2NW2A

Crystal structure of els4 tcr at 1.4a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
196
Chain Sequence
b'QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVQAGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELS4 TCR alpha chain
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 196
sequence length 200
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nw2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nw2A02
3IJYA 5JORB 5CLTA 1D5IL 3LRGA 4CNIB 4OM1L 4ZTOH 3RWJB 1BBDH 2X4SB 1INEH 4PJGE 5HI4D 4L9LA 1S7RA 2D7QA 4OM1H 4PYHA 4P48A 2DB8A 2R9HD 3KPSA 1FIEA 2PYEB 5J12B 1P4BH 5AG8A 1AC0A 1DE4A 5GRVK 1ZS8A 1EFXB 2BERA 2VLJB 4XXDA 4YE4L 4OF7A 4QHMA 3LEVH 3M1BB 5SX4I 2AERT 3T1WA 1QZ1A 2WLYA 4F80A 3LKSB 4GRWE 1V3MA 1RUML 3GMRB 1OTSD 1OF2B 4PJ7F 3B9EA 2ZG1A 1XR9A 1XCQB 2BSTA 1TJIL 2W0FB 4RWYH 4ODXB 3O2DH 4MD5A 4MSWA 1TJIH 2WWKO 1DLFH 2NY5C 1LP9B 2LABA 3RUGF 2Z31C 2H9GA 4FXGB 1D6EA 4EDWH 1LE9A 3UTSA 4LMQI 4KJWC 5A40E 5F1IB 4X4YA 1CDBA 4LRNL 1OB1A 1OQXA 1N2RB 5H94B 4LRNH 1CVRA 4NGHH 2MWCA 4YHOL 5GSRA 3HNVL 3V4VL 3VGAC 4DUWA 4M4RA 3HE7C 3CFKA 4NO5B 3V4VH 5EIQA 5JXEA 3N1GC 1ZT4A 4NKIL 2H2PD 2RFXB 4HKJA 4OCXL 3BW9A 5ESAA 4JZNA 4P4RA 5KSBF 5DFVC 3BGMB 3TJHC 3N9GL 3RBSA 4L8SB 4L9LC 3TA3D 32C2B 3VXRA 4PJBE 3V4UL 4UTAL 1ND0B 4WDIB 1D7FA 3V8CA 1DN0A 1DBJL 5DJ2B 1KIQA 2C3GA 3QNXA 4UTAH 2D31B 5DJCA 2QKIB 2IALA 5BXFB 1DBJH 5I71B 4J3TA 4Y19B 3RWFA 1KTKE 5GXBB 3HI1B 1FH5H 3QO0B 4UINL 1F90L 5EZLB 4X7TA 3HZKA 3F6IA 3DV6A 1F90H 1HOCA 4XMLH 1UGNA 1OGAB 5FKPB 5IEKB 3WE6B 1JGVL 3C5ZB 3GHBH 3NZ8B 1OCWL 5KOVC 2UY7A 1YC8A 2Y25A 4MWFB 1YMHA 3RI5K 3RX7A 5JW5A 1OCWH 5DRXA 5FOBB 1ZHBB 5F9AC 2C26A 2YR3A 1RZKC 5HYSG 4PRHA 4KKNA 4PJFE 4XI5C 3D69A 3ARBD 1JF1B 4N0RA 5MEPA 4HG4J 3RL1B 2BNRB 3VGHA 4RBPH 1SVCP 5I9QC 1QBAA 4OFVA 5KSVA 3Q2CA 2VERN 2YWZA 2Q20A 2DL9A 5MEOA 4K7PH 1EEZB 3AREB 5JXEC 3P73B 4NN7B 1KBGL 1U2CA 3WN5A 5FM8A 2W60B 5CBEA 4R0LA 3RWHA 4W4NA 1OARH 1KBGH 1AO7E 3UYPA 4Y7MA 1S3KH 1Q38A 5LG1A 4IJ3C 4LHUA 1U8QB 4QHKI 2F5BL 3MV8A 3T0EA 2FEEL 2F5BH 3NA9L 3QB7C 3H9HA 3H3PH 1N8ZA 2DMBA 1CGSH 4NRZB 3NA9H 1G7LB 3CU1A 4NM8L 4F58L 1MHPL 1QO3B 4NM8H 5GGSA 2NY2D 5DJ8B 4F58H 4Y8AA 1FVDB 1YEDB 4PJDE 4YHKL 1CE1L 1GL4B 1W72B 3QJHB 5KN5A 2VWEE 2HLFC 3S5LG 1L0YA 4YHKH 4CJ0A 3TJEL 2GQHA 2E3VA 3FB5A 1U3HD 5GIRA 3PE9A 2ICWI 5I1LB 1XEDA 4KJYB 5I66B 3ZE1E 5HYFA 4X9HA 3VDBA 3OGCA 3FQWB 5D6CB 4DFHA 4W6YB 2QEJA 3HC3L 1NCWL 4PV9A 4PJIA 1B4JL 2DQIL 5IBLC 3GSWA 3D3VD 3FO1B 5EUOB 3WKNA 3HC3H 4XP1L 1B4JH 4MA7H 4YDLC 4TVSa 4XP1H 3HUJB 2CQVA 1DQJB 1ONQA 2V5YA 5AZ2H 1MJ8L 2HVJA 1FAIL 3WN5C 1CLYL 5BS0E 4R0LC 1FAIH 3S4SA 3S7GA 1CLYH 3VWJD 1UH2A 5T5FH 5F7WC 1NMCC 1YN7B 2R1WA 5C3LD 2EH7H 1J8KA 3IDNB 2YBRB 4YC2C 3T0EC 3KDMB 1YUHA 3F5WB 2NQCA 4XAKE 1OTTC 3D25A 1HI6B 1R3JB 4FZ8L 1RK1A 2HKHH 1IM9A 5CEYA 4XHJD 4GG8A 2FNBA 2N7AA 3HA0A 2D7MA 3MGTB 3RBGA 1QRNE 1DUYA 3N50A 3ULVL 5HI4C 5CMAA 3ULVH 3IRPX 2PW2B 3P4OA 2R9HC 1A2YB 2PYED 5GHWL 5JLZA 4PG9B 3V9FA 5E8NB 2ZUXA 3TN0B 3MRRB 1EFXD 1JMXA 1GC1L 3ARYA 1AIFA 2VLJD 5D7LE 1QRKA 2NW3B 2X44D 4B7LA 4R4FL 4AL8L 1GC1H 2CK2A 5EU4B 2A6DB 4OT1L 3RVVD 2NY6B 4IMKA 4R4FH 5EZIL 4MA1B 3UX9B 3PF2A 4OT1H 2FZ3B 1XGQA 5EZIH 1MCIA 1OTSC 2CXKA 4X6DE 1RZGA 3CSPA 5KBNC 3CK0H 5DJZA 2J8OA 4UB0L 1MVUA 1LE5B 1NKOA 2XWBB 4UB0H 1MCHA 1AGEB 1RIVL 1IGFL 5FUCC 1E6OH 5C1MB 3X3FL 1T21A 3IAGC 1IC4L 8FABB 1IGFH 2AV1A 4JKPL 3ARBA 3X3FH 3FB7A 3ZZ1A 1IC4H 3EYFA 2Z92A 3JWNC 4FQQA 4JKPH 4JM4H 1S9YB 2EC9T 2CR3A 4NQDB 5I1EL 1G6RB 1AH1A 4PRIE 4U1KA 4U6VL 1YNTA 4RISH 2R56L 5I1EH 4J3OC 3GSQA 2R56H 3NIFE 4RGMB 4C83A 4LSPL 4KY1L 1JRHI 3DECA 2H2PC 3GBNL 4DWHA 4LSPH 1JNLL 2DYPB 3UJTL 4U0QB 5IJVB 3GBNH 3MJ9L 5GS0L 1JNLH 2YA2A 3MJ9H 1QBMH 1IT9L 4CW1A 3MRDA 4MJ5A 4LHQB 2BRRL 3FQTB 2H3NB 3G5ZA 2FHCA 4GRWH 3D85A 4CVWA 3O11A 4A2MA 5J1SC 2BMKA 3ZTNH 2YRPA 3MLSL 4Y19D 1QLEL 2R69H 4AK1A 1BQHB 3LD8C 4D9LL 1TJGH 3UTTE 1U95B 3DYOA 4J8RB 5FM5O 4D9LH 2CGRL 3BH8A 3LHPH 3KVQA 4IMKC 1OPGH 5DQ9B 3VI4F 3ULUD 5IB2A 1OGAD 4CU8A 3VFMB 5EULV 1INQA 3C5ZD 4GQ9H 4PGZA 4FABL 5DMIL 2PTVA 3IGAB 4KXZI 1U3HA 4FABH 1G9ML 1CDIA 2XOTA 1FFNA 1OY3B 5E7BA 5T3ZD 2VMFA 1G9MH 1KT2B 3QAZB 4OZFA 3MODH 3ZSSA 3O2VL 1Z0MA 2F53B 2P46B 1CDGA 4HLZG 1J0YA 3DX9A 3EO0B 3O2VH 4E42B 4Z7OE 5JW4Q 3ARBC 1X5LA 2BNRD 4XNZB 2X9WA 4OUUA 3ZYOA 2CDEB 4JGUA 2OZ4A 2DBLL 1T83A 2WBJD 2XZAH 1CLZL 1JF6A 3ARED 4X7DC 1CLZH 1Y0LA 5BRZB 3UBXB 1FO0L 4C56E 4HWZB 4ZYKA 3S98A 1N5YL 2H8PB 4WUKH 3E6FB 1N5YH 3MR9B 4GXVL 5F89B 4HLJA 5ESQB 4GXVH 3W5MA 3F65A 2O61B 1EIBA 2IBZX 1J0JA 1YC7A 1FLTX 3DETD 5AYUL 3BMVA 4GAYB 5DQDH 5FGSA 3GB7B 3MFFB 3LH2L 1A6AB 1T89A 1TXKA 1S7VB 3QO1B 1BX2A 3GHEL 4HZLB 4AG4H 4LPVA 4CNIA 1GHFL 3GHEH 4JG0L 4RAUA 2G60H 1GHFH 3CLEL 1CL7I 3IFLL 4XNUL 4P2CG 4OFPA 3FONB 4GH7B 4XNUH 2VJXA 4WI4A 3V2AR 4N0UE 1U3HC 1C5CH 3BEWB 5EPMB 3HMWL 4LLUB 3HMWH 4XCEA 5TE4L 4MCYA 2CIIB 4MCZA 2OXHA 4F7PA 1C8PA 5TE4H 3GMRA 3MLVL 3T2PA 1OF2A 3MLVH 1XCQA 2W0FA 3Q1SL 3LZFL 2DQHL 4ODXA 1T83C 2FD6L 1U93B 1NSNL 4BA8A 1K4DB 1MCNA 3GSUB 4ZUUB 