1P5UC

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
130
Chain Sequence
PARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein Caf1M
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone, structural protein
total genus 28
structure length 130
sequence length 134
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5uC00
1P5UC 4AYFB 1P5VB 4AZ8B 3DSNB 1P5UB 3DOSB 1Z9SB 3DPBB 4B0MB
chains in the Genus database with same CATH superfamily
3TO4A 3VVVA 1CTOA 4GI8A 1EWHA 2J55A 3FF8A 5DEFA 2FQFA 1J5CA 1UJTA 5KVFH 4YR6A 5JQHC 4NZUH 1R5IB 5BZDB 3PXLA 5C9JA 1A66A 1P7QB 1F4AA 4GQPH 1XGQB 3BZFA 1GGYA 1HOEA 3B7UX 3V0VA 1ASQA 3QHZH 4N2CA 2HVKA 1NMBL 1S9VB 3ECQA 2R23B 5KYNA 2IVFC 5HGAB 3IJEB 4KTEH 5J3HC 4HIHB 3L3DA 2QFPA 1IKFL 3IETA 2WBWB 4WK0B 1GSMA 2HX9A 3EZJB 4ATWA 5ENWB 3FU5A 4D2NA 3ZHNA 2BLFA 3DX8A 5TK4A 4ZW3A 3DI2B 2PPCA 1KXVA 2A73A 2DTML 5DURB 3W37A 1SHWA 5CUSL 2PWDA 1D2OA 3NGBC 5I0DA 2PCPB 4A2MA 4OCWH 3VGBA 4LHJB 4H8UA 4JJHA 5A2LH 5HGBB 1PVHA 1MCQA 1MRDL 4LHQB 2F19H 3UL4A 2A9CA 3HC3H 4TUKL 4PGEA 2VISB 4NRYA 5DWUH 1KEMH 1I85A 4XN1A 2J5LC 3Q8CA 1ITBB 4R26H 1GIGH 5EC1B 4HF5L 2TAAA 4X7TA 4TL4A 1XEDA 1R3HA 3UZVA 2DY2A 2BVPA 2OL3B 1GTNA 3HFMH 2Z9TA 2IGTA 2OJZH 5GRWA 3WEBA 4X9YA 3GDBA 2NTSP 4U1MA 5CEYB 3RPIB 3RA7L 1QEXA 1SXZA 5LN8A 2HAZA 4HBCH 3L4YA 1VIWA 5E9AA 5BVJB 3FH7A 2ZOOA 1DVFA 4YE4H 1S7RA 2X4RA 4F7MB 4TVPD 4LRIC 5T5NF 1VKXB 2YK1H 4FQLH 5D7IB 4RCAA 1E4XL 2IALB 1CI3M 3AXLB 2P46B 2X6VA 2E9BA 4GUCA 5GHWH 4M7JL 1GGBL 5D7IF 4KO9A 4JG1H 1EAPA 4N3TA 1I1AB 4BKTC 4YSUA 5HVHC 2WMPA 3ABZA 4MDRA 1WWWX 4TVPL 1QUNB 3IWUA 4UZUA 3K2MC 4L9LB 5J3HD 4NQCD 5EORL 4DP9X 3O3DA 4NZJA 4PJHA 4KOBA 2HN7A 3ZL4H 1FH2A 4ZG1A 5IIEA 4J3BA 2WO2B 2VLRA 2Y5QA 1FNAA 4DQOL 2NR6C 4HXAH 4MMXB 3VD1A 3ZZLA 5BZXA 1HSBB 2MCG1 4ZTOH 5HY9B 2OCFD 1NOAA 3FUIA 3F5WB 5J12C 2APXA 3EDEA 4WO4A 3V55A 4X5PA 4NWTH 3ECBB 5FYKL 5I8EB 4HWBH 4GI6A 2G9KA 2K9FB 3ARFC 1J5OL 2XG4B 1U0QA 2C7FA 4OGYL 1DE4A 3I75B 4FQ1H 5MEOB 3GJFB 1RHFA 4PBWD 4ODTH 1SLUA 4OM1L 1MJUL 3MGTA 4HKZB 1RY7B 3SQOL 3EO0B 1P7KB 3CZGA 4HEMA 4N2KA 5JOEA 3GI9H 1Z5YD 5LJYH 4EKXA 3ZT7A 4NNYB 4Z95L 4HJJH 5BJTA 1LO2H 1OXYA 3PNWB 1YEEH 3WUWA 2IANA 4U1HA 5BPPA 4MDIB 4RDQG 5AZEL 4WFED 3WDIA 2QQKL 4M48H 3QBTB 3SE6A 3DSFH 3VXME 1GGCH 4PGJA 1TTAA 1AMXA 2F7QA 4PCYA 4NI6A 4JFYB 5C0JB 5K1NA 2YXMA 2VKWA 1FNHA 3R19A 4AGOA 4G1EA 4LHUG 5K9KB 1XXDC 1EIBA 3EH2A 4KI5C 1J9SA 3KLLA 2A6IB 3ETSA 3QPXL 3W2DL 3SJVA 4JNXA 3EJPA 4IRSB 4JS7A 3TC9A 1KPRB 1J05B 3ZKXC 1T03L 4MA7L 1LEGB 1NMCB 3EXJA 5JHMA 3KL3A 4DN3L 1MAJA 1ASPA 4BFEA 5I66A 4OGZA 3ZE2E 4HUWA 3UTZB 3QYNA 2ICES 1CGUA 3KCWA 4TRPL 2WCSA 5DJDA 5IVZA 5H37G 2V9TA 4QLRA 3UYRH 3I3DA 2QQLH 1C9SA 2VABA 3GPEA 2NR6D 5J9PB 4N68A 3OC8A 3IF1A 1UQSB 3HI1A 4NM4L 5IQNA 1RUML 2K3HA 3OPUA 3CCHA 3TA4D 2Z8VC 1XMEB 3MRDA 5E5MB 3ZDXB 3QXAB 1JXGA 3BAIA 3IMSA 1BZ7B 3ARFD 2QGEA 4EZJA 1CGVA 5TTRA 5F9DC 2KZKA 3QDJD 3LKOB 4U1KA 4HIPA 4HJGB 4LPUA 3ZDXF 3CFBA 2CO1A 2PYED 3SPJA 2QL1A 3PWPD 4YBLB 3REVB 2LTQB 4Y9GA 4QHNB 3PWNA 2JKWA 4U6VL 3PHQB 3N42F 1N6QL 4G80B 1CLZH 5FYLL 5J1SC 5KSBA 3ULSA 4FYQA 3RZWA 1JZ5A 1TQVA 3FFOA 1F4YL 4P5TA 3L08A 4LLDA 5IFAH 3VGFA 2GJ6D 4OKDA 4AVIA 4GO9A 4UIKL 3D39B 2H45A 2E9GA 3H3KA 3N3EA 4QAMB 3L95A 5FYJE 4E5XG 2YRZA 3K5RA 4L5FE 5I1KH 3GMQB 3TASA 1TZOA 3VM7A 2H6PB 4LSSL 4PLKC 3WXWH 4DGYL 4X5XB 3EOYG 4R4NC 4KI5D 2ZX8A 1NGWA 1U8NA 5A6LA 3POHA 4FNQA 4LIQE 4OH2A 1IAOB 3V6ZA 4A66A 5A2BA 4ZMAT 4YJZL 4U6XA 5FKAB 3RX7A 3DPBA 3CDGA 1U8IA 4NN7C 1ZIBA 3ET9F 4X5QA 1HHKB 4CUCA 4GG6E 2F54B 2GITA 4HPHA 3V5DB 3KDMA 4ANWA 4I0PA 4KQ3L 2HH0L 1VGEH 4J3OG 1VB9A 4Z0BH 5DK2B 1FQ9C 1XGUB 2GAZB 3OJ2C 3K80A 4HP5A 4PWGA 4AGPA 4BINA 5LG6A 4R96A 1NIEA 2HLEB 4I3RH 1Q4NX 1ZWIB 4PJIB 3HKZA 1I7ZA 3T4AA 2ESVA 1BFOA 2OMTB 4Y2OA 3SDXE 1KZQA 1LK3L 2V6HA 4HMCA 4KK6C 4WHYH 5DD3L 3L3JA 3NFSH 1IAIH 1MCPL 2YPLE 2DQMA 2K3TA 1N19A 3B4NA 3PDGA 4PJIF 4YHZH 4A2EA 2VR5A 3QRLA 3WIAA 5I76B 5AYTA 5AB2A 1UWEL 3P77B 2VM9A 1I8MB 3LOWA 1CQYA 2E46A 3BVNB 1P7QA 5IP4A 3K2IA 1EO8L 3ULVC 1XGQA 2N1TE 3HFFA 1NOLA 4XMVA 1UD2A 2IPUK 3PL6C 4Z7VB 5ERWB 5CBEB 2R23A 2R4SH 4S0HA 1CLOH 5HGAA 1PY0A 2E7HA 4ZAKC 1AQKH 4LLQB 4ZTEA 1UFGA 1FORH 2H26B 3BSZA 3IJSB 3QEQD 1D9KC 2R69L 1RJYB 5DZJA 4Z7VF 4XNZC 4LDLB 5LDUA 5ENWA 4PLKD 