2P5PA

Crystal structure analysis of the west nile virus envelope (e) protein domain iii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
TTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Genome polyprotein
publication title Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
rcsb
source organism West nile virus
total genus 12
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p5pA00
2JQMA 3WE1A 5JHMA 4UTCA 3UZVA 5KVDE 4X42A 5GZNA 5IREA 4GT0A 4AM0Q 5LCVA 3J2PA 3MUUA 4AL8C 2R69A 4UTBA 3P54A 4BZ1A 2I69A 3N43F 4ALAC 3G7TA 3IRCA 1S6NA 1OK8A 3C6EA 3VTTA 1URZA 1PJWA 5B1CA 5JHLA 4GSXA 5KVEE 4UT9A 1TG8A 1SVBA 3C5XA 5KVFE 3N42F 1Z3RA 5GZOA 3UZEC 2ALAA 1OKEA 1UZGA 3N44F 5KVGE 3UZQB 5LBVA 2HG0A 2R29A 1ZTXE 2JV6A 5LBSA 4L5FE 5H37A 3N41F 4UTAA 3J27A 1RERA 4FG0A 4BZ2A 4FFYA 5IZ7A 3UYPB 1Z66A 3N40F 4FFZA 2P5PA 1OANA 2GG1A 4UT6A 3UAJA 5AAMC 2V33A 5AAWC 2H0PA 2JSFA
chains in the Genus database with same CATH superfamily
3A6OA 4RMQA 3LKQB 4JHZA 5ACZB 2MOGA 4KJYB 5DFTA 1UQSA 1AC0A 4POZD 3U2JA 1RULL 3BAEH 1X5LA 1XGZA 2EE6A 3L81A 1YJDC 1WFNA 4XXDB 4P5MB 5DYFA 1OV8A 5KVFL 3FU0A 3HLKA 4YGVA 1F4XL 1X9QA 1G9ML 4FHBD 1GC1H 3BPNB 2G2RB 3ZTNL 3A6BL 4M61A 2D3NA 3SGJA 4ZMOA 3GMQA 1A2YA 3QQXA 2W1NA 3WNIA 1TSHA 1IC5L 4AC2A 2O72A 2FYYA 1ERNA 2PW2B 3U0WH 3LEYH 4RZKA 4PVLA 2YARA 1CI3M 1JV5A 2YMXL 2OCJA 4WWKD 2YSSA 4CDGC 4MXVE 3UBGA 1ZD6A 2H3XC 1QSED 3MJ6A 3VWJB 4PHXA 2KQNA 4M7ZC 1DVUA 4MD0A 5J89A 4IHOA 3BAEL 3NMEA 4H4NA 2WVTA 1VFMA 1ZHLA 4G59C 5CSGA 1OHQA 5DJAB 5F7NC 5SWSD 4U1HB 4Z5RB 4W9IC 5IQ7H 1I9IH 1QSEB 1LNUB 4JM2B 2GEEA 5EOCH 1XZ0B 3KHOA 1BVKB 3KLLA 4YN3A 2YXFA 1ZANH 1GC1L 1EXUA 3FFDA 4TVPH 3GJFA 5SWSB 1KB3A 5JO5A 4NPKA 5ITFA 3RVXD 3ZYOA 5F1KC 5EOTB 2K3HA 3L4WA 5LBSA 1P7KB 1GZHC 3U0WL 3G5XA 3QJZA 3LEYL 2F7IA 1HNGA 1NMBH 3RU8H 1T4WA 1NCIA 2W5PA 5I66A 4LPYA 5EDSA 1F97A 4RETB 1J5CA 1U3JA 4AIZB 4UILH 1QTSA 1CB4A 1D5XB 1WDAA 2AC0A 1S7UB 3NN8B 4OCWH 1KYOK 4GI6A 5IQ7L 1I9IL 2OPCA 1NLBH 1YJDH 1CIUA 5EOCL 3VD4A 5E4OA 1ZANL 3FUMA 4TVPL 2GBUA 5BOPA 2YEZA 3RJOA 3DX4A 4NDMB 2A83B 4EF3A 4KTYA 2WAHA 1TYRA 4KRMB 3WY1A 4PS3A 2IEPA 5D2LF 1KLGA 3NIGE 1Y7VA 5CZXD 5E1HB 3I9PA 1NMBL 2X53A 4L29A 3RU8L 4W70A 3AWGA 4JS7A 3C5JB 3L95A 1UA3A 3ESUF 3VRIB 3RWJA 2DIEA 1VEPA 1F0LA 4UILL 4XNMB 4WUUD 4BFRA 2VSDA 3MLTA 1TETH 5HVGB 4PRPA 2AMGA 5BS0E 1BM7A 4OCWL 3QUXC 5E6SB 3QORA 5EIIG 1HT6A 2NY2C 2ZTBA 3MXWH 3PYCA 3QZBA 4GT0A 2G5BB 1NLBL 1YJDL 4I0CC 1MLBB 3VRJA 4F58H 3FQ1A 4PMFA 3WJLA 2XKUA 5DJ2A 2GJ6A 5E99H 4TLSA 3IFOB 3KH4A 3BQUC 4W9HC 4XPAH 3DRQB 4D0CB 1DVFB 4OZGE 5E8EB 4Y88A 1U4EA 2B9BA 2IQ9H 1Z5HA 4M1DH 3C5ZC 2NYKA 3DI3B 3GTNA 4G70B 4M4RA 4M4PA 5AUMA 4KDWA 2O5YH 2Y07H 4AE0A 1KGYE 4S1DD 1MWAH 3NSJA 4HLJA 3MREB 3O6LH 1PVHA 4PGEA 3MLXH 4UB0H 3OV6A 4RWYH 3QFJE 4UAHA 3FO2A 3O0RH 3OX8B 4F2EA 1J7VR 1MW1A 3FB7A 2Q76B 2J56A 1TETL 1UH2A 2R69H 1KDIA 4Z7NF 4IRJC 3MXWL 3GSRB 4IKIA 2O93L 4F58L 3L4VA 4QHMB 1KYUA 4JRXE 1LK2B 3QDMA 2DYRB 2VWEE 4MMZC 5E99L 5IEKB 3VB9A 4XPAL 5DC9B 5E2WH 2HVBA 5G4NA 3ZN6A 2IQ9L 4A7GA 4M1DL 1CZ8H 2D31B 3NT0A 4OB5H 4KGLA 2JVUA 1ZWIB 2BWIA 1U92A 2O5YL 2Y07L 3IE9A 3L2LA 4L5FE 1X6LA 2XBDA 1MWAL 2HKAA 1SDDA 3O6LL 3IJYA 2Q20A 3MLXL 4AENB 1PX8A 4RWYL 2P24B 3ESMA 3ETBF 1G9NH 3O0RL 4NHUA 1XR9B 1KIRB 1OF2B 3H9ZA 3N91A 4WFHE 4YHNA 5AD0B 4IGBC 5F9AC 2R69L 4NP9A 4XMLH 4QXWA 3PV6B 2ICEB 2GTQA 5CEZD 2NYYD 2KMWA 4RDQG 5DJ0A 1NICA 1OIOA 3DPBB 4ANUA 2VL5B 4HHWA 2WP3T 3QIBA 3EOAB 2R2BA 3FONB 3IU3B 5E2WL 3L1GA 5MEOA 3IMUA 3SQRA 2VXTH 3VU1A 5IMMB 5KZCB 2DQGH 2EC9T 2N56A 4HIIB 5M94B 1CZ8L 5DTFA 4NKMB 4OB5L 2V2XB 4IMLA 5BO1H 4U6XB 4YJZL 2CIKA 5DZOA 2V33A 4PJ9A 4QKXB 2RH0A 5HGBA 2RGSA 2G75A 5CHNB 4NQDE 3QEQE 4YR6A 2B3IA 1T0NA 4AM0A 2JKRM 4C57C 1U3HC 1P69B 2PPAA 3H54A 3L3IB 4UQEA 1BEXA 3AB0C 4WK0B 4XMLL 3TA4D 2BY0A 5JIQA 4BDVB 2J8UB 3HZMA 1H3TA 1AANA 1GJUA 3QZLA 4DP6X 1AR1D 4GPVA 1S2EA 4UANA 5FA4A 2OYKA 2HX7A 1SXNA 3WEXA 4FFWD 4M8QA 2VXTL 5TK2A 2DQGL 4NJAH 5FUOH 4ALAH 4R2GC 1AR1B 5BO1L 3PAZA 4RFOH 1EFXA 4Z7WE 1E90A 4XO4A 4EBQH 5INCA 3NGBC 4PWHA 1WTLA 4HSCX 5B1KA 3GMMB 5ANME 5LN4A 4LMQI 5KS9E 1HHJA 1MCFA 3IDYC 5AL0A 4TS6A 4HYTB 1SVBA 2VJ0A 5DJXA 3ULVD 1OOAA 1HXYB 1ADQH 2JLPA 2Z4QA 2QZ5A 2FRGP 5FOJA 3VXSD 3QJUB 3MNWB 4WV1B 3KPNA 1ZXQA 1YNTA 4FQCH 1KUMA 2Q86B 3ZKMD 3UAJC 1N26A 1IAOA 4G1EA 2OX5A 3C08H 3UBFA 4JFDE 5BRZE 3LKNB 2YD8A 2CWRA 1JJUA 1ZT7B 1MI5B 4Y4KA 4NJAL 4ALAL 2ERJC 3TZVB 1QR1A 4JW3A 1RQ5A 4PRNB 1T7XA 4RFOL 4EBQL 4KVCH 1VERA 3GBEA 3IWVA 4MX7B 3KLKA 4JGMA 3O3AB 4JMXA 5A2LH 1AO7D 3CCHA 3NCMA 4U1JA 3CDFA 4NRYA 4Z7VA 5SWQB 3O4LB 1A65A 2NTSP 5F8RC 2RD0A 3SE8H 1TEGA 3D39A 1AO7B 1ADQL 1CFTB 4YLBA 4OZHA 4IMKA 4RGMB 1NKGA 3ARPA 5F0MB 5I76B 5GJTH 4I0PC 1F11A 4FQCL 4AXWA 3ETBJ 3LQZA 2W0KA 2GC7C 2Y5EA 3AXLA 3BKCH 1UHVA 3C08L 3V7AG 4F7MA 3SJVD 3KXFA 1Z7JA 4IEFA 3VSQA 1AD9B 3WLBB 2B1AH 1QLRA 3Q05A 2Y72A 2P26A 4L18A 3MA9H 3GINA 4N6RB 3TH4T 4WW2B 4KVCL 3IVKB 5DFVC 1Q9LB 2O6PA 3W0WE 4TV3A 4X9IA 1R19A 2NY3B 3ZK0A 2H0PA 2OV0A 1VZIA 1PY0A 1T1WA 2IAMB 1KF9B 3IM1A 2ILLA 5IW6A 1DVQA 4AUYA 1BQLH 