2P5PA

Crystal structure analysis of the west nile virus envelope (e) protein domain iii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
TTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
rcsb
source organism West nile virus
molecule tags Viral protein
molecule keywords Genome polyprotein
total genus 12
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p5pA00
3MUUA 5B1CA 3UAJA 1OANA 1OK8A 5GZOA 2V33A 4X42A 2H0PA 1URZA 2I69A 3C6EA 4BZ2A 2HG0A 5JHLA 5KVDE 3UZQB 5JHMA 2R29A 4FG0A 2ALAA 5GZNA 3UYPB 1Z3RA 5H37A 4UTCA 4GT0A 4UT9A 5LCVA 1Z66A 5KVFE 5LBVA 1TG8A 2JQMA 4UTBA 5IZ7A 4UT6A 3N43F 3UZVA 3G7TA 4L5FE 4UTAA 4BZ1A 3J27A 5AAMC 1OKEA 4FFYA 1PJWA 1SVBA 3IRCA 4FFZA 4GSXA 5AAWC 1S6NA 1ZTXE 1RERA 1UZGA 3P54A 2GG1A 2P5PA 5KVEE 2JV6A 2JSFA 3VTTA 3WE1A 3J2PA 4AM0Q 4AL8C 3C5XA 5IREA 3N41F 3N40F 5KVGE 4ALAC 5LBSA 2R69A 3UZEC 3N44F 3N42F
chains in the Genus database with same CATH superfamily
4RNRB 3H7BA 4NQDA 1IAMA 3P4MB 3SE9L 4GUPA 4Z7OB 5I1KL 1V3JA 4PJBE 1M7XA 3CFEB 4CDHA 4AG4L 3VWJB 4XGZA 2W9DH 2OAAA 3Q43A 4LHJB 1KF9B 3HBGA 4MQSB 3H6JA 3VXPB 3ZU8A 5A40E 3EFOB 1YQVL 4X5LA 2VM3A 5F96L 4P5KA 4R2GB 3EYFB 4PJHF 4LVHB 1F4WH 1X6NA 3K72A 4UZUA 2F1BA 4TLSA 3VTMA 4AYDC 2XV3A 1N6UA 2EICA 3P3UA 3PIQB 4PW3A 3FO0H 1DBBH 2HJFB 3D69B 3P77B 1JFQL 1XF4B 4NKMA 4BXVA 2YMTA 4FI6A 4TF4A 3ZYOA 4UOW0 3FFCB 1E3ZA 3MOAL 4FXKB 2PO6D 1QRKA 3AITA 4QMEA 2DPKA 1INDL 1AR2A 4QHUA 2APTA 4BA0A 3D39E 5KW9L 5G55A 4F7EB 1IM3D 1MFEH 5I71B 1IGJA 3NP3A 4LLQB 2DIJA 3O45A 1JWMB 4TTDD 2J21A 4KZ0A 3QC5X 2DL9A 2B4CL 3EGDB 1EVTC 4MZ3A 1WFMA 3BDBA 4EI5B 3O2DA 3MFFB 3HVNA 1WYJA 1IAII 1NA8A 2Z31B 3K80A 3HC3L 3N42F 1P9MA 3BAKA 1Z9LA 2F68X 4JJOA 2J2ZB 5FA3B 4XH2B 3MLVH 3WO4C 2GABA 2G3ZA 3HFMH 1MFVA 3X13B 4NKDA 5IMMB 2BCKA 3MX0A 2MTAA 2VDML 2FGWL 3UG5A 3RZCA 4Z23A 2AFNA 2R1XB 1NJ9A 2G75B 4Y1AD 3GUFA 3T6QC 3C5JA 3G5XA 1I1RA 1ZHKB 2VXTL 4DK5A 4YDNA 1JZ2A 3PHQB 2W95A 5E6UB 5BNXD 1HIML 3QUYA 4M5ZH 4YE4H 3T77A 3MLXL 3D1MC 3VACA 4NKQB 3AZUA 4I18C 1JGIA 3FYIB 4IGBC 2F54A 2Y06H 4YQXL 2WXGA 3HZMB 5E6ID 4HGMA 3REWB 3IJ8A 3L5HA 2XJKA 3QDAA 4OAWB 1C12B 2W65B 1YNTF 2F08A 3T8XB 3ZIYA 3I6LE 2G2PA 3ZLQC 4MXQC 1O7DE 1J87A 2BSED 3G5YA 2Y36H 3CDZA 5KJ7E 4A7SA 2IIJA 3PS6A 1QUNB 2UV3A 1NWPA 4W9FC 3RWJB 3GBNL 4WHDA 4K94L 2AV1A 1VADB 5D1XA 3TXAA 2YK1L 3ESUF 3RL1B 1Z1WA 2VQ1A 2RCSH 4PBWD 4TUJB 1ED3B 1XR9B 3QS3A 3MXVL 2OJZL 3OAZK 3CV5A 3KH3A 1MOEA 3EH4B 1G7LA 3OJDB 1MW1A 1WEJH 3DMMD 1XSJA 5JA9A 1B88A 4PY7A 1F18A 4LO9A 3A6CL 5IKCB 3A67L 5A2LH 1W0WA 1ZTXH 4OY9A 4UQBA 3MV9E 4JJ5B 5J5EA 4POUB 4JO5A 2FX8H 4RMUA 1MFEL 2XLLA 1UFGA 1FFQA 4MVBD 4RX4A 2QPDB 3QUYD 4HWEL 4G80A 3Q8BA 4FQCH 4XVSL 1NMCC 5EN2B 4N2OA 1U8CA 2XV0A 2FQEA 5I6XC 4WO4D 2X38A 3QUML 4P23A 3B3IB 3A6CH 5KYYA 2VMEA 2DM2A 1DBBL 4UNIA 4LKCB 4MJIA 2OJEB 2EIBA 4KRLB 1P1ZB 2YN5A 4OZGA 1L9NA 3CZFB 4M6NH 2IXQB 4Z7VB 1DQML 5C1MB 3K6SB 2AS5M 3QXWA 3QQNA 4BFIA 32C2B 3QPKA 1XB8A 4ZFZB 1GW6A 2E4TA 4HIQA 4WU7A 1QBAA 1UTDA 4P59H 2PW1A 1E5AA 4JDZB 3VXUB 2XACC 4QYOA 3RPIA 4G1EB 1BOGA 5F8RC 4JO2H 2A6IB 3E6FA 4PJGF 2EDLA 5CGBA 4N9GA 4FEMA 1Z3GL 3FULA 2EC8A 4R7DA 1WBZB 4QCIB 3T4YA 5DC0A 3NJHA 4M7JH 2I9TB 2BIMA 3HE7C 4G42B 5E6SB 4AITA 2PR4L 3P9LB 4OGZA 1EVUA 5E2UL 1AP2B 3QPQC 5B1AB 1QLEL 2YZ8A 4UDUB 4I1NB 1TQBB 3UAAA 2MCG1 1BYNA 1ZMYA 2KZWA 4OCMC 3GD1C 1N6VA 2Y0SA 1NINA 3ZUCA 3Q44A 1RJZB 3F5WB 4AG4H 5ANHA 1X5YA 4K94H 5GSRA 3GIZL 3V0WH 4JFFE 5BO1L 4AMKH 1AS6A 1D7DA 3TO2A 5C2BH 3SJVA 4Y16A 5KBNC 1RVFH 2AEOA 4JCMA 3SZKC 4PLOB 4M62L 3S2AA 4EIZC 3MLVL 5F0MB 4X4YA 5C0DB 1HHJB 4UB0H 1V3LA 3W9EA 1N6QH 2C9XA 3FH8A 2AJUL 4JCWA 1CF8L 4IBWA 5DA0B 3GMPB 1EXUB 1SJMA 2A6DA 5DMIL 4LSVL 4BZYA 4R97B 3BP6A 3GSVA 3C8KB 1Z7JA 3EHBB 1OAQL 1U3YA 3C60D 2R69A 2XN1A 2W38A 2ZCZA 1U8MB 2V33A 4UTBL 2WO4A 3SPGA 4HXBH 3KLAA 4GBXB 1A1MA 5FUOH 5IP4A 2XYBA 4ZFGL 3SPIA 2IWGA 3P2BA 4XO8A 1UOKA 1C16A 2X4PB 1BD2B 1I85C 1P84J 4LP8A 3QG7H 4NHUA 4R26L 4JMNA 1JGLL 4N90E 1MPAL 1XF5B 4QHLA 4XAWL 1K5WA 2N7BA 5ESQA 2EILB 1R1CA 3S48A 3CMOH 3L1FA 4PD4K 5D7LE 2Q6WB 2KMWA 3SKNB 5JA8B 4P9ML 3RNKB 1AHWA 4NUGL 4JN2B 4IEFB 4IU2A 4RSVA 5L4JA 1SYSA 3QFJD 1OQOA 5L8JB 2VDLB 4GIAA 1FAIH 1KXQE 2VDPL 4WUKL 1T04A 4MHHG 1KY6A 1T2QH 2JMRA 1QOKA 2WYIA 4FMKA 2OL3H 3T6ZA 2GJRA 2QEJA 2FEEL 5H2BB 3QRGH 3VI4A 3RY6C 4M7ZC 3PHSA 5B3SB 3DUSB 5EOTA 2YD3A 1OTTD 3CFKA 1UWEH 1EJ6A 1RZIB 4CMHC 3DHJA 2M83A 1C5BH 4YNYB 1VACA 2Q86A 5FAAA 4HLJA 3UAJA 3AS0A 4LPUA 4J23A 1ZVHA 2YD2A 2YXMA 3CUPB 3CVDA 4PJIE 1JZDC 3HRZC 2ICEC 4RFEA 3ZDXF 1VEPA 1TQWA 1DTUA 4LQ1A 4H8WH 3M46A 3HN5A 4KVPA 4KTEH 4RMTA 2CUHA 3IJHB 1TITA 2WSPA 4OFQA 1I8KB 3VDAA 1BG1A 4QHKJ 2JTDA 2ZCKL 1L9SA 4PRPA 3RU8L 5DJZB 5T1KB 5D93B 1RZPA 3VRIA 1E4KC 2QADC 4F2FA 2DQFA 3W11C 1LE9B 2XHNA 5J57B 2Y4SA 1LO2H 1HSBA 1J88A 1J8KA 3MBEB 3FT3B 5HYSG 1FI8C 3PWUA 1M7UA 5C0AE 4CAGA 4JM0A 1R47A 3QXDA 4JHZA 5C86A 5EDXA 1R0AH 1V3MA 1KB3A 2JCWA 3PJLA 4ZMOA 4K5PA 3D0AA 2X87A 3DIVA 1RZKH 4H0IA 4M1DH 3LKRA 5JIPA 3MYJB 2PYEA 5TGBB 2BERA 2Z7ZA 5LBVA 4LSDA 4NNYA 3VFMB 2F5AH 3GJFB 5BVPL 1GPOH 5G5DB 