4OI7A 1CXEA 4YQXH 1IGYB 3BUYA 2QSCH 2UXGA 4R4ND 3C2SA 4AYID 3QFGA 4HXBL 3HHSB 3GXIA 2GFBA 2XLLA 1G94A 4JMNA 5FKPB 3WE1A 3JWOH 2PCPA 4WI6A 5JDSB 5HPMB 4RMWA 4BZ2H 5EBLB 1H8SA 4OM0H 5HGBA 2A5UA 1L6XA 1HU8A 3F6JA 4DEUA 1B4JL 2I69A 5AKSA 1BG9A 3NESA 4RQQB 3NYKA 1RVFH 2A6DA 3K91A 3N6YA 3QORB 4KVNH 3VG0L 3AB0B 3JV6B 3WMSA 4CSPA 1GH7A 5TQ2L 4FJZA 1G9NH 4AQOA 5EO1B 5I15H 4KROB 2EDYA 2OL3A 2VXQL 2L7EA 4X4XA 4D7BA 1XH2A 4U3XA 4DP0X 4Z7AA 3U2SB 3FTUA 4OQTH 4QNPF 5F9OH 3RZCC 4QKTA 4RAHA 4J6RH 1NBCA 3HZ3A 3KWXA 3F85A 3MLSH 4KK6D 1OAUH 4P2OC 4HUXA 1LE9B 1ZT1A 5CILH 4F7MA 5F6HI 1QSVA 2BZCA 3PU7A 3SDAB 1KIPA 1VKXA 4XN8A 5D7IA 5EOQL 3FT2A 1FHNA 1HT6A 2X4OB 4YZFE 2IALA 3ZMRA 1L5GA 5EWIH 2J88L 3AXLA 3MUGB 2NY1B 3HZVB 3UJIL 4QY8A 3GRBA 5DJ8B 2XPZA 3ULVD 3D51A 1KELL 2D31B 2B59B 3G08B 3HZYA 1I1AA 2OA9A 3IDYC 2V3FA 1YEKL 2XTJE 1FNGB 3B9EA 3PL6D 5BNXD 1BGXL 3D0VA 4JPVH 5C2BH 2C9SA 2FNBA 5D1XE 4ZAKD 1DDHB 4KZEL 5HYSG 1R5VA 2K0RA 3NCMA 2AQPA 5C09E 1X9LA 3KPLB 1D9KD 5ABDE 3C2AL 1O6SB 1UEYA 5ESAB 4ZO6A 1VZIA 1G9MC 3REWA 4LVOC 4HJTA 1P5VA 4RMUA 1F3JB 4NRZB 3JWDL 5DJ2B 5A7EA 2AXFB 2FCBA 2YN3A 1MJ8L 5B22A 4PJ8A 2ZCZA 3HNTH 4Z7UB 5JOFA 1SMOA 4UYQA 2DWEB 2V2XA 3E3QC 5DUML 2Z7ZA 3EBHA 1UM4H 3I75A 1Q1JL 2WYTA 3GJFA 3NA9L 4Z7UF 1GHFH 2COQA 4PGDB 4ZUWA 5LGHH 2AQNA 7CGTA 5HHMD 1DEEB 2B9BA 4HKZA 1Y0LB 2XHNA 3QQXA 5CZKA 3EO0A 1P7KA 2BIHA 3VFMB 1ZJBA 3LRSB 4P2QA 1XIWB 1KGCE 4NNYA 4AV4A 1WA2X 5I1EH 3EJSA 4ZO7A 1NL0L 3KVQA 3WIFA 3RZCD 2ZKYA 4JX0A 4KU1A 4Z7WE 4OV5B 3OGOE 3QZMA 5IW6A 4PRPB 1UWYA 1UA6H 4P2OD 2CKBA 1UWXK 5FYJH 2E5EA 4L5FH 2YKKA 4XPHH 3WMPA 4WGWB 5L7XH 1NGXB 5T3XD 3US1A 3O81A 2XN9D 2VLKA 3RWFB 1CE1H 5IBTL 5IB3B 1FZJB 1MCCA 3PPSA 2BOCB 4YOKA 1BHGA 1J05A 1KPRA 2GEEA 4LIQH 1EZVY 1LEGA 1XL6A 5J0BA 3C5ZC 3IGKA 5T3XL 4DKFH 2WLKA 1T3FB 4JY4A 3UTZA 4NC2B 2YMXL 3VCLB 2XIBA 3DTUB 4JM2D 3ZYOA 2ZXAA 5BW7C 5ITFB 3K2UH 3GJEB 4XVJH 3SPGA 5DA0B 3M45A 1UQSA 3B8YA 3LXUX 5K39A 1KYFA 2DD8L 3PABA 5E5MA 3SO3B 2CGZA 4WDIB 3ORJA 3QXAA 5C08A 3O8XC 2C8NA 2Q8AL 1BZ7A 2RALA 3Q13A 4N1HB 3NUKA 2DQDL 3MJ9A 3LKOA 4KAQH 3QJTB 4QAWA 1QKZH 3DBSA 5B7EA 2A1WH 5AALA 4AYFB 5KYYB 3QIUC 4QHNA 2VGLM 5ILTL 2A77H 4LK4A 2IAMC 4FAAB 1CG9B 3PHQA 1GPOH 2EH7L 4CMMA 1FF5A 2XKNA 3KXFA 1IAMA 1G0YR 1VADB 2APWA 3ABKB 3IT8D 3CX5J 5KSAC 2ZSWB 3OC5A 2OMYB 2AAAA 3P4LA 3D39A 3FMGL 4GAGH 4WV1C 5A40E 2WYZA 5EHFA 1GYCA 1UM6H 5EU5A 4OFIA 4AGQA 4ZW8A 3QIWA 1TJHH 2KMWA 4X5XA 3T6ZA 1OHZA 3TF4A 3ECUA 4HAFA 5FUZH 3MACL 3WY4A 3RPBA 1WIUA 4KH2A 1OF2B 2DEYX 3CZJA 4H88L 2XSKA 1IAOA 4P5MB 5DEZA 1BF2A 3FUMA 3V5KA 2V0AA 2WZPD 1XBDA 1E27B 5FKAA 4K23L 4D0BB 4IJ3C 3C5ZD 1JGUL 3GIVB 5LAXB 4Y2DB 1HL9A 1J87A 2BW4A 2QVTA 1HHKA 2DI7A 1H6TA 1Q9LA 1E6OL 2ZYHA 4N8VG 3PUCA 4MWFB 1GJUA 2ZXBA 3V5DA 5E4OA 1DLFL 3RJOA 1F56A 1FYTD 3DMMB 3KYNB 3H2WA 1GGUA 2GAZA 1P4UA 1UCBH 5K5YA 1PDKA 1XZWA 3WO4C 3BRDA 2YBRB 2JFCA 3QUXC 2FHCA 3DV4B 4OFKA 4GINA 4PJIA 1DBKH 4L0ZA 5A7BA 5ITBH 5FFLA 2WLNA 2DM4A 3BAKA 2D0GA 5D93B 3T71A 7PCYA 5JW5A 5I8KL 2W81C 1CURA 2QTEA 5I76A 1BXUA 1KJVB 3I6SA 3R1GL 4H8VA 4M02A 5G4MA 4A6YB 1QA9B 3P77A 1A2YB 3QIUD 3SKNA 3F12A 2IAMD 1KTLB 2CRYA 3EGXB 1JPTH 4FX5A 5IMLB 1RULL 5CP7B 1G6RH 2HTLD 4M03A 1WITA 3QCVH 4OLXL 3U46A 3S36L 4R4BB 4UNTA 4WEMB 4Z7VA 1YO4A 4U1NA 5KSAD 3UTSE 3VFVB 3LIZL 3IJ7A 4LLQA 1T2QH 3MR9B 4P46B 1B0RA 4M62L 5LCVH 5J5EA 2VXTL 3FRUB 4N5EC 4G8AC 4YDMA 2DMBA 2NY4C 1GYVA 3OJVC 1ZS2A 2RQEA 1RJYA 1EUTA 3NQKA 4O58H 5AVUB 4IOIB 3UJTH 2DS4A 2GYSA 2XWZA 3W39A 1BZOA 1IGYA 1N6VA 5E5UB 1MCRA 3TM6A 2X4UB 3HHSA 2G3MA 4DFIA 3SD2A 3UTOA 5FKPA 3K6SA 3HNVH 4UAOC 5JDSA 5FGCE 1R1CA 1U9KA 2P52A 4HWUA 1EHLH 3ZKSD 3SPIA 1UOVA 2DM3A 1NKOA 4TUUA 3BZEB 1IT9H 4JEGB 4RQQA 5E2JA 3PWUB 4JJOA 1S7VB 2VZSA 4TSAH 1PYWB 1X3DA 2GC4C 3OVUB 1YN7B 4HWBA 3G6JE 1ITCA 3O6ML 2MJWA 1PLGH 1S3RA 1N5AB 5HHXH 5HVGB 1HHIB 3CFTA 5EO1A 3WOVA 4E9YA 3OG6B 1AQHA 2YAHA 1GYUA 1V3KA 1CFSB 3LMJH 4NQSB 12E8H 4ALAC 2OKMA 4NHUB 4RSVA 1I7RB 2B1AL 1OCZB 3HI6L 4PBXA 4F3FB 3KPSD 2OLDA 2UY7B 5AVTB 3C60C 4OZFA 3WAJA 1KPVB 3QI9B 4IMKC 3TJEL 3WUZA 5B4MC 2X4OA 5JLZA 4GMTL 1E9OA 5HHVH 1O7SA 1L7IL 1RHHB 3M86A 4O02L 2VAAB 1NWPA 2BRQA 3MUGA 2BY0A 2KH2B 2NY6B 5SX5K 4CKVX 2MNJB 3VTTA 3MRRB 4DW2H 3UXFA 4HMDA 2OBGA 2D31A 3G08A 1OPOA 3AQYA 1FNGA 3MA7B 3CLFH 