2Q8BL

Structure of the malaria antigen ama1 in complex with a growth-inhibitory antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
213
Chain Sequence
SIVMTQTPKFLPVSAGDRVTIICKASQSVSNDVVWYQQKPGQSPKLLIYYASIRYTGVPDRFTGSGYGTDFTFTISTVQVEDLAVYFCQQGFSSPRTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Apical membrane antigen 1
publication title Structure of the Malaria Antigen AMA1 in Complex with a Growth-Inhibitory Antibody
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 42
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2007-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q8bL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q8bL01
1XGQB 5FM4A 5ACMA 4AENB 4NUJA 1D6EA 5DQDH 3ESUF 4NKDB 3B2VH 3PQYA 5D9SA 3AVEA 4YHZH 1G9EA 1EFXB 3SDAA 4NM8H 2JCCF 3LV3A 1QBBA 4LPTA 4WUUB 4Y5YB 2VITA 2R2HA 4G6KH 4E0RA 2PTTB 5KBNC 2NY2D 2MOVA 1MCWM 4GAGH 5CZVL 1NBQA 2AV7A 4N1CA 4OF0A 1J1OL 3V5DA 5DRZA 2WBJC 4U6YB 2ICWA 1IAIH 1J0HA 1NEZA 2YPKB 4KHTH 1LO4H 3GK8L 4PJ5D 1WAAA 3UBXB 5C2UB 3P0GB 4NJ9L 3QCVH 5I2IA 4OGZA 1KB5H 3EYVB 4HUWB 3ZTNH 5T3ZL 3NCEB 1YY8B 1U8QA 1BWWA 4CDGC 1BMGA 4DFHA 4ZNCD 5LBSL 4N0CC 4PV9A 1MFAL 4FTVE 2VSCA 2G2RB 4NRZB 1OWRM 3F7VA 3VWJB 1BIIA 5DD1L 4I0KA 2VL4A 4OZHE 3MQIA 4UIKH 1MCPH 4YDVB 1NCWL 5F97E 5CEZL 3P2TA 3P4NA 3LKNB 2Z93B 4MS8D 4RFNC 3PWVB 3BX7C 2IMNA 3HNSL 5HI5C 4PJ7F 5FA4B 3TZVD 3IT8D 3C2SA 1I1AD 4KI5C 2ENSA 5CJBA 3PV6A 1MVUA 5HGBB 3HI1B 4YK4C 1Q94A 3MYZA 4M62H 4FABL 4QTIL 5GRVK 4F7TB 1YEDB 2NTSP 1AR2A 3JZ7A 5DMIL 1F58L 2BZDA 1G1CA 3BQUB 5FYKL 5MERA 5J56B 2X4UB 4MA8H 1IL1B 4JY4B 3R1GH 5CLTA 5DQDL 3LDBB 5EU7C 4GRWE 3S3JA 3RVUD 5T3XD 2N1KA 3B2VL 5IQ9B 1QR4A 4YHZL 4JDVB 1BD2D 2UVEA 2PXYA 4NM8L 5F1OB 1GAFH 5ISZE 1WIPA 1GOHA 3BIAX 3I3DA 1HXMB 5K93A 4JGJA 1BQHB 4NIKB 3QUZA 2HT2C 3KPRB 4JFYB 4ETYA 5J6GA 2EIBA 1XIWD 4G6KL 3ME0A 3SDDC 1JGEA 1NCTA 4GRLD 1HQRB 1ZV5A 2OZ4H 3N9GH 1UH2A 4J7RA 1IAIL 2XN9A 1RURH 4IIQB 4KHTL 5GS2H 4DGIH 1R3KB 4OLWL 4YNYA 3SKMB 3S97C 4H0IA 4M7LT 5DJXA 1TVBA 2CUIA 1KB5L 3ZTNL 4HWBA 5DJCB 4BUGA 2P5WB 4Z7WE 4P2QB 1CFTA 1IM9B 3OKOB 2HG5B 4ODTH 1B4JH 1J12A 3D85B 4L9LC 3WFHB 5DHVB 4G8GA 5KW9L 2X41A 4PP2A 4OD2A 3NZ8B 3FRPG 3M1BB 3AFLA 5HHNB 1XGRB 1X3DA 1MCPL 4UIKL 3UTSB 5KVDL 4LSTH 4QRRB 3KAAA 3MZTA 4RA0C 3IRZA 4Q58C 4Y5YC 2GTWB 4J2XA 2FIRT 5MENB 4OB5H 2RGSA 1VGKB 5SWZB 3IGAB 4W6YB 3BHBA 4XXCA 4M62L 1ZA6A 3HA0A 1T5WB 4DKFL 1M05B 1FFOA 1FVCA 1I3VA 3STLA 3FOMA 4MA8L 2HLAA 1UB5A 5CEXA 3R1GL 4Y5XA 4QNPF 3WUWB 3B2UC 3CAFA 4DCQB 4YIQA 1CWVA 4X5WA 4XNZB 3VWJC 4X6CA 4OIIH 3QJFB 1NC2A 1SJVA 1JTPA 1QRNB 1P2CA 1U3JA 4LLMB 1GAFL 5D1ZB 1QEWA 2CIIA 5ENWA 4U1NB 5EU4A 2AEIT 4Y1AE 4WO4B 5C9JA 2IANA 2X4PB 3TN0D 1YQVH 3L9RB 3KNBB 2OZ4L 1BX2A 1KT2A 2ARJQ 5I8OH 3N9GL 2BSRB 4PRPD 5KVGH 1RURL 3REVA 5FB8B 5I1GH 3QDGE 1S9YA 4YLQT 2CDFA 1G6RA 4DGIL 4KAQL 1GH7A 4BKLA 1K8DA 4C56A 4Q9CA 3B9KA 2YBRB 3FQUA 4TUOB 3B43A 4JFFA 5FOBB 3NFPA 4K7PH 4ODTL 3VFGH 4TN9A 5B21A 3Q3GA 4XMLH 1B4JL 3DYMA 3T3ME 4LEOA 2ZCLH 3V0VA 3P9LB 4Y16B 5JHDB 2VDPH 4LDOB 3DTXB 3NA4A 2VLMD 1HILB 1A0QH 4NKMB 1SEQH 1VHPA 1VEPA 2HP4A 1T21B 4LSTL 5D7KE 3TBVA 3DGCR 2LE9A 5C0BD 4OB5L 1SQ2N 2ZUTA 4PBVC 3O2VH 4HF5H 1T66D 1P53A 2EIZB 5HGHA 1BQLH 3QA3A 5HYQA 4IIQC 3FN9A 3QEUA 5DMGD 4GKSA 4BSWB 4L8CA 2L7UA 4HXAH 1A9BB 3QIBD 3RVVC 5E6ZA 2XKNA 3NH7H 3RZWA 4MWFA 3ES6A 4P5TD 4HKJB 1C7SA 4RNRB 1N5AA 1BZ9B 2BNRD 2BMKB 2J8HA 3MRRA 3PHQA 4KROB 5D2LF 4OIIL 3UO1H 4X6DE 3ULUF 3QXDA 3VD4A 1U8PA 3TCLB 4PJEB 3OBAA 2EYTA 4UDUB 1H5BC 4PJCB 3PNWB 3D3VE 3OXRA 4ZTOH 3X14B 4Z78A 2BDNH 1YQVL 4OM1H 2DI9A 2BVPA 5I8OL 3G5VA 4OQTH 3OX8B 5KVGL 5I1GL 5CJXC 1R3LB 5CGMA 3SDXE 1A1MA 1ND0B 1R3JA 2FR4B 3PWNB 1TJIH 4HUXB 4K7PL 3VFGL 3STZB 1S8DA 4XMLL 5BJTA 4HIHB 2IALB 5ACZB 1KBGH 4U6VH 4APQB 2VDPL 4FNLH 4J8RA 5K9QI 4V1DA 3BP6B 3DX9A 4V2BA 4WHTA 4QRQA 4R4BB 4KTYA 1JWUB 2PYED 1A0QL 5GGRB 2SEBA 1SEQL 2BSSA 4U1KB 4YPGB 3HFMH 1VACA 1Y0LA 4F2MB 4U1IB 3R8BB 3UZQA 1NGYB 2EEAA 4BH7A 3O2VL 2QEJA 4HF5L 4NBXB 5IJVB 4Y89A 1JNNH 2YUZA 1BQLL 2C3VB 2XQYG 4U1MA 3U36B 3QWQB 2P8MB 1XGPA 1BGXH 4PRIB 4I77H 4HXAL 3C9NB 5CMAA 3PIQB 5DC4B 5FO8A 3NH7L 3QHTC 3KJ6H 4JRXA 4Y16C 3WYRA 5DSCB 3QIWD 4KK5D 3PABB 4LLDA 3TYGH 3SBWC 4K8RD 4DKDC 3CFIC 3UO1L 4R96B 1KPVB 2V7NB 5D1QD 3X12A 4XI5D 4K7FB 5IMLB 3GJFK 4PJXE 1EAJA 3FL7A 4ZTOL 1VFBA 4Q6IB 5DJ8B 4OBSA 3D18A 2BDNL 4P3DA 4OM1L 4M8VA 3PHOA 4OQTL 5ANMA 3SO5A 1C12B 3DO7A 2XZQH 1VESA 2YWYA 5GIRB 5MHSD 4L8SA 5DMKB 3SO3B 4TNWK 5IF0A 4MDJA 4M1CD 1TJIL 2NY0C 3CXHK 4XC3H 5F6IB 3K74B 5L9DL 3W5NA 5CIPA 1G9MC 2H32B 1DVFA 2YD6A 1KBGL 1UB6A 1I8KA 2K7QA 3BMVA 4U6VL 4FNLL 2E7CA 3D2UB 3RTQD 4UT9H 4KROC 5EC2A 5AEAA 3MCLH 1PZUB 3RIAK 1HNGA 4L4VB 3HFML 5GJTH 4GRLB 3RL2B 1K9TA 4NN6B 4QO1A 4FQQB 4U1SB 1JPST 3FMGH 1IEBA 2F54A 5HSFA 2H1PH 1JNNL 1SHMA 5J1AB 5I1JH 3FO2A 2DQHH 3MRCB 4JPWH 1LO2L 1MELA 1BGXL 5FKAB 1Z5LA 3VW3H 1Q38A 1WBZB 3MFGB 1T2QH 2DKMA 4I77L 1GC1C 1MWAH 2HKHH 4JGMA 4M93C 3QNZA 3VRLF 3GMQB 4CADA 3KJ6L 1ZA3B 3PWPB 4GRMA 5E5UB 3TYGL 4X8XA 4RAVB 1B0GB 4PG2A 4K3DH 3PQYE 1XR9B 4P2CG 2NY2C 1IGCH 3EDKA 