3H2QA 3N50A 3T4YB 4XCNA 4D3CH 4PI0A 3SE8L 5GHWH 4KO5A 4ZFOL 1OP3H 1GW6A 1ZVYA 4L2LA 3B5TA 3WO4C 3IE4A 3HC0B 2EEAA 1JK9A 3HE6C 5CLYA 5F7DB 3MCG1 5GJTL 2OSLA 5D1QD 4NPYA 1OAXH 2FQDA 3AQZA 5DRWB 2KS0A 3BKCL 1D2OA 4LLMB 2XFXA 5JXED 2N3JA 2Q6WB 4ZBJA 2B1AL 5F96H 2YPLD 4QRUA 3WI9A 1S9YA 1JP5A 1UENA 3RLSA 4DN3H 3FT3A 4X8GA 5I8CB 3MA9L 4L1LA 4I4WB 1QSFA 2LABA 3HB3D 3DBXA 5CP3H 5D71H 3DMMD 1DQDH 2W9LA 4P4KC 4U1GC 3W9DB 2LLNA 4JRYB 1XIWA 5CD3B 2D7TH 1BZ7A 3OKNB 1D5BB 4MHHI 3E8UH 4ORGA 1FNSH 2X38A 4JO4H 1Q90A 4JJHA 1F90H 3MKKA 5CLXA 1BQLL 3DMMB 4D3CL 5LCVH 5GHWL 4UT9A 2BSDA 4A1RA 4J6IA 4RX4A 2X10A 3LS5H 5I1LB 4JQXA 4A37A 5AVQB 2WOYA 1QABA 3C8KB 3HPLA 4XN9A 2WXIA 4E36A 1OAXL 3Q2WA 3VFPA 2CIIA 1PS3A 3UYOD 4A7GF 3KDPB 4KY2A 4XWOD 5F96L 3SY6A 5INDB 2IDSA 4DN3L 4DP8X 4LLVA 5ISZD 4OLVH 2K6YA 2HA1A 4FQJH 4PYHA 3CFCH 1A3ZA 4G9FB 2FSEB 2ADYA 5B3NA 5D71L 1DQDL 1Y0LB 1CICA 2BS71 4KRLB 2D0GA 3MV8E 3QA3B 1RHFA 3QUGA 2D7TL 4GAYB 5A2CA 3E8UL 1FNSL 3KM1A 4WTWA 4JO4L 2VLJE 4ZW8A 1F90L 4AUUA 4DEWA 2HPTA 4HKJB 5EUOB 5LCVL 3H53A 5KW9H 3PWUB 3LS5L 1OQXA 3FFCE 3WDHA 4A2MA 1SDAB 4F3FB 5B1AB 3DX3A 1RLWA 3G6JB 3HR5B 3FQWB 3AWEA 2C7FA 4M8RA 4EN3A 3LRGA 1I4FB 1NGWA 1MLCB 3HRZC 2FQEA 3DYOA 3VFWB 4F7CB 4UQBA 1CIDA 3LKRA 4OLVL 3QGVA 2AJVH 2DF3A 4FQJL 3CFCL 3NJXA 4DVBB 5JW4R 4MAUH 2GEQA 1X9LA 4ABVA 4YHYC 4GB9A 1ODUA 3S7GA 2ZUVA 1VENA 2QELA 3WEAA 3EDDA 5FV2A 2D7MA 5E1IA 2X70A 1FN4A 1MY5A 2MQ0A 3DX1A 3MYZA 3DV6A 5I71B 5HBBA 1TO4A 2XN2A 4XN8A 1P84K 4XHQA 5GSVA 1KXTB 1WA2X 4HGWB 5IBUG 4MZ3A 3ARVA 4GFTB 2E7HA 3ZKND 5L8LB 3GQFA 1V5JA 3CJJA 4NXSA 3HG0A 4LARH 1J0IA 2FGZA 1WBZB 4NENA 3HMWH 4HJGA 4LEOB 2EYRA 1SJEB 4E41B 1NKRA 2AJVL 5D4HA 2YZ8A 5D2NB 4O51B 3ILQC 4W9EC 2UZIH 4MAUL 1OCOB 3KH3A 5DDHB 3P4LA 1DCEA 4HZAA 5IVZB 1EUTA 3UZVB 5J0BA 1DLHB 1HYRC 4J3XA 4U6VH 2DEWX 2XG4B 2A6JA 1Q9KB 4EQ3A 4LEEA 3RHWK 3EFOB 1RJLB 3E3QC 1DJYA 3EGXB 3HG1B 4N8PA 4NN7C 4XMTA 5JHAA 1A9EA 2APVA 4HDIB 4KO6A 1FNGA 3ROOA 4MA3B 4LARL 3BAKA 4P9MH 5JORA 1NA8A 2IMMA 1ZVSB 4LDOB 3BHBA 3HCVB 4J3WA 2RIKA 3HMWL 1I7ZA 1OE1A 1SBBA 1YEDA 1BF8A 1J5DA 2QFRA 1F58H 1REIA 3PL6A 2UZIL 3KNBA 3IGKA 1HHKA 2EIDA 5AKSA 5IVXF 1YY9D 4G5AA 4Z7VF 3ZHKA 3JWNC 2C3XA 4NC1C 2DJMA 4I3SH 4U6VL 4XVOA 4L1HA 5E6ZA 4D0BB 4L48A 2A7BA 4OZHF 3T0EE 3WJMA 3QB7C 5CLTA 3UG4A 4EZMA 1IKNC 4J3VA 1CXIA 1FNLA 3PUUA 5AVUB 4Z18A 4J1UB 1NCJA 5L7XH 4P9ML 4C58B 5KBDA 3O6FC 3GD1C 2GW5A 2OCCB 2H32H 3EYFB 3TASA 3T0XA 1F58L 3N3EA 1CCZA 1H19A 5E1GA 4MB1A 4PU2A 3B5HA 4G7SB 1N18A 1FZMA 4PCKA 4I3SL 3O8XC 2TRYA 3NEXA 3T3PE 1RK1A 2UX7A 4EI0A 2YRLA 5AENA 4JDVA 2WIMA 3G08B 3C12A 4XNUH 2PNDA 2VN4A 3FOMA 5IJBC 4YVUA 1FSKB 1CYXA 1OARH 4DVRH 1URIA 2E6PA 1YUHA 4U3HA 5L7XL 1OO2A 3BC9A 3TV8A 2XZCH 3GHBL 3ZGHA 2PPCA 1W0VA 2DPKA 3EJPA 1ZA3B 2A6IA 3OR7A 4Y9GA 2VQUA 1G7JB 5DS8A 2DEYX 1HHGA 3HC2A 3MRIB 3BXNA 5F3FA 3FTSA 2F53D 5BS0A 5IF0A 3O2DH 3U7WH 1SLUA 2PXYA 3TBSB 2HT4C 3ARFD 3JWNH 2LVCA 3SBWC 5BUPA 5JHLH 4LVHC 5TDPA 1XT5A 3KPTA 3PDOB 1XGTA 3LEXA 5B1CA 2FNWA 1KB5A 3I9GH 2QV4A 3KWWB 4QRQB 4XNUL 4MMYB 2IWFA 3H9HB 1GGIH 1C12B 5IHHA 1OARL 4DVRL 3F2LA 4KKBC 4OZGA 2B7DT 1PKQB 3DTXA 5I8KH 1G7QB 3O41A 5TDOB 1BFOB 2YAEA 4WSJA 2XZCL 2WJ5A 3OC8A 4ICXA 3D69B 2Y0SA 2X6VA 1KIUB 2FAUA 5EIIB 5J3HC 4FQQA 4HGKC 3TU6A 4JO1H 3MBEA 3QFJA 2Z8WC 1K8DA 1QZNA 4FF9A 3RP1A 2PO6C 3L3OC 3EXJA 3PHQB 1JIBA 1KFGA 1KPUB 3FQXA 3UYPA 3O2DL 3U7WL 5C3TA 1EEYB 3VFMA 5JHLL 3MHZA 1CYWA 4TULH 3GLDA 4KOBA 5D7JD 3UGUA 1YRKA 1S7TB 1WEJH 2OMNA 4IIQC 4O2EB 4QRPD 4RGNC 5DRNB 1U8MB 3BH9B 3I9GL 2IDCA 2VAAA 4OV5B 5B39B 3RRQA 1BVOA 3OKKA 1ZJAA 5D7JB 4AJWA 1J0KA 5I8KL 4QAWA 4QRPB 4H2AA 5E6ID 1I8IB 1HI6B 1HXMB 2P8PB 4HWBA 4L9LC 1J9SA 4JBSA 1KZQA 2CK0H 4Y9FA 1S7WA 3ZDYB 5E2TH 4FZEH 4JO1L 1HCYA 3G6AB 4POYA 1A21A 5E6IB 1HINH 4APQC 1FL6A 3PLYA 3QNYA 3R19A 4IBQA 4S10A 2IGTA 2E9GA 3GHEH 3L45A 4MAYA 2WXHA 2YAFA 3EF4A 2J6EH 2VUKA 3F6JA 4GAAA 3EF7A 3BZEB 3GXNA 3T3ME 2WB1A 4LOEA 4TULL 5IY5B 4AUJA 5MP6H 1WEJL 4GUQA 5K93A 1UQSB 2ESVE 5A3ID 4UTCA 1ZV2A 3J8F7 3QNZB 1DSWA 1XMWA 3MLZH 5B1BB 5HI5C 2CMRH 1F3RB 1W15A 4FFZH 4TQHA 4P5TA 2HFGH 5KEZA 5FYJH 2HLFC 2CK0L 1F3DJ 5E2TL 4FZEL 1U3ZA 1TTUA 3JUYA 4NQDA 3KCPB 3QEQA 3F04A 4GS7C 1HINL 3RY4A 3SDCD 1DJGA 1QPXA 3RVTC 1AQMA 5DF0A 3F7YB 3GHEL 2ITCB 3BSZA 4WKZA 2J6EL 1KTRL 4G42A 4PV8B 1TVBB 3ZQ9A 1IQWH 3MJWA 5MP6L 4XTRD 5HI4D 1QX1A 2DRUA 2OULB 3B2VH 3RFRA 2APWA 1D7BA 3C87A 3MLZL 2Y5QA 1C7SA 2BSEA 1BAGA 1FFTB 2VSKB 3FBQA 2CMRL 3BRDA 4LL1A 4FFZL 2Z9TA 3I6KB 2KPNA 2HFGL 2ATPB 4Z7WA 5CN2A 3FFDB 5FYJL 5C0AD 2P5WD 3CTTA 3D4YA 3I6LD 1BBJB 4MXVF 3IRPX 4HKZA 3EUUA 2CR0A 3QRBA 5EA0H 1NIAA 2ZUQB 5ANMA 4AZ8B 1CGTA 5KS9A 3OWEA 2VAJA 4LSTH 4FXKB 5DO2C 3OZKA 4RQQA 4OTXH 4NAQA 3NCXA 3DX8B 3K6FA 4GXVH 4CBZA 4GKLA 1EEZA 4JZNA 1IQWL 1YUKB 4I7ZC 3KWXA 3QARA 4HJTA 3TH2T 4NUQA 3CIQA 2AJZA 2CM6A 4IU2B 3B2VL 5BRZA 2WYTA 5DJCB 2W80C 1A7QH 4M3KB 1M6OB 5CIPB 2YEQA 2IH8A 5AG9A 1XSOA 3T8XA 5I1DA 5JYMA 4K9EC 3ECBA 2WPGA 1W8NA 2ID5A 3ZIYA 5EA0L 1D9KB 1Q9WB 1P5VB 3DKHA 4ILDA 1U30A 3DX9B 4GO9A 4LSTL 5BCAA 5C07B 1RZ8B 1S7VB 3CSYB 