2NW2A

Crystal structure of els4 tcr at 1.4a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
200
structure length
196
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVQAGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords ELS4 TCR alpha chain
total genus 36
structure length 196
sequence length 200
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nw2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nw2A02
2YPKB 4WO4A 2HKFL 4U6YB 5H94A 3O6FC 2VLKE 4X6EB 5DJDA 4U1HA 4ONFH 4OZHA 1OVZA 2NQCA 1B88A 4EI5B 1KXQE 4QHLA 1EO5A 3R06A 3P9LB 5C09B 2OJEA 4IHOB 1N2RA 1T04A 5LCVH 9CGTA 5CGMA 2R9HC 2DWDA 1AO7A 4PD4K 5ISZA 4G9FB 1LP9F 4O2FB 3LPWA 1I7UA 4YJZL 2RAMA 3C60D 3ROLA 1FZOA 4ESKA 4YO0B 1CD0A 3OKKA 5D2NB 5D6DC 4YX2H 4PJEE 4OI9A 4B50A 3HPJA 4UOW1 1YPZF 5IFJB 5HHPB 3FT3A 5K33A 3S37L 3JVGC 5SWQA 5L7XL 3ILQC 4HQQH 3MGTA 5FHBH 1BLNB 4WU7A 3D0LB 1YUHA 3LRSA 1A7RL 1CICC 2NYYD 1YYLH 2GJZB 4XNZC 2IALA 3KPQB 4C56E 3HE7D 1K4CA 1QRNA 5HYSA 3VI3F 4LMQI 2PF6A 3T77A 3MACH 4Z0XB 3MNWB 3GM0A 3NGBB 5ESVA 1L7TH 3BP7B 4F58H 1PKQE 5GRUH 1G7QA 4MA3A 1U8MA 4FQQA 1FGNH 3JWDL 4NQDE 2R1XB 5SWSB 2AAVA 4RIRA 3L3KA 4HV8B 4NRZB 1MCCA 4FQJH 3SDAD 1WITA 3HZVA 1KTLA 1CF8L 3TV3L 3WFCH 5E8OA 1UH4A 4IDJH 1D5XB 4GMTH 3RL2A 1SJVA 3CVHB 4MAUL 4QXUH 3BP6B 2EO9A 1L0YA 5E8EA 2BNRB 4C59B 3G5VB 3ULVH 4JM2C 4PR5A 4QXWA 1QFUH 1QNZL 1HDMB 4NOBA 4R2GB 1T7VA 1RK0A 2EDNA 4OZFA 5L2JA 1BIHA 4G3YL 3SDDA 1JWSA 3RDTC 2HG5B 4XMPH 3I50L 4LASL 3D6GA 1MIEL 3HI1B 1AGBB 3IDXH 1K6QH 4JR9L 5C0AD 2V5RA 1RUQL 1ZANL 3BIKB 2AEWA 1ED3B 1BM3L 3TJEL 1WZMA 4L3EB 3D3VB 4MDIA 1ZA6B 1JF1B 3UBXB 5L9DL 3FB7A 3PWLB 1E4WH 1VPOL 4MQ7A 2DQGH 5KVDH 2D03L 3HB3D 4ZDHA 1BREA 1KJ2A 2DI9A 1JN6B 4Q97A 3VG9B 1MHCA 5IG7A 1YY8A 4LBEA 1S7WA 4OF3A 4YHKH 5GS3A 4M7KH 3D18B 1RK1A 2IQAB 2XNAB 4DFHA 3QIUD 1I3RA 4GOSA 4YUEL 5KAQG 3MV11 1JF1A 3ESUF 3MRPB 3BPOB 4P2YA 3SDXB 3W82A 2AK1H 2VC2L 4MJ5B 1CDCA 4ODWB 3BZ4B 5IMKA 3O3BB 1KACB 3NAAL 3ZO0A 4NQDA 2JJVA 3G9VA 1WQVT 2VQUA 1OD7A 4P57A 5F8QC 4K9EH 3VXSA 3W9DB 5EWIH 3LS4L 5I8OH 1IRAY 1F6AB 5HBBA 3GMMA 1C12A 4CVZA 3WSQH 1FL5A 4ODTH 5JXAH 4I1NB 3UZQA 3IDNA 4YZFF 3LMJL 2R0LH 1K3IA 1GGIH 5FYKE 4MAYB 1CGUA 3OR6A 3IDXL 4PJHE 2JJSC 4RBPK 2BVEA 3MRMB 2VR5A 4K94H 1U91A 5IHBA 4JANB 4LPXA 3SE3C 5SX5K 3FKUS 2Z91B 1YEDA 4BQ8A 4LNRB 1T1YA 1FAIH 2NW3A 1TMCB 5CIPA 2E8ZA 1JPTH 4PJCE 5CD5C 5JW3H 3CK0H 3FRUA 3DTXB 2HRPL 4JRYE 5HHOB 1KT2B 1OY3B 1VPOH 3ARSA 1GAFL 3U30C 2DQTL 1QACA 2V7NB 1U95A 1P4BH 3LRGA 3E6FA 3I6GA 5A16B 4LRIC 3UBXG 4X98B 1QLFA 5CIPB 1HZHL 2FSEA 1S9XB 5GJSH 4H20L 4PREB 3KPRB 4ZYKB 3ULUD 2LVCA 4P2OD 4UAOB 3W39A 1H3VA 4OSUL 1YN6A 4RMTA 2VXUL 2XWBA 2X70A 5EIIB 2AJSL 2EDEA 3QEGH 1DTUA 3TO4C 4W81A 3V0AC 3BH9A 4JR9H 1BX2A 1RUMH 1X5ZA 3O8XB 2NX5D 2X44D 2IH1A 3FT4B 3I6GB 3NFNB 4NKQB 3V9FA 2R56H 1QFWL 4KQ3H 3B2VL 5DJYA 4F2MB 1OP5K 2EEAA 1XF5B 5JW4M 3DV4B 3U0PA 2I24N 3B9DA 4LLAA 3QQNA 5B22A 4OD1H 1PZ5A 2FLBT 2EDHA 3FB8B 5IVXF 1NMBL 2IAMA 2ID5A 2PO6B 1HINH 3GI8L 4U3XA 1A6VH 1UWEL 1UCBH 2BY3A 5EZJB 3ZDZE 2KH2B 1AD9A 2NZ9C 4JRXB 2YD7A 5CHNB 2F8XC 1S7VA 1SEQH 4LRIA 2VH5L 1QKZH 3MOAH 5EO0B 1MWAB 5KS9F 2W0KA 2YRPA 2OMBA 5KSUA 4MA7L 1N59B 4PV8A 3L3HA 3EIFA 5JW3L 1I1RA 3Q2CA 4JZOA 2J8HA 4YPJA 1FVEA 2JIXD 4K3GA 3TVMD 1HNFA 2VN7A 3IDIB 2OI9B 4JVPA 1LHZA 2DJSA 5L6YH 2A6DA 1JMZA 4XP4L 3VWKA 3D85D 4ZUSB 5C08B 4DVRL 3U9PH 3DMMB 3KDMA 4RZCB 4XI5C 5F7MC 5BRZA 4OZFG 2O26U 2P8PB 5ITFA 5JLZB 4DAGL 1ZHBB 4XNUH 1JGLH 3QIUB 4G9FD 2FATH 3I75B 3NN8A 3PABB 3C09B 1AQDA 3G5ZB 1ZS8B 1XGQB 2XXMB 4AEHL 1FFOB 1T2XA 3B5TA 3TPUB 2YR3A 1IBGL 2WP3O 3MUHL 2Q3AA 3GJEA 5HGGS 2D7MA 3O2VL 1QFWH 4XZUA 5BQ7B 2VDQH 4WI8A 2FHBA 1F4AA 4I0PD 1NBZB 1RZIB 3H9HB 1A9EB 2EDTA 1OD9A 1GAFH 4HLJA 4ODSL 3DO7A 3DROA 5F9OH 4U1NB 4Z7NE 5MEOB 3CZJA 2EH7H 3RDTA 1B9ZA 4NWTH 3QEQA 3LHPH 1Q9WA 2F15A 4WFED 1XGQA 1HIMH 1GC1L 1UT9A 4H88L 2FB4H 4H20H 3HMXA 3RWDB 1KN2H 2A73A 2NY3C 1G0DA 4U49A 1PQZA 2F54D 1N0XL 2GHWB 2Y72A 2X5PA 2HJKB 1NBZA 4MJIB 2DQHH 3ARDA 2A6JB 1KIQB 5EU3A 1YZZA 1AGEB 1OQXA 1SJXA 3FQNA 2VZSA 5E9DD 1G7MB 4MMZC 2FHFA 3CAFA 2GTZA 2FEEI 1UJTA 3L1OH 3S37X 3S96B 4AM0A 5HDBF 2XWTA 3FFCE 2IWGA 1D6EA 4E42A 4OGYL 5AWNL 4WGWB 3HLAA 4LLDA 1P4LB 4MNGA 2FECL 1JI1A 3F7QA 3DOSA 3IKCA 5FV2A 2E6PA 1RZ7H 3GRWA 3NPSC 1M05B 2NXYB 1E27A 3OB0H 1DJSA 5DS8A 4NQCE 5ABDE 1IVLA 5E4EB 5IB1B 2XWTB 2LU3A 1MPAH 3GBNH 5C0EA 2B4CC 4KJQD 5DD1L 4MWFA 2MNUA 4Z7WA 5CJOL 4MJ6B 4K71B 2PYED 4MNGB 3ARTA 5I0ZA 3DUSB 5EN2A 4XI5D 2AABL 4KK8C 3PV6A 1D5ZA 1C5CH 3CFEA 3F12B 5JW4N 5H94B 3D85B 3OKOB 4Z7OE 4RDQF 4LL9A 1WSST 1FL6A 5T3ZE 2BNRE 2PNDA 2FJGA 4JPVH 4XNYL 5HGAB 5DRNB 5LG1A 5LGHH 1U8NB 4MLIA 2Q8BH 2Y6SC 1NFIB 1HH9B 3U9PL 3UTSA 2GW5A 2AQ2A 2PO6D 5DMKA 4O2FA 1U8IA 3BQUD 1L6XA 5M95B 4YO0A 3WXVL 5D1QA 2XV6B 5DEZA 4G7VH 5GRJH 1CFQB 5D2LB 4POYA 2GCYA 1CFNB 2JJUA 1FVDA 1GZQA 2J5LC 1ZT4B 2D2OA 1A7BA 4AMKL 4GRWB 1Z3GH 4WU7B 3WFCL 1OTTD 4G8GE 3MV8D 3S4SG 1IM9A 2GUOA 2GFBA 4J2XA 3O2DL 2HTKD 4H25B 3MMEA 3VMPA 2IG2H 1HN1A 4RAHA 43CAB 1K5NB 3VGBA 1HKLH 4NC0B 