2P5PA

Crystal structure analysis of the west nile virus envelope (e) protein domain iii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
TTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Genome polyprotein
publication title Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
rcsb
source organism West nile virus
molecule tags Viral protein
total genus 12
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p5pA00
1UZGA 5GZNA 3N44F 1PJWA 3UZEC 5KVDE 3UAJA 4UTAA 3UZVA 1OANA 5LBSA 3WE1A 2GG1A 5LCVA 4UT9A 4L5FE 4UTBA 4FG0A 3UYPB 2JV6A 2JSFA 3N42F 5KVFE 3G7TA 5H37A 5JHMA 4X42A 2P5PA 5KVEE 1Z3RA 5LBVA 5AAWC 2I69A 3C5XA 1RERA 4FFYA 3IRCA 4BZ2A 3N40F 3VTTA 5JHLA 3J2PA 1SVBA 4UTCA 5GZOA 5IREA 2HG0A 2V33A 4FFZA 3MUUA 4UT6A 5B1CA 1URZA 2ALAA 2H0PA 4BZ1A 5KVGE 3J27A 1S6NA 3N43F 2JQMA 4GT0A 1OKEA 4AM0Q 1OK8A 3N41F 1Z66A 4AL8C 3P54A 5AAMC 4ALAC 4GSXA 1ZTXE 3UZQB 2R69A 2R29A 1TG8A 3C6EA 5IZ7A
chains in the Genus database with same CATH superfamily
1SOSA 2QGBA 1GOHA 2A3TA 4PJXF 5GS1B 5IQ7L 3I6SA 4R4ND 3WNIA 5CJOH 4JRXE 1M3JA 2BOCA 2YOAA 3SOBL 1UM4L 2A9AA 4XBGA 2ZKXA 3NA9H 1AR1C 3D69B 4AZUA 5LBSA 5B39A 3BMVA 5I28A 1SXAA 5JW4Q 1RURH 3WSQH 2P5WD 1A4KA 2JK5B 1Z32X 4FG4A 1PZCA 3MUZ1 4NCC1 1VJSA 1G6RH 1KYFA 2FQFA 4X5LA 4ABUA 3ZT7A 5D1XD 1WZLA 2EVHA 1NM9A 3QPXH 5I1IL 4L3EA 1VCBC 1D5XA 5L7XH 3RBGA 3DI3B 4N6RB 1FE8H 4KH2A 3L5WA 3JTBA 3HE7B 2JCCA 4UINL 5D1ZI 2V37A 4ZUWA 3ZMNA 3IB4A 4XCEA 4BWWA 4KMQA 5A6LA 5KSUB 4PJXA 4F93B 2Y5EA 1TU2A 1LP9F 2PP9A 5A2LH 1OE1A 1TYRA 4Q6KA 4RMRA 3TIDA 1J05B 4X4ZA 4I5BB 3VFRB 4AY0A 4U6VL 4KHTL 4NN5B 4XPAL 4XVOA 5CLYA 4UV4L 4TVUA 4WWKD 1L3WA 3QIUD 3MYZA 3P0GB 2NXYD 1FO0A 1MNUH 5FEBA 4J1UB 1NKOA 3QCUL 2ZONA 5BNXD 4QY8B 4P57A 3ZBMA 2VSMB 2HFGL 3O11A 3H7BA 4HZAA 3UTZA 2ODIA 3UMTA 2WNWA 4PGDB 3EXJA 4ODTL 4MAYC 4NC1E 3QWOB 2YAOA 3B1UA 2VT0A 4M8QB 3KPSE 5DYFA 1LP9A 1YYCA 2IXQB 1U2HA 4P9HC 3O3AA 3MRBB 3IE9A 2GKIA 4FTVA 5CN1A 1KCVL 1SN0A 4NQED 1XH0A 2ICCA 3V5HA 1CB4A 1SVZA 2PCFB 5A40E 1EZVX 3CHPA 4YBLC 3BWAB 3N2JA 1FNEB 4KK6D 3CZKA 3N1PC 5KSVB 1GRWA 2VZUA 1DQQA 3S0PA 2NT1A 4XNAA 5D2LE 1MJ8L 4OZIB 1SPDA 3KGTA 4NKDB 2AABL 2MKLC 3ILQC 3B2MA 4FI6A 4YEEA 3VXUB 4L8BB 4AMXA 4Z7UB 5IBUB 3ARXA 3Q6GH 4MD4B 3UOAB 4JPIA 5DDHA 1DSWA 5KVDH 3QUXD 4U7MA 5I5JA 5IW3A 4QRQB 1UZGA 1MFAH 1FJ1A 2NRDA 3X1BA 3FOMB 4P49A 5JQHC 1KJVB 4HPYL 1QFWM 4IDJL 5KTEH 1IBBA 1G4RA 3DHPA 4QRFA 3NQKA 2WBJD 3CPLA 1KCSL 3DGCR 5F3BB 2BVTA 3MRQA 3OQRA 4WKZA 5D1QE 2BIOA 4WHYH 2DRUA 3E2HB 2EO1A 4CKQA 5EUKB 3Q8AA 5TD4A 4HKBB 1ZPUA 2P80A 5DD1H 2P5ED 4WO4B 4HEME 5LAXA 2GAZA 1T4KB 4OD2A 5D1ZB 1JS4A 4OW6A 4NDMA 1RZJC 4ALAH 1AKPA 3CMOL 4U1LB 3MV7E 4B7IA 3WIIH 5BRZD 2QR0B 3ETBF 3IMVA 5IK3A 4FQXD 2XWTA 4ZMNA 3OD3A 2VLMD 4BFGA 4K23H 5AVZB 5HPMA 5BOZG 5D7JB 2K7QA 5FKPA 1QW8A 1OP3H 3A22A 5DS8B 5FB8B 1Y1DA 3D0VB 4HCRH 5DUPL 4MYWB 4EZLA 5A43C 5CBAB 3Q5TA 4YPGB 3KWXA 4FQLH 1TLMA 3SBRA 3TL5A 1G9MH 5E9NA 4M1DH 3A6BH 5DWUH 3U36B 3RZWA 3QG6B 4FFZA 3TLRA 3ZTJH 5IBTL 3HNVL 1UFGA 3ARWA 5C70A 1UC6A 5L88L 1PJ9A 3OMZA 4EBQH 1UA6H 5JMOC 5BZDB 1AO7B 2KLSA 4AG4L 3NGBC 2GB2A 3J27A 2P8PB 1QPPA 3KYOB 3VAEA 1D9KC 1XGYH 1F4YH 2AFNA 3FO0L 2VR5A 3LN9A 5E08L 4Z3JA 2LVCA 3DJZA 4AM0Q 3GMNA 1H3VA 3EYOA 3DV4B 1INDH 1XEDA 1XD1A 3KPOB 1SJEA 2FD6L 5EUOE 1EJOH 4QXTA 4NOBA 1D6VL 3FO1B 3KD4A 3P54A 4PJAE 2I9TB 1XXFC 4PWHA 1PY0A 4J3VA 5E00A 1P53A 5F8RC 4MVBC 4TLUA 4K9EL 3LHPL 4TPRH 2HRHA 3RE0A 4AX3A 1IVLA 1R24B 1ROCA 2GTQA 2J1KA 2YUWA 4KQ4H 4MAYA 4XXWC 5DD0H 3WE1A 4CILA 5I30H 1BM3L 1RL1A 3ZDXF 3TM6A 5A7EA 4LSUL 4DUVA 4XMTA 2O6EA 3O6FC 3S3JA 3INUH 4EDXA 3LIUA 3VGFA 2X4PB 4KX8A 5IG7A 3S88L 1EO5A 1JGDB 4GQZA 3ETSA 3QULB 5ALCH 2Y5QA 3KCPA 1CTOA 4PB0L 1WAEA 4H1LA 1W16A 2ZUYA 4RLDA 5L2JB 3T8XB 4CU7A 1NEZB 2NZ9D 5INCA 1Y1UA 3L3GB 3O9WA 1FGVH 2Y23A 1FAKT 1BG9A 5AW9B 3RL2B 5BVPH 3PP4L 4JQIL 2QVTA 1CYXA 1FNSH 3QIWC 1U8MB 2DJSA 5TK4A 2WUCH 5LN4A 3B7TA 1LEKB 4FHJA 1CO1A 4DVBA 5FC9A 1NWOA 3V0DA 4U3CA 5K1JA 4P2YA 5CEZH 4FG2A 1X5YA 3DK2A 4AL8H 3QO0A 3GHPA 1CE6A 3SY0A 1FVCB 1G7HB 5IB3B 5L8JB 1TOXA 3W0WB 4ZMAT 3VXOB 1LILA 4GPVA 4R9HA 3WFBL 2P5PA 3RVTD 1QLEH 4UM9A 1KXTB 1PZBA 2YXWA 5F7YC 5HYSA 1IE5A 4FA7B 4NJAH 4POZD 5CP7A 2WQVA 1S4IA 3L6FB 2F1EA 3F84A 1FL6A 2HLEB 4A7GA 2DF3A 5I66B 1GS7A 3NG5A 2VLLB 3O41A 1LO5A 3I75A 4PJIB 3H4HA 5C0RH 4PY8I 3G5ZB 2MCAA 3ARVA 3NZHL 5E94B 5DHYB 1TZOA 2CCWA 1XF4A 1OP3K 3HNSH 4JJOA 4AW4A 3L4XA 3GSWA 5KBKA 1AI1L 3U0TB 1CD9B 1VZHA 3AABA 2E4TA 2HTLD 1E4JA 1JXGA 5AB2A 4OQTL 1DQLH 1R3HA 4PWIA 1IZKA 3JV0A 5I1HL 3DETC 1DVQA 2P44B 1RCYA 3PAZA 4L3AA 2GK0B 1DVYA 1Q0XH 4F33A 5AVXB 3U2JA 4IK6A 4DN4H 4ZMYA 5J3HC 4XZ4A 1S7WA 3IN0A 4XBEL 4LGSB 1YQVH 4M7JH 3GDCA 1SYSA 4YDVB 5HPOA 1Z5HA 5C0GA 5HI3D 1W2KT 4NUGL 1I8KA 3QFDA 3IJHA 4A2DA 3KPRB 2R0ZL 1IKFL 1FV1B 4GKNB 1S9WA 4HWBL 5DRWB 2V3DA 3S5LA 1NGXA 2N7AA 4C56B 1HHGA 3NCEB 1UWGH 4P04A 2I27N 3FU8A 3AXIA 1KPVB 4ATTA 2R1WA 3VA6A 1BZQK 3QORA 3ZKMD 3RVWD 2HWZH 2YPVL 3MLUH 1A6WL 1A5FH 2E59A 3EH3B 3HC3H 4LCIL 4OH2A 5D7KD 4EI6B 1R33A 1RIUH 1F11A 4GIOA 5JIMA 3PHAA 1D9KA 3MLTA 