2P5PA

Crystal structure analysis of the west nile virus envelope (e) protein domain iii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
TTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
rcsb
source organism West nile virus
molecule tags Viral protein
molecule keywords Genome polyprotein
total genus 12
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p5pA00
1OANA 2R29A 5AAWC 1S6NA 2JQMA 3J2PA 2HG0A 4AM0Q 5JHMA 5KVDE 3C6EA 2ALAA 2P5PA 5GZNA 5B1CA 1URZA 5LCVA 3UZQB 4BZ2A 1Z66A 3IRCA 3C5XA 1RERA 3G7TA 5LBSA 5GZOA 1OK8A 3UZVA 5IREA 2V33A 1ZTXE 1PJWA 2I69A 2GG1A 4FG0A 3N40F 4L5FE 5H37A 4GSXA 3VTTA 4FFYA 4UT9A 2H0PA 1OKEA 4GT0A 5KVGE 3N44F 4UTAA 1Z3RA 2JV6A 3UZEC 4AL8C 5JHLA 3N43F 4UTCA 1SVBA 2JSFA 5KVFE 4ALAC 3N41F 3UYPB 3WE1A 3J27A 2R69A 3UAJA 3P54A 4BZ1A 4UTBA 5LBVA 5KVEE 3N42F 4UT6A 1UZGA 4X42A 5AAMC 5IZ7A 4FFZA 1TG8A 3MUUA
chains in the Genus database with same CATH superfamily
5E4AA 5ESVA 1FC2D 5TQ0L 4OZFG 1ZLWH 4L37B 2CKBL 2PWEA 3TA3B 3KH4A 3AWEA 1BJ1H 1M7DA 3GFUA 3UAJD 5CGYC 4N20A 5DR5H 1IQWL 2YD6A 4RFNB 2NQCA 4IU3A 5MEQB 2X70A 4HS8L 4A7GF 4GXVL 2GI0A 1COBA 5EOTB 3T0DA 1FZJA 1CFSA 5BZDA 1OCOB 1TZIA 2DW5A 3Q43A 3U2IA 3BPNB 1AVAA 4L29B 2MOQA 3SCMD 2EXYC 4UM9B 1S7XA 2DQIH 2PTTB 1BSIA 2CNZA 3MGAA 5FUOH 4YNYB 1GHFL 3LMJH 4A7SA 4F37K 4O4YH 3SE9H 3KLAA 4MJJA 4J6IA 2BFVH 1EEZB 3EZJB 4XMPH 1PZ5A 4HJ0D 1KYOK 3VTTA 3Q3GA 1M1XB 5I8EB 3MLYL 1X3DA 5IFAH 5AOZA 4G83A 5D93C 3WUZA 1DLFL 2BOCB 2VUOA 5ICZA 5EOQH 3X11B 1SYVB 3CFKA 2ITFA 4LQFH 1BAGA 1IC1A 2G75A 4ZO9A 1ZEAH 2DF3A 3DX8A 2XBDA 3GSNL 1LM8V 4GMTL 5HHME 5C0AD 2MEJB 5EOCH 3ZZSA 4YWGH 2BRRH 1WAAF 4JHAL 3SDCD 5DXWA 2F18A 2HLAA 5DD5L 5BZWA 1J0IA 3DV6A 4G59C 1TXKA 4ZUSA 1MJ7L 2PWGA 3AZUA 5I1HL 3KYOA 1S7QB 2G2RB 5IW1B 2V37A 2V5TA 2X89D 3QXVA 2E8ZA 3SYAA 1XQ4A 2P7TA 3HG1D 4FX5A 4N2LA 3B2UD 4XAKD 3QIUD 2K9UA 5I19H 2EDJA 4C59B 2FSEB 2J2ZB 3MOAH 3OMAB 2EYSA 1YAZA 4ZFOB 2WZPD 4LRNL 3RPBA 2ZPKH 4O2FB 4P2RE 4H8UA 4ZAKD 1MY5A 1R3LA 1DVFC 3ZKXB 1OLLA 3P73A 5CNHA 1NCAH 4B9CA 1F3DH 3IPFA 1YUHB 3EO1B 1WF5A 3ARXA 1ZLSH 2XACC 4O58L 4L3EA 3T6ZA 1J9TA 4ODUA 1TFHA 2VZ3A 1J8HD 2IAMB 4R2GC 2FH8A 1T66C 4UAOB 3GRGA 1UFUA 2OSYA 1Z9MA 3SGKC 4HGMA 3GHPA 5C86A 2ZCZA 1XZ0B 1HXYA 3VI3A 2VC2H 4JFHD 1F58L 4NO2A 5I6MA 2RIKA 3CC5A 5E94B 4MNGE 5EIIG 1JXFA 5CU9A 2J8HA 3MKKA 1MFBL 4X4KA 1MRDL 3OKOB 1LO4L 2VLKB 1V7NL 1X5MA 1LWHA 4HMDA 2EXWD 3RVWC 4IU2A 2BOCA 3LQAC 4F9LA 4NQCE 5JZ7D 3MXVL 1FE8H 3ZDXF 3CSYA 3S8WA 3GTNA 3FTVA 4P46C 4G5AA 4BUQA 5FCUL 1SF3A 5EN3A 1WCBA 1CR9H 3U82B 5K1VA 4KK6C 3WIIH 3VRLE 2F61A 2V33A 3LH8A 1D6VL 4QKXB 4XCEA 2OK0H 4K7PY 5PAZA 2E75C 4JQXA 3QZWG 5DUPL 1KENH 4NRXA 5AG8A 1MCFA 4J3XA 4N8UA 1DO5A 3CHQA 4Z3EA 5IMLA 2DM4A 3U4EA 1ZHBA 5DVMA 5L2KB 1JHLH 2D7QA 2FSEA 3ABKB 3CHOA 3ISYA 3OLGA 4R90H 3I9IA 2ZXQA 4GUPB 4KNTA 5SWZD 5FKPB 1EEZA 3RBGA 3M1BB 1MRFH 1IEAA 3DROB 2YWZA 4FQHB 4MRCA 5D9SB 4GKNA 5L88L 1FLRH 4TPRL 3GBEA 2QJDA 5L4JA 3IWVA 3EYVA 4OLEA 2E7LC 1EV2E 2EH7L 1TVHB 4L4VA 3V4VA 1KJ2A 1TJGH 1JV2B 3DXAB 2WPGA 4LEBA 4PD4K 5F21B 4DO6A 5KVMC 4D2NA 4HALA 2K6ZA 3L5JA 4KO9A 1RSFA 4ZNEA 1KB3A 2YBRA 2IXQB 5BV7B 4Y4FC 1N64L 1AXSB 3VFWA 3OJMB 1NKGA 1OD9A 3MLTA 4K3DH 5DWPA 1T21A 3CXHK 3ZSTA 1FCGA 3X3GH 4C58B 4CMMB 1O7VA 3PG2A 2IV8A 4HLJA 3SIKA 1IGJA 1HQ4A 4XMVA 2VDLL 1A4KB 1NLDH 5C07D 1I3RA 4IGBC 4QHUB 2Z1PA 2DWEB 4OF3A 4C4KT 2K0RA 1I8KB 2YGNA 3O3DA 4R4NC 4N2CA 5GRUH 3N41F 4NZFA 5CAYB 3T3PF 2HKHH 4ZO8A 3QDJD 4ZYKB 3WD5H 2FTAA 2J8UB 1E65A 5BZXA 1R34A 3B5HA 4LVNB 2OI9B 5BVPL 4ZFOA 3ROOB 3TIDA 3QZWB 2NY3B 4CILA 4X6DA 1HJBC 4J6RL 5C0IB 5T1LD 5D1XA 1PZDA 2VR7A 5A2KH 3GJFB 3WLBA 2C1OB 3BGMA 5EOQL 5SWZA 3N43B 2R4SL 1ZLDA 4LMQE 5GS0H 4R26H 3HOGA 1BYNA 2KT6A 1BVNT 3WY1A 5KBKA 4V11A 5HDRA 3S4SA 1Z3RA 3DXAE 4ADJA 4ZODA 4R5XA 5DSCB 1PD1A 5F97E 3VI4E 4K8RL 4JFDA 3ZL4H 1AO7E 1P84K 5KVFL 4X8JA 4XN1A 1TLMA 1ZS8A 3FRUB 2QQNH 3WCYA 2FO4A 3SCMB 3T4AA 3BRGC 4X5PA 2VC2L 2ZWSA 1JK8B 3BKJL 4JRYD 1GHFH 3LMJL 5LCVA 1LE5A 2UV3A 4MKMA 1QTPA 1GGBH 4PJ5A 3U4AA 3Q2NA 5HYFA 3JZYA 4E9SA 5DYOB 2ORBH 4FNPA 3U6XS 5BUPA 4UV7H 3QORA 5EF0A 5DWUL 3N85L 2GYSA 5B3NA 1PG7L 5C0GA 2X3AA 3O2DL 1MSPA 2NW2A 4FXKB 5A2AA 4EQ3A 1AHMA 3RP1A 5E1QA 4ZX6A 3TVMD 3VJ6A 3NJXA 1RIHL 1BQHA 4LRNH 3CCHA 4FFWC 2NZIA 4LBAA 4Y16B 3X14A 4EZKA 1LWJA 4IRSD 3RGVB 2W5PA 4XO8A 4BH7A 1I4FA 1KIPB 1Q9LA 2MKLC 3V0WH 3BVTA 3H53A 4PGJA 5HXMA 1A3QA 1E28B 1WBYA 2F54E 2ZP9A 5FGCE 2NDFA 5JMRA 2WZ6A 4EEEA 3VD5A 2FJFA 2WYZA 3OKMB 2GK0A 1EAQA 3G5XA 4LEEA 5F7UA 3S2CA 4PV1C 1S5IH 4LCCC 2JB5L 1NUGA 3VM7A 2ZKMX 3SKOA 3GXDA 4U1SA 1L3NA 4JFFA 1OAUL 4ZXBC 2VM4A 3C6EA 4MMZB 5E6YA 3M1CA 2RALA 2GFBA 4LU5H 1NCDH 2ZG2A 2D9QB 3HI5L 3POHA 3VYPA 5FHAL 5GS2D 2CBPA 1MCOL 1BBDL 5GZND 1N68A 5DRNA 1R3LB 2ALWA 1CFNA 1A6WH 2PXYA 4AQ1B 3VGAB 3VH8A 1I1AC 2I7OA 5DJ6B 1H3TA 3POCA 5BQ7B 2FJUB 2PR9A 3TC9A 2CK0L 4OBSA 4LCIH 3C6SA 2BNRE 4JRXE 3ISRA 2H6PB 4O4YL 2CH8A 3LQAL 2Y7MA 1MWAA 3KPSB 1MG2C 1G7LB 3QNXB 2FX7L 4P2YA 2WBXA 5FUOL 4N0YL 1RJCA 1SJEA 5D7SH 2W9EH 3S96B 3TBVA 4MFHA 5DRZA 3DURB 3AS1A 4L5FE 