MPAL 2OS7A 1KEGH 2A73A 1CTNA 2A9NH 1DE4B 2BVPA 3HI6L 4HXAH 1MQKL 2XKNA 5ANMA 1K5NB 5L8KB 5I1EH 1KCVH 2N56A 2Q76B 4QF1B 5GHWH 3G6JB 5I2IA 1WWAX 3UBXB 1YNLH 2R29H 1HYRC 4RWYL 1D3CA 4MZ2A 4NZTL 3C5SB 4I3RL 3QBTB 1I9RH 1BZQK 3PP4H 3SDXF 1OARL 3TA3A 4MLIA 5T5FL 3S98A 3MGTA 4Z95H 4AH2B 2L4OA 1HOCA 4PJHA 2BNQA 4Q0XL 2PYFA 4HGMA 3CH1A 2DLGA 4HIEA 2IJ0C 3F6IA 2APBA 5K9KB 1NFDA 1A6UH 4PS4H 1S78C 3SE4C 2GSGA 1CXFA 3UROR 4Z7WE 2P24A 2I27N 4DCQB 2C1PB 2FX9H 2X89A 1EAPB 1E4KC 1JNHB 3ZKMD 2P8LB 2WIIB 3SCMB 1UH3A 3CUPB 3V4UL 4OZIE 1NBYA 5C09D 1NJ9A 3M07A 1DL7H 4YHPA 3GSVA 5A40E 4UTBL 4L29B 3HG1E 5E2JA 3RPIA 5CSZA 5AWNL 2AEQH 3T04D 3QP3A 3FB8A 5DVNA 1CFTA 4Y5XC 5C0RH 4YBQD 5KW9H 3QDJB 4E41D 4IOFD 1C16A 2CUIA 3C6LC 1X7QA 4U1KA 4MAYB 2PW1A 4P48A 1DANT 1CYGA 1T04B 1A14H 4QRUB 1OTTC 3SKNB 5EC1B 2ATPA 3HB3D 1A7BA 2A6KB 4ELME 1GZQB 4BUHA 4U33A 4XH2B 3G5VA 3LRHA 4O51A 1RFDH 2XFXB 3O9WA 2PUQT 3VFMA 4XCEA 5B8CB 1G1YA 3GMRA 1UWXH 3EAKA 2OM5A 3L3KB 3C2SA 2W59A 4DK3A 5IKCA 2HT4C 4F37K 1DFBH 4QRRA 1GXEA 4RNRA 3VMPA 4WO4C 1QG3A 2DTML 4QXGL 1FDLH 4UOW1 4R2GB 2ADIB 4XMLH 5J6GB 3CZJA 1KNOB 2XQYG 4KJPC 4BUGA 1H3GA 4JAMB 3MLZL 5KJRL 3LKSA 5CBAB 3DVIA 1AGCA 1A3LL 4KK5D 3UTZB 1UKQA 1E6OH 1RMFL 2XG4A 3AY4C 3DRTB 1WITA 3SE4A 4TYUA 1YYMH 4TUKH 3RKDD 3I6KB 2XY1A 3V6BR 2Q6WA 2X4NB 1TZGH 2NY4B 3EYOA 5K9JH 1J86A 1E4KA 1QFWL 4M6MH 3PE9A 3PG2A 2GEEA 4OLVH 4N9OB 2A77H 3MGAA 1FG2A 1C08B 3MYJB 2EKJA 5FXCH 1WIUA 3SQOH 4LIQE 4QOKA 4WI3A 3DNKA 2FJFA 2IBGA 4LLVA 4RGOH 4Y5XA 1CFVH 3FB5A 1UB6B 3C6LA 2EH8L 3O6LL 1F4WH 5E9DB 1XGYH 1U8HA 3WXVL 4PJGA 1MJ8L 5EO1A 1JF1A 5D7IE 3BN3B 2YWYA 3KJ6H 4LPVA 3VFPA 3AXLA 4FQXD 2KPNA 3VXRD 4M7ZB 3GMNA 1GC1H 2R4RH 4G6ML 3P0VH 4HZAA 4RGNB 5HI4C 3MXWH 4MNHB 1NCDL 4XNQB 5H35B 5C1MB 1CFSA 5D9SB 3OAUH 2DQTH 5F7NC 2F5BH 1NGQH 2VDLL 1R5WB 3MJ8A 4NQUA 4PY7A 3LRSB 1A7PH 4G80B 2Z0BA 4K71C 3TIDB 5IQ9B 3BD5A 5IHUH 4L4TA 1JUFB 1NANI 4ODUA 1TJGL 4H1LG 4XNZC 4BK5A 3CVHA 4LCCB 3FZUD 5JO5B 4HKBB 3S35L 3MLUL 1NLDH 5I1AB 5E94A 3AY4A 3S37L 4MA3B 3DX8B 1ACZA 4YHLH 4X4ME 4FZEL 2EXYD 5ID1A 5LG1A 1JPFB 4L8SC 1G9NL 