5CHNB 5AALA 2NY6B 1UEYA 5CCKH 5C09E 1K4CB 1SNRA 1IGTB 5DT1L 2QSTA 1PS3A 1S7XA 5EC2B 1EERB 4M4PA 1LTXA 3UPRB 1XIWD 1C5CH 1S9XA 2X4QA 2VABB 1Q1PA 5E23A 1G5AA 4Z7WF 3NCXA 4HCRA 2Y7SA 5DC2A 2V8MA 4XNBA 4LLYB 4F7CA 2CK0H 3NRPA 2OX5A 3NESA 3QIWC 1I1FA 4L5FE 1DVFA 4DW2L 3VFRB 3MRPA 2UUDK 1NFAA 4YDZA 3P73A 1PY9A 4I5BB 3RBGA 1JGDB 4AKQA 4ODUA 2PP7A 1M6UA 2QADD 4DGYH 1NAMH 4MAUL 5D4HA 1K3ZA 1HJBC 2EEFA 12E8H 2WWKO 3EFDL 3KLHC 1OHQA 4TSAL 3IFLH 3ZZQA 3FOLA 1AS8A 4R4BB 4OFKA 2MHAB 1ACCA 5C7XL 4PJHE 3SDAB 5AAWA 5IHZB 1CGTA 1OAUH 5IFHL 4GXUM 3AQYA 3BUIA 4GQRA 2CIIB 4XCFH 2ZSVA 1RJYB 5I1EH 1BVNP 4DGVL 3MXWH 4LGPB 4G7VH 2X1XR 2H6UA 4EUPB 4YR6A 2N7AA 1FHNA 2C1PB 2MNUA 3VXOB 1UB6B 3FCSB 4R90H 4D0BB 3CFQA 3JTBA 4MA7H 3G5WA 2XUWA 1WIOA 2OSLA 1CGWA 2K3TA 1SJXA 3OX8A 5LBSH 4DGVH 1VSCA 3WJJA 4BSVB 2L04A 3FQ1A 3RB5A 2R0ZL 2HKHH 4W9HC 2JNZA 2ORBH 4ZOAA 2J8UE 4CJ1A 1NQBA 1G0XA 4P2QB 4YHKL 5E2VH 3ZE2F 1DDHA 4Z7WE 3QBTB 2DQUL 4B9FA 3IKCB 4U1SB 1CQKA 4YL9A 2VSCA 2CBQA 2FYYA 3IMRA 1NC4A 4M48L 4PYHA 1B6UA 4YFLI 5DVNA 1EO8L 2FBOJ 4PJEA 4QRRD 2MNWA 1DZBA 4Y19A 5C9JB 4Z95H 4XNZC 2GHZA 3LIUA 5D8JH 3IXTB 4MX7B 3A21A 1TZGL 4I9WD 3V5KB 2Y1AA 1IC5L 4PJDA 3LIZA 4UQ9A 4CL7A 3U46B 3F65A 1SXSA 3VUAA 3ISRA 5E5RB 2F7IA 2R8SL 1I1AA 2WQUA 4GLRH 1AD0A 3MCKA 4RAUB 4BFBD 5D7LD 1U3ZA 3WDHA 1IGCH 3KPOB 5FYLH 2LW3A 4XB8A 1MZZA 1JAEA 2NW3B 3VTTA 1LO0L 1BGXH 2H1PL 2PO6B 5B7FA 1R5WB 5F7NC 5IM7A 3NJXA 3O9WA 3N0AA 4K9EH 3SN6N 4GG6A 5E8NB 4QHKI 3NJKA 3HUJA 1X7QA 3IVKB 1NIDA 2VTFA 5D1QB 3QHTC 4NHCH 5GSVB 1CPUA 4RIRB 1YPZB 1UB5A 2IO5A 5GGRA 1JWSB 4XXWA 1WAAE 2AJSL 3Q3GA 1PX4A 1FORH 3Q13A 1NCDH 1I8IA 1AC6A 1YSOA 4V1DB 1KCUH 2B4CC 2NNRA 2WXHA 4G6KH 2C7UB 4H1LG 3TOPA 5I1EL 4XOBA 2BWIA 4XN5A 3QULA 4AQ1C 1SN0A 3AGWA 3JWNG 3QORA 2NLJA 4JRWA 3QUZA 2NR6D 4X8JA 2F5AL 2KZKA 3RAJH 3OKMA 4QRRB 4PVMA 1XIWB 4WNSA 5E1IA 1Z9PA 2VWEC 1BLNA 4CNIA 1S3RA 5GZNA 4Z5RA 4WJ5B 4JL2A 2VZ3A 1A6WL 2UZXA 3HE7B 2BP0A 4X6DF 1JMZA 5EPMA 5EZLB 4XTRD 3RU8H 3VX0A 4G8EA 4ZX3A 3DO4A 4H25B 3HZVB 3VFWA 1NCJA 1OTUC 4KKLD 1NDGA 4PR5A 3P9MB 2AMGA 3WY1A 2A4ZA 3Q2VA 1PLAA 5AVWB 4D0CA 3MRKB 4JGNA 2VL4A 3HE6A 3OXSB 4RZCB 4RRPM 5ERWA 3RQ3A 3VXRD 3OPZL 1JZEA 1RPUA 5HJBA 2CDFB 3O8XB 1D7CA 1KV3A 3QXUA 2AKRA 3FU5A 2BVUA 3GXNA 1D5RA 4LPYA 2GCYA 5ADOL 1NUNB 3MHZA 4YHML 1FYHB 3QFDA 3FQNB 4KY1L 4LNRA 4XVUC 5HHOB 3APDA 4PJ5E 2DQHL 5I6XB 2Z7UA 4OLUH 3ARSA 1NMCB 2VZVA 3MGOA 2WJ5A 4FXLA 4G1MA 1L5GA 4RMBA 3KJ4C 2OQJB 5EOCL 4IJTA 1MELA 4X4MA 2VR9A 4ANVA 5MEOB 1AOZA 4ESKA 1NGQL 3ARFC 3NZHH 1MWAA 4OZFH 4PGDA 3IJ9A 5FYKE 3IJ7A 3U4AA 5HDQH 3MRGB 3S5LG 2BRRL 5JORB 1S78D 4R9HA 4BFOA 2V3DA 3W0WA 2MRYA 4X0KB 1C1EL 5D96B 1QBLL 1DQVA 1D5XB 2B0SH 3RVXD 4WV1C 3U4EB 2VZTA 4QNPF 2EUVA 3O0RH 4HCGA 4HSQA 3ARDB 3KWWB 2HKFL 3QZWG 5J3HD 5B39B 1B4TA 1NGZA 2PPEA 1SVZA 2CBTA 4N8VA 4YGAB 4O02L 3QEUA 2K78A 5MEPB 1K85A 2IJ0C 4DP1X 2VB5A 4U05A 4MA3B 2J12B 1WAEA 1ZLVH 3BUPA 4P9HC 5JHMA 4A7QA 3BH9B 2BNRD 5DMGC 4HF5H 1N8ZB 4M3KB 3QEHA 4Y5XA 2HMIC 2FJGA 5MP6H 2YEVB 2Q3ZA 1CF8H 3BT2L 5L4MA 1XAUA 3MGTA 3MXVH 4S1RH 4F2ME 2NY4D 1IAKA 1TZOA 2ZKHH 4X5WA 2DOCA 2VIRA 4WFGE 5DR5L 1YDPA 4LL9A 4KU1A 4KKPA 2C4FU 5B38A 2R2CA 3LEVH 2WLZA 3RIKA 2ADYA 2BVOA 4NNXA 3HHRB 4JO4L 2YO3A 4HIEB 1EBAA 5DJ0A 3UGUA 2HG5B 2ROYA 1IFHH 2BVQA 3AQXA 4A63A 3PWVA 4BINA 3MJ7A 4ZNEA 3WL9B 4KNUA 2ENPA 2GBUA 5FYKL 3PP3H 4IRJB 2EXYC 5AOKA 3GJFH 5C07D 3ZTCC 4D9QD 2IG2H 2WKOF 4HKZB 3FSWA 2VRAA 2AZAA 4M6OL 4NO0A 5GS1C 4KTGA 4P04A 1BQRA 2VDKH 2EDDA 4BEIA 5E6YA 3L5XL 5CP3A 4A67A 3OJ2C 4HC1L 2Y24A 4NO5A 4DP6X 2QQLH 4YDVB 5JIKA 1CFVL 1AY1H 1E4WH 2ZX6A 1A7PL 4FXKC 1UM6H 4Q7DA 2B7DT 4NC1C 3OHXC 3FSOA 1WFJA 3NCCB 1INEL 4NQEA 2RQEA 4LVOB 4UOQA 5FHBL 3BAXA 4MQXD 4XNUL 1J5CA 4XMKL 1XMEB 1UEMA 2AJUH 3POHA 4U1LB 1R3LB 4LVHC 1JGUL 1JSYA 4TQEH 3DJ9A 2R2BA 5F9AC 3VU2A 4DPRA 4OUUB 25C8L 2DQDH 2OMUA 5D96C 3G6JB 1G9EA 3ZQ9A 4ODXB 4G9DA 3UTZA 5H37A 2QVKA 2OMWB 4Y5VB 2W0FB 4GAAA 3L4WA 4Y4HB 4HW6A 4KDWA 3WXWL 2KHAA 3IU4L 4NQXA 1E5UI 1K8DB 1ET7A 4PJBB 3CU7A 1CXEA 4WEBH 4W9ZA 1IVTA 5DMJB 4H1LH 2E6PA 1ODAA 1P6FA 2EACA 5ALBH 3L3KA 2ZJSL 5DLML 4QRQB 1XCTB 5CMAB 2D7TL 2OMXB 3G9VA 4A2FA 3B3BA 4GI9A 5KUMA 5B3JF 3S7GA 1EHLH 5CD3B 2JB5L 3TIEA 2YGQA 5I1CH 1BZOA 3MZGB 1NMAL 4ZX4A 3RX7A 2ZKMX 4MAZA 3DGGA 5F1KC 8CGTA 4RA0C 1IGFL 1KLUA 2QKIC 3RA7H 1ZANH 1TZIA 2Y1ZA 3HBZA 3TEYA 4IU3A 4I2XA 4X6FB 2JLLA 4EMZA 4XC3L 2VDLL 1VGEH 5AB9A 4WCYH 3QEQE 4KJQC 2P52A 2E75C 1GOFA 1TJGH 2X3AA 4XCNA 2H1LM 2A9CA 1S7VA 4JKKA 1DJYA 1G4RA 3N40P 1MFAL 4NM4H 1SY6H 1HDMA 3EOTL 2ZX5A 2E74C 4AQ1B 4JFDD 1D9KD 3NCYS 4FFVC 4RDQG 4YDKH 2QHLA 4TULL 2DBJA 4Q0XL 1ZRUA 4MTMA 3DHPA 4AGOA 3DX9A 2QGBA 3TA3C 1WC7B 1XO8A 3V79C 2AQNA 3FDWA 3K2IA 1T1XA 2EYTB 3P3TA 2NQCA 4R7XA 4W6XB 1IFHL 4XGZB 1GZHC 1I7ZB 1DVFD 2YOAA 1HE8A 3QCTH 3GXUB 1RY7B 4ONOA 3DO3A 1WEJL 4OCSH 4HX1B 3RWIA 4KX7A 3K72B 2FX7L 1CFSB 3PIQA 4LOUD 4OM1L 1N64L 1IU1A 3D69A 1P2CA 1K6QH 5I75B 1DZ0A 3KYOB 1BXVA 5HTSA 1QLFB 3ILDA 3WXWH 3V0VA 4HWEH 3FFCA 1Q94A 5DRWB 3LD8B 3EO9L 3O6FC 3FUIA 4F7EA 2RAMA 3W9DA 2AJZB 4UOZA 2IADB 4MCYB 