3Q1SH 3LZFH 2DQHH 4G7YL 2FD6H 1NSNH 4GOSA 4PUBL 4FXGA 2D9CA 1S7WB 2JJVA 2VDPL 4EXKA 3WFHB 4NT6A 4PUBH 4MNGB 2VDPH 4Z9KB 5F1IA 1C5BH 1D5BA 4LLWB 5GS2D 3MUJA 5F7MC 1N2RA 5H94A 4S11A 4HS8L 1ZLVK 1TQCB 4NO5A 3MLRL 4HS8H 3D18B 3CFDA 2J1KA 1LVEA 4I9WD 4U1JB 4V2CB 5GGQL 3MLRH 2RFXA 1T7ZA 1T89C 5GGQH 2WANA 1RPQA 4R26L 1UA6L 3FOLB 2DBJA 4H8WC 4RGNB 1ND0A 4WDIA 1I1CA 4X5WB 5E2UH 5B4MC 3CFCL 5J12C 2C3HA 2DI9A 1S9WB 2QKIA 3V6OA 4Y19A 2ADJA 4PRPB 4H88L 4ELME 1I1FB 2HT2C 3IAQA 3HI1A 3QO0A 3V6ZB 5EZLA 1NUNB 4TNWF 1NBVL 2NY6D 3O6FB 1NBVH 4QLRA 1QFWL 5FKPA 5IEKA 3WE6A 4PLKD 1DL7L 3NABL 4XBGB 3ECBA 1QFWH 1RUKL 1CD1B 1F3RB 1I4FA 2KH2B 4ZO9A 2NY4B 4MWFA 5JPMB 5HGGS 5JZ7D 5FOBA 3DRQB 1ZHBA 1F4AA 5DZNA 1OT2A 2R0LH 5FDYA 5FXCH 4PJAE 4WFGD 3D87B 5T1LB 3T0XA 3BE1L 3BWUC 4YXHL 3RL1A 1ZVYA 3BE1H 1A6VL 4YXHH 3DMMB 3QULB 4NQDD 3DJ9A 25C8H 1A6VH 1CGTA 1EJOL 4U6TA 2WAHA 3LRSA 3P4MB 1EJOH 4JPWH 2KUTA 4NJAL 3AU1B 3AREA 4P57A 3RU8H 4NJAH 2W60A 2XKSA 3HR5B 2AI0H 2DYPD 4NFBA 3Q0HA 4Z7WB 1UQSB 3MLZH 3QPQD 1PW3A 1HNFA 4XX1E 3L7FA 1CXEA 5IW3A 3GUTB 4RMRA 1P5UA 1A7NH 1G7LA 4FFYL 3V6OC 3H42L 1HEZA 2R4SL 3KWWB 1S5HB 3BMWA 3QNZB 5HDLA 4FFYH 1QO3A 1U36A 3CZFA 2R4SH 1AY1H 1BZQK 3WLWD 3QXWA 4OF6A 1RIUL 2LU4A 1FVCB 3ULUC 1W72A 2WLZA 1RIUH 4OCYL 2VLKE 2WWKT 3UO1H 3RTQB 4OCYH 4PJXB 4QXGL 2O5YL 1BQLH 3BD3A 1KXQE 4QKXB 4JY6B 3GIVB 1MCPL 1N7ML 1FL3A 2O5YH 1T03L 3GI9L 5I66A 3LEXB 2CLVB 4HV8B 1N7MH 3KLAB 4GW1B 1T03H 2DTML 3QQ9D 1S7TB 3VD9A 2F53D 1C1EL 2VYRE 5F9WB 2VAAB 2G9HB 1C1EH 4HKZB 4P9HH 5EUOA 3LRHA 4P59H 2VLLB 4G3YL 3VJ6B 2DL2A 4ISVB 4LK4A 1DQJA 2FEDD 3FFDB 5E99L 1C5DA 3AREC 1G7QB 5E99H 2RAMA 4MQ7B 5BRZD 4TSBL 1CYGA 4CL7A 2FHBA 4M7LT 1NCNA 1X4XA 2B20A 4TSBH 3QRGL 1NPUA 5C08E 2OP4L 4PJCE 1KJ3L 1YN7A 1KTLB 3B9AA 3U83A 4TUOA 4ZTPL 2OP4H 3IDNA 1IE5A 4JE4B 2YBRA 5CEXA 4K55A 4ZTPH 1PDKA 4IRJB 1AQKH 5AAWA 3OKLB 5ICZA 3GRWL 1HI6A 1R3JA 2OL3A 1EFQA 2W9EL 3GRWH 1FDLH 3M8OL 1HXYB 1QACA 3MGTA 2W9EH 1JPSL 1KLUB 4HMCA 3HRZB 2X7LB 4P2OB 1JPSH 3ARTA 4OZIB 1AKJB 5INDA 4H25A 1LQSR 2PW2A 4Y88A 3MRHB 5I1AB 1BP3B 1R24B 1ZMYA 4L4VB 4MVBD 4WFHD 4JN2A 3W11D 5JOPE 4OF8A 3U36B 3TN0A 3MRRA 1RZJC 3MA7B 4WCYL 3QG7H 2NW3A 1LNUA 5HGBB 5KSUB 1U8HB 5EU4A 4WCYH 2XWTB 3RDTB 2FZ3A 5F6HI 2QLVB 5IESL 4OLYL 1T7WA 3U79A 2X4NB 2A38A 2VABB 1L9NA 2AV7A 2JIXB 2AEIT 3MCKA 4JO1L 4WEBL 4HX1A 1DQQA 2VKXA 3OKKA 1ZK9A 3ZKSD 3PQYB 4WEBH 2BVPB 5D70L 4ZPTA 5TH2B 1KCUL 3MO1B 3VXME 5D70H 1KCUH 2VXQH 1S9YA 4G8FB 1G6RA 4J6RL 5FYJE 2E7BA 5LQBH 4R2GB 1SM3H 5DUMH 3SE3A 4J6RH 2X4TB 4XP6L 3QUZA 3DXAE 2HP4A 3E6HB 2AJVL 4C55A 2DYPA 3IAPA 4RMQA 4U6YA 1HSBB 2A73B 1L0XA 2EDJA 2AJVH 2VNCA 3BP5B 4XC1H 3UZEA 2KQNA 5I1KL 1T5WA 3HAEB 5IHZB 1WEJL 3NN8B 1CDUA 5I1KH 3CUPB 3FQTA 1WEJH 2B2XL 4QYOB 1WISA 2WQRA 4JPIA 4HH9A 3U0PB 2R15A 1MFCH 3OG6B 2B2XH 3TN0C 2KBGA 4PRPD 3DI2B 1U95A 4Y5YB 4J8RA 2CSPA 3KXFB 2NY6C 3O6FD 4G6JL 4PB0H 4UDUB 4H0GA 3ZMRA 4G6JH 2G75B 3OSKA 3MMEA 4NPYB 1K8IB 5MERB 2CKBB 1UEYA 4XGZB 3IGAA 1OSZA 4Y4FB 5DHVH 4ZNEA 1UWXK 4DGYL 1BMGA 5T3XD 3PP3H 3TESA 1KT2A 3OKYA 3JTTA 4WI2A 4XBPB 5FA4B 2F53A 5T1LD 4XH2B 4LSDA 4D9QE 3MNVA 3BEVB 1FORL 3NOIA 5HI3D 4LLMB 3V5KB 3DMMD 1FORH 3QEQA 4P4KB 3WNOA 3SE3C 1EERB 5I8CA 3QUZC 4M1DL 5CKAA 4YXLH 1XH3B 3J7HA 4GMSL 3CH8A 3C9NB 4RGMC 3BSZL 4M1DH 2DWEA 4Z76A 1YYLL 4JZJA 5D7IF 4GMSH 3UBXA 5FYKD 5B8CA 4HWZA 1YYLH 4P3WA 4F57L 4U1MB 5T1KA 4NWUL 4NWUH 1HHKA 1R3LA 3E6FA 3MR9A 4GW4B 3RVXD 3QXTA 5CHNB 4WY7H 5ESQA 2DQGL 2KPNA 2O61A 1MREL 1NAML 5CEZD 2DQGH 3MRQA 3MRMB 3X11A 2GTWB 1MREH 3FT4A 1NAMH 4GAYA 3MFFA 3SKUD 2HTKC 4G8GB 4P2QE 1S7VA 2Z8RA 5KVDL 1YN6A 1QEWA 3FB8B 1KCRH 3WLWC 4OLWL 4BQ6A 4N9OB 2BNQB 4OLWH 3AROA 1JHLH 1SJHA 3FONA 4N8VG 5FDWB 3RTQD 5JNYB 2IMNA 4X6CF 5IVXA 2FYYB 1B0WA 5EPMA 5F7KC 1SEQL 1FL5B 4NZUL 4I4WB 4TTDD 2D03L 4XNXL 4RDQF 1MVFA 1SEQH 1ZLUK 1W0VB 3RP1A 4NZUH 2CUIA 1NC2B 4XNXH 4RAHA 2WSKA 4XNZC 3U4AA 1QSEB 4PJHF 5HVFB 4DKDC 15C8H 1HK6A 1YEJL 1QFHA 2RHEA 2FEDC 5EO0A 3I02B 4F7MA 4ZUUA 1YEJH 5C70A 3JV4A 5MENB 4Q9QL 4JZJC 5GGTA 1S7WA 5DXWA 4PJ5B 3WFHA 5B8CC 4MNGA 4Q9QH 4R4NC 3O3AB 2JCCF 3LKRB 4LLWA 4S0SD 1J05B 3E3QE 2RJMA 4OBSA 2I9TB 3KPRE 4OD1L 3VGBA 4IRJD 1A1OB 3QJFA 3D18A 3JWDL 1QTYT 5DRZB 1KN2L 5ACMA 3JWDH 5CP3A 1G0DA 1KN2H 5ICXB 4HWNA 4NSKB 4QHLA 4K9EC 5ETUB 4ZMAT 2GK2A 3PDOB 4P2OD 1AKJD 2B5IB 4X5WA 1NCTA 4L4VD 2VZVA 1S9WA 2CMRL 3BH9B 4U6HB 1BFOB 4KVCL 1X5YA 1I1FA 2CMRH 3HE6A 4KVCH 1AGCB 5BW7A 3V6ZA 1CE6A 5EA0H 4UU9B 3DX8B 4M5ZL 3QPXL 5JDJA 3RDTD 4MXQC 3O6FA 1J1OL 4S2SB 3QDHA 3QPXH 4JO4L 5IHUL 2Z8VC 2IPUK 2FCBA 4LCCB 2IMMA 4JO4H 4PJGB 1J8HA 3WEXB 4DEPC 1KFAL 1MCRA 5GISL 4NN6B 5GGSY 1G7JA 2JIXD 4LLYB 5JPMA 4PTTB 3OAUH 1KFAH 4TUKH 3O4LA 3H0TB 4JQVA 3ES6A 3PQYD 3QYCA 3MNWB 1YECH 3QIBA 5DJAB 3UYRL 4KGJA 4Y89A 5IQ9B 4NKDB 1ED3B 4HT1L 5I1HH 5JTWA 2BJML 2GSGB 4R2GD 4WW1B 4HT1H 1TQCC 2LFGA 2BJMH 3P4MA 3LSOA 3G5VB 1AD0B 4UNTA 3AU1A 3FMGH 4QXTB 3GKWL 2VZTA 4LDOB 4MDIB 4NWTL 2AKRB 5FUZL 3GKWH 4Z7WA 1UQSA 4YHNB 4NWTH 5FUZH 4PJEE 1CU4H 4JDTH 4KKAC 1WWWX 3MNZB 4I3GA 1K2DA 4RGNC 1Z3GL 1FFOA 