2NW2A

Crystal structure of els4 tcr at 1.4a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
196
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVQAGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ELS4 TCR alpha chain
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 196
sequence length 200
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nw2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nw2A02
1JPTL 3DX7B 2F8OA 3LEYH 4DCQB 5EU6E 4YPGA 4EDWL 4JZJB 4ZUUA 4ELKB 1EXUA 1QZ1A 4L3CA 5T3XL 5DO2C 2I27N 3WKNA 2P47B 3DXAA 4PGCB 4R8WH 1WFTA 2H32A 4EOWL 4NOFA 5GJTH 3CNKA 1FE8H 5C0CE 3RTQD 1YN6B 3EFFA 3VMOA 2NXZB 3LKRA 4AH2B 3HC4L 4GS7B 4GUPA 1OARH 2OJEA 2R4RH 2X4NB 5BS0D 4K71B 5BZWB 3HA0A 4BFBD 4PJ5A 1A64A 2OJZL 2HVKB 5C0BE 3MLPA 2FECL 5M94B 4ZO9A 2E9IA 5IF0A 1OCWH 3ARFD 1DLHB 3U48A 1B6UA 3ARGB 3Q6GH 1DQJA 4YLQT 3SKMA 5FKPA 4LVEA 2AJ3A 4Q9BA 2P5EA 1J18A 4JFDD 2AVGA 1I3RB 2GJ6B 4G6JL 1FL6A 3QDJA 3MLVL 4LVNB 4ZMAT 2E7HA 4Y1AD 1UZ6F 4NPYB 1UM4H 1P7QA 3STLB 1AKJB 2NR6C 3BD3A 2EDRA 5T5NF 2HWZL 3O41A 4JB9H 5EIIA 4ZFZB 1MI5E 3AFLA 4TUOA 5F72S 5CP3H 3QXTA 2AEWA 4PBVC 1M7DB 4GW4A 4IIQA 4U1IA 1LD9B 4M7LT 4PTUA 2XIDA 3RIAF 1K8DB 2XZAL 2QADC 2I9LB 3MJ7A 3UC0H 1OPGH 4ZFFB 3GI8H 3KYNB 3H9HB 1AXSA 5IEHB 3AGVA 3W2DH 3LHPL 5ADOL 1HN1A 2R69H 3WKMH 3DVNB 3RGVA 2OZ4L 5L6YL 1OM3H 4LSVH 3CC5B 3MLTA 1WT5A 5FDWB 2YBRB 1R3LB 3MRHB 4ONOA 5IV2A 4LOUD 3CFJB 4X7CC 3BXNB 1FVCA 1NMCB 2X70B 4Z5RA 2FZ3B 1UC6A 3BKCL 3TV3L 4M43L 5HYJE 1WICA 3G6DH 4U6HB 1CFTA 4NNXB 5IK3A 3CLFL 4H1LH 1K4DA 4TNWF 3SGKA 2Z4QB 4NQSA 3HE7A 2YZ1A 1IQWH 3ZYZA 5I66A 2XG5A 3OJ2C 1NEUA 4KTEH 1A0QL 1I85C 1T2QH 5D71L 2NY4C 4FFVC 3IFOA 1HXYA 5CP7B 1W8OA 5SWZD 3O4LD 2L7JA 2DLFH 2MPAH 5DEFA 3U9PH 3L3DB 3MV7B 4LSQH 2P8LB 1QG3A 4CUCA 4L8SA 2PW2B 4R4ND 3TN0B 4R4FH 2HRPL 5C1MB 4HFWA 2IGFL 4OF6A 4L4JA 2Q87A 1XIWC 3EOTL 4Z0BL 1C5BH 2FH8A 3JTTA 3S35H 2X40A 2HLAA 3OGCA 5JPMA 3TWCL 1KJ2H 5GZND 2FATL 3J7HA 3S36H 5EZLA 1A6WL 1QFUH 1TPXB 4PJGE 1INDH 4GG6E 5GGSA 3V9FA 1SBSH 4HWEL 5D7LA 3V0AC 1SHMA 1L7TL 1U8OB 4JFEB 3DMMC 1ACZA 4YUEH 2MTPA 4ZDHA 1RZGB 4P46A 3BPLC 2GK2A 3LKSA 4G6AD 4LLUB 5CHNB 3V52H 4EVNB 3Q1SL 4WUKH 4U0RB 1FSKC 3P73A 2OTWB 3QIUD 4GAFB 3EOAA 5FOJA 1IL1A 2PYEE 1EAJA 4N5UA 4G43A 4XP6L 2WIMA 2ZG3A 4LCYA 5C0NC 5H94A 4E41D 4G42A 4O9HH 4YHYC 1SYSA 1IJ9A 4QRSA 5SWQB 5GGRB 5BJTA 1QBLL 3QG7L 5EUOB 5D2LA 1P1ZB 4NN5B 2ESVE 3PDGA 3QI9C 5HI4D 4P49A 4O02L 5D7IE 1U8PA 1ZHKB 3B83A 4JPIB 1JYWA 1MRCL 1FNGB 3GSQB 2ARJQ 4JFOA 5L0QB 3C6LA 5CS7A 1RU9H 1JIBA 1U0QA 3D9AL 3MJ9A 4IRSD 4G8GA 1JRHL 3V6FB 4XAWH 1KN4L 3KS0H 4JKLA 1X6LA 3NIDE 4ZSOA 4LBEA 4HC1L 5GRVK 1QEWB 3P30H 1T1ZB 4YE4L 3D3VE 2YD4A 4P2OA 1F58H 2AK1H 3ARYA 3RUGE 3MZGB 1EEUA 1PVHA 4R0LA 5FYJD 4JO2L 4XCNA 4Z7OF 2AEPL 3QAZC 5L2KE 1JF1A 4L4TE 1XGUA 1S7VB 2FJHA 1QQDB 2A74B 4L8DA 5BXFA 4NM8L 3QHFH 2EXYD 5J6HB 4TVPL 5T1DH 2DQCH 3QXAA 1C1EL 2IH3A 3EW3B 2D7TL 1UB5A 5KAQF 3H42H 4P99A 4Y5XA 1KCKA 4PPTA 4ZNEA 4X6EA 3GEWB 1D6EB 4NO5B 5JZ7D 4U6XA 5B38A 1AC0A 4EIGB 4POYA 1SYVB 4F15C 4GH7B 5C9JB 3A6CL 2XKUA 3LRSA 4LL9A 3LQZB 3F7PC 2R1YA 2PTVA 1V3MA 2IPKB 2O61A 1F4AA 2OQJA 3KYKL 3ABZA 1ED3A 1JF6A 3O6LH 4QTIH 4PJAA 2P8MA 5CKGA 2O5ZH 3QHZH 2JE8A 3FQUA 3O6KH 5E8OB 5F1NB 5I1HL 2PXYA 3SJVE 2DWEB 1JPST 1ZT4B 3UTSD 1D9KA 4KJQD 3VRLF 3RKPA 1E4XI 5GGVL 2AQ2A 4NKQB 4HUVA 3KPPB 4JJHA 4S1QH 3OAZH 3LVEA 4YK4C 1IEHA 4X6FA 1AGBB 5KZCD 5KTEH 1Z9SA 4RAVA 4ODHL 1U8NB 1CE1L 1ZGLM 1EHXA 5C08B 3DX6B 2EIEA 4PLJD 5T5FH 1E27A 1T3FB 5GGTH 1BIHA 5BOZG 1AFVH 4M7KL 3WUWG 4ISVA 1WIOA 1YEDA 1TFHA 3BMVA 2HT4C 2Z8WC 1V7MH 5H2BB 3VGHA 4X80L 1A21A 1OAUH 1LK2B 4MSWA 3N85L 1GXEA 4WFGD 2WAHA 1Q9OA 2Y6SD 3SCMD 4M6OH 4LFHD 5KVFH 2DF3A 3OKLB 2J88L 1A4JB 3I2CL 4C56A 3HZYB 3ZT6A 5AZ2L 1CDJA 5ALCH 5DDHA 4NRXA 1ZT7B 3P3YA 4JFDA 1OD9A 1VHPA 5LWYH 3WIHH 3T3PF 1WF5A 1P69B 2ENYA 2W0FB 4DVRL 5FHAL 1NDMB 4MQ7A 2RR3A 1N64L 2GTWB 2UUDH 4Z95H 4FQLH 5I73C 4JG1H 3NCEB 1ZLVK 5I1EL 3GUTB 4D8PB 3Q5YA 4W6WB 4YDJB 4CN6A 4RAUB 3T0ED 5ITBL 2EYSA 4MJ4A 3O2DL 3BIKB 4LSDA 4NKOB 4WIQA 4FQCL 1PY4A 1NGQL 2C1OA 1QSEB 1J0KA 1U58A 4XGZA 1UADC 4XPTH 1NFDA 3PP3H 5J11C 2VR4A 1E4WL 1X5JA 1CYGA 3I6LE 3SGJC 4OLYL 1IBGH 4E5XA 1GGBH 1ODAA 4RISL 1NEZG 4JEGB 5IFAL 5C0EB 3O0RH 3X13B 2BSRB 1EHNA 5IHBA 3QG6A 1J1PL 1YY9C 3LOWA 3S37H 4NNYA 4ERSL 4HBCL 4XH2A 1A6VH 2E9JA 3VG9C 1FP5A 2WBJC 5GHWH 2OM5A 1ACYL 1JGLH 1FL3A 2R56H 4PJIE 1ZTXH 3IJSA 2Q8AH 3L9RA 3S5LA 3UJTL 2IAND 4GAYA 5ID1B 3CU7A 4M93C 4XX1G 5I8EB 3WLBB 3RA7H 3IFPB 3IDGA 4WGWB 3BPLB 4MJIA 4NQEB 4S1RL 1FL5B 3CH8A 5IVZB 5DUMH 1CG9B 2P5WE 1RVFL 1FSKB 1FV1B 3RVVD 5IR1A 1Z9MA 2AV7B 3FQRA 4CN4A 2KUTA 2X4OB 4KTYA 5JNYB 5DJXB 3BJLA 1KB9J 5E8DH 3X14B 3MV11 1IC4L 1G9ML 5HSFA 5LGHL 4PRPE 1CL7H 4ODTL 2VTFA 3QA3A 2AI0L 4NT6A 5TE4H 4EXKA 3QT2A 3MLYH 3QWRD 2GUOA 1BGXL 1CZ8L 3BQUD 5DURB 2QQNL 4R7DB 3EZJB 5FA3B 5IEKA 5IQ7L 3NH7L 3PE9A 4HZLB 1BVLA 2HLFD 5EC2B 4DGIL 1I7ZB 4N8VB 5D1ZB 4Z8FH 3EYQD 5LBSL 3TGXA 4UOJA 3GSRA 3KLDA 3T65A 1S7UB 3UX9B 5EOCJ 1TJIH 3D85D 4HXAH 2B20A 5DXWA 