4AQ8C 5CCJA 2B1HL 2R23B 1X4XA 2VR6A 4NN6C 3QORD 3EGDA 3CLEL 3KGRA 3W3BA 4E5XA 5K1JA 2VDKL 3L4ZA 3MFFA 3MUZ1 1J86A 4L3ED 5D5MA 3UTPD 1KCWA 3S9DB 4PBDA 2A1WH 1HH6A 1YMHA 1JFQH 1GS7A 4B0MM 1Q9OB 5L88H 4RGMC 4BK5C 4PTTA 2ZWKA 4IBSA 3ULUE 3MX0B 3QWQB 4R6UA 4BUHA 1ID5I 2AQRA 1MJ8H 1NJ9B 2FD6H 4BWUA 3C09B 5L0QB 2XKUA 1V7MH 3QQ3A 3RGVA 3E1ZA 3KPSD 4M9PA 4YHIB 4PBVC 2IALB 4MBOA 3PGFL 3VGAC 4ZMQA 5IW6A 1GCFA 1FN4B 1FSKC 3T77B 2DH2A 1GZQB 3QA3A 1XGZA 1UCBL 4PWJA 5DA4A 4X6EA 2YR3A 3H42H 4GT0A 3UGXA 2A3TA 1U3HD 2XWBB 2JJSA 4WKZA 3ZY7A 1AGDB 1OAYH 4XZUA 5I17A 4N1CA 4PJ8B 1BMWA 3IRZA 1JI1A 1XCXA 1UUSA 3S37L 1MCHA 1CIUA 3FPXA 4OLVH 5HDLA 4ABUA 5IREA 4NM8H 3IGAA 1M9WA 3SKMB 5F7AA 3RJDA 5IV2A 2P5WB 3U36B 5TF0A 5G4MA 1D5ZA 4XBMA 4OR1A 4GP8B 5FWQA 3K6DA 2AV1B 3FUFA 3MRNA 5HDBF 1NGYB 3RL1A 5K93A 1NMBL 2QSVA 1L0PA 2NX5D 1YEGL 3RDJA 1CGSH 1E90A 3U7YL 3JYCA 4JMXA 1AG6A 2VQ4A 3IF1B 1CDGA 3QIWB 2HRHA 2X88A 2E5EA 2Y07L 3BWAA 3ZHFA 3COOA 4UM9A 3OJDA 1XFPA 2JJWA 2SEBB 3AMLA 4KVCH 3BD4A 3DX3A 3KDMA 4K8RD 4PCTA 4PY7B 4RBPH 1UJ3A 2ZCHH 3MNVB 5D4QA 1V27A 1XX9C 3NUKA 4AY0A 4UIKL 1MLBB 2JCCB 4KVNL 4FCHA 3RGHA 4OTXL 5T33H 1A9EB 2BZCA 4HZLA 2CALA 2VJXA 1TT6A 2R56H 4L8DA 4U1JA 4ZD3L 3DI2B 1RZ7L 3GSWB 2IAMD 4NDMB 4JBSA 2CKBA 1NIBA 1CLOH 2F9BT 4JFZL 3KM2A 1Q0XH 2ESVB 2JK5A 4QPEA 4HSAC 2BIQA 2CLVA 5ES4B 1BVLA 3PAZA 2OXHB 3GBMH 1FVEB 3OKEA 5JW4Q 1YEHH 5FX3A 5KYYB 4HGWB 2OMTA 5JPNC 1LO3H 2BNQD 2OJEA 1TQCB 3RB7A 1YJDL 2NY5L 4ZAKC 7FABL 2EEBA 3GEFA 3HB3D 4Z7VA 4MJ2A 3E9TA 5FUCC 5KSBF 2B20A 1LO0H 1UJTA 4XP1L 2WLMA 4O2CB 1TQTA 1MRFH 1RLWA 3MLWH 3BJ91 4QHNA 5IVXE 2X10A 3S5LA 5I19H 1Y0LB 2VXSL 5D93C 2VITA 4JHAH 1QWNA 4N9GB 1JNNL 4UYPA 1XH0A 5EIIG 5EOCH 3ZTJH 2D7OA 4OLXH 2CO1A 4LCWB 1WPCA 5LN8A 5J12B 1IKNC 4X5RA 5C6TL 1HXKA 3DYPA 4G42A 4FNPA 3P9LA 1A5FH 3KLSA 5JHDA 1LEGB 1NDMB 4CGTA 2VUKA 4AC2A 3HRZB 2OV0A 3HI5L 3UYPA 4RGNB 5HGBB 3WFBL 1IO4C 3L2NA 1MCLA 2ZKXA 4X7SH 2AQPA 1AO7A 2QGEA 3NCJH 4FABL 4GRWE 4UTAL 2HN7A 5I0DA 3WLWD 2GK0B 4MWFB 3F5WA 3LYRA 1KLFB 3DJRA 3NRFA 2HVKA 4MZIA 4CMHB 3T0DA 3IKKA 2ZNXA 3SBRA 4LFHD 5HY9B 3VE0B 5DJ8A 4N28A 1AGFB 1MW3A 2CGRH 3WO3B 3U0PB 2DQEL 3UZVA 1A5FL 2ZWSA 1F41A 2NXZC 2QBWA 4ZYKA 2Z93B 3FQTA 2L8AA 4OQ1A 4N86A 4M00A 4AIEA 5MEND 3PWLA 4WI7A 3OGCA 2H32H 3L9RA 4O00A 3W9EB 4NGHH 5EBMA 5I8KL 1AYRA 2H3XC 1JP5A 1GW0A 4PV9A 2ZOUA 2VAAB 3DJSA 3EH1A 4JM4H 2JFCA 1KYOJ 3C8KA 4W81A 1LYQA 2JELH 2NNCA 2QVFB 3D4CA 5DRNA 5K39A 1X5ZA 5DD6A 1U8MA 2KPNA 3HI6H 3QR1A 4OCWH 12E8L 1DJXA 1MH5A 5E99H 1QFWI 5E9DA 5HD8C 3GRGA 2DQHH 1UASA 4DH2A 1BD2A 4TSCH 5J0BA 2QGCA 1CLVA 2WLLB 3QWNA 4AYBA 5JHDD 3Q1EA 2H9GA 4PJ9B 3GHBH 3HG1B 5B8CA 1VENA 2WAHA 3CHRA 4KDVA 1A4KB 3Q5YA 4WJG3 3ZIMA 4IEFA 4IU2B 4TUUA 4HHWA 4R97C 3HNTH 1Y7VA 4OFIA 2NX5B 5ISZA 1WAAF 2W9EH 1UOLA 3EJTA 3FTYA 3HMWH 2HT2C 4DK6A 1Q9KA 1KDJA 4K7FB 1O6VA 5JNYA 4PJAF 3AU1B 1ZDSA 1GS8A 3IDGA 3MLTA 2W0LA 3D09A 3A4AA 2E7BA 2YGOA 5H2BA 2LAGB 1KEMH 2IGFL 4OJEH 3LZFH 1O7SA 2NTFA 4ATTA 2P7TB 5FCUH 2EVGA 5F0JB 4KI5D 1P4LB 2JXMB 1RZIA 3KJ6L 1TQVA 3VGEA 5SX4H 1VACB 5IHUL 3X2QB 5T1LD 3A6OA 3BN9C 4TNEA 4G7VL 3V95A 4GKSA 5JW5A 4QXTA 1G9MH 4MJ6A 2PCFB 1J9SA 2ADFL 4AE1A 3BW9A 3PQYD 1IKNA 5DHXB 5J6HA 5FCUL 4QY8A 4LHUB 2JKIS 2QFPA 2PPFA 1SDAB 4ZUWA 4NAJA 3S3CB 3TBCA 4KKNA 3NIFB 4JQIA 3KH4A 1LE9A 3P0YL 4OIIH 5DEFB 1F3JA 3QG6A 3PUCA 3GLDA 2E9GA 3KPPA 3M1BB 3WNLA 8FABA 5I1HH 4B60A 4JK0D 4N6QA 1LL1A 1MVUB 3UTTD 1N59A 3ULUC 3C8DA 5IG7B 4DQOL 4ZAKA 1AYOA 4H8WL 2APXA 1KNOB 3VU1A 7PAZA 4KTDL 4L29B 3QDMD 5JHLL 3FB5A 5JOFA 3QRFM 3V4LA 3MYJA 3ARGC 1OAJA 4NNYB 4YL4A 3VFMA 2WOYA 5J11C 1W8OA 1IGIL 2Z7WA 3Q8AA 1TIUA 3G08A 2X28A 2BIIA 4LBAA 2DYSB 3FT0A 3OWRA 4JFDE 4BCYA 3ABZA 2PTTB 1TZ8A 4OB5L 3QRBA 1YEHL 3DXAA 4WTXA 3ECWA 3GSUA 2EDOA 2Z92B 4KHXH 2BSRA 3T2NH 5C09A 3RWGA 6TAAA 1SJEA 1MLCB 4M7KL 3NCJL 4FABH 2Y1YA 1BF2A 5J06A 4XC3H 2XZQL 1CWVA 1IBGH 2GJ6E 4NNPL 4PJCB 4LSRL 3GSNA 1MFBH 4UU9B 4BD4A 2GG1A 1BYOA 2ITEA 4Z3FA 2OL3A 4JFXA 4KJPD 4OKVB 5FKPB 4XTRC 5C8JB 2WGXA 3L13A 3LXUX 1SXAA 2XA3A 5TQ0L 3O4OB 1NLBL 3ABKB 5DQ9A 3ULVE 3RIFF 4OD1H 4QF1A 4DO6A 2DEYX 3VXRB 1UXLA 2UWEE 3OAYH 5CZVL 4TVPD 2DIEA 2VH5H 5D6CA 1QVOB 4F1SA 4LCYA 4JPKL 3HR5A 3WFHA 5FC9A 2DEXX 5IHZA 3RDTD 2VLRD 5BOJA 4M8QB 4F7TA 4JRYE 2ZX8A 1N2RA 4RMQA 5AB0A 1ESOA 1ZTMA 2VXQL 1UUNA 2ZUSA 2JJSC 3CFJA 1AIFA 3MUUA 1M2VA 4PEEA 5IB5B 4IS6B 1BBDL 5I6LA 4BE6A 2IAAC 1WHPA 4IGBB 4N3TA 3TWCL 4F57H 3D6GA 3VH8B 4M3JA 1CB4A 4LSVH 4LPWA 1UB6A 4B6ZA 2I26N 4TQEL 3ZE2E 2IDUA 4P49A 5HGGS 1SRDA 3BQUB 5E2WL 2E8ZA 3UJTH 4PP1D 3LX9A 1D7BA 1WJ3A 1BFOB 2UZYA 1JL8A 4Y1SA 2DL2A 1O9WA 4UILL 1BPLB 7PCYA 1J8HD 1JHKH 1MNUL 3ARZA 4BK5A 2GJJA 3FQWA 1NCWL 3WO4B 1UOVA 1YNTA 2XOTA 1KCVL 1MJ7L 1OOWA 4KFZC 3ZDZB 2FO1A 1C5BL 3WJMA 1UWGH 4G7QB 5AVXB 1PEWA 2APFA 1BXXA 3GMRA 3ZYZA 1H5BB 1NUDA 4EI6B 1B6DA 2BSBA 4M7LH 3VXSD 3EG9B 2I60H 5JQIB 5E24E 1DO5A 3ZN6A 1HQRA 1IBHA 1MIMH 3CHPA 3INOA 3MRJA 4JVWA 4YBQC 3ROOA 5I71C 2JI2A 2QMJA 4YEEA 1JE6A 3O6FA 4W9JC 5DEJA 5FUOL 3V5KA 3UX9B 1I4FA 4AENA 1ND0B 3WIFA 1CG9B 5T3XL 2XTJB 3ULUL 