2CD0A 4WFEE 4WW2B 1B88A 3PGDB 3SQBA 1KGCE 4DK6A 4LCCB 3BPLC 1OM3H 1A21A 5CLWA 3HPJA 3BVNB 3EOBA 2EDOA 4ERSH 2HYMA 2IADB 4PJAB 1P7QA 1YPZB 5KANG 4M9PA 1FVEA 3WSQL 3CFJB 5JO5B 1TIUA 2VXVH 4U3HA 1WAAE 3PWLB 4YUEH 4LHUG 3VH8A 4Q2ZB 4XC3L 5HVFB 2X9WA 4I48A 4ONFH 1A8JH 2WP3T 3RIFK 3LSOB 4UT9L 4NP4H 3MCLL 2GY7B 4MS8C 4X8JB 4KZEH 2X7LA 3K4AA 4M61A 4XAKE 2P4AB 3LKOA 1X5FA 5GJTL 4EUPG 5EIIA 2A6KB 4X6FA 3O4LE 1I1AC 3WJLA 5J9PA 3FMGL 2NQCA 4OCXH 2R1WA 3DVIA 2AVGA 1H8OA 5L6YH 3IDNA 3TLRA 5B3JF 1J8HA 5FGSA 2H1PL 1BEYH 1VSCA 3MBED 2O5XH 3IFOA 3QUMB 3UJTL 3W39A 2DQHL 2FJHB 4JPWL 4QRPA 2OXGA 2XA3A 3DPBA 3SO3C 3VW3L 3ULVE 1T2QL 3RVUC 1MWAL 1A1NB 1ZXQA 2HKHL 2GW5A 2V2XA 1Z0MA 4C54A 2KZWA 5DUPH 1AQDA 3LN4B 5D7JD 1MRFH 1U58A 2A77H 3VMOA 3QFDB 1ETZA 2I9LB 2KZ1B 1XIWC 1BOYA 5EUOB 2RHEA 1IGCL 4Y5VC 2A73B 3KGRA 3DIFB 3C8KA 4GRLC 4PJGF 4ZODA 5EC1A 5EN2A 2Y5TB 4GLRI 2C5DC 4NN5C 1J1PH 1OM3L 1HCVA 5FF6B 3DETD 1NC4B 4ERSL 3VWKD 3S96B 4ZUTB 2WNGA 4PP1C 1ES0B 3DJ9A 1BFOB 1S9XA 2VZSA 2VXVL 1T20B 4XZUA 3HUJA 4YUEL 1AE6H 3BN9D 3KWWA 1GRWA 2UZIH 3B6SA 4L3CB 1UQSA 5DURD 1I1FA 4J1UA 4MNHA 4QGTA 2AAVA 1FL5A 3MUZ1 4ONFL 3T1FB 4G8GE 3I02A 4NRYB 4NP4L 5JLZA 5C0AB 1W0VB 4KZEL 1MHCB 1Z6JT 1NFDA 4G9FA 5ESAA 1TDQA 1F6LL 3D0VB 4LCCC 4RX4A 1W8OA 1OSZB 4MXVE 5JXED 4OCXL 4OFYA 5L7XH 5L6YL 2AEQL 3NFNB 1D5XB 1BEYL 2O5XL 1X7QA 4XMKH 4P4KA 3CFEB 2FCBA 2I26N 4YC2B 2VDLH 4U4BA 5BRZA 3W0WD 1MHEA 1FYTD 1G9MH 4X83A 4X7TA 4CVZB 3QEHB 5IMOA 1EGJL 5EBMA 4E41D 2EE9A 4MNQB 2J1KA 4JPVH 4NC0B 2B39A 5DUPL 2QHLA 4LVNB 1MRFL 3VJ6B 3W9EA 2A77L 1K4CB 3S98A 1M6OB 1X6LA 4X6CE 3ARBB 3SY0A 2VDMH 3AXLA 4ZTPH 4IJ3B 4KVNH 4UOW1 3GKWH 4X99B 3ALPA 2I07B 4UBDD 1RUPH 5D5MF 4AM0B 3ARDB 4LRIA 3MTRA 4QTHB 1OGAA 5IKCA 1GC1H 1CG9A 3MRLB 1H3WM 5CD5D 1XH3B 3W5MA 2VKWA 3SQOH 2I9TB 3QUYB 2HTLD 1AE6L 3OJDB 4HS6B 5FKPB 4N1HB 2UZIL 5CZKA 1KPRA 3QFJD 4Z7VB 4GG6A 5I1LB 2EYSB 2L0DA 3KYKH 3OKMA 4N0UB 3GMPB 3S7GA 4PGEA 4XPAH 1KCUH 4G6MH 1RZ7H 3PHSA 1HDMA 3QCTH 3ARXA 4XVJL 3U1SH 1YN6A 3IDIB 4L3EA 2CDEB 4N1EA 3UDWC 2VABA 2RB8A 4A6YA 2VXSH 4PRNA 2ZPKL 5DMGC 4FQHB 3C60D 2KH2B 4Z0XB 5L7XL 1Z9LA 3NBNA 2DDQH 2BSTA 4GXUN 4QGYA 1J0ZA 4XMKL 5DZOA 1I9RH 3SGDH 4B50A 1JWMA 2VDLL 4P5TC 2VAJA 4JFDB 1FO0H 1G9ML 1KCSH 2NXYB 3RPKA 2ADJA 3MJ9H 1PZ5A 2E9IA 3QDMA 3RTQB 2ED9A 2X4TB 3BIKB 3QPXH 3WLBB 5DRWB 4JPVL 3VFSA 3QDJB 4WI2A 3IDMA 3RUGF 2D31B 2MCPL 3T8XA 2D7QA 3C8DA 3L95B 1A9EA 3TA3B 3TNMB 1AKJB 4FTVB 2VDML 3WE6B 4ZTPL 3RWEB 3QPQD 4NO2A 2BNUB 4KVNL 2X89D 4AL8H 3GKWL 1RUPL 5I15H 5C0IB 3MV01 1GC1L 3UZVB 3K81A 3PGFH 2R23A 5JA8B 3RWCA 1H0DB 1QSEE 3TF7C 1K85A 3SQOL 3TVMA 4WI3A 3B83A 1QSFD 3DLQR 5CD3B 4Z77B 4XCYB 1FPTH 3KPPB 4FFVC 1JVKA 4Y19A 3FQRA 4HGMA 3FB8B 1QLFB 5D7IA 4UQ3A 4X4XA 1UADC 1YC8A 4O4YH 2B20A 1PQZB 4OGAD 5IVNA 3KYKL 1GZPB 15C8H 1P7KA 1VENA 2PR4H 4V1DE 4GBXA 4XPAL 1KCUL 4G6ML 1RZ7L 4GRWB 1JN6A 3QCTL 2D7PA 2DJUA 1R3HA 2YK1H 3RY6C 5CP7A 5DI8B 4NQCD 4IJ3C 3VFNA 1FORL 3SCMB 3WS6A 2VXSL 1SM3H 5ISZB 5JW4Q 4M6MH 5DDHB 3GSWA 2DDQL 3OR7B 3DSNA 5HTSA 2FZ3A 2PETA 5FAAA 3MCKA 3O6FA 4I18C 4TTGA 1OD7A 1FO0L 3TO2B 3WO4B 1T2XA 2WM0A 5E6YA 1KCSL 3QIWC 3VFVB 5KN5B 3MJ9L 5BOPA 3X3FH 2ICWI 1K3ZA 5CJ8A 4K8RC 5E1HB 4EZMA 5C07A 5D7LB 4C57C 1I3RA 3QPXL 3PDOA 1ZHKB 5D1QC 2EDHA 4XI5C 2ED7A 5DJ2A 2AK4D 5GRWA 5EU5A 5HHXH 1WWWX 2NY3B 4JRXE 5BS0A 2D7OA 1RZ8A 4IMLA 4JHWH 5I16A 3MYJB 4AL8L 5KSBB 1E4XH 3MXWH 1EHAA 5I15L 5EZJA 4M1CC 1DUYB 4ZO7A 1V7MH 3PGFL 5I1DB 2W9DH 4LSPH 5IOPA 4AQOA 1J87A 4P3WA 3BESR 1G7MB 3NABH 5IT2H 3MJGX 1FPTL 3RTQC 1RQ5A 4JAMA 5T1KA 5HHVH 3OKKB 1IM3B 3QJHA 4MQXD 1CXEA 1VADA 5F7LB 4O4YL 3FB6B 2LABA 1QO3B 1PJ9A 1FG2A 15C8L 2PR4L 3MGTA 5ERWA 1YC7A 2ID5A 2YK1L 3ZKQD 3K1DA 1PG7X 4KKCD 3ET9F 3HAEA 3EGSB 4K3HA 1MCSA 4ZUUB 1CDHA 4M6ML 3SJVD 2F54E 3FT4B 2D0HA 1DTUA 2C1PA 4LHUA 3LEXA 4NCDA 1PYWB 4NDMB 4P59H 4WU5A 1XT5A 3IDXH 4H26B 3S35H 3SE4C 1LP9B 2A9NH 4RAUB 3DMMB 5F7FA 3X3FL 3ARED 3L6FB 3QDGB 3UTTA 3W2DH 1RPQA 5JORB 1U3HD 2ARWA 2ZOKB 5DEZA 1CDUA 5HHXL 1OARH 4YDJA 3TBSA 4QHLB 5E8PA 5HHME 1QFWH 3I85A 2HVKA 2VQUA 4HIIB 4P46A 4OLUH 4JHWL 3RHWK 2OJZH 2PTUA 1LE9A 1CR9H 3B5TA 4H25B 1LEIB 2V2WB 4PY7A 1KJ3H 1E4XL 1MAJA 3MXWL 4XBEH 3MFFB 4JRYD 5J3HD 4ZPVB 1FNGA 3B8SA 3UTQB 4MQ7A 4FXGA 1AIFB 1V7ML 4PJHA 2W9DL 5HGAA 4LSPL 1RJCA 1TZIB 4LPWA 5DGRA 1IBGH 1UWEH 3NABL 5DYOB 5IT2L 4G43A 2P8PA 3BDXA 1FHGA 4MJ5A 5HHVL 3BP5B 1C16B 4PJ9A 3ZDYF 5KAQG 1YNLH 2NY3C 1XCTA 4PRHD 1ADQH 3CUPB 3DV6A 2CR3A 4L4TB 1IRAY 1S7XA 2EDYA 4P9HC 3BEVA 3MBEC 2C3GA 4X6DB 2CLZA 3DRQA 3MRHA 4P5KA 2OK0H 2P48B 3VXMA 4WV1B 4QEGA 4YHPB 1BZ7B 1WT5A 5D1XD 1J8HE 5J11B 4P59L 4Y4KB 3FQXA 3IDXL 3S35L 4LPCA 4OCWH 3MRGA 3MV8A 2YEZB 2A9NL 3JTSB 3QT2A 4C83A 1HHKA 1I3GH 5KS9A 1T1ZB 5D7JC 4WUKH 5KG9A 3SKOA 1T0NB 3W2DL 3RWFA 3IF1B 1BAFH 3ELAT 1T0PB 2AJUH 2B8OT 3QH3B 1WCBB 4POZD 4XCFH 1OARL 3SGKC 2NTFB 2V9RA 4PRPA 1MHHB 4YR6A 4POUB 4NO0A 1GPOH 5K9OB 3DETC 4WDIA 1QFWL 1QVOB 5JTWA 5C92A 4PV8B 4OLUL 5EOTB 1A6UH 2W0PA 2EE2A 3EYSH 2XPGA 4L1DA 3G6JA 2E8ZA 4BFIB 2OJZL 1MI5E 1CR9L 1KNOB 3GSNH 4IOSD 3VFRB 1KJ3L 4JFXA 4MD4A 5I1KH 3TBWA 