2LQRA 3GUTA 3M17A 1WUNT 1Z3GH 2FR4B 3KWWA 1EBPA 4OZGB 4UIMB 2AGJL 4OLZL 5BW7C 5DLML 4WI7A 2ZUVA 2AGJH 3RIAF 5DJ0B 4OLZH 3KXFD 4XX1G 3FN0L 3O6FC 1A3QA 2AJYH 5I1GH 3FN0H 5KS9B 2EO9A 3RTQA 5F21B 4PJXA 2VDML 4PJBB 2DQEL 1CFTB 2NY4C 5FYJL 5HGDB 4JY6A 2J5LB 1TVBB 3B5TA 1HQRB 2DQEH 5FYJH 4XCNB 4HV8A 3KLAA 4GW1A 4J12A 4JQVC 1Q0YL 1MPAL 2WP3O 5D5ME 3V0AC 1FO0B 3U0WH 1DANT 1UG9A 2HJLA 2J8UE 4PLOB 1MPAH 5GGVY 2FECI 1F4XL 2B4CL 4PRNB 5L2KA 2G9HA 1NFKA 1SJEB 1OSPL 3QIBC 2B4CH 2XG4A 1I9JL 3DMMC 3VJ6A 3NH7L 2FX9L 4P4KD 2XTJE 4FXKB 4W81A 1I9JH 2HKFL 4WI9A 2I9LB 4RFNB 2FX9H 2HKFH 5KAQG 1G7QA 2R4RL 4EIGB 5I30L 4Y5VA 2L4OA 3UPAA 2JJTA 3R1GL 1AD9A 4UUJA 1TVDA 3R1GH 1SMOA 1OP9A 4GG6E 3H9SA 2O5ZL 5ITBL 4QNPE 2A6JA 4D0DB 2O5ZH 4FMFA 3OKLA 5F7LB 3EYVB 4OLEA 4OZHE 1MFAH 4IMLB 2P24B 4G8GD 3EYUL 3HLAB 3RX5A 1A47A 3NZHL 4TSCL 1CGWA 1KLUA 2VR5A 3EYUH 4XMKH 1G1YA 4UV7L 1A4JA 4TQEH 2X7LA 2BNQD 2EKSA 4TSCH 1HCFX 5GSVB 1AO7B 4ONHB 4OZIA 1AKJA 5I1AA 4EUPG 1BEYH 4HMEA 3LV3B 4L4VA 1RQ5A 3RTQC 4PV8B 3U36A 2HN7A 3MA7A 1YEIL 4G9FE 5HGBA 5KSUA 5C0FB 2ATKB 1YEIH 4TTDC 4PREB 1J7VR 3E1F1 3RDTA 5F9WC 1NC2D 4J7RA 4M3JA 3MCLL 1WZMA 4WHYH 3PL6D 4KMQA 4NJ9L 3WFDH 1QSED 2E7CA 4PJDB 2X4NA 4KH2A 4OSUL 4CMMB 1N0XL 4POZD 3I75B 2VABA 4HDIA 2JIXA 3JXAA 1N0XH 4I5BB 3IRZA 5C0AA 5I8EB 1ZE3C 5MEND 5DI8B 2EH8H 2GKIA 1ACYH 2BVPA 1F97A 4PJ5D 5TH2A 3QNYA 3MO1A 4U2YA 1V3JA 2VITB 3ULVD 1E4KA 1FFQA 3WO4B 2NLJA 5L9DH 4G8FA 2I25N 1R5IA 4X6FB 5D9SB 2VC2H 1DBAL 5C86A 2X4TA 2CO7B 1TIUA 5IQ7L 1LHZA 1AXTL 2O93L 3E6HA 1B88A 1AXTH 5JHLL 2BHYA 2A73A 4ZFZA 2Y72A 1J0ZA 3K7UA 5JHLH 3OB8A 2PR4H 1RZ8B 4Y1AE 2GFBB 3HAEA 1B2WL 3NN8A 4U1SB 4N0YH 2VKWA 1B2WH 4YXKL 1JYNA 2QADD 4QYOA 3OQ3B 3U0PA 1OTUC 4G6KL 5F3HB 4Z7NF 4D9RE 4YXKH 1D9KA 2LU3A 1TCMA 4G6KH 1YQ2A 3VRIA 5IB1B 3AXLB 1A3LH 2Z8SA 3DUSB 4AY0A 2IF7A 1T5XB 4M61B 4DVBB 1GZPB 3DYMA 4L8DB 3KXFA 4A6YL 3RDTC 4K3HA 4NQCA 5F44A 3N06B 1NFDE 4UDUA 1NDGB 4A6YH 4OD3L 4M6NL 4NPYA 1BECA 1K8IA 4MZ3A 2CKBA 4Z7UF 5MHSD 4OD3H 3NIGF 4M6NH 5JW4M 4Y4FA 4UNUA 4JY4B 3CVIH 4XWGH 1TETH 4G8EA 3C09C 2XYCA 1T4KA 5FA4A 2R2BB 2C3WA 4XH2A 3K4DA 4OIBA 3O8XB 5GS0D 2VUOA 4D0BB 1KIPB 1A7RL 4LLMA 1E4KC 1RU9H 3V5KA 3SJVE 1A7RH 3I85A 3OKMB 4CVUA 5IK3B 3Q6FB 2BDNL 2PO6B 5KOMC 3EHBD 3T0DA 4X6DB 3A6OA 4PLJC 3AM8A 4WTZA 2BDNH 4N5ED 5E70A 2VXUL 4G5ZL 1QVOA 1JFQL 5KSAD 4DOHE 1RAMA 4FQIL 1BFVL 4G5ZH 1JFQH 4FQIH 1BFVH 1D5MB 1JV5B 5I74B 3V7MA 5D7SL 1V3KA 2R23B 4WHYG 4YHPB 4GW4A 1UCTA 3ZDZF 4LPXA 5CHNA 3ME0A 3PDGA 3SKNA 5F7EL 5GQBA 4Q7DA 3MRMA 1D9KC 1X4ZA 2GTWA 5FO8B 5DVKA 4YQXL 5F7EH 3SCMD 3UTZB 4G8GA 4CADB 4YQXH 1RFDL 1FZOB 1ZGLP 3FB8A 1IL1B 4BSJA 4ETQB 2ZOLB 1PY9A 1RFDH 5I6XC 4FA8A 1DVFB 2I07B 4PPTA 2I60L 2MNUA 1AC6A 4DW2L 3KPOB 2I60H 4QY8A 4PYGA 4K8RC 4DW2H 5JNYA 4Y4FC 4WNQB 4MD0A 5EUKA 3K3QA 4NQUA 3X14B 1QG3A 3QWRD 5FO7A 3LN9A 5D1XA 3TO2A 1T2JA 1M71B 5C6WH 2APWA 3Q5TA 1A7OH 1QSEA 1PGRB 2XFXB 5BOPA 4NRXA 4RWHA 2HT3C 4ZPVB 4IDLA 2J6EH 4NRYB 1DJSA 4UDTB 4JFEA 3I02A 2ESVB 3AM8C 2C3VA 1AI1L 3WIFB 5I19L 1H15B 2JELL 4MMZC 1AI1H 5D1QB 3DYPA 3FN9A 4HK0B 3ZTJH 3KPSE 4JLRB 2A6KB 2OMBA 4X4ZA 2QSVA 2VN7A 1J05A 3P2TA 4QTHB 3MXVH 1SJXA 1MAMH 4YGAB 3BUYB 3V95A 9CGTA 1KB5H 1A1OA 1B6DA 1K85A 1I9IL 1KYOK 1FAKT 1I9IH 1TJHL 2MHAB 1HYSD 2UZIL 5DRZA 1TJHH 4EEEA 3LPGA 5I1DA 2UZIH 5ICXA 3Q6GL 3RIFF 5CGMA 5ETUA 1S5IH 2HFGH 3PDOA 1AO7D 4J4PD 4M1CD 5FYKU 3IDYB 4LIQE 1N4XL 3TZVB 3SDYH 3BH9A 5FYLD 4XPTH 1N4XH 1BFOA 4MMXC 3UTSE 2OJEA 4EQ2A 4ZUWB 3ZYIA 3P77B 1MY5A 2BVUA 1OGTB 1VFAB 3OKEB 3P11H 3ARFB 2EDLA 5IFAH 5D1XC 4Q6YA 4S2SA 2VL5B 2NY1D 2EE3A 4Y4HB 5I16B 4MJ4A 3TVMB 3H9ZA 1R3KB 1M7DB 3FFCA 1Q9LB 4M8QB 1HIML 3VXRE 4MXVF 3U9UB 4FFWC 2OR8A 1HIMH 1UJ3B 5C09A 4LL9A 1FNLA 2D0GA 3MNWA 5DJAA 3U7WH 1NUGA 4CGTA 1ED3A 1FGVL 4JG1H 5AWNL 5DVOA 2GSGA 3LVEA 4WW1A 2FDBP 4S0TD 3ULVF 1JWUA 3QUXB 3GMQB 2HLAA 3RWEB 3MRCB 4BZ1H 1AD0A 2DKUA 4QXTA 5ADOL 4MDIA 3ETBF 5ADOH 3MLTB 4C59B 1MUJB 3MLUL 4U1LA 4PBVC 4EI6B 4WW2F 2B5IC 4PGEA 4DK3A 1RD6A 1ZHKB 1YPZA 4PRHE 1CD0A 4LCWA 3T8XA 4OZGA 4UIMA 1JI2A 1S7XB 3RNQB 4WWKA 5DJ0A 1MLBB 1VEOA 1XIWA 2D0FA 4O2EA 1OVZA 5E6IB 5KS9A 1QRND 1WFUA 4EDXA 2CLRB 1CFTA 5HGDA 4NN6C 1TVBA 1KV3A 5INCB 3IXTA 3MRIB 4PJGF 4XCNA 1C16B 4YAQB 3QWRA 4Z0BL 3MV8E 4ELMB 3T0EE 1WBYB 2RB8A 2UVEA 4E41A 4PRAB 1SJEA 2WNGA 3O8XD 3VCLB 1WCBB 1DBBL 3V0VB 3MJ7B 5DJYB 3DBXB 2P5EB 4YPGB 2PO6D 2I9LA 1U91A 4GRWF 4N5EC 4XMPL 1RULH 4HCRA 4RZCB 1JZ8A 2CPCA 2EO1A 3EYSL 4R7DB 4PJAB 2Q7NA 5IKCB 1ZV5A 3EYSH 1XZ0B 3BWAB 2X1PA 2RCSL 3PWUB 3EYVA 2RCSH 4PJIE 4HPOL 3CMOH 4IMLA 1A9BB 2P24A 3DIFA 2UYLA 3HLAA 4J1UA 1JHTA 2XI9A 4WWKC 3WKML 2G5BB 4HUUB 4EN3A 1XIWC 3WKMH 3L5HA 3CFBB 5GSVA 1DVFD 1WIPA 1NCUA 1RMFL 3CVHH 3FB6B 5FUCE 2APXA 3LV3A 1V8HA 3OJ2C 1T0MB 1U6AH 1ZOXA 5HHXH 1BF2A 1MCWM 4YJZL 5EC1A 2A0LD 5LBSL 5C0FA 4LCUA 1PJ9A 2ATKA 3MV9A 4J2XA 4PJBF 4S10A 5LBSH 4PREA 43C9B 2NZ9D 2B1AH 4LP4A 2AJXL 4ZDHA 1I8LA 2Z91B 3C60B 3AB0C 4KZDL 2OQJB 4CMHB 2EDYA 3I75A 4KZDH 1TPXB 4I5BA 4M7ZC 1D3CA 5I8EA 2WW8A 2ESVD 1OAYL 4JVPA 1FE8L 2GCYB 4G6AD 1KELL 3CXHK 