4AIOA 1FC2D 4XWOD 4JFDE 1EK3A 3H3KA 2K7QA 4XHJC 1OCWH 4YDIH 4EZMA 5TDNA 1AFVL 1UXWA 3R1GL 1OF2A 3PIQA 4XMPH 2NZ9D 3CH8A 3KHQA 1MRFL 4DOHB 1JV5A 5FUZL 4XNYL 1OW0C 2XWJB 1ZLVH 4LP4A 5I66A 3H9SA 4M8QA 1AR2A 1EO7A 3MRLA 1ZLWK 3RJQB 1DQJA 4FN0A 3QUMH 5DZOA 1IGFL 2HFTA 1NGZA 4S1RH 4I0PA 3BYTA 4K7PX 1U6AH 5DQ9A 4HIHB 1SEQL 1VFOA 3QDME 1T0MB 2NY5H 5LQBL 3O3DA 1F4XH 4WHYG 3IDIB 4XPAH 1I7TA 1ZTXL 3TYFB 3GSNL 3PWUB 5DEGA 1MAJA 1EDQA 1KELH 5F1NA 4BJLA 2NY2C 1UQSA 3ZE2E 2HTKC 4LVNB 4BSVA 4P2CG 3IAPA 3DTXB 2HH0L 4DN4L 1ONQB 1NCAH 1D6EB 5FO9B 5ITBH 1VACB 3K2MC 4D2NA 1KJ3L 4NO0D 4PRIE 1U0QA 1I7RB 2H41A 2XXMB 3GJEA 1ZT7A 4Y4HB 4OFYD 3VA6A 4LASH 3FCTA 4QRPB 3MXVL 3O2DA 1DQQA 3BH8B 4L9LB 1FFNA 4G9FB 5KN5B 4DVRL 1YYLL 4JFXA 1H15B 3FQXB 3UZQA 3RVVC 4ZXBC 2E7MA 1EIBA 2ITDB 2Z92A 4FQCH 4RX4D 4NNYB 5INCB 5T1KD 1DVFC 3G6JE 4ERSH 4PGCA 4CVZA 1YNKH 4GG6A 4QRSA 4NKQB 3RHWF 3KLHC 3GUTA 1OW0A 1RIUH 3F5WA 5GRVL 5I0ZA 4KJWC 4M1CD 2F54B 3GMMB 1I8KA 3VFTA 3QYCA 4HKZA 1D9KC 4X6EA 1TJHH 5CJXC 2CRYA 2E27L 1TPXB 4LVHC 5DD3L 2PO6C 5GGTA 3DMMD 4G8IA 4GRMB 1BFVL 1U8QB 3WD5L 2PW2B 5GZOC 1G7QA 3O8XC 5F3BA 2BFVL 4MVBD 4KTEH 4DKEL 5DS8B 3ARBD 3C5ZB 4QHNB 3BIKB 2FJGA 3D3VD 2ZCLL 5HJ3A 5DK0A 1QLFB 2I9TA 3H3PH 5DHVB 3FFDB 3Q6FB 2YPLA 4KJQC 4U1JA 3T4YA 35C8H 4AG4L 4LRNL 1JZ8A 4YZFE 5D1ZD 2JJVA 2WINB 2GAZA 4F7MA 5B39B 2O5ZL 3QULB 4JHWL 5MENB 2BNRD 2IANB 4YHOL 3OXSB 4QXUL 5D8JH 4JHAL 3FN0L 3DOSA 3QDJE 4EN3D 4TOYH 3RVWD 3BP7A 4ELKA 4NZUL 1XF2B 1IAOB 1B9ZA 5A43C 1KBGH 4L5FH 3RAJL 1MCIA 3SGDI 2AV7A 2CKNA 4CNIB 5C0AB 3SDXA 5DT1L 3QDHA 4I77L 3UJJH 5DK2B 5FUCE 1FLTX 4YHNB 5EZLA 1L7IH 1WFNA 3IS1X 4ZXBA 5C2BH 5CILH 1DVFA 5HDLA 4HC1H 1FE8H 3O3BA 4JG0H 2VN4A 5CINH 4P2RA 3LQZA 1BF8A 2VJXA 4C59B 4LBEB 3GIZH 1IFHH 4EQ3A 1V3LA 3FTGB 3KLDA 5D93B 1BAFL 3QIUD 1U95A 2GUOA 2HG5A 4PV8A 4Q6IC 5CJXA 1JZ3A 1Q94B 3NN8B 2FX8L 5DMYA 1JHTB 4OLYH 3SHSA 4J1UB 1E28A 2LABA 2PR4L 4KKNA 3INUL 3O41B 1KOAA 3HA0A 3DURA 1MSPA 5E6IB 4XPTL 4UAOB 2Z93B 2GSIA 4FNLL 3WJLC 3REWB 1QPXA 4IRJB 1HXMB 1UM4H 4GAJH 4QYOB 5DLML 6FABH 1FVDA 5I0DA 1C5BL 2ZPKL 3V52H 3T1FB 3L3JA 