4Y5XA 1IL1B 4HCFA 2VLJA 5KYNA 2DKMA 1XDTT 4KI1A 4AL8C 3QT2A 1RZIB 2PCYA 1A6VH 3EYUH 3GI9L 4QIRA 3TZVC 4J3VA 5GS1B 2VDPH 2R1YA 1RHFA 4QXWA 5K39B 4KFZC 4HX1A 1KTBA 1RKRA 2DQMA 1YEEL 4NHUA 1OSZB 3OAUL 4QXUL 2UXTA 4W4OC 3B34A 4N5ED 5AFAA 1M05B 5IBLC 2ARJA 1NMCC 3HMXH 4DP6X 4ENEC 2X1XR 5AZ2L 3NVQA 3T8XA 5FDYA 2K6WA 3VRIB 1U33A 4G72B 2VB5A 4NB7A 2CO7A 3PPSA 3KS0H 3SE8H 1I8MA 4NM8H 3CFCL 2YLKA 3I9GH 3UJIL 3FRUA 4PCKA 4XP4H 5KZCB 4FLSA 3D7PA 3P11H 2GJZA 2ZOTA 2CCVA 1A6PA 2VKWA 3KEHA 5HI3C 5G4NA 4P2QD 5L2KA 2NUPA 3BDBA 3HPLA 1T04A 5H35A 3VXTA 5DVKA 5EUOE 2APTA 2RFXA 2UXFA 4MXVE 3MRPA 3HHSB 4MA3A 5JHLL 1TEFA 4QCIA 4KQ0A 4N0CC 1LP9E 2NY7L 4CN4A 4GRLB 3HG1E 1OY3B 4I1NB 1T03H 4WNSA 4G43B 3ZRSA 2W9LA 1V3MA 3DXAA 4ODHH 1D7BA 1F90L 1BX2A 1KGIA 1SY6H 2EINB 3T2NH 3LHPL 4I0CC 2ZXDA 5I0ZA 5AKTA 2R0ZL 3CCHB 1S7WB 4GUCA 1KCUH 2AANA 2X4UA 4RGNE 5E8DL 4DN4H 4U7MA 4RMVA 2AXFB 1INQA 4AYFB 3WNNA 3CMOL 3L5WA 4AJYV 1D5IH 2MQCA 2WLMA 3AG4B 4J4PA 1EDHA 1T20B 4N68A 2R2BA 4AMWA 2EKSA 2QKSA 2XN2A 2CKBA 2WBKA 4JO3L 4PJAB 3GIVB 2P5ED 3NA9L 3UADA 1UKSA 3CK0H 4JANA 2CBMA 5M94B 2LQRA 2OMNA 3ULUE 1Q94B 3KYNA 4FI8A 2JI3A 3JV6B 2QKIA 4PRIA 4I4WB 1Q0XH 3VGHA 1T83C 1XR9B 2BVUA 4DT2A 2E56A 3QH3A 4WFGE 3DVNA 2Q8AL 2HA1A 3BZ4A 1EERB 3H42H 2QADC 3L3IB 1G6RB 1H15B 1AXIB 4QRBA 3TF4A 3CFBB 2XXGA 2NSXA 1U58B 1L7TH 1UXWA 1M2VB 2V17L 3O9WC 5FGCB 4N3UA 3MUHL 3KPQA 2JKNA 3PIQA 4GRLC 1E43A 3VVWA 2BIMA 2WB1A 3DJRA 3IRZA 5SWZB 5E94A 5H4ZA 4H4NA 2DKUA 3KPPB 5C0RL 3MYJB 3BDYH 3LDBB 1TNNA 1R3JA 1JERA 3MACH 2WLIA 4JREB 2NXYB 1L9NA 2P52A 4EDWL 1KEMH 4TNGA 3DJSA 5CLXA 3BRDA 3CSBA 3CHRA 2NUPB 1BWMA 1FL5B 3CN0A 3SQOH 3NK4A 3JBG7 3AITA 1I7RA 4QXUH 3ARBD 3L17A 3L4UA 1MW1A 4DCQB 1UGNA 5D7JD 4BK5A 1UJTA 1U4FA 4WI4A 3HB3B 3CVBA 1MQKL 3KBHE 3WTWA 2BWQA 3MO1A 5SWQA 1DQTA 1FNHA 4JFTA 1Z5LB 4AENB 2XTJE 1T4KA 1HZKA 4UT7H 1YO4A 3RNQB 4X8XA 1WZAA 4AGOA 4Y1AB 2VO5A 2HRHA 1SNRA 4XPTL 2DWDA 3VU2A 3CQQA 4HJGB 3ATDA 5EU6D 2GJRA 2HX7A 4L8SB 3LEYH 3MN8A 3QUYA 4XCYA 2CIIA 3SKNB 4GKNB 1XR8B 1A21A 2IVFC 3C60A 2HMID 1DJSA 1Q9OB 5K9OA 4XCNA 1JPTL 4WI5A 2Z92A 4G3YH 4AEHH 3VXMD 3KGUA 3L3JA 1MCOH 2ADGA 5HD8D 3MRJA 1IGYB 2GPZA 4GW5B 4L1LA 1IAIL 2ZYRA 5JHDD 4Z0XA 3P3TA 2R23B 1WK0A 3FFCE 4JO5A 3MRPB 3VWKB 1J9QA 1HHIA 1ZK9A 4TSCH 4KXCA 5GZOA 4ADGA 1MNUH 1KYOJ 4F9PA 4M5YL 4RAVA 3PL6A 4K0OA 1DZ0A 2DQUH 1BJ1J 3T8MA 1GZPA 3B7RL 3VQ1C 1G9EA 5EMYA 4ZFOL 3MBWA 3T2LA 3UAEA 4JFPA 4XBEH 2A6IA 1ED3B 3PWUA 4N5EC 4JY5L 2KH2B 5EH1A 1KMGA 1BGXL 1HZHH 3FHEA 2UVEA 4FQ2L 1K5NB 1BBJB 2LVCA 4R8WH 4LLMA 1YVLA 1NH6A 4E9QA 5CKGA 3WMQA 4M03A 2HFFB 4FYTA 3ZDYE 2VM3A 3SOBL 5B38B 5KVEH 4HIIB 1N9PA 1WD9A 1A6AB 3VD7A 4KVNH 4H8HA 1QI4A 1JZHA 4X6CA 2OP4H 4YHLH 2C3GA 3WTTA 4OZGA 5ENWA 7FABH 3O2DH 3O4LE 4M48L 5HVHB 3WAKA 1OGTA 1U3JA 2E27H 2EIDA 4DEUA 5L0QC 5DWUH 4WTQA 1Z1WA 4JDTL 3QFJA 4N2IA 4MNQE 3KLHD 4C56E 4PJ8D 2VZTA 3C2AH 3IJYB 3KH3A 3L3IA 3HZVA 4LRIC 4OKVB 3V4UH 5IJBC 3KLAB 2QTEA 3GBDA 3CZSA 2F5BL 3KPOA 5JHAA 2IANB 2NX5D 4BZ2H 4DVBB 4WJKB 3INUH 4MSWB 5EZJB 2DZEA 2JJTA 1RH8A 4A1RA 1U8PB 3WTUA 1FVDB 4K8RH 1V7ML 5FM4A 2Q7YB 1NPUA 1PLGH 4BZ2L 5FYKE 4PRHD 4GMSL 4AGLA 2ADFL 4HWBA 1MFDH 1G1OA 3LZNA 2Q9OA 3CZGA 4JK0D 1HHIB 2F54D 4KKNA 3X1FA 4RRPA 5I1KL 3NCXA 4CVZA 3EXJA 5E5MB 3DUHA 2A83A 2YEVB 1EO5A 2X4SA 1J86A 2L7EA 2YK1H 3MXWH 4NC0B 1N4XH 5HGHB 1I85A 5A3ID 4XB8A 3IFPA 2VN3A 1CWVA 5BW7A 1FHNA 1J5OH 1UG9A 2Y5QA 3GDBA 2HFGH 1H6EA 4M48H 3ARDC 4P99A 2YN5A 4G1EB 1DQLL 2P24B 3BP6B 1LL1A 3ESPA 2EH8L 3W9DA 2OP4L 4LAQL 1T2JA 3PE9A 5DHVB 3OQRA 3TCLB 3OC5A 4L3EE 1NINA 2OSLA 3B43A 4RWYL 4KROD 4R4FH 5IQLA 1G0YR 1G0DA 5EEUA 4OB5H 5ID1B 1L9PA 4JZNB 1E8XA 1UASA 4GG8A 3N40P 3L08A 1Q9WA 1PAZA 1V54B 2VT0A 3DPDA 4FYQA 3EJSA 3F65A 4QLRA 1C12B 5T1KD 2WBJD 1GL4B 2H3KA 5LVEA 1HHJA 2EDDA 4FQ2H 2R2BB 4L05A 1RK0A 5HI4D 3OG6B 1QSFD 1UQSA 5IVXE 3ZHNA 3QDME 4W9FC 4YGAB 1TZGH 1A1NB 1HXKA 3B9KB 4PWFA 5DDHB 1NFDF 2VERN 4NJAH 3ZMRA 3CSGA 1TJGL 3OR7B 1P84J 4XWGH 4Z3IA 2EH7H 3BQUD 4AK1A 2BNUA 5FGBA 5IVNA 2JJVA 1L5GB 1FFPA 3EJYC 1QR4A 4HHAB 5K1JA 4GSUA 4XC3L 1ZT4B 1EAJA 1D5MA 2F58H 1EMTH 2CLRA 2DH2A 1OCWL 4KY1L 1ZPLA 3QQNA 5I76A 4PY8I 2WXPA 5CF3A 2MWCA 4NN5B 4NOFA 3QWOB 3M86A 4PRDB 3G6AB 3LEYL 1KFGA 4EI6B 2DBJA 1AR1B 4D0BA 3CQPA 3I75B 3MV8D 1JXKA 3PXJA 4WGVB 5IBUG 4CVZB 5KN5B 4XPTH 1BHGA 2CE6A 4IIQB 4B97A 3H9SE 2QELA 1AHWC 1BMGA 3ULVE 5J11B 4PS8A 5J6GB 1CXHA 3BPCA 1H5BC 2OL3L 3IN0A 3V52H 3W39A 1FL5A 5IHHA 4KRNA 3SN6N 4NKDA 3SKMA 5CD5D 1BXAA 4OZGB 5JR1L 4HF5H 4PFEA 4OLZH 1RY7B 2WXFA 7CGTA 1TETH 4WO4A 2XTJB 1MQKH 2D7OA 4MDJA 1DYZA 1NA8A 5D5MF 4PS7A 1ZA3A 2X09A 4G8GB 3T3MF 3GM8A 2P80D 5FF6B 5AOKA 1UZGA 3EFFA 3V55A 2AQPA 4WJ5A 4ZNEE 4XPAL 4RAUA 3STLA 3WN5B 4M8QA 3TA3C 1AZNA 5KYYB 2UXVA 2N0MA 3WDJA 3S5YA 3ARFA 1WA2X 4MJID 2DQDH 4P23C 3DBXA 3ZRCC 3ZE1B 2OXHA 2FX8H 2Y0SA 3JV4B 1CFBA 3V8CA 1RK1B 2ESVE 5E03A 3X1GA 2WLZA 7PAZA 4M1CC 4PGCA 4XXCC 5FUCE 4ACPA 5SX4H 4LARH 5DHEA 1ND0B 4PJHA 3ARVA 4GFTB 4R84A 1P7QB 1DVTA 5DUJA 3IB4A 3RDTB 2KC0A 1E4XH 1UWEL 2LU4A 4NC1C 3QRBA 4WK2B 1MWAH 3OMIB 4FEIA 2BNQA 