1I8IA 1P4IH 1MCDA 3PHOA 1CXLA 1AQDA 3ULUH 4FQ2L 2HJFA 3QXDB 2EDBA 1KTDB 4MA1C 4WJ5B 2YD8A 2JB6A 2JJUA 4R7NB 5A3ID 4MQXD 3VFVB 5F7WC 4YWGH 4DUVA 5D93B 5T3ZE 3JWNC 2NY6C 4YXHH 1BZ9B 1HYSD 4X6DF 4NYLB 4EZMA 3C08L 4UT7L 4GKZB 4PB0H 2H6PB 1CLZH 1MFAL 2EEDA 4F58L 1Q9LA 3MFGB 4OLUH 3FFCA 1UT9A 5EWIH 4PJBB 3ULVC 2VZSA 3BRGC 4OSUH 2X4QB 3IGAA 5IB3B 4OZFH 4MWFA 2NZ9C 4X5LA 4KK9D 3MUJA 2P24A 3I3BA 5BVPL 1HKLL 4MA3A 5MERB 3DWTA 3VFUB 1FO0H 1LEGB 4YDKH 2BK8A 3KWWB 1A1MB 4TOYL 3EDKA 3R06B 1ROWA 5F44A 4RWYL 2VLKD 3LDBC 5DQJA 4LDEB 3O3EA 4OCYH 5EDXA 3NPZB 2JKXA 4O4YL 4JRYD 4YK4B 3VFOA 3U1SL 1TCMA 3R8BB 2CKBH 2V2TA 1HH6B 3MMEB 1D5ZB 4M7JH 1XCTA 1KIQB 1PW3A 2WV3A 1R5WA 2DD8L 1XZ0A 1D3CA 3P4LA 1JGUL 2A38A 3HI6H 3TH2T 3FRUA 3S4SB 3JWDH 4QRTB 3VFRA 4MD4A 2APVA 3NGBC 4JM2B 3QWOB 5DJ2A 2G75A 5C09A 4AZ8A 3SKJH 5T1KB 4Y4FB 3M45A 3RVUD 4C83B 4RMSA 4QXWA 1U3HB 3GO1H 3HI5L 4QCIA 4O58H 1S7XA 1V8HA 1JPGB 1B4JH 3NZHL 3OXRB 3K74B 1DLFH 1QVOA 4TRPH 1GAFL 4Z78B 4JANB 1S5HA 1XF3B 1CN4A 3UTSA 1CT8A 4EN3C 1IC5H 1D5XA 2EIBA 4M7LH 1MCWW 2GT9B 4JPWL 4NO2B 1CDUA 1JGVH 5J6GA 2EYRB 2CLRA 3RPKA 4KH2A 1P9MA 1T21B 1UYWL 3CLEL 3MV9B 1DSFH 4PJFB 2V9QA 5I73B 3WEXB 4DFIA 4PRDB 4G3YL 3TO4C 3IFNL 2GI7A 5C86A 2R0WH 2P42B 3OAZK 5CBAA 1VFBB 3L5WB 4M3JA 2EDNA 3IF1B 4HCRA 5FB8A 2A6JA 5DRZA 5JXEC 4OGXH 4XNQA 1NKOA 4TTGA 5E94A 1FJ1A 2NYYC 3TBYA 4DN4L 2J6EH 5F3BA 3P0VH 1S7QB 2IQAA 3PABB 2R2HA 4H1LB 1XF2B 1IGFH 2DIAA 4XNYL 4P9ML 1GC1H 3VXQA 5HY9A 4KKCC 1FG9C 2IJ0C 4QY8A 4JFHE 4G5ZH 1FYTD 3WS6A 3CVIL 3JXAA 4P23A 4WUUD 4HKXA 2R23A 2A77L 3ET9F 4ESKA 2HJKA 3V8OA 4L3ED 3VG9B 2WBJB 5IVXB 2MQ0A 3WNLA 4M1CC 3OGOE 5EZOL 3VXPA 5MHSD 1CLOH 4GAJH 3X11B 2QKIB 4PREA 1OGAA 4XC3H 1C12A 5DK0B 2OTPA 4M93B 3QQ4B 3PWUB 1INEH 1F13A 1OTSD 3HAEH 2XPGA 4LLYB 1HZHL 3E6FA 3EFDL 1MLCB 1IC7H 3IDNA 1OP5K 3UJJH 1AQKL 3P11H 2BHUA 3I6GB 2P7TB 2HKHH 3KXFD 3Q2CA 3GMPA 1ZHBB 3DTXB 2XICA 5JHLL 1KJ2B 4WHTB 2DYPD 1LWRA 4RGND 3VGGA 4K8RD 1KB5L 3CJJA 3ARWA 2NY1B 1BREA 1C5DB 1H3VA 3L3IB 4OZIA 2NNAB 2RFXB 4FQXC 3TT1H 3ETBF 2OBGA 1EEYB 2HG5B 3OF6D 4LSUL 1WV7T 5B21A 3H9YA 3PP3K 4NQXA 4M00A 2XZCL 5DFVC 1R0AH 4P5MB 4YHIA 4NCC1 1REIA 2JJVA 4UNVA 4HLZH 4K7FA 3G04B 3PIQA 1MCWM 1F11B 4FMFA 2BVPA 1A5FL 3REWB 3T08A 1N5YH 5CGTA 4K3EH 5CWSA 3HNTH 2YK1L 5IESL 4KZDL 4JRXA 4B41A 3A6OA 3CK0H 2NY0D 3C60B 1F02I 1NDGA 4I9WE 4JHZA 3X3GL 4OV5A 4JDTH 3SE4C 2Q3ZA 3UJIL 4U3XA 5ISZB 4OCXL 5C2UB 1FNHA 4MA1B 2EDKA 1IKFL 3KPRA 1DQQA 4XNMB 3TJHD 3SDDD 5GS1B 3GRWH 1TCRA 4QYOB 2CDEB 4LMQE 2I60H 3EYSH 3GSUA 2BMKB 3QUYD 5DJCA 5EORL 4G9DA 3KPQA 4KDWA 1T2JA 5DJ0A 1MLBB 1INQA 5E9DD 4I0KA 5I1CL 1JWUA 4P5KA 3C5ZC 1TZIB 2EC9U 5HHMD 12E8H 4HX1B 1BZ7B 2F54D 5C08E 5FYLD 5I6XC 5JW4R 1NJ9A 5TF1H 4CRPA 1EZVY 3RWGB 4S1DC 4LKXA 3VXSE 1TQBC 4QOKB 5IT2H 2PYFA 4H20H 2VDQH 5C2BL 4G7VH 4PD4J 3WFDL 3IXTB 4ALAL 1LGVA 4E0RB 5EH1A 5ILTL 2GFBA 1HHGA 4PLNC 4X7SH 5MEND 4UNTA 3LDBB 2V2XB 3GMQB 3TFKC 5K9JL 5KS9A 2EDEA 3FAXA 1N6QL 1L0QA 3ULVF 3UTTA 5GGVY 1SBBA 3KNBA 3UBXI 1VACB 2BXZA 1YEGL 2JB5L 3K8KA 1PX3A 3X3FL 1PBYA 4HJ0D 4PB9H 2LU4A 4Z0XB 4K3DL 3WS3A 5A43C 4LARH 5M7QA 4PRAA 5C0IA 4IEFB 4PJGF 1BQHG 1U91A 4GG6F 4YQXH 1JPSH 2DB8A 4LCCC 5ITFB 4U6YB 5HHOE 1WZKA 2E27L 5JW3H 4CL7A 5ICZA 4LCWE 3GMNA 1XGRB 1NGYA 4O2CB 3RGHA 1SEQL 2C9AA 1KLFA 1WWWX 3VFMA 4Y5VA 2GAZB 2IC2A 3CVHH 5I1LB 3BGMB 2VDLL 4PJEB 2HJLB 3BP4A 5ICYB 2NW3A 4PJ7F 2CLVA 5FYJH 3V6OC 2R4SL 3JZ7A 5KANI 3FTGA 2Q3AA 2CQVA 2FHFA 3S35X 1Z6JT 4WU7B 4TN9A 4A2LA 3O9WD 2DI9A 4FZEL 3S36X 4IS6B 3VWJC 4DN3H 2Z35A 1CXKA 4KWUA 2R2EB 2KZWA 4LLQA 3BKJL 1KPRB 3IS1X 1UEYA 3ARBC 3OR7A 4ZPTA 1UKQA 4BQ9A 4X4YA 4AQOA 5JMOC 2QSVA 1RUMH 3NCMA 4FQ1L 1OGTB 2E7CA 1J8KA 1QFWL 5SWSB 3S34L 2XN9A 5EZIH 1SM3L 4FMKA 3EDEA 3RUGF 2VMFA 1RZJL 2ZOKA 1KENL 4D2NA 5KSAC 5F93C 1EH9A 1C08A 5J89A 1FVDB 5B8CC 3V4PL 3PGDA 4IRZL 2VNCA 4NJ9H 5IFJB 5DMKA 5IROC 2AJXL 3GMLB 1NCAL 2Q6WA 4ZO6A 1QBML 4JQVA 4IOSD 4G80A 4FZ8H 4HG4K 4I4WA 5D6DC 1IFHL 2IG2L 1GHFL 3QEQB 1GC1C 5ETUA 5GJSH 2FX7L 3SDXB 3BP5B 3LKQB 2A6KB 3RWFA 2GITB 3OXSB 5BV7L 5JLZB 3DIFA 1EEZA 4HULB 1ZA3A 1PD6A 2N1KA 1L7IH 4P59L 1AHWA 2X9WA 4X98B 2X4TA 5D2NC 1CXEA 1G7JA 3K8LA 5HGDA 3TZVC 4BFIA 1V7NH 3WE6A 2WSKA 4GKOA 25C8L 1LO2H 1OW0C 4AMKH 3KPSD 5C0DA 5CKAA 1Y6NR 2JCCA 1N4XL 5BW7C 3L6FA 4WI2A 4GRMB 1RZ8A 2AEQH 4OIBA 4QF1B 1K3IA 3QO0B 3F5WB 1TNNA 4YGVA 1YN7A 4MA7H 4I0PC 3PDDA 1SQ2N 1IQDA 3QZWA 4PJDA 2G9HB 2HVJB 3DRQB 3DGGB 4KKAD 4P9HH 3ZSSA 1CXIA 4WHYG 5LAXB 4QO1A 2ADFL 1P7KA 4FNLL 5EOQL 3L7EA 2BVOB 1UM6H 4R2GD 2BC4B 4LNVA 2C7UB 4ZAKC 4OF7A 3C2AL 1W72L 2Y1VA 1OLLA 3GJFK 5BRZD 4N68A 1IKNC 3IVKB 3MRBA 1YNTB 1PFCA 2H9GA 4TTDC 3RBSA 3PGFL 1E28A 3KXFA 1FFPA 4U1HB 3C9NB 4BJLA 2DYPA 4XP5H 6CGTA 4FQJL 4ZXBD 3G5YB 4HF5L 1XGQB 2OI9B 3DHMA 1T5WB 1BFTA 4R26L 4YHOL 5GZOC 1DBJL 5FM5O 1CU4L 2OP4H 5I71C 5IW1A 1ZHNA 4LHQB 2UWEA 3FQNB 4Y4KC 2VDPL 4HKBB 2MJWA 5HTSA 3DV6B 3HR6A 5ALBL 2DBLH 3BIAX 4OZGB 2BCKB 5I6XB 2BY1A 5F1SA 4UAOB 1GSMA 2F19H 5T3ZL 1NC4D 1TQBB 3NCYS 1KTLA 4OI8A 3ZTJG 3LEXA 2OZ4A 2VYRE 1LDSA 2ZSWB 2J8UA 