3QZWB 4XP9H 5DI8A 5D1QD 4PG2A 1IGYB 1PG7W 2YD8A 2EC9U 2X4QB 5E2TH 4HK3J 3NFPA 5D9SA 3LKOB 1KJ2L 1CDHA 1NAKH 4LSVL 2HTLD 1KJ2H 1XF1A 3E2HB 4PJFF 3BKML 4G42B 2NY5H 1VADB 5E2JA 5J56B 4KAQL 2UZYB 5FO9B 2EIZB 3ZHLA 4JFHD 3EYQC 4KAQH 3P0VL 4YZFE 4EN3C 4ORGB 1RZ8A 2GFBA 2HG5A 3WJLA 3OX8B 4C56D 1RHHB 4J4PC 4M1CC 1JZ3A 5FM4A 3BIBX 4PJCB 4X5LA 5F3HA 2WP3T 2JE8A 2DIJA 1SEBB 2X41A 4KTDL 3AXLA 2BVOB 3DUSA 2DQJL 2R1YB 2G2RB 4M61A 5C0GB 1J11A 4FG6D 3ARFD 3NPZB 3U30B 4EUPB 3HNTL 2J2ZA 2BHUA 5DEFA 1NDGA 4HUNB 3RWDB 3HNTH 5DS8B 3O4OB 2APTA 4Y4HD 1QBBA 4B50A 1I8LC 5FCUL 1JE6A 5JOEA 3TVMD 3SDXB 2DIAA 3TBTB 1R5WA 4HC1H 3C2AL 4PJDF 4O5LL 6CGTA 3BYTA 3L3GB 2H32B 2R2BA 4O5LH 5I1IL 2ICWA 2C4XA 5BQ7B 4JO2L 4PG2C 3S36H 5I1IH 3O8XA 1IZKA 3KHQA 2VOTA 5E8EB 3KGRA 3PWNA 4JO2H 5CJ5A 3WO4C 2GITB 1PYWB 3BVNB 1E28B 3ZE1F 3LB6D 3OKMA 3Q6FA 2PO6A 4ALAL 2E9WA 4B7IA 1UKQA 1RZKL 4LIQL 4ALAH 2BVTA 1RZKH 4LIQH 4PR5A 4XPBL 5HDQH 1EX0A 1T22B 4YFLF 4GAJL 2QQLL 3JWOC 1X6LA 3GMOB 3EJYC 4GAJH 3H3KA 3VXTB 1CI5A 3HFML 2JJWA 3EJJX 3WJLC 3VXMB 2R23A 4IHOB 4YHPA 1DDHB 3VFNA 4OM0L 1S9XA 3HFMH 2HFEB 1X7QA 1IAOA 3UJJL 2L7UA 2RIKA 4OM0H 4QGYA 3UJJH 5TDNA 3UTZA 1ITBB 1EHLL 3DXAB 1FZOA 4OQTH 1IL1A 5E94B 3CU7A 4ETQA 5TE7L 1RUQL 1Z9LA 3QEHB 3GJEB 5TE7H 5E6ID 3WYRA 1MNUL 1RUQH 5FGBA 3S35H 5IB3B 4MDJA 3KPOA 5LVEA 3NCCB 4N8CH 5FB8A 5D93C 3RVWC 4WNQA 1YEFL 4QRRB 2DQUL 3X14A 1YEFH 2UZXB 2DQUH 4MAYA 1JK8A 3ARPA 4G43A 5GS3A 1M71A 3UP1A 5JOFB 2V2WB 3O8XC 5IIEA 1G7HB 2ZSWB 2XFXA 2ZUYA 3T08A 3CPLB 3MV11 2ICES 5FHAL 4NRYA 3BO8A 4O2FB 2P5ED 1UEMA 4UDTA 5HHVL 1UACL 2KZ1B 2PO6C 5FHAH 2ESVA 4NHUB 2VDRH 1UACH 4K3GA 1MCSA 4DK6A 3E8UH 3P9WB 1CG9A 3GBLA 3QISA 5GRWA 3EYOB 3LY6A 4BFEA 2ZP0T 4JLRA 1IGML 2A6KA 3AC0A 3HC4L 2Y23A 1EDQA 3WCYA 5CZXD 3HC4H 1ADQA 5I74C 5J9PA 1EEYB 1S78D 1IGTB 3GO1L 4RFOH 2V9RA 4BKLB 1HZHL 4LCIL 2DQTL 3NGBB 1MCQA 2YZ8A 4AH2B 4N68A 1V05A 1HZHH 3WLBB 2DQTH 5DJDB 5HVGB 3S37H 4BFIB 2MHAA 4KK9D 1M7IA 2VQUA 4OZ4B 1EZVY 43CAA 4JAMB 5JO5B 4LARL 5H35A 4LARH 1DVFC 3NIFF 5JIHA 5CIPH 5FGBC 4Q0XL 3MJ6A 2X4RB 5EU5B 2P42B 3TZVA 2BSED 4JHWL 2QR0B 1CXHA 4Q0XH 1KNOB 1INDH 4JR9H 5E4IA 2XIDA 4JHWH 4ZUWA 3PHOB 3P77A 4KUCD 1OGTA 1VFAA 3DV4B 4OGYH 4WU5B 3ARFA 1P7QB 5D7IA 2XACC 4NZJA 2NZ9C 1N6QL 1JPFA 4MLIA 5IMKA 1G9EA 4P2QB 3P9LB 2ITCB 2XY1A 4RMUA 5DDHA 4Y4HA 5I16A 3C60D 5KANI 5EBMA 2IQAA 3TYFB 2FX8L 4HJGB 1R3KA 4V1DB 3VXOB 1M7DA 5C0BA 2FX8H 3QWQB 3GMNB 3JV0A 4QCIA 1NBYA 3SY0B 1JTPA 4G6AC 3U9UA 5KW9L 1UJ3A 4HIXH 5JW4R 3T4AB 3HPLB 1SYVB 2OJZL 5KW9H 3OPZH 4M03A 4QRQB 3V6OE 4Y19E 4NCC1 1WBXA 4WU7B 3QUXA 2HTLC 3GMQA 5DWUL 3QH3B 3RWEA 4S1DD 1MQ8A 3PJSA 4Z7OF 3ULUE 5DWUH 2DLGA 2MCG1 2YC1B 3KPQA 3VFWB 3F7RA 1MJJA 1MH5A 5HVWA 2EDTA 1JI1A 4G80A 1PVHA 4EI6A 1DR9A 4H0IA 2NYYD 3IDYC 2F74A 4PS4L 5C08D 3TZVC 4IOIB 3MRNA 4PS4H 4MJIA 2IBGA 3KPRB 2BNRE 4OF0A 2BFVH 3NTCL 4AENB 3RNQA 4TULL 3MJGX 3NTCH 3KHOA 3ARFC 2P43B 2QQKL 35C8L 2IG2L 1KC5H 5ID1A 1L4IA 2QQKH 35C8H 5IVOA 4K94C 5E6IA 5GGVL 5TF0A 2IG2H 4Y4HC 1AGBB 1KTDA 5GGVH 1RZIA 3QUMH 2D2OA 3KJ4B 1CTNA 2CLRA 4C54A 2NTFB 3I6KB 3MRIA 1C16A 2I5YL 4Q9CA 3A67L 2P8PB 5FM5M 1IAIH 2FL5A 4TUJB 4OQ1A 4LGSB 1JPST 4PRDB 1UJ3C 1WBYA 5GGUB 4L8BB 5IOPB 4PRAA 4IDJL 1FZJA 3V0VA 1HH9A 3QCVL 4IDJH 3PV6B 4W68A 3DBXA 2P5EA 3LB6C 4YPGA 3V6FB 4CVZA 3QUXC 2JK5B 4K7FA 4Y0GA 3RKDD 3IVKA 2VDQL 5E24E 2VDQH 4I2XB 4N9GB 2HMIC 1BQUA 3CX5K 4RZCA 5A2LH 1YY9D 2VSDA 1I7RA 3VXMD 4EXPX 3QUKA 3BWAA 4MB4A 4U7MA 5AYQA 4N1HB 1KJVA 1VKXB 4HK3N 3RL2A 3DVIA 3IF1B 4WGVB 3EFFA 4FFVD 5EUOE 4GRLB 4PFEA 1A9BA 3DXAD 1T1ZB 5IFJB 2G5BA 1XGTB 3CFBA 2PXYB 2VZUA 3W5NA 1GGIL 5E6IC 1GGIH 5DEGB 4PJEB 1A1NB 1T0MA 5IM7B 2QL1A 4WGWB 1U2HA 3FOMB 4U0RB 4QRRD 1I7UB 2MFNA 4OCNC 4HJJH 3T0VA 4LQFL 2EXWD 2HAZA 3B4NA 4LQFH 1NGPL 3O3DB 3QDGA 3T77B 1U8KB 3VH8A 1BZ7A 4MNQB 3WHE0 4JQXA 5GRVL 3S4SG 5F72S 3QHZL 4XPAL 1NCAL 1OP3K 2YPKB 4XPAH 1A22B 1BOGB 1NCAH 3K1KC 1YQVL 4UOW1 5TE6L 4Z77B 1I3RB 1SY6H 4JFOA 1WTGT 4ODUB 1HHIB 3QZWA 5TE6H 4JFXB 4MNHB 3RKPA 3HS0B 4HIJB 4X7CC 1LK3H 4WI5A 2OZ4L 2P5WB 2X4QA 4Q2ZB 3LKOA 1QLRB 1IFHL 4D9QD 1S78C 1JUFA 1C08B 1FV1A 4PJAF 1IFHH 1EGJA 2GEEA 2BNUA 1CICB 4OI7A 4G42A 4X6EA 2CKNA 2EIZA 2AABL 1MCCA 4Z7VB 5KZCB 3VW3L 2XXCB 5K59E 2AABH 1RJYB 4JREB 4ORGA 3VW3H 5T5NG 3GGWB 3TPUA 2IH3B 5DD0L 1A3RH 4K3DL 5ISZA 5DD0H 4ONGL 3RPKA 3VGEA 5DRWB 2P7TB 1M05B 4K3DH 4ONGH 1SEBA 3EO1A 3GSOA 2BVOA 2R1YA 1AR1D 1X5IA 2G2RA 4GXUM 5SWSB 1P7QD 5F3BB 1H3TA 4ODWB 4LRIC 4H8WL 4P2QD 3RWDA 4L4TA 1TFHA 4DN4L 4JQXC 1FZKA 1R6VA 4H8WH 3DGGA 3C60C 4DN4H 5DK3A 4KHTL 4CMHC 3I84A 3JV6B 3SDXA 1N5AB 3TBTA 2FJFB 4HEPG 2V17H 1TPXC 3QT2A 4KHTH 4JM2B 3L3GA 4KKCD 1QKZL 2OSLA 4Y5XB 3BGFB 4JO3L 2ZZUT 4L29B 2DTSA 2MQ3A 5L8KB 2JB5L 1DUZB 3INUH 4JO3H 5C2BH 4KZEL 3BGAA 1RY7B 2GITA 2FGWL 3LS4L 4KZEH 4HWBA 1EVTC 4JJHA 2FGWH 3X12B 5C0DB 1PEZA 1HHHB 3E2HC 5HSFA 3NIDE 3M45A 3ZT6A 5IR1B 4QXUL 1UVQA 3MFGB 1U58B 4XVSL 5C7XL 3ZKNC 4UT9L 3DSFL 5ECJE 4XVSH 5JPNB 5JA9A 3GMOA 4ZNEE 4UT9H 3PIQA 1FNSL 4IHOA 1DDHA 2NYYC 2HFEA 2F53E 5C07A 3KPRD 3RVTC 4HW6A 