3FUNA 1I3GH 1I1AB 4YC2C 4BELD 1AD0B 3MCKB 1QWUA 4OM0L 1EK3A 4EZJA 2G2NA 4F24A 1A7OH 5B22A 1KPRA 4N0RA 2YEQA 3EO1B 2NW3A 3ARBA 2DZEA 5SWSD 3BJLA 1TJMA 3CMOL 1CXHA 4KK6D 2QPSA 2CH8A 4PRID 4YXLL 3X1GA 3L3HB 3SO5A 5E8NA 3CXHK 5IJVB 4NQQA 1E27A 4YK4C 1RI8A 1SF3A 5HHNB 1GYVA 4U1NA 1E9OA 3O81A 1GZHA 1JWUA 4QRUA 5JW4M 2BHYA 1MRCH 3TO4D 1ACZA 1JWSA 1TEFA 2Q7YB 3FCTB 4XBEH 4ZZKA 3CFDB 5TE7H 1GZPA 2CXKA 1HU8A 1EEUA 4FCAA 3LN5B 5DMKA 3DX7B 3MACH 1E6OH 3MRBB 3QH3B 2VE6A 4FQJL 3ZL1A 5HGHB 5C07B 3JWDL 1DN0B 4M56A 2NLJB 3QJVB 3QUZB 5FO2A 1ZTXL 1N3NB 1DP0A 4FNTA 5DYOA 4XB7A 3BXNA 1IZKA 2DLTA 4O5LH 2UY6A 4CILA 1FE8L 4PJHA 1BD2E 5DFAA 1ZLUK 3D39A 2IOMA 4ZFFA 5L4IA 3VWKA 1NL0H 5KSVB 4L3FA 5EZLA 4TNGA 1MJUL 4G8EB 5AVYB 1LP9A 1X6LA 3VFWB 1T1YB 5HHQA 3IDMB 2QKIA 1U2YA 3EYQC 2DMGA 2RH0A 5BRZD 4QRPD 3IDYC 2AJYL 4PH8A 3KWVA 1JZJA 1MRDH 5TE6H 1KIPA 3IAQA 5FF6A 5ANMB 4K3JL 3W11D 3IRPX 1YNLH 5F88B 3QIUA 3MO1A 1P53A 2CAKA 4S10A 1U8HB 1YEDB 4PLJD 2G60H 2VZUA 3FTZA 4PJ7F 4X7FC 5CSGA 3V0DA 3FQNA 5TH2A 5DZVA 4S1QH 2X44D 1B90A 4J8QA 1BWMA 1KXVA 4NKOA 4UV4H 4ETQB 3WGVB 5IUSA 4H40A 4M61B 3N44F 4L37A 5B1JA 5SWZB 1HIMH 5HVFB 1N7ML 4Y9CA 3TLRA 5TD4A 3MRGA 1IIKA 5JORA 3U6RB 1S9VA 3KVPA 5LG1A 1IM9D 4Z3GA 5GXBB 2IC2A 5IR1B 1QMUA 2XWJA 5LGHH 5I73C 2FBJH 4P5KB 2KZ1B 4H5SA 4LKXB 4ZMVA 4ZSOB 2H41A 4K5NA 4L8SA 5FGSA 1ILSA 1KIRB 4FTVA 3LKPA 25C8H 1WH0A 2CMRH 3C5SB 3FUDA 3IFPB 5AUMB 5AZEL 4A39A 1XF4A 1UM6L 3D0VB 1Q4NX 5D2LA 1ZANL 5SWSA 3TBSA 1XF1A 2B9BA 4D9LH 4GKNB 3EOBA 4B7IA 4JVUA 3EJPA 2X7LA 4LLUB 1C1EH 4A7GA 3R1GL 5CIPB 5LN4A 3EHBD 2N0KA 5DC9B 4OM0H 4F2EA 1GKEA 2XY2A 1NCOA 2ESVD 1KTDB 2IWKA 1QASA 4FX5A 1JWMA 3A47A 1UA6H 4HC1A 2IPTL 1RHHB 1NOFA 1YCSA 3CU1A 1ZEAL 4RX4D 4Q8BA 1E5CA 3ZRSA 4IIZA 5GS1A 4LSSL 4ONHB 2XPGB 5JDJA 3CFMA 5JZ7C 4E9RA 1SFDA 4G5ZH 4U3SA 2I07B 2YA1A 4X7EC 4KZDL 2J2ZA 1BJ1H 3BO8A 4ICWA 4DNLA 2OSYA 3DK2A 3TA3D 3IU4H 2BCKB 5IF0A 1TTRA 2VKXA 3HN8A 3X12A 1FL3A 4OD2B 4XBEL 4JPVH 3G6JE 4UILH 4YLCA 1OSYA 2YPVL 5IK3B 1LJMA 3PHQA 1HSAB 5BMFL 1BM3H 3EO0A 5DLMH 5FOBB 4KDTA 2BVQB 1SUHA 1SZNA 3M8OL 4DP4X 4QHPA 3QQDB 3TBTA 3WL9A 1NCAH 3UTTA 3TH3T 4X4XA 2XTSA 1N67A 5CF3A 3KPRA 4JR9H 3Q6GL 4P5TA 4YVUA 5E8DH 4R84A 3TTYA 3MSPA 2RD0A 5LDUA 1C12A 3VA2C 4GLRI 2PYEE 3D18A 3RDTC 4CVXA 4Y5XC 2YN3A 4IGBD 4ZK8A 4LOEA 1OGAE 4XXCC 5CUSL 5IESH 5TDOA 1W72H 5TK4A 4HBCL 1QUNA 3FN9A 1I3GL 5BV7C 3RWJA 1KPVB 1JHLH 1OP3K 1IAIM 2I25N 2YLHA 5KVDL 1RAMA 2XWZA 3QR2A 1GC1H 2J57A 1NANI 1U6AL 1FYTB 2BC4B 3Q05A 3TZVC 1ONQB 1QFUL 3B2VH 2EXWD 4HK3N 1S7TA 4PJGE 1G7LB 5F6IC 1IC0A 3FO9A 3E9UA 2UZIH 4WV1A 2ZWYA 4DKDC 1IM9A 4AZ8B 1A47A 1G1CA 4Z8FH 3PV6B 4OUUA 1P69B 1WLHA 5F70A 5KVEH 3S96A 4Y4KB 3CIQA 3U4BH 5MEQB 4G2AA 3D2UB 1JIBA 3CMGA 1GL4B 2OMWA 3INUL 2ICES 3NN8A 1G6RH 1ORQA 1GY1A 2I85A 3EGXB 3SDXE 1HT6A 4GH7B 4G9FA 5A43C 1F5WA 5FYKU 3MTXA 1U8CB 3S5ZA 3HAEH 1BFTA 4HV8B 3ABLB 1T03L 5CJOL 1AZBA 2C9SA 1TTUA 5T5NG 3CVCA 4WWKA 3CD4A 2ZWNA 3BWUF 1E8YA 4BUGA 1QSZA 2DICA 1XCTA 2IXQA 5CMAA 2A9MH 2YGPA 4OCYL 3K6SA 4ZFZA 3EUUA 3IGKA 1IKFL 2F53E 4WU7B 1GH7A 5D1ZC 2R0WH 3VXUA 1JPSH 2B1AH 4QYOB 3HBQA 3F7VB 3HE6C 4KZCA 3RPIB 3V4VH 1MCWM 3RPBA 3C6SB 2WCPA 5D7LA 3U79A 5IVZA 3O3EB 1SEQL 2FIKA 4N2GA 4KBPA 4NN5B 3TZVD 4UQAA 3W2DH 5D70H 4QCIA 5A2JH 2F1AA 5I1LA 5EOQL 4PJXB 3RUGF 3P2TA 4LLDA 4X80L 5JMRA 1LEKB 2B3IA 4HMDA 2HG0A 4AEIH 4LOFA 4L4TA 4OZIF 2DAVA 2PCXA 2XTJD 4OZGE 4NQDD 3IM1A 3D0LA 4HJJH 4L0ZA 5K59E 2PCYA 4OV5A 3APFA 4WUUB 1OGTB 4F5CE 1MFBL 5C09D 1U41A 3TCXA 1KZQA 4KGJA 1ZTXE 1YQ2A 1E5BA 3HE7D 3FU9A 3LDBB 3SJVB 2HJLB 4GSDL 4U7MA 4XXWC 2VISB 1YMME 3GB7A 2WTRA 3GM8A 4MD0A 4PJ5B 5F2FA 4U6HA 4DTGH 2Q76A 3STBA 1MKFA 4RBPK 1YY9C 3O3AB 4ZPTB 4S1SL 4AL8L 5DD3H 1UCTA 3VXQA 5D7HA 2IGFH 3NCFB 3EGSB 1R3KA 5PAZA 1KT2A 1X4YA 4WKXA 4W70A 4N8CL 4I2XE 3LIZH 3QDJE 4KZEH 1Z9SB 3SDCB 1NBVH 3MMEA 3NIFE 5C0BD 4L4VB 4APQD 1QLFA 1CBJA 3MODH 2PF6A 5M95B 3N06B 1OP3H 4ES9A 2V2WB 5E9DE 4H8UA 2XA8L 4FLSA 1UOWA 5ITFB 3Q2NA 3QJOA 4GI6A 2KLTA 1XF3A 2E3VA 4EDXB 4LBEB 1JGVL 3CK0L 4QHLB 5KAQF 4N24A 4LSPH 2DQUH 3FB8B 1SDYA 2Q6WA 3I9IA 2X3BA 1MCRA 1HH6B 3JWNC 3RKDC 4APQA 3ULVF 3CBRA 1MFCH 4BH7A 4HJSA 4YPGA 2A74C 1P5UC 4XI5C 5DI8A 5EUOF 5I1HL 1VKXB 1PEZA 2OXGB 2Q7NA 4IMLB 4X4KA 4ZODA 5LB1A 4ZMZA 2V3EA 5I0ZA 4FZ8L 1MHPL 1MCCA 1GJIA 3M6DA 4GQPH 2ZXAA 2R29H 1NIAA 2IBGA 3DKHA 3G5ZB 3EJSA 3QQ3B 3TNNA 3ASWA 3NH7L 4DO4A 4ONFH 2XG5A 4L3CB 4JPIA 4HKJA 2ZWLT 2N0MA 3C08H 3O6LH 3BVTA 4XCEA 4KK8C 2I24N 2YD9A 1QO3A 5KS9E 4NRZB 4QOKA 3P0GB 5FM4A 3I9GL 3EF7A 4X6EB 1RH8A 5GGSA 4WKZB 3L5IA 2BFGA 3F12A 3PJSB 3D33A 3O6KL 1RZJH 4JRYA 4L8BA 2R0WL 1UD4A 5HD8D 4X6DA 4XOAA 1HCZA 5SV3A 1RZGA 4PUBL 5K9OB 4TSCL 3CN4A 4JFPB 4R5XA 4UM8B 4P2CG 5A2FA 2DJSA 5CP3H 1NANH 3BIKB 4JG9A 2D9CA 2P5WD 3N9GH 4PRPB 4Z7UF 4E0RA 4JHUA 4UT6A 4LVNB 1XF2A 3RX5A 2ADIA 5EF0A 1WFUA 2ATPA 4NO3B 2WO3B 4D0DB 2EEXA 4X6BA 2X9ZA 1FLRL 1ASQA 5F1NA 2CJUL 4OCXH 2JWYA 2J56A 1CLCA 3BWAB 1IBDA 4QKTA 1U3HB 2MPAH 4FFZL 3LZQA 1X9RA 1OK8A 4QTIL 3MV11 2E9IA 3MNVA 4OF6A 4J3UA 1RK7A 1MLBA 1QFWM 2CR6A 1BG9A 2JCCA 