5BXFB 1J5DA 1I31A 1OW0C 4RRPG 1N64L 2J72A 1DDHA 4DGIH 4DGVH 4P3DA 4N5ED 3KPLA 2NY4D 3RTLA 4XHJC 3WHXB 1O6SA 3FT1A 5ESAA 1JOIA 4CSSA 4NRZA 1MFEL 2PCXA 1NC4B 4NQDE 4XI5C 5JQ6H 4GG6B 5AB1A 4Z7UA 4MAYA 5BMFH 4XO5A 1QSFB 2DWEA 1PZCA 1DBJL 3CDFA 5HJ3A 4R6UA 1LJMA 2I32A 4FGMA 4N0YL 4O02B 4X8GA 5DU7A 4NM8H 1BD2D 1T6WA 4B9KC 5JHAA 1Y0LA 1V27A 4G43A 5B1AB 3D33A 3SDXB 5F7BA 3LRSA 4ZZFA 2Z4QB 1XIWA 4JCLA 2YPLB 4DUWA 3P2DA 4ZX4A 1M6UA 2W9EH 5I18H 4RGMB 4MZ2A 1K6QL 1U2YA 3H4FA 3P73A 4LBEA 1UM5L 4XPTL 4OV5A 4K3DH 2P43B 2IOMA 4PRPA 4BSVA 1KXVC 4KV5F 3C60D 5E8DL 1MCHA 1U21A 3TBTB 2EUVA 5B4MD 4LLMB 3W0WD 4TULL 1EHAA 1CDBA 3GUFA 1EXHA 4JGJA 4ALAL 1FZJA 3NIDE 3P0YH 4D8OA 2BOCA 3F00A 4YHOL 1QTPA 3NZHH 1I85C 1BCIA 4ODXB 3IXTA 1O5PA 3X3GL 1QBAA 1X5IA 1EDHA 2YKLL 3QRFM 2ZUVA 4WNQB 1BREA 1T3FA 2YRPA 5MENE 4HOZA 3ARDB 1NIAA 3IM1A 4XHJD 4JFVA 3WHE0 4AZ8B 5ITFA 3GJEA 3QT2A 4WEEA 4FMKA 4X6FA 4XI5D 3TZVB 1DVFC 5JXEC 2CK0L 4JN1H 2DLFH 4W1TA 1D6VL 3M8OL 2HKFH 2NYYC 3MFGB 4FNLL 1PW3A 4Z18A 3RVUC 4TNGA 5EPMA 2QSTA 5CHNA 2OZ4A 3PWVB 4K0OA 1CD1B 3MNZB 1RZKC 2NY5C 1YDPB 3CVBA 2WXQA 1KC5L 3VWJA 1OCOB 4PIBA 3K8KA 1K8IA 3AG4B 3OF6D 3M6DA 1ZLDA 1ET8A 4M61B 5EU6E 1J8HB 4AH2A 5FDYA 3UBXG 4Y2NA 1RH8A 2UZIL 3KGSA 2F53A 5I1HH 1SQ2N 3FB6B 2FE0A 3J2PA 4O5LH 2YAPA 1W0YT 4AYGA 1VADA 2VAJA 2WUBH 1TQUA 2ZSWA 5F1OB 1G6RB 5LKNA 4F7CB 3FO2B 1ZVSA 2NY2B 2OMYA 3UACA 5B3SB 1F4HA 1CIUA 4F9PA 1E0OB 2XTJB 4Z3JA 3OZLA 4WO4C 3T8XB 2CK2A 4Y7MA 5EOTA 3FU0A 5D1XB 2FEDC 4LQFH 4BDVA 2DRUA 2XTLA 1U42A 2CG9X 5C09B 3SO5A 3FB5A 2MQ0A 3CFKB 4TPRH 2O26U 4BFIB 1DVZA 5FGRA 1IGTB 3DO7B 2J4WL 3VRLE 4FN0A 3GIVA 4M29A 3KLDA 4Z78B 5KWYC 5LAXA 4Y2DA 5EBMB 4Z1PA 3U30C 4UQAA 1WFUA 2OYMA 3FTSA 4YIQA 1SJHB 2AEWA 2VXUH 1UH4A 3FUNA 5GGVL 1EJ8A 3BN3B 3MODH 1KTBA 3DMMA 1UUSA 3KYNA 4ZFQA 3U6XA 3ESMA 1ZXKA 5JXED 4Y5VC 1DVFD 2Q7YB 1G7MB 2BY3A 4J8RA 5IMKA 3WIIH 2CSPA 2WBKA 2IGFH 3QZPA 3MLXH 2NYYD 2R2HB 3DV4A 4PD4J 1QFWM 3RVUD 3T3PB 1GZQB 5L2KB 4N9GB 1HNGA 3ZN6A 4AL8H 1YPZE 1RIVL 3L9RB 3FK3A 4JCWA 4OQTA 3S4SG 2X2HA 2CHDA 1KJVA 4A6YA 3T3PF 3Q6FB 4Z7WB 1KACB 1WAEA 1A2YA 3FN3A 3CFQA 1UZ6F 2Q3ZA 4M5YH 4RDQF 3EGXA 5IMLA 3GQFA 3P3SA 1CVSC 1AZNA 1PNDA 4W9EC 5MERB 3V10A 2LFEA 2RB8A 2XPGB 4MA3B 4LHUB 1J0HA 3HJEA 5TD4A 3VFGL 1LILA 1RZKL 5B1BB 4URKA 3LZRA 1NCAL 5E0FA 3HRZA 2VLRD 3CMGA 4QHPA 4C8XA 1FBIH 4QHMA 3L9BA 3FRUA 4ZTPH 2BS9A 4XNMB 3L7FA 4WO4D 2VSCA 5KUKA 5D7SH 4IOIA 3UMTA 2FEDD 3P3TA 1HSAA 3E80A 1V10A 4D0CA 2FJFB 3AU1B 1P4LB 3I6KA 3NEXA 3UTTD 4KXCA 2FDBP 2X4UA 4J2XA 1T5XB 4S1DD 4WCYL 3VDAA 5I75C 1KB9K 1XDTT 2Z0UA 2GJPA 3CSYB 4HISA 3WY2A 4ZMWA 3VXQB 3LKNB 4HCRL 2JB5L 3E8UL 3PXHA 4FA7B 5A2IH 3TS8A 3BZEA 2J57A 1V7NL 4AITA 2ZUTA 1HE7A 2XYBA 1UCTA 1YN7A 5GRUL 5GGRB 2IAND 1U8LA 3B9AA 1EBAA 4K7FA 5D6DA 5CIPA 3MV7E 3ULUF 1HHIA 4P5TC 5GRJH 3X11B 3RY6A 4DPAX 3FHEA 2VDML 5ICUA 3VE0B 1FGVH 2ZYIA 1CFSA 3EBGA 1FE8H 2WC7A 2AQ3A 3MHZA 4NHUA 1I7RA 2OYPA 2WZ0A 4U1IB 1BVNP 4F3FA 2W65A 1PIGA 1DCLA 1CU4H 5EA0H 3CG8A 1KJ3H 1KPVA 3NH7L 4ILDA 4NIKB 5I1CH 3SJVD 4Q0XH 3HBQA 2B5IB 1DL7H 3VYOA 1GMEA 3VW3H 2VAAA 1IIKA 5DS8A 2WQWA 4BH7B 1OALA 3MRRA 4FG0A 4X83A 4NOBA 1JJUA 2UY6B 5HHOD 1B0WA 4EUPH 2VXSH 2E7BA 2H41A 3BKCL 5E8NB 5AFAA 4WSKA 4I0PC 1M2VA 1DUZB 1CT8B 3VXRE 2E59A 4EZMA 2IFFL 1FVEB 2OJEA 3ETBJ 3WHXA 1KTDB 3FKUS 5D1ZI 1KGWA 1KB5H 1ZOXA 3DKHA 3T4AC 4CA4A 1XCXA 1MUJB 2NZIA 1J86A 1RZIB 3BAXA 5LVEA 3N1QC 3MC0A 3QNYB 2C9QA 3AXHA 3A6BL 3L5XL 1QSFA 3QQ9C 5DZPA 4YHLH 5DVLA 4FMFA 4NN6B 4PJDB 4BZ1L 2P47B 1SFDA 2R59A 1JZIA 4GEIA 1A1OB 4PLNC 5A43C 4J3OF 5CJ8A 3CSTA 1D5IL 1F4WH 2APFA 2LAGB 4PJDF 1AH1A 2V7NA 5DGQA 4P5TD 4FFVC 3GF8A 1ND0B 2Z4QA 4JG0L 2YPLA 3LSOB 4NIYE 3HMWL 3WG7B 3MNMA 1ZVNA 2X7LB 3S5YA 3VSQA 4H26B 5I8CB 1N70A 1GOGA 3ARRA 1KYOJ 2Q9OA 3B9KA 2X4NB 2YD2A 2ZKMX 3MRQB 4MQTB 4OCYH 3BDYH 5IVOA 4FQPA 3TBTA 1QYGL 2H2SC 5F97E 3LNEA 3G5VB 4DKDC 3UTSB 2WAHA 4LLMA 1VFAA 4DN4H 1KSRA 4JFSA 1LDSA 4J5VA 2PTTB 4KHXL 4DKAA 1YYLH 3PP3K 5AVRB 1FFOB 3MRBB 1P1ZB 2UVEA 4OV6F 4LOVA 1OP5H 4ODXA 4AENB 3DJZA 1IC7L 3SYCA 1ETA1 1R24B 4I0PD 3DJTA 4Z7NF 4F1SA 1CJYA 2ALAA 2HWZH 1A0QL 2FECI 1L9QA 3ARDA 4HUCA 5FGCB 4PRNB 1MG2C 3H4HA 4AZ8A 1QFWL 5DVKA 5SWSD 1MFAL 2CXKA 2ESVD 3FSAA 5ICZB 1JTOA 4I89A 4LL1A 1UVQB 3G6JB 1XV8A 1DCEA 2DH2A 3W57A 1A7PL 