5I1JL 2Y72A 2BNRB 4PJ8D 3RHWF 3VFWA 1IGYA 1JI1A 2FO4A 4OZFB 3HNVH 4QHUA 1A6TB 1NSNL 1ZAGA 5F88A 2X1WL 1RZKH 2VLRB 1AD9A 3T0WA 3LKNB 3OHXB 3MLZH 4PV9B 5I8KL 2FJFA 3SDAB 4Y4HD 5C0JA 3T1FA 2J1KA 5CAYB 1FO0B 3DETD 4NQCE 2V17H 3A0OA 2W92A 2D31A 2YWZA 3T1WA 3F62A 2WUBH 4PJIF 5I1DB 5JXAH 4KPHH 1UJ3C 1IM9D 1SY6H 2XTJC 4HHAA 5I19H 4LCCB 1XGPB 5D6CA 4CJ1A 2YWYA 1SJEB 4PRNB 5DRNB 2AS5M 1MVUA 3RX8A 3SKNA 2CKBB 4RGOL 1RSFA 2A73B 1MCPL 2M26A 4DGYH 2CPCA 3C8HA 1PG7W 3WJJA 4FTVE 2Q20A 3AU1B 2YRLA 1KFAL 3LKPB 4MA8L 1TZGL 4KQ3H 1ZWIB 2LU7A 3B9KD 4J3VA 1I3GH 5IFHH 5MENA 3V0VA 3QPQD 2C3HA 4X5WA 2GTZB 1IZKA 2NTFB 3B3IA 4HV8B 3VWJB 3O6FD 3LEVH 1HSBA 3OG4B 4KTDL 5JDSB 1G0XA 2VWEE 3FO0L 1YNLL 2NY5C 5CJOL 3ARBB 4EEEA 1ETZB 5D1XA 3QIWB 5EO1A 3NTCH 1JNLH 3DBXA 2IAMC 4Z7NE 5JOFA 1G7QA 4I2XA 4ZQKA 5CJ5A 2VISA 5CEZE 1UWGL 2Y06H 3LB6D 5H35B 3CDGB 5KSAB 2IBGA 4D9QD 1VFAA 3IRPX 4PP2A 3ARDD 3BOVA 1FPTL 5BS0B 3UTZB 4XMKH 1U41A 5DZNA 4RWHA 4ZTPH 4QXUH 4EQ3A 1CICC 5F3HB 4XTRC 4A6YH 4XWOD 5J57B 3INUL 3BZFA 3IJYA 3JUZA 2BVQA 3ARFB 3MRRA 3SE8L 4P57B 1DN0B 5FUOL 4JR9L 2VIRA 43CAB 4YO0A 2H8PA 2Y7QB 2RAMA 3RVWD 4HC1A 4KJQC 5AG8A 1XGYL 3RDTD 5MEOA 2ZCHL 5CGMA 3DURA 4OFKA 15C8H 1CGSL 4MNQA 5E5MB 1JHLL 2ZJSL 5DJAA 1T6WA 1ONQA 5L9DL 2BDNL 1HHJB 4JDVA 4QRUB 4GW5B 4X5XB 3QCTH 4DGVL 3L3OB 5F6HI 4F9LC 5JHDB 1JP5A 1HINL 2ZWLT 4E9LA 3FN0H 4PLJC 5F1IB 4JFFD 1MNUH 3MRFB 1CVSC 4QRPE 3HAEB 5E2WH 3WL9A 1U9KA 1OQXA 3G5VA 4OQTL 4PJHE 2GIYA 4NSKB 1T89A 3U36A 3HE6D 5AWNH 4Q58C 3KJ6H 4TULL 1DBML 3EAKA 3P4MA 3SCMC 1N2RA 3OTTA 5E0QA 2CMRL 3M07A 4Z7UE 1MHCB 3H9SA 1K2DA 3O3BA 4U4BA 2ARWA 4O51A 4LVHB 2WWMC 2R1WA 3BH8A 1HWGB 2VDOH 3KPLA 1IEBB 1A9EB 4LHUA 5IB4A 2DMCA 1I9RL 4NN7C 1NBYA 1EJ6A 1PQZB 1E6OH 5C6TH 2J3SA 3O8XA 4UT9H 1EHAA 3W0WD 4Y8AA 4M1DL 4TYUA 4MQTB 5DI8B 3CFEA 1I1AA 4QHLA 1EMTL 1YPZB 4G9FD 4CJ0A 2GSIA 1EO8L 5IMMB 4AG4L 2ZUQC 3VFPB 3NFSH 4WEBL 3UDWA 4HUXB 1KLUB 3T3ME 2F58H 5I71B 4PYGA 3DGCR 5SWZB 3KPNA 1H5BB 2YA0A 4D0DB 4LGSB 3GHEL 3MOBL 3TNNB 1H3UA 3L5JA 5EU4A 3G6JE 2QQLH 3GSVA 3VH8B 3MRNB 5JORB 5DMGC 1LP9A 1WLHA 3FO9B 4UB0L 5FHBL 1XGTA 2NX5D 4KDVA 4LLWA 1AC6A 1R3JB 2OL3H 4FFWD 1B2WL 4B7LA 2I5YH 5D1QA 1TZHA 3MUY1 4LLAA 1MJ7L 4K8RH 4R96B 4Q9QH 2FEDD 1JZ5A 1MAML 2R8SH 3MRMB 4F37F 1U3ZA 3PP4L 5IOPB 4ZXBA 1J0YA 1G0DA 5C07D 1AJ7L 2ID5A 4PJ5E 3BWUC 2ZUUA 2VZTA 3QIUB 4J4PA 2JK5B 3L1OL 4J1UB 1F6AB 3V7AG 1RJZB 2WP3O 5B38G 4X4MA 4N5EC 1MAKA 1Q8MA 1RJLB 1UJ3B 3MRCB 4HKZB 1EV2E 2DIJA 4Y19A 1D7FA 4KQ4L 1M6OA 5C0AD 4XHJC 4QWWC 1FNSL 4E41B 3O2DA 2H1PH 3FB7A 5FK9A 3WMSA 4OB5L 5HI3D 4XPAH 3B6SB 3QNXB 5C0GA 5F7UA 1OLZA 1EFXA 4MNGB 3F6IA 1CGYA 1WK0A 3OAUH 3QDJE 2EDWA 1RUQH 1Q9KA 2O5YH 1QHPA 4ZUTA 1UXSA 4FHBD 1EGJH 2E6JA 4NIKB 4EI5C 5HPMB 3ULSB 2X9YA 4ORGA 1A7PL 2X4UB 5DUBB 5JIHA 3TPKA 3QEHB 1KN2H 2DJSA 4IRSB 3RIFF 5SWSE 4CVXA 2IPTL 3SPVA 3ES6B 3WHXA 4V2BA 3UYRH 3EYQC 3B43A 1LEKB 4HH9A 4PRID 5GS0C 1L4IA 1GPOL 3CVHB 3BPCB 1RIHL 4N9OB 3LS5L 5FECA 4RGMC 3MACH 1UWXH 4Y4HA 5D4QA 4PIRF 3OAYH 3JV6A 2PO6D 4RMUA 2COQA 4KI1A 2C4FU 2X89A 1IRAY 1K8IB 3G5ZB 1MAJA 3QEQE 1KELH 2BOBB 4GQPH 3D39A 4ZS7L 5FYLH 1AGDA 5FV1L 1IMHC 1M7IB 2EH7L 2GQHA 1UXWB 1CFSB 1GIGL 4GW1A 4OD1H 5EN2B 1HYSC 1WGOA 4C58B 1BFSA 2Y5TB 5J12C 3AM8C 2NY3D 5F7FA 5IG7B 2Z93B 1AD0B 1G7LB 4XBGA 5DQ9B 2DJ4A 5ESAB 1CICB 3TA3D 1J87A 3N1PC 1J7VR 3QPXL 1KCUL 4Y2DC 3TIEA 1DZBA 1JMXA 5GSRA 4F7TB 1EAPA 4CVUA 1VKXB 4RFNC 3FMGL 3IAQA 1MCKA 4FXKB 2HTKD 1ZLWH 2ICES 2VE6A 5GRVL 1A3LL 3QO1B 5CD3B 4AEIH 4U1NB 4IRJD 3ISWA 2VZVA 4MB4A 3FZUC 1DQDH 4DW2H 4BSWB 3ELAT 1KB9K 1JNHB 5KZCB 2VSCA 1JI2A 1GOHA 2BNQA 4BH8B 4OAWB 3NCYP 3RP1A 4QRRA 4CVZA 2MQCA 1KIUA 3QXUA 1NC2D 4NO3B 5HI5D 4L9LA 1PY9A 2B39A 1FGNH 1PSKH 4K23L 5EZJA 2Y23A 2HH0H 3NOIA 3W11D 3LAFA 2QR0B 5DLML 4PRBB 5IMKA 1TVBA 1LDPH 4P5TC 5D7LE 4UDTB 2MOVA 5DT1L 4GMSL 1U95B 2I26N 3SCMB 2VABB 1MQ8A 1N0XH 4CADA 1XF5B 1X7QB 3S5LG 4X6CB 3GSNA 3O3AA 3D69A 2FX8L 3WNOA 4PJCB 3E6HA 3LSOB 4Z6AT 1BD2D 2FD6H 1IAKA 3UP1A 5CMAA 3U4BH 1QSFD 2NXYD 5D7KD 1EBAA 4ZD3L 2QQKH 5EU6A 3QIBA 2EKSB 2JLLA 3H2WA 4QHNA 4BSJA 2BNUA 5FO9B 1I4FB 4I3RL 3QDMD 5D2LE 5T1MB 3GMOB 4HJJH 2DRUA 2BZDA 3UTQB 2ORBH 3U7WL 5C0CA 4OZGE 3EJYD 4EI6A 3T0EB 2XWTA 4MDIA 4LAQH 3QQ9C 3BKML 1SJHA 2NY7L 1DEEB 4GBXD 5C0BA 3RNQB 1A7QL 1A8JH 4KV5E 2XA8H 4G8GE 4ZSOE 3AB0C 4ODUB 1P6FA 2PW1B 1DN2A 1TQCC 3DV4B 3P4NB 4MXQC 4N0UB 5I1AA 1NCTA 1RK0B 4Z77A 1OAKL 1HNGA 1YY8A 5KG9A 5IMLA 2VLRE 3LEYL 4X7TA 3B9AA 5IMOB 3HZVB 2HTLD 5E03A 1MF2H 2IFFL 1BVKB 4AK1A 4R8WL 4F9PA 3MRDA 3ZHKA 5GJTL 5C8JA 3I9GH 1FE8L 1W0VA 2OYPA 4ETQB 4V1DD 5C6PB 2WBWB 4D0CB 3U4EA 2IANB 5J9PB 1YEKH 1T5XA 3K46A 1DQMH 4P48A 3DYOA 3VXME 5HHPA 3V7AE 5E4EC 1U8JB 3T4YB 3Q6GL 4OCRH 3TJEH 4IMLB 3FT3A 1BOGB 3PNWB 5DZOA 1I9JL 5KN5B 4K8RC 7FABL 5HVGB 1IM3A 4PJAE 5IIEB 1KBGL 1RK1B 4N8PA 3IDYB 4OLWH 2AKRB 1HKFA 4LLMA 3VGFA 3QUZC 2R9HD 2IADA 4F7EA 4PUBL 4WU5B 3PL6C 1FCCA 1BBDL 4HPYH 4OKVB 3BQUB 4S0TD 3S6CA 1IAIM 3MOAH 5HYJA 1DE4B 5CLWA 1K6QH 3QFJD 4POUB 2ICEB 3EYOB 2APXA 5LQBH 3UC0L 1OPGL 3QXWA 1C16B 2BY0A 3BWAB 