4FQ2H 1FFNA 4XPFL 4KTYA 1A1NB 1WJ3A 4F7MA 5FGRA 1IEAB 5F7DB 2CLZA 1BMGA 4DN4L 3ALXA 1A14H 3MA7B 4CMHC 4X6DE 2EEDA 3DVGB 1WIOA 3BN9C 2NY7H 4M00A 1IGIL 1OAYL 2V2XA 4M43L 1ITCA 4NZUH 2WM0A 4YHYC 2M1KA 3WS3A 5KS9B 1CR9L 5MI0C 5ICXB 4KAQL 3TO4A 1XAUA 1JUFB 4WO4C 3B8SA 4ZTOL 1D5XA 4O4YH 4OLEA 4NUGL 1KFAL 3QQ9D 4P46C 1VFOA 3CLFL 1YNTB 4GXUM 3V4VH 1A6UH 5C0CA 4PG2C 1ZHNA 4HPOL 1I8KA 2B8OT 4TN9A 2EC9U 5IOPA 4UDUA 2QADB 1HDMA 1H0DB 3HR6A 2JB5L 4QF1A 2ZSWA 1HHIA 1TDQA 4PJAB 2OL3A 2GSGB 2E7MA 4ORGA 5D7IE 1JHTA 4RMQA 1DUZB 4ZQKB 4Y5VA 3KPRD 1N3NA 3FQWB 1MPAL 3VXRA 4XHQA 3PQYE 3VFVB 3VWKD 1CQYA 1HNGA 1NDGB 2YWYA 3RBSA 4XB7A 1I8KB 1Z3GL 3OWEA 4XPFH 1MCWW 2JJTA 4FQHB 1JK8B 4PRBB 1AXIB 3SY0B 1ACYL 5TE7H 2IG2L 3MLTA 5EIQA 3VH8G 4R4BB 3VXRD 2GSGA 3H9ZA 5BVJB 1LO5B 5M94B 3VD4A 5IKCB 1Z5LB 5JW4Q 1OGAA 4M62L 4OUOA 2YRLA 5EU6A 5LGHL 1ZVHA 3X12A 4IRSC 4JFFE 4TSCL 4KMLB 1KGCE 2P5WB 3MBEB 2QKIA 5GSRA 1UWGL 3S3PA 4NQXB 2VZVA 2VIRB 3OAYK 4NHUB 1J1OH 5T1MA 1ADQL 2RQ8A 4U1MB 4D0DB 3ZT7A 2VAJA 1A7RH 5GXBB 3ULUC 4YFEA 3VXME 4JY5L 4ZOBA 1OM3H 3O3EA 1LMKA 2BSED 4OI8A 3QCUL 3TZVD 4F9PA 4JM2D 2ARJA 1RZKH 4XNQB 4LRNH 4M1CC 4TRPH 1TQBC 4P57B 3IFPA 2R0WL 4X6DB 4M61A 1H5BB 4WVRA 1G6VK 5EBLB 2VIRA 3GJFH 2GIYA 4AH2A 4WJ5A 3MOQA 3GIVB 2VDPL 3JWDH 4U1MA 3ROLB 3KWWB 4D0DA 4X7SH 5E2JA 3C6LA 4RFEB 4JM2A 5D8JH 4HX1A 4MAYA 4JZNB 3LS4H 3E3QC 5HHMD 1KPUA 4Y4FB 2VERN 1SY6A 1P84J 3KXFE 5DRXA 2HAZA 1RV6X 4WDIA 3BRGC 1CD1A 1HI6B 1I1CA 3QA3B 2NZIA 3TT3H 1A21A 1I9JH 3K2UL 5DJ2B 3BMVA 4XVSH 3KS0J 3ULUH 3T0WA 2QBWA 3BO8B 4N8CH 4XCEA 1NAMA 3P0VL 2P46B 3HZMA 5DJ6A 4JN1H 4G80A 4X7TB 4CVXA 3MNWA 4HK3N 5TE7L 3L3JA 5KVGH 1Z2KA 4Y8AA 4JPKH 3OJDB 4J1UB 4P5TA 3LOWA 4I0PB 4HBCL 1RJYA 4PRHA 2Z31A 3UCRA 1WIUA 3FB6B 1D5IH 4UT9H 2OL3H 4GW1B 4XWGH 1E4WL 1OF2A 3WL9B 4UT7H 1CZ8L 4MQTB 5DRZA 4HMCA 4LSRL 2OTPA 4R7NA 5C8JA 1BZ9A 1MQ8A 4QRSA 3S98A 2R0WH 5MP6L 3FB7B 3C8DA 5F6HI 1CD9B 3SOBL 3K1KC 4LSPH 3AROA 1S9VB 5FGBA 2FGWH 3NCJH 5DGQA 4XX1G 1DANU 4Y16D 3MNVB 1T7YA 3KJ6H 3DVNB 3O2DA 2FD6L 2Z31B 3GJFA 3AMLA 4YBLC 2F5BH 2XA8H 4FS0A 3RWHA 5IJVA 4M7KL 1RVFL 4WI6A 5CEYB 4XXDB 1KV3A 3MZTA 5LGJB 2ZWLT 1DEEB 5JA8B 4KVCH 5KANG 1IKNC 2OLDA 4TPRH 1RHFA 1CT8A 3H0TA 4YZFE 4WUUE 3ARGB 3B2VH 1AGBA 4D9LL 1I4FB 1ZV5A 4ODXA 1Q1JH 4QOKE 2BVYA 3GGWB 1DLHA 2H2PC 3VRJA 3ARBA 1S7VB 4WENB 1WC7A 4KI1A 1W72B 4X6DF 3NFSH 3TT3L 4PRPE 4H0GA 2NXYD 4OZ4B 3AM8A 5CEZL 3RPIA 1S7UA 2CKNA 1UM4L 2ATPA 2EE2A 1V5JA 5J57B 4E0RB 2C4FT 4LQFH 1SEQL 5T3XH 1D5IL 4LARL 4L3ED 4WY7L 3WS6A 4HEPG 3D3VD 4K2UH 1TJHH 4OZIF 4Q7DA 4NO5A 1DQQA 1FDLL 2P5EB 4MA7H 4UTBL 1JPTL 3QWRA 3VRLF 4OCMC 1EPFA 4XTRC 1H5BC 5D1QD 5D7IB 1G9MC 2ZUXA 1IGYA 5BMFH 4YGAB 5DVLA 5EZOL 2IC2A 4Y5YA 2IBZX 1CFSB 4BK5A 4ZAKC 4H88H 2ATPB 3TNMB 4FXKA 5GQBA 5IHZB 2BOCB 1XEDA 5I8EB 3GMNA 2YBRA 4PBWD 1MELA 1AGDA 2Y7QA 3O9WA 4ZG1A 3PNWB 1ZGLP 2E6QA 3OR7B 4S10A 1TZHB 2FZ3A 1NAMH 4QEGA 3TBSA 1I85A 3U4AA 4PJ5E 5FUOL 3BQUB 3QRGL 2FGZA 2AV1A 5ALBL 3UROR 4PRNA 3BUYA 3IXTA 4ISVA 4U6TA 1KEGL 2R29H 3ULVF 4K7FB 3KYOB 3VWJD 1E0OB 3C09C 2LU4A 4P99A 3QXUA 2GT9B 1IBGH 3RWCB 1Y0LA 5DJ8B 2Z91A 2W60B 4GRLB 1T20A 2X70B 4X4YA 4Z7UB 2AV1B 5BW7A 4P9ML 2YOCA 1KYOJ 3I6KA 1ONQB 3QCVH 2AKRB 2HRPH 3RL1A 2W07A 4AG4H 2JIXA 2W92A 1HHKA 1QO3B 1FDLH 2IJ0C 5ANMB 2UY7A 5INDA 4B53A 5GS1B 4KHTH 3DX7A 2GT9A 2O5YL 1T7XA 2V7NA 3QPQC 3BPLB 3WHE1 3WN5B 4PY7A 3VRLE 4HK3J 2WINA 4KKLD 3RGVD 2GTZB 4RFOH 1AGFA 2AEPH 5EOCL 2DQHL 3PWJA 4AT6B 1RVFH 5DR5L 1VADA 2ZCLH 3WIHA 1JTPA 4N9GA 1OL0A 4PJ7F 2MMXA 3VG0H 3C8KA 5CZVH 1WLHA 5C0JA 1OARL 25C8L 2HTLC 4WFHD 3FOLA 3GSWA 4FP8H 2DKMA 3DSFL 1SEBA 5TGBB 4BSWB 1HHJA 3VFNB 2XI9A 2R56L 3C9NB 4KQ3L 4ELMB 1CI5A 2V5SA 1NAML 4NKMA 4EJ1C 1VADB 2J7LA 3OKNA 3EOTH 2PW1B 1D7FA 4JY4B 4X8XA 1HYSD 4GKSA 1NCUA 2Y5TB 5T3XL 3LEYH 4U0RC 5ID1A 2OX5A 2CRMA 4CW1B 5C0CE 5E6ZA 1H15A 2V5TA 4PP2B 5CJXC 5I1CL 3MLXH 5IWLA 3MGAA 3LDBC 1ETZB 4JQXC 3TBYB 3DUUA 3VMNA 4M9OA 4RAUB 3W2DL 2JK5A 1B6UA 1RIHH 2J8UE 5EUOE 4NNYB 5CSGA 1ZA3A 5MEPA 2YA0A 1W0VA 5CMAB 3MJ9A 1A4KB 3FAXA 5A2FA 3MJ8B 1DBKH 3JTSA 1CDBA 2EC8A 5TDPA 5J12B 4APQB 1SM3L 2ZUWA 1J8HD 2DMBA 4I8DA 1RU9L 1CQKA 3E2HC 4OCLC 2CIIA 3L95A 1HHHA 4JKWA 1PDKA 3MXVL 1WCBB 1VGKA 5JIPA 5MEPB 3ILQD 3T4AB 4HFUL 3LY6A 1RD6A 1DSFH 1A6PA 1NBVH 3NABH 4RGMC 4X7FC 4XVUD 4K8RL 2P4AB 4FQLL 1M1SA 4PY8I 4E5XA 1A7QH 3HUJA 4FXGB 4NM8L 4P2OC 1G7IB 2V2XB 2XKSA 4OQTA 3VE0A 2Z93B 3ARDC 3LS5L 4ZD3L 3ZE2E 2ESVE 1XCQA 4MA1C 4HZLA 4RX4A 3SKOA 3O4LD 4QRUA 5HYJA 2K9UA 3BP5B 1D9KB 1HHGB 1CDGA 5FEBA 4HWBL 5F44A 3H7LA 3LEYL 2W91A 3UJIH 5D9SB 4KKNA 3CH1A 5MHSE 5I71C 1IGFL 3EYUL 3RWDA 3I3BA 4LPYA 5JA9A 4P2OA 3W2DH 4XMKL 4NOFA 4GRWE 3QQ9C 1UJ3A 2BRRL 4QRUB 4V2CB 4QY8B 4IOIB 1DUYB 4KRLB 4NKOA 5SWZA 2OL3B 3OXSA 2JELL 2QR0A 2GQHA 4HG4K 1HOCB 4P2RA 5F7HA 1JHTB 1Z9MA 4BKLB 1X5YA 2D0GA 4MHHI 4HLZG 4ZS6D 4CUCA 4JFFD 5D93B 3IDMA 2KBGA 1CXKA 1IZJA 3BPLC 4FFZH 5D71L 3V7AG 4TRPL 3UPRB 4G42B 1NFIA 1BD2A 1YECH 1J0ZA 1XGTB 4PBVC 3MLTB 1B2WL 2A9ML 4C54A 3ULVD 1GGCL 2NNAB 1TPXC 2BJMH 1IGCL 4XPBL 2AW2A 4Y5YC 1HKFA 