4B96A 3BKYL 1KCBA 3GXPA 1E9QA 3QQ9D 4MJ6B 3K71B 4LO9A 3IJYB 4GFXA 3CXDL 3DX4A 4Z7OB 2AAVA 4CL7A 5I6XB 4JRLA 4Y1AE 1GJIA 1YDPA 1EXUB 2A83B 2EP6A 3IPFA 1P7QD 4LOFA 5AW0B 4FKHA 4LRNH 1G7IA 2ZCHH 4TNFA 4Z7OF 1I1AC 2YD6A 3WNNA 3IU4L 1V7MH 1J8HA 1KTKE 1DN0A 4R97B 4FZEH 3QJSB 1OF0A 1SEBB 1RCYA 2I27N 4GXVH 1E5ZA 1U95A 1Z9OA 3V7MA 3FB6A 4KZCA 1QFHA 2WQAA 3WIHA 3B2MA 5TK2A 4H5SB 4UQ2B 3MJ8B 3ALXA 3ZW3A 4XBEL 1F41A 1C1EH 1G7HB 2CHWA 4MMXC 4AUJA 4CGUB 5FO7A 5DURD 4F7CA 2OM5A 4IHOB 3D69B 1R0AH 4PJ8C 1W9XA 1ZHLB 2H2SD 2IPKB 1SY6A 5DK0B 3VFSB 1PZ5B 1LYQA 3NSDA 1UXMA 4U7KA 3BSZL 3E6FB 2AJYL 5D1XA 5F7WC 1NAKH 4LKXA 5C09A 3QJOA 2I5YL 1KCVL 2AS5M 1ECZA 1EK3A 3Q2NA 4BFIA 3ENEA 1WZLA 5AL8A 4X9GA 5J11B 3QRGH 4NQDB 4Z78A 1TQWA 5EBMA 5DUPH 2EUZA 1MZYA 5CSZA 3ZSTA 5JW3H 4JFEA 4J39A 1UACL 1EGJA 3ATDA 2J71A 2E6JA 4NAMA 5GS1B 3MZTA 4LVEA 1NFDB 2MEJB 2VMDA 4GKNB 5E2WL 3ZQXA 1IRAY 1E8WA 4M3KB 1PFOA 4AYBA 2Q7YA 4S11A 2WZ6A 3WI9A 1NFDF 2JI3A 2OL3L 3RHWK 4ODSH 1TJGL 5L2KA 4N9GA 1QZNA 2Q3AA 5IHHA 4A04A 3L9RA 3CSPA 3ESNA 3NSCA 2EIKB 4GPVA 5F96H 2JKJA 1X5FA 3Q6FA 1I1AD 4OAWB 4Y19E 4UOW1 4B41A 1BEYL 2FO4B 2OTPA 1NMCC 2ZX5A 2X38A 4LPYA 2YGOA 4GAJH 4MA3A 4LHUA 4N26A 4N25A 1Q9OA 2BVYA 5I73B 4Y1SA 4OLWL 2GSIA 3FDWA 1A8JH 2EH8H 3DIDA 2GW5A 3KR3L 4EUPB 1BLNB 4XNMA 2Z92B 4FXGB 5T33L 4PMEA 4ZS7H 4PJAF 2ZT9C 4KKCC 1BBDH 4N87A 2FJFA 3RIAF 1P4LA 5H37A 1WWBX 1I3RA 2P28B 2XVBA 1VRSA 1T5XA 3L4VA 2GTZA 2AANA 1I9JH 1MCNA 1RSYA 3MV8B 3UDWC 1KB5B 3CSYA 3CBRA 4YBLC 3VXQA 2LTQC 4OCRL 2Z91B 4YL9A 4OUUB 1CL7L 1HXYB 3UTPD 1YNTB 1TNMA 2DQ6A 1HQ4A 5GGRA 1DQTA 1FWXA 2F15A 4O2CB 1RLWA 1YNTF 1BM7A 3X11A 1C5CH 2X4SB 3S5LG 4NNPL 1BZEA 1LNUA 1NPJA 3D12B 4G7VH 5EU6B 1B2WH 3PGDA 4K55A 3ZE1E 1RKRA 1XH0A 1KWGA 1PY4A 3EOBB 2VLKD 3OX8B 4U1IA 2IV9A 5FWRA 1T83A 1DVQA 3RVXC 3N41B 5GS3A 5EN3A 2DQHL 2GSGB 3MV11 5I28A 3NK3A 4JFQB 4IRSD 4UT7L 2CKBL 4ZNCD 4POUB 3IN0A 2W9DH 4E5XA 2HLFC 3BUDA 3FCTA 5LNDA 5CZXD 4AIXA 2UY6A 3PFUA 2YWZA 2Q2EB 4Z3TA 1N4XL 1H15A 1Z7JA 2QQNH 4PSPA 1UEMA 1YEIL 1CT8A 1YZZA 1A6AB 5CJOH 3NSJA 2RCSH 2VDNH 5E2TH 4M5TA 1DJYA 2Y36L 3ZKQD 1KTCA 3IYLW 3DVNA 4KKCD 2RFXB 2FUTA 2VM4A 1FDLH 2XRAH 2V5MA 5I0YA 1RZIA 3QNYA 5T8IA 2DDQH 3LRLA 4PBDA 3IK2A 5DMYA 3MLUL 3OAZK 2WD0A 1VENA 4H8PA 3Q01A 4IIQB 1EV2E 3NCJL 3L4CA 4PJDA 3MLZL 4FZ8L 4U1LA 3LRGA 4YDNA 2R8SH 4I9XA 3NZUA 1A1OA 1UKSA 3AACA 4GO8A 4PG9B 1WUNT 5I5JA 3MJ9L 4FF9A 1NANH 4P5SA 4TM9A 3H2QA 1X5JA 1YPZB 4YMPA 2WXNA 2QPUA 3SE9L 1E4KA 3KE0A 4C83B 3I6LD 4LCWA 3D39D 2X7LA 1YMHB 4H2AA 4UU9B 1YPZF 3SKJH 3SY6A 3FFDA 4ZOEA 4U0QB 2DQUL 2R0LH 3MRQA 2UX6A 1ILUA 2YPVH 2H6OA 1FRGL 1WBXB 3ERXA 4XAKE 2VL4A 3I9AA 1G5AA 4FNPA 4Q9BA 3QHZL 2HLFD 2PTTA 4P07A 4N86A 4HIXH 1FFOA 3UBFA 3MRBA 2CLZB 2EINB 1P1ZA 2JXMB 4LAJH 4P23B 2VR4A 3QORC 4PW3A 3RUGF 4AENA 2F54D 3NPSB 4MB5A 3EH5B 3FJTA 1R24A 4H20H 3VD9A 2QBWA 4K7PH 4KROC 2PETA 5E00B 4HUVA 2CDGA 1TO4A 4FFYA 2OMWB 1BFVL 4FQXB 4A39A 5I8OL 3CZEA 2P5WE 4JPKH 5EZIH 4EDXB 3VFPA 1BQUA 4ZW5A 1CGWA 2VL5A 1EUUA 5I0XA 3W9DB 1YJDC 5DWUL 4KZDH 4AT6B 4MJ6A 3MV7B 4H1LG 3K71A 1HHHB 3IJYA 3SGEH 3BRFA 1IUZA 1YAZA 2I7OA 1NFAA 3HUJE 1TOXA 3ZIYA 4Y4FB 5IOPB 3GKWH 1A1NB 4PJFB 2NY1C 5FFOA 4Q9RH 1EXUA 1FIEA 4B5EA 4E0RB 1BMZA 3QDAA 3DV6B 4HCFA 1SBBA 4PJFF 3I9GL 1E4XI 3WKMH 1PX3A 1SEBA 5D5MF 2ZXQA 2ZKHL 2VXVH 5FYKU 1N8ZA 1F18A 4OF3A 1JP5A 3MJ8A 2VZ1A 4TNEA 1G7HA 3OMIB 1JWSB 1TYEB 1KXHA 1J1XL 4OZ4B 3D69A 4QGTA 4E9SA 1T5WB 4MAYC 1H6EA 1NCCH 5HYSA 2X4QB 5EFIA 3Q0HA 2O5XH 4FQHB 5EU7C 2ZWKA 4Z8FH 3S48A 5C0CA 5IY5B 3FQWB 4M5SA 3QORD 3QULB 1JHKH 3U1SL 4N1CA 3D9AH 3ZL4L 4UZSA 2E6PA 2R0ZL 2ZOTA 1GTFA 4ZZKA 1XIWC 4KROD 5I2IB 1R3IH 1BV8A 5ANHA 1INDH 3EFOA 3JT2A 5GS1A 1JZ4A 1MH5A 2JKLA 1NFDA 4PJ5E 3A4EA 5GIRB 2WTOA 3D4GA 3U1PA 2CM5A 2VERA 5K93A 3X1NA 4CN4A 5L88H 4FQ1L 4WSJA 2WXOA 1PZAA 2VDOH 3BQVA 2XXFA 3GJFK 3ZJAA 3HE6B 4KHTL 4JBSA 4BXVA 3KMDA 3G5ZA 1ID2A 2NY1D 2X6AA 4IK7A 3K1KC 5D70H 4YH6A 1MJ7H 1SBSL 3QNXB 4OAWA 2FIRT 3WAKA 3TIDB 4Z7QE 1NCDL 1YJDL 2FO4A 1M2OA 4Y9FA 1KWKA 3ARVA 3IEAA 2WBJB 3QEHB 3MA9L 5ICXB 2XY1A 3QG7H 3WKQA 1PU0A 2BP0B 3FZUC 3ZKMC 2YUWA 3QP3A 2O5YH 3LH2L 3D3VA 1GXEA 2Q1EA 5CO1A 4QRPA 2Z65C 5EZJA 4PJAA 2ZZUT 3BPCA 4U0RB 2TSAA 1IBHA 4YHKL 5L4MA 3H0TB 3SYOA 2N56A 4YLBA 1BLNA 2WNGA 2ISDA 5EO9B 4FXGA 