2P5PA

Crystal structure analysis of the west nile virus envelope (e) protein domain iii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
b'TTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Genome polyprotein
molecule tags Viral protein
source organism West nile virus
publication title Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
rcsb
total genus 12
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p5pA00
5AAWC 2ALAA 4UTAA 3UZEC 1TG8A 1OK8A 3N42F 5H37A 1Z66A 3UZQB 4BZ1A 1OKEA 4ALAC 1ZTXE 4BZ2A 4UTBA 5GZNA 5LBVA 1RERA 3P54A 5IREA 1UZGA 1SVBA 1URZA 2JSFA 3N43F 2JQMA 5JHMA 1S6NA 3N44F 5KVGE 3UYPB 3G7TA 5AAMC 1OANA 4GT0A 2V33A 4FG0A 5LCVA 3UAJA 1PJWA 3IRCA 2JV6A 3C5XA 3N40F 4FFZA 5IZ7A 5B1CA 3N41F 2R29A 3WE1A 4X42A 3J2PA 2GG1A 3MUUA 1Z3RA 3VTTA 2P5PA 4L5FE 5JHLA 4UTCA 4FFYA 4AM0Q 4GSXA 4AL8C 5KVDE 5GZOA 2R69A 2H0PA 4UT6A 5KVFE 5LBSA 2HG0A 2I69A 5KVEE 3J27A 3UZVA 3C6EA 4UT9A
chains in the Genus database with same CATH superfamily
4WK0B 5T1MA 3FONB 4QRFA 5I2IA 1TCMA 1I8AA 2MWCA 3APNA 5IHLB 2H47C 2X70A 3Q6FB 3I74A 3V4UH 3N43B 4N0CD 1C08B 2DJUA 3HFMH 1CD0A 1RZJC 1JZ4A 3BKML 2FWOA 3ES6B 1MCDA 1YUHB 3P02A 2XX1A 1NC2B 1JXDA 1P5VB 5FX3A 3V4PB 2FEEI 5C3LD 3RTQD 3NAAH 3THML 5C2UB 1U3NA 2L7QA 2GI7A 3GUTA 5CCKH 4L5FH 2IANE 1QHPA 1FN4B 2VL5A 4A2DA 3QPQD 5KS9A 1R6VA 1KSRA 3SD5A 5FYKL 1T0MA 3FRPB 1MJ8L 1MWAH 4WV1C 4KTGA 2P5WB 1M6OA 2QVIA 4PB9H 3FUMA 1NBZB 1HVXA 3MBEB 1A21A 2IAMD 3LPPA 4WTWA 1XR9A 5E4EC 1W72B 1OXYA 3A3YB 5HJ3B 3F7RA 1TMQA 4AVHA 2C9SA 3KNBA 3HAEB 4PJBB 5ANHA 3S88L 3Q2NA 2YZ1A 3PE9A 5IIEA 1KG0B 3D39E 4F7PA 4RFNC 1AD0A 4C57C 5E94B 4P3DB 3IU3B 2ZD0A 1IZJA 2AJSH 2ZKYA 3C60D 2EE3A 2VDRL 4LXFA 3VFVB 4E41D 2DQCL 3HBZA 1FPTH 1PQZB 3SDCD 4IIQC 4OM1H 3RLSA 3SKNA 3D2UA 4LHUG 1UCBH 4UNTA 4EI5A 4YJZL 5E00B 2JCCE 1UXLA 4UMSA 4K3JL 1WDAA 4K8RC 1SGKA 1WA0X 3RWIA 1E4KA 3ARYA 3OAWA 5SWSB 3PFUA 4YWGL 4MMZA 3GI8L 1FAIH 5ADPL 5J6HB 2P5WD 1MQKL 2WP3T 4WW1B 5EZLA 2CCVA 1MNUL 1KF9B 4IGBB 4KX7A 1NSNL 1RK1B 4ZNEE 1G94A 2Z93A 3D3VA 3FW6A 1FVEB 2X1OA 1A7PL 1S9YB 2W07B 2C3XA 2XN2A 1HHJB 2X4RA 2Z6FA 3IMVA 4MAUH 4KXAA 4ZUUB 2C26A 1BVLB 3MO1B 4OQTL 2WXNA 2W95A 4MXQC 4LVOC 4PHZA 2BOLA 3EBIA 1FG2B 5AW1B 1IAKB 5DRXB 3R8QA 4XN7A 2MNUA 4GUPA 3G6DL 3L4YA 1A6UL 3TIEB 4F8NA 2E7HA 2DTSA 3O3EB 4WKZA 1YEHH 3DRQA 1Z5LA 3S35X 5HYSA 2IAMC 3CVHA 3K4AA 3BI9X 3WDHA 3P4OB 1QFUH 2QGBA 3QYNA 5E5MB 5DD0L 5CJQL 1KBVA 4P5KA 2ZP0T 4I3SL 3AS1A 4I87A 3RWHB 4EZLA 4DKEH 5CSZB 3V0EA 3VTMA 1VGKB 5TGBB 5HYSG 4NCC2 3UPAA 2I9TB 5IT2L 4HIXL 4M8VA 2A9MH 4FXTA 2I07A 1S5IL 4J3XA 2XKSA 2AJXH 3TH4T 1P4BH 2VCOA 4PRNA 4K2UL 5G5DA 1P7BA 2GIXA 2ZOOA 4UM9D 1BCIA 4TQIA 5IHZB 4X5RA 3HG1A 3L4TA 5CUSL 3ZE0F 1V8HA 4C4KT 1XV8A 1TR7A 4NO2B 3O2DL 1JWMA 1UTDA 4MB4A 1W0YT 5D7LA 1EO7A 1BZ9A 2WINB 5BO1H 5JORA 4Z18A 3HR5A 3F7QA 5AG8A 2B5IB 1NUGA 1EFQA 5F3FA 5DJ2A 2F1BA 2VLME 3DSFL 3QG7L 2EIKB 4ZXBC 1AQKH 2W0LA 5MEOB 3PWNA 3QFDB 4H88L 1KXTB 2R1WB 5IW6B 2VDKH 1UM4L 3CPLB 5CJQH 3VXMB 3LEVH 3RNQB 5AKSA 6FABL 2Z7YA 4XNZB 1E9OA 4O58H 2JFCA 4OLXH 4XZ4A 4YXLL 2NT0A 3WIFA 3DJRA 2JJVA 2GY7B 2ZKHL 3HVNA 4WSKA 2ODHA 1U93B 2BSCA 3KLLA 1FNGA 3LV3B 4FNUA 3T4AC 1MUJA 3HMXL 4JFOA 4YDJA 4R84A 3RA7L 2EIBA 4H1LA 4PJ5D 3LAFA 2D03L 3HG2A 2UZPA 1LLAA 1VFBA 5KBDA 4KJQC 3I9PA 1NCTA 1JPSH 5CFHA 2P5PA 4KFZC 1OP5K 2O5XH 4U1NA 3QZWG 5BOJA 2XA8H 4AGMA 3PWUA 4PVNA 5KYYB 3BGAA 2BSTA 1E4XH 4U6TA 5AQ0A 1XF2B 2DBLH 1BQHB 4F8LA 4NKIL 2SEBB 4J3SA 1T20B 3T8XB 5BMFH 1RIUL 4WWID 1WGOA 3FHAA 5ISZD 2Y23A 2LVEA 3HI1A 3PHAA 5I1DA 4RAVB 3IFOB 3QZWA 4JFUA 1J1XL 1M7XA 1SYVA 2EXYD 5IVXA 3K71B 4JQVA 3T0DA 2IPTH 4JE4B 4FFWD 2AGJH 2APTA 3MMEB 5C8JA 5JXEC 4NQCD 1KPVB 4I3RH 4Y2DC 1SOSA 1U8QB 3OAZK 4G8EB 5CJBA 1UOKA 3ABGA 4LL9A 4OT1L 5I18H 2ROXA 4FKHA 1OALA 2DH2A 1B0RB 4MDIB 3T8MA 3ZKNC 3FN0H 4B9GA 5F6HI 3ULSB 4MJ6B 5DS8B 4YXHH 3OAUH 2IEPA 3EFDL 1LEGB 4OZHF 3CIQA 4RZCB 1J9QA 4I88A 3HZ3A 3SEPA 3UJTL 4GP4B 4AGNA 3M17A 4ZMTA 1WPCA 3D51A 3RKDD 4OCWL 4MB1A 4X6EA 2VLJD 4HHAA 1TJGH 5ANMB 1K3IA 1WZ1L 4QJ5B 1P7QB 4U6YA 1UD5A 4JO4H 4OZGA 1WC7A 5D1ZI 4X7CC 3PQYD 5FUCE 4L8DA 2YD4A 1E5UI 3WI9A 4OCXH 3ZMNA 4RRPG 1GKEA 1HIML 4N0CC 1I8MB 2BW4A 2M2DA 3D0LA 1NEZG 3C6LC 2PCXA 5EH1A 2EZ0D 2YBGA 4XWOC 1KTLA 2XZCL 4YC2B 4YR6B 3H1ZA 1URLA 3QIUA 1BX2A 3PG2A 1P1ZA 4L4VE 2OZ4H 3LNGA 1WVZA 1YECL 5CJ8A 4I4WA 1NCBH 3CGTA 4P4KC 1HJCA 1TJIH 1ASQA 1MY7A 3Q2CA 4XN9A 1XCQA 1SUHA 1JF1B 1QBLH 3KAAA 2X2YA 5K1NA 3F5WB 3AU1B 2W92A 4R7XA 4NOFA 2F1AA 3GBML 2NY2C 3T09A 4E9XA 4U4BA 3MZGB 1YRKA 4BGLA 2HLAA 3I6KB 3GD1C 2APVA 2J7LA 2ENJA 3GUFA 4FQLH 2RHEA 1F86A 1N12A 3GMPB 4WGWB 4ZW6A 3W9DA 3MV7B 4S1SH 1M42A 1UA6L 2PMZA 5JIKA 1VPOL 2P24A 1GCYA 1GS6X 4BFNA 1B0IA 4KGJA 2YPKA 1ZT1A 5F9JB 5IMKB 2AV7A 1FI8C 2Z4TA 2KKQA 4WTXA 1ECZA 2NYZA 3QPXL 3VI3F 4NX0A 2IJ0C 2OX5B 3HZYB 3QORC 3VG0L 5EU7E 3EGSB 3RU8H 3BAYA 1AKJB 2VMFA 4AYID 4XE0A 1XGQB 4RESB 1NC4A 1Y18A 2OI9C 5D7LB 5JHLA 1AZUA 4ODXA 5LUMA 4Y5XB 2PYED 1OB1A 1VCAA 3VXTA 5L2JB 4HX1B 4UTAL 4QRTA 2GJPA 1AOZA 4YHIA 1SLXA 2WQ8A 1I9IL 3BPCB 3ML9A 4W9FC 4ODXB 