1AI1H 5ID0A 1WZ1L 4HDIA 2D7TL 3QRFM 4U6YA 2DYPD 4A6YB 3QUZB 5FO7B 4D3CL 2CUIA 4CVWA 3QUMB 5JW4R 1CDYA 4LLQB 2CUMA 3MSPA 3VFWA 4NQSB 2A9NL 4ELKA 3SDYH 3P9LA 5C09A 5FYKH 4CAGA 1YEJL 3GDBA 4N5EC 4XNMB 3MOBH 3OHXA 5T3ZL 3O11A 1AO7B 5MENE 1FVCA 4PJXF 1F4HA 3MXWL 4NQEB 3LKOA 5IFAL 2OYPA 1T1XA 4N8CL 4OKVB 1YY9D 1RJLA 4YK4C 5J12C 3RGHA 4KH2A 2PYEB 5F7DA 3SO3C 5IB5A 4GG8B 1KPRB 1WBYB 5JOFB 1CR9H 5L7XH 5HVFB 1P9MC 2WV3A 1J1PH 4D2NA 1S5IL 5E24E 1MCSA 4KDTA 3ZTNH 4ZTOH 2ICWJ 5L8JB 3B83A 1CFQA 1DVFD 4UT7L 5B39B 2NXZC 3LEVH 1R5WA 1CFNA 4OLYL 1MCPL 3CDCA 4RGMB 2HH0H 3KPQA 1LDPH 3TO4B 5IB2A 2X7LA 4WU5B 2VDPH 1QHPA 4MJ2A 5I18H 1HWGB 5DMIL 3RVWC 2DQUH 1IMHC 4PYHA 2YD8A 3VU2A 4BJLA 3IAPA 1XIWC 4Y4HB 4Y4KD 3TEUA 3QCTL 2CK0H 4PJFF 3RIAF 1AP2B 2ADIB 3LPFA 4F7PA 3AB0B 4IS6B 3TIEA 1T2JA 2V2WB 2RGSA 4NRZA 5C0RH 4LPVA 1PAMA 5IHLB 4N8VA 1KCKA 1PYWB 3S88H 4J3UA 4QF1B 2DWEA 4XVSL 2OTWB 4YAQA 2YUWA 5D2NC 3TV3H 5TF1L 5FECA 5K9QI 1U2CA 3BQUC 1OSZA 3GJFK 3L6FA 1KXTB 2D4FA 3BKML 1CLZH 4EOWL 3QIBC 3D25B 5E2TL 1JZ5A 2CGRL 5ICXA 5BW7C 1MVUB 3U9UB 3IGAA 5DK3A 4PR5B 5F70A 3LVEA 4OD3L 3QAZB 2HFEB 2X4UA 4Q74A 3KPSD 4PRBA 3SY0A 4H8WH 4JAMB 4OZIE 4U7SA 2MTPA 4CBPA 1CICA 3KPPB 5E00A 1ADQH 1AIFB 4M62H 2VE6B 3O4LB 4NZDA 5HYJD 4RIRB 3SGEI 5MP6H 2PTTA 3D25A 2OJZH 4TQEL 3WFEH 4WV1B 2WIMA 4YIQB 1MVUA 3U9UA 3HZYB 3MRNA 2X4OA 1NGQH 1GPOL 4HT1H 5DJXA 1DUZA 4TVSa 5ALCH 2FX7H 2ICCA 4OD2B 4JHBA 3S8WA 5K59F 3PGFL 4JFXA 1I4FA 1UACH 3VI4E 5DGRA 2YKLH 1RSFA 2QADD 3S3SA 3B6SA 1AQKL 3DVFA 1A3QA 5I18L 4EBQH 3NPZB 4FRWA 2ATKA 4WV1A 1ACYH 1DN2A 5FUOH 4G6ML 4JG0H 1A6WH 1NEZA 1FG9C 3QG6B 1ZLWH 1NBYA 4OZFH 4NRXA 5HJ3B 4CADB 3CVHL 5EORL 3MRFA 5CJ5A 2VTFA 1Z9SA 3BIKA 1XIWD 2QHLA 3E6HA 3E1F1 3BE1H 4IBLT 5SWZD 2CDEB 2H45A 2VXSL 1A3RH 2BP3A 2DI8A 4DK3A 2NY3D 1YEGL 4X9IA 1BQHA 4NQUA 1MCPH 1PKQB 5ADOL 3GBML 3D48R 2DYPB 2I26N 4OZGB 1G7HB 2CDFA 1EZVX 3CU7A 3ZL4L 5DJ6B 1CGXA 5GISL 1WT5C 1TZHA 2XOTA 3RNQA 3GSVA 3D18A 3LN5B 3KXFB 1TQBB 5EZOH 4WV1C 4S1SL 1RUAL 5DUML 5AYUH 5BV7C 1X5AA 1YEDB 1H3GA 3E6HB 4ODUA 4IMLA 3ARRA 2AQ3A 2VAAB 3SGKA 2VLRD 2BX5A 2XPGA 1K85A 3WE6A 5D5MF 3KYMB 3A67H 4IM8A 4M9PA 2DM3A 5C2BH 1Y0LB 3RWGB 4CJ1A 3TFKC 4IDLA 4UV4L 4Z95L 2Y6SD 1C12B 4PJ5A 4OF5A 4NGHH 5KTEL 2DIAA 5D7KD 2BNQB 3MV7A 1ZOXA 3TA3D 1NCAL 5DC0A 3M8OL 3OR6B 1BBJB 2KQMA 3RWHB 3CFDA 3QEUA 4HJ0C 2C3GA 5HGHB 2RB8A 2FSEB 4M7JL 5AUMB 2ITCA 3QWOB 5DFTA 3WFZA 1WWCA 2C1PB 4CU7A 5E6IB 4URTB 3RX8A 4Z78B 5CCKH 1YMMA 2ZOKA 5I76A 3RFZC 1RJYB 1TTFA 1AY1H 4O02H 1FHGA 5EORH 5EOTB 5E8PB 5FYLH 5F9OL 3O6ML 1YEKL 3NFNA 1NGQL 4DOHB 1QSFB 3I84A 3NVQA 2N56A 3F7YA 2XY1A 2HYMA 1SJEA 3ALPA 1S9WB 2CO6B 3M1BA 3NCJL 2Q7NA 1F8TH 3X11A 1N8ZB 5E6IA 1CFVL 4QWWC 4MQSB 3MUZ1 1YN7A 4U1GB 1BFVL 3K1DA 3WNPA 5HYFA 4RCAA 1MFBH 1YDPB 2EDRA 3BI9X 5F7KC 4LSSL 5I17B 1QLFB 3SQOH 3QUXB 1WWWX 2AXGA 1NGZB 4PREA 4U33A 4F8QA 2R23B 4G6JL 1XH3B 4JRXE 4NPYA 3UXFA 3FQUA 5IMOB 2CQVA 4LGRB 5K9KA 1SY6L 4HS8H 1CVRA 1A22B 4ZPTA 3QNXA 4NBYB 1RUML 5CFHA 4UAOC 4WW2C 3VXTB 2VKWA 1H15B 3IDGB 3L5WA 1V3KA 1DN0A 3SDCA 3W9EA 1LQSR 1EEYA 5C0BB 1AGDB 2Y7QB 4OSUH 4MS8C 4Y4FC 1NGPL 1VACA 4KRNA 1JI2A 5DQDL 3RU8L 2PKDA 1RAMA 2R23A 3QHZH 1YMMD 1RZ7L 4LLWB 3MRIB 2DL2A 3HHRB 2ZUQC 2A6DB 4WEBL 3PXHA 1J9CT 4DJMA 3MFFB 3MNZA 3QIWC 4NUJA 1U8PA 4Q9BA 2P5EA 3BOVA 3S7GA 5JDJA 1TENA 1BVKA 2QSCL 3EHBD 3H42H 2WW8A 3Q5YA 5CILL 2BY2A 3TCXA 2JJTC 1VACB 5GZNC 2AABH 4H1LA 3B2UD 3EDJA 3V5DB 4GRWF 4NHCL 2IMMA 1FN4A 3L3HB 4TNVF 1N6QL 1DR9A 1T0PB 2BHYA 1IGIH 3OAZK 2X41A 2AJVH 1VFAB 5JORA 4NBZB 3PNWA 4PUBH 3EDFA 3SQOL 4YHYB 4KXZH 2J88L 1UA6H 2DQDL 3BQUA 5ANME 1CFTB 1W2KT 2ARJQ 2VZ1A 1MJ7L 4U3HA 5K59E 2NY3B 4X8JB 1C08B 2VWEE 3T4YA 1ZLSH 1CCZA 4N1HB 2PR4L 5J9PA 3MJ6A 5EOCH 1A1MB 3H6JA 1AHWB 3OPZH 4OJFL 4ALAL 3Q6GL 1K9TA 2UZIH 1CXIA 5E4IA 1UVQA 1IC5L 4PV9A 4C55A 4MNHA 3PDDA 3VFRA 1ZS8A 2DD8L 1N5AA 3T65A 3SJVA 3PHOA 3QPXL 3EOTL 2H2SD 4OZHE 3TPUA 3UTPD 4UTAH 4LLVA 3T4YB 1T6VN 1N64L 3GSNB 1KJ3L 2PW2A 3JV4A 5FDWA 3WUZA 3N0PB 4AZ8A 4ODSH 4RDQG 5I1CH 3DO7B 1GGUA 5E08H 3C6SB 4HQQL 4Q9RL 2DLEA 1BD2D 2J8OA 3O2VH 1JMXA 4N5UA 1J05A 1JYNA 1F4WL 4F7CB 1S7RA 5FGBC 4QRPA 5C3LD 4JDTL 3H2WA 5FUZL 5EOQL 4ZSOA 4ZXBD 5FGCE 4HS6B 1FNEA 3OGCA 5C0BD 4QNPF 3PP3K 4X6BB 2JJSA 1J12A 2DQIH 4FFYH 1KN2L 2KQNA 1IGJA 1W72L 4LVOC 2AVGA 2AI0L 2C5DC 4Z77A 5I6XB 3V4PH 2ICWA 2VLRA 5ID0B 5CGYC 2FJFB 2YPLB 3FT2A 1JPFB 3EFFA 5IEHB 4E42B 4QHKI 3GK8L 4LPTA 5ESQB 4GKNA 4APQA 4M6AA 2Q8AH 1A2YA 4LAJH 2MQ3A 1RU9H 5HDQH 2E27L 4ZSOB 1VKXA 1IC7H 4HKBA 5JMRA 2VDKL 3CCHA 4LLYA 1UM5L 3Q3GB 5KANI 3RVVD 4I4WA 5ECJE 5CZXD 5E94B 3BESR 5D7JD 1LILA 3SKNA 1GXEA 1GGBL 4PP2A 5C9JB 5B4MD 1E27B 4J3WA 5EIVA 5L0QC 1FO0H 2JKXA 4U0RB 1RIUH 3U7YL 5KW9H 2AJXL 5D2LA 3KJ4B 4N1CA 4FQLH 2PXYA 2R9HD 3FQXB 5E8DL 4FA8A 3KLDA 4GW4A 1F4WH 3QHFH 4HIXH 4XMPL 3NZHH 3PV6B 3MLWL 3ZYIA 2J88H 1TVDA 1RHHA 1XIWA 1HYSC 3IFNL 3BP5A 3PL6D 4I48A 1OHQA 3FQTB 3TZVC 4J6RH 4CU6A 4YHZL 1AGCA 1WT5A 4UILH 4ALAH 5EU4B 1UXWA 2BRRH 4GAGL 1QR4A 2NYYC 3RWEA 2OR9L 1MI5B 5L8LB 4JFOB 1UM6L 1KEMH 3KXFD 