2IBZX 4YDVB 5EN2B 2KKQA 4UM8B 1M9SA 3WD5L 4ZFGL 1LP9E 1BVKB 5DRNB 4KKRA 4FQCH 1DDTA 2AP2A 2CWRA 3SOBL 2F7OA 1TIUA 3GMLB 2TRYA 3NCFB 3V7AE 2EUXA 1T1YB 4KH9A 2NY7H 4G70B 5L2JB 2YARA 5DO2C 1V3LA 1G9HA 1MCFA 2XWBB 1OTSC 3MV8A 3TBYA 3VWJC 1TETH 2DEXX 2XDHA 3L1OL 1M6OA 2IPUG 3C6SA 3MCYA 2Z91A 3O41B 4OUUA 2X9YA 1YNTA 1GRWA 3HVNA 3OXSB 1XIWD 1IGIH 4U1GB 4UQ3B 3F84A 5LQBH 1OEZW 4KVCL 3BZ4A 1OAZH 4QXUL 1OWWA 3QH3B 3KPTA 4NHCL 3FQXB 3QXDB 4Y1AB 4MA8H 2VLJE 1KY6A 4G8GE 1FP5A 4OLVH 3RU8H 1OM9A 4PRPD 4B27A 5I19L 1HESA 5KS9B 4NPYA 3X1BA 2WP3T 2C9VA 3D48R 5EU6A 4F9PC 5CLWA 5DHEA 3S35L 3CH1A 3ZYZA 3EOBA 2D3VA 1MCSA 4YGVB 1LLAA 3X13B 5KS9F 1DVSA 2N59A 4P9MH 4W9DC 2GSGA 3MCLH 5IWLA 2YD5A 4R7LA 5GJTH 2QGCA 3N91A 3D2TA 1CGTA 3UIYA 3BP6B 3SKMB 4ZDHB 5L4JA 3EFDL 2HKHH 4Y2DC 3KWUA 3RTQB 3ZKMD 3FZUD 1KV7A 5EZOL 5HJBA 3ZHDA 4XVTL 4NJAH 2YUZA 1WTLA 4ZX6A 5JPNB 3T8MA 5T5FA 2X53A 4ZMVA 1G5GA 4JR9H 3DMMC 1FNLA 5FV2A 4UTAH 1BF8A 4Y7OC 1EA9C 1XBRA 2ED8A 2RFXA 3NAAL 4B9IA 4BRVA 1R3JB 1G9NC 4MNGE 4N8VA 4JZNA 4BE6A 4B7IA 1DSFL 5D93C 1IGML 2Q8BH 5DO2D 3LX9A 2Y22A 1OTSD 4NKIH 4R5XA 2Y06L 3P3UA 2EO1A 4IIQA 4AWJC 4LNRA 2N0KA 1WS7A 2WQSA 4K94H 1CPUA 1A7OH 1AZRA 1RIUL 2Q0ZX 3RKDC 4GIOA 4A7VA 4P0DA 4M6NL 2OZ4L 4PG9A 5BRPA 3HKFA 1RURL 1KUMA 1AHKA 1TLKA 3DOSA 4A2HA 1YPZA 1ETB1 1MIML 4UWQB 3S4SB 5DTFB 1TQBC 3IDXL 3GSOA 4P46C 4YDKL 3BIBX 3MOQA 4Y19B 2JQAA 2PW2B 4V2CB 2OX5B 1BW8A 4Y9CA 1AC0A 2E27L 4PCSA 4I1NB 3GSQB 3FU6A 5DC4B 4HPYH 4YSEA 4L8BB 3L3GB 1IEHA 1U3ZA 3T04D 4UM9B 3L2NA 1TMCB 2EVHA 1WBXA 3JV4B 5BZZA 3RJQB 4APQA 5DHVB 4U3CA 4N8CH 5EU4B 3V9EA 1J1OH 1UB6B 4Y2DD 2R4SL 1TT6A 3GMOB 3TPKA 4MCYB 1ASOA 4TV3A 2JXMA 2MOQA 3MRPB 2BNUB 1FORL 1O6VA 5CNHA 3FFCE 3N1PC 5DC0A 1IAII 1X5MA 2AEQL 3F01A 4HHWA 1MIEL 1T7VA 5D6DC 1HJCA 1ZA3B 3DMMD 4XRCB 3VVWA 1IC1A 4DP6X 3RY6C 4ONGL 5E00A 4PG2A 4FXLA 3RQ3A 3QAZB 1J9RA 5DHMC 4ZYKB 4FQXA 1KPUA 3N1MC 1U3HA 4G7RB 3TWCH 4UV4H 2Y25A 1JYNA 4BWTA 2O93L 2Y1ZA 1SEQH 1UKTA 2BFVH 3HBGA 5CJ5A 4O2FA 2CQVA 3W9DA 4P2RE 4YSQA 3QI9C 2Z3FA 3CH8A 4AT6A 4CJ1A 2N7SA 2MCPH 3EGSB 4PP2B 5HHQB 4D0DB 1SMAA 2I9LA 1M56B 5IOPA 1VFOA 2NY6C 1A1NA 1NPUA 4IJTA 4PJFA 3RKDD 2OCJA 4ZOAA 3APMA 4HZLB 1K8DB 2GUOB 1G1CA 5D5MA 5ETUA 3ZE1B 3FTZA 4H25A 4ZO9A 2D7PA 4OQTL 4R3SA 3H56A 3PJLA 5E1GA 3UG3A 1W8EA 3ESVF 3QFJE 3S34H 1PZUB 4A6YL 2MWCA 4MJIA 3FYEB 5E1IA 1J9QA 4P46D 1Z9NA 2DWSA 3E6HB 4QD2E 3NCXA 4LPWA 3AY2A 3HNSH 1RZQA 3MYJA 2R51A 2W92A 5GRZA 3FQRB 4JO1H 3WKNA 1BVZA 4K2UH 3FT4B 2N01B 3ZOAA 5KSVB 5FIEA 2UX7A 3H9SA 1DJZA 1NGPL 1OARH 1FAKT 1REIA 2PR4H 1MFDH 3GK8L 4RRPA 1ED3A 1GCFA 2HB0A 1IC5L 3OKEA 1MHPH 4F2MA 3DVGB 5C2BL 5DO8A 5F7LB 3BZDA 1HKLH 4NGHL 3QULA 2OI9B 3AGVA 4QWWC 2VZTA 1CBVH 1Z1WA 3O45B 3BE1H 1QI4A 1KCLA 4ZS6C 4GQRA 3MNVB 2XX0A 2NNXA 1BWMA 1I4FB 1AVAA 4O00A 1IGFH 3V8CA 2YEZB 3F7VB 3SGDI 4MNQE 3GMNA 1B3IA 1RUAL 1M1XB 4DWHA 3QWRA 5AAMA 3B9KC 4LFHD 4PI0A 1MPAL 3QI9D 2Z8WC 5E4EB 2EAEA 4OLZH 1J8SA 2ZX6A 2XV3A 3KYOB 3V0WL 4D7PA 3VI3E 2NY6D 2XWDA 4U4BA 3DX1A 4AEEA 3KPRE 3HEIB 4U05A 5CMAA 5I1EL 2AXJA 2H3KA 4N0CC 3H9ZA 1A21A 1NLDH 3TIDA 2A7BA 1U33A 2X6BA 2AHIA 2TRHA 2XXMB 2BP0A 2AABL 3F83A 4PRIE 3ARDC 3PDOB 4NPJA 4QOKE 4JQVA 3GIZL 2PWEA 5IOKA 3GRGA 4WI8A 1N12A 1E5UI 1O5DT 3CFIC 2X1XR 3JTSB 1CFNB 5ANME 2PCFA 4UNIA 1L6ZA 3UAEA 1CE1L 1NC4D 2BMKB 4CW1B 4KOCA 4LLVB 4UM8A 2R56L 4LSUL 4Y9BA 3VI4E 3S3DB 1QSFD 1BVKA 2V5RA 1PZDA 1O7DE 2DICA 3SDCB 2CHNA 5ALCH 3BAEH 2FTAA 5L2JA 1MQKL 4DGWC 3CV5A 3P9MA 1CVRA 4DKFL 4QWWD 4XC3H 4XNUL 3QJUB 3TL5A 3DRQB 3HE7A 4N2AA 3TP4A 3EGDB 3ESUF 1F2QA 3OXSA 2AI0H 1NEZG 4FKEA 4ZS6D 2YPLD 1OAQL 3ZHKA 4W6XB 4Q89A 4UQ3A 5F0LB 5JYMA 5I1AB 4NFDA 2VO8A 4XVUC 4B50A 3S3SA 3FQXA 3I9IA 5EOCH 4Z3IA 3B9KD 4KRLB 2F1AA 1QATA 5FM8A 5KS9A 2NY2C 2BSED 3AJ7A 4IBVA 4TL5A 3UBXA 4CVWA 1OO2A 4FTVE 4EPSA 2XTJC 1QKZL 3KNBA 4CGTA 3IFPA 2WTRA 4N2GA 5D1XC 3V0EA 4YGVA 5DJ0A 3X13A 1N18A 2CBMA 5E5LA 4XCEB 4N0CD 3HRPA 4UILH 4EOWH 1BPVA 1F1GA 3X3FH 4YFLI 2CIKA 2IXQB 5JIKA 3ZK0A 1YN6B 4Q9QL 1IVTA 3BP6A 5AB0A 2Z34A 4ZDHA 3SKMA 2YPVA 3Q1SH 3RTQA 1I9RH 5D71H 1WAPA 3ARDD 1EEYB 1X4ZA 2F61A 3SE3A 4UINH 1FZKB 2AQRA 5IHUL 1WCBA 5JPNA 2FSDA 4B3EA 1DBBH 4N0RA 2AQSA 1HOCB 4BSWB 4XAWH 1UA7A 3VH8B 4P9HH 4GAFB 3GSWA 5EUKA 3IDIA 3TZVD 5FUZL 4WTZG 4WNJA 1KFAH 4B60A 