5I24A 1HSAB 1IM3D 1LDPL 4YDJB 1A3RH 3QEHA 4A6YH 3P2TA 3D39A 3CGTA 2LAAA 2P48B 4GQQA 1TTAA 4EO5A 4JN2B 3TV8A 5EC1B 1Q0XL 4JDZA 3WY2A 1A47A 4LLWA 4J8RB 1RUPH 3L3HB 4L1DA 5EEVA 4XNDA 2OSLB 3PABA 3MV7A 5IHZA 5KSVB 1T89A 2DM3A 4OLXH 3IDXH 4OCSH 4ONFH 1DQKA 2NYYD 4HBCH 4X8CA 5IKCB 1W9XA 1M42A 4Y5VC 4Z7UF 1HEZA 3VYOA 3RPIA 1D5IL 1T5WB 1FAIH 1K6QH 2R29A 3HRZA 4KK9C 3BW9B 3PP4L 4FOMA 2WBJA 3KDMA 5FEBA 5T1KA 3GSNH 2UY6A 4Q6IB 1MLCA 4E9LA 5KOVC 4FTVA 3HUJE 2NW3A 3MI6A 1PEZA 1T80A 1KB9K 4FQJH 2AK4A 3S4SB 1IMHC 1DLFH 1T03L 3UX9B 5C9KA 2V8MA 4HIEB 4NO3A 5FECA 1XXDC 2Z7UA 4NAJA 3BQUC 2C4XA 1S2EA 2PO6C 5E4EB 5A2BA 3OXRB 4KK5D 3FQNA 1I31A 1BFVL 4FNRA 4NQDB 3VGGA 4ODTH 2BSTA 3QHFL 2BFVL 3BN3B 5ETUB 1R3JB 4NT6B 3C8HA 3JWOC 5CP3H 3T6QC 1PU0A 2WTRB 2NCMA 2YXMA 4XP1H 3GZKA 1YQVL 3PU7A 1G1YA 4K2UL 3BP7B 3D48R 4N22A 2VMCA 5ICUA 4FNLL 1UVQA 3G6AA 1BOGB 3QNZA 4N6RA 3DLQR 4TQEL 3VA6A 3SOTA 3S7GA 1G7IA 3QIUC 3B2UC 5C0BE 4HS8H 1VPOH 1OGAD 2A99A 2VDMB 2FX9L 1LMKA 3EYSL 1IQWH 1UCTA 4D0CB 4NQSB 1SFHA 4X9GA 1IAOB 5B1KA 2ZCKH 2CRYA 3P2BA 1QATA 5AAWA 4M43H 4PJEA 4LXFA 4I77H 3CZKA 3FOLA 4L48A 4JX0A 3M1OA 4PJ8A 2B77A 3FFCD 3IU4L 2OBGA 1CLYL 3RWEA 2VQ1A 1MHCB 3O4LA 1INEL 1AIFB 2NY5H 3C8DA 3HKZA 3HG1B 2JVUA 2WSPA 3OHXA 5B1JC 3WN5A 1HT6A 1U36A 1MHEB 4E41B 3U0WL 3EDDA 1E7UA 3F05A 1NWOA 1WH0A 1IGMH 4FNTA 1OCCB 1AGCA 3CVIH 4OFYA 3QQ4B 5ID1A 1KWGA 4YSTA 5DD1H 4UTAL 3A67H 2KPNA 5LB1A 5BV7H 4GQRA 1NIBA 2AMUA 3WNPA 1MDTA 4NNXA 5DEFB 2B0SL 3IJ9A 1IKOP 4RMTA 2BSTB 4M4RB 1SY6A 4KQ4L 1XF2B 1ZANH 3JVFC 4XMLL 3T1FB 4Y8AA 4YJZL 2A7BA 3QNXA 4NN7B 1NL0H 1UZ8B 4XTRD 3WS6C 35C8L 4A37A 2G2NA 5K9QG 1SFDA 2V9UA 2VR4A 3IGUA 2ZKWA 2VLRA 4IBQA 4NNYA 1DO6A 1H8LA 5D1XE 2F5AL 2AV1A 5IF0A 2R39A 1D5MB 1J87A 4G6FB 3VXMA 4NC1E 4HPOL 4RX4D 2F19H 1MPAH 4N9OB 2WD0A 4OLUH 5EOTA 5IB5A 3X3FL 1XMWA 2MPAL 1FNGB 1MHHA 1V55B 1Y6MR 3QJSB 4OZ4B 4LSTL 4R5VA 1WV7T 3O0RL 4I0KA 1DEDA 2DS4A 2C5DC 5DJ2A 5DO2C 1JMXA 5KSBB 2PCPA 3VE0A 4JN1H 2VDPB 4HH9B 1B0RB 3RLSA 2AK4B 2X9XA 4QO1A 1JTTA 1RVFL 1JK9B 1KTJA 2GSMB 4Q74A 3ZDZB 3DC0A 5E4IA 5F7MC 3WIHH 3IDNA 2O72A 2CJSA 4Y2OB 2ZG3A 5F89B 4FMFA 1ITCA 1I1FB 4DQOH 4FXGC 2J1XA 3ZSSA 2WLHA 3NOIA 3O2WL 5GGRY 2PYFB 2AEPH 2JXMA 1CGWA 1YNTB 5T3ZD 3UZQA 5ICXA 2NY3C 3GSXA 4F33B 1BQUA 3FCSA 4X6DF 3HZ3A 2Y9RT 1P6WA 1BG9A 4U0RB 5D1ZB 4XX1E 1N59A 5SWSA 1RP9A 3CFDA 3ZL4L 4F7EA 5KVFH 1OAQL 1H8NA 2WUBH 1DEEA 1IV8A 4U3HA 4YE4H 1EFXA 3B2VL 1G9NH 1PCXA 3GMMB 1T5KA 3PLYA 2CXGA 2R4SH 1MOEA 2NPLX 4YHKL 1CICC 2NOYA 4GAJH 5GGQH 3TIEA 3CFNA 4E9YA 2VQTA 1IEAB 5D9SA 3RL2B 3WJJC 3RDTD 3IE4A 1KZYA 3BIKA 3WNKA 3GUTA 4PJ5E 1JZDC 3T0WA 4QWWC 4LSRL 5C0DB 1DJIA 4NZRH 3F7QA 4M6AA 5D7JC 4DHLA 1I8IA 3ARBC 5IW6A 1IQDB 4HKXB 3WJLA 3S35H 4YSDA 4J8RA 1YYLH 2IBZY 4XNYL 4LASL 3TS8A 1G7QB 2VZUA 2AJZB 3CFEA 1PLCA 3HNVL 1GS6X 1NLDL 1ZLWK 2WJ5A 2C9RA 4BWUA 3C75A 2Y22A 4HFUH 5AW0B 4YS4A 1GYAA 4ODUB 2NY2B 5T33L 1BW8A 4HD9A 4ZW5A 4J4PD 4AZUA 4DVRL 4PM1A 3CN3A 1WUZA 4JFEA 3JWDH 4HUWB 1MUJB 3QAZC 3ZTEA 2G4GA 2WP3O 1PPIA 1U8MA 4TSAH 3V0DA 3BVWA 3QJZA 5T5NF 4BXSV 1DSFH 5KUKA 4LSVL 5GISL 2JK5A 3TT3L 3BAJA 3Q48A 4NAMA 4LGRB 4RGNC 4F57L 3K6SB 5I6KA 2VLKA 4Z7UB 1BJ8A 1NMAL 2VDKB 3S3PA 5KTEL 1NIEA 3WTSA 4K23H 1I9IH 5CSZA 5I8EA 3V7AG 2VDOH 1T1XA 5L88H 2K9FB 1IZKA 4EMZA 1OE1A 2YD8A 1XBRA 2GJ6E 2EUVA 2I5YH 1IE4A 3L45A 4NRZA 3ESMA 5K59E 3N1FC 1FIEA 4HEPG 1BPLB 4X0NA 3WNIA 4HD5A 3DX7B 3VXOA 5EBLA 1IE5A 1PKOA 1PJ9A 3RZCB 4OM1H 1U2YA 2XVKA 4LGSB 4TUJA 3V4PH 1RU9H 2MOGA 4HCGA 3SKMB 3L2NA 4V1DA 4ODXA 5B3JF 4QRFA 2ZZUT 2B9AA 5IHUH 3S5ZA 1T4KB 1IILE 3LCYA 2WVVB 2VN4A 4OCRH 3SDDD 4Y2DA 4K7PH 1FO0B 3VCLB 3O3BB 4NFDA 3BMWA 3TH4T 4Z7NE 4PQXA 3FT3A 1MCHA 4NN7C 4J2QA 4YHIB 4EF3A 4WKXA 3F04A 2HT3C 4CMHB 1UM4H 2WSKA 3CU7A 3ZT5A 3UH8A 4MCZA 4S10A 3LN5B 4G6JL 2GK2A 1JD7A 2NW2B 2VDRH 3VXQB 3FRPG 3KYMB 2GTQA 3DIVA 1XEUA 2UZYB 3T2OA 4GXFA 3V7MA 2ZUYA 1WS7A 2OCCB 4GIOA 1ITBB 3KLLA 5D5MB 4RSVA 3S2AA 1IAKA 4JJOA 3ZDWA 3FH7A 3EJUA 1IBFA 1QHOA 2XIIA 1F0LA 1ID2A 4WENB 4MYPA 2DQEH 1U3ZA 1DE4B 2KZ1B 1E2WA 5E8NB 3ZO9A 1EBPA 2ADIB 2SEBB 3ZDZE 3TEZA 4MA7H 1S5HA 2O5ZH 4QHUA 1JWUA 4PB0H 4WV1B 2DDQH 4IOSA 3CWGA 1PS3A 3MTRA 4TQIA 4KKLD 2FBJL 1N26A 2H45A 3L48A 3VTAA 1A9EB 5JW5B 5MEOA 4TVPH 3FU0A 3WI9A 2CRZA 2PR4L 4ZMQA 4N90E 3VWJC 1A6AA 1MCWM 2FQGA 3CE1A 4KUCD 4QGTA 1XGPB 3RY6C 1RSYA 4M4PA 4LL1A 4XH2A 1PDKB 5I1CH 4WNQA 2WCSA 5C08E 1ZGLA 4UMGA 3IU3A 4XBPB 4G80A 3S37X 3A47A 3UYRL 1K85A 3TWCL 3K6FA 2O5YH 1LHZA 1KJ2H 4MNQB 4NOBA 5AVRB 4AVIA 4QAWA 2YZ1A 2H2PD 4EPSA 1QNZL 2AJVL 4ZZFA 1CYXA 5DJ2B 3VFVB 5EZJA 1EZVX 3GMNA 1RJZB 5I8OL 3WIAA 1A7NL 1HIML 3IKCA 2DMBA 4NQQA 1HEHC 1ETA1 3AREB 3HNTH 3K2KA 5GS1A 1XH1A 2B4CC 5TGBB 1CLVA 2R9HC 4O2EA 4WTZA 1AS8A 2A6DA 1A6TB 3C5ZB 4L8BA 2JCCA 5DU7A 2ZJSL 4LSPL 4ELME 4ZUVB 4A2FA 4AYFA 3MCLH 3L5IA 3RA7H 1N8ZB 4A6YA 4ALAL 1WZ1L 1I9JL 1RZ8B 2PXYD 5TQ2H 4A66A 3CX5K 3MCG1 4PJ5D 1KDIA 5H37G 3IDGB 5GZNA 2QQKH 4P57A 3N04A 5GJTL 2VW4A 3MKGA 3HR5A 3EF7A 4JPQA 2VXQL 5FK9A 1A4BA 2BVYA 2GUYA 1M3JA 4F7CB 3AREC 4LLYA 2DTML 5I8CB 1MFVA 2UYLA 4EUPH 