3F7RA 5EF1A 4N1EA 1ZVNA 4LEOA 4TLKA 1OQXA 3TYGH 4MA7L 5CILL 5DF0A 4YN3A 4DTGL 4KQ0A 4DT2A 2BHZA 2VO8A 3EYVB 4UTAA 4X8GA 5CHNA 5AVSB 1OCZB 3SDCD 3OKYA 1JS4A 1MHCA 1KTKE 2DWSA 3FU6A 4LNVA 4W93A 4EN3C 2CE6A 3DETD 1WRFA 3UPRA 1JNJA 2DKSA 2X4QB 4JY5H 4HHAB 3WXVH 1C5DA 3NACL 2BOBA 1SDDA 4XPBL 3GWJA 2Z0UA 3M1CA 1I1FB 1DQIA 4Q9RH 1N5YH 5I1IH 2ED7A 3NQKA 1IE5A 3ALPA 4X7TA 4ZOBA 3SIKA 4HK0A 5E5LA 3ZDWA 2F61A 3BGFB 4CADB 3II3A 4ZTOH 1S9YA 4NOBA 4HD9A 5DFWH 2DW5A 2VLRB 4M6NL 5FFLA 2ZSWB 3RIAF 4HWZA 3WFEH 4FQ2L 2FNBA 4R4BA 4WFFD 4GJTB 3SQBB 4Q97A 1F58L 4WK0B 1A7BA 4ONGH 4QJ5B 1KXTA 3ROLB 3DJZA 3NSDA 3MV7E 2VERA 4GW4A 3HRZA 3ARGD 1OY3B 3IJEB 3VXNB 1CFBA 2OZ4H 3BQVA 1IC7H 4UV7H 2QELA 1QA9B 1P7QB 2ESVE 3LQZA 4EUPA 1TVBB 5JO5A 2GTZA 1SY6L 3VM7A 1IT9L 4DN4L 2YPKA 4OLWL 3FAXA 5LDSA 4LCUA 3VE0A 3M88A 4Z7NF 1E3XA 43CAA 1B4LA 1SOXA 4D8PB 5CLYA 2OSLB 3OGCB 3S34H 3ILPA 3BC9A 2XWTA 3CZGA 3GSNH 5T3ZD 4FOMA 1JRHI 4JKPL 4FQIH 2P24B 4MNGA 3WAJA 1BDYA 3FNKA 2DQCH 5C0AB 3V4UL 2V9UA 4PV9B 4BZ1H 5T5FA 1AHWC 3VNZA 3MRQB 5DJDA 3N85L 4E41A 1AQHA 2VDNB 3L3JB 2BSEA 4TV3A 3CVHL 2FBJL 4TNVK 1GGIH 5AKTA 1BQHA 4GO8A 4NO0D 4EQ2A 1FCCA 1I85A 2XCMC 5JHDE 3UC0L 2Y7NA 3C6EA 1DLHB 4NM8L 4S1DC 1EJ8A 1MCKA 3C6LA 1Y1DA 5CGYC 1G7IB 4N2BA 1OZUA 3I6GA 2EUZA 3VX1A 1MCDA 1NFDA 3KPOA 1KTLA 4F7MB 2WN3A 4PV8B 3WFDH 3DIDA 4FZEH 3PL6D 1OKEA 4PRBA 3REVB 2EXSA 4JR9L 2ZUQC 5ISZB 1Q9KB 3HUJB 1WP6A 1BX2B 3H42L 4YSTA 5AOIA 1S9WB 4NUJA 4OM1H 2IPUG 3LH2H 4RIRA 4ZTEA 4GAJL 2EKSA 1UB5B 4KTEL 3PAYA 2XWCA 3CN3A 5MENE 3QO0B 5I66A 4Y16C 5CCGE 2WIIA 1MJ8L 2ZYRA 3ML9A 3MNZA 4WUKH 1EV2E 5K9QG 2LT9A 5BO1H 3L3OC 4ZBJA 5I15L 2C7UA 4HCIA 3N43F 1T66C 1DSYA 3DOIA 3OZ9L 5KOMC 2ZCLH 5D2NA 2YMXL 5CN2A 5TPWL 1BFVL 4M43H 4L8CB 1LGVA 4QXTB 1EQWA 4MJ6B 4BXSV 2D7MA 3OKMB 4QRRA 3BGMB 3D07A 3OKNB 3OL2A 3ISYA 4EE2A 1FZMB 4W9LC 5F3BB 3ELQA 2GTWA 5CKGA 2XN9D 4QY8B 4GSQA 4U1IB 3SQOH 3V6FA 5JHBA 2A6JB 1OB1B 1I9EA 2NY2C 4CSZA 5LAXB 3OZ9H 3BFOA 3P9MA 3MLXH 2I7SA 5FM8A 3MRKA 2E86A 3LZOA 4U2ZA 2OMBA 3VB8A 4AGMA 3EDKA 2X6VA 2A9AA 1ZV2A 5DD1H 3KPPB 3M1BA 8FABB 1QYGL 4JHBA 3QYNA 4YDIH 4XPFL 3FB6B 3IFNH 2FGWH 2O26U 1JXFA 2YFOA 2GCYB 4YDLB 4KY2A 1F0LA 5GRVK 4OT1H 5DR5H 1X5FA 4LNRB 4P23C 2EIJB 5GRJH 2VDRH 4LARH 2YPVA 5AZ2L 4MMXB 3SQRA 1H8SA 4HP5A 4Y8DC 4Z7OF 3CIAA 4G1MB 1WBYB 1PG7X 5AOLA 5LNDA 4UT9A 2WUCL 2FL5A 3ZTJG 1GXEA 1YZZA 1SFHA 4HA1A 3SGEI 3V6ZA 2F58L 3FU8A 3RURA 4UT6H 1FDLH 5FO8B 5EMYA 2Y5EA 4OZIA 1JYWA 2Z35A 4G8FB 5HYSA 3L3DA 3RIFK 4YSCA 4NQEE 5FKPA 3WLBA 2DM4A 3QI9C 5KWYC 4ORGB 4HS3A 1IGMH 3CVIL 4JVPA 2P5EE 4JHWL 3PWJB 3APCA 4KO9A 2PW2B 4R4NC 1NAMA 3GI8L 5INDA 5B7EA 5C0GB 2FH6A 5JYMA 3DV4A 3FQUA 1J0YA 4ZX5A 4TVPL 5D1XC 5GZOA 4QF1B 3V0AC 2CGYA 3ESVF 3VXRA 1CGVA 4JE0A 1Q72L 3WKQA 1AHKA 2C3HA 5D6CB 4MA3A 3KGSA 3FH5A 3WFHB 1O9ZA 2QFRA 3QQ4A 4M6OH 3MVSA 5F72S 2DTSA 1AHMA 2X1PA 3V9CA 5IVXF 5C6PB 5JPMA 2AXFA 5IBUG 3P11L 3NRQA 1UACH 1M2VB 3MGTB 4XBPB 3SPVB 4FQPA 4FJ6A 4Y4FC 1AXIB 2EINB 1RK0B 4A38A 4JZJC 4C56B 2D0GA 5F9JA 4N8UA 1YDPB 5K59F 2P46B 3TFKC 5ADPL 1RIUL 3F01A 2ATKB 2YJLA 5FKAA 3W1ZA 3QUYC 5I8CB 3QYCA 2ZT9C 4H8PA 2J6EA 2CHDA 4IBQA 4CRPA 1FFPB 2R1WB 4G3YH 2WYTA 5DJ0B 1NZRA 2XN2A 3KPSE 1UM4L 2WV3A 4EOWH 4LZKA 3RE0A 3RZCC 1K5NB 5HI4D 2BH0A 2VC2B 2NXZD 3BVVA 3FJTA 3PHAA 5L8LB 1FH5H 1ZVSA 4BKSC 1INQA 1AGEA 1S46A 3F7KA 3K3QA 2XKNA 1PZAA 2PXYC 5A7EA 1EAPB 1F2XK 2ARJB 4A6YA 1OF2A 4Y9FA 5JIIA 2NW2A 4PWIA 1CDJA 4PP1C 3TYFA 4KQ3L 4G3YL 1UYWL 3CN2A 3MRJB 3HMXH 1AY1L 1E4WL 1QFPA 4LCCA 2QDVA 4NO5B 4XNYL 5DTFA 1SJHA 2ZAGA 4OI7A 2WXOA 4PS7A 1NFIA 1ACYH 2QV2A 2B2XH 2BOCB 1TENA 3K91A 3QJHB 1AGCA 2JQZA 3OHMB 5E1HB 5EO9B 4F9PA 3DX6A 2EE6A 1TKWA 1KPRB 3MRHA 3SCMC 1I9IH 3AREB 5J7CC 2FZ3B 3A6BL 1KFAH 3GTTA 3BUYB 2X6UA 4GKZB 2BDNL 3FTGA 4QXUH 4LIQH 4DKFH 2V37A 4U1LA 4F91B 3GJEA 5IFJB 3L3HA 3VI4E 3W0WE 1AQKL 3JXAA 5CFAA 5I0XA 2WP3T 5AW5B 3RPKA 3E8UH 2VOTA 2WZPA 4O4YH 2TRHA 2D7QA 5HHNA 4MD5B 4MRCA 3KS0H 2EDXA 2E0PA 3DX0A 4F1ZA 1L9TA 4MCZB 2XQBL 1AZZC 3FCTA 3L6FA 4KK5C 3Q7JA 2VDMH 3LMJL 3QS2A 1GZPB 2PPDA 4WQOA 2UUDH 3LN5A 1FG9C 5KSBE 1EIBA 4PRAB 2VN5A 3CBKB 4FYSA 4P4KA 4KK8D 1N3NA 1DCLA 4HJGB 5DYOB 1Z5LB 4NQTA 2JKSA 4ZTPL 5I1GH 1LNUA 4MSWA 1FVCB 1CDBA 4CN4A 2OMXA 3WTSA 4Q56A 3CPLB 4OZHE 4BDVB 5MP6L 1YLBB 1UH3A 3MBWA 3MRFA 4JLRA 5C0BA 1F02I 2G4EA 4KROC 1JG9A 2EDMA 5DUBB 4X6CF 1J05A 2ZXBA 5DK0A 3WKMH 5HHQB 1NKGA 2IFFH 3HAEA 3LEVL 4HIXL 4PS3A 4IU3B 5GGSY 1F11A 2W0KA 1AI1L 4KKZA 3STZB 1HCYA 4K5OA 4Y0GA 4LCIL 4LEBA 3BYYA 5AG9A 1H8OA 3QIUB 3QWRA 4XN8A 3MO1B 2WVSA 4K7PH 4P4RA 2DY2A 3CXFA 1DVQA 4U1MB 3GXIA 2NNAA 3T2PA 4NXSA 5TJWK 3GSXA 3SBQA 4E41E 5IROA 1IBGL 1O6TA 3OJVC 1JPTH 1MW2A 4ZFOB 1B2WL 3U48A 5CD5D 1JF5A 3WEAA 4FHBD 4MA8H 4QI3A 4I8DA 2EYTA 2OR7A 1FJ1A 4FQXA 4Q6IC 1HXMA 5EO0B 5H35B 4WFED 1CT8B 4ABWA 1A6ZB 3DPBB 4U3XA 3S5YA 5IR1A 2XWJB 4NBYB 1E0OB 1H15B 4HX1A 3TH2T 5GRUL 4H5SB 1XD0A 4LKXA 5EIVA 1EEQA 5KSAB 4Y1AE 5CBAB 4X5XB 3GMQB 2ZPKH 4PGBA 4WEMB 8PAZA 1RUPL 4J5VA 1V54B 3VD5A 5AUMA 3VD7A 1U8KB 3CAFA 1MAKA 4W9CC 3QUXD 4NQUA 1L0XA 4PJDE 4WSKA 3EJJX 