3G5YB 2H1PL 4A2FA 3RAJH 4HD9A 2O6FA 2G2PA 1R3JA 2ATPA 4LSVL 5DJXA 3FQNA 5DJAB 2BNRE 1T20A 2JKSA 3HZKB 4PJ5B 2X70A 1MY7A 1CLCA 2ED9A 2X9WA 3ABGA 5DEGB 1J8HD 4JRXE 4OCSH 1BLIA 1WICA 5C97A 2A99A 3OHXB 3VAEA 3HVDA 3FSOA 3LNFA 5CM1A 2FX8L 5E2UL 4J27A 1UCBL 4KXBA 3C6LB 4OSUL 4XVUD 5TFSL 4HJEA 4R7DA 5I1GH 3LVEA 1SM3L 1WWCA 2EE2A 3VD3A 5HJDA 3B2UC 5ITBL 3G04B 2NY2D 3QCTL 4GKZB 2DQFA 3QE5A 4N2LA 5F1SA 4Z7QB 2XTJD 4V1DE 5F8QC 1CS6A 3CFUA 4FABH 4HKBB 3WTVA 5D1XD 3WIHL 3BXNA 1IMHC 1TTGA 4MXVE 3PJSB 5C09D 4WI3A 3ZR5A 3K4DA 3L3GA 5CEZE 5IKCA 2AQTA 4PJ7E 1UJ3B 5DHVA 1RPUA 3BH8B 1KV3A 5DFVC 3UAJA 2WLIB 4FHKA 1MWAL 4XCFH 4N6RB 5E9DE 1PG7X 3BQUB 1SY6L 5EU4A 4YS4A 1UB6A 3C8KA 3RWIB 3KJ4B 4XP1H 5EZLB 3GMOA 1CF8L 5K59E 1FFNB 3ULUC 1KOAA 4U2ZA 2YFOA 4PRHE 1LP9B 1FH5L 3MRPA 5F3HB 3QCUH 2WLYA 2XG5B 2WQRA 4RFNB 1H6FA 4XP4L 3UJTL 4XRCA 3OGCB 4M7LT 4M6OL 4P05A 4ZUSA 3GO1H 4XB8A 1RK1A 4MQ7B 4KX9A 4ZYKA 1NICA 1MCOL 3NJLA 4UT6A 4RH4A 2H0JA 3EUDA 4GRWE 3A4AA 3DURA 1EGJL 3UGUA 1KGCD 5GGRY 4C56A 5L2KD 1OHQA 2C9UA 1T83C 3QJQB 3Q2LA 5EEVA 1XB3A 1HHGB 2XN2A 2B5IC 2VLJB 5D4QA 1A4BA 4G8GB 4D0DA 4JGUA 1TVDA 4LXFA 4NKDB 3JWNG 3AY4A 4HV8A 1XAKA 5IJVB 5BO0D 3ZZ1A 1M4KA 3QG6A 4UB0H 5JIIA 2BNQB 2YD9A 1K8DA 1JWUB 1BYPA 2G4EA 4KBPA 4LHUD 4N2OA 5AVVB 2HCZX 2HPTA 3LMJL 1F02I 4D9LH 1I82A 2HJFB 4YXHL 2I85A 1BZ9B 4Y8DC 3B2UD 4BQ8A 4F8OA 4F92B 4R0LB 3E6HA 1OCWH 4ENZA 2A9NH 2H1XA 4G6ML 3T65B 5KSVA 1GVIA 2W0KA 2ROYA 3QZWG 3FU3A 2BSBA 5IF0B 3GB7B 2BVQB 1I9EA 4YAQB 2ADGB 3TV3L 5B3JE 3P4NB 1IEBA 3WTTA 2GY7B 5AOMA 2XBDA 4QKXB 3CWGA 1A9VA 4J6IA 5AW3B 1NBVH 4J3OC 1RUQL 4XXCA 3WNJA 1MFMA 2CA4A 2NX5E 1UG9A 3CLFL 4NN6C 3G3LA 1RJLB 3ULUD 3CK0H 3WEXB 3V52L 3WN5B 2HT4D 3HTLX 4HSQA 5HYJB 4LSQH 3O45A 3NT0A 4IIZA 3MNVA 3IMUA 3MOAH 1L0YA 1JNJA 1I4FA 1LEKB 3G9AB 2FRGP 3CFCH 3UAAA 3ULUL 4OJFH 5CZRA 3F7VA 2VDQH 3PGCA 1XD0A 1D5ZA 3QHFH 4XP6L 1AOHA 2YA1A 1YYMH 1M1XA 3SHSA 1OTUC 5C0BA 3K0YA 1NOFA 4J23A 3PREA 5BOJA 3IKCA 4CJ0A 4L8DA 1HC1A 2IDFA 3KYOA 2VO5A 4QCIA 1J12A 1QUPA 4XTRC 1HYRC 4XZUB 1AGFB 1PQZA 2F5BH 4JHWH 4QMEA 4FHJA 3T3MF 1TO5A 3FQUB 3MLVH 3OZ9L 4XMKH 5C7XH 4FCAA 3SZKC 4BGDA 4XP9L 1U4EA 1RERA 2EIZB 4GSDL 5EEXA 1TYJA 2QKIB 2XNAA 4LCIH 1TNNA 3UH8A 2VDPH 3I84A 3WY3A 3BYTA 4JM0A 2VZOA 4AVJA 4WKZB 2E7MA 1RZJL 4ZXBB 2EDBA 2WGNB 2LW3A 2Y1AA 3FTXA 3M17A 5F7DB 5TDPB 3U0TA 1OE3A 1WEJH 2BMKA 4PS4H 4ZBJA 4LLVA 4CW1A 5K9JL 2HZHA 2FHBA 3FFCB 3QB7C 4E9WA 1RZGB 2EEAA 4N0FA 3GSVA 2ZF8A 4J3OD 4ODUA 3SDCA 1VEPA 4AGMA 1JZHA 3BVVA 4LEOB 3K6DA 5AOLA 3VGGA 3FO0H 4UTAA 3K6IA 1LE5B 2YD8A 5I6XC 4JANA 3BVTA 2FJHB 4MZ3A 4UQ9A 5AVQB 4FEMA 1FZOB 2AC0A 1CTMA 4Y4HA 2MOGA 1W0WA 2CAKA 2FD6L 3DRQA 3ZGIA 1E9PB 4DCQA 1QAWA 4R97C 1AP2A 4AL8C 3IFLL 3OKNA 1JZFA 4DEPB 25C8L 2UZPA 2F9BT 3OAWA 5DMIL 2DLFL 1JMZA 4D9RE 3VXNB 4I2XB 5JPMB 3ZDYE 1OTUD 2ICWB 1H9VA 2AQQA 2Y5EA 3N2JA 3A0OA 2Y1YA 2AEIT 3BDXA 2DYSB 3HR5B 4HU2A 5F9WB 3T4YB 4QRRE 2RQ8A 3QFJB 3UTSD 3OBAA 5IM7A 1E30A 4QHLB 4XTRD 4NC1C 1I3GL 5CEZH 2IOOA 1AQMA 1PSKH 4XCEA 2ZSVA 1OTTC 2XVLA 1RZFL 2H32H 2H7WA 4CNIA 3P4OA 2GK0B 5J11C 2O6CA 5C3IA 3JTTB 4K9EC 3C75A 3GRWA 1A14L 3SD5A 1IBYA 2PO6A 3HW7A 4KMTL 4HC1H 4AQ1B 3CDCA 2BCKA 1AR2A 2MHAB 3F3HA 1FZKA 4O51A 4R4FH 3AQXA 3V6OA 1LO0H 5GS1C 1PJ9A 3NPZB 1YUKB 4XH2B 3UYPA 4BSWA 2KLSA 4XE0A 1DSWA 2XQYG 3MX0A 4JM4H 4I3SL 1GL4B 3B2VL 2C3XA 3G5YA 3U4BL 4GRWH 1EBPA 2ZE0A 2NSXA 4QTIL 4FFYL 2DQJH 4IDJH 4NUPA 1EO5A 5JHDE 5DJAA 5TH2B 3RL1A 4JRYE 5AAWA 2NZ1A 3GSNH 2VRQA 3E2HC 3EF7A 3HC0B 4N1EA 2ZP9A 4PY7A 3PP4H 4PJBF 3VD5A 1KJ2A 1DLHB 3VQMA 3IMRA 4YL4A 4IU3A 1SVCP 1W16A 2IH8A 1NC2A 3INOA 3OHXA 2YLHA 3S2AA 1ONQB 2QGBA 4JFHE 3IFNH 1OGAB 2OZNA 2ZP8A 2FIKB 5DR5H 2VZUA 1BOGA 4WAFA 4ZMZA 4KQ4H 1RJCA 3VI3B 5I73C 3RDJA 1TSRA 2ICEB 1AD9A 3NIGE 4GIAA 4G6JH 4GW5B 4S1QH 4NQEE 1QO3B 2CBPA 2DPKA 4P57B 2Q20A 4JZOB 2R29A 4GKZA 1NEPA 4FXGC 5AD0B 4GG8B 1HAWA 1L0PA 1JFQL 2FJGA 3NZ8B 4HKBA 4X7CC 4BFBD 1OANA 1A3RH 5LXGH 2ZCLH 5T1JA 2VN6A 3VX0A 3PJSA 4PRIB 4AIZB 4JY6A 1ZA6B 4QOKB 3P4MB 3UX9B 3DRTA 4X4YB 4NUQA 1OTTD 1J11A 3BH8A 5L8LB 3GS7A 3S2CA 1VPOH 3BQUA 3DK2A 4NQDD 3LN5B 4DJMA 3CMOH 1UHVA 3PS6A 7FABL 1IFHH 5EZLA 1FFNA 2OV0A 3VI4B 4DVRL 2OR9L 4JZJB 2LFGA 5F3HA 4GLRI 4ODHH 5GGQL 3SE4A 4RGNC 1FFQA 2XG5A 4JQIH 1N5YL 3OGCA 1FFPB 1TPXB 5TDOA 