1ZGLB 3W2DL 5DC9B 2F9BT 1M4KA 5DEGB 2R69L 3D85B 3WKML 5BS0E 1DVFD 1Y0LB 1OM3L 4LSVL 3BDBA 3RWEA 4CAGA 3U79A 2VLMD 1F3RB 1GZPB 4G8FB 4MYWB 4ODXB 5GSVA 5JR1L 3K80A 3LCYA 3WNNA 1AGCB 5SX5H 5IUSA 3DUUA 1G9NH 4G6ML 1A7OH 5FM5M 3DROB 3H3PH 2YSSA 3BEVA 3IRZA 1MCSA 3STZA 4JFPB 4JFDE 4LU5L 3QUYC 1KB5A 4PV8B 2D9QB 3BH9B 3WFZA 5J12B 4WV1C 1RPQA 4HIHB 4Y1AE 2WQ8A 4HGWA 5D9SB 4OCSH 1FYHB 4WW1B 4P3DB 4YEFA 1JE6A 5D7JA 3PWNB 2GEEA 1U8LA 3RWDB 2DLFL 3B8SA 5BQ7A 4Z7VB 2MPAL 3U9PL 1IAMA 1A6ZA 5J1AB 5CEZL 1QLFB 1ZSDB 2PYEA 4R4FL 4YNYA 4ZO7A 4GRWH 2Z31D 3EO0B 5E8PB 4A6YB 1WCBA 4JRYB 2H26B 1C5BL 3S35L 1ZE3C 2GYSA 4I5BA 4OFIA 4BELD 4CN1A 2VQ1A 2GJ6D 1KJ2L 1HOCA 5TDNB 2ESVA 4POZC 4HJ0C 1T7XA 4YFLF 3S36L 3QB7C 1JGEA 1QFUL 5D7IA 1WAAF 2FSEB 1LK3H 4MAYA 1QR1B 1INDL 3NCCB 1Y18A 4GT7A 3I75A 1SBSL 1UA6L 3N50A 3PHQB 4YUEL 3O6MH 5CIPB 3PGCA 4Y5YB 2XZQL 4UU9B 3GK8H 3V52L 1YJDH 4WUKL 2WK2A 5F9JB 2VUYA 3RJDA 5GGRY 3QH3A 3RUGA 4M1GH 4D9RD 1U8HB 4WO4A 1F00I 1QBAA 3NPSB 1CLYH 3SKOB 1AR1D 4LLDA 5GS3A 1ZLSH 2Z91B 4ZODA 4NZTL 4O9HL 5L2KA 5GGUA 3CIQA 1ZOXA 4YBQD 3OKOB 3V5HB 3PG2A 4X4XB 1YQVH 1EK3A 1U8KA 1F45A 3TO2A 5SWZE 5DJ8A 3O4LE 3CD4A 4IIQC 3QULB 3O9WC 1DCLA 3FONB 2A6IA 5I76B 2HN7A 4KRPD 4RA0C 5T3XD 4N9GB 1Q0YH 1RU9L 1RAMA 4YHZH 4XAWL 3U46B 4MS8C 1ZLWK 4RNRB 1UKTA 3P30L 2DDQH 4OD3H 2QHLA 4MD0B 3RGVC 5J3HD 2CXGA 4WW2A 2ARJA 1F58L 4LSRH 4JZOA 1MRDH 4EUPH 1CFNB 1ZLUH 3WN5A 3AB0B 4N0FB 3E2HB 4DTGL 4HUWB 4NRYA 2V5RA 3NIGE 5IQ9A 3SBWA 1J1XH 2YD2A 4H88H 1TQCB 3PWJB 5E08H 4LSPL 5D5MB 1FZJA 3STBA 3FB6B 3SJVA 2ICCA 1ORSA 5HHQA 4KHTH 5T1DL 4AIZB 1FYTB 5B39A 1OAZL 1J88A 3SGKC 1NFIB 1OAQH 4WUUB 5CBEA 5C7XH 4PD4K 3HE7C 4Z7NF 4OLVH 3H42L 4NQTA 3U0TB 5EU5A 3T0XA 4PLOB 5E2UH 5EUKB 4PGDA 4L3EB 2X44D 5EPMA 3BSZH 3G5XA 4E41E 2Q86B 2VXSL 2R39A 2QEJA 1J0HA 1HILA 3ILPB 4PGEA 5J13C 4QHKJ 4MNGE 3QDMA 1RZFH 4HGMA 3ZT7A 2KBGA 2MKWA 2ADGA 4P4KA 5K59E 2D9CA 2UV3A 3O6LL 4WY7L 4JZNB 1KV3A 2GK0B 4RMWA 5E4EB 3DPBA 2O5ZL 3O6KL 1IGML 1F8TH 3SE3A 3VXUE 2NQCA 1X5FA 3IAPA 2RCSH 4JFED 4XZUA 4RGNB 1G7MA 3WFEH 3RL2B 2XG4A 3CCHA 3WYRA 1O0VA 4S1QL 1JF5A 4MXVF 1YYMH 5F96H 3RVXC 3ARTA 5KTEL 1JUFA 1ZGLP 3QUXD 5FYJE 1FHGA 4JY4A 3IKCA 4NHUA 4P46C 1FAKT 1MCNA 2CR3A 5CSBA 2ENSA 2VXTH 3OJMB 1AFVL 4ZS6C 4Y16A 3WIFB 1W0WA 4JM4H 5F6IB 3REVB 4F33B 1G1CA 3ILQC 2KDGA 4V1DA 1V7ML 1EBPA 1OAUL 1RMFH 5J1TC 4PJHF 1D5IH 3U9UB 4J3WA 1WITA 4PJ9C 4LIQH 2BOCA 3KLSA 1S9VB 2Z8SA 4PP1D 5ESVA 1T1WA 4M6OL 4S2SA 5KVFL 1KLGA 2NY0B 4XBPA 3DO7A 1ZA6A 3T0BA 1YMMD 2MCG1 2J4WL 3IU4L 4NQVA 4Z7UF 4Z7QE 3U0PA 2AGJH 4BH7A 2O93L 1KIPB 2LTQB 3SDDB 3ALPA 4P2QD 3AAZA 3G9VA 1GOFA 1PYWA 3QNYA 1BIIB 2Y36L 3UTSE 2QBWA 3VXTA 4Z95L 3V7MA 4FQLL 3QUYB 3E8UH 4JG1L 4P2OC 4ZUSA 4HK0A 1SEBA 3FCTA 3DVGA 1T7WA 3MNVA 2VDKH 4R0LC 3BE1L 5DO2D 3VRJA 5L88H 5E9DB 1E6JH 1A6UL 3BZ4A 5HHMB 2QL1A 3QJHA 1CFBA 3T3MF 2F54B 2ADIA 4XPTL 4PG9B 1FNAA 4APQD 3MPCA 2P5WA 4ZUUB 2AXJA 1EXUB 3HMXH 4L3CB 1IBGL 1AI1H 3BPOC 3HR5B 2G5BB 4H25B 1GGBL 3BT2L 1O7SA 3TVMA 3G6JF 3O0RL 4PJ8C 4JRWA 5DHVA 5IBUG 1W72A 4YDVA 3T77A 1D5BA 2QJDA 4UTAH 4WFGE 1NCBH 4PRPA 1DUZA 3MFFA 1S9XB 1PLGH 4NQDD 4JKMA 3BAEH 5IJVB 1Q9WA 4M8VA 2R56L 4PJCE 3HLAA 1ZTXL 4UIMB 2Q8AL 1MJUH 4JG0H 4K94L 3MO1B 3MBEC 3SKMB 3DX7A 3WXVL 5FKPB 5E70A 2NR6D 4DCQA 3RA7L 1QLEH 2LVEA 2PXYC 4JZJA 1G9EA 1A1NA 5SX5K 4ELKA 1D9KC 5MEPB 4GXVH 5DUML 1OGAE 2ICWB 4PGCA 1B0GB 1T66C 5D8JL 1LEIB 1MJ8H 4AH2A 1T03L 2X4NA 3T0EE 5E8DL 1OP3H 2QADD 4JLRB 1CL7L 2HVKA 4HQQH 2VDNH 3ZL4H 3WBDA 5E2VH 5TE4L 4TUOB 4OF3A 4TUKH 3B9DA 3BZEA 3MLYL 5I1IL 1CR9H 3ARGA 5I8OH 3SDYL 1BX2A 1BF2A 3O9WB 1PG7H 4GKSB 5CJ8A 4QNPF 4OZIE 3O6FC 4N0UE 1YDPB 5JQ6H 2NTSP 2DQDH 1I3RA 3VWKA 4M5ZH 5DVLA 1DFBH 5IBLC 1S7RB 5C3TA 4Z8FL 4NPYA 4MCYB 3STLA 1AKJA 1EDQA 4L5FL 3W39B 4QRQB 1BLNB 5LJYH 1TJIL 5IHZB 4HXAL 3QDAA 3BP6B 3ECBB 1P4IL 3TT3H 4Z5RB 3ULUL 5HGHB 1U93B 1M7DA 2NY4D 1LD9A 2H3NB 5F9WC 4FFVD 2DQGL 3MCG1 1QSED 2CLZA 5IK3B 3TBTA 1YYLH 1K8DA 2I9LA 4MJ2A 2ITDB 4NGHH 1NAMH 4XNUH 1VESA 4ZFFA 3W5NA 1X4ZA 3OBAA 3H9HA 3HPLB 4YXHL 5IEHA 1QYGH 3DVNA 3T8XB 1CLZL 2X09A 5FDWA 1HXMB 2YBRA 1R3LA 3MRHA 1XIWD 2WBKA 3QUMH 4OTXH 4F3FB 5CSZB 5EWIL 3CFJA 4B0MM 4OSUL 3BXNA 2FLBT 3DUSB 2X70A 5JW4Q 2FZ3A 4LVOC 4PRHD 5DJYB 5DYOB 1MH5B 4NDMB 5LG1A 2W65A 1JWMB 3D2UD 1WWAX 2XWBB 4U6HA 4NNXA 1MCQA 1JGDA 4HFWB 5E6ID 1FO0L 4DJMA 2XV6B 4XB7A 4YDKL 3KPSB 2Z4QA 3DMMD 1RHFA 1CD1B 1JN6B 1PKQB 5JPMB 5GRZA 2C26A 4OCYL 1Z5LA 3PV6B 1BWMA 1HHIB 1V05A 5DQDH 3CXDH 5CP7A 4LRIA 1ZLUK 3BVNB 3EOBB 4JN2B 2V5SA 4OLXH 3WCYA 3HE6C 4M7JL 5KS9E 4ODVH 4ONFH 3CPLB 5C0ND 4CMMB 2YPLD 5HHXL 3MV7A 2YD7A 2P8LA 2DQFB 3RJQB 1VEOA 3TN0A 2PW2A 1AIFB 3JWDL 3QI9D 4R2GB 1S9KC 4M6MH 1CGUA 1FORH 4NNPH 3SKJL 3HNSH 2CIIB 2ZUVA 4PJ9B 2E5EA 5BRZB 3GO1L 2DQEH 2XQBL 4O58L 1B4JL 4U49A 1DLFL 4TRPL 3E3QC 1AE6L 1YNKH 4F7PB 4OUUB 4X83A 1U8OA 4NUGL 4JFEA 3ROOB 2VO5A 4EKXA 1N6VA 3GFUA 1IC5L 1RZGA 4K3JL 5CZVH 4M7LL 5CHNA 4LLUA 5KSBB 4EVNA 2VDRH 3O11B 5HGAB 1JGVL 2OTWA 1KPUB 2EIZB 5KAQG 3MLUH 1UH3A 1DSFL 4P2OB 3SKUD 3ZHLA 2VLKE 3CDYA 4MZ2A 