2Q76A 5FCUH 3SKJL 4NZTH 4NQED 3BN9C 5GS0D 4K8RH 4XNQA 3L3IB 3ZKMC 1IBGL 1UWEL 1AXTH 4X98A 5EIQA 3REWA 1X5IA 3HUJE 1I7UA 3HZVA 4ORGA 3VFOA 2H3NA 3WFZA 5DD5H 3IVKA 1N8ZB 2XY1A 4S0TD 5IFJA 1YNLL 3F5WB 5KSUB 1EA9C 4F37K 4WGWB 1ADQL 1JPTH 2FSEA 2AXGA 5JXEC 2W38A 2E8YA 4WWKD 5DQ9B 4M48H 1NFDE 4BZ1H 3GMOB 4G9FE 3V7MA 3ZDZE 4NCC2 5FV1L 2EIDA 4HEPG 4MSWA 1IGJB 1F5WA 1NANH 4PJXB 2NZ9D 1E6OH 4LNRB 3OF6A 4J12A 4JR9H 4OCWL 4P23B 5BRZE 1I3GL 1A47A 1U0QA 5JDSA 5F9AC 4OD3H 5K59E 4WUKL 4ODXB 3MA7A 1CICB 2V5TA 3Q6FB 1MVFA 1BAFL 1U36A 5F93C 2AJUL 2P5EA 4XCFL 1A14H 1DE4B 1I8MA 4M4PA 1GPOL 2R15A 3WFDH 4UBDC 1A6UL 3EYSL 3CVHA 1OLZA 3LQZB 4JJHA 5EORH 3GSNL 1F6FB 5CD5C 3V8OA 4HXBH 5CILH 1DLFH 1CXKA 5EFIA 3QXTA 2WV3A 5I1KL 5FCUL 2FYYB 2X6MA 5J11C 3ARPA 2HTLC 1NUNB 4Y4KC 1HHHA 2PYEA 4E42A 4K8RL 1BVKB 2AXFA 2P7TA 2R1YB 4UOW0 1W72H 3LPGA 1W0WA 1AXTL 5DK0A 5C86A 4WWID 2X5PA 4HWZB 2XWBB 4N68A 2C4FT 3I6GA 4UZGA 1PY4A 3RGHA 1K2DB 5DD5L 4O51B 3WEXA 4I2XB 4WNQA 2X40A 5CFHA 2W1NA 3RWGA 2A83A 2O5YH 4M6NH 1JPTL 2XRAH 3MOAH 2OLDA 1DN0B 3E3QE 3QAZB 2DD8H 4LCWD 1D5ZA 1KPUB 4M48L 4BZ1L 1DEEB 3TFKC 4AQ1B 1NGPH 3RWHA 3BH8A 2Y06H 4HH9A 2OQJA 1P84J 1E6OL 2HFEB 1XGTB 5ETUA 3U2SB 2MSPA 4RGNE 2HMID 4JR9L 4X9FA 4M1DH 2GITA 2XNAA 3EYUH 3MRJA 2BC4A 4OD3L 1YEEH 3D69A 4LCUB 1ROWA 4KTDH 2ZG3A 4IS6A 1BQSA 3CMOH 3QDME 4MJIA 3PJSB 1XCQB 1FG9C 3P30H 4NQDE 4P9HH 3HR5A 4PR5B 3O6MH 1N64H 4MMXC 3QXVA 4QHNA 3QPQC 4N8VG 1WEJH 3WFDL 1ACZA 4QXWA 4LRNH 2EDLA 5EORL 1S7VA 5F7DA 1KC5H 3KXFD 4HXBL 4OLYH 5CILL 3WNLA 1AQKH 5CKAA 3D9AH 2ITCA 1TNNA 2XOTA 3CSYA 3O4LB 5JHLH 5I17A 2R4SH 4P23C 3JXAA 1U3HB 1U41A 5IR1A 4PJDF 3P77B 5ID0A 1ZGLP 3I3BA 4HWUA 1W72L 1YQ2A 4P2RA 1F42A 4OGAC 2YKLH 5HY9B 4LLWA 1UFUA 1NGZB 3T3PF 4CMMB 4HKZA 5HHOD 4RMTA 5D7IE 3UP1A 2O5YL 4M6NL 1AHWC 4NO5A 1AFVH 3MOAL 2XRAL 2W0FA 2DD8L 1I7ZB 2AJVL 3GHBL 1KJMB 2JJWA 3NN8A 3MBXH 1JHTA 2NX5E 2J3SA 1IQDB 1UC6A 1L7TH 5E8OB 3PGCB 1ZEAL 5GSVA 3H7BB 1NGPL 2PUQT 2OJEB 1UKQA 3MV9E 5IBUG 5IIEA 2Y06L 2ZOLA 4TSAH 1F00I 1QQDB 1IGTB 4J6RH 3QXUA 3ZT6A 3J8F7 1JCKA 4M1DL 4N9OB 5I8EB 2UYLB 3EYUL 1JGDA 4M4RA 1YEEL 4KTDL 3T0EA 4FQ1H 4EN3B 3CMOL 3S34H 1JRHI 3GMNB 3WJJA 1H15A 1BP3B 1DQQB 3P30L 5H94B 3CLEH 4P9HL 3D0LB 3O6ML 1N64L 2R9HD 2YPLA 3LS4H 2FEDD 5T1LA 5BS0E 1OTSD 3ZLQC 1WEJL 2PW2B 3EO1B 4AH2B 4LRNL 5DRNA 1JZ5A 5FDWB 5DS8A 5EU3A 4U6HA 4Q9BA 3RNQA 3L3DB 3VRLE 1HQ4B 3GRWH 3QEQE 4OLYL 3OAYH 1AQKL 3D9AL 1EHLH 2G60H 4NNPH 3U0PB 5JHLL 3QO0B 1FNEA 2R4SL 4UAOB 3QZWB 3JVGA 3CZFA 4MQXC 2PO6D 4YO0A 1ORSA 2GIYA 1CLOH 2YKLL 2OZ4A 4DZBA 2DYPD 2YRLA 4HMCA 4Q74A 4AEEA 2PW1B 1Q1JH 1P5VA 4M6OH 1HIMH 3GMRB 3MRMA 3ZYJA 2XWJB 2JF1A 4AEHH 1QACA 3EYOA 3FFCE 4PRAA 4WRLA 3O6KH 3ZHDA 3MBXL 2H8PA 3ARQA 2K1MA 1L7TL 4KMLB 5EH1A 4KDTC 4X7DC 3AMKA 2LV4A 4TSAL 2QR0B 2XIDA 3WCYA 4ZAKD 4J6RL 1AO7D 3WIHA 3AREC 2ZUXA 3T2NH 4TVPH 3JTTA 2A6DA 4ZSOB 1J0IA 1U3HC 2YRZA 5DUBB 3ABZA 3OL2A 4WFHD 3HE6A 4J23A 2R0LH 4NO3B 2DI7A 1A1OA 4FQ1L 1HZHH 1NFIB 4GW4B 4PREA 5F9WB 4Z5RB 4GG6F 5FK9B 2DF3A 3S34L 1BM3H 3GJFA 5GGSY 1ZKAA 1ZT1A 5LJYH 5E5MA 3CLEL 3ZT7A 5EWIH 2ARJB 4S2SB 5LGJA 3LS4L 4XVSH 4R7NA 3QI9D 1UG9A 3U46A 3FQWA 3H9SD 2BP3A 5J3HC 3RVWC 1NDGA 2HFFB 3KPOB 4NWTH 1ORQB 1RUMH 2P8LB 1JYXA 2M1KA 3GRWL 2CKNA 1OOAA 1EHLL 4ZOEA 1B0WA 2G60L 4NNPL 3VGHA 1NDMB 3FTGA 1XAUA 1J05A 3O2DH 3QG7H 2GYSA 1RAMA 3VXUD 1MCKA 3MUHL 3QQ3A 4PG9A 3EYQC 3V6FA 1IAKA 3ZE0E 5L2KD 4JPIA 1CLOL 4PGDB 4X5XA 4JJ5B 1S5IH 4EN3C 1MCNA 3GIVA 1KJVA 1QFOA 1Q1JL 1LNUB 5FYLE 1JYVA 1NLDH 4M6OL 1HIML 2BNQD 4FOMA 1F11A 2IQAB 4JM2B 1UGNA 4ZFFB 1I85C 1OQXA 1U8OA 1QOKA 3C5ZA 4QOKB 3S5LA 4AEHL 1R5IB 3O6KL 5IM7A 1YN7A 2OSLA 1T1XB 2MWCA 3QIUD 5HYJB 4NFDA 3FO9B 2FATH 2X70A 4ZUSA 3CD4A 1N3NA 2FH6A 3O3BB 4ISVB 4CW1A 2FX7H 2FL5B 3GGWB 5E9DD 4RZCA 1UCTA 3T2NL 4TVPL 4K23H 1IAOA 1U8IA 1LD9B 2F53E 5J4MA 4POZC 5SWSA 3JBG7 2P24A 4U1JA 2R0LL 4HCRH 3I6KA 4OZIE 3LPFA 5E70A 1OAQH 1QSEB 1BM3L 5H2BB 4X0KA 3BP7A 3CDGB 4H1LH 2LFGA 2VQ1A 3ZL4H 3SDCB 3MZGB 3VE0A 5EWIL 3EYFA 3V4PH 4XVSL 1CGYA 1SJHA 3OZ9H 4NWTL 1R5VA 5I0DA 3G6JE 4QY8A 5GS0C 1TQCB 2P43B 1RUML 4HD9A 4FQXB 3QSKB 2FEEL 3EIFA 1FFNB 4HW6A 1BF8A 3BRDA 3BSZH 3O2DL 3QG7L 3ZDXF 3U4AA 3BKYH 3DURB 3NZHH 4GW5B 5INCA 3TIDB 1CQYA 1FZOA 5IW6A 1BJ8A 3ARGA 2Z4QA 4GH7B 4OZFB 2I27N 5J6HA 2L7JA 4NQXA 2FWOB 3KPQA 1S5IL 3VXSA 2NMSA 4EI5D 3P9WB 4ONHB 5FFLA 4WWKC 1A6TA 5D5ME 1NLDL 3ZYIA 2YA2A 3MPCA 3QUXA 1S9VB 3BI9X 3IETA 1I7TA 3C6SB 3ULUD 1U42A 3GSVA 1R24B 4B5EA 1TQBB 5IVXA 3KYOA 2BVEA 3MNVB 2NZ9C 1F4YH 1HN1A 1WITA 1N0LA 1CTNA 3ARFB 3FQNA 4ZFZB 1CLZH 2FATL 5CJOL 3PP4H 5KZCB 2Z92A 2GJJA 4K3GA 3DRTA 3WIIH 2FX7L 4FG6D 4MDIA 1JGVH 2H2PC 3FHAA 1A3LH 4K23L 3OR6A 5IMKA 3MXVH 3TO4B 2AJYH 5HPOA 5FUCC 4HCRL 2VXQH 4LKXB 4LIQH 5F6HI 1OAQL 3IKCB 2JCCB 2VIRB 2CLRB 5TFSH 2P5EE 1XGQA 4AENA 3ZL4L 5E8NB 4JM2C 2ADIB 5EU6D 4NKDA 1MNUH 3V4PL 5FYJD 4IOFD 1FE8H 4BJLA 3UTPE 1GJIA 1EFXA 2ICES 3OZ9L 5DJZB 1CCZA 4Q6YA 2ZJSH 2EE6A 2JK5B 3M45A 3C5SB 4HHAB 1V8HA 4Y5YA 4G8FB 4Y4FB 4F9PC 4OF5A 2ZUWA 2IAMD 3RX5A 1ZTXH 1QFPA 3BSZL 4DGVH 3IJYB 1XR8B 1JP5A 3WMSA 3KHOA 3BKYL 