4BFNA 1KGJA 4JFFD 3UPCA 4A2EA 5CBAA 3HMWH 3T0AA 1J8HB 1HXMB 1I8KA 4IJ3B 1OAZH 5BPPA 3OZKA 4QRRB 4PN6A 3FFDB 3SKJL 2OI9C 5CCKH 3HC2A 3OKKB 4RWHA 5TE6H 5DC2A 4MASA 3VNZA 4WDIA 4EI5D 3WTXA 1E9PB 2DM2A 3QZNA 2W94A 1E42A 3BKYH 3AY2A 2KLTA 3E1ZA 4GY4A 4AJVA 2IV9A 4GBXB 4LE8A 4NDMB 2JTYA 3FU7B 3FMGL 3H4FA 3LNGA 4YDVA 3V4LA 4MCNA 1KB9J 4PJXA 5DJZB 4B9PA 5EU6B 3GRBA 1XH2A 3NCFB 3QIBC 3TJHD 4NUQA 2V7HA 2WLIB 5CJOH 2J21A 3BUIA 5JNYB 2R51A 3ERXA 2VYRE 3WEBA 3VXRD 3UTSA 3GMLB 3CC1A 4RFOL 2GY7B 4X9FA 3KMDA 1BZ8A 1M7DB 3S3DB 1UB5B 1KGXA 4ZYKA 5DMIL 1A64A 4N25A 2EDHA 1W72H 1KPUB 3PQYB 4PJ9C 3DOIA 2KZBA 1L9SA 3VFGH 2AQRA 2CNYA 1MVUB 2NQDA 3ZPDA 1X5AA 3SSGA 2GY5A 3DECA 2I60L 3T0EA 5D1QE 2CZNA 2DTMH 1OXYA 3OX8A 3Q8BA 4LLUB 1GZQB 5EBMB 4GW1B 1J5HA 4PREA 3K81A 1CGYA 4U49A 4WU5B 3EOBA 3I50L 1EZLA 3DSNB 3I2CL 4OW6A 2E9WA 3ZXAC 5FYKL 4MCMA 4BJLA 1J1OL 1KTLB 4X5RA 5AW4B 4GNKB 4X5XB 3VXPA 2VZ1A 4N86A 2BNQE 1MCDA 1DQVA 1ZVSB 3Q05A 1QBAA 2UUDK 3BVVA 1Y0LB 3KPQB 3G6JE 5CKAA 2XZQL 1HOEA 3N6YA 4KXDA 4N1EA 3X14B 4JM4H 1M1XA 3JV5A 4XI5D 5GGVH 2ZXBA 1Q9LB 1JRHI 2NZ1A 2QPDB 1Z9SB 3B9EA 1ZLUH 2NNXA 4GQ9L 3M07A 4J3OD 3QWRD 1UM4L 4RISH 2EACA 3C5ZD 5FKPA 2Q87A 4Q97A 4LOUC 1N19A 4JFXB 5JOPE 2HUHA 3FQTA 2FJGB 3DUSA 3OZ9L 4KV5F 4N2DA 3RIAK 4RAVB 3DJZA 1ACYL 1WGVA 4DP8X 3D0VB 4Z7VB 6PAZA 5ICXB 3BKCH 1NIDA 3BPLB 1FQ9C 4Z0BH 5FO7A 3WEXA 1KOAA 4NKIH 5IWLA 5DS8A 5LQBL 1AYOA 1OTSC 3HUJB 4LDCA 4AQ1C 2FQEA 4JO4H 5ILTH 5J6HB 1LO0L 1QUNA 3O6KH 3UTSD 2NXYD 2FJSA 2QR0A 2K78A 3DHJA 4OM1L 3ZTNH 1ZHNA 4XN9A 1UEMA 2E7BA 2WXOA 3D39B 2NY0D 3NABL 4QGYA 1XGUB 1F5WA 4P9HH 5E5LA 2FBJH 4UT9H 2X53A 3EBHA 3HC3L 4O02B 3KE0A 4PGEB 1E27A 4FQIL 1R1CA 4ZPTA 4OJCA 4OJAA 2O5ZL 1JP5A 5TE7H 5D6CB 4W9CC 3RILA 3ILEA 3MOQA 2YGQA 1ZHLB 4P2QB 3UPRA 2G9HB 4JJ5A 1RZIA 3QG7L 3JWDL 2K45A 4NZTH 2CALA 2ARJQ 5C0JB 4MDIA 4X99B 2R0WL 3W2DL 4G7YH 4HYTB 1RZGB 4W81A 4LEOB 3J2PA 3T6WA 4A39A 2P5EB 1NC4D 5HDQL 4ONHB 4NLHA 5EORL 5FYLD 5HY9A 1RZQA 2V9TA 1YQ2A 3OTTA 4GO6B 5KYXB 2H2PC 5DSCA 4Z7QE 2VCOA 4FFYA 5KYWB 4G6JH 2F8VA 2X4TA 1IKFL 3S3JA 2Z64C 3ZDXE 5K5YA 3FO1A 4JFXA 5BCAA 3KPPA 2ENYA 3L16A 5DZ9A 1BEXA 2IDQA 3C09B 3VGBA 4H8VA 3RFZA 2X87A 3BUYA 4CRPA 5C0AA 5ADPH 5JUEH 4ZO6A 3HA0A 5IHBA 3CN2A 1JNNH 1NUFA 1J11A 3FB8B 1FG2A 4P59H 1BOGA 1PBYA 3WLWC 3LPPA 4F24A 5AB9A 1ONQA 3B2MA 2I07A 2XKNA 3LV3B 3TEUA 5IHUL 5T8IA 3H2PA 1XF5B 1A14L 3V0FA 4CU8A 1I82A 1AZBA 2GI7A 1A7RL 5F1IB 5J3HC 3C5JA 2MCAA 1KCBA 3IS1X 5J1AA 1I1AA 2KHAA 3FTGA 3T6VA 5HGBA 4N0UB 4MNGB 1CDCA 3F62A 3U1QA 4JCLA 4NWUH 4OAWA 2N59A 3VGDA 5J1SC 1V5JA 6PCYA 2OTWA 4ZAKA 3ULSB 4OJEH 2IFFH 5FW7A 5HHMB 1FVCB 2R56L 4IEFA 4F2EA 5EU4A 4ETYA 2ADJB 3N06B 5BOPA 3C60B 1B4RA 1EGJH 3SKOB 1NOAA 3QZPA 1RVFH 4YR6B 4C56D 2NLJB 4OLVL 5INDA 3GRWL 4LDLB 3RNKA 3O0RH 1XVSA 2VAAA 2IANE 4KKRA 4QY8A 2VTFA 3TONA 4IKIA 3NRQA 1KPRB 3UMNA 2X9YA 3K4ZA 1CFNB 2PPCA 1UWGH 4LASH 1S9YB 3L9BA 4V33A 3LS4H 1VFBB 5D72H 2HSIA 1N7MH 5MHSE 1RZKL 2CHXA 2EXYD 1EDYA 4QHLB 4BCXA 4OUOA 5G2NA 3P77A 5AW5B 3ULUH 2NY4C 1JTPA 2R1WA 1WFIA 4ADIA 2XV6B 3OPZH 1N0LB 2ZKHH 1ROWA 3EH2A 5CZVH 4PJGB 5E0QA 2R69H 3CH1B 4N8CH 4X7SH 3KS0J 3GJFA 5IESH 2HG5B 3NCCB 1DBML 3FL7A 1V10A 4Z3TA 4U1HB 5IGXL 2J2ZA 3DYOA 3QUXA 5KAQF 4P23B 5D6CA 1N7ML 1W6WA 3EAKA 4M7JH 1A8JH 1E30A 3HS8A 4LLVA 4G5ZH 3SGJA 4X6CB 1RIVH 2GBVA 2G60H 1MAML 4H88H 2WUBL 3KNBA 3PIQB 5AALA 1ZS8B 4MXQC 3GPSA 1RV6X 4L9LA 1IUZA 4MMXB 4Y9FA 3ABLB 2FQFA 2IALA 2OJZL 3E0GA 4JR9H 3TPKA 1S8DA 2X4PB 2EDLA 3VXSD 4ZS6C 4DO4A 1IGML 3SPHA 2D2OA 2VISA 2FD6L 4V1DD 5KJRL 3MRKA 2P47B 3SJVE 2D7PA 3T2PA 2HT2C 1I3GL 2P45B 1OZUA 3CAFA 5AL0A 4M62L 3K74B 2ICEB 2DLEA 1YMHA 1E8YA 2DIJA 2AERT 3BFQG 3RIAF 1ZTXL 1W0VA 3MLPA 3RVTC 5DRXB 2ZYIA 3U6RA 4D9QD 5LGJB 4FADA 2UZPA 4YHOL 5BOJA 1EFQA 2DEXX 2QHRL 4IMLA 4CC1A 4J27A 4CU6A 4H0IA 3EHBD 5GGTA 3A3YB 4N6QA 4Y4HB 1EX0A 2Y1YA 1BXVA 2WIIB 5HTSA 3WXWL 1JZEA 1MJ8H 5KANI 2HVBA 4B9JA 5EC1A 4ZFZA 3ZUCA 1UTDA 5I82A 1ETB1 1IAIM 3EYSH 4JFEE 3RHWK 3LQMA 4GI8A 4WI8A 1XBDA 1XL6A 2HLFC 4WU7B 3QEGL 3AXLB 4K3EL 4P2RA 3RX8A 2G3NA 4H8PA 2Q7AA 3KBEA 1S7VA 1Y07A 4G70B 3LZLA 2AP2A 4NN5C 5LDUA 5HYSA 3IDJA 4I7ZC 4OT1H 4TNWK 4E0RA 1NCBH 1JGUH 1W72B 3LNHA 1Q1JH 4HAFA 3PP3K 4GUOA 5HGDA 2WO3B 3DDGA 3V5KA 4XNBA 5EIIA 4XPHL 1SBBA 4MNHA 1YYML 2EKSB 3MREA 2VJ0A 2BDNL 4WW2B 3FTXA 2YQGA 4JPKL 5E2UH 5FA3A 2LLGA 3ARPA 5ESAB 1DSYA 1BFVH 1BD2D 2JIXB 2JWYA 4X6CF 3TBYB 5C3LD 3JT0A 1CE6A 4S1DD 5A43C 5T1LB 3TT1L 2AJZA 1IGCH 1E6JH 1JRHL 3DTUB 4RAHA 3E9TA 4D8PA 1ZTXH 1TYRA 2HRGA 3JYCA 3KW7A 4JO8A 1EXUB 5ENWB 1SDDA 4QTHB 5F7DB 2X0UA 4RGOH 5BV7L 2BS71 4XZUB 1KUMA 32C2A 4EVNB 3LAFA 1JDDA 1RZPA 3KDPB 3UPRB 2W38A 3IJHA 1TQWA 4MQ7A 3U2JA 3UTSB 4ZW6A 4WGWB 1CGXA 5I2IA 4S2SA 5SWSD 2NY5L 2C1PB 5DTFA 1QSEE 4DP0X 3O8XB 3RZWA 4LHQB 1G7IB 2GHZA 3IU4H 2G60L 1AY1H 4MGXA 1G4MA 4MJ4A 3H8NA 3N9GL 2FBRA 4L37A 5EU5B 1RJYA 3WS3B 2ATKB 3QC6X 3QUKB 3RWJB 1T2QL 5KWYC 1ZHKB 3GLDA 1NPJA 4JCWA 3PREA 1JWSB 5I5JA 5IGXH 3IMVA 3IE9A 4GKZA 3F8UB 5IP4A 3W37A 1N5YL 2WV3A 3BZFB 3VXPB 3ABZA 2YFNA 4KO5A 2IGTA 4XTRC 5ITFB 