4EN3A 5KS9E 1WUNT 4Z7VE 2IALB 5HHXH 3VFPA 1Q94B 5DUBB 4Y2DC 3O3UN 4ZO7A 3OJVC 3DX8A 1WAAE 1LEKA 3L5JA 3HN3A 3P77B 3GBLA 4P5KA 5ITBH 1F2QA 1PFCA 1YECL 4MXVF 2AK1L 2VC2H 3MLPA 4YXKH 3H9SD 4FFWD 2X9WA 3BZDA 2X42A 3UPRA 2YPVH 4LU5L 1IEAA 1ZHLB 2VNCA 3C6LC 5DTFB 3CFCL 2CMRL 4XVJL 2J8UB 1WAAA 4M6OL 1CF8H 3RWFA 1P5UA 4ODVL 1BM3H 2RBLA 5CKAA 1AC0A 5IQ9A 3P77A 3EOYG 4HJGA 3MJ9L 1OTUD 3RUGB 1TZIA 1UQSB 3LDBB 3RX5A 1AKJA 1X7QA 3U79A 2FEDD 1LNUA 1RMFH 3LSOA 1KCUL 4P4RB 1Z0NA 1FBIH 3K8MA 1OAQL 2YPKA 1EGJL 4S1QL 3V0WH 3WFDH 4NT6B 2HMID 1LEGA 3NFSL 2P7TB 3WDJA 4TOYH 3JUZA 4GAGH 4JPWH 4N1EA 3GKWL 4XCYA 5JPMB 4BA8A 3DETD 1LE9B 3H9YA 4J6RL 4M7ZC 3NA9H 3O2WL 5GS0C 2EYRA 4HUVB 5MEQB 4O2EB 1K6QL 4ZOAA 4Y16C 3OZ9L 4LCCA 3R1GH 3PWLA 4KK9D 1U2HA 3ARBD 3TN0B 2NTFB 5IFJA 2EICA 1HCVA 1GVIA 2EDBA 1HH6A 4EEEA 4WU5A 2VKXA 3KS0H 1S7WB 4PBXA 1S7SA 4XMLH 3BP4B 5BZWA 1QBAA 1TVHA 1UZ8A 1YEJH 2VXVL 3MYJB 3RVVC 1SYVA 4AEFA 1K3ZA 3TYFB 4NQEA 2EDYA 4JFPB 1PX3A 3LEXB 4U1KA 3CX5K 4ZTPL 4LU5H 5GS2H 3GRWH 4A2LA 1ZLVH 3RI5F 3DNKA 1DCLA 1RUQH 1QVOA 3NAAH 4IRJC 4WDIB 3GIZL 4MA8L 5I71B 1HI6A 3QA3A 5L9DH 1KEML 2M8XA 4NRYA 1U8HA 4L4TB 2OMNA 7FABL 5DA4A 5H2BA 3WYRA 5KSVA 5A2JH 4N0CD 4OFDA 5ICYA 3KYMA 5FHAH 4ERSH 1JHLH 1ND0A 5GRVK 3T8XB 2FR4A 5DC9B 2DJ4A 3RWGA 4UNTA 3BPCA 1FJ1A 1I1YA 1I1AD 3VGGA 2HWZH 4PRHB 2YMXL 4L4TA 4ZS7H 5KSVB 1PYWA 3AGVA 1TETH 4NCC1 3NCYP 2VLME 4X6FA 4X5WB 4XT1C 1AJ7H 2HT4C 5I76B 1JPGB 3MFGB 4TULH 1MCEA 4Z7WE 3NPSB 4PJ8A 4OD2A 2Q6WA 3WLBB 2W9DL 2XRAL 2DM7A 5DJ2A 3AMKA 1XGYL 3V6OE 1WCQA 3IGAB 4JO1L 4OTXL 4AIZB 1J0YA 3B6SB 2R0LL 3CJJA 2X4RA 3AXLB 4WFFD 5IBLD 4K71C 2HFEA 2X4UB 3SE3A 1B0RA 1FFPA 2NY1C 3OAUH 2XFXA 4KI5D 3BKYH 5KVGL 3MUJA 1CG9B 4ZNEA 2QSTA 4X6FB 4I3RL 3MRBA 3OJDA 3BEWB 3CC5A 3EJZD 4JO4H 2F54E 4CADA 4HUWB 3HE6B 1HQ4A 5I17A 3EYFA 1YEGH 1F42A 1Q1JL 3SQBA 1UB5A 1NGWA 3ARUA 4YXLH 2NR6D 1DBBH 4LAQH 3PL6C 8CGTA 1N6QH 2VXQH 4LCUB 2D4DA 5GRZA 2VQTA 4OZGA 1AQKH 1EEYB 2CD0A 5INCB 1B6DA 1C5BL 3O6FD 4PLNC 2J2ZA 5ILTL 5EB9A 2VUOA 4OFIA 1FSKC 1IEBA 2H26A 2F58H 3AAZB 3FOMB 3A67L 3PGDB 5T5FH 3IDNB 2EEBA 5D7SL 5A2LH 1CGSL 1H3PL 3CLEH 1TLKA 5H37G 2VH5H 1NBYB 5AEAA 3QUZD 3O6FA 4PV8B 5I9QC 4DVBA 1TETL 4XXCC 3WJLC 5B4MC 1Y18A 3DLQR 5DJCA 2WWKO 4JHWH 1YJDH 1EDQA 4UINH 4AEEA 2BSRB 5LWYH 1F4XH 3PP4H 5GGSB 5D7JB 1NAKH 1U3JA 2DLIA 5DSCA 1PLGL 3GHEH 1BQHB 4ODBD 4BZ1L 1ES0B 4C56B 4OCRH 5CCKL 3V4UH 3V6ZA 4P49A 2VLKD 1DQTA 4NC1E 4GAFB 1QPXA 1PG7L 3RHWK 5DF0A 3UMTA 3LHPL 5CGTA 1BWMA 1XCTB 5F9JA 4XXCA 2LU7A 2ZUTA 3WJLA 2CRZA 5J6GA 5CEZD 4XP5L 2VWEC 4KHXL 4LLUA 4C56A 5KJRL 3SHSA 1MSPA 5IV2A 5T33H 5A1AA 1VEOA 4N0FB 4PV9B 5TFSH 2BNUA 2NY4D 1U92A 4RGNC 3E2HB 4YGVB 3VFRB 1MAJA 3X11B 5FYKU 4OZGF 5MI0B 2J3SA 2VLLB 1XGUA 5IJKC 5F96H 4OTXH 1S7XA 1EH9A 5ENWB 3CFIC 1Q9WB 5J6GB 4NJ9H 1JGEB 4HS8L 1IQDB 3PG2A 4L8DB 3KLHC 1YC8A 1RI8A 1TXKA 3P11H 5GS0H 3VW3H 2MQ0A 1BBDH 4LHUD 3LQAC 2WIIB 1NCNA 3V52H 5ISZE 4Z78A 5J8OA 3WHE0 1H3PH 3CLEL 4NQEE 4GG6B 2W59A 3C8KB 1NGPH 1WZLA 2HFGL 2XG4A 1MCFA 1ITBB 1U6AL 5K9QG 4U3CA 5FFLA 3REVB 4BZ1H 3L5WB 2OSLB 3D3VE 3QAZC 1JGEA 3RVUC 2UVFA 4ZUTA 1FRGL 5DMGC 2A77L 3L3GB 1A6ZB 4XH2A 2WZPD 4KJWD 5I75C 1YN7B 2UZYB 3IKCB 4QRTB 1I7TA 5BXFB 3BKCH 2EECA 4DEPB 4M02A 3HNTL 3MNZB 2NCMA 4TUJB 5IEKB 4XMKH 5T3ZH 2DI7A 3S9DB 3WD5L 2HJLB 3WIIL 1Q0YH 2VYRE 3ARYA 4YEFA 3IF1A 1P84K 1WWBX 1GZPA 3DUUB 4FQXB 3RZCB 5DI8B 2H32A 4NWTL 5EUOB 1NGYB 4JZJB 4GT7A 2BOBA 3MRGA 4WO4B 3K80A 4OLVH 3WNMA 3MUGB 4NUGH 4F58L 2AJ3A 4EI5C 2AEIT 3SDCB 3W9EB 2Y23A 2QADC 3OG4B 4FFZL 1EVUA 4KKCD 2FO4A 4OCSH 1QFHA 4YBLB 4HMDA 1WEJH 2LABA 1N2RB 1T04B 4OLYH 4CU8A 4Z7WF 1OT2A 4IJ3B 3LQAH 4OCRL 2DF3A 1U8KB 3FMGH 3U2SA 4DCQA 2R2EA 2NW2A 1UCTA 3QNZB 4LHJB 3RVXC 1A9EA 5F6HJ 4AIOA 1GSMA 3GUTB 4JFHD 3QDMD 2EYSB 4F7TB 2GCYB 4M43H 5ACLA 4X6EA 4MNHB 4RSVA 1M4KA 2R69H 1I9EA 4LDOB 3QQ4B 5F9WC 4GO6B 5E2VL 1ZA3B 3KYKL 2Z8RA 1B4JH 3RWEB 3R06B 4NP4L 1G7IA 4ONOA 2B4CH 2W65B 1JIBA 4LEOB 5I1AA 2Z93A 5IF0B 3MJ9H 2XQYK 4TSCH 5DRWA 4HXAH 3SO3B 1FNAA 4XRCA 1A1NA 1CVSC 1EVTC 1RMFL 1C08A 1JL8A 1P7QD 2J8UF 4RMVA 5EZIH 1JFQH 1ZTXH 2A83A 4XNXL 3MGTB 4MYWB 3DGGB 4H8WL 1D6EB 1CIUA 1MRDL 3SCMB 1IGFH 1ZHKB 2D31B 5JXED 4QRPB 4HBQA 1H3TA 1OAZH 4XPTL 1G6RH 1LDPL 3GSOB 2W65A 2FDBP 3BD5A 4H0IA 5AZ2L 2NPLX 2CRYA 4EQ2A 5EOCJ 3T65B 4ZOEA 3RHWF 2DN7A 1DUYA 1M05A 5IESH 3KPLB 4O9HH 1DSFL 1TCMA 1SYSB 5CUSH 3TO2A 2YPLA 4JLRB 3ZDYF 5E6ID 2PXYC 4Q6IB 1HKLL 5IVOA 1I3GL 4HIJA 5F88A 1M71A 1Z9LA 4F37F 3HNTH 1D5ZB 2B1HH 3QH3B 4P23C 3F12A 5AAMA 2JCCE 1OTUC 4N68A 1N3NB 4YX2L 5FO9A 1FG2B 3U0WL 4NO2A 4R7DA 5GPRA 1DVFC 4DZBB 2G9HA 5E9DA 2FX8L 2H6PB 4RGOL 5C0GA 2VLRE 1EBAA 5J13B 1S7QB 4KKLC 4TUKH 5HVHC 1KJ2B 3QUXD 3FONA 1Q9LA 1PVHA 5JW5A 5MHSD 3VXQB 3FT2B 3PWPB 5DZNA 4DQOL 5IW6B 2R0ZH 1GCFA 1P1ZA 3GI9H 3OBAA 4WW2F 5ESQA 3AS3A 4X5XB 3SDAB 3Q5TA 3V7MA 3H7BA 4HWUA 4PJDA 4YUEH 3ARBC 5FYJH 5GGVL 1P7KA 3GNMH 4H5SB 5D1XC 5IBUG 4B41A 3OKDB 2G9HB 4UILL 1CICD 2BVQB 5E9DB 4ONGH 1MFCH 43CAA 2VB5A 4EXKA 2ORBL 5FKAA 3ZTNL 1HE7A 4QCIB 4CN1A 4G8IA 4QOKB 4EN3B 