1JZ4A 4U6YA 3NZHL 2L4OA 1W8NA 3CFKB 2YPKA 5C0CD 3UBXA 2JJVA 1YJDC 3EYVA 2ZUQB 1F8TH 1KLFA 1YY8A 3JWDC 3O8XD 2R1XB 1KLUA 3ZHLA 1ITBB 5A2KH 3CX2A 3SDCC 1GXEA 1ZVYA 2CXGA 1R0AH 4NRZA 1CT8B 5ITBH 4UUJB 3VWJA 5T3ZE 2BFVH 4PD4K 3BEWB 1F4YL 4PJ7B 4CVUA 5F72S 1FNLA 1TQCC 4J4PD 1CLZL 4G6FD 3WFBH 3BD5A 3PP4L 1XF3B 3LKNA 5DEGB 2Z93A 1YEGH 5F7MC 3WIIL 3PWVA 4PJHF 2VERN 1BFVH 1JGVL 1A3LL 5FA4A 3U0WH 5HHQB 3MXVL 5CEZE 4OFKA 4ZDHA 3I6LD 1UEYA 4O2EB 3D1MC 2AJYL 5HGBA 4X4MA 1KN4H 3HI1A 3M17B 4JFHE 4B53A 1HSAB 2CK0H 4F7TA 1YEDA 2VXQL 4LIQL 1YECH 5I76B 12E8H 5BXFB 3BQUA 5TFSL 2X4UA 1IL1A 2D4FA 4MJIE 4Z76B 3KPNB 4JY4A 5ICXB 1T89A 5IBTH 3L3OB 4I0CC 2J6EA 4OLVH 1FE8L 3EDDA 4Y1AD 5IQ9A 5IROA 2ZSWB 2G5BB 4JDVA 4K07A 5FYKE 3P4OB 2QTEA 4W4NA 1L0XA 1FFQA 2J5LB 3MRKB 4KXZH 3ARFC 5DA0B 4NNYB 2ZJSL 3CFDB 1HXMA 4WCYH 3UROR 1BQHA 3AB0C 1PEWA 3KPRA 4JFYA 1U92A 1IFHH 1XEDA 4R2GB 2HT4D 3LAFA 3T4YB 1ZTXL 3GSOA 4DGVL 1HQRA 5KS9F 3L1OH 3TO4C 1R3KA 1VPOH 3SKMA 4P2RE 4QRUA 5F7WC 4PYGA 5INDB 2MHAB 1F8TL 2P5WA 2WUCH 1IM9A 3OKOA 2A6IB 2DJSA 1NUFA 3U82B 5B39G 5DHVA 3WFHA 5BZWB 2YD3A 3RL1B 1R0AL 5D7KD 4ZS6D 5ITBL 5GS0H 3NZ8A 2BFVL 4RISH 2AJ3B 2EKJA 5EO0B 3S36H 3M1BA 5HHNA 4MAYB 1XGRA 4L8BA 4WU7B 3K4DA 3UTSA 3U9PH 2OMNA 4J3SA 4QRRA 3NTCH 5IJKC 2C9AA 3WFBL 2GTWA 5HYFA 3F65A 4HKXB 4Y4FC 1YEGL 1EFQA 3DXAA 1MI5B 1DBKH 5EZOH 3V9FA 1BFVL 5SWZA 3U0WL 3H3PH 1ZS8B 1A7OH 4EJ1C 4NGHH 4Z7UA 4GAFB 1KN4L 4P2OD 4PJIF 2R9HC 4F33B 2CK0L 2ZUQC 1T5WA 1YECL 12E8L 2FEDC 1M05A 4NQTA 1OTSC 3BMWA 4PPTA 1ZWIB 5GGSB 3CZJA 5C0FB 2V9TA 2VLKD 4GW1B 3WUWA 1SMOA 5IBTL 4OLVL 4DCQA 3EJYC 3QIUB 4KRMB 3D3VD 3OAZH 2YPLE 4CL7A 5IW1B 2J88H 5C0RH 4B7IA 3QJFA 3G6DH 3OGCB 1QRNA 4LLMA 5D1ZA 3MJ8B 3RGVD 4WCYL 4U1NA 1IFHL 2PO6C 4WO4A 2X4PA 2GJ6B 1QD0A 5ECJE 2UUDH 3L9RA 2B2XH 3KNBA 1VEOA 2YA0A 2AERT 2BSRA 4L8DB 3L1OL 3BZEB 5FB8A 1EDQA 3UAJD 4KK6D 1VPOL 4JZJC 2XZCH 1S7SB 1OPGH 2YBRA 1MFBH 2WUCL 4TUOA 5FOBA 5C09A 3BPNB 3LQAC 1S78D 1T3FA 5AAWA 3ARRA 3P9LA 4Y16A 5JHDA 4K55A 2FECI 4XXDB 5E8DH 5GS0L 3DTXA 2XTJE 3SBWA 1FC1A 1HILA 4RISL 4NKMA 1WC7A 3S36L 2BRQA 2ZSVB 4ODVH 2J5LC 3V6OC 4OM0H 1T21A 1GZQB 3U9PL 4DZ8B 3NTCL 3BOVA 1D5IH 1IARB 1F90H 1HYRC 3VGDA 1DBKL 5EZOL 5HGGS 1CBVL 2EIZA 4EBQH 3MV11 1M7DB 1YJDH 3H3PL 3LQMA 5D7SH 3JWDH 2B1HH 5D2NB 2ICWJ 4NGHL 1S3KH 4P9MH 4BSWA 1A9BA 4BFGA 4KGLA 5A2IH 1KG0B 4HKJA 4RNRA 5BV7C 3RKDC 2BMKA 3JUYA 4JREC 2QQNL 3LKPA 4LVOB 4K7PX 2J88L 5C0RL 1YUHB 3GSQB 1WZMA 1P9MA 3G6DL 4I4WB 4G8EB 3HI5H 3BPOB 4KTEH 4HX1B 4MAYC 3TCLA 1FJ1B 2R39A 4PJEA 4UDUA 4PJCA 3PNWA 4KMQA 4LFHD 3RPIB 3X14A 3MLWH 3F7QA 5HDBF 3VI3E 2B2XL 4IMKA 5DK2B 5E7FA 1OGTB 3OX8A 3MRIB 4NOBA 4JDTH 4HPYH 1R3LA 1MPAH 1Q0YH 4OZGA 4XNMB 1ND0A 1N2RB 2XZCL 2FR4A 1OPGL 3PWNA 1MFBL 4HUXA 1MUJB 4KJQD 3VGEA 3STZA 5DF0A 4HPOH 4AIZB 4GXVH 4HIHA 4GJTB 3FO0H 2UY7A 3GI8H 5ACZA 5K33A 3QIUC 4APQA 1PY9A 3D39E 1T7YA 5E8DL 2YD2A 5IHUH 3BP6A 1NBZA 4R4BA 1JWUA 5GGRA 5JW4M 4U1KA 4ODVL 1DQJB 4MA3B 4OM0L 4YPGA 4G9DB 4U1GB 4MAUH 4MJ6B 4YQXH 5AAMA 4F2MA 2I60H 1KB9J 1NKRA 4U1IA 4LQFL 5JMOC 1D5IL 2ZP0T 1NGYA 1F90L 3OXSB 3CXDH 3D6GA 5CBAB 5IJVA 2IG2H 4EBQL 2C3VA 1K4DA 1YJDL 2ERJB 5F1IB 3U36A 2VUYA 2EDWA 5D7SL 3JWDL 2B1HL 2P8MA 1S3KL 2ESVD 4LKCB 4PRIA 1TZGH 4F7CB 4ODUB 4GKNB 4P9ML 3HZMB 3C9NA 5ABDE 4YDKH 2UVFA 3HMXA 3PQYD 5GZOC 3PIQA 4TNVK 3BPNC 3B9DA 5H37H 3SDAD 3TIEB 4LGSB 5DSCA 4WFED 2O5ZH 3NCMA 1T7WA 4W70A 1KGCD 3PABA 1RJZA 2R8SL 3UMTA 4R96A 3DROB 1KPVA 3HI5L 2D0GA 3CSGA 1T04B 4LAJH 2V7NA 4KTEL 4CU8A 1AH1A 4K7FA 5IMLA 2VZUA 2X10A 1AD9B 3FOLB 4GMSH 5D8JH 5E4EB 4R3SB 4Q6IA 2X4NB 2OTUA 5DJ8A 1SJXA 1CFQB 1QBAA 3MLWL 4YHIB 1FZJB 4QHMB 3MV9B 5J06A 2Q3ZA 4EI5C 2D9CA 1C12A 4JDTL 4HPYL 5GIRA 2GT9B 1MPAL 2LTQB 4KI5E 1Q0YL 1RZIB 5DMKA 2APWA 3H42H 3KPSE 5BZDB 4PJ8B 3ULUC 4WI7A 5KSAB 3DSFL 5C8JB 4HPOL 1FV1B 2Q7YB 4JVWA 2H32A 3FO0L 3GI8L 5ITFB 3LN5B 3OKLB 4EXPX 3D2UA 5IHUL 3A6OA 1AC6A 5FGBC 3EAKA 3N50A 3V4VL 5GRJH 2UUDK 5IVXE 4Z7QF 3JV4B 4FG6C 2ZCHH 1F4HA 4L4VA 4MAUL 2ZZUT 4YQXL 4ZO9A 3HCVB 5CBEB 3RL2A 2I60L 4FQQA 3QDAA 4U1SA 4HSQA 1SYVB 4MVBD 1C5DB 3HZYA 3CXDL 4I8DA 3NIDF 3QR2A 5J1AA 2IG2L 5IEKB 5KVEH 3MRCA 1HKLH 4H20H 3LQAH 5IK3B 1TZGL 1H3UA 1WBZA 3WKMH 5GGQH 4IOFC 4YDKL 3T2OA 3NIGE 1K3IA 4K9EC 3GMQA 5HDOA 2PXYD 4D3CH 1EUTA 3PWPA 2O5ZL 3QUZD 1DUZB 4RAVA 1B0GA 1XR9A 3ZKSD 2IAMC 4BH8B 4LPUA 1GGIH 4WW2A 3FFCB 3PGDA 2FBOJ 4LCCA 4GMSL 5D8JL 4BQCA 2XN9D 1G0YR 4KJWC 4WUUE 3BVNA 3IS1X 2IADA 1D5MB 2NY1D 4PJAA 2ERJC 1YPZA 4KKBD 3O8XC 5JOEA 5AD0B 3IJHB 1ZSDB 1FNAA 3CFJA 4XH2B 3BW9B 5JO5A 1FCGA 2VLKB 3H42L 5EOQH 4G8GD 3PWLA 4ZFOB 1TJGH 4TSBH 5BV7H 1L6XA 1IZKA 1KCLA 1TPXB 43C9B 3LPWA 4Q2ZA 5E94A 4JCLA 5I30H 2E7LC 3IDYC 3VFPB 3IFPB 3JV0A 4J4PC 4JN1H 3QYCA 3LSOA 4XVTH 2VYRE 4EUPB 4KK9D 1KXQE 5GRJL 4X8JA 4PRDB 4LLYB 4Z0BH 1I3UA 2ZCHL 1TVHB 4HS8H 4ODBD 2A6KA 2D4DA 4P57B 4TQEH 5E4EC 1A4KB 3ZTJH 3Q5YA 1FVDB 1ZT4B 1PFCA 3V0AC 1AXSA 3UTZB 4LCYB 3QUMA 3TCXA 5KVEL 2COQA 3KYNB 4GG8B 1HKLL 2FJHA 1M71B 2X1XR 4H20L 4DN4H 4EDXB 2GHWB 3BYYA 2FHFA 3LQAL 5EPMB 3WKML 4X4ME 3MLVL 5GGQL 1P6FA 1A1NA 1H8NA 3DOSA 4HWNA 