2B39A 4OTXL 5DRXA 3SD5A 1MSPA 4GRWH 4QY8A 3S5LA 4GXVL 3FUEA 3VUAA 2UWEF 3BRGC 2PF6A 1OL0A 1M6UA 3F85A 2ZUXA 1T1ZA 3FTYA 3GMOB 5IROD 3QUHA 4IU3B 4FP8H 2AHIA 1BXAA 2D2OA 2XWBB 3VFSA 4GRLA 1A7QL 1EEUA 4UINH 1KT2B 4PTTA 1UH4A 3NIGF 1XCWA 2APXA 1JN6A 2VJ8A 1SJMA 2BNRE 3EJZD 1T20B 3ZDWA 5H35A 1G0DA 2WWNA 4M03A 3F05A 3W0WA 1MVFA 5C0JA 3NDZE 2K3TA 3QUKA 1SXCA 2BY3A 1GY1A 5MERB 1UD2A 4LCVA 4GBXD 2VW6A 1N70A 5H2BB 5IB2B 1CWVA 4OI8A 4YDIH 4FC3E 2TSAA 5IT2H 1SYVB 3POHA 2GI7A 2YOAA 3TJPA 1U8KB 3GSQA 3FT1A 4FA8A 3IBEA 1S9WA 3DO7B 2Q7YA 4OZGF 1FC1A 2F7QA 4FP8L 2WXLA 5FYLH 4BH7B 4CKQA 4UINL 3ARBA 1SQ2N 3Q3GA 5B7EA 5F7HA 3NZ8A 4WU5A 3L4ZA 1KYOJ 4GXFA 3NQIA 3QPKA 2CQVA 1UKSA 4GSRA 4I9XA 2C9UA 4K9EH 1C16A 2R23A 4ZFGH 3CD4A 2UY6A 4M6OH 3BZFA 1CE1H 3TNMB 2OMVA 5LB1A 4BFFA 1CE6A 3BPNC 5AAPA 5FCUH 3DDFA 1TCRB 4HD5A 3QW9A 4QRRB 2VXQL 4KFMA 5DHVB 3Q2LA 4YDIL 3VD9A 5KJRH 4PI2A 3E38A 4OFIA 3VXMB 5IT2L 1YAIA 2MHAB 2Q3AA 2X2JA 4JVUA 2H8PA 1MHEA 3C8DA 4U1MA 1Z1WA 5IHZB 4P23A 4MJ2A 3D12B 4JFED 3TLRA 4LLWB 2WZ0A 2WTRA 3GGWB 5EO0B 3MLUH 2DH3A 5FYLL 2IADB 5DRZB 3P2DA 4HZ1A 4E9TA 3K72A 3VWJC 5AAWA 1FZJB 1U8CA 2WQUA 2EXTA 3KPSD 3H3BC 1NANH 1HH9A 1BIHA 2WY3B 3MCYA 3HLAA 3DIFB 1Y18B 3MRHA 2VXSH 2KDGA 1QRNE 4JM2C 4K9EL 5GRZA 4ZFGL 4M6OL 3WS3B 1CE1L 1GGTA 4Z95H 2CBMA 4F8NA 2VLJA 2C1OA 4HBQA 4JCWA 5FCUL 2E7LA 2J3SA 4DKAA 3LD8B 3DX2A 4X9FA 3CVHA 1DTUA 2AW2A 3FFCA 5KJRL 1KCSH 1ZY9A 4AM0B 4IBZA 1AACA 3SGEH 3P4MA 4OFYD 1TYJA 3RVXC 3H42H 2WSKA 3BLBA 4JUTA 1OAUH 1LDPH 3LIZA 3MLUL 3RWIB 4X7TA 3AADB 4FJ6A 4XBMA 2KZBA 5FGBA 4RDBA 2X9XA 2KH2B 1UXSB 4K3EH 2HVJB 3SY0A 2VXSL 4B95C 2E7DA 3O3BA 2JE8A 2DQTH 3UAAA 5I1HH 1LEGB 4CDHA 4Z95L 4PJ8D 4KPHH 1CFBA 2ZX9A 3V79C 3NG5A 1MY7A 3F00A 1QFWH 2IVFC 2ZXWB 5GGTA 1HOCA 3VD5A 3D06A 4BUGA 1BGXH 2ALWA 1NDGA 4U1SB 1F1GA 1KGUA 4IBWA 2Z8VC 4PRDB 5D7EA 4DHLA 1HHJB 4N3TA 3T65B 4EIUA 4OZIF 3L4UA 1NFDF 3FSAA 4IJTA 3H42L 5D1ZD 2Q0ZX 1OAUL 1LDPL 3QQDB 2X9WA 3WSQH 1FGVH 3ARDD 5E2UH 3IMVA 4Y5VB 2YN3A 4Z7WF 1GJWA 4JFXB 1E9QA 2Y69B 3KL5A 5KVFE 2XZAH 3F7VB 1Z3RA 4LNRB 1H8LA 5D1ZB 1IM3D 2VQ1B 4K3EL 4G1EB 3OMNB 4HBCH 3AS3A 4LP5A 2H6PB 5KS9F 2WVSA 3S5LG 2K70A 5CNHA 3FTUA 3U2SA 5A2FA 4YBLB 1TQTA 2DQTL 2GIXA 2P8MB 3NH7H 4GKSB 1F00I 3UROR 4KPHL 3ZYIA 3CWGA 3NRPA 4P04A 3SDAA 3IF1A 4AVHA 1INQA 1WZAA 1DVFC 1QFWL 4WUKH 2OZNA 2EDYA 1BGXL 1MF2H 4YL4A 5B4MD 2BM3A 3L1FA 4MXQC 3IT8D 4NNXB 4OCNC 1ZLUK 5IB1B 2OAAA 3MFFA 3WSQL 2XVKA 1FGVL 1DANT 1O6SB 2PN5A 2H2PC 3FNKA 5E2UL 1EHXA 2K7PA 4EDWH 3QIUA 1E28B 4CU6A 1K5NA 4TUJA 3ZO0A 2V7HB 3LNEA 2XZAL 1BZ9A 1WBYB 4RMTA 3O9WD 4HBCL 3T0AA 4HA1A 5A2KH 1XF5B 4JLRA 4A68A 1BWMA 3FUHA 3NH7L 3DSNA 4NQEE 4DGYH 2X3CA 4QXTA 5EZLA 1LEKA 3ZY7A 2A1WH 2VDKB 3V5DB 4Z77B 3T0EA 1YPZB 1ZS8A 3S88H 4WUKL 1EZVY 3N9GH 3IKCA 3CXFA 1T5XB 1MF2L 4N3UA 3RIFK 3V0GA 3TA3D 5E8NA 4ELKB 5C7ZA 2H9GA 4LKCB 4YLQT 1C5DB 1KBVA 1GYAA 1EDQA 4ANVA 1MVUA 2ZYRA 3VD7A 1AZUA 4ZMAT 3TA3B 4ZX6A 2AQ3A 5AVVB 4EDWL 5HJ3A 4PRIE 4HKBA 1HSBA 1BG9A 2EICA 4HK0B 5F70A 2G0KA 1KBPA 4YK4B 1P2CB 5C70A 2ICEC 5LNEA 4TVPE 4H8UA 4KK6D 5D7KE 2MWCA 2A4CA 3V0VB 3VGEA 2VOTA 2K78A 3PPEA 2OK0H 4DGYL 1KY6A 1NC4D 1ZHKB 3NESA 3VQ2C 4R84A 5MHSE 4ETQB 1MHCB 2A1WL 3EW3B 4B6ZA 1J11A 3F84A 3S88L 3GUFA 5DZPA 3N9GL 4QI3A 4PP2A 1NC4B 1PZUB 3WS6A 1BP3B 3U7YH 3OAZH 1T5WB 5KUMA 1IGJA 1KIPB 2BDNH 2LFEA 2NDGA 4FQHB 4D9RD 1QFOA 2GSGA 3M88A 3VTTA 1H6FA 3LYRA 4WY7H 4PJ7B 1I1CA 5CCJA 3OF6A 3MGTA 4G11A 4LDLB 4Z7UB 5C08E 5CLWA 3TYGH 5EEUA 2KPWA 3WIHH 2VXVH 3VI4E 5AW0B 2D3VA 3OG6B 2OK0L 3GNMH 3QEHB 4NLHA 1ZVNA 2DQUH 2Q3ZA 1VFAB 3EOBA 3AJ7A 2HZHA 5L8JB 4FAAB 2DIJA 4KXBA 2BSTB 1WH0A 4NQXA 1CICB 3B7SA 2ZOKB 3FRPA 5EU5A 3BWAB 3D52A 5I0WA 1QFPA 2WQ8A 3AY4A 3DC0A 1JRHI 3U7YL 3B7TA 4OLYH 2XSKA 2BDNL 3UPRB 1FZOA 4PJIE 4ZFQA 1INEH 3OM3B 1OAZH 1RUQH 4K9JA 4WY7L 1ZAGA 2QJDA 1T3FB 3QPXH 4KJWD 5FYKU 4JG1H 4JHWH 1KJMB 1UJ3B 3TYGL 4Z7IA 3WIHL 2PYFA 3KWUA 3L9RB 2I85A 1ECZA 3CHQA 3FB8B 2IBGA 1OD9A 3D51A 4X83A 5C0CE 4WV1C 4DK5A 2MIZA 3T08A 3GNML 5FWRA 3SDXE 1F1AA 3FDWA 2DQUL 4DOHB 1FJ1B 4OJEH 4X8JA 1TLMA 1CLZH 2FEEI 4R26H 5IHUH 4DTGH 1EHAA 2OM5A 2X4RB 4ZOCA 1NKOA 4K5OA 1ZLWK 5GGUA 5GIRB 1IUZA 1GGBH 3TZVC 3RHWF 3S4SB 3PWPE 4OLYL 5C92A 2VL4A 1HHHB 2K9FB 2PWEA 4WHTB 1RK7A 2B3RA 3DV6B 1TJIH 3CH1A 3MO1B 1INEL 2ZX5A 1OAZL 3RWCB 4ZUWB 4K3HA 1JMXA 1RUQL 4OFKA 1ZEAH 4CRPA 2RJMA 5JUEH 3QPXL 3T71A 4JG1L 4JHWL 4BKTC 1FO0A 1XFPA 2EC9U 2OMWA 4QHKJ 2DL9A 2EKSA 1MXDA 3L3GA 4Y16D 4RGMC 3ME0B 3I3EA 2RALA 4AM0Q 4F92B 1ED3B 5LGJA 5CO1A 2WV3A 4YXHH 4EZLA 4DTGL 4LLYA 1CLZL 3N5AA 3Q6GH 4R26L 4UF7C 5IHUL 3LH2H 2IJ0C 2DS4A 4Y16B 2YAHA 4BH8A 3D6GA 2ESVA 2PP9A 3EO9H 4KH2A 1GGBL 1WWAX 1S78D 4QRAA 4UDTA 2DIAA 2QVTA 4WW2C 3MBWB 1KEGH 3CQQA 5IB5A 4R5VA 3P4NB 3X14A 3NPSB 4CVXB 3MRNA 1ASPA 4XXCA 1TJIL 2NY3C 4ZMZA 3HI1A 5T1DH 4ACPA 2UZPA 2BZCA 2IAMC 2WBJA 5JUEL 2NW3B 1ZEAL 4JO2H 4J3OF 4AGOA 4NT6A 1BXUA 3ROOB 5FK9B 1LO2H 1ZKAA 3PG2A 5E6YA 4N5ED 4NCDA 4UTBH 3RL1B 4OKVB 5F1OB 5TPWH 4L4TE 3O6KH 4ELMB 2WN3A 4MD5A 4YXHL 3L7FB 5SWZE 3Q6GL 2WWMD 1X5MA 5DHXB 3CFUA 4EMZA 3LH2L 