3FQNA 4QRQA 1A6TA 2X70B 4XC1L 5BVPL 4P4KD 3C08H 5I1HH 3VFGH 4GQ9H 4LLDB 4Z7UF 5E9DE 3ZTJH 4NQSA 4ZFFA 5IB4A 4I18B 3VRIB 3MRQB 2DAVA 1Q9WB 3IGAB 3P9MB 4QKXB 4C57C 2DL9A 3VDCA 1D5MA 3LKRB 2D0FA 2YC1B 3TBSA 4DEPB 1C7TA 1AE6L 2W9EL 3LN5A 1RJYB 4RGNE 1VKXA 2YPVL 2JIXA 2BOCA 1Y0LB 2NNAB 3KLAB 3C5JB 4P46A 5KS9F 4NC2B 3B3IA 5FO7B 3S6CA 5CEXB 4E42B 3G9AB 4NM4L 2M8XA 2OTWB 3JTTA 2B1HH 3BWUC 2YKLL 5T1LA 5JHDA 1T21A 5HGBB 1CLOH 2BMKB 1JZ7A 3SDAC 4JKPH 5LCVH 5FCSH 1FIEA 3I3EA 4HUUB 3NA9H 2J4WL 2DQUL 4HGWB 1CF8H 1SBSH 1YY9C 2VAAA 5LWYH 2FNBA 3PQYA 4UMGA 3VJ6A 3HZVB 1D5ZA 3EDFA 3NCCB 2H2SC 4LVEA 4MJID 1CLZH 4WI7A 1XIWD 2H32A 2NY3B 3EKCA 1JGDA 4J4PD 4PJ7A 4DOHE 4AENB 1FCCA 3CLEL 3U9UA 4AIZA 1WT5C 3DGGA 2W9DH 4P2YA 5DEZA 4XAWH 3P0YH 3PABA 1OM3L 3O11A 1TETH 4HGKC 2BERA 4NQVA 2YRPA 1WV7T 1FORH 1S8DA 2BZDA 5C6PB 1R24B 3DARA 2EIEA 1NGPH 2G9HA 5JOFB 5IW1B 5BVJB 1U91A 2ADGA 1I7UA 2A0LC 4JFHD 1OAXL 4UV4H 1YEFH 1BX2A 2HRLA 1A22B 2WBJC 3W81A 3LKNB 3MRRB 43C9B 1DLFH 4Y5VB 1A6ZA 1ADQH 3SE3A 4IIQB 2Y07H 4NYLA 1U8OB 1GIGL 4RZCA 3O4LD 1WZLA 1L6ZA 4XNXH 2HVJA 3SDAA 5DO2C 3RVTD 4KFZC 4MB5A 1FO0H 3AM8A 3FFCD 2YHGA 4YGVA 1ZT4B 3WNOA 1UCBH 2IPUG 2VLLB 3SE8H 2LQRA 1IAKA 1MWAA 3PHOA 4JREB 4QRPE 4PGEB 4XB7A 1I7ZA 2AJUL 3QHZL 1FC1A 4G9FE 4NT6A 5T3ZE 1IGJB 1OQOA 5EBLB 5MEQA 3LCYA 4M1DL 2VH5L 4X98B 3BSZL 1OLZA 1TZIA 4G7VH 4P4RA 1EVUA 2PXYD 3UXFA 1PDKA 5GS0D 2CKBL 2D0GA 4LKCA 1ZAGA 4I2XB 2JKXA 3VD3A 1MHHA 4K3DL 4LQFL 2BDNH 3S36X 3L95A 3U0TB 3I84A 2FHCA 4DQOH 5K9QI 1WT5A 2DLEA 2HWZL 3DIFB 5FHBH 2F54E 3GMPB 5DMKA 3S7GA 1HHJA 5JQ6L 2A73B 3K8LA 2BVPB 4GKSA 3MJ9L 4NQED 4EI5C 1ZA6A 2XKNB 3ETBF 5ANMB 1YEGL 5DGRA 2P5WB 5D6DC 3TH4T 2B7DT 5JA9A 5I2IB 3SKOA 1ZEAH 1OP5H 1LO3L 5D7LD 1CBVL 4AJ0A 2HAZA 1FZJA 1MAML 1FZOA 1XGPA 3SOBL 3TA3B 3G6AA 1T20A 4JFZL 3ULUC 4EQ2A 3MGTB 3LS4L 4XX1E 1EH9A 2WBJA 3UJTL 5DJAA 4AK1A 4H5SA 1HOCB 4AM0B 4P2OD 4PJHB 2BNQB 4LVOB 5ESAA 1HN1A 3CH1B 3WMSA 4WTXA 1G0XA 4ODBD 2VDRL 2MHAA 4Y1AD 1BPVA 5I1GL 3PGDA 1NFDB 2B2XL 5MENE 4PP1D 3QDAA 4AMKL 4PD4J 2IANE 2IAMD 2GSGB 2DYPD 1MJUL 1RZ8B 2AEPH 4OQTA 1KXVC