5DTFB 1L9NA 2R29H 5D2LF 4AENB 4FFYH 4JRYE 5SWQA 4CGTA 3EGSB 4OQTA 5GGRA 4XCNB 5EUOA 4JE4B 4OGXL 1P1ZA 4FQHB 2J6EL 2CXKA 3P0VL 3U4AA 2VXQH 1ZHKA 1MFBH 1IGFL 1FNGA 3GSQA 3JV0A 3QDGD 4P2RB 4XVTH 1NC4B 1VGEH 1FZMB 3V6FA 1G7IB 3D5OF 2XN9E 4DFHA 1F4HA 4G5ZL 4PJ8B 1T1ZA 4U6XB 3VFNA 4C57C 2A83B 3DRTA 3R0MA 4D9LH 2FX9L 4ZYKB 2D03H 1MRFH 3N1QC 3OJVC 1CLOL 2K7QA 4GAJL 4L4VD 3RY6A 2WANA 3PQYD 1S7VA 4XC3L 4XVJH 4YDLB 2NY2C 1QQDA 1TNMA 2A74A 3MBEB 5J6HA 1INEL 4GRWB 3QUKB 2AJZB 4ODSH 1IC7L 4XMLH 3UJJL 4KUZL 3P11L 2HKHL 1IEAB 5EBGA 4YXLH 5IHUH 3KR3H 4NO5A 3QNZB 2XY2A 1MPAL 1WBZB 1LO3H 1MIEL 2Z8RA 3DECA 1SYVA 2HT4D 1D6VL 5C9JA 1XF4B 3GGWB 4PJAF 3LQZA 4XCFH 4X6BB 4BKLB 5IJKA 1WBYB 2IPKA 3B9KB 4U3HA 3TT1L 4Z7WB 4AYFA 2J5LC 3L95B 2Q7NA 2JCCE 2D7PA 4ISVB 2W9DH 4OT1H 1U2HA 5E8OA 5D5ME 4K9EH 3O6FB 5F1NA 2B4CC 2OS7A 5JIKA 4LLVB 2GKIA 2DWEA 3HUJE 1ZT4A 1FYTE 1HEZB 1MREH 4WUUE 5DC4B 2GJZA 4RBPH 1N5YL 2HT2C 4FFZH 2OX5A 4K3EL 3HNTL 1AGBA 2EDQA 1U8NA 5DDHB 4MZ3A 1ND0B 3IU3B 3FJTA 3CK0L 4LP4A 5MHSE 5C08A 1X5YA 2EE2A 2H2PD 1T3FA 1S7WB 1FBIH 5F9WB 1CDBA 1P9MC 4GRLC 3KXFE 1FDLL 5H2BA 3W9EB 3ZLQC 1LK2A 4DOHB 1I1RA 4EUPB 2DKMA 3GBNH 4LHUG 2I60L 3EYSL 4HWBH 4RGNE 3K2UH 3RZCD 3ME0A 1QUNA 3ZKXB 3CSBA 1A4JA 4GFTB 4NCC2 1OP3K 1YY9D 3CSGA 3HZYA 3O4OC 1U58B 4TVSa 2CUIA 1N8ZB 1ZT7A 1EFQA 3RDTB 4YBLC 1FC1A 5F7EH 2UWEE 12E8L 4K7PH 3V5DB 3ZDYE 1X4XA 2WBJD 2HKFH 1I7RA 5E2TH 5HHOA 4KZEH 5TF1L 1NDMA 2CIKB 4P23C 1HI6B 1X6NA 4H0GA 2GTWA 1J8HD 3A6BH 4H20L 2VDQL 4G7VL 3GUTA 1NPUA 4YDJA 4RAUA 3O2VH 1IT9H 4NKOA 3BIKA 1NFDF 3KPOB 1EA9C 3S5LB 1QSEA 2J8UE 4E42B 4M4PA 2E6QA 4JQXA 1JPTH 3HE6B 5MI0C 5TQ2H 1X4YA 5HVHC 1Z2KA 4LARL 5T3XH 2IBZX 2X10A 4EOWH 5B3JE 4YQXL 5C0EA 4M6NL 3X13A 1JPSL 2BSRA 3O3DB 4ORZC 5ABDE 1AR2A 2J8HA 4OLEA 5JW3L 4RQQB 1XCQB 3HC4H 2VDML 3QHTC 3FL7A 3VXUD 4MXWH 1U8MB 2IBBA 1S7TB 5HDQH 32C2B 3LD8C 3W0WB 4KK5C 1WZMA 2VZ3A 4KAQH 5FYJL 5FA4B 5ID1A 4YFLI 4JDZB 2IALB 3RWJB 5HHME 5I8EA 3WLBA 4G9FB 2F54E 3IFPA 4NP4H 5FYLE 1KEGH 4NQEA 5EA0H 1FL5A 1QRND 2EZ0D 5IVZA 8CGTA 1CG9A 4KJPC 1S9WB 3MLVH 3MBXH 2P4AB 5GRWA 1FV1A 3VXNA 2AV7A 5ISZD 4H8WH 4L8CB 2X4OA 2YUXA 5JNYA 5MENE 2BRRH 4Z9KB 2E6PA 3T65B 3F12B 1VADB 2DTSA 2RBLA 3M1BA 2ZCKH 4N90E 1RUML 2NY6D 4TSBH 3QEGH 1I8IB 2C4XA 2X1QA 4DZ8B 1FN4B 3WXWH 2HTLC 5EZIL 1JK8B 1IAOB 1JTTA 1TLKA 4KJYB 5DD5H 5IB2B 2JB6B 1T1YB 2NX5B 4R7DA 1TETL 3CSYB 5FA3A 4QXGH 4HZLA 3ULVD 3NIGF 5K93A 1A47A 5DK2B 5T1LD 2NZ9D 2FR4B 4I2XE 1HE7A 3MGOB 2ITCB 4N8VA 5D1ZA 4OM0H 4PGJA 1ZHLB 2K7PA 2K9UA 4QOKD 1LE5B 1Q72H 1S7UA 5HYIA 3CMOL 3H8NA 4FZ8L 2C1PB 3TPUB 2ZUYA 4JVUA 2FB4H 3BMWA 1KXVC 5C07B 2VXUH 3RPIA 5GJSL 3UZVB 2P24B 5INDA 3VXOA 2NY2B 3TV3H 3QXDA 5I1KH 1KTDA 4WJ5A 4R7NA 1NBZB 1L7IL 3CLFH 4HCRL 5C0AB 4KMTL 3LPGA 3ZKMC 3U7YH 2EYTB 5K59F 1V7NL 3MC0A 1BZ9A 2OMBA 1LO2L 4NWUL 4NYLA 4XVSH 3GJEB 4GKZA 3FB8B 2DLTA 2H6PA 1FFRA 2AEQL 4N0CC 2PCPB 4PJBA 3TH3T 2X4QA 3VDBA 4Y7MA 2ZKHL 3VXRB 3C6SB 4OCNC 1JZ8A 4MA7L 1X44A 1F3DH 4PRIB 5MERA 5L8KB 3VFUA 2IGFH 2CH8A 3KWWA 4P9HL 4OJFH 3EOTH 3F6LA 5DJ2B 2G75B 2XKSA 2EICA 3R8QA 3D3VD 4EN3D 4U05A 2OSLB 2PO6B 1UM6L 1U36A 1I1FB 2P43B 2WINB 3DO7B 4LEOA 5EBLB 1ORQB 2JJSA 3H9SE 3B4NA 1HH6A 2DLHA 4L4TD 4NKDB 1RQ5A 4FP8H 3TO4D 3MMEA 1D5ZA 4K9EC 2VKXA 2V7HB 5B4MD 4JCMA 1KYOK 4JPVL 1GZQB 5EIQA 4Z7QF 4XP5L 5JXED 2NY3B 4WNQB 3S4SA 1NMBH 2A6DB 2NYYD 3KPMB 1MVFA 4GRLB 4JM2A 3QWOA 5K9QG 4KROC 2VH5H 2GW5A 3TA3B 5HDOA 3IDXH 5T1KA 4Y4FA 3KPSE 1OAXL 2OP4L 1OOAA 1U3HA 3ZE1E 1JHKH 1A4KA 1JPGA 1PKQE 1QBLH 2A6JB 4BFGA 4YH6A 3OXRA 5CP3A 1KUMA 4YX2H 3OX8A 3O4OB 4FG6C 3FT2B 1R24B 1MRCH 1T0NA 1A6AB 4S1SH 1NAMB 2CSPA 1M1SA 2GT9A 4M1CD 4IRJB 3ZSTA 1P4LB 3EOYG 1KT2B 1NMAH 4UBDC 2EYRA 2F19L 2QHRH 2I25N 4YE4H 1T21A 4PJFA 3MV9A 1MFDL 3WEXA 4M61B 3ZT5A 4M3KB 4PRDA 4OIIH 1OTUC 1KPVB 1NC2B 4GMTH 3QUMB 4OM1L 3F8UB 3MJ8B 1BFVH 4Q9RH 1VFBA 4RRPA 3L5WA 3HNVL 3VXPB 3MV8D 2ADJB 3IF1A 1JZ6A 5BRZE 1F4YH 1RZKL 4U1LB 5HYQB 1H3XA 3QRFM 4M9OA 1FC2D 3MLZL 4W70A 1S7QA 3PABA 1AHWC 4H1LA 1XF2A 3VMPA 2A9NL 3E6FB 3BUYA 4HIIB 5BVJB 2UZYB 4U2YA 5GQBA 2ZUXA 4QGYA 5JXAL 4FQXD 1J9CT 3OKDB 1WFNA 4KPHL 5F97E 4IDJH 2CK0H 3CAFA 5HVFB 4CU6A 5I19L 5EO9A 3V8CA 4WFHD 1BFOB 4YBQC 2DQJH 1BD2B 1QSFB 2NXYB 5DFVD 1UG9A 2B1AH 3THMH 1XT5A 2L7UA 5JIIA 3B9VA 2WBJA 4MJ6B 1NQBA 3LD8B 3RIAK 3KYKH 5E95B 2YS4A 3X11A 2QKIA 3MRPB 3SY0B 5DK0A 5I30H 4XXDB 3QQ4A 4KQ3L 3PWUA 1I3GL 4CDHA 5IFHL 4LLYA 1WBXB 6FABH 1MLCA 3IYLW 3I6GA 2YN3A 2ZCLH 2P7TA 3MGTB 2FDBP 1ZMYA 4WI5A 2EO1A 4J7RA 4GBXB 1ZHBA 3DTXA 3VGDA 1DBKH 4NN6C 2DBJA 1KJ2A 4WHTA 4OZIF 1KCSH 3FO2B 4XCYB 3WDJA 2RQ8A 1C5DA 3L3IA 2NNAA 4LSSL 2RFXA 4XCEB 1OAYH 3NTCL 3S9DB 1NDGB 4M48L 3RI5F 1X5GA 1JNLL 2W0LA 4NUJA 1EEYA 2HG5A 4HT1L 3T0VA 4TNWK 4RX4D 3QCUH 3NMEA 4NBXB 2BX5A 1CE6B 4F8TA 1H8NA 1UJTA 4FQIH 5TH2B 3GHBH 4X80H 4GRWE 1TCRB 1RUPL 1AO7D 4WHCA 3C5ZD 3EJZC 5JO5A 5DD0H 3G04A 5MP6H 1F11A 3QR2A 4XMKL 4YDIH 5DJCB 4XAKD 5EFIB 4LPCA 4ZTPL 4QXUL 3REWA 4KVCL 2J88H 4S1DD 4A6YL 4U1GC 4QRPA 1PG7X 3K81A 2DLIA 2AJYL 5AZ2H 4PJHA 3OKEB 4L1DA 4RAHA 2BNRD 