1I8IB 1NC2D 4PJGB 4D3CL 5HXMA 3G5ZB 4JO1H 3VRIB 3LN4A 1I4FB 5E1AB 1PEZA 3QFDA 3VRJB 2I9LA 2VLLB 5EUOA 3ZE2F 2HT4C 1SMAA 2IAND 1OT2A 2Y6SD 1GGIL 2A73A 3VXOB 3DIFA 5BMFH 2Y5TA 2VZVA 2VO5A 3UDWA 2E9BA 5TDOB 4CN1A 3U30B 2HFTA 1NC4A 1NPUA 5CZXC 3O11B 3VXPB 1BBJB 3S96A 1FCCA 4C56D 3B9KD 3HMWH 3VXRA 4ZUTA 1Z3GH 4JFFD 1ES0A 2I5YH 1BFOA 3OJMB 4U49A 5GRZA 1JFQH 5EOQL 1TJGL 4TSBL 5BV7L 5IV2B 2Q1EA 4ZS6C 4OZ4B 2P5WE 1UZ6E 4P2QE 1CD1B 4L3CA 5I30L 2IBZX 4FFYH 4OZIB 4KQ4H 3T1FA 4R26H 2VL5B 4JN1L 4PRBB 4NRYA 4XVTL 1F3DH 1DQDH 5C0AA 2AKRB 2DL9A 4HUMB 3BGMA 1MHCA 2X9XA 4Z0BL 4QRTA 3KYAA 4X9BA 4HS8L 2J4WH 5SX5K 3VFTB 5I74B 3UTSE 3D0VA 4YBLC 4QRRE 2F9BT 1AJ7H 1OSZA 4CN6A 1OTTC 5MENE 1JGUH 5E08H 4P2OC 4J3UA 1UZ8B 4IRJB 1D5XA 3NFNA 3T4AB 5TE4H 4ZMAT 1PBYA 2GI7A 1D9KB 5SWZE 2G9HB 4DN4L 3ULUH 3CFEA 5E4IA 2GAZB 5EOCJ 4WI8A 4XMPH 2IBGA 1WZ1H 4P3CH 4CVZA 3QEHA 2VQTA 1TPXC 3NCCB 5DHXB 4MNQA 1XGYH 4JO1L 5HVHB 1HI6B 3RGVC 5LAXB 1A2YB 3VJ6A 3MGAA 1GGBH 5IHZB 1K4CA 4D9RE 3A6CH 5D5MB 5L2KA 4U1LB 3T65A 1M6OA 3ARBA 2VLJB 4XWOC 1QRNE 3E6HA 5ESQB 3M8OH 3R4DA 5BMFL 2DQTH 4K7PY 4I3SH 2OI9B 3CK0L 2ESVB 4JFQB 4KKAC 1T4KB 4AM0A 3ARDA 3ZT5A 4S1QH 4QTHA 3HMWL 5FYJH 1L7IH 3O3EB 1Z3GL 3MRLA 4KV5E 1OTUC 3GKZA 4CVXB 3GFUA 3IAPA 4K9EH 4JG0H 1XH3A 2I5YL 4MA1C 4ELKB 2I9TA 1JFQL 3QUYA 3ZE1F 3HLAB 4FFZL 3VFMB 5I1EH 3OJDA 4V1DD 1U6AH 1CU4H 5FKPA 3BRFA 2F74B 5E9DA 4FFYL 4E0RB 4Z7VA 4KQ4L 1MCOH 1YEFH 5I71B 4R26L 4LSSH 4PB0H 2EYSA 5I1LA 3GMPA 1DQDL 1UWGH 1NEZB 1U3YA 3U4BH 4YFEA 4NZDA 3IDIA 3WIFB 3MLYH 2J4WL 3RDTB 2CDEA 4QXUH 3EHBC 2R2EB 1AJ7L 3KS0J 1KENH 4Z0XA 4FQHA 1Z9OA 1JGUL 5GSRB 5E08L 3O9WB 5TE4L 4PLOB 3N85H 5FGCB 3CVIH 3ULUL 1X4ZA 3RUGB 4XMPL 4WVRA 4MHHI 4JFDA 3S6CA 5D6CB 3W9DB 1WZ1L 1AGBA 4GOSA 4JRXD 4P3CL 3LN9A 3GM8A 2YA1A 4OUUA 5F70A 3V5HB 2X4TA 3BIKA 3QISA 5F8QC 5DRWA 1XGYL 3QDJA 4HFUH 1WF5A 2D31A 1GGBL 4XBPB 2AGJH 2YD1A 3A6CL 2P49B 4JQXC 4U05A 2EXWD 3L3HB 3TA3A 4I9WD 3TNMA 1AKJA 4FTVA 5KVMC 3WE6A 4GQPH 4KUCF 3M8OL 5I74C 3GJEB 2DQTL 4PJEE 2Q7NA 1OQOA 4I3SL 3RWEA 1IAIM 2BNUA 5MERB 3DX6B 4LMQE 4HULB 2DWDB 4S1QL 1AR1D 2JB5H 5DWUH 5FYJL 5GRYA 1L7IL 5I1IH 3SKNB 1KJ2B 3MLUH 4KJQC 1F2QA 4K9EL 1H0DA 4JG0L 2X4QB 5DJ6B 1TXKA 2VC2H 1NMCC 1FSKB 3SOBL 4L5FH 2VISB 1DVFD 4X9HA 3BFOA 5CD3A 5I1EL 4Z77A 1MREH 2EDBA 5JPMB 1U6AL 1CU4L 3CH1B 3KPPA 4XCYA 35C8H 3FB8A 3HZKB 4LU5H 1MCOL 5HVHC 4JZNB 1JGEB 1YEFL 3BH9B 1TJHH 5AWNH 1PQZA 4LSSL 4PB0L 5F7HA 3P0VH 1GZPA 4U6XB 1UWGL 2XN9B 1DCLA 1E6JH 3U4BL 2F54D 4E5XB 1KV3A 3MLYL 5DI8A 2WAHA 5JPNB 1G7HB 1TVBB 2VXUL 4QXUL 3SCMA 3EOAA 4GLRH 1FAKT 2DI8A 3L7EA 1KENL 5ISZA 3EFFB 5DDHA 2E6PA 1SVCP 3OR7A 4GMTH 5ESVB 1YDPB 3RZCB 2MNUA 3N85L 3CVIL 5A3ID 3LB6D 3TO2A 1M7IB 2CKBL 1R5WB 4PRIE 3BPCB 2QQLH 3VFVA 2BOCB 4ENEC 4Q9QH 5LGHH 2D03H 2ITDB 2WQ8A 4YHYB 5D7LA 1LILA 4W68A 4IHOB 4TPRL 1ZHKA 1A6PA 3DUHA 3UBXI 1WFNA 1ZHNB 4HFUL 1ULVA 3UYOD 4CN4A 5LCVH 3MV7B 1TCRB 4XCEA 4MYWB 2AGJL 4AZ8A 2K3TA 4JQVC 4QCIB 5C0EB 4M7LH 4M3JA 2YXMA 3A6BH 5FYKU 1MIEH 1FNHA 5CP3A 3P3YA 3GBLA 3WNMA 2FO1A 3GEWB 2CR6A 4HS3B 3HR6A 1P7QD 3BKJH 2DQEH 3BUYB 5I6XC 4LSRH 3BT2H 5ADOH 1YMMB 4IRSB 4OKVB 1DUYA 2HWZL 2JB5L 3HE7B 4Z7UF 5DWUL 5I1IL 3ZYOA 5I1DA 1YY9D 3QRFM 1CDCA 2VC2L 4L5FL 4PBWD 1G7MA 3TPUA 1HH6B 1XF1A 1MREL 4KJPD 35C8L 1IM3A 4Y4HB 4XCNB 1SYSB 1BD2E 4G6JH 1CDBA 4LU5L 5ID1B 3FB6A 4GS7C 4DUXA 1TJHL 5AWNL 1NGXB 3G5XB 5DC9B 1QO3A 3P0VL 2OYPA 5L8KB 2DICA 2IPUG 1XGUB 3J7HA 3QHZH 2Z31B 4MVBC 4ZXBB 3REVB 1E6JL 1UACL 1KSRA 3SPVB 4LGPB 2CDFB 1G6RB 2ADGB 1J8HD 4C56B 4L4VE 1HSBB 3FQUB 3WBDA 4QYOB 1L0QA 3EGSA 4QRPD 4JFFB 1NLBH 4ZUUA 2IJ0C 5E6IA 3FT4A 3H6JA 4N5ED 4OFPA 5DMYA 4GMTL 2NNAB 1DBBH 3C6LB 1PYWA 4NDMA 1LO3H 3KR3H 4MZ3A 4H26A 1KTLB 3ROOB 3G5YB 2X4OB 1LP9A 1UXSB 4PTTB 2YC1B 3VDAA 4RAUA 4JG1H 4PLKD 3DMMA 4DVBB 2QQLL 2EIEA 3SGJA 3L6FA 4Q9QL 3QDGA 5LGHL 3QUZC 4WGVB 2J8UF 5JORA 4DUVA 4N0FB 2ZOKA 1EO8H 3F6IA 3QZWG 5LCVL 3MREB 5TDNB 3PWPE 4QHLA 1IKNC 3MR9B 3FN3A 4HIIA 3T08A 4M7LL 3IXAB 3A6BL 4FZ8H 1MIEL 1NUDA 4GKSB 5JW5A 2NY1C 4H25A 1LEIA 3BKJL 2V2WA 2DQEL 4KKBC 4FZEH 1EEYB 2XKNB 4LSRL 3BT2L 5ADOL 2XZAH 3MFFA 4P99A 2J7LA 1TZHB 4ZPVA 3ZSSA 3UTQA 1NAMA 3EDJA 4MX7B 4ZFOL 3LKQB 3PDDA 1AIFA 1G7QB 2OTWB 4PJAE 4LL9A 4RBPH 1UJ3B 1CGSL 2JB6B 3S4SA 1YPZE 4AK1A 1TZIA 4RDQF 4JHBA 1J0KA 5DYOA 1UEMA 2MMXA 2AS5M 1I9EA 5A16B 3I84A 3S35X 2VLRB 4YHYC 3BP5A 5C08B 3VXTA 4Z78B 1C16A 4G6JL 1ZLVH 1NAKH 1PX4A 1DEDA 4G9FD 4PJFF 3QHZL 4RX4D 3CUPA 4OFYD 4PJCF 4M7JH 4NQSB 4XXCC 1SY6L 4L4TA 4JY6B 1KFAH 4FXKA 3PG2A 4R0LB 4X6DA 4P4KD 5CEYB 4Z9KB 1NLBL 4H0HB 4OQ1A 5BRZD 4Y5XC 4WV1A 4YHPA 1BZ7A 1UH3A 3GSXB 1YNKH 1DBBL 2FO4B 4OZGF 3MRDB 2B5IB 1IT9H 4Y4KA 1LO3L 2EO1A 1PKQB 3KR3L 5F7KC 1BECA 4WHTB 1A3RH 5D96C 2YEZA 2SEBB 2BSSB 3K2MC 3C08H 1KIQB 3JTSA 4YPJA 4JG1L 2JLLA 3ULSB 1T1ZA 3V52H 1T0NA 4ELMF 5E99H 1AXIB 3G04B 3IF1A 4Y4HC 2VLME 3FHQA 3QH3A 1NBVH 1WCBA 1KTKE 1EO8L 2Y6SC 3LKRB 3WS3B 5I1HH 4RMUA 1EMTH 2NTFA 3RI5F 4M00A 5DR5H 1H8SA 3WL9A 5K9OA 4ODSH 2IFFH 1XGPB 1QVOA 4PV8A 2VSDA 4FZ8L 4GKOA 1IC5H 5EOTA 3D39B 3B9KC 2DKUA 4BFIA 1OGAD 1KNOA 3VFRA 4FZEL 4D2NA 