3FQXA 5EWIH 4GT0A 1OHQA 3WSQL 1XIWB 4FI7A 4NQDA 4RFEA 4H0GA 2KYIA 2HH0L 1UXSB 3IJ7A 3O6FB 4GYBA 4KQ3H 3KPMA 1YQVH 1BJMA 1OF0A 2W0KA 1S7RB 4PR5A 3OKDA 2P9RA 3A4AA 1B6UA 5F7LB 4DWHA 3LQZA 4ZSOE 4GRWE 4ZQKB 1RFDH 2IH3B 4FZ8H 3REVB 1X9UA 3QYCA 2EE3A 3NCEB 1ZJBA 2VLRD 1FWXA 3NK3A 1H3UA 3TP4A 1CXIA 1K2DB 5DHMC 3U4BH 2Z9TA 3S35X 1MJUL 3D0VA 5LGJA 3U6RB 2MH4A 3NQIA 2H8PB 4YHYC 5JIDA 1OSYA 2J7LA 3QIWB 4YDIH 4OI8A 3NAAH 3VTMA 4UQ9A 3GEWB 3V4PB 2AS5M 1SQ2N 1CFVL 1PSKL 1CLCA 3HCVA 3L4WA 3OLEA 3Q2VA 4G1EA 3T77B 2KDYA 4XVSL 2MPVA 1SXBA 1UM6H 4H8WL 2R0KL 5LBGA 3WKYA 3CX2A 4CNIA 3BI9X 4IOIB 1C1EL 3JWNC 4P2CG 1GGIH 2AVGA 5JLZA 2DQTL 5LN4A 1QD0A 2BY2A 2DEWX 3C5SA 3QGVA 5C0AE 3ZYIA 3VFRA 1ED3A 4GG8B 4OLXL 3WENA 5IFHH 4LO9A 1IBGL 4TLTA 4KO7A 5IOPB 3QNFA 4Z77A 2M8XA 1CG9A 3FT1A 1OCWH 1AO7A 1BAWA 2F58L 4HIJB 3D3VA 4JM2B 4PVBA 1IGIL 2FJFB 2Y36L 2ZTBA 1N2RB 4XC3H 4G7QB 3MREB 4L2LA 4X42A 1ZTMA 4Q0XH 1F6FB 4AQOA 4ZMYA 4L8CB 1IC0A 1T5XA 4NWTL 3PHQA 2J6EH 5DMIH 1GPOH 4JPIB 2XUWA 4W70A 3I3EA 3ZTJG 3I75A 4XXDB 4RFOH 3WGVB 3QEUA 4AYID 2ZAGA 1HTYA 3I6LE 3IAGC 3GXNA 1PDKA 1WTLA 1KSRA 4PWIA 3L8QA 4WUKH 5AZEL 4LFHD 4NCC2 1HHKB 2UWEB 4ZD3L 3WEOA 3QPQD 3AW5A 1QSZA 1SJVA 3GMRB 4HOMA 1Y18B 3UC2A 2B2XH 4M5TA 3BH4A 4Z7WE 3L4VA 4AYDC 1JVOA 1QI5A 2HP4A 4GXUN 4LPCA 1XEDA 1FGNH 1PX4A 4OB5L 4XPAH 7PCYA 1SHSA 2DYPB 3G5YB 4QF1B 5ICZB 3DHUA 5EZLB 3BVNA 4BUHA 2G0LA 2PMZA 4S1QH 2QDVA 2LOEA 1QFHA 2Q7YA 3W39B 3ZE0E 5HHXL 2CHWA 3FC8A 5JYLA 3QI9B 3D08A 2JQAA 4PJXE 1UOWA 2ZKXA 2D03H 2OL3B 2F2HA 4RIRB 1CFTB 3TJEH 1XCTA 2NT0A 5GPRA 3WFHB 3O41B 5HPMB 1VB9A 2OW6A 3MBXH 4CVUA 3UACA 3SYCA 5L7XL 1N8ZA 4RMSA 1M7IB 4GAAA 1ZA3B 4Z95L 4LPTA 2GIYA 3H9HA 4FNSA 3HC3H 1S6NA 5TQ2L 3NEOA 5CIPH 2A74B 1MJJA 2P5PA 3MCLL 2H1XA 3MCKA 3NABH 5HGBB 2Z31C 3BUBA 2OPCA 2O61A 1BF8A 2YD1A 1EUUA 2WMPB 3EYQC 2KZWA 4RFNC 2CCLA 3ZLQC 4U3SB 1OCRB 2OJ1A 3DIDA 5AW3B 2QL1A 3O6KL 4GQPH 2D8KA 3ZOAA 5E6UB 1RK1A 3FUMA 1A4JB 1JPFB 1ZT7B 2ADJA 1X6LA 4MB5A 1JPGB 4HQQL 1AOHA 4QRSA 4FQHA 3HG5A 2DYRB 3B7UX 2A77L 5FHBL 5FOBB 4A55A 4HG4J 3OZ9H 1T5WA 2D3LA 4U0RC 2ROYA 4WW2A 2YQ3A 5J9PB 3D39E 1H5BA 2QSQA 3PFQA 1A7QL 5KS9A 3VXTB 4FG0A 1ZGLM 2DJ4A 2JIXA 3E9UA 3RYMA 2RFXB 1KIQB 4U3XA 3MUGA 5ERWB 1Y18A 4AQEA 4UTAA 5BNXD 3U1SL 5AEAA 1RULL 3P0VH 4HKJB 4KI5C 1WICA 5F70A 4WJG3 3J07A 5MEPB 5KVDL 4PGDA 3U48A 4AW4A 2HPOA 3NDZE 4KK9D 1TVBA 1ZE3C 4F7PA 1QBBA 1SDDB 2QPEB 3CZLA 5F7DA 3HZMB 1L9OA 2DB8A 3QQ9C 4WSGA 3FN3A 2OYKA 3RZCA 2PWHA 5DI8B 1CURA 4R7NA 4RDQG 2X7LA 1FSKC 5B1CA 4ZFFB 5LNEA 1CQYA 4MJIA 2BLFA 2R0LL 4FZEH 2JELL 4NXKA 1P7HL 2WWMD 4JY5H 1ZSHA 4QDGA 4P23A 1E90A 3OB0K 3UBXB 3FCTB 4DERA 1V3LA 2CHNA 4R7DA 1X7SA 2G4EA 3QQ9D 1KCVL 4X5LA 3KWTA 1EHKB 1VFMA 3K46A 2EKJA 2BVOB 4F58L 3O6LH 4JPVH 3QJUB 5I9QC 3APMA 3FQNB 3VFGL 4DKTA 2LU5A 4YSOA 5A1AA 1VADA 4WO4D 4N2MA 4BEIA 5GGRA 2FH6A 2IANA 3FYIB 3E8VA 4ZMTA 2NX5B 1T1YB 3P02A 4MCZB 4PD4J 4MD0A 1KELH 3TFKC 4TVPD 3BLBA 2CPUA 2ZWZA 1TSHA 4R0LC 4WF7A 3DVGA 4BSJA 5GJSL 3FUEA 1XGRA 1X5ZA 4JS7A 3U1SH 3U2SA 4U1JB 4F7TA 2V9QA 1GC1C 4LCCB 5DJ0B 4NZJA 1ADQL 2VQ1B 1YAIA 1J0KA 3HS9A 5EZIH 5DRXA 1T89C 3EJCA 3BCFA 2KKQA 1DVZA 2HFEA 3QFGA 4JFOB 1KBVA 2JKXA 4R96A 4TOYL 1GTFA 2O4EA 2JFCA 4YX2L 2AV7A 4POUB 5KSAA 3DYPA 2MIZA 5B4MC 3T71A 1FZKA 1HWGB 4AIXA 2Z31D 1NDMA 2ZWNA 1SGKA 4F5CA 4ODWA 2BNQB 3V8OA 1BD2E 4I1RA 5DQ9A 4M6OH 3ZT6A 4DFIA 3BDXA 5AVWB 3NRFA 5DI8A 4KNSA 3C09C 4I5BB 4LHUG 3SOBH 4NLAA 2EZ0D 3NZ8A 1ANUA 2DQFA 3NSFA 3SQOL 1QSFA 2O1AA 3L4YA 3MRLB 3SQBB 3TNNA 4NKOB 4FAAB 2BZCA 1KTDA 2FT6A 1QA9B 3MV7B 3WKPA 1NCUA 2CWRA 2KPWA 3QDMB 4KKCC 4U4IA 2F1AA 3QUMB 4D94A 1DUZA 2VLRB 3NEEA 4IKLA 4OZIA 1T7VA 3KWXA 4G11A 2CD0A 5HBBA 3G5VB 1FFNA 5GXBB 1HL5A 3AS3A 3CFEB 5IQOA 1KGWA 3KD4A 4XX5A 1NANI 5HHXH 2DQJL 3KL0A 2B59A 1ZD6A 5AUMB 5E6SB 4S1QL 4Q9BA 3AABA 4AUYA 3AG2B 5T33H 1JD9A 2VN5A 3EGXA 3PGCA 1Y6NR 4X0KA 3MRMA 4P2RD 2OMBA 1SF5A 3D2UB 5DEZA 5CP3A 4YSCA 2VLJE 3KWWB 4ZS6D 1VFUA 1HC1A 3P0YL 5IQ7L 5AD0B 3CK0L 3LNDA 3RIFK 4LCCA 5FYJL 3WSQH 4BA8A 2AV1B 4ZS7H 5KBLA 5EWIL 3D8MA 2GJJA 1ACCA 2A6KA 1LMIA 1KJMA 4WUKL 4PJBB 1O0VA 2X4OA 4NFBA 5KOMC 3TBSA 5B1JA 3PV6A 3WN5C 1S9WA 3VU1A 5IVZB 4EE2A 4S1SL 4G8IA 3IS0X 1OK8A 2WOYA 1GPOL 3KXFE 4QF1A 3M7OA 4BFOA 3GSXB 1UADC 3ARBB 1X5IA 3RHWF 1F90H 2QFRA 2EYRA 3KYKH 5SWSB 2G2PA 3MA7A 5FAAA 1G9NL 4UNIA 1SEBB 1LD9A 3EG9B 3QHZL 4UNVA 3PHAA 2VIRB 3PJNA 4IK7A 2EE6A 3HN8A 4RA3A 2WO4A 1SLVA 4TUOB 1AZRA 4U7SA 3VFVA 2GITB 3I02B 2DQEL 2YC1A 4H7VA 4M8QB 1DVQA 5L8LB 4OD2B 3X1BA 1C1EH 3WO4B 1FSKB 1MCPH 3ULSA 2DQHL 3N1PC 3DUUA 3MACL 4WEBL 3D9AL 3RI5F 4NM8L 1JZ2A 2A6DB 4C47A 3PWPD 3QI9C 4L3EB 3D05A 2UZXB 3EUUA 3MGOA 1AGEB 4X5WA 2HT2D 2EDFA 2FDBP 2LV4A 3NAAL 4NO5B 3GHEH 1RZFH 1GGTA 3GJFK 1CUOA 1LO5A 1U93A 4GKLA 2IEPA 3QCVL 4EIGB 1J5CA 4W4OA 2A73A 3DPBA 4KVCH 1IAKB 3FPYA 1ILSA 2H0JA 4X2UA 3G6JA 3C87A 4HZLB 5EO1A 5J12B 5H2BB 4I3RL 3PL6D 2YLHA 3FB5B 4QRAA 3DJ9A 3E38A 3KG5A 3ZTJH 3I6SA 5F88A 4MAYC 4OI7A 4NPKA 4NPYB 5EOCJ 4KKBD 2OJEB 1ASQA 4ZK8A 2F5AH 5IB2B 1KLGA 3O6FC 1AS7A 2FNBA 3EADA 3CZFA 2WLLB 3NACH 4ZG1A 