1CFQA 3II2A 4P5KB 2AXGA 4NN5B 4LSUH 4OKVA 4PCSA 3P69A 2BINA 1UJTA 2OMXA 4JFZL 5GRWA 4AYFA 3V5KA 4GQ9L 5GS1B 5D1ZB 3CFIC 1FH5H 2ED6A 3DXAA 1KIUA 4MCYB 1ZLVH 5BV7L 2WXHA 3QZMA 4A6YH 4AVKA 3QZLA 3DO3A 3VGHA 5E5MA 2JXMA 1MWAL 3IJ7A 4DZ8B 4EVNB 4GAYA 1X5MA 5FYKH 4EI6A 4GRLD 5DUJA 5EPMA 2DQTL 2ORBL 4RWHA 4LNRB 2WCPA 4U1NB 3M8OH 2DY2A 2Z91B 4HEMA 5HYIA 1ADQL 3TYFB 3TZVB 2G9HB 3D3VB 2X6VA 4JZJB 2DH3A 3SO5A 4H8WH 3RWCB 4KAQL 3EO1B 1KGUA 4JEGB 4BWUA 2EO1A 1F90H 2B08A 2TAAA 5A7BA 4MD4A 1S7RA 5FA3A 2QPSA 4F1ZA 4H88H 3DX1A 3SDAC 5IKCA 3HUJF 3ZE2B 1AHMA 2DM7A 4TV3A 5GGVH 1I7ZB 4U7KA 5C0RH 1QTSA 1D5XA 3JWNC 1JPTH 1QACA 2WYIA 3CZSA 4S1RH 5TE7L 3D4GA 2NY5L 4BFBD 4DGIL 1EWHA 2UZIL 2PW1B 5LHDA 3QCVL 2AANA 3ARGA 3NA9L 2PXYB 3WLBA 5DS8A 5JIPA 3EJYC 2GAZA 2CLVB 2MPVA 4EI5B 3CXHJ 4KY2A 5DJ8B 3V4PL 1HN1A 1MIEH 1CXEA 2WQUA 4LSQH 3M17B 1NEZB 3DNKA 2Q8AL 3HHRB 2VLKD 4PS4H 4JO1L 4TQ8A 3OTTA 2HJLB 1F4YH 3QEUA 3VSVA 4XCCL 1FLRL 4NRXB 4N2DA 3SKMA 4QTHA 4RRPM 2P5WA 3LVTA 3LH9A 1QWUA 3EYQC 4ODVL 3I50L 4Y9BA 2FEEL 3MNWB 4L48A 4Z7UF 5C0JA 1Q1JL 4J2XA 4QO1B 3RIAK 2A6JB 1PD6A 1ICTA 1WS8A 2G4EA 1XR9B 1Q0XH 1P4IH 4JG5A 4M62L 3MOBH 2FNBA 1LTXA 2KPWA 3ULUF 1A1OB 2XTSA 1OW0C 5SWSE 4OGXL 3WNPA 2BSRA 1E7UA 3UPCA 4DAGH 5B8CA 4OI9A 1U6AL 3A4DA 4G6ML 1NKRA 4G9DB 4X5QA 5F96L 5LDSA 3PJLA 4G7QB 4BFRA 4FP8H 3JBG7 4DNLA 1LO4L 2H2SD 4LGPB 4WEMB 3CX5K 1SEBA 4AMWA 1WIUA 4AL8H 1ZEAH 2XN1A 2OTPA 3DUUB 1HS6A 1R17A 4XBPB 5AZEH 3VFPB 1R3KA 1ETB1 4JANB 5L88L 4AL8C 3MRNA 4PJ5E 4RSYA 1R5IA 4ZW7A 2Y06H 4AWJC 4B0MM 4XPAL 1U3ZA 4PWIA 2ARWA 5F0MB 1GOHA 1K72A 1VESA 3H9SE 3FT2A 2OJZH 1JV2B 2D2CC 4ENED 1LE5A 3IT8D 4HBCL 1F18A 2NRDA 1OVZA 1R5WA 5DRZB 3VGEA 5KOVC 1CICD 2GUOB 4TPRH 1CXHA 3RL1B 3ZDXB 4TRPL 3TZVD 5ISZE 2JJSC 1WAAF 1X5LA 4OCNC 3RTQB 5GJTL 3WIIH 1ZT4A 1WWCA 4NQQA 5LGJB 2I5YL 4DGWC 4CADB 3ZX1A 3EYQD 1F11A 1XVSA 1A65A 2VQ4A 5D93B 3IBEA 3OKMA 4QYOB 5LCVA 1HFUA 1WUZA 4PBVC 3ZDYB 4L4TA 1EEYB 4M3KB 1P6WA 4YSRA 2YEQA 4ZTOH 4LIQH 5J6SA 4P0DA 1TFPA 5T1KB 2WGXA 4WNSA 1ZY9A 3BQUD 3OKMB 1U8CB 4F33A 4XPTL 2CGYA 4JPWL 2XOTA 5TD4A 3WUZA 3ZKXC 1AXTL 2WTRB 3TF4A 1F56A 1YEDB 3M1BA 3VG0H 1AANA 4DP6X 3L3KB 3GHBL 3K6SB 4G9FD 1T7ZA 1HAWA 3SE4A 2FBOJ 4S2SB 4DP4X 4JRXB 1J5HA 4LCCB 2ICEA 2GPZA 3HTLX 1WZLA 5D1QB 5IHUH 5L88H 3FQ1A 1ZV2A 2DQHH 2Q7YA 1BZEA 1JZGA 1JV2A 3KHQA 4BELD 2D0FA 2OP4L 5D6DA 1QO3A 5FDWA 3P2DA 3TESA 2ADFL 5DRWB 1PKQA 5E4EB 4LLQB 2IMMA 3EBHA 5A43C 3GGWA 3LZOA 4G6AD 4X99A 4YFLF 4X6BB 4JPVL 4QD2E 3HB3D 5EB9A 5I0DA 3MLTB 4IRJD 3U7WL 2L04A 1D7CA 3B9KA 4YDVA 5E08H 3TC9A 3T3PE 2B0SL 4L1SA 1BEYH 2VXTL 3ARED 1Z5YD 6CGTA 4DIXA 5D1ZC 2VLRB 3QR1A 2Q10A 3R4RA 1J9RA 3ZQXA 4UT6H 3GXMA 4HIHA 1U8MA 4KGLA 3NP3A 3VXSB 2WBXA 5BO0D 1ZHNA 1EFXA 1NLBH 3C2AL 1J0KA 3S48A 5T3XE 1LE9A 5DURD 4NENB 5C0GB 1MFBL 1TEFA 3MPCA 2OFQA 2V7HA 4A2MA 3T1FB 2N4IA 4XPTH 1C16A 3F12B 5D5MB 4BA0A 2XWJB 2J43A 1T5XA 1PZ5A 5I1IL 1MHHB 1XF4B 4FNLH 1ZWIA 4QO1A 2GTZB 1RZFH 5ICZB 1SN5A 5JXAH 1SY6L 3VXUE 2FWUA 3QORB 4U05A 5FO9A 1J0ZA 3UZQB 4NAJA 1B90A 3NESA 2H41A 4NLHA 5C0AA 3IGAB 3DYMA 4H1LH 5GJSH 4KX8A 4R7NA 2EH8L 3T2PA 5B7MA 1BF5A 5HHVH 4LHUD 2XJKA 3ZE1E 4RDBA 5TE7H 4FQIH 4PJBF 1HCVA 3O6KL 1I85A 4NFDA 1HSAB 5B3NA 5C0AD 4XO8A 4LCYB 4E9SA 1YVLA 3CMOH 2BOCB 5E1AA 4U2ZA 4BZ1L 2X7LA 3A5VA 3JUYA 1I1RA 3C6LB 3F8UB 1J1OL 5H37A 2RTTA 4N0YH 5KS9E 3AT0A 5J12B 4C47A 3L5HA 3BP7A 1UADC 1QRNE 1PSKH 3DIFB 2NUPA 4GRLA 4ACTA 2XQYA 3N06B 1B4TA 1JNHA 1JUFB 2HVJB 5AAWA 4QRPD 3AREC 4J27A 4F8QA 2XY2A 1WISA 4NQTA 2K3HA 1ACZA 4F7MB 2HAZA 1EV2E 2XVGA 4TMPA 1TQSA 4BFKA 4L3EA 2DN7A 1PZDA 4U1HB 3VFGL 4EIZC 5DJYB 1MLCA 2PPEA 32C2B 2YAOA 3K72B 4JMXA 4WK4B 4XBEH 5D2NC 3RWDB 4E42B 2K9FB 3GXIA 3L3IB 1OGPA 3QUXD 3DX6B 5I15L 1KYOJ 2B3IA 1YSOA 3B9AA 1UZ6F 4GPVA 5C0FB 1TQTA 1MREL 2KLRA 3AG1B 3EO0A 1MKFA 4B9YA 1K85A 3I9GL 4M5ZH 3CSPA 2ZWKA 3AXIA 1KLFA 3ARUA 3FB8A 4PJ7B 3UTSB 1OHQA 3K6SA 2OMVA 1CLZH 4JO3H 4KXBA 2HVKA 3P3UA 4K71C 4K0OA 3IF1A 4ZYKA 5I1IH 3HZMB 5FGBA 2MHAA 4XP6L 4PJXE 4YQXH 4GBXB 5IUCA 4X9YA 1PLAA 4PJXA 3GM0A 1XD1A 2KYIA 2YKLH 1JZ7A 2FSEA 4EBQH 1TKWA 2QDVA 5KVEH 1MIMH 4OD1H 3UGXA 4HV8B 1ZHKA 2NUPB 3CU1A 1CGTA 3O41B 3VFMA 4ETYA 1R0AH 2BSEA 4UINH 3UEZA 5LQBL 1X5ZA 3IAPA 4APQD 4BFOA 4F57H 4YBLB 4AY0A 2RR3A 5CEYB 1DQLL 3MJ8B 3NQIA 4ZX5A 1IM9A 1CGXA 3QXWA 1FL6A 1QYGH 2KDGA 4X9BA 1MPAH 2FHBA 1DO6A 4R26L 5MI0C 4A6YB 4J4PC 4JRLA 3VFSB 3U46A 1U8JB 4X98B 5FO8B 5CEYA 1AO7E 3GS4A 5KOMC 1CD9B 7TAAA 5EEWA 1KTDA 3EOAB 4R96A 2JIXD 4GW5A 3QVAA 2A6DA 1TEGA 1D9KB 3MRRA 4XPBL 4FJ6A 1ED3A 1NCBL 5BUAA 2WLHA 3ZU8A 4LASH 4ORGA 4WSJA 1KTKE 2MCPL 4BHUA 3VJ6B 4IBWA 5ILTL 2OTUA 5J13C 2YAPA 4G1MA 4JB9H 1HX0A 3R1GL 3FB7A 3ECUA 5KVGH 4HDIA 2DQFA 2QSCH 4F37F 1B6UA 4BK4A 2C3HA 1E6JL 3K8LA 1LILA 1BZ7A 1KY6A 4G2AA 2QTEA 5FKAB 2QQLH 3TGXA 2EE6A 1HL4A 3CCHA 1L0QA 3QI9C 4G8GD 1E9QA 4JY5H 3TVMA 5DI8A 2V2TB 4AT6A 4B27A 4JFZH 4Y5VC 1BQKA 1RMFL 1DVUA 4JPQA 4N2MA 5C6TL 5LVEA 4Z7UB 2X2HA 1TCRA 4IMLB 1A1NA 3GJFB 4HCIA 4WEBL 4Y2OB 5DTFB 1T0OA 1MVYA 2FIRT 1OT1A 1QX1A 1M1SA 3IDIB 5FEBA 2BVQA 4LLMB 1MCNA 2R0ZL 