4OCMC 1AGCB 2XZAL 1S7UB 1CE6B 3C6LC 4LP5A 2KL6A 1YYMH 2GJZB 2P46B 5IQ7H 3GSUB 4H0GA 2CRMA 3L3IA 5B38B 1NUGA 5DQJA 1P69B 2W91A 4MD0B 3O2DA 4U2YA 2WBJB 5TQ0H 2VZTA 1N8ZA 2E7HA 1NAKL 3CU7A 1WJ3A 3F5WA 5KSUA 4L3ED 2XICA 4XX1E 2YD5A 1JPFA 4R90H 5C0AE 4M7JL 1FL3B 5DQ9A 5DHYA 5CCKH 4RGND 3GMOA 1KFAL 5D72H 1XFPA 2BX5A 1RVFH 3BZFA 1IGJA 2GTZB 3DBXB 4UTAH 2X1QA 4ZG1A 4PJXA 2OR7A 4KRPD 5GS1B 1YNKL 5E2UH 1UB6B 2QHRH 1IT9L 3QDMD 3GI9H 4M7ZB 4P23A 1A3RL 4LMQI 5EC2B 4RFNB 3TEUA 3C08L 1TTFA 1HHJB 3T77A 1QG3A 3V52L 4ODXA 1CICA 3Q6FA 3RWDB 1Q9KB 1NBVL 3KPSB 4YK4B 3B9EA 1QSZA 3I9GH 5I1HL 3NMEA 1EMTL 1G6VK 4ZUVB 4JN2A 2MKWA 4HJJH 5EBLB 5DR5L 5IHLB 1DZBA 1WIUA 2VH5H 4ODSL 2IFFL 1IC5L 4PLJD 2QBWA 1U8NB 3VGFA 4WIQA 4P48A 4OAWB 4LVHC 3NIFE 5TH2A 1DBAL 4R0LC 3L5HA 1KJ2H 2A74B 1A7QH 3IRPX 4CADB 2XY2A 3U79A 3TVMD 2FYYA 4EVNB 5IQ7L 1YYML 5HYEA 4Z7OE 1DL7H 3EOYG 4Y19D 3V2AR 1BVKA 2R1YA 3SDDB 5DEFB 2F5BH 2NY6D 3GHEH 1WQVT 2XWBA 5TQ0L 4GBXD 1K2DA 4O51A 5FM8A 1OAUH 1HHIB 1DLHB 3OKEB 3V6BR 1F58H 1MJ7H 4HWBH 5FXCH 4N0UE 1DN0A 3VFWB 1VGEH 2GKIA 4R90L 4WW2F 4YZFE 4DEPB 4L9LB 1KPUA 5CCKL 2VN4A 1A02N 1DEEA 4G80B 5D72L 1RVFL 3O6FD 4UTAL 2V5SA 2F8VA 2HFEA 1XGTA 4WW1B 5E2UL 3QP3A 2QHRL 1CGXA 5H37G 4WHDA 1ZLVK 3GI9L 3DX7A 1BBDH 1FH5H 3GMMB 5C07D 4ZQKA 4M61B 4JFDE 5ICZB 3PV7A 2HJKA 5BS0D 2Q8BH 5J9PB 3PJSA 1XCQA 3DX8B 4OLWH 2R1WB 5C0DB 5KSVB 3I9GL 4N8VB 5GGVY 3QDJE 3T0XA 4PR5A 2MPAH 4D8PB 4HJJL 3W39B 2GCYB 2VH5L 4L8SC 5KW9H 3O3AB 4X9IA 3EOTL 5C0ND 4PJDB 2MFNA 2PYFB 1KJ2L 1EEZB 4FMKA 1A7QL 2VMFA 1LK2B 5MI0C 1XF4B 2FH8A 4PGJA 5GS1C 5KVDH 3O4LA 1AQDB 1HXYB 1EO7A 2F8OA 4M7ZC 2W07A 1DL7L 5T1KD 4UB0H 3MOQA 5A2JH 3P77A 2VDRH 3ILQC 2ATKB 1BJ1H 1FGVH 2F5BL 1VB9A 1WUNT 3GHEL 4PGZA 3VGAC 4LLAA 1JPSL 5EC1B 5HY9A 4HBCH 1NGZA 3MLTB 1EBAA 4CMMA 4KJYB 1OAUL 1G6RH 1JNHB 1VA9A 5EUOF 4DKFH 1AP2A 1FQ9C 1MJ7L 4FQLH 4HWBL 4RIRA 5HI4C 4WI6A 4ONGH 5KTEH 1VGEL 1I7ZA 1KJMA 2BRRH 5IBUB 3EKCA 4WTXA 3FN0H 1MWAB 4LHUD 1EJ6A 2BY0A 1IQDA 4XZUB 5E8OA 1QR1B 3PGCA 1IGIH 3H7BA 2OJEA 3LEVH 1S5HB 1IGMH 3LB6C 1QQDA 4FFWD 1LWRA 1IGTA 4PY8J 3SKUD 3I02B 3UTTD 1VKXB 4F7MB 3BD4A 2JE8A 1BBDL 1FH5L 3HI6H 4YHLH 3VMNA 2ILLA 2X1WL 1V5JA 2UYLA 2NY4B 2H6PB 1ITCA 3PL6A 4EN3A 5F1NB 2Q8BL 4PJBF 3GMNA 4KAQH 5D7LE 3CSBA 1DQQA 1DDHB 1CK0H 4P46D 5H94A 3WN5B 1E4JA 3D0LA 3HG1B 2MPAL 4M5YH 1T7VA 1I85A 2F5AH 4H5SB 4WEMB 4P4KB 4DEPC 1BFTA 5GS3A 3ARSA 2PW2A 3EO1A 4AH2A 3FFDA 1C8PA 1WTLA 1JWSB 2WBKA 3UYPA 4X7TB 4H8WC 2W0LA 5MEQB 1YY9C 2VTFA 3MMEB 1HQ4A 1LGVA 5KSBE 2CSPA 5M7QA 3BJ91 3U0PA 1H5BB 1JI2A 1GOGA 2FHBA 3QO0A 4UTBH 2Y9RT 4RQQB 4DKEH 5E7BA 3QZWA 4UB0L 5FYLD 2W65B 4XCCH 4PJ9D 4S11A 4XHJC 2FLRT 2VDRL 1FGVL 1J5OH 1F4XH 1OW0C 4HBCL 5B8CA 2RFXB 4B41A 2PW1A 3AMLA 2WK2A 1G6RL 2Z35A 3GMRA 3ZTJG 1EEUA 3BKMH 5F9OL 4FQLL 4ONGL 5KTEL 2BRRL 4N5EC 3VXMD 3FN0L 4LLQB 3WHXB 4KUZH 1IGIL 5DJDB 2ZUUA 3CC5B 3LEVL 1IGML 1N0XH 4D0BA 2QR0A 3MV8D 3CH8A 4OSUH 4PLKC 2DM3A 4JFEB 4Z7NE 3O3DB 3HI6L 4X6EB 4YHLL 3WXWH 5EBWB 5DUBA 1LP9E 3AM8C 5TJWK 5K9QG 4MB5A 2XFXA 4L3EB 4NO3A 4GW4A 4Z5RA 1NFIA 4Z7VF 2E3VA 5FK9A 4NUGH 4UNUA 4NO0D 1URLA 1CK0L 1ZLUH 2APFA 1CYGA 4UDTB 2ARJA 4S2SA 4M5YL 1II4E 2F5AL 5ALBH 1EBPA 3IJSB 1DQLL 2KQMA 4R7DA 2BVOB 3RVTD 3HB3D 4NJAL 3DUSB 1PAMA 3RVXD 2HFFA 3KPOA 4HDIB 1ORQA 1EO5A 3EO9H 2P8LA 1CXIA 4F80A 4WI5A 5CAYB 2FJFB 1NDMA 2O93L 4S1SH 1FYTE 4UTBL 4DKEL 3IU3A 3KJ4C 2QADD 5D93C 4XCCL 1A9EB 3RWIA 2NY4C 4Q0XH 3KDMB 1J5OL 1F4XL 2NXZB 4JJ5A 1EPFA 5CINH 1L6ZA 2OP4H 5EOCH 1OY3B 4ODHH 1X5XA 2AJZB 1I9IH 3WN5C 3ZKXB 2IQAA 4JM2A 2NY0B 3RU8H 4ZFFA 3BKML 2HH0H 4QOKA 2IPKB 4NFCA 4P4KC 2R23B 1R5IA 1X5AA 5GPRA 3TP4A 4OZHF 1SJEB 1T1XA 4L4TE 3N1GC 5DJAB 1BVLB 4KUZL 5HYJA 2JIXD 3OF6D 3FO9A 5MEPB 1N0XL 1EXUB 2XG4A 3FQRB 4Y19B 1CLCA 3O3BA 4ISVA 4OSUL 5FHBH 4KQ3H 3GGWA 2CGRH 1JUFB 1U2HA 3BAEH 3JSSA 1LD9A 3WXWL 2P5ED 2DRUA 1KEGL 3QFJE 3BIBX 1C08B 3UTPD 4TVPE 1QSEA 4NUGL 5H2BA 2HA1A 3CDGA 4D9LH 5BVJB 3SDCA 4LRIC 3RAJH 5AUMA 2APBA 5SV3A 4GRWF 3O41B 4M93B 4W4OA 1T03H 3KPLA 5ALBL 1E0OB 5L9DH 2XWTB 2UV3A 2BXZA 2R56H 4PGBB 4ZYKB 2FJGB 3EO9L 2HLFD 4FQXA 1PKOA 1NMAH 2NY2B 3PDOB 3ILPB 1FFNA 1CVSC 4S1SL 1ZVSB 2DIJA 3BPLB 2YSSB 3EW3B 3KS0H 1XF2A 3DURA 4GW5A 3MNWB 4OGXH 3TIDA 5CGYC 1BPVA 4PJ5B 1YEIH 4Q0XL 2X4SB 4OZFA 4IMLB 3IS0X 3CPLB 1REIA 2FWOA 2AQ3A 2XT1B 1LO2H 5CINL 4HC1A 4Z7WF 4ONHA 2OP4L 5EOCL 4Y2DA 5EO1B 1TLKA 4ODHL 4HUVB 1JRHH 4GAYB 1I9IL 3AY4A 4WEBH 4RGNC 1S9VA 1U8JA 3Q6GH 4M9OA 3RJDA 1SBBA 3RU8L 4H8WH 2HH0L 3C6SA 4HJGB 1R24A 1FO0B 3QWRA 5D71L 3VMPA 1U8HB 5GGTA 3MNVA 5HDQH 3ZE1E 2FRGP 4YAQB 3ARFA 2Y23A 2BOBB 1Q9OB 4ZFZA 5CEZD 5T1KB 4DTGH 3GIZH 3RRQA 4RMRA 4AT6B 5FHBL 4KQ3L 4JFHD 2C3HA 2CGRL 1QSFE 3H3BC 2FNBA 3TC9A 3TZVB 1I1AB 3BAEL 2UZYB 4MJID 3TO4A 4DVRH 3B5HA 2D7MA 2ATPA 5F1SA 4MLSA 2NXZC 1PW3A 2V5RA 4CU7A 1I7RB 2FB4H 3HAEB 4LKXA 3IKCA 2VIRA 2CLRA 3WSQH 4M5ZH 4D9LL 2PN5A 4OV5B 5E8NA 3ZKXC 1RK0B 3RAJL 1F3JB 1B2WH 5DLML 4NQCE 4WU5B 1T03L 5A40E 1INEH 1BD2B 2LU7A 5GHWL 4UNVA 4ZOCA 2Q86A 3O45B 3TVMC 5DJZA 1FZKB 2R56L 2JK5A 3C5SA 4HHAA 1XIWB 2ZCKH 3UJJL 3R0NA 1NMAL 4G8FA 4Y4FA 