1KCRL 1LDPH 1XZ0B 3S36L 1DANU 1T80A 1Q94B 1I7TA 4PM1A 1HYRC 4P2OC 2VSMB 4LLUA 4NPYA 4S11A 3ZKQD 5C0EA 2CA3A 1AZVA 2X2UA 2F53D 4HJ0D 4O58L 4JY6A 3V4PH 2C26A 3GS7A 5BVJB 4YXHL 2F53A 3VVVA 3EW3B 2EE2A 3EYOA 2NY3D 1OP4A 1A2YB 2WYZA 3AY4C 5AVQB 1IX2A 1EGJL 4RFOL 1ZA6A 3CZEA 4LEXH 2JQMA 1TOXA 1W0YT 3ETSA 3IJYB 4H2CA 4L9LC 4AV5A 4PTUB 4GRMA 1JPFB 3TN0D 5CGMA 2P44B 5I1DB 5ID1B 5JLZA 4NQVB 1IBZA 4TSAH 2BS9A 1HSAA 3CNKA 1E9PA 4PB9H 4MLIA 5CU9A 1RUQH 1FN4A 2EDYA 4X9YA 1LE5A 1OK0A 3ARFD 4L23A 1GZQA 4TVPE 4ERSL 2WC7A 3QA3B 1MN4A 3HPJB 4NYLA 5IIEA 2J6EH 2EAEA 2RALA 5IJKA 3UO8B 4V33A 1OD9A 4PJ8A 1RJCA 3EBGA 3SKOB 2Y6SD 4YSQA 3B7UX 4UBDC 1MRFL 3MRCA 5DO2D 4YSAA 3QIBA 2NCEA 4MMZB 4MXWH 4PRPD 3I75B 3G04B 2BHUA 4Y1TA 3JYBA 3NPSB 5KVFH 3IFLL 3OAUH 2ZONA 2NDGA 4R83A 4JQIL 2AK4D 5IFAH 1R19A 2WBJC 5I5JA 4BFRA 1E8ZA 3CG8A 4WTQA 4JRXE 5C7XH 3W38A 5KYXB 1KGCE 4YBLC 3AS1A 1NGYA 3BPLB 1URIA 4MYPA 5HHVL 2J1ZA 3B7YA 2NY7H 4H0HB 1T0NA 2O72A 5C2UB 2J8UB 3BRGC 1QI4A 4BWTA 4LSQH 3LY6A 4W4OA 5KBLA 4XI5D 2HVJA 3KDMB 2XQ0A 2Z8VC 1HS6A 5E08H 3U30C 3PV6A 5EH1A 5IJKC 3QDME 4H20H 4FEIA 4D7BA 5GS0L 5HP5A 3SDXA 1GAFH 3S96B 2L4OA 3OKKB 3D2UA 3BVUA 2FQFA 3WN5C 3E0GA 1BAFH 1R9FA 1KBWA 2CKBB 4AQZA 2Z64C 3LN4A 2EKJA 3ZDYB 5KS9A 2YQ3A 4ECNA 2GIYA 2LTQB 4YUEL 4G9FB 3QQXA 3KXFB 5F7FA 2F5BL 5IQ9B 4FQ1H 4J2QA 4L9LA 4JDTL 4S2SB 3DA0A 4AMXA 5GGQL 5E08L 3O2DH 4HGWA 5J13B 1MIEH 4I9XA 3CH1B 3AY4A 2QPUA 1EGJH 4RFOH 2E7HA 4H88L 5GGTH 4NZRH 1ETZB 3NDZE 4NZTL 4FFWC 3MR9A 4O2CA 1W72B 1KBGH 3S5LB 2FSEB 4ELMF 3NZUA 3BAIA 2VZ1A 1IJ9A 3O41B 4P2OA 1CL7L 4WTWA 2RFXB 4KI5E 4LLDB 4EQ3A 3P1VA 1PNDA 4ZDHA 4QTIH 1CK0H 4FXGB 2ADGB 1DHKA 2YFNA 4PS4L 4JO3L 2DLGA 3TEUA 4OV5B 1IAIL 5HYEA 1PL3A 3D4GA 4WUUA 1YYCA 5KVGE 2VZOA 4XCCH 4WHTB 3UTQB 2GK0A 4KITB 1TZGH 1PQZA 3I9PA 1KLFA 3N9GL 1QBML 1DE4B 2A1WL 4HALA 4XNQB 1KCSL 2OYPA 5D71L 2WTRB 4L1LA 3NAAH 3UZVB 4PJAA 4FQXC 2Z93A 4KKRA 4KGLA 2YQ2A 4F15C 1MUJB 2DLFH 1RZJL 3VXQB 4LRNH 1NBYB 1GOHA 4HS6B 1M71A 3KYMB 3FTVA 5IROC 1KT2B 1OAKH 3LV3A 4XNAA 6CGTA 2YGVA 1DJSA 1E6JL 2IAND 1F90H 1CMOA 2PPAA 2A83B 2GUOB 2WVTA 4MAYB 1LLAA 5DMIH 2FT7A 3B7SA 2FK9A 5K39B 5ECGA 4OFYA 4ZPVA 4QXUL 4GXVL 3VYNA 1LDSA 2DBLH 2VLKB 4OFPA 4PJEF 3O2WL 1PD1A 3WDJA 5C6WH 4NUGH 1EFQA 3ES6B 3KYNA 3RWHB 3T9WA 4K3DH 4PJGB 4M93C 3FMGL 3NDYE 4HYTB 2YPLE 4Y2LA 4GQ9H 3F7PC 5LXGH 5BS0A 4C58B 2NY4B 3QWOA 4PJIB 4AMKL 4LSQL 3JZ7A 1OM9A 3QJQB 4EOWL 2H0JA 5B8CB 3WD5H 3ILQC 3V0HA 1BD2D 3BAJA 4LSUL 4Z7WA 2GY5A 3T5WA 3L7FA 4ZMNA 5IQ7H 3LS5L 4TL5A 2BNRB 4PJFB 2AK4E 5E8PB 5EZIL 1VKXA 1A3ZA 4IMLA 2G3MA 2YRBA 3IDUA 3EJYD 3BFWA 4P4KC 3TBYB 1YPZF 3Q6GH 3AU1A 5GJTL 4U6XA 3LSOA 2YAMA 4RWYH 3F7QA 2M8XA 1IAOB 1HOCB 4JL1A 2BW4A 4ELKB 2XG5B 1GTNA 4L3CA 4Y89A 4JGMA 3S8WA 2JSFA 3L4VA 3KL0A 5K69A 1A66A 2QTVA 4HPYH 3QWRD 4TL4A 3RVXC 2JB6B 4WW1A 2HLAB 4LAQL 2WVUA 3SDYH 2DWDB 4WVRA 1L0YA 4UZSA 3F12B 1C5CL 1MCFA 2GJPA 4A04A 4L8BB 5E9AA 4YO0A 2AJ3A 4K15A 3LNDA 4N2KA 4QD2E 3RVTC 4BWWA 3EDEA 4EUPH 2MJWA 4MQ7A 1ITCA 1K9TA 3LRSB 3SCMA 2H0EA 4F9PC 1P6AB 5I76A 3LH9A 3BIKA 3FHAA 3OAYK 2ZOTA 4WGKA 1BREA 3PF2A 4AYSA 1AMYA 4UAOC 5E4EB 5DZAA 4F8OA 2XWEA 5BS0E 1QEXA 2DN7A 3BFQG 4HLEA 5IMKB 3HMXL 3MBED 2HXAA 4JM2B 4IRSC 4GIOA 4LCCC 1F4HA 5DYFA 5I2IA 4XC1H 1OWWA 1PNCA 4ABVA 3NG5A 1U3HA 2C9AA 1CD9B 2WQ8A 4N2NA 1KGWA 5BZXA 4C57C 5JOFB 1HWGB 2BCMA 1EZLA 1NGWB 2PXYA 3FB5B 2F8VA 3HKFA 2VZSA 4GSUA 1QG3A 5AB1A 3ZO0A 4IIQA 5E8DL 1M3JA 3VFTA 4XNMB 3H9SB 3WNOA 3P54A 1OVZA 4PB0H 1ZLWK 1RZFL 2LFGA 4X6CA 1G9NC 4AKPA 2WLIB 3S4SG 5CU5A 1RL1A 1FV1B 3DXAB 4FL4B 1Z9MA 3A4FA 3WKML 1QPKA 5CP7B 4DKTA 2BSRB 1MHCB 2YD7A 4KJWC 3B9KC 4P57A 5KG9B 5BUAA 3L1EA 1KENH 2JI1A 2CCLA 5CN3A 4GO6B 4TSBH 3DJTA 3RLSA 2P49B 3OLGA 2NZ1A 5D7SL 4Y4KD 4I7ZC 4JZJA 1VFAA 3FQ2A 4PJCA 1T03H 2QTEA 3HBPA 4Y4FA 2W5PA 1AZUA 3WNPA 3NJGA 5AAMC 3QNFA 2MCPL 4K8RL 2I60L 1U95A 1ZSHA 2GSIB 5JPMC 3K8MA 2NSMA 3GMOA 3II1A 1XBRA 1JDDA 1RSYA 2R0KL 3NGBC 4TTDC 3T1FA 4HMEA 5D1ZI 2XXGA 5DQ9B 4YE4L 1CE6A 4NZUL 4XWGL 3BSGA 2YK1H 4GINA 1FG2B 3DRQA 2V17H 1A21A 4LAQH 1T21B 1XGQB 2VDNL 5E8EA 5HGAB 5J3HC 3EXLA 3Q06A 2VSDA 5GZOC 2D0FA 2B1OA 1W16A 4FYRA 4DN3L 5FCSH 3GO1H 5DRXB 4M8QA 4F7TB 3GK8L 4U0RC 2A0LC 3U9UA 4QLRA 4HKBB 2EYRB 1QR4A 4KO5A 4HIXH 3B9DA 3ECBA 3QI9A 4MD4A 4GAJH 3RX8A 3ZT6A 2Z8SA 1QA9A 2EDBA 1DQQA 2GJ6D 4ADJA 5IB5A 1DFBL 4KKCC 2VXUH 1RMFL 4K4KA 4JZNB 1HCFX 5AVZB 1VLXA 2IH3A 3JWOH 4KRPD 1M6OA 1PIFA 3OLEA 1Q0EA 5E8OB 3MV9B 4FQCL 2WTOA 3KPLB 1WFNA 1E5YA 1SBSL 1KTJA 1V05A 2FEEI 3DOSB 4HF5L 1JI2A 1RZJC 3WY3A 3LQAC 4QLWA 1IGYA 1PZ5A 4KO6A 2FJFB 3BZEB 4P2RB 4EXKA 3CTTA 1ACXA 4TNVF 4EDWH 1JGUH 1J1OL 3GM0A 3SGDI 2VO5A 1TPXB 3NIGF 3BX7C 4RMSA 3V7AE 4LDOB 5AFAA 5GRJL 2AI0L 1RK1A 3CFBA 3WJMB 3UXFA 4WW2B 2I69A 3EG9A 4PSPA 1CDYA 2YPVH 3B9VA 4ELME 3EFFB 2BSSA 4N90D 3S34L 5A2AA 4A2DA 1ND0A 3WIFB 3D2TA 3E3QE 4YHZL 3K2UL 2H32A 3C6LB 2E7DA 3I6GB 1J9RA 1L9PA 3O4LB 1S3KH 1S6NA 3K7UA 4JY4A 4FFWD 2C8NA 3HC0A 1KTLB 3J07A 4XNXH 3LZPA 2GIXA 1CD1B 2AXHA 1F3DJ 4W6YB 2G60L 2ITCA 1HOEA 4LASH 3S35L 5HPOA 3ALWA 4R4FH 2QV4A 