1UM4L 5DVLA 4PJCF 2NZIA 2WUCL 1UM4H 1Z2KA 3QEQE 1VERA 4OZFG 4Y2DB 3QEHA 2FATL 3GSXB 4MJ6A 4C57C 4ELKB 5EIIB 1AQDB 2FATH 5EZJA 5IB3A 3V5DB 1FHGA 1WAAA 4EOWL 4Y1AB 1P4IH 5CSZB 1JNHB 1VGEL 1TTUA 4LDLB 4EOWH 4GKNB 4QRRA 5MEQB 4KROB 1H3PL 1VGEH 3GJFB 3DROB 4QRUB 1S8DB 2DI7A 4IEFB 1CFNB 1H3PH 3ULUL 5GJTL 4WEMB 4LF3B 3ULUH 2V2WA 4P0DA 1G7HA 2ZSWA 3CIQA 5C0IB 2BVQB 3IFNL 2IPKB 1OLZA 3HTLX 5L88H 5KVFH 3TF7C 5JW4N 4YK4C 1TVHB 2VXTH 2W91A 4OCMC 5IFHL 4NHUA 4NQVB 5T3ZH 3OWEA 1EO7A 3WNKA 1Q9WA 3MYJA 3O2DA 1DQDH 3EYOA 4BM7A 1KPRA 4WFHE 4XWOD 4JPVH 4KGLA 5IVXE 1YY9C 3BPNC 3D2UB 4O58L 5C0RH 2J4WL 4KTEL 1ZGLB 1T6VN 1EEYA 3B2VL 4O58H 3V4PL 5IROC 4NDMB 2EYRB 1J9CT 5F93C 4BKLA 3SJVB 5F6IC 3V4PH 5CUSL 2X4UB 5L2JB 1M1SA 4BFIA 3BN9C 5CUSH 4FFVC 5CSBA 4GRLD 4P23A 1LDSA 3MBXH 4OZ4A 2H41A 5DD3L 4XVUC 4GS7B 3F7YB 5BZDB 1IEBA 3RQ3A 5JO5A 1UZ8B 1KXVC 4N1CA 2CO6B 2PXYD 5DC4B 3QWOA 3VFTB 3OAZK 1QUNA 4LSQL 1S7QA 2BY1A 2X4RA 1RJCA 2QR0A 3SGEI 4Z0XA 3WUWB 1KNOA 1FNGA 5LCVH 5KVGL 4MNGE 3PHOA 5BVPL 3RPIB 3S96B 5IBTH 2FLRT 5FF6B 4DZBB 2EXWC 2Z35A 5C0NC 3DV4A 4WU5A 3GJFK 1P7QA 3IKKA 4BQ8A 1NGXB 1W72L 1XR8B 3CFJB 3QHTC 3P9LA 4MNQD 2ITCA 3D48R 1JTTA 4G7VL 4LLDB 3RJDA 1UENA 5ANMA 2GAZB 2X89D 1RZJL 4G6MH 3TYFA 2P47B 4HJGA 4V1DA 1AHWA 3VXOA 4ODVL 3QQ3A 3T04D 3MROB 4D8PB 3GMNA 4ODVH 3SY0A 3VGFA 1OT1A 3L5XH 3ZL4L 4RGNE 2ZOKB 1PQZB 5JW3H 3RWGB 1SYVA 3ZL4H 5K9KB 2NR6D 5DA0B 3IFOB 4QRQA 1YEEL 5IHLB 2P5WD 4Q58C 1U8PB 2QSTA 5ITFA 1YEEH 1T0PB 3HE7B 4QTIH 1K8DB 4HF5L 3SDDB 3KAAA 2C1PA 1D6VL 3NGBC 3GK8L 3OKNB 3ZSTA 2LAAA 4N0CD 1BJMA 5C9JB 4OI8A 3CDYA 1IM3A 1O7VA 1KENL 5KZCD 3VFWA 4KI5D 4PY8I 1J8HE 1S7RB 1MI5B 4L9LB 3TYGL 5KG9A 3V8OA 5EFIB 1A14L 1KENH 5DUPL 3G6DL 2ZKHL 5GS2H 3KPSB 1A14H 5DUPH 1GGBL 3G6DH 3O4LE 2ZKHH 3SN6N 1ZS8B 5GGRB 3K2MC 2OL3L 2AJUH 3EDKA 2Q1EA 3VRLE 2FBJH 1J18A 1HXMB 3F12B 5SWSD 2P44B 5DUBB 3RVUD 4TVPD 2V5RA 5E2WH 3OV6A 1AGBA 2UWEF 1CGYA 4NBYB 3T2NL 4FFZL 5FYKE 1AHWC 4Z7WE 4JB9H 2NTFA 3T2NH 1SVZA 3I6KA 3ZKQD 4WHCA 2H9GB 1D6EB 4JM2D 2P8PA 4KKCC 4TUJA 5GGUA 4X4YB 3SGDI 2FH6A 4GSDH 2IPTH 1SJVA 2H45A 4GKSA 4CKVX 2FBOJ 3PV6A 5HJ3B 1A9EA 2DJ4A 2V5TA 2OTUA 4GLRH 1ZT4B 2JK5A 4KMTL 2Q8BH 1ZLSL 1H3UA 4HKJB 4ZUSB 3P9MA 4KMTH 4R96B 4I2XA 5TF1H 4N9GA 1J5OL 3STLB 3ILQD 1PX4A 3HZMB 4P4RB 1NMAH 2XRAL 3P3YA 4HIHB 4IJ3B 4LGRB 4O4YL 4PJXE 3VXRB 3QCUL 3MLXH 1G6RL 1SMAA 1QBLL 4FQJL 1OAUH 1DN0B 1G6RH 4M7JL 3VFOA 1KPVA 5LGJB 5DJCB 1QBLH 2IALB 1EUUA 1BLNB 4JCLA 2MCPL 3RWFB 1A6WL 5L2KE 3IF1A 4HIEB 4HSQA 1RK0B 4GRLA 2MCPH 1T1ZA 2VDNH 3KPMB 2HRLA 4XPGH 1XGTA 1E4XL 4NBXB 4R7NA 4Y2DD 1XGPB 2PXYA 3RY5A 3WUZA 2AK1L 2WK2A 1A6ZB 5IWLC 5J1TC 5DEGA 1A1NA 5IM7A 1YMHB 5JW5B 4Y1AD 4NOBA 3KJ4C 5DRXB 4ZSOB 1NMBL 1JN6B 1UKTA 4LPTA 3WD5L 2DF3A 1NMBH 4KROD 4WUUB 3K4ZA 3WD5H 3TC9A 4D9RD 4EZMA 3D69B 3JUZA 5MEPB 3H9SE 3O3DA 1U8LA 1DQML 3T77A 1U8KA 1IGJB 1F8TL 1WWBX 2QHRL 3MUHL 3QIWD 4MNQA 1JGLL 3VWKA 3RHWF 1DQMH 1F8TH 2QHRH 5D2NA 2X89A 3GMLA 3U2SA 1UM6H 4YHIB 3LN5B 4MYWB 4YEEA 5MEOB 1BOGA 3SGKA 2Y36H 4I13B 1I3RA 4ODUA 4R0LB 1HHIA 3UYOD 1MRFH 4MNHA 4OZIE 5FK9B 5F88B 3O6LL 2CUMA 2D4FA 1NMCB 4L4VE 1YNKL 2DAVA 4GRMB 1NANH 4PD4J 3O6LH 3K8KA 1DBKH 3WIHH 2P5WA 1YNKH 3D2UD 4YC2B 3T0EB 3VFSB 1QLRA 3H9HB 1PKQA 3QFDB 2P48B 1C08A 3SJVD 3DX7B 3B9VA 1CICA 5HTSA 1CXIA 1FFRA 1VESA 5GGSB 4NIKB 1H9VA 4YO0B 1CTOA 4GRLC 2QQNH 4Z7VA 1F3DH 1MAJA 1NL0H 4OF5A 4NQSA 4JFDB 2A1WL 1J86A 5D7JB 3BKYL 5C0AE 2PXYC 1ZLVH 2RBLA 2IH3A 3FB5B 2A1WH 3EOTH 3BKYH 4LKCB 4JFFB 5GIRB 5DRWA 2P7TA 1M05A 2ILLA 2ARJA 4PJEF 2F15A 2R39A 4L3CB 2E6QA 5IHBA 1JGEB 5SWSA 4PJIB 5F3BA 3GSWB 1BF8A 4ODWA 1G0XA 4K9EH 4I3RL 1E4JA 3VWKC 4M1GL 4I3RH 3RY6A 1ITCA 1UXSB 2UUDK 1T0NB 3NCBB 4M1GH 1J88A 3JV6A 1T04B 3SGKC 2HVJB 1B6UA 3O41A 1UH4A 4B53A 1JTOA 3ZT7A 4UOW0 3DX6B 1Z6JT 2FO1A 4Z8FL 1HYRC 4Y5XA 4L29A 3STBA 2VE6A 4WRLA 4Z8FH 3NFNB 2NR6C 4NO0B 1BJ8A 5DGRA 3GIZL 5JIKA 1PLGL 3HE7D 3K74B 3KYKL 3GIZH 4JDZB 3X12A 5C0DA 3R0MA 4JRXA 3MUZ1 3SDDD 5D5MF 4DKEL 1HHHA 3KXFE 3KYKH 3RGVB 3D25B 1QPXA 2J8UF 4NQCE 2EDBA 1CICC 2DN7A 1IM9B 3NMEA 5EH1A 5GGTL 4GG8B 4N0CC 3U6RA 5IR1A 2P49B 1FN4A 2NX5A 5GGTH 3TJHD 4KI5C 1MI5D 3MV7A 5JPNA 5CMAB 4WTWA 4PP1D 1N64H 5DR5L 4OFIA 3ZDYE 5JQHC 3KPSD 5DR5H 5CLWA 1NGYB 3JTSA 3ZHDA 4ZNCD 1AIFB 3OJDB 1NJ9A 4F8TA 3ARQA 4M5YL 1UYWL 3SKJL 1QPPA 4GG6F 5CP3H 1UYWH 5DURB 3SKJH 4QNPF 4K3EL 4Y2DA 1BD2B 3GSXA 3EOAB 1UWEH 3RVUC 4AMKL 4ZXBA 5EIIA 3D39B 2BOCB 1FGNH 1AQDA 4OZHF 4CRPA 4GW5B 2YPVL 5CSZA 2AXGB 4GKNA 2YPVH 1CK0L 3GJFA 3ZHKA 3PWPA 1CK0H 1IAII 2AV1B 4WHDA 4XI5D 5HHOA 3RZCB 3L5IA 3EYFB 2Z92B 4FQQB 4Y5XC 1L7TL 3BGFC 1AJ7L 4OCRL 4JM2F 2EDNA 5CCKH 3UBXG 1AJ7H 4U1KB 4OCRH 2BVQA 1ORQB 1YNTB 1II4E 4G8GE 1TVHA 5EOQH 5JXED 1MWAB 3N1QC 5T3XH 4FN0A 2Q8AL 2LV4A 5F1NB 2Q8AH 4ZQKB 1C12B 3X17A 3G08A 1RUAL 4KJQC 4NZRL 3VXRD 1EEUA 1RUAH 4NZRH 3MLPA 4TNVK 1ZGLA 3NACH 1HHGA 1K9TA 3D85B 3O11B 4NDMA 2EYRA 1UB6B 4YNYA 5CINL 4HEME 4FQLH 4HFUL 3U9PL 5L2JA 5CINH 4E5XA 3HZVA 5FYKL 4KQ3H 3EO9L 4HS6B 4KDVA 3U9PH 1QSEE 3B8YA 1NGZA 4U1HB 3VFGH 4ZODA 2H6PA 3F7YA 5FYKH 