4WFFE 1CG9B 2N0KA 3EO9L 2IO5A 3NCEB 3DHUA 4JN1H 4MZIA 3E1ZA 2ENSA 1A7BA 1DUYA 4XVUD 1KEGL 5CP7A 1P4LB 2CA3A 2CRMA 1R33A 2PCPB 3WJMB 3SPVB 4BFNA 1MHPH 5T1DL 3K2MC 5ACMA 3BWUC 3IDIA 5GRXG 2AEOA 4OZFA 5JYLA 2ZOWA 2TRHA 4FG0A 4JO2L 1NLDH 2P48B 3QIWB 4UQDA 4JPSA 2EDMA 3QZOA 1QATA 1LO2L 2QHRL 5T1MA 4DNLA 2J8OA 4GSUA 1L4IA 4UTBL 3VI3E 5TPWL 5J6GA 3BO8A 1A6TA 3ELAT 3IS0X 3KLHC 1WFOA 4UNVA 3O6KL 3HFMH 2KLTA 3DWTA 2FEEL 6TAAA 2C7UB 1ZSHA 3FQYA 4YDZA 5I16B 3ZSTA 3V8OA 4KC3B 5HP5A 1VCAA 4F20A 1CFQA 2V7NB 1CFNA 4JN1L 1OPOA 2BHFA 3JV4B 5JPNB 1QAWA 3P3RA 3T09A 3PABB 3QFDB 5AYUH 2M26A 2VYRE 1AIFB 1EK3A 3T6ZA 1MHPL 4YO0A 2EYSB 1HQ4A 1K72A 4BCZA 3HC4H 1IE4A 2VR3A 4YSOA 3KYOB 3RWGA 4LGPB 1NLDL 2DWEA 2X4SB 1KTLB 4TTGA 1XV8A 3H6JA 2TAAA 3MI6A 3I84A 3WNJA 4P4RB 2H2SC 5C0ND 3N06B 3MYJB 3TBYA 2J1KA 5TF0A 1WITA 3FRPG 3U4BH 1AOHA 3HFML 3T3PF 1OB0A 4MBOA 1WGVA 1BF5A 3BWZA 4X7SH 5HHOE 2XJKA 2X4TB 2L7UA 3H6AA 5C0IA 3DJRA 4XVTH 5D72H 5AKTA 5DJ8A 1JV2B 4D9LH 1EJOH 4L3CA 2DAVA 3ABKB 4MNHA 1FRGH 4KXZH 3MMEA 4NO5A 3QDGB 3IDJA 3BDBA 1W6LA 5AYUL 8CGTA 2P8LB 2WNXA 2BNRA 1X7TA 4LBEB 5DGRA 3HC4L 4JFWA 4RFNB 5PAZA 1O75A 3D85D 1BVNT 5T33H 1AZZC 2LTQC 4WW1A 5E51A 2DWXA 2J88H 4KHXH 4XT1C 3H3KA 3PQYD 1FNEA 4HWUA 4PJGB 5SX4I 5A43C 3O41B 3B3IB 3K2UH 1PLAA 3E6HB 4WNQB 4BQ8A 2E9JA 5HY9A 1X3DA 1N2RB 3U4BL 2RTTA 4QRTA 1I3RB 4Y1TA 3ARGD 4HUCA 2L4OA 1KMGA 4X7SL 1PQZB 5LG1A 1AGDA 4XVTL 5D72L 1TQCC 4D9LL 1EJOL 4FYQA 1AKJA 5C0GA 1FRGL 5D2NC 3QHFH 2BVPB 5FDWA 1DQQA 1QPKA 3LKSA 4EI5D 3GLZA 4IS6B 4W1TA 4DO5A 1KXVC 2O30A 1ACYH 4PJXE 4DQAA 2I32A 2GBVA 1MCNA 4OGQC 4WO4A 4JRXB 2LU5A 2WQRA 2I9TB 5T33L 5E8OA 4CAGA 2EDFA 3B9KA 2J88L 4KHXL 3B2UC 4Y2DD 3WO3B 4DSYA 2IPKA 4JHAH 2QSVA 5FO8A 3K2UL 5I5IA 2XG5A 3M46A 1PZ3A 3O0LA 4WIQA 5TDNB 4XGZA 1QG3A 2OMXB 2ZT9C 2G2NA 3NJGA 1BJ8A 4HAKA 4WEEA 4C56E 4J4PC 4ZO9A 2UYLB 4HUVB 1JPGA 1T0OA 3ZE0E 3MR9B 1TITA 4MB5A 2QPDB 4BSVB 3QH3A 2V5TA 2RA1A 4ABQA 1R3KA 1SJXA 3RZCC 4X99B 1A5FH 3QHFL 3WENA 4QWWD 1BQHA 1I7TA 1DQVA 3G5ZA 4KKQA 5FFLA 4ZAKD 1ACYL 4ENEC 1K3IA 2V17H 2X6AA 4MD4B 3MRBA 2JJTA 1LE9B 1TVDA 3GI8H 2ZXAA 5CS7A 5I6MA 4N2CA 2R56H 2BVQB 4WEBH 1E2ZA 2XHNA 2X4QA 1QRNA 3E6FB 1GHFH 4JHAL 4LPVA 1W0YT 3GHPA 4KK5D 5HGAB 5DLLA 2HVKA 3VCLB 4AQAA 1HDMB 1OLZA 4L1BA 1OCRB 2GUOB 4NRXA 4J8RA 2VN5A 1LO5A 4P2OA 5AOLA 1CD1B 1K4DB 1SHXA 3KEHA 3QEQB 3UDWC 4A04A 3IDNA 3N55A 3L5JA 1OTUC 4X4YA 3EHBD 4Q9RH 4PCYA 5AYTA 4G43B 3GZOA 4R7DB 1OP3K 1AHWA 1K2DA 3L4XA 4OZFG 3TO4A 2VUOA 3I6GB 4TNWK 1HZHH 1PNDA 4IOIB 4K2UH 3STBA 4NUGH 4OIIH 2V17L 1VEOA 2GVYA 4ATTA 2GAZB 2AABH 1U8OA 2EDWA 4JKPH 3VFTB 4GFXA 4LESA 1S7RA 5L4FA 2R56L 2OMZA 4WEBL 3TS8A 1GHFL 1IGCH 4AMXA 3DV4B 2CJSA 3D3VD 3CHPA 1XXDC 2QPEB 1EFQA 3D4GA 1I1YA 3ARWA 2Z7ZA 4EOWH 2G3ZA 1N59A 4URKA 2COQA 2MKLC 3QUMB 4XNBA 5AALA 1DBJH 3Q7JA 1JMZA 4XRCA 3DYPA 3WMQA 2P7TB 4Q9RL 1LMKA 1KCBA 4QDGA 2D9CA 1PMYA 1BXXA 4NQCB 5TGBA 3OJDB 1L3WA 2HG5B 1HZHL 1IGYB 3CPUA 3DETD 4K2UL 4JFYA 3A67H 4NUGL 4GW1B 5LQBH 3S98A 4U2ZA 2AABL 2AJZB 2A77H 4H25A 4JN2A 4JKPL 4XHJD 4XPFH 2HUHA 3IEAA 1T03H 4NCC1 4JFDB 4JREC 1JERA 4K3DH 2HRPH 1IGCL 4PRHA 3B9EA 3BGMA 2WBWB 1MH5A 5E5LA 5F7EH 3D9AH 4PP1D 5BQDA 4ODXB 1XR8A 4P57A 2IANE 3ECBB 4EOWL 2OMUA 5D1XD 3ZUNC 4WWPA 4IRSD 1XCQB 4CU7A 1DBJL 3QDHA 2BCKA 3L17A 4WI0A 4XVSH 2HP4A 3BT0A 4P46A 2JKSA 5KOVC 1KTBA 1MW0A 1A1OB 4DH2A 1OCZB 3UP1A 3ATFA 3A67L 1ZT1B 5JXEA 3IFLH 5LQBL 1L5GA 1SLXA 1M9SA 1T1ZB 5FHBH 2A77L 2X0WA 4XPFL 5AFAA 1T03L 5F1NA 3W37A 4K3DL 2HRPL 1ZTMA 4YNYB 4NQEA 4JJOA 5F7EL 3D9AL 5IJKA 4ZXBA 2X7LB 4LSVH 4CW1A 4WNSA 5C0JB 1LYQA 2WOBA 2XV6B 3GJEA 3SGDI 3II3A 1NDMB 2WO4A 2X5PA 3APMA 1LWJA 3HHSA 4XVSL 4HPHA 5I23A 5CCHE 1MW2A 3CBJB 3DDGA 3SPGA 1Z9SA 3B6SB 4DESA 1A02N 1IGTA 3ZZSA 3GBMH 2WKOA 1SMAA 3L08A 4PRIA 1OOWA 3GSWB 3IFLL 5EIQA 3GSQB 2WLNA 5FHBL 3GZQA 4W4NA 3LZNA 1HXKA 3P3YA 3RWEB 2BNQD 1CGSH 2P80D 5GJSH 2X40A 4KDTA 2WLZA 4PRBA 2DQFA 2DWYA 1D7CA 2FEDD 3KYNA 4LSVL 5E0QA 4ZX5A 4UV7H 4MCZA 2Z35B 1D5RA 1FIGH 2GBAA 1BQHG 3GSXB 1SEBB 4QYAA 2A0LC 4D0DB 5EZPA 4UNTA 2FJUB 5I2IA 5K9OA 2ICWA 4KX7A 5DMYA 3AITA 3CVIH 1ROCA 4XP9H 1G7PA 4YSDA 2NX5D 1YEHH 3ABGA 3LZLA 1U95A 4K3JH 3GBML 3EOTH 2NY4B 2H8PB 4LASH 4P23B 1LP9B 4LGSB 5C08A 3MACH 4FTVE 3WE6B 2ZWNA 1CGYA 43CAA 3VI4A 3CN0A 3L9EA 3E3QE 1J88A 3FB5B 3FUFA 1AGCA 4PJCB 1CGSL 4FNRA 1XF4A 3VXOA 3ZHLA 1D5ZA 5JNYB 1F6LL 3LN5B 4UV7L 3QBTB 3K71A 3MRHB 4IK6A 4HQQH 4W9ZA 5DUBA 5C3IA 1FIGL 4LNVA 3MV8B 2LE9A 1XF3A 1AY1H 2P5EE 3WKMH 1R1CA 5E56A 4YXKH 4J7RA 2BWQA 4P2RD 1TFHA 4ZSOB 5HXMA 5J9PA 1S5HB 1V27A 3CVIL 4PJIA 3DXAE 4YFLI 2ZUQC 4XP9L 1BMGA 5C0FA 5CFAA 2MMXA 1ZIBA 1YEHL 3JWNE 4K3JL 5FO2A 3EOTL 4FXKC 5C2BL 4I9WD 2DYSB 3MGAA 3S96B 1ITCA 5I6NA 4JFFD 3MRDA 4LASL 4UNUA 3FU3A 1PAMA 3MACL 5C09D 5TQ0H 4O02B 3H7BA 3LNDA 3OWRA 2X4PB 3ZX1A 5C0CA 3PGDB 1ZGLB 2OXHA 5F3HA 3SDXA 4MDIB 2LU7A 1QFUH 2P3YA 2QMJA 4XMPH 5D7LE 5ICYB 3HZVA 1MWAA 3JUZA 4HQQL 4K8RC 3WUWB 1BSIA 1GZHA 2LQRA 2XWZA 3F7QA 5ENWA 2Z34A 3ZRCC 1AY1L 3PWPA 3WKML 4YXKL 3ZHDA 4FRWA 1BWWA 5F7MC 5HDLA 2VLRE 4XBPA 3MRLB 4CGUB 