5DD1L 3CMGA 4L4TD 4A7GF 3K6OA 3NA4A 2F7OA 3NIGF 1XMWA 1J0JA 3L6FB 1YY9D 3D09A 4KI5C 1OB1B 4X7EC 5EOCH 5SV4A 4UQ2A 3UMNA 3FMGL 1GGUA 2A6IA 3NJMA 3WKMH 2GG1A 4AENB 4TTDC 4PR5A 3RZCA 3IMUA 4YPGB 3ILQC 1YMHA 1HDMB 4DPCX 1MVFA 3GSNA 4NQVA 4EUPA 1N6VA 1Q9LB 1ULVA 3ULAB 5IW1A 1AJ7H 5GRVL 3LKQB 4R9HA 1FV1B 4DO4A 3RZCD 1QR1B 1HE7A 5HYEA 3BX7C 2FECI 4NNYA 4QI3A 5I5MA 5JQ6L 1A7BA 2BVUA 4AC4A 3MLSH 5I30H 4W9HC 3BH9A 1DL7L 1FFQA 1G7MA 5D1ZD 4Y5YC 3VQMA 2OSLB 2HMID 4JY5L 3N1QC 3VWKD 1PDKB 1E6OL 1MAMH 2DBJA 4L0PB 2XHNA 4L4TB 1BFSA 5DEZA 4JO5A 5IMLA 3QFJD 3U9PH 1GMEA 2GTZA 3J27A 3L4WA 2Q3XA 3OJDB 3PWVA 4BINA 4TVPE 3T4YA 3O6FD 4LCCC 4QRRB 2JVUA 4UQ9A 3TZVA 3OPZH 4L8SB 5MEQA 3NCMA 1DQMH 1KENH 5KVGL 4FXGC 5I73C 5I75C 5LXGH 4WO4D 3RA7H 1B4LA 1FORL 4Y5YA 2W9EL 3D4CA 3FHEA 4X9GA 4EOWL 5I1EL 5LGYA 3WAJA 3TIDA 3NPSC 5H2BA 2H2PD 2WXJA 5F1NB 2ZG2A 3VFOA 2IGFL 1MJ7H 5FYLD 2QVFB 1GGCL 4DESA 4JPSA 4ZMYA 2WLZA 3P9WB 4RGMB 3GSRB 3RUGE 3GB7A 5A1AA 4FNSA 3H42H 4M6NL 1MHEB 3CZLA 2PYEA 1BFTA 1YJDH 4G42A 1U3HA 1AQKL 1CIDA 4ANKA 1LVEA 4XMKL 2WWMC 2VN5A 5D93C 2IANB 4PJ9C 2VM3A 1CIUA 4F15C 4PG2A 4IRZL 3VXUA 1DSFH 4NERA 1O6TA 3NEEA 3LIUA 4FQCL 1VFMA 1N6QH 1DCLA 5I1KH 2VJ8A 3P73A 2Q6WA 4ZMXA 1ZJBA 5L2JA 1IKNC 4K5NA 1JXKA 1N70A 3GLZA 3O3DB 1KV3A 1KC5H 1BAFL 5BS0A 3WJLA 3VRLF 2X0UA 4OD1L 2XVKA 8FABB 3L9RB 1JGEA 3II1A 3RX8A 1AKJA 4N90E 4PJBE 2ZUTA 4CVXB 1A8JH 3IWVA 1ML0A 1KTJA 1SEQH 4NKIH 4LARH 3FQNA 3AZUA 5EO0A 1LQBC 2NY4B 2F8XC 3TCLA 3VXRD 1JGLH 1R1CA 3PGFH 4D7PA 2Z7ZA 3EYFA 2XTJD 3RWHA 1YDPA 2A9ML 1EUTA 1HHHA 4OCYL 4HSAC 1M3JA 3ROLB 2NTSP 4F33B 4ELMF 1Z5LB 5J4MA 3EH4B 3O6FC 4BZ2L 4ZDHA 2QDWA 3BZFA 3QIUD 4FKEA 4YL9A 5B1AB 2AXFB 3PNWA 5D7SL 3QEUB 2AI0L 4LAQH 4F24A 3BUYA 4DCQA 1JGLL 3PGFL 4L8SC 4LSVL 1VFBB 2WWOA 3D18B 2Y5TB 4UOQA 1NSNH 3NIFB 3RGVB 1DJWA 2MTAA 2WYZA 1NFKA 3O8XD 4MKTA 1J1OH 3FYEB 1S8DB 3U36B 5E99H 1RKRA 2ZJSL 4P4RB 3ARTA 3FO9A 5DVNA 5EUOE 3IETB 5IB1B 1AXSB 3SYPA 3U6XA 3CHRA 4AQ8C 1C5BH 1JDAA 1Q1PA 1E5ZA 1RZ8A 5BXFA 1SDDA 1A5FH 1XGYL 3NRFA 4MHHI 4QHUB 5E2VL 3ZL2A 1JZ3A 3Q2WA 3T6VA 2OULB 3WL9B 1N6QL 4I1PA 5IW6A 4WNJA 1AR1C 2DQCH 3MXVH 5MEOA 5I71B 4JKPH 5T1DL 3B1UA 1QQDB 1JK9B 2P5ED 3EXLA 5I0WA 2NZ9C 4OZFH 4PREA 5C6TH 4YO0B 2B8OT 5DMJB 4ZPTB 3QNXA 1V3LA 1XGPB 2XY1A 4Y19E 5AD0A 1DEEB 5EN2B 1AE6L 3S88H 1I53A 4L29A 1AC6A 1H8LA 4XN4A 4WNQA 3VXSE 5AAPA 3K2IA 3V0IA 3C8DA 4AYGA 2HH0H 3AXLA 4HFUL 5MEPB 2BNQD 4IK6A 5ECJE 4GI6A 4PGDB 1M53A 1RUAL 3NFSL 4L18A 1F3DH 4U49A 4BH7A 5H35A 3SPHA 2G75A 3ZMEA 4EVNA 3TF7C 3COOA 1G1OA 2QADC 4FYQA 1XSJA 2FR4B 5F3HB 1ZV9A 2J44A 1JYWA 2UYLB 3JV4B 1G4RA 5FYLH 4OF8A 4OZIB 5KJRH 2VMJA 5I9QB 1G9HA 1RD6A 4OLUH 4KKLD 3K71A 2XKNB 3HI1B 1H9VA 2J6WA 3QK0A 4B0MB 4ELMA 5KBMA 4NKOA 5C0JB 3TBCA 1AO7D 1UACH 3QCUH 4JFQB 3T6QC 2AS5M 3L9EA 4LCIH 3G6JF 3PWUB 3DVNB 4Z3TA 3KH3A 5L2KE 1I7RB 3O8XC 1O5PA 3GMNB 4LQFH 1A9BA 3CH1B 4ZQKA 4OJFL 3CHXA 3F7VA 2GJ6B 3FT3A 1IKNA 3HE7A 5DEFB 1N0LA 3VXUB 1QI5A 1KYFA 5GSVA 4JG0H 2P7TA 2V17L 3VTAA 3Q6GH 3EHBD 4W6WB 4H40A 3WLBB 1KJVA 4MA3B 2QFRA 1XTMA 4G42B 2ZIDA 3D25A 3Q9PA 3T0ED 2NZ9D 1UOWA 5SV3A 5FA4B 2Y72A 1FSKC 2HKFH 5FW6A 4I9WE 3C75A 5ESAA 2N0MA 3NJNA 5CCHE 5IBTL 3EJZC 3L4XA 1LP9F 3B4NA 2IDSA 1RSYA 5ECGA 5KWYC 2PCYA 2DW5A 2HJKB 4CSZA 4L8BA 1GJWA 4LPTA 4UANA 5FPIA 4QRRA 3QQDA 3NT0A 5T3XH 4HG4K 4QKTA 2C1OA 4TXVB 1KCUH 3CN0A 2JE8A 3KPMA 2BSED 4OQ1A 1D5ZA 1YQVH 3HCVA 3ZDXF 1I8KA 5F9WC 3QSKB 1XF3A 2R51A 2F18A 3FCUB 4ZMQA 5I5JA 4GW1B 4RWYH 5D7KD 2BRRH 1TUPA 4Z7OE 2EUWA 4PS3A 2EC8A 3J07A 4XB3A 1KACB 1MJ8H 3II3A 1E5BA 4G5AA 2QQKL 4S1DD 4U3HA 1FVCB 2XZAL 5ETUA 5TE6H 3ZDYF 3WFZA 1J18A 1KBWA 4R2GD 5TFSL 3U2SB 1TIUA 5H94B 4M48H 5AOIA 3SBPA 4F8OA 2LAGB 2QR0A 2CUAA 4MMZC 4D9LL 2X4PB 2MQCA 1TZHA 4PG9B 5ESQA 4OV5B 3ALXA 1THCA 2OQJB 1QWNA 2WCGA 2HTKC 1KCSH 5CLTA 4MNHA 3TCXA 2ZOUA 1ZA6B 3OXRB 1J8KA 4E9QA 1HEHC 2EIEA 3LEVL 3QG6A 3ETBF 3NH7H 3LQAC 1F4XH 4BCYA 1ZHBB 4MSWA 4Z77A 4P49A 2YMXL 4CBPA 1IC0A 1F4WL 3VWJD 4D3CH 4Z7NF 2E56A 1DVYA 4Y9EA 4WLCA 3INUH 3PWJB 2X28A 2YD6A 3FT0A 5D8JH 5GQBA 3HZYA 4TVPD 2EZ0C 2FLRT 2ZUQB 1C1EL 1FIGH 3DOHA 5JIDA 3NJVA 2CLRB 3N04A 4AV4A 1R0AL 3FTGA 4UNVA 2VW4A 5ISZB 3MOBL 1RZKH 1KCUL 2BRQA 2BVQB 4LLMA 5DJZA 1BFVL 2FT6A 4I0PC 3P4MA 5BVPH 3ZL4H 5IJVB 1K3ZA 2Z9TA 4ALAH 2F74A 4XOAA 1OCOB 4G8FA 3C5SB 4RVBA 1DUYA 1Z66A 4XPHL 4C56E 4OZHE 1L9PA 1U2HA 3ESPA 2MCG1 3GSVB 3CUPB 4LLUA 3ABMB 1G1CA 3OKNB 3X1FA 3ARBD 4A7VA 4D0BA 2Y6SD 4FMFA 4W6XB 5BUPA 1A3RL 3NJKA 4FI8A 3CHSA 2IPKB 3SE6A 4I1NB 3WIHH 3RPKA 3WMSA 5KZCB 1RK0B 5CGTA 3TVMB 4AW7A 1WSST 4JLRB 2G9HA 2YA0A 2WXMA 5DD0H 4CVUA 3IETA 1ZANH 3WEAA 3ZZLA 3BYYA 5T1LB 5C07B 2EH7L 1AZRA 4FZ8H 5DDHB 4YR6A 3EXJA 5ADOL 4R6UA 1FFOB 4LGSB 1J8HB 4JPKL 3QDGE 1G6RA 3NACL 4KZCA 3D85D 1U92B 2YWZA 3ZKMD 2DEXX 5C0RL 5BV7B 1HQRB 3AACA 5HVWA 4Z78A 1GZPB 2ZICA 4BXSV 2AXJA 3MV8A 1CFNA 1EDYA 3QJRB 2NY2D 3QQ3A 4CU6A 5BUGA 2VOTA 3QCUL 4I8DA 2XTJE 1UASA 4Z0BL 1C1EH 1FIGL 2FX8H 3QIBD 3TM6A 4R4BB 3MTRA 4NWUH 1CU4H 3AM8A 2YJLA 4ZUWB 1ZCRA 2Q8BH 4H25B 1BJ1H 5DVOA 1FUNA 2WMPA 2ILLA 3AS2A 1B3JA 