3WJJA 3EO9H 5BZDA 1UZ8A 5IB2B 1MFEL 1YY8B 4Y2DC 4JFEE 4LOUC 3V6BR 3DO3A 3VFTA 4ZXBC 1MFEH 3OHXA 2YEZB 5T1DH 3U0TB 5A43C 3WUWA 3L5JA 1CD9B 3DO7A 5IG7B 1FFNB 5CEZH 4AEFA 2FO4B 3RPIA 3S96A 4OZFB 3MZTA 5EOTA 1C7SA 4KROC 3KLHD 1NGXA 4G8IA 1FFPB 2DLIA 4OUUB 1P1ZA 1TMCB 5I15L 4LLDA 2A2QT 2GAZA 4OCSL 3FRPA 5K9QG 4OCSH 3HNSH 3MROA 4D8PA 3DTXB 4DFIA 2Q3AA 1I7TA 1NFDF 1Y0LB 3K80A 1V7ML 1IVLA 4OLUL 2ZOKA 1PQZA 1V7MH 1ZGLM 5K9KA 4OLUH 4X5XA 1U8PA 4RCAA 3S8WA 3T0ED 3K1DA 4APQB 2M26A 3UZVB 2XKNA 1JWMB 1AR2A 1KLGB 4LVOB 3SDDA 1OTTD 4NBZB 3WNLA 3BZ4B 4RSVA 1RZFL 1BX2B 5C9JA 5DVMA 2HT4D 5MHSE 5M95B 1H3XA 3SDAA 1D5IH 4GS7C 4RAUB 2W1NA 1MI5A 3WJJC 4MJ2A 5EFIA 4JFDD 3FFCE 5D7JD 4UT6L 5EOCL 3QEUB 1UZ6E 5F1KC 4JFFD 5AD0A 5E4EC 5GGRA 5C09E 5LWYL 5LWYH 1EA9C 5E6YA 4YE4H 5JQ6L 4XCEB 5C0EB 4MCYB 4MCZB 1P4LB 1HXMA 3F12A 3KR3L 2PF6A 4F7PB 4OD2B 1HILB 1AXIB 5DUBA 4I1NB 1A6TA 1EZVX 1I3UA 1RUMH 4E0RA 1SBSL 2M2DA 3MTRA 1U8JB 4XPHL 3IDGB 3EJZC 1SBSH 1MELA 4XPHH 4CDHA 4QRPA 4P46B 2QBWA 4NT6B 4WV1B 1X5FA 5F8QC 1TNNA 1B4RA 1D5BB 1FJ1B 1YPZE 2YRZA 5IGXL 4M62L 4NO0D 4NOFA 4LCWE 3VA2C 2F5AL 1DQLL 4OZGE 5HJ3A 4RMTA 1UWXH 2F5AH 4YHOH 1DQLH 1VSCA 2KDGA 3HNVH 3CFDB 1DZBA 1P2CB 1NEZB 3SDDC 3RGVD 3G6JB 2XY2A 1P7KA 4ZUSA 3MPCA 5EO1A 1P6AB 1IM9D 4ORZC 4R96A 4NKIH 1F58L 3STLA 4HBCL 5KS9E 3HZMA 3GMPA 4HIHA 4OCXH 1F58H 1T7VA 3GI8L 3SDAC 3N9GH 3MUGB 3QDMA 1A64A 4PP1C 3GI8H 5DMJB 3U4EB 3V4UH 1EV2E 1QFPA 2C1OB 1OP5H 4DCQB 5LGJA 5TDPB 5JHDA 1BLNA 2ADJB 4X7EC 3GNML 4HIEA 4E41E 3H6JA 1BM3L 3MA9L 1RK0A 4KVNL 3JZ7A 4JY5L 1QSZA 4GT7A 3R0NA 1BM3H 3KPMA 4UINH 4JY5H 5DURD 1NCDL 1XGPA 1BD2D 3ECBB 1TENA 2VXVL 4D3CL 3HAEH 3D39D 2EZ0C 1NBZA 1A6ZA 4MD4A 1I4FB 1JGVH 4HPYL 5E9DA 4D3CH 1H0DA 3C8HA 4ZSOA 4HKBB 2A9NL 2J8HA 1JN6A 5DEZA 1XGYL 5D8JL 2EDHA 4FMKA 1MAKA 4P5KA 1XMWA 1V5JA 4WUUA 2JF1A 4AQOA 1F6LL 2N7BA 3FAWA 4LMQE 3RZCD 5D2LB 1VFBB 2OLDA 1IGJA 1NFIB 3QXVA 4F37K 2NY3C 2CKBL 3NAAL 3I3EA 4K8RL 1EK3A 2CKBH 3NAAH 4YHIA 3LN5A 3LRSB 3P30L 5TQ2L 2YD2A 4P9HC 5TQ2H 4P57B 1NUDA 4HXBL 5BJTB 1ZLUH 5A2FA 5HHNB 1TNMA 4HXBH 5FK9A 5F88A 5A16B 4AEHL 4GRMA 4ZFFA 2DLHA 2EIBA 5FYLE 4AEHH 3L7FB 3VFSA 5T1MB 3QFDA 3MV9E 2FB4L 3D85D 3DX7A 2FB4H 1HEZB 4LEXL 4BQBA 1U3JA 3CZFB 1GYAA 4LEXH 4YO0A 1MHPH 4NCC2 1WGOA 3BJLA 5B38B 4DZ8A 5CGYD 3BI9X 4JFDA 5D7JA 3VMNA 1CE1H 3VXSB 2Z9TA 4LKCA 2BOBA 3TJEH 4JFFA 1E4WL 3H7BA 1FL3B 3PWVB 1E4WH 4K71C 3VXUB 3LN4A 4L3CA 4GAFB 1IARB 2YD9A 1JGEA 1U42A 3ROOB 3KLHC 5E00A 5J06A 1BHGA 1NCWH 1QFUL 2DQIH 1G7IB 1I9EA 5DMKB 3CH1A 1VFUA 1QFUH 3QQNA 1UXSA 1T0NA 1U9KA 4R90L 1T04A 5F9JB 5C0JA 1C5DB 3B6SB 3MRLB 3DSNA 4R90H 1MJ8H 2AEQL 4DUXA 4PJ9B 4L3AA 5DHVA 3DX6A 3WXWL 2AEQH 4Y4KA 1VGKB 4Q9RL 3WXWH 3CX5J 3NFNA 1DN2A 4NO0A 3IETB 1TZHA 4Q9RH 4TUOB 1HQ4B 1W0WB 2E6PA 5CEXB 4WHTA 4LDEB 1WFOA 4JDZA 4APQD 3HAEG 1CLOL 4OLVL 5ICZB 3RGVA 3BDYL 4HLZH 2OL3B 2YN3A 3P4NB 2H2SD 4I0KA 4OLVH 4XCCL 2BY0A 4FZ8H 3BDYH 4OUOA 2YSSA 4MA8L 2HT4C 5JIIA 5IW1B 2DLFL 1ZWIB 3JSSA 2DLFH 2Y06L 5INDB 4H25B 5D7JC 2PYFB 1BIHA 5B4MD 2YKLL 4JN2B 2Y06H 3RWCB 1T1YB 1NGYA 5GPRA 2YKLH 5D7KE 1UCBL 5GHWH 4HWEL 1BVKB 2HT2D 3BIAX 3OJDA 1WLHA 4HUVB 1LNUB 1YJDC 4HWEH 4AL8H 1I1YA 1MHHA 2X5PA 3HZYA 1CXKA 4KUZL 1BD2A 3EOAA 3D39A 2BOCA 1KGCE 5I1CL 4H0HB 2AV7B 4GW5A 1TQBB 5I1CH 2AXGA 3L9RB 1QSFB 3MCKB 1V7NL 4HX1B 1DQQB 3OKKB 3U82B 1HH6A 4P46D 1RIVH 3FQRB 1CN4A 4ZPTB 4WTZG 3RZCA 3FKUS 1F2QA 2N1KA 4Y4KC 5HYJA 2XG5A 1B0GB 4WVRA 5IB4B 1U8IB 4X0KA 1UFUA 2FJGA 5DVNA 1ORQA 3QUZB 4U6VH 4GQPH 3T2QA 1MWAA 2VLME 5HHMB 3RGVC 2DLEA 4P5TB 1LO0L 2X05A 4KY1H 1A0QL 4OF3A 5EB9A 2Y9RT 5F1NA 2D7PA 4U6YB 1MQKL 3TT3L 1LO0H 4ZQKA 1C12A 3BN3B 3UJTH 3AAZB 1MQKH 1GGYA 1T5WB 5GS0H 2W0LA 4R4BA 2YXMA 2R0WL 1IT9H 4MHHI 4JPIB 4HH9B 2BRRH 3L6FA 4ZFGL 2R0WH 1UB6A 3IDXL 4IBLT 2WUBL 4ZFGH 1H8OA 1NLBL 3IDXH 5IMLB 5LGHL 3MLSH 2WUBH 1QLEH 5J57B 4M00A 3I6GB 4HS6A 2NY7L 1MLCB 3RZWA 4U1HA 1FSKB 3Q5YA 4ODTL 4JKMA 4XAWL 2CGRH 2NY7H 4P2YA 4RIRB 3IDIA 1K6QL 1YY8A 3EDDA 4ODTH 4RRPA 4XAWH 3MMEB 5T5NF 2ESVE 2Q86B 2YEZA 1K6QH 2IPUG 3QUYB 3KPTA 3REWA 1OSZB 5I8KL 3U0TA 5DMIH 3LPWA 1W2KT 4IOFC 5IG7A 4ZOCA 1CWVA 2FO4A 3KS0J 2AS5M 4K7PY 3JTTB 3PGCB 4YZFF 5JIPA 2J12B 5A2KH 3RZCC 1I1RA 4NN5B 3MNVB 2G5RA 1FFPA 4NNPL 1JYXA 3CX2A 4QOKB 4NNPH 1I7ZB 3QEQB 5HGAB 3ZYJA 1T80A 2ZUSA 5I8CB 4YIQB 4JFHE 2DBLH 4NNXA 3DTXA 2DWEB 4Z76B 5JA8B 4JZJB 2CD0A 2GY7B 1OW0A 5TQ0L 5B8CB 2DKMA 2BSRA 5T1KB 4L8CB 4UMGA 5A3ID 2V7NB 3GMMB 5TQ0H 1FO0H 1SYSA 2V9TA 5AUMB 1HHKB 1R3LB 3QIUB 1U8MB 2M1KA 4I18B 3TFKD 2N4IA 4APQA 5DMYA 1AGDB 1JWMA 3AMLA 1KLGA 3U7AA 3C8DA 3MRQB 3X11B 5D7IE 1VB9A 3BZ4A 3FT4B 1IQDA 3QQ4A 5MI0B 5AYUH 4CN6A 1YN6B 4HCRL 1QEWB 3LH2H 4PGJA 1CGXA 3W9DB 2ZJSL 4X9BA 4HCRH 1XF3B 3IB4A 5CGYC 2ZUTA 1FBIL 3G04B 4JG0H 5C0BE 4ZUTA 3CLEH 1FBIH 1SJHB 4LGPB 3QEUA 3FJTA 3IFLH 5IP4A 5IVXB 1JP5A 1G84A 3O3UN 3FQUB 3H2WA 5J89A 3VXUD 4M43L 4ZFOA 5C0EA 3AS2A 1P4LA 4XB7A 4M43H 4ZO7A 4OD2A 1HILA 1EMTL 3V0WL 3PGDB 3DUHA 2XPGA 1EMTH 3V0WH 1T2XA 3T65B 4DEPB 1Q1JL 1RVFL 1U8JA 5FYLL 3IDGA 5MP6L 5EO0B 3QG6B 4F7MB 4U3XA 4UV4L 