1M7XA 2A9DA 4R8WH 1E40A 5M7QA 4K9EL 3CVDA 1NINA 3DXAA 2Q6WB 2JK5B 2A9BA 4Q9CA 4AGNA 4HH8A 2JKRM 2D0FA 4XN4A 2GKIA 3DIFB 3KJ6H 2Y3AA 4ZFOA 5BS0A 2FH6A 5IWLC 2VDQB 4AGLA 5D8JH 1ZHBB 3S5LA 2VLJA 1KCSL 4YEFA 4G8GA 2BINA 2DLIA 4XWGL 2BXYA 3EYUL 5B21A 3DJ9A 3F65A 5GGTL 3DUSB 2EKSB 4X42A 2BNQA 4FTVB 1CYGA 3MUY1 2E74C 4K8RH 3ML8A 1FGVL 2JTDA 3OQRA 5AEAA 4M5ZH 2N7BA 3FU8A 2EDRA 1URIA 2HJFA 4HK3J 4X6DE 5M95B 1C7SA 3FCBA 5C0AA 4HUNB 1RXLA 4R0LA 1G7JB 2RJMA 1NBZB 4UQDA 3T65A 3ZMNA 2OTWB 3AMLA 4GB9A 1S7QA 3GB7A 4YAQA 2VDPB 3T0EE 2ADGA 2EO7A 1XMWA 1IKOP 1TENA 1AO7B 1OIOA 2F68X 3ZRCC 3P4NA 1DBAL 3VXPB 3CVIH 3MV8D 2XICA 4IIQC 3RG1C 3U9PL 2HFFB 4YXKH 3ARBB 2WXGA 1RJLA 3WEXA 2GC7C 1PLAA 2Q7NA 3KHOA 3GGWB 3WN5A 4WQOA 5HYJA 3LKSB 3D7PA 1U6AL 1QLRB 4L37B 4RRPM 3ZO0A 1K4DB 3PQYA 2JH2A 4IRZH 1QHOA 2CHXA 4HH9A 1JNHA 3FBKA 1HH6B 3QDGE 1LEKA 1MG3C 5IHZA 2BY1A 2AJVL 3GC3A 4UV7L 1NCUA 4M8UA 5EU6D 1JVOA 2GG1A 4JRXB 4CDHA 1J8KA 3R18A 5AB9A 1L6PA 3VGAB 4X0KB 1DVYA 4XOCA 3OWRA 4NKMB 2RACA 2HUEA 2ODHA 3LZFH 2MSPA 2FX7L 2GT9A 4LVNC 5F1IB 4E9QA 2OXGB 4LKCB 4APQC 1WDAA 2J73A 3KPQA 3UPRA 5I1JH 3QGVA 1F4WL 3MUJA 1BQLL 4WWOA 1YNKH 1UASA 3V4UL 2R27A 2XZQL 4Y16B 3CVCA 1KN2H 1BAFL 3TBSB 1HILA 4PB0L 4V1DB 1KDJA 5E1QA 5BVPH 4P23C 5SX4H 1KJMB 5HDOA 3L3HB 5AW7B 1RFDH 2XFXB 3DYOA 3S35X 4XCNA 2CDFB 1AKJB 1BM3L 2IAAC 2QKIA 3DDGA 1KCWA 2AF2A 3QUGA 2NUTB 4J8QA 4PG2C 3MREB 3SPHA 1IM3A 3GHEH 4FQXC 2H32B 4B95C 4OLUL 5FO2A 1L9TA 2G3XA 3U0PB 4YE0A 4LGSB 4N2EA 1CDJA 1U3HC 2BP8A 3AREB 4N4YB 4ZXBA 2E8YA 5AKVA 2GHZA 4PRHB 3LN9A 3NZSA 2B1HL 4FKKA 4M6ML 5TDPA 5T5FL 1YYLL 4YHMH 3FFCA 3LEVL 2ZTBA 4O2EB 3ZUCA 1QFOA 3BWAB 2KT6A 4LEOA 4XB3A 3CSFA 5F3BB 3MBWA 1A1MB 4Y4FC 1LE5A 3CZFB 4DERA 4UDUB 2J5WA 2BVUA 3POCA 4GRWB 2FJHA 4H13C 3C9NB 5CN1A 1FZOA 2BSTB 3AT0A 4IS6B 5HI3C 1E9PA 3HPJB 2X41A 1WD8A 1CE6B 4DQAA 3GSNB 2FT6A 1KCRL 2BIOA 3P69A 3QJHB 4H1LA 5G4NA 3WFHB 4EF3A 2JCCE 1AQDB 2E3VA 2DLGA 3DDFA 2J2ZA 1G7QB 2RIKA 3QARA 4QO1B 4I2XA 5JPMA 2RAMA 2ICWA 3R4DA 4CBPA 5FEBA 4HK3N 3G9VA 2JWYA 1JYXA 3FAXA 2J8UB 4JFZH 5AUMA 2IBBA 1JGEB 1WA0X 3WJMB 4EIZC 1A5FH 3Q05A 5DQJA 1JDAA 2J8UF 3FUKA 2CCWA 4R5TA 4KKQA 3V0DA 3L4UA 2V8MA 4P23D 3H3PH 4GXVL 1S7SB 5HDQH 3RNKB 1EERB 5JA8B 1BG1A 4RMVA 4KI5F 2GK0A 5IQMA 4TQIA 2GCYB 1XD1A 4B7LA 4ZMLA 5KVEL 1QRNB 35C8H 4LP8A 5E0QA 2MHAA 4JO3H 1E7UA 2R4RL 4FQXD 2W0FB 5EUOB 5C0IB 3SE8H 2NX5B 2LT9A 1MDTA 5D7KE 4DTGH 3OPZH 4XH2A 4NYLB 1ZGLB 3APCA 4E42B 1NM9A 1OPGL 3BP7B 2A4EA 2UZYB 1QLFA 2R0WH 4HSAC 2XZAH 3UBHA 5EUOF 2VNCA 4WHCA 1JXKA 4BK8A 3S6CA 3L45A 2K78A 2FB4H 4NKOA 2QSVA 4FC3E 3MV7D 4GFTB 2E8ZA 4PJBA 1U91B 3LNDA 3HE6C 2FZ3B 4N0UE 3ARSA 4Y4FD 3KS0J 1XXFC 2XOTA 4NUGH 4XMLL 3HC0A 1CLVA 1A64A 1S5IL 3RDTB 1UZ8B 2J56A 4FG6C 4PJGF 5JW3L 1DLHA 5HI3D 4G7SB 5J8OA 1WE5A 2F74B 1FVCB 4HK0A 1O75A 1OSZB 2WBJC 5DF0A 1ZE3H 2BIPA 1VSCA 4MJID 3UTQB 4ZMTA 4IM8A 4DVBA 1FPTL 4LEBA 1OGAA 2Z64C 3TOPA 2E76C 3SN6N 2EXSA 3FCSB 4LAQL 5EG6C 2DJMA 4QIRA 4BELD 2ICEA 3U2IA 4YSSA 4U0RC 1U8KB 2I60H 3VACA 5HGDB 4GW5A 5KJRL 3CLEH 5I23A 1QO3A 3H9SD 4P57A 1S6NA 4R7NB 5IFHH 5JR1H 3I2CH 1RPQA 2DIAA 2X10A 3NZ8A 4JHAL 2FBJH 4UAHA 2WZAA 3NJKA 5MEPB 2YSSA 3OJDB 1PKQE 2EDTA 2EQDA 3ABLB 3O4LE 4G7YL 4RIRB 1OT1A 4GUPB 1AIFB 2H8PB 5KZCB 4PRIA 3VRJA 2H3NB 3P4MA 3GXNA 5DQDL 1FNFA 2HJKA 3VU2A 3CPUA 1F3DJ 1AGEB 5IESH 4GXFA 3HE7C 1AD0A 4HD5A 5D7JB 1L0XA 1FGNH 3MRJA 4JZJA 2EH8L 4U1GC 1T2JA 4YHIB 5TPWL 1HIML 3LTVA 4PRDB 3RIAK 3WLWC 5E6IB 4XN9A 4HHGA 4IK6A 4JVUA 1A7QL 3QZLA 2J8OA 3QWRD 2JIXB 4B6ZA 3OKMB 1CL7I 1OB1B 2AXGB 2EDXA 3GNMH 5E4IA 4KXDA 1A6VL 4GBXB 1NEZB 2Q6WA 4K4KA 2JK5A 1I9JL 4WZ9A 3E38A 2IGLA 1JZDC 3HE6D 5JIMA 3DIFA 1CCZA 3CU1A 1S7XA 3F58L 3IRPX 4HS3B 1H3WM 2Q7AA 4KRPB 1J0IA 4FG6D 3WEOA 1X5ZA 2HRPH 3D4CA 3ZDYB 1NKRA 2CGYA 4OT1L 2MCMA 3HIZA 3D34A 1IAKA 2WBJD 4ANKA 4KDWA 1AJ7H 2XWTA 2EKSA 2ZCKH 3DUSA 3WFEL 2HYMA 3RTQC 4QRRB 1K4CB 3U1QA 5BRZE 3LS4H 3ZDYF 5I0VA 3S8GB 5EF2A 3SE3C 5JPNC 5IB1B 1QSEB 2YA0A 2EEBA 5INCB 4HFWB 3TCLB 3UC0L 4HOXA 3ULVF 4NQCA 4PTUB 4M4RB 1TITA 1KLUA 1NGYB 3L3OB 5FOJA 2NNAB 4XCCH 3QJFA 2OTWA 1TZ8A 5D96B 3S3PA 3A67H 4FP8H 3EZ8A 3CVHA 1AO7A 2JMRA 2WLHA 4QPEA 5I6LA 2YGPA 3FSVA 3HMXA 2AZAA 2ZF9A 2GBUA 2ZOUA 1ETZB 4ZPVA 3VXPA 2APTA 4YSDA 4TOYH 1ZANL 2V17H 1E4WH 4HCIA 