1G9NL 1ZGLB 5D2NC 4NIYE 3VXSB 4NUJB 1J9CT 3QDJA 5CEYB 4MXVE 4DQOH 4FTVD 2AV7B 1KB9J 3L3OA 1D5MA 1T7XA 3D51A 2ZXEB 4M8UA 4TPRL 1B4RA 3MJ6A 2Q7YA 1W6LA 2OI9C 1J8HB 2P8LA 4B9YA 5DMKB 1ZJAA 2VE6B 2GBTA 4B3VA 1JNHA 2NPLX 1IGML 4RGND 1OGPA 1T83C 6FABL 5I6OA 2FCBA 2MCPH 1MHHB 3UG3A 1JV5B 5A2BA 4H13C 4HJ1A 2B4CH 2G9HB 4Y19D 3D39B 5L6YL 1KELH 4BA8A 3VWKB 3L4TA 1QSFA 3IBEA 2VXQH 4PP2A 3SDXF 1SQMA 4OLZL 5CJBA 1D9KA 5MHSE 1BXAA 1H3WM 1TLKA 2WNKA 3C6LC 3TH4T 3SKUD 4DO5A 2VCOA 1LO4H 2W94A 1BVKA 3ARUA 2DI8A 5ILTL 1KJ3H 3RUGA 1YEFH 2WBJD 4PGZA 1QFHA 4ZO8A 3SO3B 4WEUD 4MKTA 2F6AA 5ANMA 2DQMA 3U0TB 4OD1L 5BRZA 1JD7A 1ADQL 4NN7C 4WI3A 4WW2C 2X05A 3UCRA 1BAGA 2VDQB 1YQVH 3PWPD 4PWEA 2HFEA 2C7FA 1P7KB 1TJIL 5BQ7B 1LM8V 2PKDA 4HUUB 1TPXC 1X5JA 3FCGA 3FFOA 4HUXB 5ABAA 4GO9A 2FX9L 3ENEA 2O6DA 4L3EB 2FL5B 1H6EA 5DEGB 3G6AA 1X5XA 2O5ZH 3RJQB 4YHYC 5HYIA 3QHZH 4L9DA 1ZLSL 4ADGA 2XBTA 5AVTB 5J9PA 1D7FA 2HTLC 4FULA 4OSUH 5CWSA 1ETJA 3DGDA 4PLJC 5DQJA 1IILE 1S9VB 3DSFH 4B9IA 1T7VA 4ODHL 4Y5YB 4XN9A 2BO0A 3ZDXE 4YAQA 3FN0L 3MRDB 2Z8WC 2Z91A 4OZIB 3S88H 2YWYA 4L8SB 1A0QH 1DEEA 1KGUA 4I77L 5D7EA 3LKOB 3LKPB 5BS0D 3MLZH 3VXME 2H3NB 4LSUH 9CGTA 3W5MA 2C34A 1KPUB 5JOEA 4U0RB 3ZE1E 3PWJA 2Q3XA 3ASNB 4X9IA 2JV6A 3EADA 4L1TA 3DV4B 3FQUB 4LGSB 5EZJA 2EC9T 4Z0XA 3W81A 3GEWB 1A3LL 1FBIH 2ZKHL 5DO8A 5B3NA 1RXLA 5TQ0H 4I48A 3QQ4B 5SX5H 5CJXA 1I3UA 1QQDA 3AXLB 1CU4L 2J73A 2XPGA 4Y2OB 1GYWA 3ARRA 1D2OA 2XVGA 4NT6B 4OZHA 4JFQA 2Q8BL 2V7NB 2LV4A 2IF7A 3G5VB 3P40A 4FZEL 2ZUVA 3HZ3A 2NRDA 1JVLA 1R34A 3P4OB 1XHHA 3S2CA 1HL4A 2E6QA 1HEHC 3IJSA 5DFTA 4IQHA 1F8TH 2QQKH 3RWCB 4OD2A 3CHXA 3FYEB 1KTBA 4WY7H 3B9KB 2OYKA 2PTUA 4EN3A 3K6OA 3SDDB 3CZNA 3TBWA 3DX8A 2H26A 4LB8A 1EUUA 1YEIL 4F8QA 2NY3B 5KOVC 3FUKA 4MMYA 1K5NA 3KLQA 2NUTB 3NABH 2YAEA 3QQDA 3BLPX 3TBTB 5L4FA 3UTTB 4LLMB 2FEDD 4X4XB 3BUBA 4RWHA 1T1ZB 1AGEB 2L3BA 2ROXA 4NQDE 2GSMB 1LK3L 4O2EA 5FW7A 1M9SA 3GMNA 4NP4L 4PG2C 3H53A 1FFNB 2RA1A 2VXSH 2F19L 2AAAA 2X4UA 4A66A 4KMTL 1EMTL 2Z8RA 4Q58C 4ZMAT 1IEAB 2Z7YA 1IBFA 3IS0X 1FL5A 2NX5E 3L1OL 2PWGA 1W0VA 3FN3A 4D9RD 3IWVA 5HI3D 1SJHB 3C87A 5HDBB 4KC3B 4JRXA 5I6PA 1RURL 3AMKA 4DN4H 4G72B 1FNEA 1VFBB 1M1XA 2PTVA 3LNGA 5AG8A 1KC5H 1FYTA 2A77L 2BC4A 1ZPUA 1JNLH 2OSXA 5ESVA 4Z7QE 3DX6B 3GBDA 1NEZG 3WNIA 3MRHB 5FLUA 3AREA 4OZGF 2FZ3A 3VFNB 2J71A 4XHQA 5IW3A 4CSTA 3FTGB 3GSQB 1U8QB 5AVRB 3NMEA 4GQZA 1UZ6F 3BPOC 4DPAX 2K6ZA 5IBTH 2XZZA 4B27A 3BZ4B 4AWJC 4DGIL 3FO2A 3VFOA 4E36A 5I5RA 2R2EB 3MBXL 3DDFA 5GJSL 4PB9L 1CFNA 5DJAA 4AEIL 3HPLA 3PYCA 1KB5B 3NN8B 3O2WH 2DQTL 1THAA 2R39A 4S1SH 5CBEB 3MLYL 43C9B 4WK4B 5FGCB 2Z65C 3OJMB 5TDNB 3ZL4L 4UI2A 3GLAA 5TK2A 3ULUD 1VFOA 4WO0A 5CINL 3STLB 3T2OA 5K9KB 3TT1L 4HKXA 5FLVA 4YSRA 3T2QA 3JSSA 1OANA 1OAZL 1P5UA 1UD8A 2A74A 3KD4A 3NSCA 5KYWB 3KL3A 1LNUB 4L3EE 3SYPA 4APQC 2UYLA 3TPUA 3CPLA 2D3VA 3NEEA 1A3RH 2FDBP 4M1GH 4F8LA 3I50L 3OD3A 4MDJB 3VWKD 3E3QC 3MRFB 5C0BB 2X9WA 4N0UB 4QRAA 1K8IB 1BJ8A 1S7WA 3L7EA 4ODHH 4XHJC 3O3EA 1B0IA 3GSRB 3T4AB 3QXTA 1X9UA 3GS0A 4Y4FD 4Z18A 1W6WA 5F89A 4AYFA 1D2PA 1F11B 3LS4L 3P30H 2WGNB 3C5XA 1LEKA 2F19H 2B15A 4L4TB 4KXAA 4AYEC 3QW9A 5HBBA 3SGEH 3BH8A 4GFXA 3D0LB 1EMTH 3P02A 5C97A 2GW5A 4H8VA 2CRMA 4M5YH 4JB9H 3WENA 4JPSA 3GSXB 4PIRF 4ZTOL 1B9ZA 2V5SA 2EADA 2WXRA 4KVCL 1IC5H 4QTHB 5FHAH 3ESPA 2AVGA 1JK8B 2XWXA 3P3YA 4WF7A 5LGJA 3NH7H 2CBMA 1MAMH 5GGRY 3B4NA 4XPAL 5C7ZA 1FJ1B 4U6HB 3Q8CA 5EO0A 5H35A 2V9QA 3A5VA 2HMID 5FDWB 4B5ZA 2BLFA 4ZPTA 3ZW3A 4ZMXA 4PJBF 5E2VL 3HI5H 2LLLA 4R0LB 5KSAA 4X7SL 2NY1C 2Q5BA 4KV5F 4P99A 5J56B 5J6SA 2WY3B 3DVNB 3DX2A 4ZMPA 2MSPA 3H2QA 1CFQB 3BKYH 1Z9SA 3K6FA 4N4YB 5FO7B 1CI5A 3QEQD 4YPJA 4BZ2A 1YY9D 4PGEA 3B9AA 1TNMA 1P4BH 2JJVA 4JFFD 5JDSA 4RA3A 1CC3A 3UADA 3VW3L 3MLWL 3WHE0 5ITFA 1ZXQA 1CUOA 5CZXC 2HFFA 4ELDA 2VLJA 4AK2A 3C75A 4QRPA 2XZAH 5H4ZA 3DIFA 3O4LE 3DO7A 2IDFA 1Z3RA 4PRIB 2DWEB 5D1ZA 1REIA 3RWEB 1EDHA 1I1YA 4QDGA 5KTEL 2P5WE 4QHMB 4YSOA 3WS3B 5C0CD 4I4WA 4BH7B 1A2YA 1OGAB 4CMMB 1DBMH 4AVKA 4YSDA 5EIQA 2BY3A 1HC1A 5J13C 3DROA 4WWKC 3PWPB 3BCFA 2KL6A 5IB4B 4YE0A 3BKCH 5I8EB 1M2OA 4Z7UB 3G5ZA 1AKPA 4C4KT 3PGCA 2OMNA 2LTQC 3HCVA 4J3WA 5DS8A 1TZHA 4LFHG 4TQHA 3UOAB 5KVEL 4I0KA 1UVQA 1ZVYA 1QO3B 1AC0A 3LEYL 3H9ZA 5CR8A 2BSCA 2EIMB 4CC0A 1ZA3A 3BPOB 4NFBA 3B2VL 2BMKB 2D3JA 2BPBA 4KNTA 3ZE1F 4C83B 3QNZA 3QEQA 4P5SA 4BK4A 4IK6A 1SXCA 4X6DB 2D4FA 3EBHA 2FHCA 4P2AA 5K9OA 2Y07H 2X2IA 1PD0A 3TZVA 1HHGB 2OW6A 3F58H 2AI0H 4P5MB 5ESAA 3ZGIA 5KYXA 4XXDA 1WVZA 2KUTA 3LVEA 1G7MB 1BP3B 1J8SA 1W72L 1MDAA 1ACYL 1EFXA 4ACPA 3UGEA 4MDIA 4ZFGH 4X6BB 1JXJA 3V4PB 5F1NB 3NPSC 1ZIBA 1HEZB 3MCYA 4XXCA 4DFIA 3BIBX 5E70A 4MMZC 1YEKH 3V10A 4TS6A 3RDTA 3BRFA 2HVJB 2R9HD 4RDQF 3PDGA 4IM8A 5EO1A 1FZJA 1G0YR 1C8PA 4NRXA 3PFUA 3VMOA 4P5TC 1FVDB 5C08E 4WUUD 4K23H 2X4TA 4MNGE 4LQFH 2Z9TA 4KDTC 5SWQA 5E1AB 1ERNA 4PRNB 4BZ2H 3V4VL 1UWYA 7CGTA 1QRNE 3WE6A 2D7PA 4ISVB 4NKIH 5HVHB 1K4DA 4HUKB 3KXFA 3QB7C 5E4IA 5EU6D 1LD9B 1JPEA 4S2SA 3D85B 4WFGD 4U1HB 3DWTA 4TPRH 4UINH 5DK2A 3TBVA 4I89A 5C08D 5HVWA 1U42A 3SGKC 3EYUL 