2H6PA 4MJ6A 4QRBA 1NC2A 3V4PA 4WK2B 3K2UH 2H4EA 1SHSA 1NBCA 2EDDA 2R69H 4YWGH 4MD5A 4ATTA 3HPJA 4ES9A 3M7FB 4DEWA 1X5YA 3L54A 4Y4FA 4I18B 4WFFD 1F6AA 4XC1L 4JKMA 4K07A 1AR1D 4UUJB 5FO7B 3IB4A 5J6GA 2DWEA 2NY6C 3T1WA 5SX5H 5FM8A 2VDQH 4WI7A 1FL5B 1UYWL 2VQ1A 3FL7A 1O9VA 1QASA 3BP4A 3IJ9A 3QUMA 3TOPA 4EDWH 1SXAA 5JHDA 4LHJB 3KH4A 3P4OA 4MJID 4CDHA 1U8KB 5HYSB 2PO6B 1NGQH 3KPRD 5E6SB 5IV2A 3GQFA 3GSRA 3SDAD 2YS4A 3UC0H 1RL1A 3EYUH 5DMIH 3ESNA 1YQVL 1L7TH 3EFOA 1CK0L 2KHAA 2G3MA 4OFPA 1NINA 3ZZQA 4Z3EA 4M8RA 1E8ZA 3H0TA 3LDBC 3OF6A 1PZUB 1UKSA 4HFWA 3WKNA 4Z76B 3K46A 1T1XB 5KANG 3NFPB 32C2A 2Q8BL 5DJ0B 3N55A 3UP6A 1EHKB 4HC1A 2XT1B 5CGMA 1HXYA 4J3OH 5E08L 4UQ3B 1T0NA 4LPYA 4JFYA 2CKBB 3QARA 4Z7VB 1UXWA 4DGVL 2W5PA 5EDSA 4ZBJA 1KDJA 1H15A 2ID5A 2OMYB 1F6LL 3S34H 2X4TA 2ZJSH 4KDVA 4G5ZL 5FK9B 3SBWC 4XPAH 4P2OC 2PPDA 5D2LA 4O00A 3KEDA 4JB9L 5FKPB 1CU4L 3QIWA 4PAZA 1B4RA 1JDDA 1G4MA 1KCKA 5B1JC 3UTTB 2X1PA 4XVTH 4HWUA 2NQ3A 3U7YH 3UG5A 4OGXH 4DAGL 4OI8A 3VI3B 2EXWC 1KXQE 4OLZL 3T0EC 2DLGA 4A2GA 3ECVA 4Q0XL 3MLXH 1EEZB 2X88A 4YHKH 5IB5B 4JM2C 1A6TA 1MG2C 3EJZD 2A6IB 3U79A 2WIIA 4NN5C 4XNYH 2OZ4A 1YMMD 3E1ZA 4DK5A 2HFEB 3OHXB 2BJML 3FO2B 3QQ4A 5B7EA 5T1LA 3MBEA 1JFQH 4X42A 1BQSA 1MFMA 4ZAKB 3GSNH 2XWXA 4NHCH 3T0EA 1F4YL 3JV4A 1LMKA 2FRGP 1ZOXA 4WWKC 5E8PB 4BSVB 2IPKA 4AT6B 2BVEA 4KVPA 4XMKH 4W9DC 1QLFA 1PZ5B 3D6GA 3NIFE 3KL3A 3AM8C 4BZ2A 1G84A 2E3VA 1I8LC 1UFGA 5MENB 4LBAA 5FKAA 1QUNB 2JKXA 1XIWA 4BH8A 4YHLH 1V05A 4FQCH 4V2CB 4LBEA 5BZZA 3QCTH 3K7UA 4LDOB 3KJ6L 1NAML 2JIXA 3BP5B 4M7KL 3TJEH 3C5ZC 1PIGA 2EDRA 1YPZE 3L4ZA 1DTUA 1FNSH 1B3IA 1N7ML 1MF2H 3RAJH 1IBGH 4L4VB 1OF2A 5TPWL 3KMDA 1DR9A 3ROOB 2Y07L 1OP3H 1MFAH 1FL3A 4EUPG 4AVIA 3HJ0A 4IGBA 5CR8A 2F5AH 3QISA 4XAWL 4AGQA 5I8CA 5J1TC 1DVFA 2N7AA 4U2YA 2ADYA 2K7QA 2OTUB 1GS7A 1C5BL 2CO6B 4NCC1 3IGLA 3BZEA 3W1ZA 2WGNB 1JV5A 1QNZL 4DUXA 1F4WH 4PRIA 3ULVL 2IWKA 4ENEC 5E6UB 3TBVA 1N8OE 2R7EA 3S34L 3MNVA 4YMPA 3Q3GA 4V1DE 4IS6A 4EKJA 3BFQG 2XG4A 1VFUA 4N85A 4NHUA 2IBGA 4LP5A 5DD5H 2F9BT 4GSRA 4N0UE 2OR9H 4L1LA 1Z32X 1HOCA 4MMXA 4Y1AB 2AFNA 2P3YA 3UZQA 4ZDHB 4PWKA 2Y2WA 1KG0A 2HT2D 2IALA 2WSPA 3ZIYA 1P4LB 2ZUQC 1M2VB 3NCEB 4M48L 3S4SB 4RFEB 2WP3O 4OR1A 1MRCL 3OKOA 3FTYA 5JQ6H 2IWEA 1S5HB 3HBGA 2F7QA 1A1MA 3RJQB 1ZTMA 3U2IA 4DP7X 5T1LD 3KYAA 5AZ2L 2BRRL 2ICWA 1TKWB 2GTWB 2VTFA 4U1GB 4ZFQA 1TJHL 3MBWA 2H2PC 3O4LB 4FQXA 3WTYA 2F53A 2VRKA 1NIFA 2ZOKB 4KKRA 2APBA 2IQAA 2L3BA 3GUTB 3HZMA 4UV7H 3UGUA 3P77A 1ASOA 4IRSA 2AJ3A 4APXA 5I6PA 3UG3A 5ITFB 4NZTL 1X3DA 4NPKA 3V0AC 2EKJA 5K93A 1JXFA 3NSCA 4K23H 4LSRH 2WLNA 4PJ5A 1OK0A 3ETSA 3D87B 5E8DL 3ZKMC 4WIQA 3D0VB 4G9FE 1MCIA 3AABA 1QSEA 2EVHA 4RISL 4H13C 2WZPA 3S3BB 3P11L 3PWPA 3EJYD 1E6JH 1F45A 2YMTA 2O6CA 4GO8A 4G80B 5I0ZA 5I66B 2HX8A 1YNKL 4ZOEA 1WFNA 2ADGA 3FQTA 2R2BB 1CJYA 3IJHB 5GGSB 1U2CA 1ZA3B 3UYPB 1A6AA 4JM4L 2G5RA 4FF9A 4QXVA 3TIDB 3IDXH 1MWAB 4JREB 2AJXL 2HN7A 2YEZA 2DDQL 3WJMA 5KAQG 4HS3A 1I7TA 1BEXA 2BIQA 4RA0C 2Z31A 4HJJH 4ETQB 3QDGB 4O2EB 4DHLA 3QDJD 2Y24A 1UJ3A 4QTFA 4TNEA 2QVMA 3MBWB 4P2CG 2WAQA 5F44A 2YQ3A 2YOCA 4Y16B 1OSZA 4HYTB 3VYOA 1GIGH 4OJEH 4EDXA 3S3SA 1IQWL 2VLRE 2X89D 4ATWA 4AIXA 3APMA 4DUVA 1CTMA 4QHNA 3WFEH 4B41A 4XVTL 2NTFA 1UENA 3BCFA 1T5WA 3G7TA 4E9VA 1F42A 4DUWA 5HPOA 5J8OA 2K45A 1KGJA 4DPAX 1NGZA 1R47A 1UKTA 2CE6A 1QSFA 4NXKA 4K15A 3AROA 1TTFA 2DLFL 2FJSA 1R24A 3WKML 2X4UB 1IC5L 4NZTH 4HUNB 3A67L 1T89C 3BLBA 3FAXA 4YNYA 4ZOAA 4O9HL 3VTTA 4FI6A 1L5GA 4NKMA 4UOW0 2CDGA 2JB5H 1TLMA 1BM7A 4ZSOE 5DC0A 5EULV 3LZRA 4AITA 2WBJD 3QIWB 4CN4A 1SYSA 5FHBL 3VXOB 3EH3B 4FNRA 1WHOA 5DFAA 5FO2A 1JK9A 3L8QA 2UXTA 4JDVA 1QFWH 4JS7A 4KY1H 1B0WA 2F74B 1P5VA 1FVDB 2W0KA 3TA3D 1A3LH 5AVTB 3B9KB 3CDYA 4KKCD 4WWKB 4YBQC 1E5CA 3T71A 1D9KD 3APFA 1EZVY 3IPBA 5C6PB 1PYWB 4OLWL 3E3QC 2J1WA 4ODHH 3RPBA 3UADA 5KJ4A 2CA3A 2VLRA 2YGPA 3DMMB 3WLWD 3ARDC 2WLKA 2ZSVA 2J2ZB 2X4NB 5I1CH 1R75A 2O6FA 1F97A 3UFIA 4NEHB 1I3VA 4FQ1L 3MACL 1LGVA 3EFFA 2Y1ZA 2LABA 4QRPE 2V2TA 1XGTB 4XOCA 2BP0A 4PRDA 2UUDH 4L5FL 2FSDA 4DW2H 1EDQA 2LR4A 1QWHA 1F1DA 2EXWD 3RDJA 3V0DA 3SJVB 3WTXA 3OR6B 5ERWA 1XSKA 2VDQL 2NW2A 3ZT7A 2WLIA 2GHWB 1Z9SA 1N0XH 5KYWA 1WWAX 1IAII 4WUUD 4N0YL 5D1XD 2XZCH 4GKNA 1P1VA 1CGUA 1BPVA 1D2PA 3FH5A 3MRMA 4TNFA 2ZSWA 4OZIF 2ZPKH 5F7EL 4ZODA 4YDLB 3VQ2C 2VO5A 4YDNA 5JHAA 3QXVA 2AXWA 2I24N 3QUZD 4TSAL 3BPNC 1A6ZB 3TYGL 3DBXA 3UAJA 1SXNA 3EDEA 4JGMA 1DJSA 1FWXA 3HI5H 5C0ND 3EH2A 4W9JC 4RNRA 5DJ8A 3MFFB 5I1AA 3GDCA 4GAGH 4H8UA 3FHQA 1WT5A 3W2DL 5I1JH 5IK3B 1NQBA 1TZGH 2R4SL 3C6SA 2CCWA 3Q5YA 5DJXA 4U6HB 3X1EA 3ESVF 4E9YA 4ZUWA 3CMOL 1H3WM 4LPXA 5C08B 1NAMH 3DKHA 4OZFB 3DI2B 1WRFA 1WGVA 4YBQD 4EN3B 1OARH 2OK0L 1OM3H 4H0GA 2QHRH 4C59B 2YEZB 5CINH 3BZEB 1HOEA 2P5EA 3B3IA 3OC8A 1W9XA 1EUUA 4MJ5B 4J1UB 2ITFA 3MRNB 2WY3B 3KPLB 5I23A 4QUOA 2X12A 2M8XA 4ZO7A 4M5ZL 3V4PH 4LESA 1UEMA 3ULUD 2R2BA 5JXAL 2DQEL 3E2HC 3HN5A 4HHGA 4BQBA 4HW6A 1G6RL 1XH0A 3BT2L 5DA4A 5INDA 3V4VB 4YQXL 3O6LH 1JWUA 4ZZFA 4NUJB 4Z23A 4JY6A 2VN7A 4P46A 3GMLA 1DBBH 3D0LB 1NGYB 1QVOB 3MN8A 4U0RC 