4Y5VB 4P2RD 4RRPG 4WFGD 1G7JB 2C4XA 2VJXA 3IJYA 4NN5B 1XR8A 1ZLUK 4OGXL 3CFKA 1YEIL 3NGBB 3UJTH 1MCWW 3JV5A 1P4LB 3LVEA 3V8CA 3WS6C 1OL0A 4PY7B 2R1XA 3TBTA 3GB7B 1JRHL 4IOIA 4WEBL 1HE7A 1V3JA 4I2XE 3Q6GL 4P4RB 3T3MF 3OJ2C 4L29B 4H8WL 4FXGB 4ALAH 1CT8A 1Z2KA 4PJHB 4UUJA 3O6FC 5J8OA 1EHNA 1S9WA 1EVTC 3BGAA 5HDQL 3BEWA 4PJ7A 5IW3A 3K8LA 3NFSH 5HHPB 1OAZH 3VA2C 4MCZB 1GIGH 4DTGL 1XF3A 5DEGA 3GIZL 3MLXH 3QUKB 3CXHJ 3BO8B 3O0RH 5IG7B 1J1XH 2XG5A 2BCKB 1MQKH 4NKQB 4RWHA 3T0ED 1KCKA 5HHQA 4PFEA 2BK8A 1G7LB 5CJQL 4F9LC 4DVRL 4O2EA 3EBAA 4M7KH 1ED3A 4U7MA 3M17A 2YPLD 3WLWD 1HSAA 2FB4L 5I76A 5BXFA 1KN2H 5T1LD 1QFWM 4M5ZL 1X5ZA 1AGDB 4Z76A 3KPNA 3VXMB 4H88L 5ICXA 1B2WL 2WWMD 3L3OA 1U8KA 5C0NC 4K2UL 4JLRB 1INEL 3MGOB 4LIQE 2ZSWA 2G5BA 2JTDA 3MRGB 3P4OA 4IEFB 4FQ2H 4X6DF 3NCBB 3MRKA 3SJVE 2HJLB 1FAIH 4NNYA 3CFDA 3WD5H 2BY3A 2CH8A 4WENB 1E28B 2ZCKL 3DVGB 3TN0B 3T4YA 1N26A 3TZVC 1RIUH 2AABH 4PRPB 1T83A 1AGEB 1XF5B 3DI2B 3EO0B 2AEQH 3SDXF 3KHQA 5INDA 2MHAA 2XTJD 4KRLB 4ZFGH 5B39B 4F58H 2EECA 2G75B 5IMMA 3SE3C 1BF2A 5M94B 5TF0A 1A6ZB 4ZUWB 3WDIA 3NCJH 1MCQA 1EGJH 2YUVA 4L4JA 3FRPA 4ALAL 3RL1A 1FLRH 3T1WA 1QTYT 2V2TB 3WO3B 2AJ3A 1X4YA 4DKAA 5EO0A 4MMZC 4FFWC 4MAYA 4JRYE 4WU7A 1TTUA 3NFSL 2CRYA 5C0BB 1OAZL 3HZVB 1GIGL 2H3NB 4HKXA 4PJIB 4C59B 3MLXL 3UYRH 1IC7H 3HE6D 1MI5A 3O0RL 1J1XL 3EZJB 1MQKL 2WMPA 5CUSH 1ZS8A 4A6YH 2AXGB 3VA6A 1GCFA 4CBPA 4M7KL 3LCYA 3NGBC 4YFLF 3F62A 3W81A 3R8QA 1KCRH 3QIBB 5T1MB 1KN2L 5EUKB 4GKZB 4C58B 1ZWIA 3I75B 4P5TB 5GGSA 3Q1SH 3FAWA 4NPYB 5C0FA 1T80A 2BNRB 4GW1A 5IW1A 5BO1L 4U2ZA 1HOCB 2YD4A 3SHSA 3IYLW 3OGCA 4FQ2L 2KQNA 3ZO0A 1FAIL 4CMHC 2OL3A 3MJ8A 3WD5L 4PJXF 1KOAA 3S36X 4XVJH 4PJ9C 4TSCH 3VD7A 1CVRA 5D70H 3KLDA 5DZNA 2GJ6A 2FX8H 3BDYH 2E5EA 4YH6A 5C6PB 4M3KB 1RIUL 1I8MB 2AABL 3X11B 1EAPB 2ZPKH 4L8DA 3BZEA 3QWOB 5BOZG 2WLYA 4X6BB 1S7SA 2N7BA 3C5ZD 2A0LD 4GT7A 4ZFGL 4F58L 3QNXB 4LLUB 1KIRB 1WT5C 2E6QA 3NCJL 4WY7H 1LK3H 1DQTA 1FLRL 1JF1B 4XXDA 4KKLD 2QSTA 4JGUA 1OP5H 2PYEB 1UKSA 4LDEB 2AXFB 2ZSVA 4MXQD 1J18A 2MCPH 3ZYZA 3DVNA 1GZQA 5AYQA 4DZ8A 4OLXH 2EC9U 4WJ5B 4DN3H 2JELH 3TN0C 3UYRL 2YPVH 1IC7L 1UXWB 5SWSD 5D4QA 1PLGH 4JE4B 2CLVB 3L3JB 3RWGB 3FO1B 1M7DA 1QA9B 5CUSL 4WTZG 1TCMA 2Q87A 4A6YL 1KF9B 4ZSOE 5D2NA 4UT7H 2DWEB 3SGEI 5CJ5A 2DQGH 3ARVA 3GSNB 1RK1B 4N0CD 1KCRL 3BH8B 4I18B 1F02I 1FIGH 1HHGB 4KHXH 3TJHD 3Q1SL 1KG0A 3MRQB 1DBJH 3QIWB 3HB3C 1IC1A 3W11D 3RVXC 3D87B 4BK5A 4PYHA 1BLNB 4YFLI 2IGFH 2C3XA 1YUHA 1CIDA 3GSQA 5D1QB 3O81A 4HK0A 4G8EA 4I4WA 4JM4H 4J3XA 4HX1A 5L88H 1CGWA 1FJ1A 3GUTB 1MHPH 3MCG1 4IS6B 5HI5D 2QADC 3RPIA 1KTDB 4TSCL 5D70L 1T66C 1YNTB 5I1AB 2FX8L 3ARGD 3BDYL 5J12B 1L9MA 1NEZG 1FORH 1RZKC 1JTOA 3T0WA 5DK2A 3VXSD 2D7TH 1CE1H 1OGTA 3MRIA 5HDLA 3CNKA 2E9WA 2DN7A 4OGYH 4XNMA 3MLSH 1N2RA 3QUXD 4B0MM 1WAAF 5FUCE 3QIBC 4NYLB 4OCLC 5H35B 3KPMB 4AIZA 1B0RB 2ITCB 1DANU 3NA9H 4WY7L 1LK3L 4GSDH 1ZHBA 4PGCB 4QOKE 3UPRA 5C3TA 4NQDA 2XYCA 1Q9LB 5IR1B 1DQJA 4MA3A 4JO4H 4G9DA 2AQ2A 3KYMB 4OLXL 43CAB 5HYJE 4DN3L 5IGXH 2JELL 3E6FA 3OXSA 2YPVL 4RFOH 4ETQB 1PLGL 5CBAA 5EB9A 3RP1A 3HAEH 5F1IA 4LBEB 1NCCH 2APVA 4BFBD 5HPMB 1J8KA 4UT7L 3CU1A 4LKCA 1N4XH 4F7CA 1D6VH 2DQGL 5GGVH 4GKNA 5CSZA 5T3XH 3HZMA 3ULVF 2ED8A 2MQ0A 1U8MA 5IIEB 1EFXD 1FIGL 4KHXL 9CGTA 4LCWE 2P44B 3TIEA 2FLBT 1DBJL 2OTPA 2VNCA 2HTKD 3GNMH 2HLFC 2AXJA 2IGFL 2IFGA 3NCYP 1W72B 4JM4L 1T04A 5L88L 2OX5A 4G5ZH 1MHPL 2FIKB 3MJ7A 3FRUB 3FOLA 2KKQA 4R3SA 2NX5A 2X4NA 4JFOB 1CFQA 1FZJA 3FJTA 2DQUH 5TDPB 1FIEA 4QHMA 3B3IB 2NLJB 3MV9A 2A6JB 1RJLB 1QBLH 1CE1L 2D7TL 2DMCA 3TH3T 2CQVA 5T1LB 2GT9A 2NYYD 2GSGB 1OSPH 4OGYL 4XPFH 3MLSL 5DRNB 5J1SC 4JANB 4BZ2H 5BZDA 4PJ8A 2R2BB 2KBGA 1LO0H 4NC2B 3WDHA 5KSAA 3VWJD 1RJYB 5C8JA 1HK6A 4BK4A 1FV1A 4KK5C 4ZS7H 2EEDA 2UY6A 3NA9L 5ITFA 3LN5A 3OKLA 3DNKA 4GSDL 1NCAH 4Y8AA 4QWWD 5SX4I 3H0TB 4CAGA 2FGWH 4KUCD 5FYLH 3JV4A 5BQ7B 2BSED 4JO4L 1CLYH 3MJ6A 1S7WB 2AI0H 3HCVA 5CBEA 5T5FH 3ZMRA 1OF2A 2RCSH 1P1ZA 4U1HB 5IGXL 1C5DA 4MXVF 4RFOL 1MCRA 1ZK9A 5T33H 3LH2L 3MBEB 5J12C 3AROA 5IEKA 3MRMB 3QEQA 5D6DA 2BY1A 4FQPA 2UWEE 1NCCL 3UEZA 4NT6B 3BQUD 1N4XL 5IK3A 4O2CB 1D6VL 5GGVL 2Y7QB 2BVQB 5T3XL 5E2VH 5CHNB 1MLCB 2PNDA 1T0MB 3MRPB 1WBXB 5ALCH 4S1DD 2JCCE 1HEZB 3V6ZB 1O5DT 5D7JB 2Z0BA 2HRPH 3GNML 2DS4A 4HGWB 1RHHB 1DUZA 3KPRD 5FECB 4O5LH 4X6CF 4BH8A 4G5ZL 1J0JA 4F8TA 1VEMA 1CS6A 3FFCA 1T5XA 4UILH 2EYRB 4P5MB 1WVZA 2DQUL 3VWKB 1D5MA 2AEPH 1QBLL 1NCBH 2H41A 2RJMA 2P5WD 1IM9D 2GEEA 5AD0A 3RVVD 3IJHA 3HPLB 5E5RB 1OSPL 1ZSDA 3FQWB 2WINB 4XH2A 3BW9A 4XPFL 4BZ2L 5HVWA 4ZFOA 1U8LB 1LO0L 3AC0A 43C9A 1PX3A 3B9AA 5DURB 2DQFB 3K8KA 4ZS7L 4DW2H 2DBJA 3G08B 3VFPA 1NQBA 3IFPA 3UTSD 4QRRD 1NCAL 4OCSH 3NPSC 4NKIH 2YWZA 4EUPA 2FGWL 4U7KA 5FYLL 3FT2B 2V7HB 2BVYA 5MEND 1JHKH 4PRDA 4LLYA 2F58H 3DXAD 1TVHA 3U4EB 4JPIB 1CLYL 5ADPH 4PJ7E 5J57B 2AI0L 5SWZD 5T5FL 3T0EC 1RZKH 4P57A 3ECBB 2RCSL 4N9GB 1A4KA 4JHZA 4R4ND 3WJJC 4EIGB 2FX9L 5T33L 1FVDA 1ZT4A 3UTZA 1VDGA 4LCYA 3WLWC 5F9JB 2E27H 1U8OB 1BREA 3KYNA 4GG8A 1N6QH 1M71A 1JZ8A 4EDXA 3W0WB 5IBLD 1FYTB 1L9NA 3SKJH 1BOGB 1YN7B 5KOVC 4OF8A 