1MW3A 3IGFA 2WLHA 1D9KC 2R69A 5DVNA 1WQVT 4E9SA 1E9OA 3JV5A 2VXUH 2C9RA 2VMJA 1MEXH 3HKZA 1Z32X 4LOUC 3UJIH 4DP5X 2EILB 3QYCA 3WN5B 4TPRH 3WCYA 3DIVA 3JT0A 2VLME 5TQ0L 3QUZD 2IMNA 5E8PA 4NP4H 5E23A 3MUGB 2Z8SA 5C97A 4GKZA 1CFMA 4FNSA 1FORH 1IEAB 5HGDB 3TCLA 2FR4A 2ZOUA 3VQLA 1QFUL 3JTSB 4XMPL 4AQEB 1BG1A 1TJXA 1TTCA 2ZWYA 2BVUA 4MDRA 5GSRA 1R5VA 5HYJE 3ZIMA 1B0RA 1T1YB 1LE5B 3SDYH 2FJHA 4M8VA 1YEJH 2GTWB 1W80A 4L1SA 1NSNH 5DZVA 1RU9H 4PREA 3UC0H 1GZPA 4NI3A 3QUYD 2VXUL 1O7SA 4XAKE 3E8VA 1TZIB 2COVD 1MEXL 4Z7QE 3UJIL 1O7DC 3QUXA 2C3VA 3BSHA 4TPRL 4B3EA 4FCHA 5F9WB 5LBSH 3GS0A 4NP4L 4FQLH 1S9VA 3MA7A 4JFOA 1PZSA 3HAEB 4L4TA 1FORL 2YD3A 3F7PC 4IYKA 3BQUA 3EGSA 2IPUK 2Z6FA 5SWZA 25C8H 5F3BA 1I8LC 1A7OH 1BZ9B 2BSRA 4XPGH 1YCSA 3C5ZA 4ZJ9A 3D0AA 3W11D 5FYJE 4AGMA 1WTGT 2DKMA 3TF7C 2HFFA 3UTOA 2VSCA 1GXEA 3T4AB 3VVWA 5ID1A 2B1OA 3GUTB 2GJZA 3HKFA 5CIPH 2CCLA 4QNPE 3SDYL 3N44B 1YEJL 3V8CA 1NSNL 1F1DA 4Y5XA 1RU9L 1S7SA 1Z66A 3OG4B 3UC0L 3GMPA 4DK3A 5JW5B 2WVUA 1SOKA 3BUBA 4Q2ZB 1QHQA 2H9GB 4IRJA 2VLKD 4HT1H 5LDSA 5LBSL 3D2UD 3AY2A 3ZE2E 3ASWA 2DLIA 4FQLL 3G5VB 1N19A 2IH1B 3VI3A 1YMME 3FSZA 2VZVA 2VLKB 1C5CH 2GSIB 2OJEA 4D9QE 4ECNA 4NGHH 25C8L 4HCRH 4XPGL 1A7OL 4ABWA 5CAYB 1J05B 1MRFH 4MZ2A 4DEUA 4AIEA 3GS7A 5GRJH 3QE5A 3V0WH 3NFNA 4OF8A 4NHCH 4ZS7H 3AUVA 4HJ0D 3QDAA 3FC8A 2X4OA 5I1AA 3UPAA 1PNCA 2BVOA 2K0RA 3ABMB 4JMNA 4PJDE 3SYPA 5I8EA 5KJ7E 4ZTEA 2WKOF 3M17B 1ADQA 4IGBA 3VFOA 4EI6A 4LSQH 5A6MA 3PV7A 4HT1L 5JDJA 5IUSA 2IBZX 3QR0A 1L3NA 2O6EA 4G6FD 2YD4A 3FQNA 2YD5A 4NIYE 5BJTB 2DWDA 4Y7OC 3UTQA 5IK3A 1AZBA 3HN8A 1C5CL 1ORSA 2H3NA 3EGDA 4HCRL 4NGHL 5HDQH 2W0FA 4YHPB 5HHOA 3UTSD 1MRFL 5GRJL 3PXLA 3A23A 5EC2B 3V0WL 4PTUB 3MRMA 3BVNB 1ETZB 4R8WH 3RDTD 3K6SA 4JFQA 4NHCL 4ZS7L 1A6VH 2Z91A 3X12B 3NCYS 2D8KA 3QDJE 1BV8A 3G6DH 4HAFA 2XN0A 2WC7A 3HZKA 2MKWA 3IGAA 4N2MA 5C6TH 4ZO6A 1I7UB 4ZW3A 1BLNB 4AVIA 4ZFOA 1FFRA 4MSWA 1TZHA 1U3HA 4LSQL 3TEXA 1DSFH 1KYFA 1XCTA 4KKAC 5EUKB 3VI4F 4LO9A 1RHHB 1GZQA 4NZRH 2PETA 3BUYA 2QLVB 2XN9A 3FW6A 5GS2H 4DERA 2XWEA 3MRGB 5DHVH 5HVFB 2YQBA 5C9KA 1Y07A 4R3SA 5ECJE 1AP2B 2VITB 4E42A 4JHBA 2A9CA 5HDQL 3UTTE 3SO3B 1KLFA 2DB8A 3EO0A 4Y5VC 4AYFA 5T3XH 1G1OA 1DEDA 5AW6B 2NLJB 3C60D 4FL4C 4R8WL 1H6UA 4B27A 1A6VL 1LO4H 5T1LD 1ZA6B 2I07B 4QHLA 4PJIF 5DQJA 3RGVD 4XB7A 3G6DL 2DWSA 1U8LB 4W68A 2MCPH 2J4WH 3GPSA 1ZK5A 4PJXA 1G7MA 5C6TL 4Y4KC 4QOKB 5GGUB 2Q87A 3EAKA 1TO5A 3NEOA 4XO5A 2VDMB 1JHLH 5DS2A 3TIDA 3F83A 4NBZB 1DE4A 1DSFL 4IKNA 4Z7OE 2BWDA 2FSDA 4NZRL 1NOLA 1JTTA 3MVSA 4I87A 3JTTA 3CH1B 2DQDH 3LHAA 3OLIA 5FYLE 4XN7A 3SDXF 3UAJA 2IF7A 4I3GA 2EVHA 4YZFE 1L9RA 1V3JA 3U1QA 4C56A 4MS8D 2HCZX 2J55A 5BVJA 1CGXA 3ARQA 1P7QB 3GXMA 5CP3A 1B0GA 5T3XL 3KLDA 4X98B 3FU8A 1CU4H 2B15A 4NRZB 1LO3H 1LO4L 1P5UB 2DJUA 1PIGA 1XD1A 3FQRA 3MRFB 5EH1A 3WV0A 3T3MB 3PNWA 4F1ZA 5DC2A 2WINA 2MCPL 2J4WL 2CHWA 2WP3O 4B5EA 1UB5A 5L2JB 3EJYC 5LCVA 2RHEA 2CO7B 3LNGA 2Y7LA 1JHLL 4UDTB 2J2ZA 1XO8A 3FUDA 2VQTA 3C8HA 5BW7C 3SYCA 1LO0H 5E7FA 5L8KB 4OI9A 4G8EA 1UOLA 4K15A 2DQDL 5D7IE 4DP9X 4CSPA 1IZKA 4N4YB 3NPZB 3BOVA 5EOCJ 3IU4H 4LCIH 3PIQB 4MQ7A 4RFEA 3TA3C 3KPQA 2QZQA 4HSAC 5D5ME 1CU4L 1LO3L 4Y2NA 2YD2A 4YK4C 1JGEA 4R96A 3KBFA 1L6PA 4NOFA 4YSPA 3NJMA 5FKAA 3HNTH 1MJJB 5F0LB 2WLJA 2IXQA 4B50A 3BDXA 3IS1X 4GP4B 3U9WA 5F9JA 4EN2A 2W38A 2G30A 4EAEA 3L5WB 2ICWJ 4OCSH 1LO0L 2X2UA 4HK3N 2BSSB 2X89A 3D18A 1S7XA 2BMKA 3KPOA 3PJLA 1XIWC 4M8UA 3HMXA 2ZNWA 1KBGH 2KBGA 5EV7A 1OD7A 1ZHBB 3NZHH 1FC2D 2FJFA 4A7SA 5TH2B 4AV0A 4NQTA 3IU4L 3RWHA 4LCIL 3TN0D 4GW5A 1C08B 4JQXC 2VABB 3TBVA 4PRAB 3AREB 1E7UA 1BZQK 1N67A 1WHPA 2X6BA 3EDFA 4ENZA 2BP0B 1G4RA 2FLRT 2XA3A 35C8H 3ILPB 4M56A 3HNTL 5IQ9A 4ZDHA 5KVEH 3UAEA 3PHOA 4PJEE 5KWYC 5EZJA 1GY2A 3VRLE 4WTZA 3Q5YA 3K5RA 1DANU 3QJFA 4OCSL 2KLRA 5HYSB 5JDSA 2OYLA 1CICC 1CVRA 3N0PB 5K5YA 1IBFA 3VI3F 1M4KA 2VDKH 4XO8A 3CFBA 1HQ4B 1KBGL 4GUPA 4WSGA 2NUPB 2IANA 3HFFA 1IKOP 2GHZA 4AIXA 3NZHL 2DWEB 1DO6A 2JCWA 5HI3C 3VJ6A 2X9YA 3VSVA 3OHMB 2X2IA 3ZYJA 4NUPA 3QPQC 4C4BA 7PCYA 3SZKC 2VLLB 3RAJH 4GRMA 3KYMA 4K7PX 5JPMB 1QSEE 2Z1KA 1TLKA 3CK0H 1QUNB 4I89A 3GBDA 35C8L 1J9QA 2HT2D 5KVEL 5JOFB 2LLGA 5SWSE 4MNHB 1NC2D 3OB0H 2V3DA 1AGEB 4JDZB 4RA0C 4H0LC 3GB7A 5GGVY 2XWCA 2I69A 3KZ8A 2VDKL 3N43F 1N5AA 4O2CB 1NC2B 1PEWA 4B0MM 4A7VA 4XNDA 4NAJA 1M1XA 3L5IA 3QRLA 2QMKA 2ZAHA 5BRQA 4WU7A 3U0PA 3I3BA 4ZUTA 2J57A 1WCQA 1JF6A 5C0EA 1MCPH 1CN4A 3RAJL 4M3JA 3HBZA 1K8IB 2W88A 2X4NA 4QUOA 5IBLD 1QO3B 3CK0L 3DX7B 2HX8A 4TQPA 5I19H 3F8UB 3RDJA 4IOFD 4KGJA 1JPST 4PRPD 1FYTA 3QORD 1H0DB 4HIPA 3D0VA 1WFMA 3QR1A 5B22A 2CLZB 3UBXB 6PAZA 4L0YA 3TIEA 2BSBA 2O5XL 1BX2B 2GJ6D 1CD9B 5LVEA 1HQRA 5JOEA 4L8BA 1MFVA 4CMMB 2H32A 1F13A 3LZRA 3NPSC 5JLZA 3PWLB 5IW1A 1RZIA 2XTLA 2FATH 3MV7B 1KCVH 4HXAH 3V95A 2FBRA 4LAJH 3ZYZA 4AEHH 1T7VA 4LOFA 3CFMA 3CC5B 1MCPL 3SOBH 3QHZH 5G5DA 2CJ3A 2I60H 2BOCB 3WKNA 5I19L 1HWGB 1JPGB 2W81C 2Z31B 2CGYA 1OK0A 4TNWF 2EDTA 4UM8B 2BS9A 1L7IH 2Y4SA 3PL6C 4FTVA 4KNSA 1IBZA 5EN2A 1EVTC 2BIIA 4QLRA 3WUZA 1ZHNB 1OM9A 3GBNH 4LHUA 2GFBA 3IAGC 