3CHSA 1H6UA 1FNEA 4N0YH 5D7SL 3K6SA 4PVLA 4Q56A 4MA8L 5MEPA 3BW9A 5IEKB 4PGDB 4FXGA 4FQLH 3ZQWA 1KY7A 1QRNB 3O3UN 1DCEA 5TH2A 1YNKL 4HX1B 3Q13A 3WLWD 4JANB 4J3SA 4HUXB 2F53B 4EN3A 3MLUL 3OWRA 4YIQB 5CBEA 5TDOB 3NDYE 3F7VB 4DTGL 1I1CA 4UUJB 5IM7B 1A6ZA 4HWEL 5DFVC 3VDCA 2VRAA 4NUJA 5MENE 2B59B 3NJFA 4LSVH 1S8DB 2BJML 3EHBB 3PUUA 4PRAA 4KOBA 1M71B 1CICA 3M1BA 5IMKA 4I2XB 1EPFA 3QULA 4GRLD 5FDWA 3MOBH 2IF7A 1NFIB 2VSDA 5G4MA 3ME0B 4NI3A 2RQEA 5JDJA 5JPNA 4ORGB 5E9DD 5FO9A 3TH2T 4JR9L 5SWSE 2W07A 3O81A 5D2NA 1HCZA 4LLQB 1IC5L 2NMSA 1GY1A 3G08B 3HNVH 2JE8A 1BZ9A 3V5DA 4DIXA 5JO5A 3H4HA 1MHPH 4HIXL 2ZT9C 3TBTA 3LN5A 3WJLC 2NR6A 4WSKA 3TT1H 4ALAC 1T0MB 4PG9B 1XCTB 3BYYA 3WFHA 5BZZA 1TQBB 2HB0A 4XR8C 2BOLA 1UB6A 4HGKC 4W9IC 1DQMH 2AQQA 5CLTA 3S5LA 5K9KB 2WWKT 1AANA 1PKQB 4PJEF 1F00I 3I3DA 3OKLA 4CKVX 4RGMB 3B83A 3K2IA 5FWQA 3GSOB 2FX9H 4H5SB 1BXXA 2BHUA 2P5WD 4CU7A 3EYUL 3GI9H 4GAJL 3DIFA 4CSSA 1UHVA 3HE7B 2VR8A 4L4VE 1DFBL 4PYHA 4ZTEA 1SLWA 4XMZA 4F7CA 5I8CA 3CLEH 4U6XA 4X6FA 4YPGB 4B9KC 4YE4L 2F7IA 2O5XL 2YXVA 4DPBX 3GUTB 2AK1H 5C0CD 1P4LB 4FFZA 5T1JA 3WJMA 4I48A 4YOKA 5DEJA 3RJQB 4PJ7B 5F7BA 1AHWB 1XD0A 3VQ2C 1WPCA 2XN0A 4D9RE 2VLRE 3PUCA 3NSJA 4OFKA 1GKEA 2WQWA 5CINH 3HAEB 1PQZA 3QJHA 4Z3GA 4DN3L 4OZGF 5GRJL 3VSTA 1R24B 4FQJL 1JGLL 2XNAA 4GKOA 4JQXC 4AVHA 5GS0L 2AGJL 1U8JA 2FB4H 3WIHL 3NZUA 3EH5B 1E4HA 3ZTDC 4I2XA 1MELA 3VWKA 3X12A 1MF2H 4JFEB 3T65B 1S7QA 4CGUB 2BZ7A 4ZOEA 3KYAA 1FAIL 4KMLB 2VXQA 2P7TB 5DHVH 3WELA 1P4BL 1G7MB 2BW4A 1S5IL 4FERA 5ESVB 4DW2L 1ONQB 2Z91A 3DETC 3K91A 3D52A 4P5KB 4K5MA 2MPAH 4Z8FH 1CDIA 2E3VA 1WAPA 4GB9A 2BHFA 2CUMA 4R7LA 5GRUL 4DCQA 1MPAL 4FP8H 5AVSB 4KC3B 2NRDA 3Q6GL 2YEQA 4HGWB 3JXAA 4LLMB 5C0CB 2PP9A 2FEEI 4FXKA 1HEJC 5AOLA 4BFBD 1KC5H 1FNGA 1MHHB 4OSUL 2X5PA 5L2JA 5TGBA 2JB6B 1F11B 4L3AA 4N0UA 2VO8A 3ARTA 1A6TA 1Z5LA 3C5ZA 3GS7A 4JMXA 4L8BB 4OAWB 4ACTA 2B3IA 5GZOC 1HEZB 2H9GA 1QQDA 2XI9A 4HWBL 4F9PC 1AC0A 4H5SA 3C6LD 2R69L 4UT6H 4LHUA 4PJIF 2ADYA 5E00B 1UWEH 1TENA 2EO9A 1IM9B 2Y7OA 5KW9H 1ZGLP 2QHLA 5DEGB 1KYAA 4FFZH 3AQDA 2J1YA 2ZUUA 3PHOB 4PBVC 4TM9A 1AH1A 1BG1A 1MVYA 3MRRA 1U91A 2O93L 1U3HD 5DO8A 3U7YH 4EOWH 1SVBA 1UD8A 1TPXC 4MD4A 5D72L 5ALCL 4PRAB 1P4LA 4IJ3C 4IU2B 4TL4A 5D1ZI 3QJQB 1WT5A 1VIWA 2D31A 4YSUA 3ES6A 4FKEA 1BAFL 3H7BB 2WB7A 3D30A 4F3FB 2FEJA 2OQJA 3MRDB 4N8PA 5IK3A 4PJGE 1F4WL 2D7MA 4F2MB 2PPDA 3U0TA 5I28A 2NT1A 4JG9A 2G75B 1NDGA 3QDGE 3KPNB 3T0ED 4XNUL 4JFOA 5C0FA 4G6KH 5FYKU 4JDVB 1T0PB 3UL4A 4ZXBD 2LAGB 2GQHA 3C5JB 3NESA 5IBLD 4OLZL 3L6FB 1D6VH 4KFMA 5TE7L 5DJZA 5HPOA 2I27N 4ZUUA 2IH1A 4DGIL 1RZJH 2W80C 2RACA 4HJSA 4M61A 5EEXA 4U3CA 5J06A 3UBXI 2PN5A 2AXJA 2UY7A 2QADB 3P0GB 1MCJA 4M43L 1DE4A 4N4YB 3SGDI 5CCJA 1NGWA 3T4AC 4BSWA 8PAZA 1E9OA 1FE8L 5CJBA 2OTPA 2RB8A 1KNOA 4WRLA 5C6WH 3JV6A 4PJEB 2XG5B 4B95C 5T1DL 3AU1B 4X6FB 3NCJL 5LXGL 1A4AA 3A6OA 2MCMA 3CFIC 1V7NH 3GLZA 1EMTL 1BOYA 4G8EB 2XWTB 4ABUA 1A9EA 2OR8A 1UD2A 5LQBH 3ZKQD 1GS7A 3QORC 2E0PA 3LRHA 4U2ZA 3EGDB 4CW1B 3B7TA 1DBAH 2PW2B 4GO9A 4JRXB 4U2YA 1FNEB 3BKCL 3DO4A 5C0BB 1PVHA 1TTCA 5JA9A 1I75A 1UXWB 1N64H 4Z6AT 4DAGH 5BW7C 1IEBA 4DEPC 1JOIA 1UQSB 1MG3C 3TJHC 1WA0X 1ZPUA 1KV7A 4JUSA 5F6IC 2DQ6A 1QYGL 4EN3B 4O58H 2OZ4H 2AJSH 3BUQA 2YARA 2FJHB 4RISL 2FYYA 2XN1A 4H13C 4XN4A 4X0KB 1K5WA 1G9ML 2C9SA 4F8OA 4QUOA 5JIPA 1U8OA 3MR9A 3B5GA 4BRJA 3G9VA 1IJNA 3ATBA 2UUDH 3M45A 4GQZA 3R06A 3CXFA 4B27A 1GIGL 3EBAA 3NCYP 5CJQL 4WFGD 3MRDA 3QORD 4HOZA 1FV1A 1R5VA 3MLZH 1JHLL 3QUGA 3ZUNC 3GZQA 3AU0A 4G7YL 3MFGB 2P5WE 5E5MA 2VDNL 3MC0A 4OGXL 2EDMA 1ZLUK 2BZDA 2FWSA 4UOW1 2A1WL 3EFOB 2ED9A 3QG7H 4PJDA 4G8IB 4Y4KB 4HBCL 4EZMA 5IT2L 5L4MA 4L29A 5DD5H 4G71B 4K71C 1JHKH 3IK2A 4HT1H 1NFDB 2PXYC 2H9GB 4JFDD 4HZAA 3S34L 4JE4B 2VIRA 2IDSA 4UT9L 4OZ4A 1EXHA 2ENQA 2C3WA 1KT2A 1SQMA 2L7QA 2XPYA 5AW2B 1LDPH 1P7KA 4D9RD 3DUSB 3Q8EA 4QT5A 3WFCL 2VZOA 3AFLA 3MMEA 4Y4KC 1F1DA 2X12A 3HR6A 3H0TA 4X9BA 1JNJA 1T0OA 3FUIA 1XR9A 2PP7A 3R1GL 1FL3A 2X41A 4GINA 1VKXB 2XCMC 5I1AB 3P2DA 3QDJA 3GB7B 5E8PA 2X9ZA 3R4DA 5BRZB 3UC0L 4QRRD 3BEWA 1SLUA 4G7VH 3MV9A 2PYFA 5B1BB 3TL5A 3KPNA 5FB8B 1GYUA 2YRZA 4AY0A 3QUML 3L5HA 5TE6L 3NSCA 3KGRA 4LNVA 4XI5C 1U3NA 3UCRA 5DJDB 3IJEB 4HLZH 1NAMB 3KPLB 1NBVL 4W6XB 3D12B 1E27B 3CQFA 4BHUA 3PNWB 3MV7E 1NKRA 3CDGB 5CLYA 3VXME 3WS3A 4AGPA 4KZDL 2PTUA 4HU2A 4PS4L 1OGPA 1FV1B 1R5VB 4JHWL 2HX9A 4PRDA 3SE4C 2HKAA 4HXBH 4ZXBB 4AX3A 1SOQA 3SDCB 3ETTA 1BYPA 3RX7A 1IRAY 5I16B 3C12A 2MNJB 5I1HH 2ED7A 2XBZA 2WXMA 1OAKL 5TDPB 1CYGA 5E8OB 1J1OH 2YOCA 1J1PH 1U3HA 1MFUA 5ABDE 5JHLA 2R15A 3W11C 1T7XA 2BP8B 3UIZA 3D69B 5MERB 2PXYB 3GRWA 4AQ1A 5C0CA 2ENPA 1ORSA 3NPSC 4L0PB 4MZ3A 2YXFA 3S36L 2WOBA 1NCOA 4Y2DD 4DEWA 4JFDB 4BH8A 1HS6A 3TNMB 4QD2E 3CD4A 3A4FA 1T1YA 1BZ7B 1QTYT 5J13C 1QNZH 4O5LL 3KWUA 1QOKA 4H0HB 2EEFA 2L7UA 2BSRB 1VCBC 2BSDA 2CIIB 3FKUS 1D6EB 4WI9A 3SKNA 5C0AB 4CKQA 4J4PC 3PGFL 5I30L 4FABH 3BSHA 3OSVA 3OF6D 4YHPA 3TH3T 5IFAL 5CGBA 4E9TA 3HE6B 3MCYA 4FD0A 5DYOA 1L3WA 1T66D 1ZKAA 4XVJH 5B39B 3HCVB 5D2NB 4ERSL 5IMMA 1KXQA 4Z0XB 1LILA 