3U4AA 4D2NA 1IJ9A 4WJ5A 4PRIE 4OAWA 3DGDA 4BCXA 1UA7A 2DAVA 3PYCA 4JN2A 1T2QH 3R19A 1LO5B 1MREH 4ZJ9A 5CHNB 3LH2H 4HS6A 3QXAB 4L1HA 1MG3C 1MRDL 2OM5A 2VE6A 4YBLC 2HRLA 4Z7QE 1X7TA 1RJZB 5B3SB 2DD8H 4YXKL 2ZOKA 4LLAA 4E0RB 2K6YA 4M6OH 4WRLA 3RY5A 1NGWB 1UG9A 1AH1A 4YPJA 4GG8B 1EDHA 1FH2A 4QRTB 4G8GE 5LGHH 4GAJL 5K5YA 3UBXB 5D4HA 3T3MB 4H25A 4HH8A 3BGFB 3BEVB 5AAMA 4KRPB 3EGXA 4NB7A 1TENA 3PWJA 1PFOA 2QVTA 3NFSH 3TJEL 4G8IA 3QJUB 4GG6E 1HT6A 1KCSL 2CGRH 2FX7H 2ZG3A 3JWNG 4PV8B 3SYQA 4J3UA 1N68A 5JLZB 2AV7B 3RX9A 5ID1A 2PXYA 3WOVA 2DJ4A 4Z77B 3QORD 1QLRA 2APWA 1IL1B 4L4TE 4XNMB 3RX7A 5IFJA 2P8LB 2GITA 3NIDB 2DWYA 1INEH 4GXFA 3ISYA 4KNQA 1QFOA 4UMGA 5FHBH 3A24A 3QUYB 1P4BL 5DWPA 4X4YB 3U4KA 4HUCA 5G55A 3NGBB 2VDRH 5C7XL 1LO5A 4TPRL 4HMDA 1PF3A 1IKOP 1DVFB 3V4VL 4PJGB 4O9HH 4GQPH 5IMMB 5CMAB 3LH8A 4CU8A 1FNGB 2F7RA 3OBAA 2IFGA 2WNGA 2CR0A 4IBYA 5DDHA 2B77A 5TDOA 2DI9A 2UUDK 2WTOA 4TYUA 3V6OA 3I3BA 4DP1X 3TWCH 4QEGA 2CLZB 2PCPB 3OB8A 5ICUA 5HDOA 4GKSA 4GQZA 1K5NB 3BD5A 4LBEB 4AQEB 2MPAL 3GSQA 1OT2A 5ACZA 2Z7WA 3PP3K 5LN8A 1UUSA 2AJYH 5D7JB 4MNQA 2ZF9A 2KUTA 4M93B 1JYNA 3GO1L 3RB7A 4XR8C 2WANA 4U1LB 3LPGA 4MX7A 4NN7C 5IJVA 2IAAC 1BEYL 2R1WA 2DQHL 2YPLB 4WDIA 2UY6A 1IL1A 5IVXF 2RB8A 1EEUA 4HK0B 4UINL 5FA4A 5IHUL 1ZHLB 3OLGA 3MLYH 3RI5F 1MQKH 5DJXB 2VDPB 3RUGF 4D94A 4KO6A 3MV8E 3LSOA 1MPAL 2ADFH 4AG4L 1FZMA 2Z4QA 3KPPA 2RFXB 5EOQH 5IQOA 3DSNB 1FCCA 2WXGA 4NYLA 1DJZA 2V2XB 1FYTD 1R33A 5FWQA 4OLEA 1XBDA 2OX5A 1VSCA 1T5KA 1H5BA 3SKUD 3WNNA 5C6WH 3R4DA 3DK0A 3WFCL 3UP1A 1I1FB 2DIEA 1KV7A 4YHZH 1MCOH 1S9VA 3GJFH 1GGTA 5DS1A 1D9KC 1M71A 2I32A 2VT0A 5FK9A 2BFGA 3GI9L 2OZNA 3BJLA 5KSAA 3IU4H 1EHLL 1O0VA 3ZKQD 4J28A 5KSVB 3QQ3B 1IBYA 4GIOA 3WIIL 3BAKA 5C7XH 3FN0L 3U2SA 2JKJA 4NKQB 1WFTA 4FXKC 3HLAB 4ZSOB 1OZTG 2ZUWA 3LMJL 1NGYA 1QVOA 4OT1H 2BVPB 4FA7B 5CO1A 2ZXGA 4ACPA 3T0XA 2PNDA 4H0LC 3H4FA 2JKWA 4FLSA 1BJ1J 4JG9A 1FNEB 5D7IF 3SQRA 5HGHB 2KT6A 3O2VH 3DECA 3KPNB 2GTQA 5EBLA 4F7TB 5G2NA 1UJ3C 2JJWA 4L3EB 3NVQA 4LLVB 5K59F 3P1VA 5E56A 5CZRA 2EYTB 5HDBB 3ZTNH 4FULA 5T5NG 3VFWB 4N2EA 2CHNA 1QBMH 1ETA1 1RLBA 1D7FA 4KXCA 2NY2B 1G9EA 4GAJH 3NDYE 4HK3J 1BECA 5E99L 4G6JL 3ZKXB 1AQHA 5E23A 3B83A 1D5IH 5TQ2L 4LL1A 5JPNC 2DD8L 3ATDA 4YXKH 4IU3B 4Z7VF 2IGLA 1HNYA 2R23B 3NP4A 3WEBA 5E9DD 3VA2C 5ADOH 5KSBA 1IGYA 3SO3C 5ID1B 4DKFL 4X6DA 3VFTA 4ODWB 1Q0XL 4I48A 2QQKH 4JUSA 2GITB 5TE6L 2EILB 5DA0B 5E8OA 1UM5H 2P5EE 4XWGL 3ECQA 2TSBA 1BAFH 2OXHA 3KPSD 1IAIL 1MELA 5C09B 2BSRB 5CEZL 3G5VB 4XC3L 3B2UC 4JVWA 4KO5A 3QCTL 3WEOA 1OSZB 4CILA 3S8GB 2O93L 3ULUC 4NM8H 5DT1H 5ICZA 1NGWA 1A4BA 4TVPH 1RCYA 4JRWA 4M00A 4KXDA 1X9RA 1J1PH 2NLJB 1Q4NX 4YHZL 1TZHB 4PG9A 5ESQB 5I1GL 1FLTX 3WKYA 1RI8A 5F7DA 1XXDC 4LCWA 1U3JA 4KKLC 1UGKA 4Z7UE 5F21B 3QJOA 2HRGA 1GW6A 3H3BC 4PFEA 1GSKA 3AB0C 2J4WH 2X70B 3Q6FA 3UJIH 2MOGA 1J8RA 3CCHB 3IFLL 2XICA 1D5RA 1TJXA 1DVFD 3C5ZD 1YN6A 1GIGL 4PREB 2MH4A 2AJYL 2BXYA 4NRYB 1Q9OA 2RQEA 5CXPA 4G7SB 3PREA 3OG4B 3EJPA 4F2EA 1USQA 2GJJA 4M03A 3GMQA 1GYCA 5EIIG 1Z3GL 1PY0A 3PU7A 1IC1A 1GHFH 3BGFC 5DRWA 1SF3A 2VR8A 2CXGA 4NQXA 2ZCHH 4P99A 1CD1B 1X6NA 4BRVA 2GSMB 3QNFA 4JDZB 5CD5D 3FF8A 2WKLA 5I8KH 4PRPB 2QKIA 2XVLA 4FQJL 3OPZL 3PABB 1TYEB 1RZ7L 2OI9B 1QBLL 4NKDB 2DWDA 1NL0H 2G2RA 4WW2F 3BDXA 4MAUL 5B1JA 4CVZB 1YEJL 4BQ8A 2MEJB 4H8WL 5JMOC 2JELH 2G3XA 2E9GA 4HUUA 4UT9L 4LNRA 4D9LH 1KDIA 3DHMA 3EHBB 1RPUA 5IHZA 3FUDA 1ZK5A 5F0LB 1DQTA 1H3VA 4JAMB 1HI6A 2C5DC 1FF5A 2BS8A 3BP6A 3D30A 4LOEA 3EOYG 1NFDF 3IXTB 4FEIA 5GRUH 3KYNB 4JREC 4RQQA 1PZAA 5LGJA 4P2YA 5JZ7D 1T2XA 4WHYH 4XX1E 1RERA 2EACA 1XL4A 1XQ4A 1AZCA 5B22A 2FT7A 3MRMB 4WFEE 2D7MA 5DUPL 1NCWH 4OJCA 2AEWA 4P4KA 2D3JA 4TUKL 5E2VH 4GKZB 4M3HA 3OC5A 4JFQA 3CFDA 2HKFL 4GUCA 3EO9L 3ARWA 3RYMA 3WHE1 2FWLB 2VDOB 4JFEB 4X4XA 3SOBL 4R2GC 3MV9B 4RZKA 3GSNB 4NQVB 2WN2A 1U36A 5HHNA 2PTTA 2D7TL 2IDUA 3L3GA 5AWNL 4AV0A 2ZX8A 3RIKA 3SE3A 3FOLB 1P6FA 3NEOA 4N2BA 5HGBB 2PCFA 1CGVA 1UYWH 5E6IC 1DJHA 4QGYA 1YEJH 2DWSA 2ATPB 2HSIA 3PWPB 3VWKA 4XVUD 1AHWC 4GUPB 3AGWA 3QB7C 4N28A 3AUWB 4JANA 4MS6A 4P5SA 5TK4A 4AH2A 3CDFA 1RULH 4KDTC 5LGHL 4XPFL 4DN4H 2YD7A 2C1OB 3P3RA 4LCUA 3PJSA 4B7LA 1NUFA 2Y06L 3DROA 3KPLA 4OZFG 2O5YL 5CU9A 4K5OA 1X4XA 4IBQA 4MJ5A 4YGVA 2Y3NA 5BJTB 1GRWA 4E5XA 2HMIC 4NO3B 1HKFA 3V6ZB 3VWKC 3LJ3A 3RTQC 1IQWH 3KHOA 5JR1H 5I8EA 1LO4H 1DVXA 1ZTXL 1HJBC 2FK9A 4E2OA 1NFIA 1QNZH 1MF2L 3V0HA 2ICWB 4OCXL 3S4SG 3QUXC 2KI6A 4KNSA 1BWWA 4GRLC 3L3DB 5CZVH 5E9AA 5FYKD 4KQ3L 4WO4C 3UYOD 1PJ9A 4I9XA 5JNYA 2J20A 4HIPA 4P3DA 3TL5A 3PAZA 5IHWA 3RGHA 3ZMRA 3JTSB 5CLXA 4YDZA 1PNDA 2DWXA 3VRJB 3D69A 1D6EB 3MCKA 2WBJA 1IIIA 4JL2A 1NLDL 1BFOB 3DX3A 1BVNP 3SDXF 5TPWH 1H0DB 4C4KO 1DANU 3CFQA 1Q9LA 1QBBA 2FVNA 1L5GB 4RMVA 3P3SA 3SGEH 3U0TB 4ZMWA 3P0GB 5BS0E 1OWWA 1KCVL 1YNTF 5DQDH 1D9KA 3MRRB 4OJAA 4BFIA 3O0RH 2YMOA 3QEHA 3NZ8A 2YGOA 3LKPB 1CTNA 4PGEB 5JIMA 4XN1A 1N5YH 1WCQA 4NDMB 2Q8AH 3K8KA 3DX9B 4HS3B 2AMGA 3ZE1F 1IGIL 3CDGA 3DXAD 3R0NA 1ZT7A 3VH8G 3OX8A 3TA3C 5I1GH 2RBLA 1XAKA 5IFAL 5JLZA 5GGQL 2CALA 1V10A 1MRCH 2WM0A 1A6AB 