3L16A 3QDMD 4Y2OA 1UOKA 3K2KA 2GIMA 5FW6A 3ARZA 3FT0A 4PR5A 4AITA 3LTVA 3ZE0F 3QEUA 1QA9A 2X4QB 1QRNB 4Z23A 1JZ4A 2CE6A 2FATL 5AAMC 1KCVL 2F74A 4HXAL 2F5BH 1WWWX 2P5EA 5B7FA 5GZOC 4RIRA 4AEHL 3MJ9H 5IKCA 3QIWC 4FERA 2H7WA 1T1XA 3QHZL 4N8UA 3SOBL 2GITB 3DXAA 2I60L 2AJ3B 4YDJA 4J28A 5DURB 5K9QG 3O2DA 1IC4H 3JYBA 2UVFA 3ROLB 4ZUSA 2R83A 1YHPA 2LGNA 2A99A 2E76C 1XGQB 1PW3A 4UQ2B 1L7IL 5F6IC 4LLDB 3CSGA 4UU9A 3GBNL 5E5MA 3L3KB 1AGBB 4PD4K 2GK0A 5DEFB 3X1FA 1UC6A 1IKNA 3BUTA 2SEBA 3QI9B 4B53A 3QIBD 2AKRA 3I3DA 3CE1A 4OAWB 4B60A 1K4CA 5JPNC 1AS8A 5D7LA 3FQUB 1KCRH 1S9XB 5KYXB 5E1AA 2M83A 3O6FA 5ID0A 2EH7H 4GQQA 2F5BL 4XCEA 4JGNA 1QBBA 4OUUA 3MJ9L 1WE5A 2VLRA 2DQCH 4Y1AD 4HCGA 4PJ9D 2DYPA 4N87A 5L2KB 3D0LB 3QG6A 3EFFB 4XMWA 2WVVA 1ASOA 4PCTA 5B3JF 4H20H 1LEIA 1GS7A 5C0BD 3FSOA 3OSVA 4MLSA 4NO2A 5CEXB 4WTZG 1EAPB 1IC4L 1Y1DA 2IALA 3SE6A 2ZG1A 5E5RB 3N42F 3HJ0A 4L1TA 3OAZK 5D96B 3SDDD 3O8XA 2B4CC 3GXIA 1ZCRA 3NSDA 1KPRA 1NGYA 1SGKA 4JPWH 5C0BB 3P0GB 3D5OF 2VE6A 3WXWH 1BEYH 2FTAA 1TOXA 3FTVA 3KE0A 3SDDB 1G7LA 1NH6A 2W92A 3GSVB 2YPKA 4TSBH 2HG0A 1N12A 3V6FA 5HHNA 2B20A 4EZJA 3AABA 1KCRL 5F21B 2CLVA 1SQMA 4UM9A 4F15B 3V4LA 4KO9A 4J12A 2O5NA 2EH7L 4XNYH 3RVWD 5GZNC 3L7EA 5DYOB 1EFXD 3X13B 5HYJA 2FK9A 3ALWA 4RFNC 2ORBH 2EE0A 2EDXA 2JK5B 1PCXA 2EDJA 3GFUA 4AEFA 4QD2E 1U6AH 3VD2A 3FU7A 3VFRA 4H20L 3ZXAC 2J8UE 5E6UB 2J6EA 3S8GB 2AK4B 4XN5A 5C8JB 2CO2A 4TOYH 3OGOE 4KDVA 4WI0B 1G7IB 3HE7D 3LRLA 1IJ9A 4L8DB 3O3UN 3GPEA 3SBWA 2AVGA 2YA0A 1T66C 3CFEA 4HUWA 4L4VB 4JPWL 5IZ7A 3EBIA 3PRZA 1RZJC 3WXWL 3BAWA 1BEYL 4ZPTA 4TSBL 5DD3H 4ZFFA 2BVEA 3FHEA 3II2A 3CG8A 4FFZA 3F12B 4GLRI 1MREH 2GG1A 4HIEB 4OLXH 2JIXA 2X88A 3RKDD 1RH8A 4XNYL 3SBPA 4W9FC 2HLEB 2CO6B 4LSDA 4NQEB 5DHYB 2ORBL 5I30H 1NJ9B 1L0YA 4G2AA 1HZKA 1U6AL 4X6CB 1ZLVK 1MCBA 3S97C 3MPCA 2PO6A 3L3OA 4NQSA 1M1SA 4XN2A 2HLAA 4TOYL 2Y6SD 32C2B 2Y7QA 5DVLA 3GC3A 3H0TB 4QAMB 1XTLA 4NSKA 3BEVB 5IVXB 1MI5E 4IIQA 2B4CH 2IQAB 3HG5A 3T1FB 4XNZB 1IAKA 4PWGA 1A4AA 1IB5A 3O4OB 1FV1B 4UNIA 5DD3L 2J21A 2X2HA 1E8XA 3IXAA 4FXGA 3KXFD 4AZUA 2E8YA 2EDEA 5E4AA 1MREL 1WPCA 3L4TA 2FJSA 4OLXL 3WY3A 3LS4H 3FU6A 4AJVA 5I1GL 1OK8A 3O4LE 3WY2A 1TZ8A 4PRBB 4FE9A 4KROD 2KZWA 2RCSH 4WHDA 5I30L 3KPPA 4AKOA 1AO7E 1SFDA 4PJDA 4M93C 1JWSA 2W60B 4APQA 3IJ8A 3DOHA 4BXVA 5IHLB 2Z7WA 1UWXK 1ZT4A 3KBEA 5EZIH 1H3PH 3FUNA 1R3LA 3EJSA 3K6OA 4KROB 1HSAA 3ZSSA 4KH9A 4CSZA 5K9KA 3MLSH 2OZ4A 1WIPA 3Q1SH 3H9SD 4KK8C 1CT8B 4LL4A 2O4EA 2B4CL 1I3UA 1W91A 4KMQA 3O45B 4ZYKB 4K23H 5ALCH 1ZXKA 4EZKA 1RZJH 1YMHB 3BW9A 2VJXA 4I48A 4HKXB 1OVZA 4OVUA 3H9SB 1FFOB 2NNAB 3NJJA 2EYTA 5FO9A 4JY4B 4ZS6D 5E5UB 3LS4L 1ROWA 4HHGA 1X7QA 2WWOA 2YMTA 4WFGE 4Y19B 1QSFD 4BEIA 4XOBA 4K7PH 4L37B 3JWNG 3VXOB 2AQ1A 2RCSL 3QDJA 4F7KA 1EJFA 5ESVB 4C4UA 1XHHA 5G4OA 3K71B 4YDVA 2XQBH 5BV7B 1VZGA 1EIBA 1DN0B 3NOIA 1E27B 2IDTA 3SPIA 3INUH 4NNPH 4WHYG 5EZIL 1H3PL 1Z6JT 4HPOH 1JFQH 2X44D 3BUQA 4K0OA 5E9DD 4DN4H 3MLSL 1OALA 4RX4D 5IQNA 3BVUA 1QZ1A 3Q1SL 1CFSA 1R75A 1WC7A 2GSMB 4I0KA 4L23A 4L5FH 3TP4A 2APTA 2E4FA 1MCKA 4AYMC 3APCA 5CEYA 4XPHH 4K23L 4KMLB 2IPUG 5ALCL 4NO3A 2M2DA 1HK6A 1RZJL 5E9DB 5L4JA 5EFIA 3QCUH 3DVGB 4PW4A 1KGIA 3UTTA 3ML9A 4JRYE 5EBLA 1BVLB 5IVNA 2ROXA 3KLAB 4AW7A 2GB2A 3WFHB 2I27N 4KX8A 4KQ3H 5BZWB 4K7PL 1DZBA 3RUGB 1I7RB 4U6HA 5GGRY 4L3EB 1A6ZB 4MRBA 3RPKA 5T3ZD 5IIEA 1N0LB 3ASOB 5TQ2H 3K46A 2BOBB 2XQBL 3TCTA 1PEZA 2B0SH 1UZ8A 3VFVA 2HTKC 1DJXA 3INUL 2QTVA 4NNPL 5EC1B 2EDLA 4HPOL 1JFQL 4ZMXA 1PG7H 4DN4L 2XQ0A 4BA0A 2G0LA 4P2YA 1XGUB 3I02B 3ZT5A 4L5FL 2UZYB 4XPHL 4FHKA 1JYXA 4G9FE 2LW3A 4AL8C 5IR1B 5C0DB 4EN3D 3QCUL 3PPSA 4IIZA 1QPPA 4EO5A 2WBXA 3MBXH 5E8PB 5AOIA 2JXMA 3ZBMA 1SOQA 3K8LA 4N68A 2ZAGA 1YYCA 1SN2A 3V5KB 4KQ3L 2JF1A 2WKLA 4OD2A 2HN7B 2R2HB 2VUYA 4X4ME 3OC5A 4LZKA 5DHDA 2LVEA 2P47B 4JHVA 1GYWA 5TQ2L 1ZLSH 1YYLH 3BP7A 5ESAB 1RPUA 4QHKI 2WNWA 2B0SL 3B43A 5EEWA 2EUZA 1R5VB 2XWJA 4LHQB 1FNFA 1QEWB 3MC0A 3G6JE 3FQTB 2LHAA 3DROB 1PG7L 4HUUA 1L9MA 2K6ZA 3QG7H 2X4UA 1VACA 5JHBA 4KKLC 4Y4FB 1WGOA 5E1QA 1ZPUA 3F7LA 5D7IA 3QUMH 2F58H 2WUCH 3ILDA 1R24B 2VRQA 1X5GA 4PWKA 5CKAA 2JKXA 1GS8A 1MIMH 2DBJA 3COOA 3EIFA 5FKPB 4YSSA 3MBXL 4AMKH 2XPGB 2R2EA 1S9VB 1YYML 3MA7B 3Q0HA 5D5MA 5DD1H 2F08A 3GO1H 4AE1A 5IFJA 4BKLB 2QADB 3E9TA 1NBYB 3ALPA 3X1EA 3CUPA 1YECH 3CDGB 5DHEA 4Q97A 5F3BB 1SBSH 1ZLSL 4EVNB 1YYLL 3RPIA 4AGLA 2DL2A 4Z7QF 1A8JH 2B77A 2DDQH 1JTPA 2XY1A 1EZVX 3FT2B 4JX0A 4DGUA 2EUWA 4MJJA 2D3JA 1IL1B 3QG7L 1X4XA 3GMLA 2E4TA 3EYQC 5CBAB 5HHMB 4E41E 1R3JA 4F24A 1MCHA 3QUML 5EU4A 2F58L 2WUCL 4XI5D 5D2NE 4X8CA 1MIML 3LKQA 5ACZA 4RNRB 4KJYA 1KN4H 2YD7A 2E27H 4AMKL 4AL8H 3TO2B 5DD1L 4QNPF 4KJPC 3GO1L 2NY4C 4X8XA 4XXDA 1H9VA 4P5MA 3PWNB 5IJVB 4P23C 1YECL 2H45A 1SBSL 4UIMB 1J8HB 2GCYB 5AAWC 4PJBF 1OGTB 3HG1E 3ISRA 2G2RA 2DDQL 3IDMB 3O2VH 1R47A 4PJEA 1E4XI 1USZA 2EIZB 4B9GA 4YSQA 3PS6A 1OW0C 3ZE2F 2GIYA 3VE0B 3DBSA 1BDYA 3NCBB 4H8WC 2PW2A 2AJYH 4B0MB 4LCWB 4FJZA 4XC3H 3S3CB 3I75B 4PIBA 3SPCA 1M56B 5JW4N 3TFKC 3W5MA 2XKSA 1KN4L 3VWJA 4MA8H 2E27L 4AL8L 1TKWB 2JLLA 2PTTB 