2YUVA 5EU5A 2EDNA 1XO8A 3N9GH 2CA3A 3OXSB 2VDQH 4ZFFA 3ZTNL 4I48B 5IBLD 3VXNA 4LOVA 4M5ZL 4J3OG 3UAEA 2VDOH 2ESVA 3KEHA 4CMHB 5E7BA 5CILL 5E9DB 1YEJH 1VACA 2WLMA 3GS0A 3NZ8A 1M6OB 3BPLC 1WICA 5D1ZD 3MSPA 5FX3A 3SDAC 3V2AR 4N8UA 3IAGC 1FAIH 3GSUB 5FUCC 1A6TB 1JBJA 2EE3A 2EAEA 4S1SH 3ZSTA 4W9JC 4F2FA 5IQ9A 1CG9A 2BJMH 1EH9A 4FJYA 1RULH 4UTAL 1R5IA 2FIKA 3GMPA 4PMEA 5D7JD 5T3XH 1DFXA 1JGEA 5ISZA 4MQ7A 1B0GB 1QA9B 5CJXC 3BP6A 1MFCL 1OB0A 1TNMA 4JDVB 4J3XA 4UV7H 4MSWB 5T5FH 2QFPA 5C2BL 1KCUL 5DMKA 2WGNB 1U3YA 3RX5A 3BKMH 1ES0A 1CVRA 1MY5A 2XUWA 3D39E 3BT0A 3FZUD 5I18L 4PJHA 3WXWH 5K9OB 5GS0C 1HC1A 5KYNA 4PVNA 4JZJA 2A6KA 1Q9LA 2E46A 4BFEA 4XNMA 1C1EH 5E2VL 4PY8J 2IADB 2K70A 2JVUA 3HUJE 3MOAL 3V4VL 3NN8A 2XVLA 3A3YB 4K8RL 4OFVA 1XTLA 3BVUA 4N85A 3HZKB 1OPGL 5L8KB 4MTMA 4NNYB 1CFVL 2LAAA 1KXVC 3RIFF 3LCYA 5KANG 1B6UA 4ANVA 4LEXL 3EHBC 4PG2A 4S11A 3DSNA 4QHUA 1LDPH 4IIQB 4RFOL 4FOMA 1UOLA 3TA3B 4S10A 1WGVA 3WLWC 4GQ9L 3SYCA 3H2PA 4YVNA 1OTTC 1I9EA 2BP5M 1PKOA 4H26A 4OF7A 1OK8A 3VA2C 4GW5A 3G6DH 3G5VB 5CLXA 2XN9A 2FECL 2P5WE 4HJ0C 5FYKH 3TEZA 3IFOB 2EINB 1Z1WA 1ZTXL 1THAA 5D1XE 4JPWL 1C08B 2P8LA 1FFRA 3KS0H 3D4GA 3LS4L 3K2MC 3L3IA 2Q76A 3OWRA 5E9AA 3RHWK 2Z8RA 4GSDL 3L1OL 4H2CA 1T5KA 4GB9A 1ADQA 1UADC 3GS7A 5SV3A 2QKIC 4HUNB 4IS6A 1A9EB 1NPJA 4F2MA 3ZZQA 2JXMB 4G8IA 1IE4A 1JWMA 5DR5H 4HIHA 1MCOL 3ZDZF 3PP3K 3SE4C 2GIYA 3D3VB 4XAKE 5HHNA 1CDJA 4PREA 1FNLA 5GRJH 3UJJL 3RU8H 1ZXQA 2NZ1A 1U8IA 4KVPA 4KZCA 5D7IA 2VR7A 3HZYB 2RHEA 3FQRA 5KEZA 1XR8B 2E8ZA 1JVOA 4DTGL 3W0WD 2FO4B 2FECI 4X6EB 1BQ5A 3IAPA 4XB3A 4ONOA 1VHPA 3AREB 5KUMA 5TPWH 2AGJH 4N0FA 1QBAA 4W68A 3MRNB 5I16A 3T2NL 4JKPL 1UH2A 5EZPA 3GXPA 2BNQB 1JZFA 2Q3ZA 4HW6A 1ZV5A 1WBXB 4LLDB 1B2WH 4M8UA 2PR4L 4OUUB 4DUXA 3D87B 2X41A 2VW4A 2VLRB 1BQHB 1CQYA 3BFWA 4ZMLA 2DMGA 2X4NB 1OM3L 3GXMA 1YYLL 2O5NA 4CU8A 5SX5H 4Q97A 5I2IB 3O2VL 3FAWA 3WFEL 1UZ6F 1VZGA 4MKMA 5EU3A 4XPFL 4BEIA 4HWZA 2D2CC 4R8WH 4TNFA 4X8JA 2DJ4A 2YMTA 3ISWA 4UU9B 3V6OC 3PHQA 1WIPA 3U1PA 3SBPA 1PU0A 1WZ1L 2O5ZL 3HAEA 4NHCL 5EU6A 2VL5A 4AMKL 5KVGL 5J4MA 3B2DC 3IYLW 3QZWA 3QRGL 5K69A 5C0FA 5CJXA 3HC4L 4C59B 5FLUA 4BKTC 3LXBA 4JPQA 3KPRD 1SY6A 1NQBA 3MRFA 2YMOA 2XXGA 4MJ5A 2L04A 2C7FA 2D4FA 25C8L 1E5AA 3M46A 3NCWA 3VGAB 5DTFB 3AMKA 2FATH 1BZ8A 1FZMB 3NK3A 4ZODA 5E1AA 5AWNH 4C56D 4Q6YA 3SO5A 4IW4C 1OVZA 2WTRB 2KZBA 1DDTA 5DJAB 2VAJA 2EIJB 2YPKA 2GUOA 2BSDA 2FLMA 1TG8A 2Y6SD 5F1NA 2VIRB 3LXCA 4MGXA 1KXVA 1BVLB 4O2FB 1IBGL 3V4VB 5IZ7A 5BRZE 1HKFA 5DZAA 1GPOH 3EJZD 1ZHNB 1H8OA 1ET7A 1MFMA 2FNWA 3QXAA 3FT4B 3SGDH 2K9UA 1A14H 1IC7H 2CDGB 2N01B 3EH4B 3IJSB 3I50L 3PYCA 4X6CF 3H8NA 3UDWC 4PCKA 5FA4B 5E9DD 2B08A 5MHSD 5J6SA 4FCHA 5LXGL 2PPCA 2Z35A 4DSYA 3ARFB 4N8CL 3TBWB 4XH2A 3QUYA 4FN0A 5F9WB 4BQ6A 4LSQH 3ARUA 1X9RA 2WQSA 3I3DA 1E43A 4HQQL 3OZLA 1P7BA 3S36H 3H6AA 2E6JA 3P11L 5E99H 4KXZI 2W07A 2AEPH 1BVKA 4WUUA 2XY1A 2X70B 1AIFB 4LAQH 1E4XH 4JKWA 3HVDA 2D4DA 4QRPB 5KANI 3MNVA 1AHMA 5AW7B 2CRMA 4BDVA 1AOHA 1RP9A 3JWNH 4X4MA 4WFGD 2QKIA 5MERB 5LGHL 1XGUB 2JQZA 4R5VA 4UI2A 1AS8A 2P28B 3MXVH 3FUHA 4YFEA 1B0RB 3T3PB 1IBZA 3TA4D 4UQ9A 4YBQC 1FYTB 3SE4A 3ZZLA 5E56A 3ZYOA 2EH8L 3LD8B 1ZJAA 2Y07L 4DP1X 3P0YH 1UT9A 5H37H 4YHLL 3ZYIA 1OPOA 5JHLA 1X5JA 3IU3A 2DQCL 3F7PC 1PX3A 4ACTA 3VU1A 4QRTB 2J55A 5IMMA 4NNPH 3PL6C 4XZUB 2G5BB 4I9WE 1JWUA 3JSSA 1CU4H 4MD5A 4ZNEA 2G3NA 3CDFA 1T1ZB 4U1MB 4YXLL 4J8QA 3VW3H 3S7GA 3SDYH 4NZUL 5I1DB 1N8OE 5SX5K 3TA3D 4IRJC 2VN6A 1EZUA 3NIGF 1TJHH 4IOSA 4NXSA 4IBQA 5JHAA 3HBQA 2EEDA 3I3BA 5TDPB 1A3ZA 1N0LB 3CX2A 3HTLX 2F74A 4R4FH 3L7FA 1MLBA 5IEKB 1LO4L 2NYYD 4UBDC 1BZDA 2ZWYA 2R23B 2OMUB 1L5GA 1NGQH 1U3HC 5HJDA 1LEIA 3U83A 3DPDA 5E2TH 12E8H 3B2XA 4QR7A 4C4BA 2IBZX 4LCVA 4YH6A 3LX9A 3VTMA 3AG2B 5DJXA 1UVQA 3UJTH 3CZNA 5FDWA 2D7PA 3U7WH 3ZHKA 1ZLUH 1JZHA 5DJ8B 3QFGA 1KBWA 4WEBL 4OZFH 4FERA 2EXYD 2VCOA 2CALA 4QYOA 3SE9H 3V6OA 1MN4A 1E3ZA 1A9BB 1BJMA 3D25B 3IRPX 5D72L 3KYAA 4ICWA 3D3VD 5B7EA 1UQSA 3HPJB 3C8DA 1Q90A 2F8OA 3FPYA 1I9RH 3PPSA 3WTYA 2NDGA 2B15A 2AQTA 3VXTB 5GJSL 4RGNC 2EDRA 4HD9A 1CCZA 1Q38A 1R1CA 2JE8A 3PQYB 4AYDC 4DP6X 1QBML 4RIRB 2WZPD 5DQDH 2IF7A 3ZYJA 3B9KC 1O7DC 1WIUA 3ARED 3BUDA 1D3CA 1U6AH 4Z7OF 4DW2L 2BFVH 2IDSA 4HT1L 2VQ1A 1B0IA 1WJ3A 1QR4A 4Y9CA 3QDHA 2BNQD 3W9EB 4DK3A 5CD5C 3C2AL 2X1PA 1QPXA 5HGHB 2EYRA 4XMKL 3FCGA 5AOLA 1N8ZA 3VGHA 1MSPA 1LL1A 2X4TA 4JDTH 3PLYA 4NZRH 5JNYB 3PWJA 1MIEL 3ULVC 1A3RH 1KENH 4JHAH 3MCKB 4UM8B 1P7QB 1JAEA 2RALA 2PPFA 3BRGC 4RISH 4ZO9A 4JZNB 3ZE2F 1OAYL 2J1YA 3VYPA 3VMPA 3P40A 1GKEA 4FQ1L 4QJ3B 3KWTA 4AJVA 4OGXL 4OZIE 5KS9F 3KBFA 1ZT4A 5MENB 5E51A 1VESA 3AJ7A 4GUPB 1U92B 3LKRB 4KKLD 3K2IA 5KYUA 2Q3AA 1IT9H 4K5OA 1UD6A 4WSGA 2K6YA 3Q0HA 5TTRA 3N1FC 1RY7B 2A6IB 3K0YA 4R0LA 4XOAA 4YDMA 5FCSH 1A1MB 1SMOA 3QXTA 3BSZH 2C7UB 4ODWA 2TRYA 4OGYL 5KSAB 4JQXA 1JL8A 1XGQB 4KKPA 2AXFA 1KZYA 4FA8A 1FCCA 1TTGA 3QQ9D 4TS6A 1Z2KA 2C3XA 5GGTH 2YEZA 4KY1L 1RHHA 4R96A 3V55A 1KACB 3WNJA 4X7TB 3BKCL 4L4TA 3GMRB 3ZE0F 2EDBA 3FTWA 2B59A 1AMXA 1YEHH 4B60A 1MCQA 3U6XS 1GOGA 3DBSA 5C1MB 5KS9A 