3SN6N 2VN7A 3C60A 5TQ0H 4Z7WE 2YUVA 3HG1D 5ISZA 4NWTH 2MCPL 1BQLH 5KSVB 3BD5A 4NC1E 1AXIB 3Q0HA 15C8L 4NOBA 5GS1A 4Q0XH 4HWNA 4QYOA 2CDEA 1J05B 3LS4H 5FUZH 3O45B 3SQOH 2D7NA 3QCTL 2BMKA 5AAMA 3B2UC 4G6FD 3GB7B 1CQKA 3FN0L 2BSSB 3U2SB 2FIRT 1MLBA 1MNUL 3MROB 2BNQE 2R1XB 3QFJB 5BZDB 4QGTA 1LO0H 4XWGH 5F7YC 3WS3B 4OLYH 4I13B 1BZ7A 2YA2A 3HC0B 4M8QB 4K2UL 3L3JB 5C0RL 1T80A 1C7TA 1J0IA 3RWGA 1J0ZA 1ADQH 4QOKA 5FKAB 3K1DA 4D9QE 1QSZA 4PP1C 5KS9F 5ICZB 4RMRA 3IXTA 3DYPA 4E0RA 4HBCH 4ELME 3FOLB 1DVFB 1HH9B 1OVZA 1KGCE 1CCZA 3MRJB 3VFMB 2V2XA 4UV7H 1ACYH 2VDOL 3WJJC 3BP4B 3G6JA 4LSTH 3OKNB 3ALWA 3MNWB 3DX9B 1N26A 1MWAH 4JFXA 4KRLB 1VACA 2X05A 1KCRL 2DLEA 1QPXA 3RAJH 4UT9L 3ARBD 1MEXH 4HXBH 4X0KB 4WWKD 4Z0XA 2ILLA 2D7QA 5DRXB 1S5IL 5DJZB 5ITFA 4U6YA 4RFEB 2BY2A 1FZOA 4KROB 2ZUSA 5B22A 3NFSL 1XGRA 4O2CA 2A0LC 5KSAD 2GAZA 2Q1EA 3G6AB 3P77B 4KRMB 2N7AA 5I1LA 4HH8A 3BGMA 4PJEA 2G2RB 4APQC 2HJLA 4I3SH 5ICYA 4JFFE 4NCDA 5GGTA 1XR8B 2BP3A 4Y8DC 2QQLL 1CZ8H 2VLJB 3OWEA 4KU1A 4WCYL 2QQNH 1DL7H 5IQ7H 1A9BB 2JIXD 3QRGL 4WU7A 2AK4B 1ITCA 2Z31B 1C08B 2YR3A 4PTTB 4YHNB 3VJ6B 4IS6A 2OL3L 2R2EA 2VQUA 4OCWH 1ZLVH 2I5YL 1FVEA 1KPRA 5LBSH 3WFHB 1FFNA 1H3GA 3MRLB 2R8SL 2P46B 1OGTA 3TZVD 5B39G 3P9LB 3H7LA 2VAAA 3WIHA 5SWSA 4FQ2H 2I9TB 1BBJA 5JHDD 1Z0MA 2AXFB 1CK0H 4DKEH 3HZMA 3LN9A 5TE7H 4W68A 3MLRH 1FVDA 4G9FE 5EU7C 3FRPA 3WDIA 3O3UN 5IFJA 4I0PD 2H1PL 4LIQE 1WJ3A 5ID0B 4HZAA 3BN3B 4DWHA 5DRWB 1F3JB 3OAUL 4M62L 4UQ2B 3RWCB 3CFBB 1CBVL 1J10A 1ZK9A 3FFDB 1EGJL 2XQYG 3QEQA 4KRPB 3SDXA 2B5IC 3LKQA 4NC0B 3UBXB 1JCKA 2A6KA 4JY6B 4I3GA 1YUHB 2GITA 3OXSA 3NFNB 4ZAKD 5BVPH 5F9AC 5JLZA 4C59B 1HKLH 4MVBC 4HDIB 2NLJB 1YEHH 3S98A 3VD5A 4X98A 2W60B 4TTDD 3UYRL 4TOYH 2JCCF 4RWYH 1P7KB 4IM8A 5B3NA 4AL8H 4O4YH 2Q7YB 5E56A 4GRMA 3HUJF 5GS2D 1R3IH 4QF1A 3O8XC 3QO0A 3F5WA 5C70A 4PJDF 1E28B 5GZOD 1IGTB 1MQKL 1U6AH 5T33H 4EXPX 1I1AC 3M8OH 5C07E 4OLZL 1YEFH 3OKMB 4EIZC 1JNNH 1KELL 1G84A 4RDQG 4Y4KD 5FYLL 5KSUB 2G9HA 2HVJA 3DRQA 3ARZA 3DGGA 1T04B 1CS6A 3UDWC 2NCMA 5LAXA 5C0AE 2FWOB 3MCLL 5DVMA 2A2QT 2BVOA 2ZNXA 3P9MB 2BC4A 2C7UA 4EDXB 4GXUN 4U1GB 4U1JB 4O2EB 1KSRA 3IVKA 1YNTA 5CJQH 1V3LA 4UV4L 3BW9B 3WO4C 5E6IC 4U1HA 3SE4A 3PWLB 3C9NA 4JPWH 3X12B 4LAJH 3G5YA 1FNLA 3LQAH 5D1QC 3IDIA 1XGQA 2UWEF 1P2CB 3ZDYF 1AY1H 1DQDL 4DW2L 3IFNH 1I1YB 1FRGH 1T5WA 1W2KT 5KVEH 1NUNB 3VFWB 3QUXB 3TIDB 2X42A 2XTJD 4BYHA 5F88B 4HKBA 4P3WA 1A2YB 1FGNL 1PSKL 3MYJB 3DV6A 5HYEA 3KDMA 4J4PC 4P9MH 2HH0L 3AS0A 5E4IA 4WEUD 4OZGA 2BCKA 3PWVA 3AMKA 3UCRA 2J8UF 4HHAB 1LDPL 4Q97A 5HHVH 2VLLB 1D5MB 1X5IA 1N0XL 2ZSWA 4ZUVB 1MCHA 3HFMH 5SX4H 1YMMB 4K7PX 5B3JF 4GG8B 5HBBA 1CGWA 1NBVH 5E7BA 3BP7B 4OZFA 3U4BL 2F8VA 5HDBE 3FKUS 3AREA 5FYKD 2CO7B 1A6TA 2XOTA 4KHXH 2VLRA 2QQKL 3LKNA 3OHXA 4PV9A 2X4RB 4J3SA 4PS4H 3EYFB 3SDAA 3PV7A 3ZE2E 4P2QB 1FO0A 2DQTL 4JREB 2W0PA 4H0HB 1WUNT 5I1DA 1QO3A 3ULVH 4HJJL 4UINL 2ORBL 2IAMD 1HSBB 4LCCA 1XGPA 1T83A 4PRNA 5DRNA 1JHTB 3SO5A 1L6ZA 2CKBA 3OB0K 2ERJC 4OUOA 4X99B 3VXMA 3Q6FB 2HFTA 2A73A 1CXHA 3R0NA 3OL2A 1QTYT 4APQB 1DEDA 4NO0D 5KVDH 1BF8A 3AU1A 3V6OA 1CICD 3LKPA 2ATKB 4XTRD 1J11A 2VISB 2BSTB 1ZWIA 5DS8B 3WUZA 3EO1B 3C5SB 4OZHE 4M4RA 4BZ2L 1N6UA 3L5XH 4QLRA 2P44B 1MF2L 4DEPC 1UVQB 3CDCA 2VXVL 1RHHB 5FYJU 1G9MC 4HV8A 2FJGB 5JDSA 3VWJA 3I02B 4I18C 4NQDB 4ZFOL 3U7AA 3O2WH 3QEUB 4XXCA 5IESH 4PFEA 3CFIC 3MUZ1 1BD2E 1ETZA 1QSFE 3QIWA 4LCUB 5D7KE 5JOPD 1YEKL 2HRLA 1DQML 2D4FA 2E7BA 3X3GH 4RZCB 4YO0B 5DWUH 2XKNB 1MHHB 2PTTB 3RWHB 1T7ZA 4OCXH 3HN3A 4OCRL 3ARRA 4OV6F 3TJEL 4Z76B 4GO6B 2NW2B 5GRYA 3OPZH 2P48B 4JJ5B 2HMID 3QDME 3DI3B 5H35A 2B1HL 1UZ8A 3CDGA 3RTQA 3D18B 2AV1B 5FUCE 4LCWD 1BJ1J 3ARQA 5BS0A 4K3HA 3UTZA 5ADPH 2QADB 3BZDA 5I16B 1OTTC 1PX4A 1Z0NA 5F3HA 4N8CL 4HUUB 5D72H 5KVGH 3ARPA 3ARFA 2J6EA 4FN0A 5JW4M 3BYTA 1V3KA 4P57A 4HPYL 1S8DA 3VFSA 3S97C 3QDHA 1J1OH 1JFQH 43CAA 1KCLA 2EKJA 2B5IB 3VG0H 2WWMD 2Y7QA 3FAWA 4P3CH 5H37G 1MHEB 2XXCB 1Q1JH 5GISH 1OP5H 5FGBA 4ALAH 4LPTA 3LMJH 5E5MA 3GI9H 4Y1AA 5ILTH 3R4DA 1HHJA 4O51B 4QRUA 4GW5A 4X5XA 3EDFA 3OQ3B 3ZKNC 3MCKB 3L3OA 1OW0A 1OF2B 1JZ3A 5JHDA 4HWZB 1KJ3H 4WENB 4V1DE 1Y6MR 2H2PC 3V4UH 3QIBC 5DA0B 5F1IA 3MRFA 3O8XB 3CZFA 3HAEA 5DD6B 2NY4B 2YPKB 4JCLA 4PYHA 1OB1B 4K3DH 1G9NL 1LE9B 4HK3N 3BIBX 5INCB 2O5XH 1DDHB 2H41A 4CVWA 3RZCC 4TSAH 5F7DB 3WSQH 1MHCA 3W9DB 5DMGD 3L3KB 4YAQB 1SEQH 3TBWB 1XIWB 2VDLH 1U92B 3NABH 3D25B 2XFXB 1IEBA 1A9EA 4HWUA 5I15H 2PUQT 5DJ6B 3CFKB 4PRHB 1YA5A 3WFBH 1F2QA 1IKNA 1PQZA 5IP4A 3QSKB 4Y89A 1IZJA 3D2UB 3VCLB 3ZE1F 2Z9TA 5E6IB 5DI8A 5BOPA 3QFJE 3DMMB 4F9PC 1YPZA 3HRZA 3ARSA 3IDMB 2VKWA 4JY5H 4NZUH 3IETB 3BKJH 5IMMA 1TZHB 1M05B 3VFPA 1MFCL 3RX7A 4HUXA 1KLUA 5FGCB 1ZVSB 4FABL 4N5ED 5SWZA 3O4LA 1H5BA 4XHJD 4D0DA 4QWWD 2X4SB 1QFWH 1LP9F 4GOSA 1LK3L 2ZZUT 4YHYB 2YPLB 3TNNA 1X5XA 3JBG7 5CILH 3VH8A 3MRNA 3LQAC 3O6ML 5ELIA 1UEMA 4IMKA 3FO9A 5F7NC 3GRWA 1QD0A 3QI9B 3GK8L 1YJDL 4UDUB 2ZUWA 4OFYD 4EI5D 1BOYA 3V4PH 4F8QA 1R3JA 4LHJB 4M1GL 3GMMB 4TUJA 1KIRB 1QBMH 4HD9A 1EFXB 4R96A 3TLRA 1ZLSL 3FHAA 3VMNA 5DHYB 