1MCCA 1UASA 4H26B 3VD3A 3VA2C 4QKTA 5DU7A 2P4AB 4XOCA 3DGDA 3LVEA 5DJAA 2AVFA 4MJIB 4JDEA 1M2VB 4R5XA 1QSEA 4PJDF 1LNUA 1OGAD 1TTGA 4UZSA 3RQ3A 1XZ0A 3RFZB 1BVKA 4QGYA 5F97E 1F6AB 3O2VL 5CGMA 2R9HC 5SWSA 5DQ9B 5IQLA 3AQDA 1OGAB 1EO7A 4OGZA 4TUUA 2OSYA 5EOTA 1BJ1H 2IBBA 4FNUA 1P7KA 5F8QC 2AJYL 1A4CA 1H6EA 1TENA 1UADC 1IC0A 2RQEA 2VMEA 3E0GA 4XC3L 1UM4H 4P06A 4QJ4B 1N68A 1CL7I 4LQ1A 4NQVB 2AP2A 2AV1B 2FT7A 4MA8L 1JDAA 2F5AH 4AIZA 1VIWA 1D5XA 1T80A 3TF4A 4WKXA 1S7UA 3NN8A 1F2XK 3DLQR 3G5WA 5KSAB 4WI8A 1IBHA 4JZJB 1A7NH 3Q1EA 4GRWF 3ECQA 1X5YA 1DVXA 2YGNA 1UACH 3ECUA 1V05A 3BFOA 4XZUB 1ACZA 2PXYD 1DR9A 2AK1H 5T5NG 1L6ZA 4NDMA 2A83A 4MVBC 4TKWA 2ZWKA 5C1MB 5HYQB 4YDKH 2NUTB 1MOEA 5AL8A 4PJXB 2A9DA 3CHOA 4FG4A 4H8WH 1CXFA 1ORQB 5I6OA 1UM4L 4E9QA 2XTJB 1IEHA 3C5JA 3VRIA 3TV3H 3SE4A 2C3GA 2F5AL 3SYAA 4XNMA 1Z2KA 1GYUA 5CN3A 5CJQH 3G04B 1M71B 2WHVA 3BUDA 3MBED 3VFUA 5F9WC 2G5BA 3QFJD 1BF2A 2ADJB 1MLBA 1PFCA 2MJWA 5EF2A 1A7NL 5CZKA 4ORZC 1UACL 4O02H 4YHOH 5L4IA 1E8WA 4AEEA 2AK1L 3DRQA 4FFYH 5D93B 4D0CA 4DKEH 5E8EA 3HZYB 5F93C 3OQRA 4HOZA 4Z7OF 1ID2A 1Q94B 1I1AD 1UD4A 2IG2H 4W6XB 4YDKL 3W56A 3WDIA 3V4PB 4WZ9A 3T4AC 4HJSA 4JKWA 4DKTA 4H8WL 4E0RB 3MREA 5CR8A 4YZFF 3VMPA 4UYQA 2CKNA 4Z1PA 2CDEB 3TV3L 5DK2A 3OX8A 3ULUC 1KDJA 2Q76A 2RQ8A 3WIHA 3OKOB 5K59E 5CJQL 2F9BT 2PPEA 5HDBB 3GSRA 4FFVC 2NXYC 2IWEA 4QHMA 1UTDA 2DD8H 2XKNB 3FTWA 5DMKB 4WFHD 4OFQA 3S3BB 1LK2A 3MNZB 5IEKA 4MAYD 4O02L 2EIBA 4YHOL 1F3JB 3B34A 4Y9EA 5F89A 4FFYL 1A7PL 3UXFA 1EO8H 4DKEL 3AT8A 5T1KB 4BQ9A 4QRPE 2D31A 3LNHA 1DHKA 4R96B 1PX4A 2IG2L 3R8QA 1ZWIA 1NIDA 5D7IF 3VXRD 1XF1A 1W0WB 2IXQB 3ZDYE 2EDKA 3U1SH 4CN6A 3C6SB 5AOJA 5F9JB 2NZIA 1R3IH 2Y36H 2P24A 3CU1A 1TT6A 1TQVA 4P5TD 2ZXDA 2AQNA 1XR9A 1KIRA 1OF2A 3IBOA 4NFCA 5D5MF 5EBWB 5F9DC 5AD0A 4KTDH 3WLWD 4KK9C 3R06A 4NZDA 5JOPE 3HPJB 3PV6A 4Z76A 2ICEA 3QWRA 1TQBB 2NY1D 1NCHA 3WNKA 5ACLA 2R29A 4NQDD 2VM9A 3C6LB 2DD8L 3RWHB 3DPBA 3IB4A 2VL5A 1HIMH 2ZSVB 4YSRA 3EOAA 3FONA 1ACCA 2X6MA 3FO9A 2NY1B 2WNKA 1EO8L 3UG5A 3HAEH 5BUGA 4HIIA 2R4SH 4NKMA 1ZV9A 2V2XA 4IDLA 4U6XA 5SX5H 4YSAA 4X0KA 2AJXH 5EZJB 3U1SL 3ZT6A 1H8OA 4NBYB 1NAMB 1R3IL 2Y36L 5CHNA 1CFVH 4WENB 3JWOC 5J5EA 4OZIB 3PWVB 4KTDL 1NFDB 3CFBB 3L3IA 3MCKB 2QDVA 2DJSA 3AY4C 2PW1B 2EE3A 1T2XA 3ULUH 2G9KA 5E8DH 2BJMH 2J8UA 5IG7B 1OSEA 1L0XA 1HIML 3CHXA 4H0GA 1FDLH 1EJ6A 4J3SA 4IBUA 3L6FB 3K81A 1Z9OA 2ITDB 4AQOA 2NZ9D 2R4SL 2DMBA 3MJ7B 3SO3C 5DJDB 1N4XH 3IXTB 3WKPA 1EMTH 5IBTH 2FHFA 4JRLA 1JXGA 1QFWM 3GZPA 4BWUA 5BZDB 2AJXL 1A4KB 3HG2A 3VXUB 4UUJB 3GMMA 5AW5B 4ZODA 1W72B 1CFVL 3ESVF 2V9TA 2E46A 4YHZH 2E7BA 4FG6C 1OM3H 1N5AB 4TUOB 3VWKB 2JQZA 4FYRA 4UTBA 2C4FT 3ULUL 1HXYA 1RD6A 5E8DL 1U21A 2BJML 4JM2F 1KOAA 5DEGB 5EULV 3MNWA 4TL5A 1PPIA 1YC8A 1RL1A 4BA8A 4Q89A 4WV1A 3B5GA 2Q86A 3PU7A 3U0PB 1FDLL 3IN2A 4YHIB 3UOAB 4CBPA 1NM9A 4OIBA 3WHXB 1NEPA 4YLCA 1I3GH 2B5IB 3LKNA 1T4KA 1ZT7A 1MI5A 4GJTB 3TZVA 4KRPB 1N4XL 2OLDA 2C1PB 4PRNA 4PLKD 1EMTL 1H3VA 2DN7A 4MX7A 1KJ2B 5IBTL 1MFDH 3WU1A 1P5UC 3O3AA 4RMVA 4GRLD 5JHDB 1XZWA 4AQ8C 4KO7A 2R51A 4KXDA 5E00B 2DKUA 1QSVA 3O4LA 5SWQA 3W82A 4YHZL 1JDCA 2YFNA 4M9PA 1OM3L 5C07E 3RIKA 1Y6KR 2VZUA 2W0PA 4ODWB 4O2FB 5DJ6B 2EZ0D 3JWOH 4FQXB 4WI7A 1AO7A 2EIEA 3Q13A 4L8BB 4ISVB 1CFTA 4Q58C 5CF3A 5K39B 1M7DA 5JLZB 5I76A 4XXWC 4M7JH 3R1GH 2O6CA 2WBJC 5KBKA 3GMRB 2Z65C 2ZE0A 1HHIB 4DETA 1I3GL 3FS9A 3WLBA 2QR0B 1AD9A 3FAXA 3WXVH 4G3YH 3ZTJH 5HDWA 4AQ1B 5HDOA 3TVMB 4F9PC 2GJRA 1S5IH 4N6RA 4WW2A 3IVKA 1MFDL 3ZKSD 4XCYB 3F7RA 3NIFE 5KJ4A 3ARBD 5GS0C 1OGPA 2GFBB 2VZ3A 1PU0A 1XGPB 2IAMA 4N5UA 3KGUA 5F7UA 4XN4A 2JMRA 4Y2OB 1GYCA 3MROB 3T4YA 3FN9A 1G43A 3KVPA 3JWOL 3KJ6H 4FCAA 4PR5B 2YMOA 2VDMH 3FF7A 1DFBH 4KKCD 1YEIH 2Y23A 5F7DA 3ZGIA 3MLPA 1JBJA 4QEGA 3AG2B 4M7JL 2A9NH 2EACA 3N41B 3R1GL 3SQBB 3VGAB 5DRWA 3HNSH 4N2KA 3IPBA 4LLMA 1T04B 2Q6WA 3WXVL 7TAAA 3DXAB 4G3YL 3P9MB 1HESA 5I8CA 1LDSA 2BINA 4I4WA 1O9VA 1S5IL 4NM4H 1HKLH 2YRPA 4K73A 3AREC 3ZDZE 2VMFA 1OEZW 3LH8A 1U93B 4LPUA 4W9DC 3ZR5A 4Q56A 4YFEA 5HSFA 2NR6C 4W9KC 4IKKA 3MX0B 4JRYA 2MNWA 5CD3A 4J3TA 3WD5H 5AKVA 3OKNA 1D5BA 3MRRB 2Z7YA 2FHBA 3U79A 5KOMC 2ETWA 5LXVA 3DMMA 4QRRE 2N7AA 3KJ6L 4NUJB 4HUKB 2BOLA 2Q8BH 2Y1AA 2VDML 4U33A 5I1LA 3US9A 2NY6D 1DFBL 1YEIL 5ID0B 3C8KA 2NY0B 2VKXA 3VXME 2L7EA 2A9NL 2CUIA 5FX3A 3HNSL 5ERWB 3FRUB 1RZGB 3KM2A 1DJWA 2JKLA 3FHAA 5T3XE 2ZXQA 3FFCD 5J12B 5INDA 5A2IH 1JTOA 1I8KB 3VQ1C 3VMOA 3UEZA 4G9FA 4JFEE 1HKLL 4NM4L 2FSEA 2IOMA 2XUWA 5CR1A 1NOAA 5D9SB 3WEMA 1Y0LA 5JPMC 4XMZA 1NGYB 4JFVA 3SE3C 4PGCB 2VDRH 3TT3H 3QA3A 1DVTA 3WD5L 4GAYA 5DXWA 4JFPB 1NMAH 3ARXA 5HHQB 3S2AA 3BD3A 4HKJA 5GS0H 3HZ3A 1CDYA 3QQ3B 4G5ZH 4OCLC 4X4MA 1D6EB 1U2CA 3SCMB 4OLZH 2Q8BL 3PWUA 4Z6AT 5D7HA 1K5WA 4F3FA 3OKEB 4WEMB 1I53A 4KZEH 3G6JA 3HR5A 3FQWA 3K7UA 4C4KO 4JE4B 3PUCA 4Y9CA 2XVGA 5EBGA 1MLCA 4DPRA 1VFOA 3VFWA 4F7CA 2X87A 3DGGB 2Y3AA 3L48A 3D30A 4DVBA 4ZQTA 5L0QB 4H8HA 1M3IA 1VJSA 2WSPA 4E9LA 3HVDA 3TT3L 4ODVH 3UTZB 3RJDA 1EGJH 3ULSA 1NMAL 4UV4H 4J3OD 2DI7A 2BO0A 5GS0L 4EJ1C 4QYOB 1T2JA 4G5ZL 4I13B 4TNEA 