2XTJE 4NFBA 4A6YA 1BP3B 3LRHA 3DXAA 4DUVA 3OAZH 2GITB 1EXUB 1BQSA 2B1AL 4UZGA 5I8CA 5DFWH 1ZE3C 1FNGA 3OX8A 5DURD 3LRSB 1FSKB 4D9RE 1RK1B 1T1WB 2D7OA 1JP5A 3BWUC 3VJ6B 2UZXB 2GJZA 3QCTH 4JB9H 2CKBH 4GMSL 3FFCA 3HNVL 5GRXG 4ZFOL 1J1XL 3P3YA 3T8XA 3OG6B 2XZCL 3UZVB 1L0XA 2YEZA 3RVUD 3WIHL 2A6KB 5FA4A 1MIEH 1XF2A 1JHLL 5F1IB 3BKMH 2VLJB 4JM2F 5HHOA 5F3HB 4WY7H 4HJJL 2HVJB 3VFPB 5EUOF 1J1PL 1X7QB 2ZSWB 4U05A 3U0TA 3RTQA 4P4RA 4JN1L 4KK5D 1XGPB 3X14B 4JKPL 2AV7A 2CK0L 1MFEH 1NMCB 1T1YB 2CJUL 3R1GL 1D6VL 5DMJB 4O2CB 4GMTL 3V6OC 2OL3L 2VLJA 2YPVL 5MEQA 4OUUA 4QYOB 1B0RB 5DVMA 1X4XA 1OB1A 4PJBB 15C8L 5C0CD 2DICA 4N90E 2GSIA 5KSBA 4M6OH 4Q9CA 4NN5B 3MRBB 2HN7A 4HPYL 4PLJD 3SCMD 4BFGA 4LOUC 5D8JL 1C8PA 3ZSTA 3MO1A 4F7EB 1R3LB 5J6HA 4X9FA 4LQ1A 4AJ0A 1A6TB 2YD5A 3FFDA 1ROWA 4JJHA 4L4VB 5F9AC 1LNUB 4YDKH 4U6VH 2WBKA 4XMLL 4XC3H 1D9KC 3STLA 5I66A 4LASH 1LEGB 4I2XE 4MJ4A 3CFJA 3WDIA 2R1YA 3G6AB 4JAMA 4RRPG 5E1AB 1IC1A 4RMRA 4PFEA 1ZANH 4HMEA 3KPPA 4S0SD 5EO9A 5DD5L 2VITA 3UYRL 3B5HA 1MI5E 5ERWA 5IVZA 4OD3H 3RZCC 1A0QH 4N0UB 4QTIH 4U1KB 4HH8A 1URLA 4W4OC 1ADQA 4K94L 5INCA 1RIVH 1A6TA 2XZCH 5JHDB 2IH1B 3FT4A 2IQAA 5HYQA 3HZYA 4JPKL 4WJ5B 5JZ7C 2O5YH 3IB4A 2HA1A 1WFNA 2IPUG 4MA8H 4LCWE 2VDNH 4BH7A 3HE7C 3DRTB 4LSPL 2X6MA 5J1SC 1HH6B 1MFEL 5ICYB 1ZSDA 2ZCLL 1R3KA 3O9WC 2IAMB 2PO6A 1EHAA 3QUKA 4LCIL 1CD1B 1DQDL 3T0BA 4ZUSA 4NZRL 1HILB 1KGCD 1MH5B 3SDCD 4UTBH 5JHDA 4CVZB 4U1IA 2QV2A 5J1AA 3NIFE 3MCLL 3HG1A 3UTQB 3HB3C 2VLJE 4HWBA 3LB6C 3VI4F 3DVIA 4MB4A 5J4MA 4LP5A 4Y5YB 3PWNB 5HJ3A 1T7WA 4FMFA 2CO7B 2JB6B 3L3JB 3C60C 4DUXA 4S1RH 5FXCH 4CL7A 3QDGD 3F65A 1HXMB 2F74A 4FQPA 5DVOA 1U8HB 2W9EL 2NW3B 3WLBA 5TDOA 2NY1B 5FM5M 5MERB 3FTGB 4XP9H 1BOYA 4P23B 3RJDA 2BNQA 4NSKA 4KRPB 4V1DA 2NY2C 3MBED 1BZ9B 1F11A 3RDTB 1N64H 2W0PA 3ZHDA 1RIVL 5KN5A 1RZJC 2VJXA 3CPLB 1B0WA 4WCYL 5CJOH 2MHAB 4DEPC 4YHML 1ZT1A 4Z7OF 1FFOA 3MLVL 4LAQL 4O02L 4POZD 4OM0H 4K3EH 3FTGA 5CEYA 3WD5H 3RL1B 3FQNB 4S1SH 3QCVL 1MRFL 2P5ED 2GK0A 1DE4B 2JIXB 2WQRA 3BJ91 4LCIH 3GZKA 1EJOL 5IBTH 4AENB 4MDJA 4DZ8B 2XWBB 5EIIA 3MV9B 4ZAKB 2LAGB 5F8RC 4N0YL 2J4WL 4BH8B 3C2AL 5C09E 4WUUD 5TDNA 1DLHB 1CDHA 5EFIB 3UTTE 5FB8A 3QG7H 4KFZC 3WXVH 4LPUA 3DYMA 3OAUL 1R3IH 3MLYL 4IJ3C 3HKFA 3JTTA 5KOMC 3UAJD 5IMOA 1O7SA 1MAMH 4R2GC 1I8IA 4X0KA 5CD3A 1SY6H 1IARB 5J56B 4OAWA 3QUYD 3RY4A 2X40A 4F3FB 4NO5B 3PQYA 1Y18B 5C0BE 4XP9L 4DAGH 4PJHF 4FG6D 5GZOC 5JR1H 3GMPB 5BZDA 2E5EA 1QFWI 3CXHK 1NAKL 4QTHA 3TLRA 3V0VB 4GLRI 2QQLH 1OLZA 3X3GL 3CFEB 1MCDA 2DBJA 2AJ3B 5CINH 5BV7H 4QXTB 5ID1B 2FJGB 2W9LA 1FC2D 3INUL 2CR3A 3VMOA 1J7VR 4L4VD 5DEGB 1LO4L 3OTTA 4G8EB 4IRSA 2DBLH 1MEXH 1TTGA 4MCYB 1F8TL 1BVKB 3ZT6A 5IB1A 4L29A 2G5RA 5C0EB 5KSBE 2E6JA 3WEXA 2NY0D 5T3ZD 4PJAE 2NLJB 1F6FB 3QR2A 4FFWC 1A4KA 1JPST 4K8RH 1IM3A 3QO1A 4MVBC 2L7UA 2OQJA 4RZCA 4G6JH 1SVZA 2YA2A 2DTSA 3FN0L 3B9AA 3PWVA 4NQVB 1GZQB 3RX7A 3MZGB 2IBBA 1JYXA 1GRWA 5D7LA 1MIMH 1YQVL 1INEH 2ED9A 1ORQB 3HR5B 3VW3L 3TA3A 1UA6L 3QJFB 3VFTB 3IVKA 4L29B 3R0MA 1XMWA 3RAJL 3A0OA 5C2UB 4DGYL 3NZ8B 5DWUL 1X5XA 1VERA 3UTSB 4DK6A 1WCBA 2PXYD 1RJCA 3PXJA 4G8GD 3S36H 1QO3A 5K9JL 5INDB 1BZQK 5F93C 4C83B 3DVGA 5KAQF 4HWZB 4GG6A 1VSCA 1P4IH 2QQNH 3X3GH 4TVPH 4UT6L 1MFDH 1MCKA 3HCVB 4JQVA 1MWAH 4HFWB 1CLOH 4HF5H 2AJVL 1VFAA 3P30H 2NY0C 4LFHG 5CJQL 2NX5B 2BNUB 4OM1H 5DZOA 3TC9A 1P7QA 4GBXD 1NCBH 2X2YA 4JN2A 5F97E 3L3GA 4NHCH 4E41A 1HHGA 1XGUB 3F62A 1T0MB 2XG5A 4JKLA 3BKCL 2FHCA 2ZCHH 4OCNC 5DUPL 3KLSA 4X7DC 1RJZA 3LKRB 1MEXL 1F3JB 1FNSH 3GMOA 4ZOCA 2JB5H 3HLAB 2PW1A 5KZCB 3QFDB 3BWAB 3F5WB 5GZND 3VH8B 4WEMB 3RZCA 3MR9B 4HIJB 4G6KH 1M6OB 2A0LD 2BVUA 5E1HB 1Q9OB 4HKJA 4UU9A 3CVHA 1R24A 2DQUL 2R2CA 4IOIA 3B43A 5EUKB 3IDJA 2O5ZL 3RAJH 4OBSA 3VA2C 1F5WA 4BKLA 4NJAH 1HSBA 2VLRB 2FRGP 2IPTH 3SDYL 1UJ3C 2CK2A 3F6IA 5FAAA 3GMOB 4X4ME 1KB5A 1MUJA 1TIUA 3CSBA 3HE6D 4EUPA 4HIIA 4HKBB 5EC1B 3ZE2F 1Q9LB 3BHBA 2ZUYA 1QLRA 2XQBL 3QFJA 3DIFA 4WFHE 2BK8A 1P5VA 2DTML 3MBEA 5GSRB 3L9RA 4P4KA 4QLRA 5GGRA 4JB9L 4Q9RH 4HC1A 3NGBC 4HDIB 4D8PA 2YC1A 4GKZA 1U8NA 4JREC 1OPGL 4PJXB 4JFDB 4DN4H 1MCOL 4MDIB 5HHPA 3C5ZD 1NCBL 3OGCB 4E9LA 4P46A 1R3HA 3TH3T 3WNOA 1AXSA 3B2UC 1UB6A 4NQCB 1E4XI 4FQHA 2E7LC 4EUPB 2IAMC 4PJFA 1EO8H 2ARJB 2G60L 2Y1VA 5E70A 3UYPA 3IFLH 4LEOA 5I1AB 3O11B 4HXBH 2ITDB 5JHDD 3IKKA 4ETYA 3HPLA 4FQXD 1LO0H 1EFXB 1KBGH 4I48B 1T66D 4KGJA 5FKPA 1WICA 4L8SA 4WNQB 3VE0B 2BVPA 4G7VL 4O4YL 4P46B 1FYTA 4R4NC 3CMGA 3SKNB 5C08E 3EYQD 3Q0HA 3GUTA 1CXLA 3BZ4A 4HPOH 4Z7VB 5K93A 1AH1A 4L8CB 4FZ8L 5HGBB 4R6UA 1AFVL 3HZVB 3RI5K 2O61B 1IL1B 5HHXL 5D9SA 5IB2B 4UT6H 4OQTL 4YHNB 4Z6AT 2AXFA 4P0DA 4MJID 3AREC 2FIRT 4TPRL 3QDMB 1SBSH 4ZTPH 5C0DB 3MOBL 5I1EL 1ULVA 2QTEA 4IS6A 1I8MB 4NKOB 4X80L 4OIBA 4AIXA 3MRCA 5AD0B 4L3AA 5CBAB 3W81A 4OCWH 3IU3A 2Q1EA 4OCXH 1JWSB 5KVMC 4ZNCD 1IEHA 4ERSL 4JDZB 3VXUB 3B3IA 2YWZA 3T09A 2BFVH 4X6CB 5GGSY 1BIIB 5DHVB 4NYLA 5KSBB 4OFVA 5FIEA 2C3WA 2EYTB 4ETQB 2HWZL 4YXLL 3CSGA 1JNNL 1KB5H 5MEND 4NDMA 5D1XB 5IJVB 3CDYA 4HJ0D 4P5TB 2Y06L 4AL8H 2FLRT 2YZ1A 4U7KA 4XBPB 