5DVOA 5FK9B 5B4MD 2VXQL 2BHFA 3HS0A 5T1MB 3ARRA 1YEGL 4QIRA 4A6YA 5K9KA 3UBHA 3L3KA 1FIEA 3PL6A 1Q9KB 1ED3B 5CKGA 4EQ3A 4K8RD 4C4UA 4KUZH 3VJ6A 1M05A 3OKNA 2YD0A 1ZT7B 5L2KB 5AVWB 1UT1A 1ESOA 4IRJA 4EZJA 1ZLUK 4XMWA 2QGDA 3NPSC 3OHMB 1MFBL 3D50A 1XGTB 1WAAE 4LSPH 4MNQA 1S9VB 4HP5A 4DGYH 1U8QB 3ARFD 1U21A 3WL9A 3TBSB 3BRFA 4LLVA 4YK4C 4UQ2B 4OLYH 1TMCB 1BPVA 5ESAB 4F5CA 2B4CC 1PVHA 3QHZH 1ACYL 4OFQA 4TQEH 1GH7A 3OGCB 3PIQB 1EEZB 1U3HA 3V4UH 4HUMB 4OCRL 2WO2B 4LOUC 2BVEA 4GS7C 1RIVH 1NFDE 3CFTA 2ATPB 4QRPD 3TPUA 1NANI 4UOW1 5A3IC 5D70H 3IDMA 3US1A 3QPKA 5CZVH 1SDAB 2ADJB 1NC4B 2Y1YA 1XF5B 4D0BB 3RWHB 1J88A 1UJ3B 2CXGA 3K6FA 4WI6A 1UH3A 3MHZA 4NGHH 5E6IC 1FYTD 2IDFA 3G9VA 4MXVE 5L0QC 2A9BA 4KK5D 3RDTA 1F42A 3ULVF 3BPOB 4XMPL 1MI5A 3FKUS 2Y7NA 2R2EB 4J8RA 2YQ3A 5DC9B 3TBVA 5JHDA 1JHLH 1J8RA 3AMLA 4V2BA 3D34A 4X5WA 2EXWD 2E75C 5HYEA 1IM3A 4IBYA 4NQUA 3HKZA 3QJUB 4A1RA 5FF6A 1YJDL 3B9KA 1P4BH 2R1YA 2YC1B 1P4UA 2AI0H 3ILDA 1KBPA 1QFPA 1YNTA 3KVPA 4ZMTA 3CN2A 2ZE0A 4CVZA 1T0NB 2WXIA 1MHCB 2MIZA 3K4DA 1FPTL 3A4EA 3DIVA 1DQIA 4ICXA 4O5LL 3ZKXB 4U1KB 2DQHH 2QLYA 3M6DA 1J5HA 4FI7A 3OLEA 3LN4A 1YN6B 3TN0C 4J3OD 4K3EL 4KXDA 1A8JH 2O5YL 4UILH 2NLJA 2W0LA 4O58H 1JZ2A 1AD0A 3N04A 4WWPA 1S78D 1C5BH 2UUDK 4LSRH 4HXAH 1M9WA 4LKXB 2ZXDA 3GZQA 5DK0B 2IPTL 4KKAD 4JFXB 1DSYA 3QDJA 3LEYH 4NC1C 3FT2B 2QQLH 1CMOA 1W8NA 3MREA 2Z31C 4BZ1L 3BEVB 2CGRH 1NGZB 2JJUA 2H0JA 5HD8D 3MRGA 5EMYA 1JOIA 1YRKA 2QBWA 4N2HA 3SQBB 1SXNA 3MLRH 3UZQB 4AUYA 5I8EA 3ALPA 3AU1B 2H2PC 4HJGA 2F5AH 3OMAB 3W0WE 4YSDA 3K80A 1MIML 1PDKB 1S9XA 4HZLA 3MA9L 5DFWH 5IB5B 4GG6B 4Q9QH 1NJ9A 3FTGB 2ERJB 2EVGA 1GXEA 5DXWA 3DC0A 1CBVH 1VRSA 4MQXD 1AGCB 4FYQA 3VD7A 5FPIA 4QUOA 1ORQB 3H3BC 3PQYD 4V2CB 2QPDB 5IB2A 1T04B 1ETZB 4LARH 3S96B 1AYOA 4TN9A 2JELH 1RJYB 4KO6A 5CCJA 4Z77B 3O4LB 3WFZA 1FLRL 3ISRA 4JG9A 3QQ4B 3CH8A 3JT0A 3APFA 3ELQA 3GRWL 4Q0XL 4ODUB 1DBAL 3J8F7 3MV9E 2ZX7A 1I7TA 2Y5TB 2K78A 4EVNB 2CAKA 1MFEH 1MJUH 5I9QC 1MAJA 1YEKL 2Q7NA 3OG4B 1PLCA 2H47C 2WOBA 4MZIA 3UGEA 4BK4A 3GJEB 1P7QD 1P5VB 2CK0L 4MMXB 1NIEA 2ZKWA 3FFCA 2YGOA 2WQXA 1TO4A 3C9NB 3A24A 1BZ7B 1JHKL 2AQ1A 2F53A 3MRLA 4R4BB 4N0UA 5DRZB 4AYMC 2AJYL 1FZOA 3VXRE 2LLLA 5IVOA 3ZKND 4OLUH 5I15H 1JGIA 5BUPA 5J5EA 1RZIA 4IGBB 3KPRE 1X5HA 3FN0L 3FQWA 3QJHA 4XP5L 3CHQA 1INQA 4C56E 1IVTA 3C08L 1QSZA 2VJXA 3VG0L 2X09A 1MUJB 5KSAD 3AWFA 1XCWA 1NC2B 4AXWB 4XX1G 1WG3A 3PG2A 3V6ZB 3HE6D 1ZLDA 3QI9B 4NO3A 4PJDB 5AOJA 3WJMA 4OJDH 4DGUA 5DO2C 2UZIH 5E6IA 4FFVC 1LWHA 1QSVA 1ONQA 4KMTH 4AC2A 4PG9B 5E6SB 4BZ2L 1O6VA 2GABA 3B9AA 2CBMA 1JVLA 2OL3A 4GKSA 1HHIB 5E4EB 2WINA 1OTUC 3F62A 4Y19B 2OR8A 5E9DE 2PYFA 5MHSE 1BD2E 2BNRB 2YLHA 5FUZL 3CFQA 3WN6A 3KPPA 5HVFB 2VB5A 3CWGA 1N12A 2YQ2A 1DDHA 1NLBL 4JM4L 4M7KH 5L2KD 2WVUA 4PD4J 4QOKD 1REIA 1QBLL 3MV8A 1N68A 3VXPA 2HT3D 1G1OA 5HVWA 4NT6A 2I85A 4QTIH 3PV6B 5J57B 2QSQA 3QEUB 1KWGA 1KB5L 4EKJA 3VD9A 2R69A 1TXKA 4LU5H 1ZANH 3BAWA 2IOOA 1A7BA 2XRAH 3TN0A 1P69B 3QCVH 5BZWB 3VFNA 1UXSB 2Q6WB 4WFGE 3MUJA 3SYQA 2CLZB 2OTUB 4PIRF 3MLYH 4B7LA 4MJ6A 1GZPA 4XODA 2XWZA 2R27A 1DBKH 3CSFA 4XXCC 4AIOA 3FAXA 3H2WA 3OKOA 2I5YL 4WCYH 4YHNB 1YEFL 2ZKHL 4EN3D 3JTSB 1U91A 4X80H 3SPVB 3P4MA 4JG0H 4W9FC 3TX4A 5D2LF 1T89C 1OANA 1DQVA 1FL3A 4RFNB 5EIIA 2WCSA 5DJDA 5IB1B 1F18A 4JGNA 2CDFB 3DRQA 1NC4D 3Q06A 4LBEB 2Z31A 2APVA 3M07A 4M62H 1GSMA 1VADA 2OXHB 2RA1A 3OHXA 2AQRA 2B1AH 4OZGB 3DURA 1HTYA 1OSZA 3L4VA 43C9B 2XA3A 2F19H 5ICXB 1OP4A 1UXMA 3RPBA 3S36X 3UPCA 5EU7C 3RTQC 4N0CD 3V9FA 4JFPA 1UD3A 1AP2B 5J13C 2FYYA 5LUMA 1EHAA 3PABB 1QABA 4JFEA 2XVBA 1HIML 1T6VN 3FUIA 1V5JA 1D5ZB 1L0YA 2BSBA 2NQ3A 4F3FA 1LNUA 1OXYA 1ORSA 1X5GA 5BJTB 4E68A 4PRPE 1LK2A 2MPVA 4W4NA 3ARBB 1UXWA 1JTTA 3FU9A 1S7VA 4XMVA 3T04D 1JPSH 2FUTA 4WV1C 1JK8A 2TSAA 3MDJA 4TYUA 5TF1L 2R8SL 2X3AA 1OAZL 5ETUA 3VH8A 3NK4A 2Q2LA 3QVAA 4PGBA 4TF4A 2H45A 2LW3A 4NM8H 3RWFB 4LF3B 1A7PL 1FVDA 3D3VE 3VVVA 2H8PB 1N5YH 1R3KB 1J1PH 4LLAA 3CUPB 2F7IA 1IFHH 2IWFA 4HX1A 5EOQL 3VFTB 4BZYA 1MHPH 4JDZA 4PRHE 4IRZA 2AJUH 1ZLVH 3VMNA 5CJ8A 1RUPL 3P9MA 3BN9D 1I1AB 1LK3H 3QEGL 2OW7A 4GOSA 4P23B 4UT6L 5FR3A 5B3SB 2XFXB 2H9GA 3FS9A 3MO1A 2FBJH 2I07A 3W5MA 1HSBB 5DD6B 2J20A 1GYWA 4JANB 2C4XA 2UY6B 2HKFL 3KE0A 2VKXA 4NLHA 4YDNA 3S48A 2WZAA 1YEEH 1NKRA 5F7DB 1JNLL 1TJGH 4PY7A 4HUUA 3WEBA 2ZYHA 2VN4A 4JO2H 1I4FA 4LRNL 3BYYA 5IQ7H 1JZDC 1RZKL 3U7AA 1A02N 3BP7A 4GINA 4AUJA 1S9YB 1P84K 3LNEA 3W56A 2Z6FA 3QC5X 2UZYA 4G8FB 2NNAB 4HXBH 4Q52A 5PCYA 4CU6A 1UM4H 4PJAF 1P5UA 4G42A 2B9AA 2VWEE 2AZAA 1ZY9A 1HK6A 3FUFA 3WG7B 3APNA 1H0DB 3F12B 4PMFA 4HJEA 1BFTA 4IRSC 1MVUA 1BBJB 2MNWA 1BGXL 4X99A 1X9QA 4KTEH 1QSEA 3KCWA 4NCDA 4XN2A 3O2WH 1EIBA 4LMQI 3RWGA 3GO1H 5E2UL 5EZOH 4TULL 1AC6A 1JRHL 5HI5D 3Q3GB 1I3GH 3QQ3A 2FSDA 3FUJA 4AQ1B 1LWJA 2H26A 4M4RB 2UXVA 3NIDF 1UGKA 3IDUA 2VITB 3TV3L 1RUKH 3P4OA 3TH4T 4B5ZA 2YAPA 1ODUA 4ELMF 4JO1L 4WGWB 1YO4A 5I71C 3ZDYE 1CFTA 4TLTA 3LQAL 4IGBD 3QNZA 4DHLA 4Q4EA 5KYWB 1KB5B 4HJIA 4U6VH 1J86A 2Y24A 3BW9A 3BO8A 1VFOA 2WM0A 3BH8A 1CLCA 4A7SA 1KT2A 2EDFA 2ILLA 1OF0A 1NMBL 3CVHA 