5HJ3A 1SDDB 15C8L 4KFMA 4NQCD 3VJ6A 1QWHA 3MR9B 1WFIA 4IJ3B 4JFEE 1CGUA 3L1GA 1BIHA 3DETC 4KPHL 3ZTNL 3BP4B 3N1MC 4DVRL 4A6YH 4DZBB 2VLRA 3K1KC 1CN4A 3NJNA 4ODBD 2ZSWA 3BT0A 3PL6B 4NEHB 1E30A 2WO2B 4FN0A 4RAHA 5J1SC 1NCTA 3CCHA 2M26A 1NCCH 4MJ5B 1U33A 1SOKA 4KWUA 2J1YA 1ORSA 4MCNA 5GS3A 1KLGB 2MCAA 3BEWA 1AI1H 3TC9A 2PWFA 3EDJA 2GC4C 3SE8H 4E5XG 1BBJA 4HWNA 1HEJC 3IJEA 3W2DL 1BXUA 4GXUN 1DSFH 1U58B 1DFXA 2FLMA 4QOKE 1EEYB 5GISL 4TUOB 3CX5J 2ED6A 2YD6A 3IU3A 5HJDA 4WHTA 4L8SC 4ZW3A 4WU5A 3QFJE 2X1WL 1ADQH 4GQQA 3RWFB 1RLBA 2E7CA 4HZ1A 4LCUB 1MREL 3D3VB 3MJ9H 4FF9A 4XVSH 1E2VA 1J10A 2DMCA 1INEH 2DYPA 4ES8A 3GLZA 5DHVB 3D34A 4P06A 1UWFA 2ODHA 3OMAB 4PWKA 3W0WD 3BWSA 1FYTD 2CLRB 3NYKA 4R5TA 1LO4L 1ZD6A 2ADJA 5B1JC 2CXGA 1HWWA 1MFAH 1S9KC 1HZHH 1BEYH 2DMHA 2XI9A 3KYAA 4HU8A 4UQIM 1AQMA 4WNJA 1ES0A 4JFOA 1KXVC 4QWWC 1KEGH 3F2LA 2HT4D 3OM3B 2M1KA 3A67H 3HS0A 1R5IB 5LUMA 5DJDB 4MAYA 2YXVA 5IVNA 3VXTA 1Q9LA 3FU7A 2J1KA 2QHRH 3NFPB 6FABH 3QIUC 3VDBA 2VLKA 3BZDA 1A65A 3FFDB 4KOCA 4PJFE 4YDMA 5TE6L 4EI0A 4BKLB 3RI5K 3RWHA 5C71A 1RVFL 3FOMB 4QT5B 5EZOH 2WLKA 4B50A 1UM5L 1JHKL 1MNUH 4HAFA 1NFKA 1NTDA 1TFHA 4NB7A 5E5MB 3NJLA 2ZJSH 3ZR5A 1ML0A 2JKTM 1FE8H 1X7SA 1MDTA 5DS1A 3ULAB 3VWKC 3HRPA 5I1CL 2RJMA 1UURA 4K8RH 1I3RB 2P8MB 4NM4L 4P23D 2YD1A 4GEJA 4M7LL 3LQAH 1T5XB 1U8OB 2Q1EA 4APXB 2VLKE 4AVHA 4WHYG 2NR6C 4XNYH 2YA2A 3GSOA 4XCYB 1G7QB 1HHHB 1A1NB 4U6XB 5C9KA 1WE5A 4XAKE 4OQTL 1AQ8A 3QSKB 2Z31D 5I66B 2OI9B 2WIIB 4H0LC 4GUPB 1SXZA 4O9HL 3AB0B 5I15H 2H0PA 2H2SD 3ERXA 3AADB 2HPTA 3T6VA 1UGKA 4FLHA 1CFTA 2ZOOA 5D4IA 1TLMA 4ZMTA 4I0PC 1CICB 3C8HA 4FQ2H 1KIQB 1NBZB 3QDHA 4G8IA 3QCUH 3VXPA 5I9QC 4M7LT 1BIIB 2F15A 4L8CA 4Z7NE 1JTTA 2QVIA 3ZE2B 5IY5B 1S7SA 1WCBA 1PZBA 2XC8A 3ZTDC 4KXZI 1E4XH 2CCVA 3ARBC 4XX1G 4PGJA 1N9PA 4MQ7B 1EPFA 4NNPH 2Y6SC 3P77A 2CQVA 3V2AR 1QHOA 1OB1A 5IB3A 1AJ7H 4WI8A 2G9KA 4CU8A 2ITDB 2VR8A 4GOSA 2WMPA 1GJUA 4FYTA 4PSRA 2E9WA 1DUZA 4MXQD 2IBZY 4JM2A 3LNIA 2R2HA 4HPOH 1A7RL 2X5PA 1FWXA 3AG1B 3B37A 4BQBA 4Z6AT 3QZLA 4LLQA 1RJLB 2UWEB 3P11H 1RMFH 1E67A 2F7QA 4FNRA 3JQOB 4OB5H 5L2KB 1I7UA 4J3BA 1FQ9C 4KXDA 3CQQA 3MUY1 4AOFA 1H8NA 3NQIA 2B0SL 5FA3A 5DD0H 2OJZH 2DQCL 3BZ5A 3V4UH 5IVXA 1HE7A 4K5LA 2J88L 3ZDZF 4WGWB 4DHLA 4I13B 3S37X 5F96H 1UM5H 5IMMA 3F04A 5J6GB 1U8IB 2HX7A 1F00I 2EDRA 4KH9A 4X6CB 4DSYA 3QCVL 4Y7OC 3AAZA 4HPHA 4OJFH 1FV1A 2CDEB 2XRAH 3MOBL 3EBIA 3UYOD 1E4HA 2OCFD 5SV4A 2NNXA 3KE0A 4XP6L 4IBUA 3U7WL 1CZ8L 4KI5F 1J5IA 3S98A 1RZQA 5CM1A 3HZMA 3REWA 1JUFA 1MWAL 2R4RL 1YUHA 1F4XL 2WKGA 1RD6A 4ORGA 2W1NA 3MA7B 2W65A 5LKNA 5F1SA 1Y6KR 4H88H 5GGTL 4Z7AA 1PKOA 3VD3A 1HL5A 3FUEA 2VWEE 3O6KH 4D8OA 3HUJF 1EHNA 1GY2A 1QFWL 3H9YA 4MNQD 1NLBH 2J1XA 1V5JA 2BJML 2FLRT 4FXTA 5T5FH 1NGPH 1UQSA 4GXVH 2K8MA 2NYZA 2X9YA 3CVHH 1DBJH 2Y5TB 4IHOA 1MCEA 2LLNA 1YYLL 3NGBB 1ZOXA 2DJ4A 5GISH 4TUJA 3G6DH 5ENWA 5EORL 1MRDL 1GHFL 5IEHB 2V6HA 3H3PH 2AXFB 2XICA 3OVUB 5D72H 5JPMB 4HDIB 1C9SA 3M17B 2CM5A 4BZ1L 1E28A 2ENSA 1JYXA 4KK9D 4FFZH 3ZZLA 3E1F1 3WKPA 4Q52A 1Q38A 5L9DL 5LNGA 3NJIA 4M1CD 4Z0BH 2G5BA 2KLRA 3T0EC 4CDGC 1ITBB 3FB7B 3EOYG 2QMKA 3KPLA 5L2KD 1S7QA 3SKJH 3DOSA 2KZBA 4RAVA 1IGYB 4OLWH 5D7IB 2FJFA 3BZEA 2J5LB 4Z3EA 3U7AA 5LCVH 4E9YA 4Z78A 4XNDA 2ZNWA 2XV2A 1INQB 4OLEA 3ARGA 3SDDD 2FE0A 4YDLC 1EAJA 3FU0A 3RZCD 3CFBB 5D1XE 1YC7A 4PJ7A 5E4OA 2O5YL 3IMSA 2K9UA 1SOQA 5F3HB 3U0WH 4JKPH 2WM0A 4QTFA 1PZUB 2PW1B 3CSBA 4JDZA 2Y2TA 1Z6JT 4JG0L 3FK3A 3C5ZD 4YH6A 2GT9B 4YXLH 5SWSE 2C4XA 4BH8A 2KDYA 3KXFD 5BZWA 2K70A 1L7TL 3KZ8A 2EUWA 5IB1B 1NCBL 1XH2A 3FU3A 4OZFG 4P46C 1AD9B 5T3ZE 2BNQE 2W07B 4QXGL 3TVMB 4BBWA 1XGYH 3AT8A 4HUVB 3MDJA 1T5KA 1AAJA 2C1OB 5F1OB 4A55A 5K33A 4UTAH 3I02A 3OR7A 4K2UL 3W5NA 4L4VE 3UH8A 4AQAB 2GVYA 2R1YA 3QJZA 3MV8A 1FO0A 4PHZA 2Z6FA 4NCC1 1G7HA 1S8DA 3QDJB 4LMQI 4XN1A 2AZUA 5G4NA 5CEYA 3ZZSA 5I30L 2AV7A 3L3OB 2R0LL 2V5MA 2PR9A 5LBSL 4GW1A 4UQ2A 3MOQA 3MV8E 3L6FB 3QDMA 1YRKA 3OB0H 3ZXAC 3CK0H 1JBJA 2DBLL 4Y16B 5FM5M 3T6XA 3VI3B 5AW6B 3KW7A 3TCLA 4U6TA 1PYWA 1TO5A 4NLHA 1NLDH 4QJ3B 1XB6A 3C2AL 2G0KA 4HISA 3DVFA 4HPYL 4KK5D 4DJMA 1Z5LA 1IMHC 4AM0B 2ZUQB 5EBGA 3GMPA 4F33A 5I30H 5HYJB 3LEYH 2OMVB 2HH0H 1QSFB 3L95B 2DLEA 1FC2D 4LF3B 3R4DA 1U30A 3CQPA 4FLOA 5B8CC 2EVIA 3N50A 2IOIA 3L17A 4IOSD 4PJXF 5C6TH 3RUGB 3TEWA 1HINH 5BJTB 5FECB 4NPJA 1S5IL 1U36A 3U0TA 1A02N 1QABA 4DCQB 3VQ1C 3HNSL 4YLQT 3CH8A 4YHPB 1CVSC 4DWHA 1MXDA 2LU4A 4UT7L 5IEKA 1NBVL 1B3IA 2YBRA 2VN7A 1F8TL 4G5AA 4Y19E 3EYSH 4M8VA 1XEUA 4R8WH 2HFEB 5EN3A 1P7KA 3GUTA 2CHXA 3WSQL 2GTQA 4B5EA 1SYSB 4HT1L 4JKMA 4ONFL 3TBBA 1JK9B 1D3CA 5E2JA 4U1GC 1J48A 3UERA 2WP3O 3D48R 3G6AB 3LKQA 3MRIA 1IQWH 1KEML 3TVMD 5J9PB 1PZSA 1WTGT 4X80H 4F15B 1WWCA 3ISWA 5D7JA 5C3TA 5L2JA 1DVXA 1BPVA 3ARYA 3EDDA 5BVPH 4UTCA 5TF1H 3BKJH 1IEBB 3RNQA 3WXVL 1A6ZA 3DPBA 4R5VA 4NENA 4W6WB 4J12A 4WSGA 1T6VN 3ARVA 1D5BB 4GW5B 1KG0A 2L7JA 5JXAL 3LOWA 1KGXA 3B9EA 3FT2A 1I9RH 3D50A 3HEIB 3ZZ1A 5EWIH 3UJJH 3U9PH 2WQWA 1EA9C 1KCSH 1IQDA 1U8KA 4J27A 4O02A 4RH4A 1CCZA 5JZ7D 3ZO9A 3FQYA 5CLZA 2WZ5A 3B2MA 3D52A