5FYLH 5FGRA 3HI6L 3CLFL 5DRNB 3JV4B 5C71A 4P46A 2YUVA 3CLFH 4G7YH 1MJ7L 1OW0C 2FJHB 3TV3L 2YWYA 4WV1A 1F6AB 5ALBL 1MJ7H 3TV3H 1FJ1A 5FUOL 4MJIE 5ESVA 5FUOH 4L5FL 3ZKXB 2ZCLL 3FZUC 1VCAA 3K46A 3QJFB 4M7LL 2PKDA 4L5FH 4APQC 2ZCLH 3OB0K 3DVNB 1P2CA 1NEZA 4LVOC 4ZO6A 3BXNA 1RJZA 4M7LH 3G6JA 3VXQA 1DBML 2H2SC 4LLQA 3O6KL 3TO4A 1DBMH 4HGKC 2MKWA 3RY4A 1BGXL 4QHLB 1J0KA 5F1OB 4U1GB 4R26H 3HKFA 1U8NB 3MUGA 1UA6H 1BGXH 2Y5TA 3KYNA 3U4EA 4B5EA 2C1OA 3BHBB 3IDUA 4DCQA 3V79C 5TDPA 3TN0D 3CFCH 3MCG1 4LEOB 3HE6B 3QXDA 1CE6B 4H88H 1XFPA 2PTTB 3JWOL 2MPAL 2VRAA 2P5EE 2CXGA 4XVJL 1DL7H 1J8HB 2ENSA 3NABH 2EYSB 1PKOA 4RMVA 4ENEC 1RUKH 5CGTA 1G7JB 5GRJL 4HKBA 4WI6A 1QSFD 2IAMA 2V5MA 3RI5F 5GRJH 3O4LB 3ES6B 1OOAA 4P46C 4F7CA 4WV1C 5E1AB 5D2LA 1VFBA 1LP9F 3QIBB 1NFIA 1PBYA 3AMKA 5DD1L 2EIDA 1X9QA 5DD1H 4ZS6D 3QUZD 3LSOB 2PCPB 3MOBL 4OCWL 5HHMD 3MOBH 4KJPD 3UXFA 5BJTA 4P5TD 1NCCL 4OCWH 2HFFB 4ONOA 5HHNA 3TO4C 2CDGA 5A16A 5EG6C 5I0ZA 1A4KA 1ACZA 3BOVA 4YGVA 1WQVT 1K2DB 4UI2A 5T1MA 1P7HL 1HCVA 4PJ7B 1FFOB 2C4FU 2D7TL 1IEAB 4HBQA 1JZ7A 3M17B 5F70A 2H1PL 2UWEA 4CVXA 3QDGE 2P4AB 2HTKD 3LKQA 2KZWA 3H42H 5BZWB 3HMXA 3CC5B 4JANA 2P8MA 3UC0L 5B38A 2DJSA 4X6BB 1S9VB 3EKCA 4UOJA 1NBQA 4ONFL 3VXSA 3ULUF 1UWGL 3QUYD 4M6ML 1UWGH 5E0QA 4QXGH 1BREA 2DMCA 3T0WA 3PWVA 1RIHL 4CAGA 1MCPH 3VXUA 3GI9H 3QDJB 1RIHH 2HJLB 2DTMH 1U41A 5L2KB 3ROOA 4NFDA 2QSQA 1G7IA 3GFUA 3QSKB 5DMKA 4QOKD 1W8NA 3WDHA 3QEQD 2ADFL 4G3YH 1Q72L 4LSRL 2ADFH 5F9JA 3VE0B 4PJ8A 3B6SA 1X5GA 3MRLA 1Q72H 4LSRH 4JRWA 4PJ9A 4Y5VB 2OI9B 3BIKB 4P3CL 3FQXA 4BZYA 2IWGA 4R4ND 3FO2B 1AD9B 5T1KD 2E7LA 4UUJB 1VGKA 2GSIB 5A3IC 3ET9F 5ISZE 4U2ZA 3IETA 2W65B 3QRGH 1HQ4A 5EBWA 3QIUD 4XPFL 1KJ3H 3H9SB 1W0WA 1KN4L 2C3XA 2A6JB 3TFKC 4XPFH 1OM3L 1KN4H 3KYMA 3M07A 1EJ6A 2EEAA 4I0CC 1KIRB 3P4NA 4YWGL 3EFDL 3QEGL 4L4TE 4NZDA 4YWGH 2Y5EA 3M8OH 1CXFA 3EFDH 3QEGH 5FOJA 5IW1A 1ZWIA 2PUQT 1A4JB 2EKSB 5FV2A 3SDXE 1ADQL 1F00I 4N8PA 1UADC 2PYFA 4WJ5B 4YHML 4LU5L 1ADQH 3RWCA 2VZ1A 1T1YA 1I8KA 4YHMH 1FLRL 4NO3B 2HN7B 4LNVA 1BVKA 1F45A 1REIA 2RGSA 5HPMA 3SE8L 3IFPB 4HUVA 1RJLB 1D5ZB 4BQ9A 4MXQD 2OK0L 1JRHL 3L3OA 3PDDA 4X8JB 4IOSD 2OK0H 1JRHH 1XF5B 4MS8C 5IESH 4OLYH 3IDMB 3CXDL 4HDIB 5EUOF 2EECA 1P84K 4HHAA 4IIQB 3L9RA 5C0AB 1QSFA 4PJ8C 3HUJF 3C09B 1LK2A 4JO1H 3I50L 4PJ9C 3ISWA 3FQRA 5I0DA 2EDKA 3QNYB 5I8OL 2E7LC 3I50H 4OI9A 1LO4L 4K94L 1B0GA 2X1OA 4QRSB 5IB4A 1U8IA 5C07E 2NLJB 1LO4H 4K94H 1R5IB 3B43A 4TSAL 3WBDA 3W2DL 4TSAH 4X99A 4XP6H 2F54B 1HNGA 3RRQA 4P5TA 2J6EA 3QP3A 4LP5A 4ZFZB 5D96C 5D6DA 3AAZA 1WAAE 4KKAD 2EDWA 4Z95L 1DSFL 4RGND 4QRRE 5J1AA 4Z95H 5GZND 1DSFH 1D9KB 2IH1B 4FQXB 5AEAA 3EZJB 1F4YL 4WO4A 3VRIB 3HE6D 5F9DC 5IMLA 1KB5A 2AJZB 1JGDA 3I6GA 1MLCA 2D4DA 5I6XB 2VLRA 4X98B 4NQCB 4JRYB 3UAJD 5I1JL 1CFVL 4RIRA 2YA0A 4GUPB 5I1JH 1CFVH 2Q86A 2DDQL 1N6VA 1J8HD 3QUYA 2AXFA 2NY4D 3WV0A 5FGCB 1TQBC 3W0WA 2JB6A 2I27N 5C8JB 4M6OL 1IRAY 4DGYH 3O4LD 4G8EB 5K59F 4M8VA 3BPCB 1FG9C 1JPGB 3PGCA 1CDCA 3BP6A 4M6OH 1T4KB 1YMMB 1L6XA 4LAJH 3LDBB 3VGDA 4YPJA 3VD7A 3QIBD 4NFCA 5DHXB 4QOKA 3K2UL 5AZEL 5GGRY 1I7ZA 5HGAA 4ODSL 3K2UH 5AZEH 4ZS6C 4ZAKB 4O02L 1CL7L 4YIQA 4ODSH 3MX0A 4KQ4L 4O02H 1CL7H 3OR6B 1QVOB 4PRBA 4KJPC 2R0KL 3BSZH 4P5TC 2ICCA 5TFSL 1IC7L 4L8CA 2WIMA 4XCYA 2R0KH 2V7NA 3GMMA 2ED7A 4NC1C 5TFSH 4F57H 1IC7H 5D6DC 5AUMA 5GJSL 1L9MA 1AGFA 5J8OA 3GSNB 4OBRA 3QIUA 1U8MA 3UPRB 4I18A 3S3SA 1I8IB 3SKNB 2DQCL 1AGDA 2FEEI 5TGBA 3RFZC 4LPUA 1KCVL 2DQCH 3RWIA 2XXMB 2VDLL 5ACLA 1RURL 1KCVH 1J10A 3W9DA 1RURH 5KVDH 5ANME 4AIOA 3B5GA 1FSKC 1XF3A 3DUUB 4V1DE 3G04A 4HJ0D 5I18L 3NIDF 2X4OA 4NM4L 5I18H 5GRZA 4QY8B 5DQJA 4KU1A 3QUYC 4NM4H 2Q6WA 1FC2D 2ZG2A 5EU3A 4HUWA 3FQUA 4MD0B 5EUKB 1PEWA 3PGFL 3MV01 3S6CA 2IQ9L 1MFDL 4I3SL 4HS3A 4WWID 3PGFH 3QDJD 5FO7B 2IQ9H 5D1XB 3TO2B 4I3SH 4MX7A 5H2BB 4KPHL 2D03H 4NQEA 5EBGA 3V7AE 5L2KD 2LAGB 1MHCA 3A6CL 4NN5C 3OXSA 3PGDA 4NRXB 3A0OA 3T65A 5ID0A 5GS1B 4W70A 4WIQA 4JFEB 3QG6A 3BPOB 3NCJL 3TA3B 3U4BL 2PW1A 3CMGA 5SV4A 5DRNA 3SEPA 2C3VB 4LLAA 4X9GA 4IRSA 4MXWL 3NCJH 2EDXA 1ZHNB 2FJHA 5F71A 4MXWH 1BOYA 4EI5A 2AK4A 1F6AA 5E08L 1KULA 5J4MA 3VFRA 3QIUC 3H9SD 5DK0B 4LPCA 3ZLQC 1WF5A 4RDQG 4I18C 5F7NC 2HJKA 4OD1H 4X9FA 4R97B 3DVNA 4FQ2L 4TN9A 5EBLB 1WBZB 3MREB 4FQ2H 5MI0C 1ZVSB 2MQCA 1ZSDB 1ZKAA 1L0QA 5I1DB 2X10A 5E8DL 1X5XA 1XF4A 1U8NA 2YPLA 5E8DH 4NO2B 1OTUD 3BHBA 3OAYK 3BD4A 4FXLA 1EGJL 4H1LG 2OJEB 1FIGL 4GAGL 4GMTL 4LEOA 1EGJH 2MQ0A 3HB3D 5FCSH 1FIGH 4GAGH 4GMTH 2PTTA 1OWRM 5IVXF 4U1IA 2BK8A 3PABB 1PG7L 4M5ZH 3BFOA 2YD1A 3H3BC 4X4XB 1J1OH 2BC4B 4FHBD 2HFTA 5C6PB 3I2CL 5IHUH 3HI5L 2YOCA 4I2XE 2EYSA 3I2CH 2W9LA 3FFCB 4OGAD 1MRDL 3BDXA 3HI5H 5C0AD 5SWZA 1T3FB 5GISH 3CVHA 4NKOA 5FKAA 3WO3B 1T1XA 4IRSC 1TCRB 4WI3A 4DQOL 3O6ML 3QFJB 5C09B 4EI5C 5E1AA 3MGAA 4EUPH 3FO0L 2NXYB 3LCYA 3SPVB 2GJ6B 1HN1A 3FO0H 5E7FA 3UYRH 2VH5L 4ZOAA 1CQKA 4UBDD 4BYHA 1JWUB 3ZKXC 2VH5H 4UT7L 5C6TL 3CFEA 4PLJD 2HLAB 2PCPA 2OX5A 5C6TH 2F54D 4LVEA 4F9PA 5EC2B 1FYTA 3UROR 2HFFA 1CFSB 5ELIA 2YS4A 1H8SA 2H32H 2YN5A 4HUKB 1D5XB 3OKOB 