1T89A 1WFIA 3QCUH 5LBGA 1QRNA 2CO6B 1NC2D 2VLJE 2RMNA 3O6MH 4KVCL 4OV5A 2OMNA 3QI9D 4JO4L 1G7MA 5IHBA 1QFUH 1UWEL 1AC0A 2OXGA 3LKQA 2WWMC 1OSPL 5I76B 2V5RA 1UM6H 3VFUA 5MEQB 3DX1A 5ACZA 1X7TA 4R90L 4D0CB 4ELMA 4E36A 3V6FB 3VE0A 2VXSH 4S1DC 4QF1A 4UQIM 2CKBL 3FU0A 1RIHL 5DYOA 3NA4A 1HEZA 4Y19D 3TJEL 3VB8A 1BX2A 3KHOA 2BNRD 2J6EA 3PWPA 3B43A 4IMKC 3RTQA 3MAWA 2XI9A 3UABA 4KK9C 3D30A 3WIAA 3ECWA 4GSQA 3NJNA 4N5ED 3QGVA 3AWEA 3MA7A 1I8LC 3M45A 3IPBA 1NFAA 2WAHA 4XNYH 3SIKA 3UGUA 2YWZA 1TVHB 3NABH 2BERA 4HJ1A 3VI4E 5CIPH 1ZLVK 4I3SL 1V55B 1ZTXE 5EEVA 1M1SA 2CA4A 2YZ8A 3AAZB 4WV1A 5EPMB 2LLNA 1H6EA 4OCXL 2NQDA 2YARA 1EDHA 4G9FA 4R4NC 3WCYA 3WNLA 5E24E 5AAPA 1BOGA 1SYVB 3WN5C 3T3PE 4G71B 1U9KA 1QLRB 4AQAA 5TK2A 4FKKA 4M6OL 4BBWA 1JSYA 2G3ZA 1QNIA 1BXVA 1IB5A 1CK0H 2MCMA 1J5OL 3DRTA 4XC3L 2HRPH 3UG4A 3RDJA 4KU1A 4YAQA 1KCSH 4NI6A 2Z3FA 3WIHA 3VSQA 3NFNB 1JXJA 3FQTB 4OJYA 1ZGLM 4QI3A 2BOBA 4EI0A 1S5IH 4C54A 3F5WA 1GCFA 2CK2A 3EOTH 3LKNB 4R7XA 1DANU 4XPHH 5BMFL 4H13C 3MOQA 4I0CC 2IBGA 4Z95H 5F1IB 2NY7L 3C5JB 3RZCC 4RZKA 4TLKA 1SHMA 5K9JL 4XBMA 4XMXA 1AQKH 3EO0B 3D06A 2FT7A 1DLFL 3GPSA 3MLSL 3TBTB 3GM0A 4IBLT 5LBSL 5I0VA 1SF5A 4H0GA 4WWKC 3QIUC 5DHVA 2NXYC 2PWHA 4ZUVB 2EECA 4AEHL 1N4XH 3II2A 3TEUA 4GBXB 1BAGA 1YMMA 2Y22A 3ARBD 4JY4A 3MMEA 1G4MA 2IDUA 1TUPA 3CC5B 1KJ3H 1P4IL 2BOLA 3CXHK 1WHOA 1K4CA 4FP8L 5BO1H 4OJEH 4HETA 3H7LA 5G5DA 5IBTH 3U0WH 5DJ6A 3QUMA 1FH5L 3GRBA 3KLAA 4MASA 4W70A 2EADA 5B1CA 1URZA 2GBVA 3G04B 4M5SA 3WXVH 5MI0B 3U1SL 1ZIBA 4QRUB 1E4HA 4HFWA 4OT1H 1OO2A 5DWPA 3PAYA 4E42A 5KVGE 3ET9F 3IJ9A 2ADGB 1S3KH 5DFVD 2ZCLL 4B6ZA 4FLHA 4P23D 2IAMB 2PCPA 5I73C 1OT1A 4KK6C 4BELD 4WY7H 4ZFOA 5F9OL 3CDGB 2OBGA 3S8WA 4XT1C 5CFAA 2R7EA 3K0WA 1VEOA 4L37B 2ZSWA 3HUJF 2ARJA 2P52A 4MKTA 4X7DC 1A6AA 3Q7JA 3OR7B 2UWEB 4XGZB 3LHPH 2E86A 3L9BA 3KGSA 3APDA 4HSAC 1Y0LB 1O6SA 4U6HB 4R3SA 2RFXA 3QUXC 4N25A 1BM3H 1R4XA 4JJHA 4XCCH 1NCDL 4ERSL 4DKAA 2V17L 2AXGB 3A4DA 2KUTA 4AENB 1AZNA 2ITFA 3D0AA 3FH5A 4OLXH 2BVPB 1YMHA 4U1JA 1NSNL 4K71C 4P5SA 5ICZA 3DMMB 3KLQA 4L48A 2WXRA 2BRQA 2WBJC 3PPEA 5CZXD 3DVGB 4IMKA 5B3NA 2F54A 3V5KB 2A7BA 2FJFB 3VFVB 2F1BA 2CKBB 5EZIL 1AKJA 5CGYD 4HCFA 4DPAX 4JFFA 3ARDB 2HKAA 1BLNA 4HH9A 1MJ7H 1U3ZA 1I8LA 4LCCA 4M61B 4M7LT 5ANHA 2ZX6A 4NWUH 3TJPA 2R2BB 1JK9A 1HAUA 3HG1A 3VFPA 3ZHFA 2XPZA 2EDTA 1YY9D 1U8OA 2XZQL 1FG9C 1ZWIA 3GSOA 5IV2B 1K2DB 5BW7C 3VG9C 5CHNB 2YFOA 1W8EA 3L95B 3O6KL 3ENEA 3D2UD 4D7PA 3LSOA 2D03H 5HHOE 5J1AA 2FL5B 4OCSL 4U0RC 1PS3A 1NAMA 3WN5A 3IKKA 4J4PD 1FORH 5D5MB 4CL7A 4GAGL 2WN2A 2WVSA 1F41A 4WK0B 2R1XB 4IOIA 2XG5B 4URKA 3VRLE 3PF2A 4BIKA 1OCZB 4O9HH 4YDKL 3NZHH 1JV2B 1P4LB 4HF5L 5J6GA 4G1MB 3LRMA 1NOLA 5ANMA 4GMSL 3SDXB 4MX7A 4XNZB 3GI8H 2ZXQA 4GUCA 1FN4A 5L2KE 1UTDA 3NEXA 1UOWA 4QOKE 4XVSH 4YHOL 1AI1H 4FE9A 3IXAB 3DX7B 4ZW8A 2GT9A 3EOYG 5D93C 1TQBB 5BV7C 5FO8A 4FMKA 4L3CA 3R19A 3RZCA 2ZOWA 3SKMB 3H0TB 2RJMA 3IJYA 2O4EA 5I1HH 4UIMA 3ZKQD 3KJ4C 5MEOA 2FWOA 3IKCA 1TF4A 4WWKA 1MWAL 2OLDA 1IAIM 1NH6A 3TGXA 3LRHA 1X4ZA 4JO5A 3EH1A 3R8QA 3SO3B 4CJ0A 5CF3A 1U4EA 2AK4A 4Z7VE 2Y7MA 3BP4B 1DVXA 2C9VA 3NCCB 4N1CA 1CFSA 4R2GB 1GL4B 5E8OB 4HLZG 3KMDA 5GS1C 3TS8A 3EFOB 3UC0L 2H2SD 1D5XB 5F88B 1G0YR 4OR1A 5JIKA 1F90H 3O81A 5LG1A 4BK5C 5HDQL 1SUHA 3L5WB 3OC8A 4Q2ZA 4U1SB 4YO0A 2DAVA 3S5LG 2JCCB 2QL1A 3BVTA 4ATWA 4XCEB 3Q1SL 3V10A 4Z7NF 1JGLH 5JIPA 4I89A 2NZ9C 2FYVA 4L1BA 4NQEA 5ADPL 1DJGA 4JFDB 5TGBA 1R46A 4NJ9H 2ICWA 1N3NB 1I85A 1NCAH 2CMRL 3QCTL 4JHWL 4XVUD 3ZZSA 5DRNB 3MX0B 2YSSB 3MTXA 1L7TL 5KSBA 2EDMA 3Q2CA 3HE7C 4X4KA 1U58A 3N50A 5CAYB 2PWEA 5CILH 1HZHL 2ZCHH 1L9NA 5AYTA 5EF2A 3DUSA 1XZ0A 2WVVA 2YBRB 3SHSA 3RNKA 3MJ7B 4F20A 1E3FA 3L2MA 3RWEB 4PH8A 1M7XA 2NNRA 1XR9A 3K4ZA 4PBDA 3QDMB 4QLWA 5F7WC 3FPXA 3CLEL 4F15B 1KDJA 2YPLE 2WZ5A 3NESA 5DK2B 1A6VL 1IC5L 5I1KL 4NN5C 3QUXA 3RVTC 2DBLH 1E7VA 3NJGA 4LCYB 4Y5XB 1UKTA 5JA8B 3CTTA 2VABB 2EUXA 5LWYL 4POZC 3EGXB 5T5NF 2BO0A 1Q1JL 2OTWA 4RWYL 2IBBA 4NP4H 3WMSA 4GBXD 1RMFL 2H1PH 5GZOD 2D7OA 4FDWA 4FTVB 1T7YA 4P2CG 1YN7A 3BAIA 1CLVA 2WBJA 3A67H 4ZPVA 3RGVB 2YZ1A 1FFQA 3P0VH 4LLMB 5I8KH 1R47A 4DKEH 1F6FB 2FLRT 5H8DA 4UWQB 5C2UB 1CUOA 1AJ7L 2P5EA 3FRUA 4FFYA 3R4RA 3FN9A 4XO3A 2KYIA 5E2VH 2FH6A 1A7QL 3QZOA 4HBCH 3ZHDA 4LSDA 4QMEA 1NGPH 1HYSD 1U8NA 1T1YB 4BCYA 1FFNB 4OKDA 5B1JC 1A47A 1CFVH 3B5TA 3HC0A 1J9QA 5ECJE 5C0JB 3V4PH 2KDYA 2IAAC 1CF8L 5CR8A 2GTZA 5DDHB 4KJYA 4RFOH 4G6KL 2IAMD 1C8QA 5E6YA 4M6AA 2ZXAA 3MRPB 1OAUH 2C1PA 2GJ6E 4RDQG 3X2QB 4C57C 4LRIC 5FM5M 5KYXA 4G82A 1SLUA 2HJFA 4HHAB 3LPOA 5HI3C 4NIKB 4JY5H 5EOCL 3FFDB 3JQOB 2OPCA 2KHAA 3TFBA 3UXFA 1A0QL 1NUDA 3MRQB 3HFFA 2V2TB 2IH3B 1QQDA 3MLVL 1ZTXH 2BSRB 2JIXA 4JPWH 3TNNA 5T3ZH 3ZKMC 4ZUSA 3RVWC 1RZFH 3BXNB 4AM0B 4GSDH 2OMWB 1HHJA 5GGQL 4OD2B 3T71A 1L9RA 4WK2B 4BGLA 3DMMD 1WZKA 2IANB 4HDIA 1ZE3C 3X13A 2XXCB 3E2HC 5IBLC 2XZAL 3C6EA 3ARDD 5D7LA 5GS2D 1XH3B 5AD0A 1YAIA 1CFBA 1E4WL 3H9SE 5HGGS 4WO4C 3NMEA 4ZOEA 4OGAD 2PNDA 1G7IA 1MFDL 1PJWA 2CIKA 1KLUA 3D18B 5D1ZC 3RWJB 5HPMB 2WXPA 3D05A 5ENWA 3UJJH 4JBSA 5FKPB 4F2EA 