2G5BB 2FWOB 4Q0XH 4PJAA 4BZ1A 1I7ZA 7PCYA 5HI3C 1BZOA 2Y4SA 4M5TA 8FABA 4XC3H 1KPVA 4LMQI 4P5TD 1J8HD 2CR3A 3REWB 2E9JA 3AWGA 4HWNA 4I85A 3I9IA 4DGYL 2KZKA 3FONA 5I2IB 1XEDA 1ETZB 2BIPA 3ME0B 2VDPH 3N0AA 3QXDB 2XTJC 2CJSA 4DN4L 2A6KB 3H8NA 1IBBA 1NM4A 4KRNA 1RU9H 3I6LD 2W88A 4OGYL 5FC9A 3RVVD 2XJLA 4WI0A 1QSFD 3NK3A 4A1RA 3VQ1C 1Z9MA 1WIOA 2FEJA 1ES0B 1RIUH 2E9WA 3TYFA 4YDMA 3U82B 4ZYKB 3L4CA 4QMEA 3GMRA 4QAMB 4WFFE 3GIZH 5EFIB 4XAKE 3SGEI 3CC1A 3T65A 3CQPA 1IBZA 2PR4L 3EG9B 2C9RA 2EIMB 5I30L 4K7PL 5KSBF 2KMWA 3J8F7 3O2VL 3QDJA 4U3CA 5D1QA 2JK5A 4OGYH 3T0EB 1QEWB 2BDNH 3MJ7A 2XQ0A 1H3TA 2YXWA 1T83C 1JZHA 1VZIA 3E1F1 3HMXH 2Z3FA 3DSFH 3QG7H 4KI5E 2W0PA 3VDAA 4NUGH 4RWYL 5E9DE 1KT2B 3S6CA 2B16A 3IJSB 5DUBA 5SX4H 3Q8AA 5KN5A 1DDTA 3IAGC 1F2QA 3DHJA 4PWGA 4Q6KA 2J5LB 3QEGH 2X87A 1NFDE 4PI2A 4ZNEA 4HGKC 5IJCC 3WXVH 2JKRM 1XGUA 4JJOA 1HCZA 4HUWB 3ILEA 4H8HA 4XCNA 5EC1B 5B38B 5DJ2B 3D5OF 2NY7L 1GOFA 2G4GA 4N8VG 2VWEE 1OTUC 1QI3A 2PLTA 5DUPH 4ZUVB 1GSMA 4UT9H 3TBVB 3O45B 4QLWA 4YHYC 3BPLC 3UBHA 3V0JA 3WFEL 4MNGA 4P5TC 1FZOB 1ODAA 3G9AB 1A7OH 4UYPA 4R3SA 3O45A 4EDWL 1HAUA 3UTSD 2BNRA 4CVXA 1V3KA 1J9SA 3K0YA 4N0FA 4EZKA 3UCRA 3DPBA 4ADIA 4G80A 4UBDC 1OZUA 1LD9A 2DEWX 1ZKAA 3FCTB 3UTSA 1QSVA 4F92B 5C0AB 1U42A 3SE8L 3PAVA 3CFJA 2EABA 1RK0A 3KWTA 2YXFA 5GSRB 3GO1H 4XPFH 3GJEA 2L4OA 5C0BB 1A1NB 5IV2B 4HH9A 1J8SA 3QUML 4B3EA 3P77B 2AK1H 2NYKA 4MNQB 4M8QA 2CO3A 3FH8A 3T2OA 1SLUA 1FFPB 5J9PA 4Z0BH 2NX5B 4O2FB 2CBMA 5EU7C 1AS8A 2BIOA 2K8MA 3ATEA 1JAEA 2BX5A 3FMGH 3EHBC 1A6WL 1NA8A 1RULL 5GRYA 3SDDB 3CK0L 3MBEC 1WC7B 5DRNA 1MZYA 1P53A 3KW7A 3AREA 1IAOA 4Q4EA 4YHOH 3DX0A 5DHYA 2D3VA 2RGSA 3TN0A 5AVRB 3CFEB 4ODTH 1NCWL 4QXTB 3MRDB 2JQZA 4Z5RB 4RMWA 3M45A 2V5YA 3BKCL 1R9FA 1N6UA 4LLQA 4P3WA 4JZOB 3UEQA 3T08A 1EJ6A 4GH7B 3GI8H 3KL5A 1MDAA 3CVIH 4ORGB 1RZIA 5E6YA 5A2LH 5I16B 4XO9A 4YXHL 4TTGA 1XHHA 2VZVA 4JCMA 4GI9A 5C08D 3FQWA 2G5BA 1L3WA 1MFUA 2B4CH 5D2LB 2IAMB 5BMFL 4ILDA 3VFTB 5HVHB 3CSYA 2H9GB 2XA8L 2A74A 1YZZA 4K3DL 4M4RA 1BWMA 4AYEC 2ZX6A 4JO3L 2OMUB 5H94A 4MWFB 3OMZA 2FL5A 2YBRA 3FU9A 4X50A 2VKXA 2CCLA 5LKNA 1NL0L 2F2HA 3LX9A 4LVOB 2MKLC 4LB8A 1KJ2B 5C0CE 3U6RA 3ULVH 2J1ZA 2E8ZA 2V3EA 2NTFB 3N42B 2WXRA 2X9ZA 3N1MC 4C58B 2VDLB 5LBGA 1TTGA 1XCXA 2F54E 3FO1A 5KSBE 2JELL 2GJ6E 4P5TB 4HK3N 1XH3A 3LRKA 3ZO0A 4G43B 1CF1A 1RSFA 5JXEA 3EDJA 1WAPA 4OGAC 5DEJA 3HFML 4JZJA 1ADQH 1FJ1A 4XN5A 5L0QC 5TQ0H 5F7LB 1TF4A 5C09E 1QUNA 2PUQT 2UWEB 4ABWA 1ILUA 1YLBB 4YDVB 1N19A 4H20H 3RDTA 4XXDB 1TNMA 2X3AA 4ADGA 1BVKA 2VRQA 4QF1A 1JSYA 2YQBA 1IGFL 2FX9L 3VVVA 4AI7A 5KBLA 4YHNA 2AJVH 3O6FA 4M29A 1W15A 1KIPA 5EZIL 4RBPH 4NP4H 3OGCA 3FUFA 3PQYA 4X7FC 3VRIB 1F3DJ 3K5RA 1G43A 3WFCH 3A22A 3FB7B 4N0FB 4AGPA 5DEGA 1HEZB 5E8DH 5HHNB 3HJEA 1YEWA 3VI3A 1PZSA 2KC0A 1CFSA 6TAAA 4Y19B 3IU4L 1FZOA 1EHLH 2F58H 2HCZX 2ZWNA 3FU7A 2J8UF 4ZS7H 3F7PC 4V11A 2WTRA 3VFRB 5HGBA 3VSUA 4AOFA 4EN3A 4GYBA 4N8CL 2RQ8A 3RWEB 2WLLB 2Y7OA 1KBGH 4F8PA 1RZKL 4H4NA 4JO8A 4JRXA 4BXVA 3C6EA 1BQ5A 4L9LA 4ODVH 4Y9GA 3D1MC 3MRHB 4YLQT 3BD4A 4ZXBB 4FEMA 5CSZA 4RQQB 1WHPA 1XF1A 2JCWA 4KK9C 3IXTA 4LCYA 1KCLA 2A83B 4M6MH 2PTUA 3KYOB 3DRQB 3WDJA 4RETB 3N41F 1QBML 2Q3ZA 4FLQA 2OTWB 4GEJA 4R4NC 5EC1A 3B9KD 4PCTA 1JNLL 4MA7H 3QDJE 3ZTNL 2X0WA 2XYBA 3P9LA 4Z78B 1OGAB 1IGMH 5FLVA 4OFQA 5HTSA 1G0XA 4PN6A 4JFPB 1GAFL 1D5IL 4JR9L 2EYRA 2R2HB 5INCB 4P59H 3K1KC 4JW3A 1DLFH 2BK8A 2W60A 3S3JA 1FVEA 4FNTA 3LTVA 2JKLA 2MPAH 3HKZA 4FQ1H 2V7HB 2K6WA 4HSCX 3L1GA 1YEEH 4QXGL 1DDHA 3TP4A 1LE5B 4OJDH 2X40A 1RUKL 4XAWH 4NLAA 4L8DB 5GIRA 2X9WA 4DKTA 3FTGB 1LP9A 4QRQA 5EU5B 4JJ5B 3PIQA 4Z7WF 3SOBH 1KEML 4IU2A 4NJAL 5GGTL 5GJSL 3JYCA 3ZDZF 3REWA 5IWLA 3DTDA 1YEIL 1FA4A 2X4SA 3KWVA 1AZNA 2FGZA 2IWFA 5IEHB 1JHTB 3U9UB 4WI3A 5CSGA 2FJHA 3B6SB 2QPEB 5KVGE 3WCYA 4HP5A 1QLRB 3HI6H 2NY4D 1WS7A 3PP3H 1AIFA 4ZPVA 3LEYH 4UM9B 1A4KB 4UTCA 3CD4A 2M26A 1T3FB 4FQXC 2YRZA 3ZGIA 1UXSA 1KIQA 4NQUA 3ZRFC 3NG5A 4QJ3B 4BFIB 3UAEA 4ANUA 3MMEA 4P9MH 2C1PA 2X53A 4LCWB 2VLKA 2A0LC 2EDEA 4AV5A 1DSWA 3HBQA 4HC1L 1SUJA 3QEGL 2V3FA 3L3KA 4RGMC 1H8SA 3QNYA 4DGUA 3M1BB 5A40E 5DD3H 1YC8A 4Z6AT 4Y4KB 1MOEA 2VXUH 1U92A 4HLJA 5AVUB 5KANI 3IBOA 2UWEE 3KWWB 5AEAA 2VE6B 4XCYA 3DYPA 3V0GA 2ZX7A 5A2JH 4JFED 3EJSA 3P73B 5D1XE 2Q6WB 1OCWH 1NCCL 3C8KA 1U8HB 1YY9C 2VQUA 3HCVB 1IM3B 1BJ8A 3Q6GL 4L2LA 3LB6D 5BOPA 4H26B 3RFZB 3HZVB 4GW1A 5I6OA 3OKNA 1MCHA 2XC8A 3BPNB 1UVQA 4M62H 4K94H 4FMKA 2V9UA 3SE4C 2JH2A 4D8PB 4W4OA 3HG3A 1NGXB 4JFFA 4DEPB 4GKOA 2OP4H 3U2JA 2QL1A 3MUY1 2VR6A 3PWNB 5I19H 4W9ZA 3B3BA 4DO6A 2WO3B 2CQVA 2ICWI 4BKLA 1KXVA 5FECA 2CDFB 4PJ8B 3Q1SH 4QT5B 2VLKE 4NQXB 3GKWL 4A2HA 1BM3H 1CFVL 2NT1A 4GAYB 1XGRB 2OJEA 5FFLA 2IXQA 3D18A 4XCFH 3C08H 4M3JA 3AXHA 4KRPC 3H42L 4M6NH 4NQCB 5AKVA 5PAZA 2XQBH 4N2OA 1IGJB 1RZKC 2ZE0A 4NRYA 3B8SA 3W2DH 4BCZA 2VDNL 4J8RB 4M43H 1OQXA 5DYOA 1P84J 5CZXD 4I1RA 4RNRB 1XGYH 5FYJH 3CFDB 3O2WH 4F93B 3K5SA 4OCWH 5EU6E 1FORH 4PTUA 4OZ4A 4QRRD 4RAUB 3T0BA 5I1EH 4DF9A 4OIIL 3X13B 2IC2A 1HHIB 4AQ1A 1I8LA 1AYOA 3NA9H 4H8VA 2D9CA 1KB9J 1KIRA 5FUOL 