3KR3H 5IR1B 3H7BB 4PJDB 3VXUA 5FA3B 3WKNA 4Q2ZA 4MVBD 1GGTA 4GUPB 2XZAL 2P45B 3WFEL 4EI5D 3QH3A 3OHXB 4JFDD 2EE9A 5KVFH 5E1AA 3D39D 4HIEA 3BIAX 3C5JB 3RPKA 5I1KL 2BZDA 3SDXA 3VXNB 3TVMA 5E2WL 1NC2D 4OLXH 5KOVC 3FB5A 5CJ8A 3C60B 5IFHL 5DJYB 4F2MA 1Q0XH 2Q87A 1UACL 3ZE1E 3GM8A 3HE7A 2ED7A 2MWCA 2GITA 1O7VA 1AE6L 3DV4A 3U0PB 4PLKD 5IW1B 5F7FA 5I8OL 2BSTB 4QKXB 1F6AA 5EWIL 1T2QH 2I9LA 3HC4L 1KPVB 5B39A 3W5NA 4K2UL 1UWEH 1IAOB 1QSEE 2MOVA 3FFCB 7CGTA 4W6XB 4W4OA 1ZSDB 4L1DA 3SEPA 4H8WC 3QUKB 3S35X 3OF6D 1P7KB 1NFKA 3HTLX 4HUVA 1MWAA 1LK2B 2HLFD 3CDFA 5KSUB 1BAFL 3ARBB 4WHTA 1NFDF 1OGTA 1WC7B 4P48A 5IW1A 3W0WD 3GIZH 4PGCA 1ZVSA 4HUXA 4LIQE 5DT1H 5IT2H 2DM2A 5D2NE 5EG6C 3I6LD 1NUGA 1KCLA 2PYFB 1LVEA 3O6KH 3WNLA 5DJZB 3TVMC 1RUKL 1KT2A 3IDIA 1S7SB 2F9BT 2APXA 3WJJC 5C71A 4M1DL 1KG0B 2DQTH 1FFQA 5KSAA 5C08A 4F33A 3BPCB 3BW9B 4DN3L 2GAZA 4PJHA 4C58B 4JFPA 4RISH 2YD6A 3SGDH 5T1LD 1GHFH 3MLZL 4L4TE 4HGMA 3QG7L 2W60A 4H1LH 2XZAH 3DUHA 4POZC 4KJWC 3DO3A 3GMNB 4Z7UA 3JWDC 2X89D 3QUMH 4GS7C 4PGBA 2IF7A 4HCRL 4EDXA 1DQMH 3BZFB 3ZDXF 4F7EA 3CXDL 4R8WL 2X4TA 4BQ6A 1EGJA 2GAZB 2FH6A 3MTRA 1QBLL 4PJHB 2ED8A 2VL4A 5F1NA 5DD5H 3LD8C 1LO2H 1PEZA 2BNQE 2I9TB 1FYTD 1MLBA 1I1AB 3O8XD 5DHYA 4KV5E 3N1GC 3EJJX 3CFJB 3T2QA 3BKYL 3UEZA 1C7TA 4M5ZL 2C1PA 4ZAKA 4DGVH 3N85H 4PGDB 4XGZB 1U93A 2CLVA 1IKNA 3FB8A 5FK9A 4LCYB 2BVOA 4N0UA 3EAKA 3GJFB 1UXSB 5BS0A 2GY5A 1FIEA 1HINL 1HQ4B 2X4TB 1NFDA 4ZPVA 2CDGA 4P5MB 1UWXH 25C8H 1QSFE 1AJ7L 4I0KA 5L0QB 4WWKD 3VD9A 2XRAH 1T0NB 3VGEA 2PCPB 3RP1A 1TTUA 2DQEL 4MZ3A 2EH8L 2A6IA 3CX2A 5FUCC 2BVOB 1XF1A 2X4RB 3AXLA 5EU6E 1RURL 3F7PC 3NABL 3FHQA 4OZ4A 2F19L 2FL5B 2C9AA 3REWA 3RPIB 4IEFB 1IEBB 2H26B 3PGDA 4M4PA 4F57H 1TVBA 5L6YL 5EO9B 3W11D 3MLZH 4U1LB 4JO4L 4OKDA 3ZKND 5C07E 1G7JA 2R29L 3EYFB 4ZFGH 4I77H 1KENL 1YEEL 1YNLL 1JV5A 5JMOC 5K9JH 1GH7A 1KLFA 2I60H 4JG1H 4MCYA 5C0BA 1V7NL 1VENA 4G6AD 3I75A 3NN8B 4IIQC 4KK6C 2DKUA 5D7IA 1XF3B 2QQQA 5EA0H 3MJ8A 3QULA 1P6AB 3UTTB 2VAAA 5IVXA 4Y19D 3A6CL 1FQ9C 12E8H 5TDPB 1IKFH 4XCFH 1R3KB 4XP6H 4V1DB 4Q9QL 1NDMB 3PDGA 4JFQB 1MLCA 2Q8BL 4JO2H 5JUEL 2Y9RT 3O41B 2XWJB 4L3CA 4MXWL 5DFVC 5BMFL 3BRDA 3UBXI 3BUTA 5HI5C 5EC2A 1BVLB 2EZ0C 4L8BB 4QOKD 4UQ3B 4PRNB 1WFTA 4TUOA 2FEDC 4MNQB 1OAKH 4WTXA 3CUPA 3O3DB 3P2TA 4OZIA 1T03L 2JB6A 3SBWC 4PRDB 3WFHA 1KNOA 5CLWA 3MRLB 3X13A 2VZOA 4C83A 1DE4A 3VWJA 2OM5A 5TFSL 2RJMA 2CLRA 2VLKB 2Q7YA 4R26L 5I1LA 4WFFE 2AP2A 4V2BA 1C16A 5HHQB 4TUOB 4PYGA 4G8GA 4KUCD 3CUPB 3O3DA 1ONQA 4NNXB 2WANA 3D2UA 3OL2A 1AHWA 1MJ8H 3VFGL 4R9HA 4XNUL 3RTQD 1X5FA 5CUSL 4HW6A 1J86A 1HXYA 1P4LA 2WIIA 1A64A 1XCTA 3FO9A 3CX5J 3KHQA 1NCWH 3HI5H 4MAYC 1E4KA 5B21A 2NY1D 3EDDA 4HLZH 3MV9E 5CD3B 1J88A 1J10A 4GAJL 4Y1AE 3D9AH 2H2PD 1SMAA 1C16B 1YEEH 3PWJB 4K3EL 4KQ4L 1UKSA 3WS3B 5HHQA 5DK0A 2EKSB 4WWKB 2EKJA 2BY0A 2V9RA 5HI3C 1FORH 4XBGB 3FQRB 4JRXD 2L0DA 4TNWF 4KKAD 5C0JB 5HXMA 2AK4E 3QNXB 3BX7C 3VXUD 2FB4L 3FO9B 4UBDD 3TT1H 1FGVH 1YNTA 4KKBD 4LCWB 1HSBB 4F7CA 1V3LA 5LQBH 2X09A 5FYJE 1YYML 4M3JA 5DHVH 5ELIA 4DQOH 4JVUA 2WBJC 1H0DA 1O5DT 3ARDD 1RUPL 3V6OA 2P8LA 4E41D 4HS6A 4JHAH 3ARPA 1IC5H 3QIUC 1A8JH 3LKSA 5EOQH 3WEXB 5BJTB 3EO0A 2RIKA 3MRGB 4Y5VB 4OAWB 2C7UB 4HCRA 2VQ1B 2APFA 2WAHA 3UYOD 1U8IB 3UTTD 2EXWC 3B9KD 4GKZB 2EC9T 4OGAC 3TN0C 2ZSVA 4U1HB 3U4BH 2B1HL 1U3HA 3S35H 4N0CC 3D1MC 1U8KA 4BUHA 4PJFB 1IM9B 1F90L 1QOKA 2GUOB 2NW2B 2GI7A 1U36A 5D4QA 5BOZG 2VZTA 4YDLC 5EBMB 1RJLB 1E6OH 4H25A 2X4QB 5JUEH 2E7HA 5FM4A 1OWWA 4N0RA 3T77B 1WBYA 3EYQC 3FCTA 1FO0L 3NACH 1U8MB 2ZUSA 3HPJB 2B7DT 1D3CA 1PEWA 5F3BB 2R69L 1TQCC 4LLQA 2NY7L 2P49B 1BFOA 4FFVC 2FBOJ 3OKEA 3RGVA 3D0LA 1R5WB 3WIIH 4FQXC 4BFEA 1JZ4A 4P59L 4QNPE 2EE6A 5E8OB 1YYMH 2ZKHL 1IL1A 1U3ZA 4A2MA 3SJVB 3RVWD 1UZ6E 1JUFA 1CXEA 4TTDD 3GMQB 2V2TB 5C0AE 4GG8A 2ICES 4IRJA 1GPOH 4HT1L 5HHME 1L7TL 3IJHB 3C6LB 3UTPE 4V1DD 1U8JA 4YPGA 3RGVB 1ZWIA 4OQTH 3VDAA 2R1XA 4OZFB 4WW2B 3V4VL 3BT2L 3FO1B 4GS7B 3FMGL 4NZTH 1ZT7B 3Q1SH 3R8BB 3MRCB 1BJ1H 5LCVL 2HG5A 5AD0A 1J5OL 1EMTH 5JO5B 5B3JE 5FM8A 1MJJB 4ZS6C 4PJAA 2VL5A 4YHLL 4XPBH 5E2TH 3RL2B 4IDJL 4ODTL 4R2GD 5JXAL 5H8DA 4AQ1B 2BRQA 3BO8A 5I1KH 1OTSC 3G04B 4NQED 4OQ1A 4U1JA 4M7LH 5E8EB 3O81A 1AP2A 4Q6IA 1DLFL 1I7RA 5FV1L 1OAYH 4NKIL 3T2PA 4NP4H 4NN6B 2B4CL 2EIBA 5DMGD 5EZIL 4FNLH 5JO5A 4GXVL 1A3LL 1KULA 2YK1H 3QFJB 3DIFB 3V95A 4HEME 1DVFB 3S36X 3VGAC 4R7NB 3CZFA 4S2SA 1MCOH 5CJBA 4XVUC 2HKFH 4PJ8D 4L3EA 4JFXB 4NQCA 3Q48A 1M7XA 4HIEB 1JWUA 4EIZC 2P7TA 4XAWH 2VR9A 3V5KA 2IPTL 3ARFC 2C1OA 3T2NH 3O3EB 4XC1L 3KLHD 4M48H 3VWJC 1S9KC 1AIFA 1A9BB 5FF6A 1T80A 1DVFA 4KKCC 2B5IB 2FJHA 3L5XL 3QIBD 1A4JB 3HC0B 3VG9C 5TH2B 3ROOB 2F53E 4LSQH 3QQ3A 2NY2B 2VMFA 3ULVL 4F9LA 4HSQA 4RFEA 1ZAGA 1OT1A 2DDQH 5C0RL 3ES6A 3VRIB 4R7DB 1QFUL 1MREL 3H9SB 4X99A 3RIFK 3SGEH 5TF1H 4M7JH 2AK4B 4WHTB 3RIAK 1NUFA 2O5XL 2ATKB 3QUML 5F9DC 2G60H 2OJEB 1CK0L 3ULUL 3K2UH 5DO2D 2O93L 4LKXB 1IZKA 1NAMB 3HE6C 4W68A 2NY0B 5C09D 5T3XE 1K8IB 4JRYD 4CVXB 4ODUB 4QHKJ 1UH3A 4YBQC 2WMPA 2YUVA 3DJ9A 4EN3D 1R5IA 1TNNA 3QCUH 3HG1E 