2PMZA 4DP7X 1BZEA 1MWAB 5F93C 2R2CA 5GS1A 5L9DH 1UG9A 2NNFA 3VB9A 1KFGA 1J0IA 5ITFB 4DTGH 3II3A 3MLPA 2D7NA 4PJDE 4LCWB 2NY5L 2IPKB 2VDPH 5D7JC 1U2YA 4BK5A 3D69A 3M8OL 1SJHB 4M48H 2YD2A 1HWWA 2FQEA 3T2NH 3QYCA 5DJYB 3FUKA 2JK5A 2IQ9L 2ZXCA 3FU6A 3N5AA 3OJDA 4X7SL 4X8GA 4DP2X 2JB5H 1PG7W 3L3HB 2EE0A 4KPHL 1MPAH 2BNRE 3QNXA 3IGKA 3MFFA 3QG7L 3EYOB 1WIOA 4UTBH 1E30A 2UXGA 5IHHA 1TIUA 3HE7A 5F7NC 1BYNA 4QXTB 2YGVA 4HFUL 3O8XB 1AGDA 2BH0A 3H2QA 4LGRB 4FYTA 2FGZA 2VM9A 5E00B 5FGCB 2F1AA 2QSCL 5GRUL 3TNMA 1BEYH 1GIGL 5CSGA 5IHUH 3GMLB 3ABZA 3RI5K 4OGQC 4A2HA 4I5BA 5DD3L 5HHXL 5EC2B 3VFRA 4ORZC 4B9ZA 3DX9A 3GMQB 4RAUB 1R5VB 2X6MA 3WKQA 1VGEH 4NHCH 4AMKH 5KVGH 3FQUB 4WSJA 4NKIH 4JN2B 4HOWA 1GJIA 3DROB 1ZEAL 1R3JB 1ZS8B 4J1UA 1EHLH 2X6AA 4AEFA 5IG7B 4QY8A 5KAQF 1J0YA 3UTOA 3PAUA 3CDCA 2A5UA 4I0PA 4RRPM 4LFHG 4R2GD 4OZIF 3QZWG 1RU9H 2JLPA 3BDYL 4Q14A 1BJ8A 3QR2A 1AZUA 3O9WB 4PBVC 1UACH 4LPTA 5C92A 3VCLA 4Z7UF 3CFCL 1MF2H 2MCPH 4L3ED 4M8QA 1Z66A 5EZLB 1PYWA 4PU2A 3CX5J 1TVBB 2IXQA 2KPNA 3ARQA 2G2RA 3AU0A 3MRBA 4DVBB 4OZGE 1O7VA 1B9KA 4AE1A 1OGAB 1KJ2H 1T7WA 1WWBX 3KPLB 3TOPA 4WU7A 5B1JA 3QO0B 1TYEB 4JEGB 3VWJA 4WI0A 1CE6B 4OLZL 4E9RA 4HISA 3BI9X 5IMLA 5KSVA 4LRIA 3LPFA 4UM9B 3T8VA 5C8JA 3SYAA 4NKDA 4TSCL 3MLXL 5CP7B 4PIBA 3STLB 5LXGH 1WDAA 2E8YA 3VXUA 1RLWA 3O41B 5EZJB 1FFOA 4Z7UA 4TKWA 3I75B 3THMH 1T0PB 3IF1A 1S2EA 4MD4A 3BESR 3JBG7 4HMCA 4UT9H 2EEFA 3KYNB 1MREL 4ISVA 3OX8B 2N56A 3CVIH 4YR6A 5EN2B 4QXGL 1IGCH 4QRQA 3T77B 3P11H 3FUNA 4HUXB 1XH2A 3SPCA 1CDCA 3FOMA 3RP1A 2X5PA 1S46A 4EEEA 2PYEE 3V5DB 3IDYB 5EOCJ 3L2LA 1ASPA 4FTVD 2APWA 3GHBL 5IOPB 1LQBC 5JW3L 2K8MA 4PJ8A 5JW5A 4L4VE 2VDMH 4TLSA 2I24N 3IBOA 2XDHA 4ZXBB 3OZKA 4HKBA 4UQAA 3DECA 4BWTA 3ZHLA 4HUCA 4WO4A 2EH8H 3WTVA 1UD4A 1AQ8A 4TSBL 1S7WB 2BWIA 2W9LA 4ONFL 4PJ5E 4YHLH 4ZMQA 3CFIC 1SYSB 4GI9A 5F7AA 4U1LA 5DVKA 5C0GB 5E6ZA 1I8KB 3FQXA 3IJHB 4QDGA 5C97A 1GS6X 3IRCA 4M5TA 5GGRY 4TNWF 4N2OA 5AL0A 3J2PA 3WFCH 1TQCB 4ANXA 1S9WB 3OQ3B 3GWJA 4NZUH 2D0GA 1WCBB 3S5LB 4KNUA 1UD5A 4KDWA 4URTB 5D7JA 2H3KA 2FR4A 4LNRB 3MRIA 1W6LA 2DQJH 2R1WB 3QORB 1LYQA 5FB8A 2AEOA 2CRIA 3D0VA 4BGDA 4NC0B 3B2UD 3QR0A 5I26A 1F11B 4GKZB 1X3DA 1HQRB 3KPMB 3PE9A 3MLTB 3LKSB 4YC2B 5I74B 3HFML 4ZX6A 2Y7SA 1SHXA 1U2CA 4XCYB 4Q58C 3S6CA 3HZMA 4Y1AE 2P80D 4LQFL 1AO7A 3EJPA 2ESVB 5EC1B 1HAWA 2P8PA 4B95C 3CZFA 3QYMA 1GGIL 2VXUL 2IAND 1CE1L 3IDXH 4U6YB 1UEYA 1A7OH 2IPUG 3DX2A 5JOFB 2VM4A 4OD1H 5JDJA 3DV4A 3KPOA 5EH1A 1JJUA 3EJZC 5AVYB 1PZ3A 1DSFH 4LNVA 5D72H 3FO1A 5EO9B 2I9TA 1DL7L 1E5YA 4CMHC 5IEHB 1OARH 3QUKB 4KROB 1IEBB 1NOFA 4DKFL 1R5IB 3GMPB 5D4JA 1SY6L 2VUYA 4KO5A 4ZO7A 5IJDC 1JGEB 5DZPA 4MQ7B 4NXKA 5DMYA 4XR8C 4YL9A 1OGSA 4P5KA 4ZX5A 1JCVA 3PY9A 2K3HA 1QBMH 4K9EC 1F1GA 4N4YB 1ES0B 4LCWD 3RA7H 4Z7WE 5GSRB 1YC8A 3X3FL 3MACH 4XC1L 1LO2H 2X4PA 3KH4A 2W38A 3AROA 4G59C 4PJHB 4QXVA 3RY6C 4DW2H 2DYSB 1L9QA 3LPPA 3Q2NA 4N2EA 4JZJB 2A6KB 5I19L 3QULA 4XNMB 3DX3A 4PR5B 1KELL 3DTXB 2CXKA 3FT3A 5L2JA 3T8XA 5IFJB 1KTKE 1NEZA 1I31A 5JQ6H 1SXBA 4H8UA 3RL2A 3EJCA 3N44B 5T1LA 3VFOB 4FG0A 1S7QB 5HDWA 1F1DA 4DP5X 4PJIF 3KYKL 2MMXA 1U8MA 2JSFA 4JO3H 1MIEH 4MXWL 1LEKA 3T0EB 1J18A 1TEGA 4ACPA 3O8XD 4EDWH 1S8DA 4H0HB 5HHVL 3C6LB 1PLAA 5LNDA 3ALXA 3WS6C 1FVCA 3ZPDA 1G7HA 5IB3A 4FFWD 1EFXB 1CL7L 5IFAH 4IIQC 2K45A 3DJRA 1CF1A 3TA3C 4MAYD 4N1EA 1KXTA 4YHMH 3K6DA 2J7LA 4OZHB 2P8LB 2O6DA 3GTVA 3AG4B 5AENA 5SX4I 4QGYA 1SHSA 5I66A 2Q76B 1M56B 2VLLA 3RWDB 3CD4A 4H5SA 4PJIA 3ZRCC 5ILTH 2GK2A 3WKNA 1NIBA 5I1GL 2NYYC 4G9DA 1W15A 1FQ9C 4IS6B 4PJ6A 4XPGL 5E94A 2C9SA 3O9WD 5DHYA 1KCWA 2NY2B 2A9CA 1H6TA 1RVFL 2AJSH 1NANH 4LMQE 3C6SA 3U0TA 3PJNA 4K94L 2IC2A 4G7YL 5C6WH 1OGAD 1E2WA 2VRQA 1G1YA 3LMJH 1GY1A 4AYEC 1G7PB 1DZBA 2EXYC 3DJ9A 4JFOB 4KKNA 3MBWB 5D7IB 1IQDB 1QWUA 3GBML 5DMJB 2GK0A 4B50A 4KVNL 3DOSB 2WKOF 3C5SB 4RZCA 4ENZA 4XO5A 4TRPL 2ORBH 3AS1A 1CL7I 3OZ9H 4QTHA 5JW4R 1MEXH 4UM9D 1UFUA 2A1WL 4QHLB 2HRLA 2CH8A 3G08B 3JWOL 3PREA 4ZX3A 2LHAA 2AQ2A 3O3EB 2W60B 5G4NA 4B96A 1FV1A 1ZV9A 2ZUQB 4GKNA 5DRWA 4B27A 4D8OA 3L81A 3BJ91 4FNQA 4EJ1C 4C56A 3AREC 4FNUA 1IBDA 1KPVA 1TJXA 3PXLA 4OLVL 4PJBE 4WGVB 4G3YL 4AWJC 2RCSL 4OI9A 3B5GA 5FYLH 4HC1L 4AQ8C 1J0JA 3EIFA 4TTGA 1KCKA 4MA3B 2VERN 5EU3B 2OK0L 3OXSA 4W81A 4I48A 2PXYA 4KZ0A 4TUKL 2A6DB 4PWKA 5JR1L 2WCPA 4X8JB 4ZXBD 3REWA 4K7PY 4P2QE 2R9HD 5CSZB 4NBYB 5DUBB 1TT6A 4M3HA 2VSKB 1NBYB 5E9DA 1UKSA 1M6OA 3ME0B 1MVFA 3Q43A 4FNTA 3QZWB 5C0FB 1J48A 4XPTL 1K3ZA 4YX2H 4EOWH 3ZE1B 4F57H 4WFHD 5CS7A 4RETB 3BIKB 1L9TA 3U7YH 4KKLC 1SVCP 2X2YA 1DBBH 2DQEL 3ELAT 2K0RA 4NQDB 5I1JH 2VYRE 3LNHA 3RY6A 1B3IA 2VC2H 2R56L 1QNZH 1B0GA 1QA9A 3PGFH 3QORD 4GYBA 4JDVA 4E41B 3QA3A 4MSWA 1IGTA 2KT6A 2F5BH 3DHJA 3QQ9C 4KFZC 2JH2A 3VGAC 5F1NB 2O5YH 4I3RH 2BSTB 4N22A 3R0MA 4OY9A 2KI6A 1CDIA 5LNEA 4HCRA 1OCWL 4B9CA 4ZW3A 2NUPB 4EKXA 5K9OA 3T3ME 4AV4A 4X6BA 3SGJA 2IADA 2ESVD 1TJIL 2OCJA 1HCYA 2JNZA 3L5XH 4H8PA 4OUOA 3VSUA 3KR3H 4NNYA 4GJTB 3ESPA 1E0OB 4MVBD 1FFPA 1GCYA 1KYDA 4AKPA 1GOFA 4K8RC 3QUYB 4RAVB 5DZVA 2DLGA 2L7UA 4IIQA 4OU3A 1BF8A 2AAAA 