3ARXA 3H7LA 2HH0L 4U1GC 4U1LB 2XQYK 5IV2B 3GM8A 4HWBL 4PGEB 4PJ7A 1YPZB 1IEAA 4E9LA 5GZNC 5C0CA 4LCWB 1D9KD 3ARDB 3T8XB 4M4PA 1DLHB 2Q3ZA 3ROLA 3HE6C 5KJRL 4MNQE 5BZWA 3UCRA 1YA5A 4WWKB 3RUGA 3CC5A 2HRPL 4LQ1A 5CKGA 5DLMH 4I77L 1XIWB 5D2NE 4NQCD 2JKXA 4JRYD 2HRPH 3UAJC 4X6BA 1GOFA 1S9VA 4O2EB 2IEPA 2Z31A 2ATPA 2FX7L 3L3DB 3S3PA 1M4KA 4K8RD 3VH8G 3BP4B 2FX7H 4Y4FD 4EDXB 3VWJB 1JWSB 2VDMH 1CT8A 5E5MB 4DVRL 2XV6B 3IXTB 2O26U 1OD9A 4HGMA 1O0VA 2W59A 3QDJA 2P5WE 1YMMD 1Q0YH 2LE9A 4E41B 1PKQE 1MCOL 3QZWG 5KSBA 5HDBE 1ZLWK 1F4XH 3WDJA 1MCOH 2HT3D 4ZTOL 3AB0B 1OSPH 1BBDL 1LD9B 1INEL 3C5SA 2Q7YB 3VRLF 3CSYA 4M7ZB 5J6GB 4ZAKD 3NH7H 4BZ2L 3VE0A 1U91B 1ULVA 4Z7VE 4KI5E 1P4BL 4BZ2H 2FGZA 4KI1A 4HFWB 2A83B 4F9PC 2R4RH 3BIKA 5F8RC 3ELAT 5I30H 3FO2A 7CGTA 3I3DA 2OM5A 2AQ3A 2GSIA 4HC1A 4K3JL 3LEVL 3AVEA 1PG7X 4K3JH 2W65A 4OKDA 5ABDE 4Z7WF 3D9AL 4YEFA 1A6UL 3D9AH 4BSVB 5ITBH 1A6UH 2XWJB 2IC2A 2CRIA 5SWSE 4PY7B 3WS6A 1QP1A 1KIRA 5L6YL 4D2NA 4RWYL 5DMGD 3DIFB 3O2DL 4TVPE 2UYLB 5L6YH 4J1UB 1JHTB 1CZ8L 4F3FA 5F7HA 3Q5OA 1DLFL 1WK0A 4EN3B 5FIEA 1CZ8H 3NZHH 4EDWL 4J23A 1WITA 2YD3A 4UV7H 4HJ0C 3GM0A 4WJ5A 2FIKB 1I75A 2DKSA 1MCDA 2F8XC 3ESUF 2EE6A 3F7VB 4NO3A 2YUWA 5EC1B 4NGHL 1UC6A 3IFPA 1RJLA 4U6XB 4LCUB 4PJXF 3MV9B 5IBUG 1LMKA 1D5ZA 1JZ4A 1AP2A 5D1XD 1KCLA 4X8JA 2AVGA 4M3KB 4ZDHB 1XF5A 4JRXE 3MCLH 4JPKL 4YHYB 5J3HC 1SBBA 5L0QC 4OQTA 5F7YC 3IDMA 4Y2OA 4NJ9H 4EQ3A 3U46A 4JPKH 4HAFA 4HIIB 3VG9B 3ARZA 3B3IA 4OSUH 4JFED 2NX5E 4IIQA 4S1SL 3MRJB 4RAVB 2R2HB 1K4CB 3TBVA 4S1SH 1GOGA 3MV7E 4FFWD 4Y5VC 2OI9C 2JJTC 3ILPB 3W39B 3FQNB 3WDIA 4S1RL 2MOVA 1FH5L 5CD3B 4GBXA 5HI5D 4NKQB 4YDIL 4QRSA 4S1RH 4TNWK 3R8QA 3NFPB 1UJTA 4YDIH 3UTPE 1DEEA 3GEWB 3AFLA 3PXJA 4XMLL 1BJ1H 1DBAH 3MRKB 4L4JA 5HYEA 3E0GA 2F54A 3GHBL 1XF2B 5IQ7H 3WS6C 3HC0B 3NCEB 2XA8L 4H20L 5IEHA 5I75B 2QSCL 4P5MB 2XA8H 4H20H 2QSCH 2HG5B 2EYTA 4KC3B 2BVEA 4U4BA 3ARVA 1QFOA 3KYOB 4Z78B 5DC9B 3PWPE 4OZIF 2IH1A 4FQXA 5HHOE 4V2BA 5I76B 4YFLI 3HB3C 2AJZA 1ETZB 2OS7A 1LO5B 5KTEL 4K7PL 3V52L 2Y4SA 4X98A 2WBJB 4JRYA 5DEFB 5KTEH 3V52H 3D1MC 1OARL 5K9JL 2E27L 4GUPA 1QFWI 3ARUA 3PHQA 1S3KL 1FRGL 2NY0C 1LEKA 1IC5L 2E27H 5D93B 5K9JH 1KLFA 2OXGA 2P45B 1FRGH 1IC5H 3FFCD 3DARA 5K93A 4OGAC 4HULB 5ACZB 1R5WB 5DTFB 5C8JA 1I9RL 4IIQC 5CIPA 4B0MM 3BPCA 1JPGA 1I9RH 3H3PL 1LEGB 5LXGL 1CGSL 1YMMA 2ICWB 1JGUL 1NKRA 3QFJD 4C58B 5C09D 5LXGH 3CNKA 2LTQB 5DGQA 1JGUH 4KFZC 4J3VA 4GBXC 2NXYD 2GJ6D 3PWNB 1P9MA 4UBDC 4ZAKA 3LQZB 3OR6A 4PR5B 2VXUH 4QWWD 3GSNA 1OP3H 3UPRA 1WIOA 3VFNB 1S9XB 5D7SH 1I8IA 4YH6A 1X7QB 1IAOB 2ARWA 3PNWB 4OB5L 4LCWD 1XGUB 4MA7L 4OJFL 3SGJA 3ARDD 1QOKA 4FQXC 1DTUA 4OB5H 5TDNB 4OJFH 1IAMA 2BRQA 1LO3L 3CZJA 2Z93A 4WWKD 4PGBB 5AZ2L 5SX5K 1XIWD 1LO3H 1QNZL 3DUUA 4OTXL 3MSPA 1QNZH 4OTXH 2E9JA 4MDJB 2LU7A 5T5FL 5FB8B 1F5WA 2EH7L 1PY4A 1XCTA 5F7DA 1GAFL 4NC0B 1UB5A 4ZOBA 1X4YA 1IJ9A 2XICA 1GAFH 4MAYB 5CD5D 4J3SA 1JK8B 4LPYA 4G43B 3ZDYF 4DGVL 4CN4A 3LDBC 5H2BA 4JJ5B 4E41D 2HKHL 4DGVH 5IIEB 3KPLB 1P9MC 4UTBL 1L6ZA 1QYGL 3BO8B 5GS1A 4UTBH 3Q3GB 1QYGH 4ZAKC 3EAKA 3TA3A 3V7AG 1MI5E 4ZUVA 1CG9B 1ZHNA 3QUMA 2CJUL 2WBWB 5I19H 2JELH 4N0FA 1UKSA 2CJUH 2JJSA 1CBVL 4K7PX 3PP4L 1CBVH 1CFQB 3FHAA 3GSRA 1JHKL 4EVNB 5DK0A 5J9PB 3PP4H 2OMNA 1JHKH 3KS0H 5CBAB 4O9HL 3SGJC 2CH8A 1KUMA 5EBLA 1WBZA 4O9HH 3CK0L 1URLA 4JFYB 2AAVA 1M7IB 3MREA 5DMGC 1OAQL 5IUSA 1ZVSA 3EYQD 1ZSDA 43CAB 4X4MA 1OAQH 3NA4A 4EN3D 1FQ9C 1E6OL 5H35B 3Q6GH 4HKXA 4NO2A 1B90A 4RX4D 2AXJA 4QRPE 4JM4L 5IT2L 1HSAA 4JVWA 3I6LE 3N1FC 1BZ9B 4RISL 5IT2H 4FTVB 1TLKA 2DS4A 4OGXL 2MSPA 3EW3B 3MV9D 4YHZL 4OGXH 5D7IB 3PABA 1WCQA 5LKNA 1JPFB 5IMKB 4X4XA 4YHZH 1DEDA 2WIIB 1FPTL 2BC4A 5DDHB 2CRYA 5EBMB 1FPTH 2IQAB 3DPBA 5IJKA 5GS1C 1QBML 4G9DB 5C0BB 1TZIB 5HPOA 3BPOC 1WZLA 1T3FA 4QCIB 3TA3C 1NBYB 4KK5D 5HHQB 1K5NA 2APBA 1TCRA 3QDME 3IXAB 3EDFA 3QFJA 3ZTNL 1IAIM 2FSEA 2R69L 4NQTA 1TJGL 4H26A 4TVPL 5HI5C 2JJSC 3SPVA 2GJ6A 3O9WB 1WICA 5JHDE 3ALXA 1JYVA 4TVPH 3LHPL 1WBXB 2PTUA 1OPGL 1FGVH 5AWNH 3KG5A 4BQCA 3OKDB 5J13B 3HPJB 5IVZB 1KIUA 3PJSB 4GQ9L 4R97C 4X6CB 2E7MA 4Q6IA 4LCYA 5EC2A 1CFSA 5JMOC 4H5SB 2WINB 3KPQB 5TDOB 4D0CA 2ADIB 3ZE0E 5E9DE 2VR4A 1MJJB 1MH5B 1D5XA 3MODL 3OKOA 1QHPA 3EJYD 1XAUA 1SY6A 4ZSOE 4G80B 5IV2A 3MLUH 2FECL 3ORJA 4PJHB 2F74B 2AQ1A 4WUUE 5CSGA 2YK1L 4YDJB 3MRNB 3D3VA 4MJIB 3ARDA 3O3EB 1DLHA 2YK1H 3DNKA 4QF1A 4KRMB 3SO5A 1EAPA 3VD5A 2XZAL 2DWDB 3MRGB 4FQPA 5ID1B 1OAZL 5HHPB 4H1LB 2JCCB 3V5HA 3L3DA 1OAZH 3BISA 2GTZB 1KTDB 1RZIB 2Z4QA 5SWQB 3RVWD 3BP4A 1KOAA 5IJKC 3VWJA 1JWSA 4WUKL 4L3EB 5E5MA 1NDMA 1HDMB 2EEBA 4LKXA 3QXAA 1OAKL 2FL5B 5D7KD 3WHE1 5KVMC 1OAKH 5DQDL 4Z0BH 1UZ6F 3CCHA 1FZJB 3OAZH 1F3DJ 1EPFA 2NXYC 3RX8A 1HH9B 2KL6A 4AG4L 5JORA 1LD9A 2NY2C 1DBBH 1N0LA 1A7QL 4Q9BA 2Q7YA 2G60L 4Z5RB 3RWJA 5J6GA 4CVZB 2X4SA 4K7FB 3IVKB 4MQXD 1A7QH 1QLFB 1H5BB 1KGCD 4OV6F 3AGVA 1UXWB 5SV3A 3F58L 4JFQB 4AM0B 4JFDE 4HFWA 2A83A 3GJFH 4Q6IC 2PYEA 5EN2B 1C5CL 3F58H 4PBWD 3ESVF 4JEGB 3T0BA 4QWWC 3L95B 4XMPH 5J7CC 1EFXA 4JFFE 2VLJA 5FECB 3R8BB 1I7RB 3M1BA 1YEGL 4LVNB