1RZ8B 3VFMA 3X3FL 3ABZA 3IDYB 1XF2B 4XAWL 5H2BB 3TIEB 3BH8B 3MV7E 4DKEL 2GJJA 2KKQA 3GO1H 2A38A 5D70L 5C8JB 3RZCD 4NYLB 1R3JB 1WTGT 1GC1C 4PJGB 3BEVB 3LN5A 2X89A 1F58L 2YKLL 3RVTC 3G6JB 3KYOA 2IEPA 1I8MA 4CNIA 4I3RH 5I74B 4WI7A 1DBAH 4IOFD 5I30H 5JNYA 4LP4A 3WO4B 5EU7C 5IFHH 1FV1B 3HMXH 1KJVA 1V7MH 4JQXA 3C6LD 3BN9D 3RGVC 5F7UA 1XFPA 3C5JA 4PJ8B 3IDUA 5HPOA 2XIDA 2VDLH 3C5SB 4K3JL 3VXNA 1BX2B 4KUZH 2NY6D 5EU5A 5GRVL 1ACZA 1P6FA 4I5BB 3VRJB 3N85L 2E7CA 4RFNC 1BBJA 3IU4H 4I2XB 5JNYB 2LTQB 5FOBB 1A3RL 4UBDC 2YD9A 2MJWA 3MGOA 3IXAB 3K0WA 3Q6FA 3KVQA 1NLBL 4JZOB 3ILPA 4OGXL 3CMOL 2AS5M 1DBMH 2KL6A 3C5SA 1WGOA 3KR3L 4DKFH 1CWVA 5IQ7H 2R4RL 1G6RB 2ESVA 3GSXA 3QXWA 4AK1A 3L3IB 2FX7L 4O5LH 4P3WA 1AD9B 5CHNA 2OS7A 4BZ2L 3WKMH 3I2CH 4HAFA 1AO7E 3KJ6L 2Y5EA 1EIBA 4HC1H 3X3FH 3TVMB 4KZDL 4M3KB 1QEWA 4ZS7L 2W9DH 1MREH 4ENED 4FXKB 1LGVA 3IJSB 3UO1L 4OGYH 4U6VL 4JG0L 2ESVB 3MLRL 5GGTH 3D39B 3STLB 4Z5RA 1XF3A 3I9GH 3U46B 2X1PA 4NO3A 3TBWA 4ZFOA 1N0LA 3BGFC 1DZBA 3UYRH 3QNYA 3CFKB 3QDAA 2N7BA 4ODHH 4LSDA 4UIMB 1ORSA 4JFQA 4DVBB 2BY1A 1MNUH 4Y7MA 4NQDB 4QO1A 3ARVA 3R8QA 2P47B 2AJZA 2VLMD 1ZHBA 4GAYA 1UM4H 3HC3L 4K7PH 3O0RL 5SX4H 2ZCKH 4X4YB 1B3JA 4QTIL 1DBBL 1FIGH 5DYOB 5HI5D 5CLTA 1OCWL 3WFBH 5IVXE 1I3UA 5F9WB 4UB0H 3IETB 1MLBB 2GYSA 5F96L 3VD3A 2AK4D 2YSSB 3TA3C 1P53A 1PG7H 1TITA 1AHWC 4AM0B 1FL3A 1OAXH 4TSBL 4Y1AD 5J9PB 3ZE0E 2VXQL 5CSBA 2F58L 5T5FL 4BQ9A 2D9QB 1UYWL 1NMAL 3L7FA 4RFOL 1W8OA 5BS0B 1MJUL 4YLQT 3S5LG 3CFDB 2AJSH 3QEGL 3VXSE 4ZXBA 4PG9A 1F13A 1MRFH 4HGWB 1DEDA 5CZVL 3SKMA 3K2MC 4PTTB 3FOLB 1E4XL 2F19H 5T1KA 4JQIH 4UUJA 4K55A 3CVIH 3H8NA 4R4FH 4M8VA 1EJ6A 4X98A 4NJ9L 2FATL 1MHEA 1F11B 1ZGLA 32C2B 4I18B 4RWHA 2B0SL 1BZ7B 3T1FA 3TBTB 2MQCA 4I77L 1NLBH 3IJYB 4OGXH 5LAXA 4KQ4H 2I5YH 5HI3D 5BS0E 2ZUQB 4Q6IC 5DEFB 4U1LA 1YEIH 4PLOB 5GJTH 1UXSA 4UIKL 4IIQB 5D6CB 3WO4C 4MS8D 4P2OB 3LQZA 4NN7B 2EO1A 1ZMYA 4PJCB 2XA3A 1MCLA 2CKBA 4RQQA 3S97C 5D7LE 1IGJB 4BQCA 5JXEC 4FABH 1XF5A 2QJDA 5HI4C 3K7UA 4ZO8A 2VR4A 5D1QB 1T0NA 4OM0L 3A6CH 2NTSP 3K3QA 2NY5L 5EH1A 4GSDH 2VQ1A 2ZG3A 2NY6B 2XN9B 2Y4SA 4R0LA 2OR9H 1RUPH 3G5XB 4YDIL 1NDMA 4HIHA 2BSRA 3INUH 4K94C 5D7JA 4G8EA 4LLYB 1FAKT 3B5GA 3UTZA 1FCGA 4N0YH 5JIHA 4EI6A 4YDVB 2NY4B 4FP8L 1ZLSL 5D1ZD 1NGYA 4JZJA 2BC4B 2ZJSL 1BECA 1BOGA 4L1HA 1T03H 1J8HB 1JGLL 2AJXH 2X4QA 2D7TH 1G9NC 4H26A 3PWVB 5B8CA 4WW1B 3EGSB 5C92A 3VXPB 3VWJB 4M93C 5BZDB 4BSJA 1NBVL 3AVEA 4FQIL 4NQSA 2B0SH 1X44A 2IFGA 2A77H 3QPXH 3VFTA 5DLML 1FN4B 4UI2A 1VKXB 1OWRM 12E8L 1NCWL 3HI5L 3Q3GA 2WSKA 3H42L 3V6BR 5IV2B 1NH6A 4ZD3H 5I8KL 5E94A 3FQTA 4F8TA 4POUB 4HZLB 4M6ML 3KDMB 5DEGA 3CXHJ 2P5EE 1EUTA 2ARWA 5ESAA 1DLFH 5C08D 4PP1D 4XWOC 4ZO6A 3S6CA 1LO3L 1IE5A 4DW2H 4X8JA 4I0CC 3CH1B 4S1QH 3MA7A 4L8DA 4PRHE 2G75A 5FHBL 2HJFB 3D87B 4XTRD 5F71A 4OCXL 4TNVK 2VDMH 4YDIH 5JQHC 4BM7A 3DX9A 3R0NA 3ECBB 4P3CH 3EHBC 4QWWD 3KPNA 4XPAH 5I19L 3TCLB 5KSBF 3Q6GH 3VFVA 1KIPA 2DJUA 3C5ZA 1JGDA 4R4FL 3BGMA 5L88L 1FGVL 4OLWH 2A83B 4PLKC 2I27N 3PGCA 1AGCB 5KSAC 4U6XB 1T22B 4K8RC 4TVPD 3LN9A 1UXWB 4F7PB 4QT5B 2R2HA 4P4KD 2PW2B 3JV4B 5FDWB 3JVGA 1ZLUH 4ZFZA 2XZZA 1A6UL 3KYNA 3NFPA 6CGTA 3LQAL 1A7QL 4QGYA 1JRHL 5BVJA 2BDNL 2WWMC 4YWGH 1SQ2N 5D72L 1S8DA 5BXFA 3U6RA 2EIEA 5DD6A 2EDFA 1UWXK 3MRHB 3H9SE 5HHVH 4Y8DC 2IFFH 1I75A 3PGCB 3VXRB 1QBML 4WHCA 2H9GA 4UQ2A 1Q0XL 4X4MA 4HXAL 4GSDL 4K3DL 1L0QA 4G6AC 4AYFA 4XBEH 4JDTH 2MCPH 3WIHH 4QRRE 3VXMD 1E6OL 1AD0B 3TGXA 4NNPH 3VD5A 4PG2A 4M61B 4QHUB 2DTMH 3JWNC 1MCHA 1J8KA 1D5BB 4P9HC 4KAQH 5E6IC 1UZ6F 2ZJSH 3MR9A 3MRPA 2G5BB 4LIQH 3MACL 1OSPL 3TJEH 3BPOC 2VDML 4Y4FA 1RZFH 2VUYA 2V7HA 3RY6A 1F02I 2B1AH 1IC7L 5AZ2H 4HXBL 1MFNA 1JYWA 3VXSB 3W0WA 3MCKB 4LKCA 5I19H 3DWTA 1TVHB 1UZ8B 4OI7A 3GSNH 4J4PA 2AK4A 4FQ1H 4LPWA 3W11C 2BDNH 3P4OA 3EO1A 3HNVH 1IT9H 5FKPB 5EBMA 5ITBL 4NRXB 5EBLA 2XKUA 3JWOL 1F3DH 3QUXC 5DD0H 3U7AA 3KJ4C 3P73B 4NCDA 5IMLB 1CLCA 4LDEB 4RISL 1QVOB 1CDIA 5EDXA 1LO3H 1LP9A 1V05A 3SPVA 2V2WA 4I3GA 4J1UA 1WBXB 3T0ED 5E7FA 2CMRH 5SV4A 2E9IA 4LNRA 2CDEA 3CFCH 2VL5B 1OF2B 5DDHA 4ZUWB 4KMTL 2AJYL 3MRKB 1CLZL 3MYJA 4EOWH 4Y4KA 1TQCB 3MMEB 1K4CB 1QRNB 3DYOA 4KUZL 4M1CD 3EOAB 3WSQL 5I1EH 1N6VA 4H1LG 2P5WE 1I7RB 1L6ZA 1JHKL 1R3JA 3IAGC 4O51B 4YBHA 4PJGA 4JY5H 1KF9B 5DT1L 5IT2L 5A16A 3AREA 2LVEA 5E00B 4KTDH 1BVZA 1TPXB 1MRCL 3KPRA 3O6KL 3FB6A 4X5WA 3WNNA 4JFFB 3WL9A 1PW3A 1YEFH 4PJ5D 5KS9A 3EOAA 4NC1C 1CLYH 4O5LL 5DTFA 4YHKL 4ONGL 1WV7T 3SE9H 1MCBA 2PTVA 5HYSB 5DJXB 5KTEH 1WIPA 3R4DA 5JXEA 2OZ4L 1BGXL 4OF6A 1JNNH 1KB5L 2BXZA 2J5LB 5BOPA 3MPCA 1TZIB 1UQSA 1AKJB 4R96B 4OLUH 5A3IC 4EBQL 5I1JL 4JHWL 4AY0A 3I02B 2SEBA 3AY4C 4UOW0 3OQ3B 5BO1L 4OCYL 5JW5B 4G6MH 3HE6A 4R8WH 5IW6A 1QYGH 1P1ZB 2DLFH 2DLGA 3QG6A 4JJ5A 3E3QE 4HPYH 5E8PA 4LNVA 4KGLA 2PTUA 2GTWB 4PY8J 4D9LH 4X7EC 2Y07H 1OP3K 4ODXB 5E95B 3G5VA 4MSWA 4PJIE 3B3IB 3BD3A 1FPTH 3GGWA 1OM3L 3NTCL 3KYAA 4GW5B 1FZJA 4MXQC 4CGTA 5DHVA 4MLSA 1W72A 4F15C 5JOPD 4G8IB 3V5KB 2X4NB 5E8NA 2YBRB 3LH2H 3PHQA 1PG7X 2AXJA 1QEWB 4Z8FL 5CSZB 2ICEA 1CZ8H 1NC4D 5EU6B 2HVKB 