2IG2H 3MRMA 5GS0D 1YQVL 3KYAA 4X6DB 5IOPA 2MFNA 4JHWH 5AZEL 5I2IB 2P8PB 2EZ0C 2GSGA 3HC3H 3QAZB 4P59H 1UZ6E 1B0WA 3L7FB 3QIUA 3S3PA 2JK5A 2W9EH 3WHXB 4J1UA 1F6AA 1Q0YL 1JYVA 4W4OC 1W0YT 4YFEA 1RJLA 1UJ3A 3MRCA 4YHZL 4HKZA 5DMYA 4Z18A 2ZNWA 5TFSL 25C8H 4E41A 3VRIA 2HAZA 1PJ9A 5FECB 1OSZA 3B6SA 4ONHB 1N4XH 4LSRL 1MRDL 2ZSVB 1MWAB 1PKOA 3JV6B 4MNGA 3T4AB 1RIUH 2GJ6E 3QJFB 4W6YB 3NACH 3FQWB 1J1XL 4F15B 3ULSA 4H88L 3QDGB 3GSNL 5E08L 5DUBA 1ZANH 3QEHA 4IRSA 4X8JB 3VXUA 2L0DA 4JO4H 3CXHK 4KHTL 4YPJA 4YHML 1NUGA 3ES6A 1P4BH 2OTUB 4Y2DD 5C7XL 1WVZA 1LEKA 4OLVL 5AYUH 2JTDA 4D9RE 5E2UL 3CVHA 3A67H 4I18B 5AG9A 3BPCA 3LQMA 2W07A 3BSZL 5D7JC 1T20B 4CNIB 4UTBL 3U83A 4GRWF 4LASH 1H8OA 4L4VB 1J0JA 2VITB 3PQYB 3FZUD 4Q6YA 3PGFH 1IGJB 1B6DA 1RZFL 2FLRT 1K8IA 3G5ZA 4NKIL 2DQIL 2BOBA 1R3HB 3RKDC 4MGXA 5EO0B 1FFOB 1FZKB 3PF2A 4U3CA 1HIMH 3PWPB 2WWKO 1CD9B 1CFSA 1UXWA 4Y88A 1F8TL 5EN2A 1VFUA 2RCSL 3GBLA 2Y5TA 3WFEL 5IG7A 2YC1B 2Z93A 1AD0A 4J3XA 1NLBL 1G7LA 2F53B 3GIVB 5DQ9A 4QRRB 5ESAA 2OXGA 1CICA 1YYML 5F96L 4P5TD 4MAYC 2VJXA 1E4XL 1Q38A 3DVFA 4F7TA 4JFQB 4P2YA 4KK8D 4RFOH 5LCVH 3CGTA 4FXKA 2VXTL 3W5MA 1HHHB 3V0WH 4JM4L 5CD3A 2RHEA 5CCKH 3PXJA 4I48A 2OR8A 2V6HA 4WO4C 1W8NA 3MRKB 4U1NA 1RMFL 3HI1B 5L2JB 1D5IL 3QCVL 3MV7E 4BSWA 1EX0A 1JNHA 3O3AB 5TGBB 4LIQL 5CLTA 4BH8A 1IAKB 3MR9B 3DOSA 3BN9D 1RULH 4NO3A 4FA8A 4MX7B 3ALXA 5EU6B 4ELMF 5B4MC 3QQ9D 2C3GA 5I8KH 5FCSH 3NIFE 4QHNB 5D96C 5CEZD 1I8KB 2DL9A 4XP1H 2DJUA 5EG6C 2AABH 2QR0A 5J11B 4PRBA 3BKYL 4MCZA 4UDTA 4F7MB 4JFEE 1VGKB 4MXQD 5DMJB 4KKBC 2XWTB 4PY8J 1U95A 3RZCB 3SCMA 2VABA 4QKXB 5GRXG 1SJHB 3KS0J 5C0BB 1KJMB 1XF5A 3D87B 1X7QA 4X6CA 4RGOH 1XR9B 2VDKL 3WN5C 4PJCA 3C5JB 5KVMC 3LSOA 3SBWC 4G8EB 2MSPA 2BSED 3KYMB 3GJFH 1E6JL 5I75C 2R0KH 1OHQA 1TJHL 1TZGH 2EKSA 5I1AB 4XHQA 4X9IA 1YY8B 1TMCB 4X7TB 1T0PB 1J8HB 3NA4A 5FO9A 1I4FA 5EUOE 3VD9A 1AI1L 5T1MA 3H9ZA 2CGRL 3GMOA 2JJTA 1T0MB 1NCNA 3OR6B 3UTQA 4BM7A 3WIIH 5ACLA 3BFOA 5C8JB 3T0EA 3FO0H 1PZUB 1W0VB 4BQCA 1KJVB 4N1CA 1DEEA 1NCBL 1S3KL 3RNQA 1WIPA 1KEMH 2VZOA 4R90H 1MI5B 1PLGL 2CJUL 3BAEL 3QXVA 4ODUA 1M71A 4TNVF 4JQIH 4AT6A 1YMME 2PW1A 4P4KC 1T1XA 1MJUL 3DV4A 4HUNB 3QUZD 4JG0L 3P4NA 4ZNCD 4N0UA 1RK0A 1UWGH 4KXZI 1QLEL 1R3KB 4N8VG 3SE3C 3PL6D 5IMOA 2F74B 4D0BB 1TJGH 1IVLA 1FPTH 3EHBC 5DR5L 2V7NB 4NJAH 2ZPKH 1HHKB 3FHQA 2JELL 4ETQA 3GSOB 4D0CA 1RZJC 2IANA 4UUJB 5J9PA 5GS2H 3T0AA 4JAMB 4HQQL 2VDNL 3ZL4L 3B5GA 5E1AA 4TUKL 2LFGA 3VRLE 1CR9L 2BFVH 4Y16C 1U8JA 5I8OL 4WDIB 1QRNB 3T4YA 2HFGH 1GOGA 3AS2A 4IMLA 1PG7L 3WO3B 4N0YH 1BOGA 3PNWA 5HYSB 4F7CB 1CGSH 4R4BB 1F6FB 2HFFB 2VERN 4OFDA 5JQ6L 5KN5A 3PXHA 3NZ8B 2DQDL 4M5ZL 5E8EB 4KKLC 1CLCA 1DFBL 5IIEA 1RK1A 2XQYK 2AKRA 5CJXA 2XYCA 3JVGC 2NY6B 3MV01 2R0LH 4FXGB 2WIIB 4NQDE 5BV7C 1IC1A 4YC2C 3QWRA 4WU5A 3EUUA 5LGJB 1QR4A 4KK6C 3BQUA 4I1NB 1YMHB 3VA2C 1DE4A 1B88A 4FQQB 5DSCB 1SY6A 2YSSB 3BEVB 5T1LB 5F7KC 4TULH 3ZTNH 2ICEA 1X5ZA 3EYOA 1YYLL 1KB5B 5DUPH 3TBVB 4XNUL 1I9IL 1YECH 1C16A 4KFZC 3BWAA 1ZGLA 4OFVA 4PJGB 1QYGL 3U30C 5DEGA 5EB9A 4GG6B 3D85A 3DXAD 1OSPL 4ONGH 1Y0LA 1YC8A 2D7MA 1I9RH 4H5SB 1GZPA 3QUML 4G8FA 4ODXA 5H8DA 3S8WA 4L8BB 3S4SG 1AGCA 3DSFL 3H3BC 1NGXB 4YJZL 1ZKAA 4UIKH 4POZD 1KCVL 2VB5A 1JL8A 3DROA 1EMTH 3TVMC 4PJ7B 4YNYB 1C5CH 3GIZH 3RHWK 4JFPA 1EO8H 4AG4H 4PV8A 3FT4B 3BH9A 2APTA 3AM8A 2R2BB 2P5ED 3TNMB 2FECI 4HIHA 3HPJB 3NGBB 2CRYA 1HOCB 5D9SA 1S7SB 3QDJD 2CDGB 4WW1A 4P3DA 5FAAA 1BM3H 5DQDL 3MOBH 3BX7C 3PWNA 5FYKH 1HQRB 1P7QD 4HIJA 4OLXL 3RWDA 3K4ZA 4ONFL 2NY5H 4Z7VA 1KF9B 4U7MA 5IB1B 1Y6KR 3IDJB 5J1AA 1AGEB 1QLFA 1ZSDA 1QSEE 2DQHL 1ZS8B 4CU7A 3D3VB 4EN3B 3RQ3A 1YEJH 2VLKA 3QH3B 2DN7A 3RUGB 1R5VB 4RRPG 5E8PA 1BEYH 2NXZC 4A6YA 4JRYA 4M6ML 1FORL 2WNGA 4GS7C 3ZHDA 4NNPL 4K71C 2V5MA 5D7IF 2DQUL 1DQTA 5L2KB 3K4AA 4L4TB 5TDNA 2DQEL 4H1LG 4P4RB 4MS8D 3TO4B 4IJ3C 5FXCH 4WWKC 2FSEA 3NIDF 3TESA 3ARGC 2E3VA 2E7MA 3RGVD 1YNKL 4J12A 4LEXH 5DMIH 1PAMA 4WTWA 4TSCH 3EDDA 3PHQA 4OCMC 4PRHE 3L1OH 5EC1B 4Y5YA 5CZVL 5HDBF 2AERT 2VDRL 5F9JA 3VWKC 4LVNC 1EPFA 4KQ4H 2YPVH 4BZ1H 1UFUA 1FNSH 4X7DC 3ZE2F 3M17B 1U8HA 4OB5H 3OZ9H 3SKOA 4NQEE 3S96B 3BHBA 3GBML 5ICXA 2R29L 1Q94B 2Z91A 1E4KC 4FFYL 1H3WM 1RURH 3HE7D 3OKOA 3V5HA 5J06A 4X4XA 1G6RL 2D7OA 2QSTA 4ODBD 2JF1A 1A7PH 3U82B 1MJJB 3QULA 1Q0XH 1ORSB 3FONA 4R9HA 5I76A 1MFBL 2YPLE 2BJMH 5E7FA 4Q6IC 4N9GA 4LRNH 2Y07H 5HYFA 1GVIA 1A1OB 4WW2F 4RNRA 3EIFA 4QHKI 5TDOB 1JPFB 1GPOH 1RUAH 1IGIH 4MD0A 1BWWA 2PTUA 4OZHF 4XBEH 3LH2L 2AJUL 3MV8B 1MHPL 1CFNA 1I8MA 2W38A 4PGEB 5KW9L 3CX5J 1Z9LA 4N0FA 1GGIH 4HUWA 1NMCC 2D03L 2DM3A 3GMRB 4P4KB 3PWJA 4XVJL 5D5MA 2CUHA 2CDFB 1JYXA 4FQXB 3RVXD 3ESUF 5JIPA 1Z9OA 3FB6A 3HUJA 4AIZA 3NCJH 1FYTA 4ODSL 5AD0B 5D7LD 3UPAA 4UQ3B 4WUUA 2IH1B 4XMLL 3ZKQD 5J4MA 3KLHD 2IF7A 4YXLL 4P46D 3T2NL 5IHUL 2FYYB 1RUKH 5EUKA 2LVCA 2AJVH 4L3EA 4ZS6D 3KR3L 5GRUH 3JSSA 3NN8B 5IVNA 1VEPA 1LO3L 2Q86A 3QPXH 3ILQD 4LRIC 3ILPA 3AXLB 4XCFL 3UTOA 5IWLC 3S88L 4PJ9D 3FMGH 2E7LA 1MIML 4JZNA 1AGFB 2W9DL 4OT1L 1BJ1H 2OL3A 4PJBE 2W59A 4DVBB 2SEBB 1B0RB 1K3ZA 1MREL 3GSXB 