2V2WB 1YC7A 1OAKH 1CBVL 1NMBL 4WY7H 5FGRA 4BKSC 2YD5A 4AE1A 1R3IH 3WUWA 5DZOA 4WW1B 4P0DA 1SLXA 5KSAB 4AQAB 5CP7A 1BQHB 3AWFA 1EHNA 3GSRB 1NGZB 2R29L 1GVIA 3LEVH 5IJKA 1ECYA 2HZHA 4JDVA 5GGSY 3QPXL 2X4RB 3G5ZB 4RGNB 4GRLA 1C8QA 1JNHA 4IRZH 2Y06H 3THML 2A0LC 5CEXA 3AVEA 4LP5A 1BVZA 2X2HA 4MA7L 4YO0A 5C0BD 1Q90A 3DX9A 2A9DA 2WXQA 3AUWB 1IBDA 1KT2B 1KJ3L 3IETB 5GJTH 2GJZB 1TTBA 3L3GB 1JF1B 4NHCL 2BMKA 3SDCC 1Z3GL 3IFLL 4GBXA 1G7PB 4HMCA 5CS7A 1N0LA 2BERA 4FG4A 4LMQI 1P7BA 1CK0L 4ZUTA 1JGIA 4XP6L 2X9WA 4BZYA 2WBWB 4LCVA 5I1AA 3QIUA 1JXJA 1KGCD 3BVUA 1D3CA 1OKEA 1KTCA 1R46A 3HG1A 3Q9QA 4NUMA 5EF3A 3QO0B 1KN4L 5CXPA 4LBEB 4KROB 2OR9L 1KXHA 4X99A 4BBWA 1T7ZA 4E41A 5KS9F 2D4DA 1AKJA 3HZVB 5E08L 4FG6D 2L7JA 4TV3A 5I9QB 3MJ9H 5IFJA 1KGYE 4HHAA 5BO0D 4NJ9H 5D5MA 5EZLA 3SBWC 2QMJA 4FTVE 4NIKB 4DVBA 2OS7A 2H47C 3CH1A 3S34H 1QBML 1IKNC 1O7DE 3OX8B 4U1HA 1Q38A 2IBZX 2I7SA 3OXSB 1DN0A 3ESNA 4WFFD 4XB3A 3C9NB 4D0BB 4P5KA 5E23A 3MRQA 3C60C 1ASOA 4KAQL 1CF8H 4LDEB 3T1FA 4XCCH 1OB1A 1J88A 3T09A 3EOAB 4LKXB 1F3RB 3ULVC 1U6AL 4XT1C 4ZSOA 3L95A 4HPYL 1P5UA 3UP6A 2FUQA 2A83B 3SDDB 1IBYA 1CICD 4YFLF 2BIOA 2PCFA 2VDKH 3MLZL 3LTVA 3QISA 3QXAA 3W0WD 2QQLH 4PV8A 1U3HB 4XP5L 4XBMA 2Z8RA 3QQ3B 1FIGH 2WIMA 1OALA 3K4DA 4NQXA 3RBSA 5FLUA 4LHUB 4MJ2A 3L9YA 3W9DB 3QIWC 5J56B 4PB0L 3CIAA 4AC4A 1FP5A 1EEYB 2I32A 3D18A 4ENZA 3LPFA 3LZRA 2R2EB 1R4XA 15C8H 4KMQA 1HYSD 3WS6A 1RUQL 2CBOA 3ZKND 4PR5B 4XN8A 4YDKH 1MNUL 2VKXA 1LTXA 3JVGC 2RD0A 5F2FA 4X83A 3P11L 4JKLA 4Q2ZB 5FW8A 1UA7A 4HCRL 4PGCB 1FF5A 5ACZB 1X5FA 1VACB 3QEQE 3SE8L 5FUCC 5H35B 2JI2A 3GXTA 3TO2B 2BXYA 4FYSA 4MA3B 1JFHA 2RGSA 1YYLL 1FZMB 3H9HB 4LLDA 4PLJC 1JN6A 4YLCA 4Z7WB 4TSBH 4ZMOA 1F41A 2OMYA 1XTMA 3G04A 4M3HA 4Y16A 4CN1A 3VD9A 2EUZA 4X5QA 4AENA 5E8PB 4FDWA 1XAKA 3QE5A 3RVVC 1E5AA 1H6TA 5FFGA 1G1CA 1OZTG 1QO3B 5H37H 3ZMEA 2YKLH 5DVLA 3L3HA 4M00A 1EFXB 1QI3A 3TOPA 3UBFA 2XVLA 2AFNA 1DN0B 5FYJU 3II1A 2WVTA 3OM3B 3R18A 2OLDA 5DJDA 2C1PA 1K4DB 5D1ZD 3MBWB 4HWUA 2R59A 3RPIB 3RX9A 5IF0B 3NFSH 1TQSA 1WLHA 3RB7A 3QSKB 3SO3C 1OAQH 2X4QB 3OKNB 2DJUA 3RWFB 1N3NB 1N2RA 1M4KA 3FZUC 4OZFB 4PJCF 2GEQA 3V4PL 3OV6A 4JL2A 3BEVA 3QDGB 3D0AA 2GTZA 3O4LD 5J6SA 5LJYH 2HFFA 5F3FA 1TYJA 1G6VK 1PX3A 3VXRE 4YK4C 3OC8A 1F1GA 4Z7QB 1B4TA 2JCWA 4IBLT 5EO0B 1CPUA 3QEUB 3CU1A 3RTLA 4EDWH 5IM7A 2DD8L 1AKPA 3NTCL 3TCXA 1SJXA 4BD4A 3LX9A 5DD0H 4RBPK 1NMAH 2O6CA 2WINA 4XX1G 5C0RH 2A6JB 3FCBA 2R8SH 3KPTA 3U7YL 2C3HA 1FJ1B 3OAWA 4EOWL 1SYVA 3BRFA 4U6YA 4W9KC 5IVOA 5C7XH 2BCKA 3D07A 1XGZA 4OFPA 2CR6A 4MQXC 2QVMA 3B7YA 4UT6L 2BWDA 4JN1L 4ORGA 2D3VA 1CXEA 2JXMB 3H42L 4XPGL 2GJ6B 2W07B 4ATWA 2YEZB 4LNRB 4NRYB 3ECBA 1A65A 1XZWA 5TTRA 4OGAD 4HFUL 4WUUD 4HZ1A 4HOWA 1EH9A 4OSUH 5CEZD 3N3EA 3MLSH 1KACB 4G42A 2DLFL 4UOZA 3Q06A 3AXIA 4ZZKA 1LK3L 2AJYH 2SODB 2EDKA 4K9EH 4AEFA 3OGOE 1BVLA 4OY9A 3SGKA 2VRQA 1FBIH 3MQIA 4GT7A 5TPWH 3PWJB 2WUCL 1WBXA 1ET5A 3QCTH 1RIHH 4PRBA 5FLVA 4NZ8A 2YSSB 1XMEB 2JNZA 4GW4B 1HHHB 1CDUA 3CMOH 3MV11 4FQXB 4Y89A 1KTRL 1E28A 3MJ7A 4OIAA 3JYBA 5AWNL 3WXVL 2AK4D 1NC2D 1ZANL 1PG7H 5IBTL 2R0ZH 4M29A 1CC3A 3IDJB 4OFQA 2WC7A 5D7IA 5EU7E 1RLBA 4E5XA 2QLYA 2BVEA 1S78C 5GRJH 3MYZA 1QBMH 4AC2A 1LXMA 1QRND 2NY7H 1E7VA 3U0PB 5F96H 5K9OB 2DWXA 1OGAE 3HLAA 1A4JA 1G0XA 3EOTH 4ZMLA 3CDZB 4G6FD 3D51A 4UU9B 5EUOF 5G4OA 4BFRA 2YPLE 2E46A 4Q6IC 2OFQA 1W0YT 5AG9A 2BHYA 3MV7D 1JF1A 2FATH 1E5YA 5HHOA 1NMCB 1W8EA 2Y6TE 1A4CA 4QNPE 5ALBL 2MHAB 4NEHB 4R97C 3QXUA 2J1ZA 4ZI8A 3L3DA 1DDHB 2QDWA 2C7UB 3P4MB 3BP6A 3BE1L 5H4YA 5TF1H 3CFTA 4TVUA 5DHVA 1Z3GH 3IFLH 1TTFA 1DDTA 3QO1B 4TUUA 2WXHA 3WL9B 1ZHNB 1DLHA 1KJ3H 5E1AB 4WI6A 1GAFH 3ECBB 3DURA 1EZSA 4Y5XB 2JIXD 4A68A 2MQ3A 2PPAA 2P5EE 4UOJA 3LSOA 3QEQA 5LLIC 3LKOB 5AQ0A 3F58H 4NRXB 3B56A 5ID0A 5CIPB 3L7FA 2OV0A 2FK9A 4V1DB 4Y4FA 4BQCA 4FYRA 1M9WA 1BREA 2CMRH 3KM1A 1JF5A 1MFMA 1AZUA 2NNAB 3SY6A 3SDYL 3CUPB 2E7MA 4R9HA 3EDEA 4HK0B 1NMBH 3BGAA 4YBQD 3FO9B 4E36A 1CJYA 4BH8B 2HUEA 2B1AH 1KJ2B 3F12B 3ZMNA 2WINB 4Y2OA 1BZ7A 2WQRA 4IGBB 3GLEA 4ODTL 5F89A 1HHGA 1KLFB 1YY8A 2Q2EB 5FUZH 3FAXA 4P23D 2XKSA 4EI0A 4DKEH 2F7OA 2OZ4A 4P9ML 2ERJB 1QFWI 2AKRB 1MRFL 1GYCA 1PFCA 1YN7B 4M7ZC 1FN4A 4LU5L 3PWNB 1XFPA 4AKPA 1FH5L 4RMUA 1CU4H 2A9MH 2VUYA 3HPLB 3ZVVA 4R90L 3SY0A 1I53A 3NQKA 2IGLA 5CO1A 1O7SA 2VJ8A 4W9EC 4I0PD 4JFHE 2ED8A 2W59A 2XVGA 4QRQA 4RRPM 1KPVB 1YDPA 1HKLH 2AABL 2AXWA 4Z7VE 3GMMA 4Q2ZA 5JQ6H 3R7RA 2UWEE 4DGWC 1NAKL 1SBSH 3DV6B 2OK0L 4C4KO 4A6YB 1RUPL 3QC5X 3BQUA 5JW4N 3VI3F 5HYJB 3TX4A 5FYLH 1A2YA 1CTOA 3DV4A 5J1AB 3W38A 3FU9A 2E4FA 3QFDB 4M8UA 4AQ8A 2EIZB 4PJCB 4YFEA 3ESUF 1WWAX 5JHMA 1CO1A 3PWLA 3LN9A 4JVUA 5JIKA 1A3RL 4HULB 2ZCKL 4LSSH 1U95A 4N2EA 3HHMA 4YFDB 2LLNA 1ORQB 3PCYA 2F74A 3PJLA 4HIJA 1BECA 4HC1H 4P8QA 4PIRF 1RZFL 3O4OB 5DLML 4KJYB 1H3PL 3OKKA 2XYCA 3GK8H 4HBQA 1ZGLB 2ORBL 3QZOA 4F8TA 4HZLA 4QHPA 3RWIB 4XP1L 2BM3A 2PO6D 1JGDB 43CAA 4ZFGL 2BVOA 9CGTA 4FQXC 1ZVYA 3EJJX 4RMWA 4URTB 5EDXA 3UERA 3KBPA 1TVDA 2Z31B 2E74C 3OB0H 3V0JA 4YGVA 2FWLB 3UZEA 4QI3A 5HI4C 1G4RA 4FE9A 4K5OA 3V4VL 1SN5A 