3TA3A 1LE5B 3NSDA 1H8SA 1K8IB 4KROD 2KZKA 4HSCX 1MIMH 2W07B 1UD2A 1KB9K 4AYFA 2VR3A 5D5ME 4MMZB 2OQJB 1OY3B 3ARFC 3RWCA 4YHZL 1CFQA 2OMXA 3MNVB 5JIDA 3BUBA 3NJKA 4OAWA 5F9WC 5FFGA 3UTTA 5A2BA 1D5RA 2QKIB 3N40P 3Q8EA 3IFOA 5FECB 3ARGA 2XG4B 1P2CB 5KYYB 3GBEA 3M7FB 4XI5D 4GW1B 1KB3A 4JMXA 2CM5A 4CN1A 2H6PB 4A6YL 2R0KL 4WI2A 3ML9A 3TU6A 3MCLL 2RB8A 2A0LD 1GZHC 3U9UB 2ED6A 2JJWA 1A9EA 4KAQH 4FABL 5IMMB 2JXMA 4LHUA 2A77L 2GITB 1CDBA 4OQTA 4MD5B 4I9XA 4DKDC 4LLYB 3FQ2A 4S1QL 3DARA 3GKZA 4EO5A 3S5YA 4PGCB 1WBYB 3RRQA 1F4XH 2CK0H 2VGLM 3LD8C 3T0ED 3BZ4B 1HJBC 1ZDQA 1W80A 3IDGB 4NYLB 3FC8A 3UTPD 3FULA 1JHKH 4JS7A 3S3CB 3C6LD 2WXOA 1SHWA 1CLOL 1UJTA 3KWUA 3EYSL 4DUWA 2EXWC 2F74B 4NZFA 1HKLL 4QT5A 1EFXD 2WZPA 3MJ8B 4XNXH 1ID5I 1DQML 1AIZA 3GRGA 1DVFB 2GEEA 4ZW5A 3AREA 2HG5B 2ZWNA 3QWQB 3GSNL 4GRWB 4CN6A 4HWBA 2CHNA 5BXFB 1LEIB 3QJRB 3WJJA 1FNFA 4HOMA 3MRNA 4L3EE 3P2BA 4JL2A 1AAJA 2AMUA 4AQ8A 2BNQA 3LRSB 3QO1B 3VG0H 5DJXB 4PRIB 4BD4A 3W81A 1NLDL 2AEIT 1WBXA 2JCCE 4EUPH 1WH0A 2DWXA 4J3OC 5IWLC 1D5BB 5CD3B 3ZUCA 3KNBB 1DVUA 5GGRA 4QYOB 1MG3C 4PJXE 3W1ZA 2VLRA 1BQHA 3BQUB 3DETD 2E6PA 2NY2D 2PPAA 1EXHA 1EWHA 2AW2A 4S0SD 2X4NA 3T6WA 4H8WC 3ZHNA 5FLVA 2LFGA 5HGDB 1Z0MA 3D5OF 1S78C 4OM0H 5SWSB 1EUUA 5I2IA 1M7DA 2A4CA 3ML8A 1DQKA 4M43L 4KKAC 4E0RB 3HI6H 2ZTBA 5H4ZA 1VFBA 1R3IL 3BKYH 4FQCL 4YXKL 1XGRB 1TCRB 2EC9U 3NYKA 5TE4L 4UU9A 4A2FA 5HD8C 5IB4B 2F68X 4YIQA 3QEHB 3DV6A 1WEJL 2IOIA 5E5LA 5F96L 3K6OA 4BJLA 4FQQA 2IV9A 5IUSA 5AYUL 4WHCA 3T6VA 4HHGA 5FM4A 2JJTC 3ZRSA 2X88A 2BHYA 4FQ2H 1Z9NA 1NAKH 2VUKA 2WCGA 3GQFA 2VQ1B 4OF6A 2D31B 1MQKL 2ALWA 4MQXC 4EZMA 3GK8L 3STZB 3CHOA 1LP9E 4D3CL 1QPKA 5EOTA 1J5IA 2EYRB 3U82B 4LSSH 4FTVE 3JT2A 3N1QC 5DTFA 1ECZA 4OV6F 1FZMA 3AITA 3AVEA 2ATKA 4LLQB 1RFDL 4P3CH 1JZ6A 2UYLB 5HYIA 3EDDA 3K2UL 3PWJB 1Q72L 1USZA 2I5YH 2F8VA 2ZKHH 5DJAA 5AVQB 3L1GA 2OR9L 3L54A 5AZ2L 2DL2A 3MODL 1HH9B 1W8OA 2GIMA 4JPKL 2VIRA 2AXHA 4O2FA 3V4VA 2D3LA 2NCEA 3KW8A 4YZFF 3TEYA 1XL4A 3WD5L 1ZHNA 4PLKD 4A2GA 3FT4A 5KYUB 2CDGA 2WBXA 3IJSA 4JFSA 2BVUA 3T3PF 3CXDH 4LFHD 5FAAA 4RBPH 2J25A 4R0LB 3F85A 4BQ8A 3TBWA 1JPGB 1ETJA 3BUTA 3GNML 1NBZA 2XZZA 5EU4B 2KMWA 3KPNB 3ZKNC 3EBGA 4YLCA 4YSUA 4NAMA 1BHGA 2E7DA 5F0LB 1FUNA 4QXUL 2GYSA 3H1ZA 2H32H 4TQIA 4YHPB 4FEMA 4R96B 5J89A 2HT4D 4NQDD 5CU5A 5ESVB 4ZFGH 2X70A 4XPBL 1AIFA 4Z1PA 4QRPA 2FWUA 2BNUB 4MQTB 2R29L 3OSVA 5KSAC 2FTAA 1GZHA 4ODHH 1GYVA 1XGUA 5MERA 3HS0B 1OP5H 5ESQB 2ED7A 3L1FA 4A6YB 5EF3A 4XBPB 5TF1H 3G6JF 1B0RA 2Y3AA 2W88A 1FYTA 3VJ6B 2Y2YA 4J3OF 1OAQL 3SKNB 2WPGA 1M7IB 2DWDA 3MCYA 1JYXA 2WAQA 4M00A 3Q8FA 3MV11 4LEEA 3S3SA 4DEPB 4QRTA 5C0AB 4F37K 2VZ1A 1EGJH 1E4KC 1WYJA 4MNQB 3BCDA 4ZUUA 4X9BA 4M6NL 4ZMWA 4TUUA 3I3EA 2EE9A 3IK2A 3QUYD 1QI5A 4HJ0D 4HPOH 4BQ9A 5HJ3B 3U4BH 4KXBA 5I1DA 3SYPA 1AZVA 4UQDA 1IO4C 4UT6H 5CGMA 2HT3C 1U3HB 1OT4A 2XKUA 2DKSA 3J7HA 4FHKA 4HAGA 4LIQE 5DMIH 1E5UI 3B2VL 2XZCL 4LCWE 5TE6H 1JF5A 1HL9A 1N0LA 5K59F 3GSNB 3LIZA 3G6JA 3INOA 5CMAA 2HN7B 4X5QA 5GZND 2ZYRA 4GSXA 4L05A 5IEKA 2DLFL 5IWLA 2J6WA 2OMUA 3BD4A 1D6EB 2Z0BA 4WUKL 4YWGL 1E5BA 1BFOB 4BFRA 1NZRA 2OL3L 3HKFA 5JXAL 5LQBL 2CRZA 1AG0A 1E5ZA 1SN5A 2MQGA 4JM2A 2CR3A 5ECGA 3RDTB 4A2EA 1K5NB 1IKNA 4XWGL 3DYOA 1R9FA 1XB3A 4MDJA 2XWDA 3U46B 3D1MC 3MVSA 2VZVA 1FP5A 4K15A 2FX9L 1PD0A 1UJ3C 1EVUA 2VZ3A 1A9BA 1EJ6A 2D0FA 3D25A 3WAKA 5JIHA 5FF6B 4NWTH 3QNYB 4X4XB 1XAUA 3LZLA 3HPJA 1YVLA 1K6QH 1YNTB 3BPOC 4OSUH 1PPIA 1IGFL 1AFVL 5E0FA 2OP4L 3C8KB 5E1GA 3TV3H 4KGLA 3VXTA 4F1SA 1MVYA 3BJLA 1H3GA 4N0CC 3PQYA 4RIRA 4OB5H 4RNRA 2CR0A 2VQTA 1DVFD 5TFSH 4L8SA 1JPTH 1PIFA 1T83C 4RBPK 4ZTOL 5IJBC 4HUVA 1AD0B 1A7RH 2QPUA 2XX1A 3ZKXC 1K8DB 3MI6A 4GI6A 3W9EA 1NMBH 5ITBH 5HGHA 5DVPA 3RJDA 2VDNL 2YLKA 3GSQB 3U25A 4F8OA 3GLEA 3MREB 4ELKA 5JNYA 3BQUD 3ZDXE 1MCWW 3MCKA 5JQIB 3WKPA 3CFKB 4JHVA 4LPVA 4N8VG 1PF3A 5I8EB 4F7EA 1MRDL 3TYFA 5JUEL 1D5MB 1OP5K 3N0AA 5SWSD 4HZLB 3BZEB 2VDRH 5AKVA 1CICB 2B1HH 3RX7A 1NJ9B 2Q87A 3F8UB 2XQ0A 1WRFA 3B8YA 1LO3H 3VRLF 1Q9OB 2JTYA 4KNSA 3I9PA 4WLCA 3G3LA 3IE4A 5MENA 4GUPA 2XVGA 2Z92A 3LKRA 3TO4B 1QI4A 4AGNA 1T80A 5IB2B 2A9ML 1ZXKA 4Y4FA 2DZEA 1JPEA 4UQCA 2A4EA 3KVQA 1KN2L 4X5XB 1E8YA 2ERJC 1A1MA 2NSXA 2C7UA 3NFPB 5KSAA 1XGQA 4I3SH 2O5XL 4AYID 4AYBA 4M3JA 2X38A 2E7HA 1YEDA 4HK3J 1CBJA 1QFHA 4Y16B 4X7TA 1P1ZB 5GGVH 1FHGA 1MRCH 3GMRA 5F0MB 1H6FA 4L8CB 2X10A 3IDNB 4Y89A 1RK1B 2G3MA 3HG5A 5FK9A 4M6OH 3SDCA 3ECQA 5T1MA 4TOYH 4J39A 2F53B 3D48R 4IRZL 1E4KA 1Q9KA 5AZEL 4ABVA 4ABQA 4NRYB 4YDJB 4E9QA 8CGTA 2XPGB 4MXQD 4J5VA 1ZT7A 3PRZA 3O2DA 2WOYA 2B5IB 5M95B 4MMXC 4ZRGA 4CAGA 5HI5C 4HIEB 1G7JB 1T1WB 2HJLA 3SGEI 3CZGA 2PP8A 4YHKH 1XGTA 3QRFM 1INQB 2FWLB 1YPZA 3CLWA 3ULUL 2XYBA 5BMFH 3MGOB 1FF5A 2AVFA 3TBSA 1N6QL 1G84A 5JPMB 4UQ2A 1HHHA 2C9UA 1TVDA 4IGBC 5TQ0L 4D8PB 1FRGL 1RPKA 3OGCA 1EEZA 3PIQA 3L5HA 1WZMA 1DLFH 4G5ZH 2EYTB 5LBSH 5H94B 2V5TA 4PS4H 2XQYG 1L0PA 1ONQB 2ATPA 2BC4A 4AEHH 1RUAL 5JIQA 2X0VA 2Y1VA 1JF1B 2ESVE 5IFHH 3QIBA 3GBNL 2ADJA 3OAUL 1MCPH 1NC4A 1OD9A 4U1HB 1XF5A 2PYFB 4XN9A 2QTVA 1UJ3A 2P43B 2YAHA 3QI9C 