3Q8CA 4PRID 3QGVA 5GJTH 1SJHA 2NY3C 5H8DA 2Q3AA 4D7BA 2JKIS 2MCAA 4UUJA 3NCXA 4H1LG 5DFWH 2NQCA 2OMTA 3OQ3B 4P4KB 4AGLA 4X0NA 5HGGS 5HJGA 2JWYA 2N3JA 4EAEA 1PD1A 2CDEA 5DD5L 1TJMA 4FCAA 3KLSA 3QJHB 4A38A 3GSXB 1F4XL 2F54D 3LY6A 2G2RB 4A55A 2WXKA 3IS1X 1JHTA 2ZXAA 4Y1SA 3M1OA 1PZCA 3KW8A 2OJEB 5EIIB 5H35B 5EIQA 4K5LA 2J71A 2X5PA 4IRJC 4GG6F 2VISB 3O6LL 4F2FA 5EU4B 2PWGA 2H0EA 3AADB 4JJ5A 4ICXA 2XLLA 2NMSA 5CBAA 2B9BA 1HK6A 3TNMA 4WEEA 1HQRA 4UQCA 5F88A 1BOYA 4XRCB 5IB2A 1NMAH 1T20A 2F53D 2AV1A 1Q94A 3B7RL 1AOHA 1ET5A 5DWUL 5IP4A 3DVFA 1FBIL 4ONOA 4F7KA 5DD1H 1RZJL 1UCBL 3QZNA 5D55A 3TFBA 5I82A 3AU1A 1OTTD 1H6EA 5EZPA 2E27L 3KXFB 1SF5A 3HW7A 4K7PX 3BCDA 4S10A 5AWNH 5HGAB 4PGZA 3SCMB 4PJGA 5KYUA 5CJXA 3HE7B 3HAEG 1RZFL 5IEKA 4FYTA 5DJCB 4HISA 4L1DA 4CRPA 2B9AA 3SPIA 4X9IA 1D7DA 1ESOA 4EI6B 4JE0A 1F5WA 3TO4D 3FBKA 3GRWA 2NY3D 4I77L 2CIKA 5B3JF 2XACC 4PRAA 1M57B 1NKOA 1VLXA 4AJYV 1E9PB 3CSFA 3SBRA 1HZKA 5GGRB 2WLYA 4HPOL 3AAZB 3H7BB 2FHFA 4B97A 4OZHB 1IKFH 1IM9B 1YNTB 4MVBD 4YSSA 4JZNB 4HJJL 1EAOA 3FK3A 2V8LA 4KJPD 4GAFB 5T5NF 2UWEF 1A3ZA 4OKVB 5ABDE 5I16A 5HGDB 4H0IA 5IJKA 4XNXL 4PJIE 1NOLA 2KPNA 5A6LA 5FM4A 1G9NC 4N22A 3QH3A 1Y07A 2A7BA 3MDJA 1XH1A 3IE4A 3U7WH 5FYLL 5C09A 4CMHB 2OXHB 3MKGA 4R97C 5DXWA 5DZ9A 3EJRA 1C7SA 3VNZA 3UYRL 2X3BA 1II4E 3D48R 4GS7B 4IJ3C 2RFXA 4X6DE 1OAYH 2EVIA 1RUAH 1MFCH 3I6GA 3M88A 4L1BA 4M7JL 2HH0L 1G7HB 3DHPA 1A6UH 3CFBA 2AQTA 4KHXH 3MGOA 2X4OB 4XPBH 5GZOD 5LQBH 2CKBA 1Q9KA 1VB9A 4RGOH 2VDLL 1RZGA 4FLOA 4KMQA 2HTLC 2H3XC 3I2CL 3SODB 2ZOTA 3SD2A 2PPAA 1NMBL 3VB8A 4U1LA 3OKEA 2R2EA 4XODA 4K3DH 4WQOA 2DB8A 3DDFA 3ZYZA 3A0OA 1QBAA 5ESVB 2EKSA 4NM4H 1WZ1H 5AAMC 4ZTOL 3H2PA 5JHDD 1TSHA 3RGVA 3EZJB 1CE6B 2WBJC 3LNEA 4K9EL 2V0AA 2ROYA 2QLYA 1MVUA 2LVCA 2P48B 4NIKB 1I3RB 3JWOH 4KHTL 1CVRA 2CBQA 1CGSH 1ZE3H 2I5YH 3HN3A 5C0AE 2NXZD 1IC5H 2DMCA 1E9OB 4M93C 3AMKA 3KYOA 2DOCA 4MVBC 5DZPA 2JXMB 2BHZA 4NM4L 2YAFA 2QMJA 3LRMA 2AJUH 2IBZY 4WWNA 3RY4A 3LXBA 5CEZH 2ITCB 1N9PA 3NIDE 3DXAB 3F6LA 5LNGA 1QRND 2NY0B 2F1EA 3A6BH 3GBNH 3S5YA 2WQVA 3TJHD 1HDMA 4DVBA 4J4PD 2G3NA 1XIWC 4IS6B 4PJEF 5AYUH 5C1MB 2A4CA 4WTZA 3ZUCA 3DSNA 5DCCA 4QPEA 2WC7A 1M05A 3NN8A 4ZFZB 4K71B 5AW8B 3NDZE 3HPJB 3F84A 4HCRL 4ZTEA 3IDJB 4YL4A 1TTAA 3BD3A 3QS3A 1F41A 5B1KA 3WN5B 1KYAA 4TQPA 3LZLA 2ZAHA 4NUPA 5BRQA 3KNBB 3QP3A 3RL2A 2WLIB 3IRCA 3K0WA 1Z9NA 4KROB 5C8JB 2J8OA 3ZHDA 3CFKA 4HEPA 1ODUA 4NOBA 1QAWA 2L7EA 2IPUK 3RFZC 1CE1L 1KN2L 2GKIA 4KRLB 4HK0A 4X8CA 3KPSE 4CMMA 4F57L 5HPMB 4N0UA 3GS0A 2GFBA 4HA1A 1K5NA 3DUSB 4O2FA 3R06A 3US0A 3UBFA 3FQUA 3UJTH 3FQXA 2EDMA 3VW3L 4KWUA 1AIFB 4X4MA 1DJIA 4GRMB 4XMUA 1GGIH 4MNGE 1J1PL 2YSSA 1S9YA 3DMMA 4OVUA 2NY0C 3R0MA 3MRBB 4XE5B 3S2CA 4IKLA 4M6ML 1SMAA 2HUHA 1BQHG 3TA4D 4AC2A 1F2XK 1MDTA 5CWSB 1AYRA 2ZYHA 3LKRB 5I5IA 2EC9T 2DPKA 5D7LE 2M83A 2ZYSA 4MMYA 3TEWA 4BDVA 1BMWA 2BHFA 2O5NA 3WDIA 2R1YB 1AZZC 3WXVL 3AY2A 3MUGB 3DPBB 3NJGA 4Y5VB 5C7ZA 1XIWD 4JKPL 2A6DB 4NM8L 5DT1L 4P48A 3UC2A 3QFDA 1JPTL 3NCFB 4UAOB 3IMTA 1SRDA 2NY1D 2PN5A 3DV4B 3U25A 2NNRA 1BF2A 3IJYB 3S37L 2ZONA 3E6FA 5HDQH 1ID2A 2NNAA 1VADB 4LO9A 1JG9A 4ZRGA 3C5ZB 4M1CC 5BQDA 1K4CA 2FJGB 3O3AB 2Y5TA 1K5WA 4HXAL 5JR1L 4DKFH 4YIQA 1RUQL 3FDWA 3LS5H 2XVBA 4HWZB 1JTTA 4P9HH 2AK4E 5K9QI 5I15H 2XXFA 2ZKHH 3BZFB 1CFTA 4PGCB 4CUCA 3WEXA 4W6YB 4JPVH 1RXLA 3JWOC 4OV6F 5FYKU 3RWFA 1X7SA 1PKOA 1URIA 3MACH 1MHHA 2K4WA 3QNYB 4CKQA 2VQTA 3VGAC 2A9AA 1WBZA 4HV8A 4CMHC 4NI6A 4CN1A 3RTQA 3CVHL 2YD3A 3JT0A 1UEYA 1PCXA 4PV1C 5I1DB 2DKUA 3X13A 4JM2B 1R5WB 4WU5B 3QIBC 1Z5HA 1WWWX 3CLFH 4B9IA 1FAIL 5ADPH 4J23A 1W8NA 2EO9A 5AW4B 1Y0LB 3ILPB 3RIFK 4PJFE 2P8MA 1MCOL 3SQBB 5EOCJ 1I8KB 3Q48A 4KK5C 4W9GC 1XGTA 2FZ3A 5C0DA 5F7WC 4NPYB 4MXQD 4Q9RL 3KJ6H 2WKOF 4WI4A 4UTAH 1AD9B 1JVKA 2AQNA 4P3CH 4M9PA 5T1MB 4ZUUA 4R0LB 3OZKA 2P5EB 4JM2F 2ATPA 2V9RA 2IBZX 3IXAB 5FECB 3VD5A 3VO0A 2P4AB 4GRLB 5EEZA 4U1IA 1FNFA 3NFNA 5B3JE 4TLTA 4M61B 3MRJB 4F58H 4OIFA 5EMYA 4HKZA 3DX4A 5ICYB 4WV1A 9PCYA 2UX6A 1NDMB 4R3SB 4FQHB 5TE4H 1PX3A 3MLZL 2XSKA 1OM9A 4X7DC 3EOBB 1A1MB 4LEBA 3D8MA 3WMPA 5AG9A 1BG1A 4L3AA 1FJ1B 1SMDA 3AQZA 4N25A 3HR5B 5D7IB 4UDUA 2CUHA 1CURA 4W68A 3ISWA 5FV1L 3S5LB 2OJZL 2NUTA 2FB4L 1DLFL 4U3XA 3B9KC 5D9SB 2PO6D 4QRSA 3I75A 3SDXB 3MLYL 1MCPH 2H8PB 2OTWA 5AVVB 1A7QH 2EIZA 1A9BB 1MCWM 2BOCA 3CH1A 4EKXA 3IGAA 3ARDA 3PS6A 4WI8A 3BE1L 4HF5H 5I1AB 1YYML 5E2UH 4EZMA 3PP4H 3QWOB 3BKMH 2E46A 5FV2A 43C9A 4MA7L 1DVFC 1IKFL 5M7QA 1OE2A 2NW3A 4PLJD 2LAAA 3LKQA 3N41B 4N2KA 3SY0A 3MCLH 2YRBA 1UWFA 4V2BA 1LWJA 5HI4D 1AJ7L 2ESVA 4FZEL 4BA8A 5HDRA 4HJEA 2BP0B 5AL8A 4KK6D 1DP0A 5C0NC 2J4WL 1LE9B 4GSDH 5GS0H 1EZLA 1X5AA 3MRQB 5A2CA 4UB0L 1G7LB 2W1NA 1E0OB 1C16B 2HKAA 1ETJA 4Q8BA 2ZUVA 1JNJA 5EOCL 1I8UA 3L3IA 4F58L 4Y16D 3MREA 3RGVC 2YN5A 1KUMA 3WTVA 5AOZA 4R5VA 1IIKA 2F19L 2YKLL 3MUGA 4Y5VA 1NC4D 5A2AA 1E28A 1BREA 1UB5B 1TJHH 4PRBA 2NY3B 1VGEH 2X4RB 1KZQA 4L23A 1JBJA 3BUBA 4XGZB 2G60L 3TJHC 2WYTA 5H37G 2QKSA 1GCFA 3VXRE 1J8HE 2R4RH 3GBLA 2QGEA 3VXPB 3WNLA 3I9GH 5LG6A 3NABH 2OS7A 4IEFB 4UTBH 3CLEL 