4KHXH 4BZ2H 1V8HA 3T0AA 1JHKH 4JGUA 3D0VB 4WFEE 5FA3A 2P5WA 4CJ0A 1R5VA 4YHIB 3VG0L 5D93C 1CDJA 2UY6A 5J3HC 1N4XH 2G2RB 1UB5B 3BDYL 1FE8H 3MLUL 2VOTA 3JZ7A 5T1MB 4PJEB 2KZ1B 5CBEA 2WUBL 4DOHE 4S1RL 4KU1A 2WUCL 3QNYB 3MX0A 3ES6B 4PGCB 4R4ND 4UIMA 5DJ8A 5GGSA 3DX6B 3QIBB 1CLYL 3KPRE 4PJ9D 5KZCD 1I9IH 4GRMB 4KVCL 2O5XH 5EPMB 3D0VA 3UTSE 1MOEA 1G0YR 1CYGA 1EFQA 4X4XB 1T5XA 2G2RA 2A74B 4AH2B 1X4ZA 4JQIL 4Z0BL 1Q8MA 3VXSD 4JANA 3RY5A 3U0TB 3HZKB 3LKNA 1JNJA 5F9JB 2EIZB 1CXHA 3ARWA 1TJIL 3C5ZC 4G8FA 5HGHA 1KJVB 1H8NA 2VXSH 1OOAA 4PJIF 1S3KL 2DLFL 3P9WB 4K3HA 4PGEA 1FJ1B 1I1YB 1BPVA 1U41A 2AXHA 3P4MB 4XNZB 1PQZB 3RKDD 1OW0A 4HUXB 1NEZG 2FYYA 3JXAA 2HJKA 2PUQT 3D69A 3O45A 4WEUD 2W0FA 1OQOA 2OR8A 1BAFH 1DBML 5T3XD 4GH7B 4HAGA 4DFIA 4APQC 2X1WL 5DUMH 5AYUL 1SEBB 5TGBA 4Y19A 43C9A 3ZTJG 3EJYD 3M1BB 4NQCD 4M7ZB 3MO1B 1N7ML 1KELH 1JZ2A 1NGXB 1CFVH 1CE6A 1S9XA 1EAPA 4PRAA 1MQKH 4RAVA 1WFOA 2HFFA 4U6HA 4LLDB 2V9TA 1QFPA 1UENA 1XR8B 1U3HC 1QA9B 2DD8H 2LFGA 5GIRB 5D1ZC 3WJJA 4PJDE 1S9YB 3NIGF 3S34H 3WBDA 4CDHA 4ZMAT 3SBWA 1FO0A 5K9KB 2VITB 4OB5H 1S7TA 4ONHB 3MV9A 2OSLA 4DGYH 2Y07L 5ISZD 1QSED 3QYCA 4Q0XL 3LKPA 4Y5VC 3DVNA 3DSFH 3LS5H 3IYLW 2COQA 1U9KA 3L3OB 3ULUE 3RVXD 3RNKB 3C9NA 4ELMA 5DVNA 4KWUA 3B9KA 1DBJH 3LH2L 3GSQB 3DUSA 5EN2B 1P9MA 4EQ3A 1FFRA 5DQDH 3GI8H 3DRTA 3ELAT 4U1SB 2KDGA 1QSEA 4TVPL 4XGZA 1MWAL 1VHPA 2VLJD 4R0LB 1IGML 3FZUD 1UC6A 4JY6A 4MMXC 4M6MH 5DXWA 2CIKB 3KLAA 5DJAB 2QHRL 1S5HA 5E5UB 3EO9H 3BZEB 4WCYH 2HLFC 1QRKA 3V5DA 4U1GC 1OAUH 3NH7L 4A6YL 4H26B 5BRZE 1NSNL 2HT3D 5DJCB 3UP1A 1JZ7A 4PUBL 3I3EA 1Y6MR 3SKJH 4XP4H 2ZKHH 2FL5A 2MPAH 3MLYH 2X4PA 1S5HB 5HSFA 4GRLD 4R90L 2V17H 3QPQD 5BVPL 5HDBE 1TVBB 1ES0A 5L88H 1HHHB 4NKDA 1EX0A 2YN5A 2ESVD 1UG9A 1CTOA 2BNQD 1JBJA 1KENH 3NCCB 1S3KH 1UVQB 1L7IH 1NL0H 4K07A 1QFOA 4IOFC 1B4JL 4PRIE 4HGWA 3QO0A 3QDME 2F54A 2B2XL 2EXYC 1E4XH 4TVPE 5H35B 1RZIA 3QSKB 2RR3A 3BAEH 2JJWA 1IGMH 5IFAH 3LN4A 3D2UB 5CIPH 3UDWA 5MEOA 4LEXL 4P2CG 2QR0B 1VFBB 5TPWH 5FCUL 4HKZB 5DD1H 4K7PY 5KBNC 3EKCA 3LV3B 4WO4D 2P8MB 1NMAH 4GQ9L 4PJBF 1A6AB 1CXFA 1HSAA 3RA7L 5T33L 3KPOA 4NWUL 3B9EA 5IOPB 5T5NG 1DBKL 1KIQA 1BEYH 2OXHA 1NFDE 4PTUA 2R2BA 3EYOB 5CJQH 5GS1C 3PP3H 3LZFL 4JGJA 4NO0D 4OLVL 3KPMA 3TO2B 1T0MA 3TYGL 1N5YH 4AEIH 4LSUH 3ZHKA 3QXDB 5IMMB 3QI9D 4HWNA 3PWPE 3TT1L 1A6AA 1HSAB 3U83A 3QDJA 3ZT5A 2MFNA 5I2IA 1ZHLA 4JFYA 2VZ3A 3CFBB 3HRZA 4N9GB 2FX9L 4QRRB 5HDQL 3N1PC 3VH8A 5E9DE 2Q8AL 4JHAL 4G42A 3LKOB 1YPZA 1MCIA 3EO0B 1IJ9A 5EU3B 5D6CA 3LCYA 1I7ZB 2JCCB 1AI1L 4J8RA 5E08L 1JWMB 4FQ2L 4IRSD 5I1IL 1ZLUK 3F8UB 4XPGH 4FQXA 3FQRA 5FO8A 2UV3A 1EGJH 3V0WL 2ZSVB 1RFDL 3VXQA 3PWPA 4LGSB 3U4EB 1CBVL 1MFDL 3S35L 1IM3B 3QO1B 3GI9L 4OV5A 5EC1A 2BSSA 1DFBL 1JTTA 3SDXE 3BHBB 2V7HB 3GEWB 3TJHC 1FORL 2Q86B 5I8KH 4LPCA 4YH6A 1K2DA 5IB3A 3VGAB 4PJ8C 4LIQL 4KJPD 3QJFA 3OKLB 3QI9C 5DQJB 5I15H 3NMEA 3MA9L 1LK3H 2A1WH 3VFOB 5FYLE 4YHZH 3GIVA 1RZFL 4QRQA 5C6TH 5F6IB 2F8VA 4P5TC 1NC4B 1NANH 1T1ZB 2FNBA 3U82B 4QOKA 1YEHL 1NKRA 3BDXA 4WI4A 3ZSSA 3V5HB 1XR9A 2NTFA 3CLFH 4M48L 5DJDB 2F5AL 3G6DL 4IRZL 2P5WD 4NQTA 3A6OA 3EGSA 1CU4L 4FG6C 3DX9B 2H8PA 2OXGA 5I8CB 2Z8SA 3ZLQC 3LZFH 5GSVB 3OKOA 5D1ZB 4DKEH 1FL6B 2WK2A 1YA5A 4YXHH 1G7LA 1AR1D 4P3DA 1SYVB 1U3HB 4E41E 3QISA 4OLWL 4GFTB 4PJ9B 3LEXA 1H8OA 2EDXA 1QBBA 3OKKB 2R2HB 5D2NA 2XTLA 4M5YL 3VGHA 3ARGC 4X7TA 3T0EA 3HI6L 4JPIA 5HGBA 1X5HA 2O61A 1JRHH 4YDLB 3K81A 5DD6B 3PE9A 2DQFB 4Z9KB 4YHNA 4NRYB 2ZOLA 3DGGA 4MAYD 2W38A 2PTTB 1XF4A 3QZWB 4HWEL 3N9GL 1PKOA 1X5GA 5E99H 5IQ9B 4CMMB 3L6FB 5HHMB 3EBAA 3ZDZF 4W4NA 3G04A 4Y16B 3ZKMD 2W1NA 4QRSB 3MYZA 4MD4A 5HY9A 4JDVB 3OAYH 4XPAL 5HYJB 4Z0XA 5SWSD 1KIPB 3C5ZB 3VFUB 1YJDC 2QQKL 3X17A 1KIRB 2CLZB 4JO3L 1DQLH 4HULB 1AD0A 3QIWD 3LEVL 2YEZB 2VDNL 1U8JB 4UDUB 1FYTE 4R3SB 4PJBA 15C8H 2IH3B 1T4KB 3NA9L 2NY5C 4Y16A 1NEZB 2HTLD 3I02A 5F88B 3HAEB 2G5BA 2VABA 3T0EC 5DJ0B 5DURB 1M7DA 3MRRB 5DD3H 3M17B 3L9RB 4P4KB 4Y4HC 5GGRB 2H32H 4N90D 3SGDI 4PJFE 1PG7W 1QNZH 4L8SC 4BK4A 4JCMA 3I85A 2KUTA 2Y06H 4R3SA 3OB8A 3TN0D 1CD8A 4G3YH 5GGQL 1Y6NR 1VESA 4L4JA 1OB1B 5ERWB 5IVZB 2DWDB 1A3LH 2ITDA 3E0GA 4LSQL 3PV7A 3TYFA 3CXDH 1Z0MA 3TFKD 4QHUA 4OFYD 4L5FH 1D5BA 3MRDA 2AJYH 4WIQA 1ZLVK 1BQLL 3SPVB 3ZKQD 4ODHL 5KG9A 2EDJA 4G5ZH 3PL6B 2BMKA 4L4VA 4KV5F 2Q20A 3T08A 2BCKA 3T1WA 2BXYA 2QQKH 4ELKB 1JRHI 4U2ZA 3ZKSD 1G0XA 4Y4KB 3M07A 1E28B 5CEZH 5IG7B 4MD0B 3MCKA 4LKCB 2X4SB 4M1DH 1IAIH 4OKVA 3PWUB 1MH5A 2EDWA 1G1CA 1SMOA 5B8CC 5FGSA 2IANB 4BSVB 3KWWA 3OKMB 1WBZA 3HC0A 1KPRA 4ISVB 4JM2B 5B38G 3QJHA 4MA3B 3IRZA 5D96C 2HT2C 4DWHA 4KTDL 4MJ5A 2FGWL 4PJDF 1D6VH 2P1YA 3HI6H 2D3VA 2JF1A 4IMLB 3QWOA 5CP3H 3DMMC 3HZKA 1KJMA 4XAKE 4FQJL 5F6IC 5K9OB 3QXAB 4MJIE 4S11A 5DJZA 2FBJL 1DDHB 3MREA 3L7EB 3VXMA 4F57L 2UWEA 4BYHA 4BSVA 1KCVH 4LVNB 4X6CF 2CPCA 4P2QB 4KK8D 5EO1B 2DOCA 4G80B 3HC4H 5FDYA 3HG1B 5KN5B 4I0PC 4JO1H 4CNIB 4HX1B 2AEQL 3DSNA 1XGRB 4KKBC 1V7NH 2MHAA 1VGEH 5C6WH 1DQLL 3QXAA 1UFUA 1RQ5A 1FIGL 4UT9L 4LHQB 4YAQB 3C2SA 1PBYA 1EHXA 1DDHA 3MREB 2AXGB 4JQVC 1NKOA 2F74B 4OF7A