1P4IH 1TETH 3KPPB 3TF7C 1DCEA 1DDHB 1RPUA 1IFGA 4Y4KA 3W38A 1UM5L 3CCHB 3QEQA 5F44A 3WY4A 2VQUA 1Y7VA 3F65A 4M8VA 2BP8B 4XVJH 5E4EC 2R2EA 4JG5A 3WTUA 1AVAA 1L6XA 3HRZA 4MNQD 3UBGA 1KPRB 2B14A 5ISZE 3P73B 3ROOB 3K81A 3T0VA 3WDIA 4DVRL 4H4NA 4N5EC 5AALA 2YC1A 4PGEB 2AP2A 1T83A 2DEXX 2QQKL 3PGDB 1U3HD 1FO0H 2APBA 3CVHL 1T0NA 1MHCA 2Q86A 5C3LD 2DQUH 1ZK5A 1RQ5A 1U91B 1ID2A 4PJHE 3ZU8A 2GI7A 3NZUA 4BSJA 1KYOJ 3BAEL 4WFED 5D6CB 1YN6A 2XPYA 4GG6F 2OZNA 4R26L 3DRQB 2RGSA 1YZZA 2OJZL 3H9HA 2A9NL 2AMGA 3QB7C 3TIEB 4L2LA 1J11A 1FFTB 2VDNB 2BSSA 2F15A 1VADB 1NCDH 4GKLA 4LSVL 1MFVA 5DC0A 1JZ8A 3OHXB 1X7QB 3TH3T 4HG4J 4LKXA 3RDTD 2A2QT 4RFNC 1NSNH 2D2OA 2GY5A 4JFXA 2W0PA 3QJXA 4D9LL 1OSZB 1MOEA 3UTPE 3QJOA 3V52L 4MD0A 5F0JB 4YE4H 3GZOA 4WENB 1JZ3A 1NGZA 2E9GA 3E9TA 1JI1A 1ETA1 3OJMB 3TYGL 3R06A 2LU5A 1DR9A 1W6WA 2WLYA 3HR5A 2XN9E 1DEEB 4JFPB 4LVHB 3WGVB 5ABDE 3Q9PA 2FYYB 5DURB 1PDKA 4JFEB 2WHVA 4RGOH 2ED9A 4GG6A 3HZ3A 1F8TH 4OZHE 4TNVK 5D8JH 1IMHC 1UB5A 4MBOA 2WXFA 5EWIL 1PMYA 4KJPD 2Y06H 1AGCA 2YSTA 3KL0A 3WUWG 4XOBA 1CS6A 1ORQA 3AQXA 3VDBA 3OLDA 4Z3EA 1T04A 1ETZA 1JK8B 1SXCA 3A5VA 4U4IA 4KXCA 5AZUA 3MR9B 3WTTA 4YSQA 1KN4H 5ETUB 1RJYA 5KJ4A 4F2ME 4OCWH 4Z77A 3O4LA 5CBEB 5CJ5A 1WZAA 3QQ4A 4HGKC 3SPIA 1I3UA 3EJTA 3R18A 3ARBC 3VSVA 4ODUA 1FVDB 5F2FA 5A2JH 2WK2A 5BS0B 1NEUA 2Y5TA 3S4SG 4TUJB 3LH2L 3HMXH 2VXQA 3VRIA 4YDKH 5DGQA 1JGVL 5LO7A 5E6RB 3RGHA 1CXHA 3LRLA 1XBRA 3GJEA 1HINH 3C8HA 5D7IE 1F3DJ 1A3LL 4MMXA 3P9MB 1I8MB 1SJXA 4PJDF 1VEPA 3Q9QA 3ZRFC 3V0GA 5EEUA 4U2ZA 3MO1B 4OTXL 3C9NA 3D4YA 1BZ7A 1XCTB 1B0WA 4R4BA 4CSSA 1CICD 1F97A 4Z3HA 1PZSA 4RCAA 3MC0A 1L0XA 2EH7H 2UVEA 2YA0A 1JZGA 4IGBA 5AW3B 1KNOA 3EXLA 5DFVC 3TO4D 2HG0A 1I1AC 4P23C 4HWEL 3ZDZE 5INDB 2HVJB 1WITA 2AQNA 4WI8A 4AJYV 5TDOB 5D4HA 2GW5A 1K72A 2UZYB 1A4JB 1Q9WB 4IU3B 4KY2A 3V7AG 5F9AC 1P5UB 5AVUB 4NQCB 1MUJA 2Q8BL 5D7HA 4AXWA 5LKNA 1KTCA 1TPXB 4LIQH 4YFLI 1SM3L 1YNLH 3ZXAC 4NBXB 4FFZH 2I26N 3ZLQC 3V6ZA 2FE0A 1W0VB 3QI9A 4FQHB 2BY2A 4M4PA 1BDYA 1G5GA 3QUML 4R6UA 3VM7A 3PV7A 4Y16D 1IGML 5FUCE 5E2WL 3NFSH 4MYPA 1LQSR 4MZ2A 3K5SA 4GH7B 3UERA 2FT6A 2J4WL 3QQ3B 4HGWB 5MEPA 2VMEA 1HHIA 1BBDH 3BKJL 1IILE 4LSTH 4Y19A 5EU6E 2F53D 2Y36H 5I0ZA 3LHAA 1BF5A 1C9SA 5CZXC 1RJCA 5ADPH 4K9JA 3VGBA 2HXAA 4ZFOL 4TVPE 3FONB 1KLGB 5I0XA 1L7TH 4AQ1C 3NH7H 4DAGL 2HRGA 4NM4H 4G1EA 5E70A 3T08A 5HYQB 3DO7B 3MBEA 1IARB 4LOUD 3BH8B 3ZQWA 5AAWA 2ADFL 2APSA 3FSVA 1YY9C 4MJIB 4OZGF 1OTSD 1UZ6E 1YYMH 2YD1A 3ZOAA 3CVHB 3ZSSA 3PHOB 1QRNB 1KCRH 5GGUA 1YEIH 3CFDA 5BZWA 1UXSA 2EIZB 2CLZA 3CLEH 3QHTC 4N8VB 32C2B 1ZT1B 4NN6B 1F3RB 1IC5H 1MCBA 4XAWL 2WGXA 3D52A 4OIIL 4P9HH 3LKQB 4J4PC 1HYRC 1SUJA 4BFIB 3L16A 3JTSA 3VFUB 2N4IA 2BIQA 4H1LH 4NZTL 3SPVA 3HMWH 1RMFH 4QF1B 1FDLL 2YD7A 2CDFA 4ODBD 5DQ9B 3BZFB 2PW2B 1YUKB 4JKMA 1BX2B 4LBEA 3LEVH 3X3GL 1IGIH 2DQTL 2FGWL 3PWPB 4LAJH 1C5CH 3CZEA 2WY3B 3QFJB 3V0VB 2OXHA 1I1CA 1E8WA 2V2XB 3TV8A 4LVOB 3RB5A 3W11D 1BZOA 3MV8D 4PPTA 5EBMA 4LDLB 3LPWA 2XWCA 1WCQA 1NUNB 4XMZA 1WA1X 43C9A 3F6IA 5ICXA 3IJEB 4DT2A 3TVMB 4WUUE 3AY4C 1CPUA 3VACA 5J9PB 2MHAB 3H56A 1AP2A 1JZ4A 4GAFB 4X4ME 1NAML 5T8IA 4A66A 3U9PH 4G9FB 1TDQA 1GKOA 4XP6H 3IM1A 1D5ZA 4FLSA 4DH2A 4GAJH 2V33A 4TSAL 2BRRH 4YSRA 3ZO0A 1CT8B 3ATBA 4AQAB 2E7LC 3ARBA 5AW5B 2OCCB 5IMOB 2CPCA 2XBZA 2BSCA 2EEXA 3VFMB 3KDMB 3MZTA 1SQ2N 4TVSa 2X28A 1MQ8A 2Z31D 2FO8A 3QWNA 3TWYA 2H2SC 3BAYA 3OKYA 3P1VA 1IAKA 4LGPB 4ZNEE 2J12B 4MB3A 2WYHA 3RWFA 1RZJH 2H2PD 3DNKA 3ZGIA 3F5WB 2H8PA 1T22B 2OA9A 4WW2B 1B4JH 2MEJB 5FO7B 1X4XA 3CLFH 3K46A 3DI2B 3VFTA 1XBDA 1WISA 5JA9A 5FCUH 2OMYB 1S7TB 1CDHA 4XVUC 2XZAH 5CINL 1I1AA 2Q0ZX 2DH3A 4P23A 1N7ML 5KJRL 5ID0B 2XFXA 1E4WH 1UT2A 3KGUA 5DURD 1LE9B 1E9QA 3N41B 4JFED 1MCLA 4AEEA 2UY6A 2FX7H 4GRWE 3IU4H 5DHVB 4G6JL 4ZQKB 5IJVB 2J8UB 1JP5A 1TEYA 3MMEB 3NJVA 3U2IA 4ZZFA 3K5RA 1HNYA 2ROXA 4L0PB 1ZRUA 2CRYA 4XP1L 1K4CB 1MJJB 1WTGT 1TSHA 4J3BA 5FDYA 3MROA 2DBJA 5G5DB 3DDGA 1RZKC 4N2IA 3NSCA 3V6OE 5KBNC 2VN3A 4MDIB 3ZMEA 3BWSA 1X9LA 4GBXC 2PP7A 4DGIL 4Y9BA 5GZOC 1H0DA 4W9KC 3F12A 4KOBA 5SWSE 5BS0D 1AD9B 1CGSL 4L5FE 4X7SH 3CU7A 3ASWA 3QQDB 1BBJA 5HYJB 3HNTL 1ZV2A 1RJLA 1KIUB 1JERA 3FOLB 4OFDA 4KPHH 5AOIA 1COBA 2RQEA 2M83A 1A7NL 4UCFA 2PCPB 2Y7QB 6CGTA 1F4WH 3F7YB 4M4RA 1BW8A 1H15B 4YXHL 2VITA 2YMXL 1JGUL 1Z3RA 4UOQA 5MI0C 4I88A 1VSCA 5D71L 1HYSC 2EDHA 5GJTH 1CXIA 1QVOA 2NY6B 4WWOA 5GRUH 1GGBH 2YK1L 5EHFA 1PFCA 2UXTA 1A6AB 1GIGH 1FIGH 5KYWA 2H6OA 2NYZA 1KB5A 1S5HA 3ULUD 4FZ8L 4JZOB 3QHFL 3FFOA 1TZAA 2IAMC 3X14B 1CGUA 3S9DB 3LQAC 3T0WA 4J4PA 4FFVD 3LXUX 2Q7YB 5LVEA 5HI4C 5C08B 2CBTA 5IIEB 5GSVB 1ZEAH 3FQNB 3SOTA 5J11B 4UT7H 1O5DT 4NQCD 2CO6A 4U1JB 3ZVVA 3NDZE 1WFJA 1LO0H 4AEIH 3ULAB 1HQ4A 4HVBA 1UENA 2ICWI 4DZ8A 4J2XA 4FFYL 3LRGA 4GSUA 4GY4A 1LLAA 2LV4A 4RH4A 5I76A 3W39A 1SGKA 2NUTB 3AT0A 5MEQA 4D0CA 1MW3A 1VPOL 1KC5L 2FH8A 3V6FA 4LCCB 4J2QA 4Z8FH 3WUWB 2R39A 4RFEB 4YUEH 4Z7QB 3MRJB 1KBGL 1JK9B 3HG1B 3DMMC 5JMRA 3AY4A 1U8OB 2LVEA 1ZWIB 2K1MA 4PJ9A 4CSPA 3D9AH 3AC0A 3WLBB 2OR7A 1KGWA 1W91A 3ARDC 2DTMH 1EDQA 2X42A 3LSOB 5D2NB 