5EPMA 5E2VL 1LMKA 5ALCL 4HGKC 4E41B 4ZUSB 1I1RA 3JWOC 1I8IA 4PJGA 3LIZH 1QRND 3SEPA 3G5ZA 3VRIA 5D1ZD 1I4FA 5E2WH 2HRPL 3HC0A 5E1AA 2FECL 3VRJA 3JVGC 4CKVX 2VLLA 5JW4N 4O5LL 4WO4D 3TBYB 4EXKA 3H9HB 2R0WH 1O0VA 3V6OE 4HFWB 3VXOA 3FONB 1AO7E 3L3KB 3I6KB 1E27B 2EDXA 4UILL 5TDOA 3VXNB 3IXTB 2WWKO 4U3CA 3O11A 3VXPA 2AEPL 2J12B 1NCBL 2XTJC 2OBGA 5C09D 4XB8A 4KWUA 3ARYA 3V4UH 1IEAB 5DZLA 1FBIH 4MA7H 1RULH 4Y16D 1DN2A 5IV2A 5JHDD 2F53A 1AGFB 3U6RB 2DQDL 4OZ4A 1FN4B 3G9VA 3L5WB 2WW8A 4X9GA 3QFJB 2YD8A 3U0TB 4FA8A 5DD6B 1MJJB 2WWKT 4DW2L 1IGYB 3MOBH 5LKNA 4OZIA 1QNZL 3FT3B 3DHJA 5I18H 5DTFB 2CDGB 2VL5A 4PRBA 4OCSL 4XAWL 5AZEH 4NKIL 2AKRA 3K8MA 4N0YH 1JHKL 3HE6C 1N7MH 2F58L 1X5LA 1QKZH 3H8NA 5ADPL 5BVPH 1JPGB 3V7AG 3VFTA 1RZKL 3WUZA 4U0RC 3C60B 1NCNA 2V5MA 1A6TB 3VWKC 5J13C 3QUXB 1UZ8A 1PD6A 4IRJA 3T4AA 2N4IA 4U6TA 5HJ3B 2E27L 1N6QL 1D9KA 4QNPE 1A7NH 1Y6MR 1CZ8H 2BNQE 5L2JB 4AJ0A 3FQNB 4LK4A 1YEJH 4NC1C 4Z6AT 2ORBH 4FN0A 2Z92B 3ALXA 3LIZL 4ZPTB 1JMZA 4LSUH 1HI6A 5B38G 5E2WL 4MGXA 1A2YA 5LAXA 5IHZA 5D5MA 1IE5A 5IMKB 3PWUB 1MOEA 3DVFA 3CGTA 3QB7C 5LQBH 4HZAA 4G8IB 2R0WL 2VLJA 1A7RH 1UWXH 5ESQA 3P4MA 2KDGA 4KH2A 2QJDA 2VAAB 3SE9H 3N1MC 4G42B 4JFQA 4OD1H 3NCYS 4S1RH 5LXGH 1T4KA 2GJ6E 2HFGH 5BCAA 3CVHL 3C5ZC 2A0LC 3O3EA 1B3JA 3CDYA 3AU1B 3MNZB 1J88A 4CVXA 3V4UL 1QSFB 4ELKA 1FBIL 4MA7L 1RULL 3OKDB 2JIXA 1L4IA 3HLAA 3VFMA 4AIXA 2VR4A 4APQD 3TT1H 4KKLC 1Z9SA 3IAQA 2VRAA 1MFCH 4NKOB 2EKSB 2F74A 3HKFA 4MXQC 1Q9WA 1OB1B 2EO9A 3MOBL 2K9UA 3NCFB 5I18L 5AZEL 3CFBB 2EDQA 5JUEH 4YEEA 1A3QA 4OKDA 3DHMA 1IC4H 1INQB 4JQVA 4N0YL 1E4KA 1N7ML 1RFDH 5DVOA 4NQCB 1QKZL 3WIFA 5BVPL 1AHWB 3RDTA 3MA9H 2R2EA 2YRPA 3U48A 4H1LB 1KLUB 2YZ8A 2C7UB 1F6AB 4PRID 5GSRA 3MLRH 3O9WA 3CMGA 3O4OC 2DMBA 2QLVB 4GUPB 4RGOH 3TJHC 1A7NL 3RUGA 5D2NE 1B6DA 5D6CA 3W11C 5JDJA 3W9DA 5F88B 1A6WH 1CZ8L 4HIJB 1U93A 4MLIA 2EH8H 5D2LE 2AP2A 4K71B 3V5HA 1YEJL 3KLSA 3ULUE 2ORBL 3AS0A 2HJFB 2AK4B 4F7EB 1K5NB 4F3FA 4F7PB 4LSUL 4XBPA 2JJSA 3QULB 1T7XA 2D0FA 3EJZD 5LQBL 4NQUA 4WEUD 3L3HA 1TETH 4ZDHB 3ARGC 1A7RL 3ETBF 3GJEA 4LPXA 2AJVH 3GHBH 3C60C 1EK3A 3SE9L 3OKYA 1UYWH 3DX6A 4OD1L 4S1RL 5LXGL 3QUXC 4K94C 2HFGL 3VI4F 2DWDA 1ZEAH 4JFZH 3SKNA 1KJ2A 2IWGA 4EEEA 3JWOH 4KDVA 3C87A 2X4QA 4UU9A 3CDFA 5DJ6A 1N5YH 1NGQH 3VH8G 2VISA 1X5HA 3TT1L 5EU6E 5JPMA 5FYJE 3CH1A 3D2UD 1CI5A 1U92B 5IB2B 1MFCL 3HZKA 4X4ZA 4AEFA 4G7YH 3PP3H 4JZNA 4L4VD 4GAGL 3BH9A 2EXYD 3GSOB 2CUHA 3S3SA 5JUEL 4U6XA 1NCDH 4LF3B 1IC4L 1IKNA 4E5XA 1RFDL 1LO4L 1KYOJ 1QLRB 4QRUB 3MA9L 3QCVL 2ZUVA 1G7HA 5JPNA 1LEGB 4PP1D 3S88H 3SJVB 4QLRA 3EFFA 3PUCA 3MLRL 5C0CE 5ESVA 3QO1B 3TV3H 3BRGC 1YDPA 1F2XK 4I0PA 3RZCA 2W60A 4RGOL 2OS7A 2R29H 4UIMA 1M7IA 1Q72H 1R5WA 3B8YA 1A6WL 3BPCA 3AREB 1X5KA 3PWPD 4L8BB 2HTKC 2BOCA 3G6AB 3WIHH 2DLIA 2EH8L 5E00B 5C0GB 2ITDA 2YOCA 5FO7B 4IHOA 1MCEA 3DXAB 4WFFD 1ZHNA 3OB0H 4MNGE 3MV7A 1TCRA 4NN7B 4QCIA 3GJFH 3F7YA 1TETL 5C0EA 2EDRA 2YUWA 4Z7UB 4HWEH 1T22B 2D7NA 1KB5A 1WV7T 1J7VR 4HS3A 3OAUH 1F45A 4UQ2B 3ZZ1A 3BUYA 2NYYC 3KVQA 1UYWL 3OG6B 4JRYB 4EI6B 1OHQA 1YMMA 3I6LE 4IRSA 2VE6A 4OKVA 3HE7A 4JFZL 4JKMA 1MCDA 1NSNH 3JWOL 4P49A 1Q0XH 3QXAB 1N5YL 1NGQL 1WTGT 4BSJA 1HH6A 3GBNH 4K71C 4QWWC 3HUJF 2GFBB 3E1F1 1UWXK 2Q6WB 4Y4HA 4XCNA 1SYSA 5F3HB 3QNYB 4G7YL 5ID1A 5GQBA 1YMHB 2QKIB 4PRHB 4CJ1A 1NGXA 3G5XA 1NCDL 1XGUA 4NQVB 2Z31A 4XNUH 4ZXBA 3SPVA 2ADGA 1NFDF 1HSBA 3ZDZF 4QYOA 3EJJX 5E2JA 3BQUC 5BW7A 5C09B 3S88L 5D1XB 3LDBC 3TV3L 1T3FB 2J8UB 1T89C 2NNAA 3C6LA 2IH1B 1RV6X 1EH9A 4HG4J 4S1DC 2YMXH 4NNXA 1WSST 5IROC 1KTLA 3ROOA 3G5YA 2X4OA 2CO6B 1UXSA 1WC7B 2BJMH 2R29L 2YC1A 4OFIA 4PTTA 1Q72L 3PXHA 4UV7H 4DVBA 1IQWH 4EKXA 3Q0HA 4I5BB 5K59F 3WIHL 2YHGA 1MY5A 1A4JB 8FABB 3MX0A 4N0FA 1RSFA 1JF5A 2GQHA 4QKXB 3MREA 5TDNA 4D0CB 4HUKB 1Y18B 2BVUA 2OXHA 3MR9A 2QSCH 5DVMA 1NC4D 4HWEL 4KKCC 3IXAA 1GOFA 4BQ8A 3VDBA 3OAUL 3VXRD 1JNJA 1EEYA 1ZGLM 1JMXA 5FA3B 4NQEB 1TZHA 2DM4A 4MX7A 3QQ4B 3LKQA 1G7QA 3LKPB 2OTWA 3K0WA 1UJ3A 2JB6A 2C1OB 4Z18A 1NSNL 3IDJB 1Q0XL 3QQNA 4FP8H 4OLEA 4PJFB 2VLKE 3C2AH 3BGFB 3N1PC 3QHFH 3GBNL 5A16A 1HYSD 2VLRA 5DRXB 4QXTB 4HV8B 5C08A 5C0AD 4M8QB 5HGDA 1PGRB 4LASH 2NW3B 4N90E 3U7WH 2PTVA 4NN7C 1GVIA 4FHBD 4R4NC 4XNUL 4WWKB 5B3JE 3QDHA 4NQSA 1KTRL 4OZGB 3DECA 4K94H 4JY6A 4RA3A 1ODAA 5IB1B 1LEKB 4R0LA 5CEYA 5IBLC 1U95A 1KIPB 1YYLH 4ELMB 2ZCLL 1C1EH 1MFEH 3GSXA 2P47B 2FO4A 4HEME 1O7SA 3MRDA 2ADFH 5F1KC 4XNZC 2YMXL 1PKQA 3IFLH 4FFVD 1NBZB 3PP3K 4MNQD 2BJML 5EO9B 1KIQA 4UV7L 1IQWL 3ULSA 5D1ZC 5JA9A 2RQ8A 1TFHA 1KCVH 2RAMA 3G04A 4D9QE 4WO4C 3V79C 1AY1H 1G0DA 3ARBD 3LKRA 4PJGE 3WS3A 3PF2A 2R0ZH 1CFNB 3IDUA 1K4DB 1ZGLB 2QSCL 3RNKB 3CCHB 5JIPA 3MRFA 3D39A 3ARDD 5J89A 1NGWA 1ZANH 3P4LA 3TNNB 4DGYH 1AGCA 5D1XC 5GJSH 2A2QT 2DAVA 3QUYD 5I8CA 1S7UA 1CE6A 2RIKA 3D5OF 2GJZA 1RJZB 3GSUA 5CJOH 1AC0A 3OB0K 1TMCB 4FP8L 5B38A 4QF1B 5DFVD 3C2AL 1F97A 4CGTA 1CFSA 2RBLA 4MD0A 3QHFL 1KLGA 2WBJA 2B0SH 4HKBB 4NHUB 3OGOE 3MUGB 2OTUB 1JF6A 4LASL 5DJ0B 5D7IF 2EICA 3U7WL 3KLAB 4JKPH 1KIUA 4LCWB 5F89B 5E24E 3FAXA 4YDIH 3OB8A 1FL3A 1S7QB 4K94L 1AI1H 3FQTB 2ICEB 4QT5B