4RZCB 4AMKL 2WLLA 4F1ZA 4HC1L 2CLVB 3DMMC 2IGFH 4BGDA 1M2OA 1KCSL 4RMBA 1FYTE 1RJYB 3NJIA 2NTFB 1QLRB 3WL9A 4HLEA 2ZPKL 1B88A 1OPOA 3DX0A 3O3EB 3VFTB 1TDQA 3A22A 3H54A 4GFXA 4U1JA 4M6ML 4WWPA 4H25A 4DSYA 2FIKB 1W91A 2OMWA 3UABA 3EOAA 4LKXA 4ZUVA 2I26N 3B1UA 3N0PB 3ZJAA 4HHWA 3WFBH 2IH9A 1K6QL 1EQWA 2XTJD 3ARDD 2QTVA 1FL6A 3GSUB 3NFPB 4K94H 2MRYA 3MGTA 4HA1A 4A67A 4AYMC 2NX5A 2H5UA 1E8ZA 4KH9A 1DJXA 4OZHE 1ETZB 3UTQA 4ZS7L 3U30C 3V5HB 2QZQA 4QJ5B 3MA7B 1GZHA 2A1WH 5IT2H 1F1AA 2VRKA 4KY1H 1XF1A 5IHWA 4IKNA 4UQCA 4I9XA 1DJZA 2XY1A 1A9VA 4PJ9A 1CU4L 2A9ML 1C08A 4MJ6B 3S3CB 1OF2B 2XTSA 1EZVY 3QWQB 2R7EB 4K3DL 4Y5XC 1LJMA 3MBEB 3RZCC 1BEYL 1MDAA 5CCHE 1NTDA 3D3VD 3ZDYB 3DKHA 4P05A 3C6LB 5ISZE 2Z1KA 3P69A 4DKEL 4ECNA 4DP7X 1T0MA 1M7XA 4AMKH 2YMOA 4N85A 5TJWK 5KAQG 4AK2A 2ZOLB 12E8H 4LCWD 2YMXH 5IQMA 1PZCA 4PRHE 4HJ1A 5B8CC 1OW0A 2X6CA 4UAHA 2DLHA 4PJBE 2HMIC 3EZ8A 3APCA 4Z76A 3FTYA 5FA4A 3NSYA 4WKZA 3O3AA 4AL8L 1C5BH 5CZXC 4HK3J 4RMRA 5I6XC 1NUNB 3GK8L 5EPMB 3W57A 2NY5C 3C6LC 1P6AB 2W60B 4GXVH 5FFLA 4WU7A 4DO5A 2QR0B 2QVIA 4BGLA 3NCJH 5GZOD 5D8JL 1CB4A 3HZMA 1HH6A 3V6FA 1S4IA 2ZWYA 4JAMA 1BLIA 4IRZA 4NHUB 3NRPA 4X98B 5JHDA 4K3JH 2CKBH 5D1QD 5SV3A 4E42B 1ZDSA 3QQDA 5F9JB 1U8LA 1Y1DA 4H1LG 4ZO7A 4PGEA 5F3BB 1XGPA 4ICWA 3QZWA 1EDQA 2ZF8A 5CFHA 5MEQA 2DWTA 4PHZA 3DO3A 4LSDA 4R7DB 3VRLF 2NY0B 4LZKA 3NH7L 3QYNA 4R3SA 2OR7A 2OZNA 4ZT1A 1AP2B 3GPEA 2A38A 1EJFA 1QHQA 4BWWA 3VCLA 4U6VL 1E8WA 3F7RA 1JPSH 2FUTA 5E56A 1RZKC 3ESOA 3PJSA 5DJ8A 4XNQB 3U1PA 5IUSA 1YEGH 2VXTH 3CUPA 3B9VA 1AACA 4KZEL 1MREL 2GIMA 3SYQA 3TM6A 1JYWA 4QYOB 3D1MC 2XXCB 3ZKXC 5ALCH 2YAFA 2AAVA 1S7TB 4OZHB 4XWGL 2QKIC 3WEAA 3U2SB 4OIIL 5JIIA 2AITA 1XH3B 2Q86A 3ARBA 4KK8C 1F11A 1ZLSL 4L18A 2D4FA 4YHNA 2YUWA 1U41A 5DZJA 4FJZA 4GKSB 1CDJA 2H32A 2OMWB 3OAZH 1R5IB 4H26A 1YY9C 2W92A 5FS5A 5GHWL 3V6OE 3VXRB 5BJTB 4KX9A 4BSVB 4PJDF 1TJMA 3EJPA 3B9AA 5HGHA 3EH1A 5I0DA 4K07A 1HN1A 1FBIL 2VNCA 4HS3A 5E1IA 1PD6A 4N2OA 5I15L 3FCSB 2H7WA 5G5DA 2HTKD 4J39A 2ZSWB 3N91A 5E6RB 3WTYA 5F1IA 1HINL 3F58L 3ZZ1A 5DYFA 3VGAC 2EH8H 1AE6H 4JAMB 3AM8C 3H55A 1YY9D 4KKZA 3IBOA 4I5BA 3GTTA 3VXSA 5H94A 2OJEA 1MH5A 3FQUA 1U8LB 5ANMA 5CWSA 3HNSL 4M8RA 4S0HA 2IIJA 2HXAA 2XIDA 1H3GA 3H9ZA 3MLRL 2MNWA 4PRID 2ZXGA 3WHE0 5IJCC 1G9NC 4QOKE 2HX8A 1ZEAL 4HSAC 3FAWA 4JL1A 5T5FL 4WZ9A 5L9DL 1PYWA 3HG3A 4QHNA 2IG2L 2QSTA 1QWUA 3T0XA 4WNQB 1ZOXA 2XRAL 5C0EB 4DUVA 2DICA 1TU2A 3F7PC 4U1NA 2ATAA 5GGUA 1I3RB 3NTCH 2DD8H 2BXZA 1GJWA 3MLYH 2CJUL 4GSQA 3ML8A 1R24A 1NSNH 1RXLA 3ETBF 3LXAA 5TF0A 1X4ZA 4OLYL 1E9OB 1HXYB 4YHZH 4ETQB 4XWOD 2F9BT 1AD0A 1BCIA 3ABMB 4CVXB 2G9KA 3WFDL 1QEXA 2AK1L 3BAYA 1U8HB 4YL9A 3X1NA 3IGLA 3QJFA 4QPEA 1LEKA 4EDXA 1GZQA 3OXSA 1SXAA 2VDMH 2YKKA 2Z3FA 2MFNA 4IOFC 2CDEB 1B0GA 1JHTB 4IDJH 2YSTA 5DA4A 2GJ6D 1CD9B 4YHNB 1GR7A 3MBXL 2ICCA 3GI8H 1CS6A 3SDXE 2DEYX 4HKXA 2H32B 5K9JL 2Y5TA 4NZUL 1J8HE 4Y1AA 5F3BA 4C56A 2DIAA 2Y24A 4NO0B 1D7CA 4Y4FB 4ZJ9A 4ODSL 1Z5YD 1MWOA 1XX9C 2APXA 4PJIB 2WUCH 5EN2A 3QPKA 1BVOA 4JPWL 5IMKB 1K3IA 2CO6B 2NY6B 1JK8A 2VDNB 4I9WD 1KEML 4CN6A 1BQHG 2FL5A 3GDCA 4R7VA 1W0WB 2GB2A 2ZYHA 4O9HL 4PJ5B 2BIQA 2DLFH 3EBIA 3L1OH 2HJLB 1FL3B 3N1QC 4XMUA 3VFNB 2ADGB 1S9VB 3MDJA 3MRRB 2ILLA 3UROR 2YPVL 1F6AA 2XFXA 3NN8B 1YYCA 3EFFB 3QUXD 4WHTB 4ELMB 4WJ5B 3NZHH 1BZ9B 3MRKB 1JNLL 5HP5A 1RAMA 3GWJA 4HJTA 5C0GB 4JHUA 4NSKA 2XWEA 3QUXC 1OARH 4ZMPA 2H3XC 5DS2A 3KPSE 1F45A 2EE9A 4KJWC 2J6EL 2QMKA 2Q8AH 1KCKA 4RCAA 3D06A 1YNLL 4NXSA 1IGIH 2G3XA 1G6RL 1XCWA 1YEWA 5LXVA 3HZKA 2V9RA 1JPTH 4P3WA 2OL3A 4K5PA 1TMQA 4KHTH 3HBZA 5A6IA 4MBOA 2WXNA 4UM8A 4U1MB 4DGYH 4JO3H 4HS3B 3IMBA 3TYFB 1FO0A 5LG1A 4CVXA 2IH1B 1A4KA 1EK3A 2DL2A 2WM0A 2KQMA 1JCKA 3ASOB 4YBLC 4AXWB 4Z76B 4U1SB 2DWEA 3V0EA 3HBPA 1CF1A 4ELDA 4XVSH 3DX2A 3VFMA 1CF8L 3HVDA 4OF0A 4UQ3A 4KDVA 1KNOB 4POZC 2C8NA 5KBDA 1MAKA 2XG5A 3T2NL 4Y2NA 3LPOA 3QRGL 4WI3A 3QJHB 2NZ9D 2X70B 3ATAA 3F7YA 3KYMA 2FO8A 3LIZA 3PDOB 1DQQB 2WN2A 4KDWA 5AUMA 2YKLL 2BC4B 1AAJA 1F3DJ 4DJMA 4QRSB 1UURA 1I85C 3DO7A 5B1AB 3OJDA 2CA4A 5D1XB 4XBGA 2X2IA 2HRPL 3EO9L 2H6PA 1G6RA 1H15A 3AMLA 5F7EL 3NIFB 4B3VA 3MNDA 5IIEB 5GZNC 2GG1A 1TIUA 5E8NA 2VDOB 4MHHI 4P5TD 2WNKA 1E6OL 5C1MB 4B53A 4XP6H 2E5EA 4FS0A 3GHBL 4HP5A 4D0DB 3I6GB 4GSDL 3KM2A 3TEXA 3AB0C 3D25B 4JM0A 1NGXA 2XX0A 2HRPH 3EO9H 3K0YA 2XPGB 1B0GB 1JHTA 4XCEB 1I7RB 3ZIYA 2GSIB 3D2TA 3CZUB 5TE4H 3OF6A 4PJAE 4S1RL 4U6TA 1RUAH 3ILDA 4J7RA 3S37H 1BV8A 1OAXL 3F64A 1N5AA 3M17A 4F5CE 4QXGL 4OD1H 2VAJA 4I85A 1NC4A 1MN4A 4PJIA 2Z0UA 3MU3A 4S1SH 3KBFA 2VDKL 3BZFA 4QRPE 2WVVA 1Q9WB 1O5DT 3VYNA 5F0PB 3O2DA 2FGWH 2G5BB 2YUZA 5DS1A 5B38G 2B4CH 2F08A 3DIFB 1OE3A 4JG0H 4F2FA 1YEKL 3A6BH 4L4VB 1FNLA 3IDGA 4NKMA 3V4VB 5CMAA 4HC1A 4XCCL 2I69A 4PJFB 1XXFC 4KXAA 5FYJH 4KTDH 3VB9A 1MI5E 6FABL 4N2KA 5DF0A 4LBEA 3JTSB 4ANWA 1SHMA 4XCYB 1VFOA 4DKFL 5I73B 1JPEA 3PGFH 3OB8A 5IJVB 1KIRB 5I18H 1YPZA 2P3YA 1YUHA 3VG9C 1AHWA 4FXKC 4F80A 4XE0A 5H94B 2BVTA 4FULA 3QXWA 3FFDA 3NIFF 3OWEA 1M3IA 4FKHA 4P2AA 3AT9A 4MAUL 3PAUA 1W8NA 3ZU8A 1U3YA 4LL9A 1NBYA 1PQZB