4K7FB 2PPDA 2P1YA 4KTDL 4OGAC 5C0ND 3WFDL 3IDIA 4HK0A 2PO6B 4MB5A 3S4SB 3ZE2E 2E7LA 1EQWA 3NUKA 1TVHA 4L4TE 3ARYA 3DXAB 3EYVB 4MJID 4MMYB 5CEXB 5CZKA 1QRND 2VAAB 1MAMH 5KS9E 3QRBA 3AAZA 1GGUA 5BQ7B 4XNDA 5KWYC 4PI2A 1N0XH 2D3JA 3ZL4L 2ZOLA 1AMYA 3GTNA 1I53A 1SYVA 3BUPA 5GGSB 5ANMB 4L9DA 1QLRA 1ADQH 2XTJB 4JRYA 4ODXB 3QSKB 1DBMH 1IEHA 1FC2D 2PWDA 2MTAA 2GT9B 4PVMA 1CLZH 1CWVA 1M2VB 5LCVA 1AQMA 3BHBB 3PWPD 3STBA 5JW3H 2QPEB 3TO2B 3FQTA 4MNQE 2PF6A 3QFJD 2MPAL 5AW4B 5CKAA 4XNZC 1J10A 2DM7A 1JNNH 2Z8WC 3ZE0E 4F5CE 3UCQA 3T6XA 4FCAA 1BAFH 2BCMA 3LKNA 1SBSL 4ONFH 4Z23A 1HL5A 1TQBC 2YAFA 3LZFL 3TVMD 3Q5YA 5F1IA 3T0XA 4AVHA 3C5JA 2N0MA 2AK4B 3PNWA 5C7XL 2YD9A 3EO0A 4LLUA 4PN6A 3GMMA 3GI9L 5F9DC 1RUQL 4IKIA 4G9FD 3TBTA 5T1KA 2PTVA 4KZEL 4KKZA 2I60L 4GMTH 4XP4L 5AVVB 2E5EA 4ZUVA 2VERA 1C8PA 4OD3H 3SO3C 3SDDA 4GBXA 4Q2ZB 4YO0B 5GZOA 4KZDL 1I3RB 1Z9SA 4HAKA 3CC5A 4BV1A 1FA4A 4R2GC 3G6AB 3POHA 2RH0A 1MI5E 2ZNWA 2K9FB 3O3UN 4A7UA 2ICWB 2UWEF 3AY2A 1XSJA 4RGNE 4Z18A 5JHDE 2J1ZA 2YD8A 2XA8H 3GKWL 5I73B 5KSBB 2R0WL 4AOFA 4LQFH 4NP9A 5DRXA 3RPKA 1O7DE 1CFNA 1M4KA 2AJVH 3G04A 4RMVA 3NACL 4EI5B 4QRUA 1VZIA 2ICWJ 2MTPA 1XZ0B 2WVVB 3P30H 3RNKB 2VXUH 4G11A 2ZG2A 4MA8H 4F7PB 3VGGA 4M93B 5A2CA 4GXFA 3E1F1 3HAEH 1BQUA 1QHOA 3X11B 3DK0A 3CDGA 1DL7H 3RAJL 4O4YL 1WWWX 2WP3T 4NO5B 4L37A 3KL3A 4DKFH 1SY6H 2GJRA 4TVPH 4AKQA 3F00A 1I9IH 4F58L 2LLGA 3OR7A 2UWEA 1EO7A 4XGZA 4G83A 3EKCA 4F15C 2NMSA 4IMLB 1YN7B 1Y0LA 4RA3A 5JZ7D 4WTZG 5FW6A 4U6HA 3T5WA 4QRSB 5GS0H 3KZ8A 1ZOXA 5AQ0A 5FYJU 4Y5XC 4EE2A 5CUSL 1AGFB 5MP6H 3IMUA 3BE1H 4AENA 4E5XA 2BVPA 3S35L 4PYHA 3EUUA 5I19H 4A7TA 2GPZA 5D5MF 1A4BA 1KELH 3UP6A 3DMMA 4AW7A 3DVGA 5HYJD 3RGVC 3KL5A 3V5KA 1GS8A 3WENA 2FJFA 3K3QA 5BQDA 3VFVA 5L4MA 3RIFK 3TJHC 4XHJD 3HC0B 3ARDA 2ZUUA 3EFFB 2EP6A 4MXWH 4QPEA 4X4YA 2GTZB 1SEQL 4M61A 4PJCB 4Z0BL 1RZQA 2DI7A 2C1PB 2ZWZA 3HI5L 2R2BA 3SDXF 3ZT5A 1XZWA 4K3GA 4FNLH 3FSZA 5IV2A 3CC1A 1K2DA 2NY6D 4UNIA 2P42B 2XN2A 4UB0H 4PJ7A 3BYTA 4CNIB 3KLSA 2FL5A 2KERA 4UIKH 1JTOA 4YDIH 4R97B 5ALBH 2WSKA 2KLRA 4NSKB 2JIXB 5C08D 1XB6A 1P9MC 1W72L 4HU2A 1I1YB 2R1XA 1O0VA 3B2UC 3FFCE 2VTFA 4HK3N 4OF5A 3EO1A 4X6DB 1GC1L 2QQNH 5LLIC 1JV2A 3P9LB 1P4LA 5C7ZA 2F53E 4N0UE 4G1MA 4F9PC 2C5DC 1MZYA 1RUMH 2H5UA 3C60B 3NT0A 3X13B 3LRKA 3SDXA 3GSXB 2VXVH 3RKDD 5D7LB 3EO9L 1S7UA 4FZEH 1CXEA 4XHQA 3NEOA 2P26A 1UHVA 2B39A 2WXHA 3F05A 4Y9FA 1KYAA 3D4ZA 2VXTH 3CDYA 4GAYB 2BIHA 1RAMA 5LXVA 3AFLA 1G7IB 3DX7A 4XMLL 2CIKB 5ADOL 4G7YH 3HG1D 2X89A 4Q6IA 2F7RA 2OI9B 2JKIS 5ENWB 2JCCF 3SKMA 4A37A 1UCTA 2BIMA 5JOPE 4NRXB 1FBIH 1WA2X 3GBMH 3ALWA 3VO0A 1URLA 2W9EL 1T2XA 4TRPH 4WFFD 5F8QC 3WHXA 1PG7H 2X2JA 2PO6D 1T6BX 4IOFD 2DKMA 4XOEA 4K4KA 4WDIA 3DXAD 3DUUA 3L5JA 1INEL 4JW3A 3L3OB 3BP4A 5E8OA 5BPPA 1N19A 1N5AB 3OJDB 4PUBL 2EDJA 3EFOA 1VLXA 2P49B 2JB6B 1JE6A 1QKZL 2C4FU 2VDLH 2XOTA 1KF9B 3QNXB 3MFFB 5F88A 1H3WM 4P9MH 4DQOL 3WIFB 4FGMA 4P59L 3V0WH 3QDAA 2XTJD 1AGBB 4KFMA 4U1SA 4Y2DB 2RCSH 5DMGD 3B1TA 1AGDB 2X53A 3CSPA 3MV8E 4PJFB 3VMOA 4FADA 1MCWM 5IGXL 1L7IL 4H25A 1CI3M 1MCJA 3HPLB 4JFDA 4P06A 2DV6A 3TNMB 3IPEA 1N3NA 4JR9L 4RMSA 3BLBA 3RZCD 4MDRA 5DRNA 3MX0A 2YSSA 4OLWH 1YNKL 1QD0A 3DX9B 4FTDA 4L5FH 2B3RA 3EYQD 3LS5L 5EORL 2Z4QA 3O8XC 1RKRA 3QR1A 1MHEB 3EBHA 3D2TA 3VQ2C 3HRPA 2YBRA 4X7FC 5I1EL 3T0DA 3MJ7A 5IJKC 4M6MH 3RWEA 2IQAB 1QAWA 4RESB 3JZYA 3QDMA 5SWZA 1MKFA 2AK4D 4I0PB 4FFWC 5DS1A 5KVFL 3Q13A 1HXKA 4WHYG 5DK2A 5LJYH 1NBVH 2Y1AA 3I6GA 4LPUA 1HILA 2WUBH 1E9OA 3KWWB 4YSSA 6TAAA 4Y5XA 4LCYA 3T2LA 5I6NA 1AHWB 3LVTA 2VABA 3VCLB 1X5LA 2TAAA 3EGXA 2Q20A 1PYWB 4U6TA 5CJOL 2Y25A 1GYCA 1KBBA 5GHWH 2WLIB 1R0AH 2G2RB 2V5YA 3NA9L 3RNQA 4ORGB 1LJMA 4KQ3L 1RURL 3UTQB 4OCNC 3RGVA 4LLMA 3O9WC 4OLEA 4WU7B 2X6VA 1QSFB 1G6RL 2VISB 3VWJB 5JXED 4WI0B 3JWDC 2AJXH 4JN1H 3QPXL 3LZNA 1NBCA 2VJ0A 3JYCA 5FWQA 5IMLB 2CJTA 1FE8L 3ECBA 1VFUA 4Y8DC 3CDZB 4JFEE 4AJWA 4EI5D 5C8JB 3MOBH 1T1YA 3PU7A 4LPYA 1FFNA 3LNDA 4OIFA 2IVFC 5A16B 4NNXB 3ZT6A 3UG5A 1CLYH 5C0JA 4Y5VB 3IDJB 1FFOB 1Z5YD 4ZSOB 1PZUB 2BS8A 3ZTJG 3IF1B 4H7VA 4ISVB 2GBTA 3MRPA 2XKNB 15C8H 4YR6B 1EMTH 1XD0A 1V3LA 3AS0A 2WTPA 1OOWA 4HHAA 1P9MA 1L9SA 3TCLB 3MJ9A 1SDYA 2CWRA 3FFDA 1MNUL 2YA1A 3ZYZA 2F58H 1TKWA 1T20B 3TT3H 5C0BB 1W72B 4KH9A 2DD8H 4QRRB 1ML0A 4AUUA 2EDEA 2Q5BA 4PAZA 2IH3A 4PJ8B 4F9PA 2V2TA 2BSRA 5JHLH 3RY4A 3RIAK 5HVGB 3BXNA 4AM0A 3PJLA 3S37H 2OMWA 1DFBL 4HIXH 1FG2B 3IDYC 4PW4A 5FV2A 3UZVB 1OK0A 3W2DH 3O6LH 2IANA 2HTKD 4KX7A 4WQOA 2IPUK 3HCVA 3P4LA 4U3SB 4FABH 4J7RA 3SYOA 3REVA 1KY7A 2A77H 3FQXB 4MHHG 1XH3A 4ZXBC 2BSED 2R9HC 4FQIL 2DI9A 4S1QH 2BY1A 3FHAA 3ULUE 2VDKH 1N70A 2OM5A 4LHUG 5EA0H 3RWJA 3D18A 4BCXA 1OLLA 4PCYA 2FR4B 2GG1A 3KM1A 3MRIB 3I02B 5A2KH 4P5RA 1CGVA 2HX9A 1MWAA 3UPRA 1BG1A 3CXFA 3CIQA 2QADB 3EDEA 2Q10A 4UOJA 5ITFA 1TQCC 1DQMH 3MNDA 3Q6GL 5CU9A 4LCWA 2IPKA 3X1NA 1QSEE 4KI1A 2JIXD 4QCIB 2QV4A 5KVDL 2I7OA 1SJHA 3HZMB 4Q56A 3QORC 5DJYA 1ADWA 1MFAL 2NY5C 1H8LA 3WTXA 1PZDA 4R7NB 2BHUA 3ECVA 4HCGA 3CZFB 5KTEL 3L3HA 2RR3A 1V7MH 4YC2C 5I74C 4O2CA 2JKJA 3C60D 3QW9A 4JY6B<