5HGBB 3RL2A 1UACL 3C6LD 2BOCB 2XNAB 1JV5B 1DBAH 4FFZL 4KI5E 3RWIB 3AY4A 3AMLA 4HG4J 4YC2B 3UAJD 4P2OD 5JOEA 3OF6A 1JZ7A 4L4VE 3PQYE 1JRHI 2BVUA 2WLYA 3V4VH 4GSDL 1UCBL 5DLMH 1RZ7H 3WIFA 1AO7B 3C5ZB 2KPNA 1PYWB 3QNYB 3REVA 4RDQF 4F33A 4GMSH 4U6VH 1L0YA 4H26B 1NGZB 2DI8A 3BGAA 1N59B 3U9UA 4P2RD 3N9GL 2FX8H 4PJIB 4HWBL 1S9VA 4YR6B 3K2UL 2PKDA 1N7MH 3MA9H 3MUGB 1EGJA 3U30B 5A2IH 4J6RL 4ZTOH 2FGZA 1J5OL 3LPWA 2X1OA 3HG1B 2LV4A 4WHDA 3AROA 1F4XL 5L0QC 1ES0B 1KIPA 2M8XA 3GZKA 1CIUA 4K7PL 3KG5A 3SDDA 2EDXA 2HKFL 1NCWH 1X3DA 2X6MA 4ZFGL 1BIIA 1U8IB 3A6BL 1ZXQA 1KNOA 3MBED 3QUYA 1H15B 3BKMH 4G6FB 3UTPD 4HJGA 1I7UB 1WTLA 4XP4H 5MEQB 4F37K 1H3TA 2PXYD 4OIAA 5FF6B 3NA9H 1D9KD 4TPRH 2ZUTA 3FQXB 3O2VL 5I8CA 4MMXC 1IT9L 5E9DA 1QPPA 4PJFE 3MV9E 3RY6C 1T66D 5GS0H 1P5UA 4OD2B 1NLDL 2F54A 1OAKH 4PJXB 3TCLB 4PG9A 4MAUH 5KOMC 4PLKC 1A1NB 4U1SB 5TQ2L 2MMXA 2IFFH 2OR7A 3S37X 3HR5A 4WFED 2G5BA 2AW2A 1XH3A 4H25A 4HIEB 4DZBB 1KG0A 3VE0B 4YHLL 3P9WB 5BMFH 4F57L 4PR5B 3TC9A 4BK5A 2CRZA 4U1KB 1S9XA 4MXWL 5IJVA 5GRJH 5IJKC 4JO3H 5HDQL 5CGYC 3RIFK 4U33A 3EDJA 5IBLD 5F21B 3MODH 4IJ3B 3BZEB 4UIMA 3H0TB 4WWKB 4KAQL 1IAIL 3EYVB 3MO1A 3FRPG 1BX2B 3MJ6A 3PDOB 5SV4A 4C56D 5E00B 5IVXE 4NP4L 1I9JH 1KEGL 5EA0L 4PGZA 7FABH 5MEPA 4MNHB 3VWKB 2ICWA 3BYYA 2HT3C 1J8HE 3MBXL 2G60H 1KBGH 1B0GA 4HEME 2HYMA 4H8WL 1LEIA 5B8CB 2BRRL 5TE6L 2ZCKL 4PUBH 5EOCH 4JLRA 1WC7B 1BBDH 4TSBL 3QEGL 1I7TB 7CGTA 1BP3B 2JIXB 4QT5B 3WXWL 3O9WA 4GKSA 5DD5L 2CLZB 3LIZH 3TBTB 4Q6IB 4QXGL 1YDPA 1T7VA 2AXGA 3NFPB 1JNJA 3WLWC 2FBJH 2MWCA 5CIPH 3MRGB 1S7RA 5D2NB 3WUWB 1CDHA 4OM0L 1MCEA 3GJFB 4DKFL 3CH1B 3TZVB 4MCYA 1G7HB 5K9OB 5EBMB 1Q72L 2DTML 3W39A 2EXWC 5JR1H 2EDJA 4QRQA 5ESQB 1BLNA 1QNZH 5IHZA 2FB4L 4WTZA 2Q8BL 3BP6A 3ECBA 2VXUL 4R97C 2HMIC 1WWBX 2R0ZH 4G6MH 5HGHA 1U93A 2W65B 2H3NA 2FEEL 5I1KL 5ANMB 3KYOB 1JGDB 4LU5H 4JFZH 1QRNE 5ACZB 3T2PA 4I0PB 2ITDA 3U7YL 1QLRB 4D3CL 4OBSA 4IOIB 3HPLA 4MJID 5ISZE 1Z5LB 5FO7B 5CFHA 5M95B 3D0VB 1FG2B 4XVSL 3T8XA 3F58H 1HXMA 4JQXC 4F3FA 1FLRH 3F65A 4LF3B 4LKCB 5CSZA 4ZAKB 2PF6A 3PUCA 1AP2B 4YIQB 1WFUA 3DUSA 2XY1A 3UROR 5DJYA 5DYOA 1MH5A 5CEZH 4NDMA 2EDOA 4L3AA 1JWMA 2XWBA 4U2ZA 4ZFOA 3ULVE 3L5IA 5IGXH 4OJFL 3KPSA 4GQ9H 4O5LH 4PBXA 3SHSA 4CW1A 1F90H 1CD1A 1JN6A 1PKQA 3U0WH 4XT1C 5GIRA 3PV6A 4KGJA 4QOKE 1NEZB 4KJWC 1HHIA 2LQRA 3WFCH 3BVNA 4AEHL 1UA6H 3EOBA 3WV0A 4JN2A 2ZP0T 3VDAA 4FP8L 1CGXA 4Y4KB 3CPLA 3SDCC 4NRZB 2XZQH 1DBBL 3MA7B 4CMMA 4F2MA 1MOEA 2DQFA 4OZ4A 2Q76B 2DMBA 1AIFA 1NMBL 4HKJB 3NIFF 1WEJL 5CSGA 4OZFG 4PJ7E 2VH5L 4XPGL 4IHOB 4LCIH 1DUYB 3IDXL 2CIIA 4NZTH 3CUPB 4PJ9A 5EBWB 5BRZA 1QFOA 2L4OA 1JHKL 4XCCL 5ERWB 2F5BL 5F9OH 5JUEH 1QHOA 4YX2L 1NFKA 4F7PA 1R5IB 4OUUA 3ROOA 4HFUH 4KUCD 4WHYH 3FFCD 4S1SL 4TQEH 4NM4H 4PJEE 2BVTA 2ATPB 5KSBA 5E99L 3O11A 4G8IB 4NKMA 2VZUA 5HGAA 4JKPL 1YEEH 3IB4A 1NMAL 1KPUA 2EIZA 2QHRL 2BXYA 2NY2D 4QXTB 3MLXH 5D1ZC 5ENWB 4NFCA 1GL4B 3VFNB 2V2WB 3ZYOA 2C3WA 2XTJB 2OR9H 4OIIL 5DTFA 3DRTB 5FEBA 5EUOF 2DWDB 4GMTL 4AENA 3BEWB 1BJMA 5F89B 5K9QI 2B0SL 4DTGH 1BFVL 1LO4H 3EGSA 3I6KB 4Q9RL 5FO8B 4GXUM 3Q5OA 3PJSB 2Y25A 1F4YL 2F5AL 4LSPH 4FQHA 1IE5A 4WI6A 3NCFB 1OAZH 2FHBA 4P2RA 1NC4A 1RIVH 4X7FC 5D93C 1FZMA 3CDFA 1G7IA 4IDJL 2CK0L 3ESVF 2DKUA 3VXRD 5TDPB 4HUKB 4PJ8A 2DQJL 1CTNA 2A83A 3F7VB 1MUJB 4HMDA 2VXSH 5F1OB 3LKOB 1SVCP 5HPOA 2B1AL 1B90A 3THML 2EECA 4PGBB 3B2VH 5C09D 2PR4H 3ZZ1A 3MRIA 4ZYKA 1T4KB 5DJDB 3D1MC 3LN5B 4DUXA 4G6KH 5HJ3B 3JWOH 3RL1B 4WY7H 2HT2D 3MBEA 3ZTJH 5I30L 1MSPA 1U8QB 1IM9A 3QUKA 2IAMB 2AJZA 1IGMH 4KI5C 4ACPA 6FABL 5J1SC 3SDXE 3ORJA 2ZCLL 2XXMB 1IEAA 5C71A 3HZKB 4PG2A 4MJ5B 1HSAB 2YMXH 4N1HB 2GJZB 4OI7A 1DBKL 5ACMA 4JGJA 2GJJA 3JTSB 5AYQA 4Y2OA 3QNZA 1XF1A 1KCSL 2IFGA 3EYUH 4I77H 4CU8A 1WBZA 2G5RA 4MB5A 1N3NB 2JJSC 2VUOA 2H32H 4GRLD 4NO0B 4BK4A 4GKNB 1XF4A 3GGWA 5A16B 3MV8E 4X6BA 4BKLA 3C8KB 1S78C 1OAYL 1WBYA 4Z7WA 3B9KA 3L95A 2MQ3A 3VXSB 2FIKB 3QCUL 3H7BB 2GY7B 5E1HB 3UEZA 5FM4A 3MRQB 3O6FA 4FQIL 3GHBL 4JM2C 3BO8B 4LLVA 1HEZA 4Y4FC 2WUCH 3ARUA 4WFHE 5DD0L 5MP6L 1U3HC 5K9KB 4YDIL 3HAEG 5DD1H 3BPNC 2OK0L 1RJYB 2PNDA 4UZGA 3P0GB 4P23D 1LILA 2P1YA 2J4WH 3IU4H 2WWKT 1QRKA 1ND0A 1JVKA 3IXAB 3IU3A 3TYFB 1VPOH 4KY1L 3V6ZB 4R97B 3GKZA 5TQ0L 1G1YA 1TITA 1S7WA 3BI9X 4NFDA 1I7RB 5HHOB 3QWQB 4NQUA 1UQSA 4NWTL 4LCWB 1BQLL 1OGAD 2AQ1A 3ARDA 2Y36H 4ELMA 4W81A 3W9EA 1A7RH 4Q0XL 4EUPA 5SX4I 2V5TA 3LS4L 5FUZL 2HP4A 3SQOL 1LHZA 1P5VA 5JW5B 3BE1H 2FL5A 1FGVL 3HMWH 3BD4A 1A6UH 4URTB 1JWSB 4KK8C 4AEFA 5GGQH 1AXTH 2X2YA 4A2MA 4HLZG 4I8DA 1N8ZA 3G08B 5C0FA 1NCDL 3F7YB 4OF8A 2YEZA 3RDTA 5D7SL 1LO0L 4XWGL 4NN7B 1LMKA 3V5DA 1A3RH 1ULVA 4XRCB 3WD5H 2APWA 5JDJA 3TBSB 2NMSA 3ULUE 3BT2H 2VWEC 4KK5D 1A14H 2CIKA 1ADQL 1HI6A 1IGCH 1FAIL 1AO7E 3D6GA 4NHCH 3I85A 5E5UB 3BN9C 5FGSA 1LNUB 1FNFA 4XAKE 4UV7L 4JFFA 3NVQA 2ZUQB 3VH8G 4KJPD 3VFGH 4QTHA 1UGNA 4U1MB 3KPOA 4LSTL 4XPHH 1EIBA 4OF0A 4K94H 4E42A 1MWAL 3VD4A 4HS3B 3KLAB 2BNRE 3Q3GB 3WXVH 3RAJL 3HE6A 1MEXL 4HXBL 5F7HA 4JRXD 3SDCB 3HG1E 3FO1B 1KACB 2IPUG 2DI7A 3QQ3B 3L3HB 3RFZC 5CEYA