3OVUB 4OLZL 2DY2A 3LPPA 1KXTA 4DPAX 4HGWA 2OL3B 1QTYT 4HS3B 4KZEL 3A24A 2QVFB 4LFHG 3SDAD 1QR4A 1L9QA 3FAWA 3BVXA 5KN5B 2EVJA 2FECL 1HEZB 3HHMA 1AD0B 1V3LA 1WBZA 2J1ZA 4LEOA 4TVUA 1SJEA 3STZB 4E41A 1HWWA 5D2NA 4O51A 2A6DB 4AK2A 1MJUH 4MWFB 4QF1B 5DDHA 3BD5A 1UYWH 1AXTH 5IVZA 3UZVA 4ODVL 3BUPA 1DLHA 1EZSA 3QIUD 2Z31C 1EGJL 1YMMB 4UV4L 3ECVA 3HIZA 3W2DH 2DM7A 2XG4A 1Q9KA 1KBWA 2QKIB 4NYLB 1RJLA 3G9VA 3HG1A 3EGXA 3JV0A 4CMHB 2O61B 1DN2A 2J12B 3HI5H 1Q8MA 4HDIA 3I9IA 5HD8D 2DMCA 4MA3A 4N9OB 4LSSH 1ZVSA 4J4PA 3HCVA 5A6IA 1FLRH 3WJJC 1AH1A 3H7LA 3R7RA 1BFSA 5HPOA 1GCYA 4TVSa 3ZZ1A 1F5WA 1RJZB 4NXKA 2ZCZA 3BESR 1MJUL 4MJ5B 1WO2A 3M45A 2NQCA 5KVEE 1VFBB 1UYWL 3LAFA 2HTLD 1AXTL 1B4RA 1OAQH 5CFHA 1JGDB 1D5IH 1JI2A 4AKPA 2EC8A 3EH1A 4LPCA 2J44A 4X9BA 4NJ9H 5D4JA 4YXLH 3W2DL 1QLFB 1MAJA 1YPZE 3TO4C 1ESOA 4TLUA 1HILB 3QI9C 1UM5L 3O6MH 5L9DH 4G72B 3HI5L 3H2PA 4AY0A 1HS6A 3D50A 4J1UA 4LSSL 4OR1A 5FB8B 3QR2A 1WAEA 5IB4B 3VFNB 1FLRL 1GOGA 3VNYA 3OZ9H 2ZX7A 3UDWA 3WOVA 3GEFA 4YDVB 4FNLH 4WW2F 4RAHA 3EYFA 1N8ZB 1K6QH 3EDEA 1TZAA 2WMPB 4O58H 2APSA 3MV9D 2PCFB 5AVXB 3FTZA 1OAQL 4FNQA 4LGRB 1D5IL 4V1DD 2OP4H 4Q0XH 1AR2A 3OF6D 3LXUX 5D96C 4NJ9L 4YXLL 3MV9B 5M95B 5JMRA 1AAJA 4AVKA 3G08A 4UDUB 4V1DB 3KPRD 2R8SH 5L9DL 3O6ML 3NAAH 1GPOH 2JJUA 4OBSA 5JZ7C 3BMVA 2FIRT 5BMFH 2JKIS 3AU1B 3POCA 4F15C 3CSPA 5IJCC 3OZ9L 3TEYA 1ONQB 2EDBA 3KPRB 3NK3A 4ETYA 2Y22A 4ANXA 4IKLA 4JG9A 1D7FA 3IJHB 4UBDC 1ZA3A 4FNLL 4PJ7E 3X1BA 4PBWD 4DJMA 5FW7A 1K6QL 4C47A 4Z7UE 4J5VA 1G7JA 3LN4B 3RTQD 4G8GB 4O58L 3LEVH 4QTHB 2EDQA 1AQ8A 3BWUF 3QQ9C 4JQIH 1NFIA 3B1TA 3RL2B 2OP4L 3LRHA 1T7YA 4Q0XL 1HCZA 3TBSA 2R15A 5GS1B 4X80H 4YWGH 3P69A 4MNQB 5CGYD 1XSIA 3TPKA 2KI6A 3PDOA 1QWUA 3GIZH 4QRQA 3KWWA 3H9HA 2R8SL 1C12A 2Z93B 3DJTA 3NAAL 1AXIB 1GPOL 4M3HA 4K5MA 1E4JA 4Y5YB 2EVFA 4AYEC 5A16B 5BMFL 5DMGC 2BHZA 1G7QA 1ZLUH 5TDOA 1BFOA 1HH6A 1AZVA 4ODUA 3D69A 4R4NC 1PL3A 1U8HB 1KIUA 5GGRB 4PG2C 1JOIA 4RH4A 3OB0K 1OZTG 4ZXBC 4ADIA 5KG9B 3UCQA 3LEVL 4B9FA 1E5ZA 4DZBB 4BINA 4XE0A 1VACB 2J7LA 4JQIL 3PHQA 4PJ5B 4X6BB 3TYFA 2H3KA 1KPUA 5EUOF 3D07A 3ARSA 4DOHE 1EEYA 3PGCB 3V5HB 4X80L 4M5YH 4YWGL 4BZYA 1EZUA 4Z3HA 1VA9A 2BRQA 4P05A 1S7TA 3P9LB 4O2EA 5DRNA 3GIZL 1U8MA 3BH9A 4XNZC 3WTVA 1T2QH 5B39A 3O4OC 4OV5A 3G6JF 2F7RA 1QQDB 2R0WH 1NWPA 5ABDE 5D7JA 4QRPA 3KLQA 2NSXA 4ONGH 3AM8C 1I8IA 2JTYA 1HI6A 1GAFH 2V8LA 1HXMA 2P8PA 3RPIB 1THAA 4KDTC 3GRWA 1A4JB 1RSYA 4BHUA 1CC3A 1QBMH 3NSFA 4GMTH 5E6IA 4RVBA 4HWZB 4TXVB 4AV5A 3NJNA 1QRKA 4ZMTA 5IMKB 1I9JH 2J1YA 5DUPH 5LGKA 1SLVA 3BZEA 3U46B 3VX0A 1AXSB 5EU4B 3OKMB 3SKNB 2P43B 4M5YL 3MNMA 1EAOA 3CFKB 5D6DC 4GP8B 3JSSA 5IGXH 2ENPA 1DQMH 2ICWI 1T2QL 4X5XB 2R0WL 1ES0B 4MA1B 3QNZA 2DTSA 2NNCA 4X0NA 3HN3A 5FWQA 2I26N 2XICA 4ONGL 2AQRA 1SM3H 1C1EH 1GAFL 1SHMA 2HRGA 1RK0B 3UADA 4PUBH 3EADA 1XQ4A 2PR4H 1EVUA 4PJEB 3AT0A 3GDBA 4KY1H 1QBML 5K69A 4GMTL 4V33A 2ODIA 3PREA 1NBZB 3KCPA 5BV7C 1I9JL 5DUPL 3DPDA 3Q8FA 3F7YA 1G87A 2ITCA 1HYSC 2CHZA 4ELME 2YGVA 2R1XB 3CVBA 5FEBA 4PV8A 1TVBA 1WZKA 1JZFA 2W0LA 2CO3A 3W3BA 3NFPB 1N10A 2D03H 5IGXL 1DQML 4UOZA 4PN6A 1U42A 1J48A 1SYSB 5L88H 5LJYH 2H4EA 3BGFB 3LH9A 4WWKB 4G7RB 1TTAA 1AFVH 4JDEB 2Z92B 3L2MA 5D6CB 4JY6B 1SM3L 1C1EL 3I6KA 3ABLB 4RRPM 1XF2B 4DPCX 2ATPA 4PUBL 2Y7NA 2PR4L 1BBJA 3O11A 3TGXA 1MFCH 4KY1L 4TLKA 1WVZA 2WJ7A 1ZS2A 1CLVA 4AZ8A 3LRSA 4H5SB 1NM4A 3LB6C 2EXWD 3MUY1 2ADGB 1OTTC 3M7FB 4FXKA 4GW4B 3SE9H 3DX8A 5DI8B 1UB6B 2B9AA 4I1PA 4JUSA 5FM8A 1CF1A 4Q52A 1PFOA 3HS8A 4H1LB 3ZKXB 4U6TA 4BZ1H 1ZLWH 2AFNA 2XA8H 1CD0A 2D03L 5F71A 4N1HB 4IU2A 1R34A 4LVOB 5EBMA 4W6YB 5L88L 1EUUA 2Q7NA 1G5GA 2NNRA 3CDYA 3RNQB 1XEUA 5DJCA 2I7OA 1AFVL 3UMTA 1M6OA 1NGZB 5CIPA 2CM5A 2WZ6A 3JVFC 2CCWA 5C86A 4IJ3B 4OU3A 5AW2B 1Y6NR 2EDDA 5D7SH 1MFCL 4KXCA 1D9KA 3HBQA 1Q9WA 1P5VA 2J5LB 2PCXA 1KXQE 3DX9A 1O9ZA 2BNRD 2R1WB 1SZNA 4TTDC 1RZ8A 1S7VA 3CSYA 5C07A 3SE9L 3ZU8A 2BK8A 3QZWG 2L8AA 2WXKA 4F37K 1YO4A 4V11A 5BV7H 3ECWA 1G9NC 1P1ZB 2XV0A 4PLJD 1OSZB 4BZ1L 4Y4FC 4HCRA 5GS3A 4M6MH 2XA8L 1FE8H 2QHLA 3TBWB 1I9EA 1CXLA 1AIZA 3GMOA 4XMKH 4HJ1A 3RWFB 4IU3A 1ZDSA 1FP5A 2XWBA 3QDGE 2AEWA 3VFUB 1X4YA 2AQ2A 2FZ3A 3Q43A 1KT2A 2ATKB 4YVNA 2EO7A 4F7TB 4WUUB 4F8PA 3BCDA 3MDJA 1T20A 1AKJD 2QADC 4NN6B 3H4HA 3UFIA 3QVAA 5D7SL 4PJGE 3QJRB 1T89C 1RV6X 3AG1B 4WO4D 5MERA 1BPVA 4RMRA 3HRPA 5H2BA 3B9KD 3FCTB 5B39G 5BV7L 4YIQB 5IB2A 2FNBA 3A21A 1MQ8A 2FQGA 3BPCB 2BX5A 4Y5XC 4AWJC 2EXYD 1SYVA 4ELDA 5T3ZH 5DK2B 5F6HJ 3SKJH 1U8KA 4M6ML 1FE8L 2JJSA 4GBXA 3KW7A 3PXJA 3FTGB 3DO7A 4XMKL 1O7VA 5J56B 1JD7A 2MTAA 3NJIA 1I8LA 1P0SE 2F1EA 2VDNB 3MRCA 4BH7A 5LNDA 2ZKMX 3W38A 5E2VH 3FSVA 2DMGA 4R7LA 4MMXB 4ZFZB 1INDH 2MPVA 3DNKA 5DSCB 3SOTA 1E2WA 4NUMA 4A2FA 5F89B 4HWNA 4ALAC 4KVPA 5DC4B 3BD4A 3TNMA 4Z3JA 5K59F 1GR7A 1BD2D 3P3UA 3REWB 1TCRA 4QRRA 5DHVA 1Z5YD 3P73B 1TQSA 5EG6C 2ZG3A 3IFPB 1JNHB 1QBLH 2B1HH 4UB0L 2W9DH 4G6AC 1CO1A 3VXMA 2MHAA 3SKJL 5IV2B 43CAB 1KJVA 2CXKA 4WDIB 3GSOB 5IHZA 3R06B 5F7AA 3EDKA 4LLWA 4GO8A 4OGAD 3GGWA 5EO0A 4P2OD 2IADA 5DRZA 4JKLA 4Z76B 2CDFA 1FZJA 1WP6A 4QI