3BZ4B 3VH8B 3UG4A 5J6HA 2XPGA 1IC4L 5DR5H 4PWEA 2AQQA 4IRSC 1QSFE 2IG2H 3BAWA 2OA9A 3K1DA 4U6VL 3BWUF 3TS8A 3FT1A 1KGCD 4H20L 1T7VA 5E00A 4PJDB 3NCJH 3U1QA 1FCGA 1EBPA 1WZAA 1YEEL 4M1DL 4BSVA 2FLBT 3TEZA 4PP2A 1T5WB 3QC6X 3WIHA 5HYQA 1E8WA 2DLIA 5GGUB 4UAOC 2OMZA 3K2UL 3PNWB 4HD9A 3BAXA 1I82A 1YHPA 3VM5A 3AWEA 4M9OA 2HG5B 4YNYB 5DFVD 5FM5M 3LB6C 1OWRM 1T1WA 2JLPA 4U6VH 1KFGA 1M7DB 2CRMA 1XGQA 1HL5A 3EOAA 4R96B 5L4IA 4HJ0C 5JW4M 2W9LA 2YD9A 1VCBC 3E6FB 4GQ9H 4LARL 3L95B 3TV3L 2EICA 1M56B 1MI5A 1UOLA 2QPUA 4WW2B 1DQQB 2C7UA 1FL6B 5GGTA 1RU9L 2ZCZA 3JTTB 3LRSA 4N8CH 4NENA 2AEOA 3QAZC 1JPFA 2ED7A 2F8OA 2BC4A 3QDGA 1OTUD 1H3GA 2W8CA 4R83A 1RZIB 4GNKB 3LN4B 1F6FB 3CBKB 4O4YH 4Z0XB 2CO6A 5TTRA 2HLEB 3GIVA 3QAQA 5C3IA 1RZQA 2G2NA 5BJTA 1LJMA 4WU7B 5B8CC 4NO5A 1M1XA 1IB5A 3VXNB 3O2DH 4PJXB 5JOPE 1YPZB 4XH2A 2J5WA 2Y2TA 3GKWH 3D3VD 4NXSA 1MHPH 2WOBA 1R3JB 1JRHH 3GRWL 4UBDD 3PRZA 5EPMB 2IOMA 4IRSD 5CZXC 1I1CA 1KJ2H 3U0PB 1ZLDA 1Z0MA 4ORZC 1NJ9A 5DC4B 4ALAL 5IBUG 4OW6A 4DETA 4KZDL 1NGPL 1U4FA 1GYWA 4MCMA 4UV4H 5IFHH 1BD2A 4FQQA 2EKSB 1N18A 1JDCA 3ZVVA 3MRGA 4KV5E 5MERB 1MCFA 4S2SA 2P8MB 1J05B 3NQKA 5L4FA 4YSQA 1AGEA 2FIKB 3BMVA 5M95B 2Y7QA 4RSVA 4FFZH 5L2KD 3FTVA 1MWOA 1A66A 3SYAA 4WU5A 4KOBA 2YD8A 5IMOA 2DL2A 2F7PA 4BE6A 2DL9A 3EJJX 1ZGLA 2Y36H 5A6MA 4NN6B 2PR9A 1SHWA 1GS8A 4YZFE 3UH8A 1LEGA 1HYRC 1TSRA 1NTDA 2BCKB 5K9KB 1RQ5A 3LN4A 4X5LA 4YAQA 4ZMZA 2YPLE 3D39B 4E9TA 4NYLB 3JZYA 2XG4B 2CAKA 4CU7A 1RJYB 5I6XB 3WENA 3RHWK 4NNYB 1AQDA 1NDGB 3UAFA 3P3YA 1QR1A 4FJYA 2IADA 3LHPH 3KLDA 4Q2ZA 1CFTB 4Y1AA 4HC1H 3RHWF 4DW2L 4UILL 5B39G 1BJMA 3V10A 3PGDB 5FB8B 1E9PA 2CHXA 4CVZA 2ORBH 3VGAB 1XB8A 3EH1A 5KUKA 4DP2X 1W0WB 1MHCB 1P6AB 4GUQA 1G7PA 4L8CB 1A7OL 3JXAA 3D06A 1PEZA 5T33H 3QUHA 4G82A 1BBJB 4GFTB 3O6KH 1P7QD 4P3CL 3VD1A 1OLLA 1RK7A 1OTTC 3ZT5A 4UU9A 4HBQA 3O8XB 3PL6B 5IJDC 4ADJA 5I18L 1JGIA 4LSRL 2F19H 3PHQA 4OCSL 3SYOA 3SCMA 2R69A 2DMBA 4XBPA 2CUMA 5ESVA 2ADJA 2CO7B 3VWJB 5KS9F 2JJTA 1SY6H 2EEXA 4DJMA 2CJUH 3FTZA 4BHUI 5HGHA 4Z7OF 4I0KA 1BIIA 2GBVA 1R3LA 3FRUA 5F1KC 3U36A 1AC0A 1N64H 5SWZE 1QEWA 2YQGA 2ADJB 2CO7A 3N50A 3QEQA 1ET8A 3VWJA 2MQGA 1JRHI 3ZR6A 2AVGA 5HGAA 4Z3IA 2QGDA 4BJLA 1ZVSB 2F0CA 4KPHH 3LH2L 3H56A 2VH5L 3BUYB 4GXUM 4AG4H 3IKCA 3BN9D 4FKKA 2ERJB 3KGRA 1WJ3A 4AM0B 1FQ9C 1RMFH 4P57B 4O5LH 1NAMB 4XVUC 5EUOF 3SO3B 4ESKA 4YHYB 1RURL 1GAFH 1CICB 3NAAL 3THMH 4M6OL 3UROR 4FDWA 4OCYH 3L9BA 3MJWA 2P80A 4MQ7A 4JG0L 3SKJH 1XR8A 3WUWA 3TH2T 1FO0A 4TNGA 4DTGH 4PLJC 2Z64C 4P23A 3GGWB 4X99B 4M7JH 3ZYOA 5CBAB 4G1MB 4ZI8A 4S1QH 4FADA 1ZGLM 1J9TA 1OAYL 4CL7A 5KJRL 4C83A 3N40P 3QQ4B 4IOSA 1U95B 3OPUA 3ARDD 1HHGA 2FH8A 4AYFB 4GLRI 2E5EA 1SHMA 2B14A 4PRNB 1KC5L 1MCKA 1MAKA 4MAYD 4YOKA 1GVIA 4FLRA 4HCFA 3LN5B 3H2QA 4YVNA 1GKOA 4XP4L 3MTXA 2R29L 4JDEA 3QR2A 1ZLWK 4ZMLA 4AMKL 3TT3L 5ENWB 3RGVD 1SEQL 3B43A 4YSPA 1DFXA 2ITCA 4JM4H 4LOVA 4MKMA 4KROC 5BO1L 1AY1H 1MEXH 1FVCA 5CS7A 3MFGB 5ETUB 2X05A 4C56D 5HI5C 4HLZH 2HTLD 4FHJA 2BSTB 1XF2A 1C12B 2ADIB 1XFPA 4YFDB 2HZHA 5EORH 2R4SH 1A6PA 4F5CA 4G70B 1KB9K 4XNQA 3FSOA 1ZHKB 2FIKA 2UZIH 4H5SA 4HGMA 3FQRB 4FNPA 3MODH 4P05A 5D9SA 4KH2A 2BVOA 2CIIA 5LLIC 3EGDB 2LHAA 4R5XA 3SGDH 4ZX4A 3DX7A 5DYOB 4I4WB 2DIJA 1J88A 2WB1A 2ZAIA 4YK4C 5TJWK 2E7LC 2W07A 4R4ND 1WCBA 1IV8A 1JHKL 2YGQA 1F90L 2EDJA 2X10A 3EYSL 5F7NC 3WO4C 3X2QB 3MJ7B 3OZ9L 4JJHA 1R19A 2CBPA 1E3XA 4GFXA 2IGFH 4PJHE 4QDGA 4U1IB 1A0QH 4U1KB 3FT2B 2GJZA 1XSOA 2FE0A 4XP1L 2OMWB 2WLJA 2A74C 2WBKA 5F0JB 4BKLB 4XXCC 5F0PB 2Y3AA 4AJVA 5F9AC 4L3FA 2IAND 4OCRH 1EANA 3MV11 5FO7A 1Q90A 2BC4B 5J6GB 1F6AB 1TOXA 1UD2A 1X7QA 5AUMA 4FLHA 2JLLA 3WYRA 1YUKB 3KPTA 1XZWA 5EU3B 5CJXC 5J06A 5DD6A 1PU0A 3IDMA 1MRDH 4HT1L 1P5UA 5F1IB 3IE9A 2FECL 3CN3A 1JP5A 4XMLH 4Y5XA 4XBEL 4QY8A 3AQYA 1KN4H 4F7PB 4AYDC 4I18A 5TF0A 3X12A 4NKOB 1QR4A 2JCCB 2VDPL 4LHUB 4Z1PA 3NBNA 4LOUD 4XNDA 3D39D 1JNNH 3SDCB 4P5RA 5B8CB 2YFOA 1QI4A 1XZ0A 3KGUA 3NMEA 1HZLA 5LDUA 1MI5D 3K4DA 1I7RA 3KVDD 1XDTT 2QSTA 1V7NH 3DX8B 3HC3L 1CMOA 3X1BA 2JQMA 1OP9A 1E4JA 1MCLA 2V33A 2GEEA 1T1ZA 4KTEL 3GMPA 3UBGA 1A3LL 1BQHA 2A38A 3LVEA 1CC3A 4KY1L 4NAMA 4F3FB 2YC1A 4LNVA 1CBJA 1N2RA 3FSAA 2JCCF 1YUHA 3DBSA 2ZUUA 3L3HA 1X5JA 4J4PA 2FO1A 3G5ZA 2P5WE 3OL2A 5IQNA 3ZK0A 4IM8A 5ALCL 2LLGA 4D0CB 3L4VA 3F58L 1G9ML 4I0CC 5K9JL 1HHJA 4H2CA 1EXGA 3LKSA 4NQSB 2F5BL 3WTSA 1MFBH 3N43F 2VERN 2R23A 3BKJH 2K8QA 1SBSL 2O26U 4PTTA 3TPUA 3WS6C 1KTCA 2WKGA 1NFIB 4KHXL 2VW7A 3MNZA 1UQSA 3X3FL 1QFHA 5JQIB 1JVOA 3P4MB 5KAQF 1L6XA 1NBVL 4PTTB 2GSGA 5F93C 2VDOH 4MMYB 4OZGB 5C9KA 2ZPKL 5F7EH 1RZ7H 3K74B 4ELDA 1KENL 1MZZA 3GMQB 3O3UN 4N5EC 2PWHA 4MHHG 1X4ZA 2IV8A 3CPLA 5I8KL 1CLOL 4S1QL 4S1DC 2ZOWA 5DF0A 3TO4B 4H8QA 1A64A 3ZRCC 4JGNA 4LASL 2JMRA 2FX8L 3BFOA 4NO0D 3CC5B 5DZNA 4JFPA 2V9QA 4GUOA 1FZJA 1IQDB 4KTYA 2HT2C 1A4CA 5KZCD 2QZ5A 4W70A 4J3VA 4EE2A 5KSAD 1EEQA 1JWMB 3CHPA 4OLVL 1HWHB 3MAWA 4DGVH 4UTBA 4WVRA 3MBED 4JPWH 5F7MC 2WNXA 1RIHL 4OFIA 4TUKH 3H9SB 3P0VH 1KGWA 4UNIA 3T8XA 1EFXD 1KGYE 3B2XA 4OV5A 5A7EA 5DK3A 1UD4A 2YUZA 3D2UD 1OB0A 3MJ9A 1BD2