2HFFA 4ORZC 3ARBA 1T1XB 5I1LA 3LKQB 4F7KA 1KN4L 1DYZA 3BIAX 3GGWA 4AM0B 3ATAA 2RCSL 4K7PY 4M43L 3GT6A 3L16A 5E2TL 1ZT4A 2KPWA 4H0IA 1QD0A 4L37A 5CFAA 2X6CA 5JHDB 3HG4A 3PUUA 1OP5K 3WLWD 4Y1AD 1BVNT 1TSHA 2WXKA 3BJLA 5AOZA 4YHYB 1YMMA 1FDLL 4GQZA 1HH6A 4YUEL 3CN1A 1Z9MA 1M7DB 1WUZA 1K5NB 1AG6A 2WK2A 4HLZG 4HYTB 4WVRA 1QR4A 5I9QC 4NKMA 1KEGH 4L4TE 5C6TL 1MF2H 1QI5A 2C7UB 4G8EB 5F1IA 2OXGA 4LKCA 4PTTA 5BZWA 1JNLH 2YWYA 1EMTH 2X9ZA 4NQEB 3H9HB 4B9ZA 4Y16A 4B5ZA 3RTQD 2WKGA 3S3BB 5HVFB 3ML9A 5CEXA 2AJZA 3L3HA 2LVCA 4JDVA 4FNRA 3UEZA 1QBLH 1DANT 2XFXA 5IB2B 2JJWA 2CDFA 1IGCL 3SKJL 2VUOA 1ULVA 4QRSB 2WLJA 4U7MA 1I8KB 1OGSA 3WU1A 4BQBA 5I71B 2V2WB 3QAZC 1HJBC 3ISYA 2AW2A 2VH5L 1OAXL 5DCCA 2YPVL 3U0PA 1ZDSA 2BRRL 3KM1A 4Q6IB 4XOAA 3LPFA 4PRHA 1NANI 2KLTA 5E6SB 4Q8BA 4WUUE 4AIEA 4JM2F 4TYUA 4HIXL 1PS3A 3TT3L 1ILSA 4O2EA 1KGIA 2A0LC 4OD1L 4CBZA 2Y69B 3L4WA 3D1MC 3WJLC 4HLJA 5TDNB 3SCMB 1KLGB 5AW8B 1A1MA 2ZJSL 3CZFA 1C5BL 4UDUA 4DZBB 4FQQA 1QNZH 1Q9WA 3UG5A 3HG1E 3WNOA 5I1IH 4NO5B 5DUBA 1F00I 3HPJA 2OSWA 4OCMC 1J1PH 5F7NC 2YAOA 1CE6A 4JPKL 3WFHA 1CF1A 3BPLB 1AQDA 2IDTA 4M7LH 1NDMB 5CGTA 1G7QA 1QFUL 5DT1L 3DUUB 1HXMB 4QO1A 1D6EA 1P4BH 4TF4A 1G4RA 2GJ6A 3BT2H 3KEDA 1OL0A 3KGUA 3IDMB 3GKWL 2J8UA 2Y7QB 4UM9D 4CVXB 1HI6B 3N9GH 1F8TH 3LVTA 4X6DB 1C5DB 4I1RA 1XCWA 1JGEA 3WJMA 4PUBH 4XXCC 5BUPA 1MN4A 2YHGA 3GZKA 4GRLB 1YEGH 4PJXB 1I8LA 2XV0A 2YD7A 5H94A 2EDJA 5E8EB 1BXAA 1SZNA 2OI9C 1RJZA 3LN4B 2BJMH 2FK9A 5SWZE 5LHDA 1E2ZA 1WFJA 1S3KL 2VYRE 4PJXF 2C1PB 5D9SB 2GCYA 1QRNA 4I87A 5EF3A 4PJ9B 3BH9B 4KJQC 3PPEA 1VJSA 4B9FA 2W0FA 1XHHA 5EUOA 5DMKA 5C0IA 1QZ1A 1JTTA 1IFGA 1PEWA 2NX5A 3CIQA 3TT1H 3C87A 4NYLA 1ZGLA 1ML0A 4E42A 2NLJA 4K71B 2QELA 3GMPB 5FUOL 1NMAH 2YQBA 2A0LD 4PJGA 1UT2A 3BD5A 4LBAA 1U91A 2DM2A 2VB5A 4UT6L 2FZ3A 3QDGB 5ACZB 2DI8A 4XGZA 5I6MA 1ROWA 3F6IA 3O11B 2FWOB 4P2YA 4JFWA 3GBEA 1IM9B 3P9WB 2AK1L 3FOLB 2F74A 3HS0B 1FVCA 2VN5A 1OSZA 4JB9L 1VZGA 1RZ7H 3MXWL 3UTQA 3UYOD 2XWJA 5FA3A 1N26A 2VDLB 5EF1A 1QG3A 2A6KA 2WLZA 3C08L 4QXGH 4BD4A 1SHMA 4MVBC 1JE6A 4RLDA 1R3LB 3QHTC 3VD2A 2Q86A 4R7NA 1JZEA 2E4TA 3HPLB 1AGCB 1WZ1H 5MEPA 2AK4E 4RIRA 4FFWD 3EH4B 3ZTEA 3SDCC 4Q52A 3TEUA 4GUPA 2H8PA 4RMRA 1OGPA 1FO0A 2H3NA 1MEXH 1CXLA 2LLLA 2VE6B 1D5BA 3PV7A 4ZUVB 3VG9B 3E0GA 1GAFH 4DF9A 4YXLH 2JKNA 1AGEA 5D7JA 3A6CH 2EE3A 4KJQD 3MRIB 5CP3H 3RB5A 5A6MA 1VEOA 4IBTA 1XF2B 2J6EH 1ADQL 2AFNA 4K94C 4XPBL 1P5UA 1K72A 4JDZA 1IGJA 3SGKA 3NSYA 4NO3A 5IW1A 1YY8A 4B9GA 3CPLB 2AXGA 1OB1A 2ZUXA 3OKMA 1P0SE 2PTUA 4DZ8B 4XBMA 4GBXA 1NEZA 4AK2A 3IDNB 3B7TA 4YDZA 5F7KC 3IKKA 3HOGA 5E94B 1W72H 3L2MA 2JCCB 1G7LB 4WJG3 3B3IA 4WJ5B 3S88L 5GJSH 1PZBA 4E41E 1GC1C 4DH2A 3BKMH 4ZD3L 1KXQA 4XN2A 3GI8H 3OR7B 3KBEA 2DQIL 4MA8L 2I9TB 2K4WA 4GXUN 5JHLA 3L13A 2PO6C 1K4CA 4QRRA 3GBML 4YDIL 1EHXA 5CD5C 4NO2B 4D3CL 3V6OC 3E7JA 2CKNA 4LSPH 1OLLA 1QSEA 3LXAA 1BQ5A 4MVBD 5INCA 4O4YL 4ZAKA 3WFCH 2BDNL 4G5ZH 1QPPA 2NTFB 4AG4L 5IT2H 2VQUA 3QXWA 4S10A 3L3OA 1NGYA 1EH9A 3FBQA 5IMMB 3DTXB 2NNAA 2JCWA 3X14B 5ISZE 3SDCD 4A7TA 3D0LA 3BLPX 4WI5A 2BIMA 3P30L 4WHTB 1A7BA 1OP3K 1BQHG 4Q4EA 5HYQB 2IG2H 2ZOKB 4ICWA 4WTZA 5CXPA 2BVOB 3BUPA 4O9HL 4PV9B 4QRQA 4MXWH 4UTBA 2J21A 2FUQA 3OHXC 3US0A 3DGDA 5L9DL 4AM0A 4UTAL 4N8PA 4JQXA 3O2VH 4I18B 3UBGA 5JHDA 3C6LC 2AJUL 4N0UB 1R5WB 2OS7A 3INUL 2AVGA 1DJXA 1HEHC 3F7YB 4LU5H 2O5ZL 4RX4D 2XUWA 1UXSA 1A7NL 3RGHA 2GI7A 3QR2A 1C16A 4XXWA 3K46A 5D6CB 1D7CA 2ZAHA 3CDYA 3JV5A 3MMEA 3B8SA 2P4AB 3BHBB 5ALBL 2BOBA 4K94L 4BK5A 4UDTA 3TJPA 5KANI 3GSXB 4M00A 2C7UA 3BEVB 4ERSL 3FB8B 4FTDA 5T3ZE 1LHZA 4G9FE 3W38A 3BQUC 4PHZA 4AVKA 4KK8C 1N68A 3KJ4C 1TUPA 3N40P 5DD6B 2PWGA 1A6WH 5CD5D 1PKQB 4OD3L 3SE4C 2CIIB 2A4CA 5IB5A 1AHWB 1QLEB 1GC1L 3WSQH 5H4YA 2IWGA 1FZMB 1AZBA 4EIUA 1GGIL 4HFUH 2DMKA 2V2WA 1M57B 4L2LA 2MKWA 4JM2A 1SUHA 3GRWL 3TN0B 4RNRA 3EXLA 4Q6IA 4PMFA 2PPDA 1AI1H 2XTSA 4YDJA 1P4IH 2BS71 4A2DA 1NFIB 1IL1A 3O2WL 4PJ5D 4F57H 5TDNA 3V4PA 3SCMA 4NQXB 1KLGA 5FPIA 4XHQA 2E86A 2EEXA 2CLRB 4JO4L 4Q56A 2DQEL 3AT9A 4MKTA 1ZSDB 4HHAB 4OBRA 4X7DC 2WCGA 3C6LD 4NO5A 4PEEA 4I9WE 3LDBB 5C07E 5CWSA 2W1NA 4ONFH 4L1LA 1KJ2L 2BOLA 2EICA 4R0LC 2CO2A 1ZLSL 2UWEE 5D4IA 3PY9A 1HXMA 4GT7A 4NC0B 5J6GB 1Q0EA 4L0PB 4PSRA 4J3WA 5D7LB 2NMSA 2OMZA 4MJJA 3AS3A 2WNWA 5BRZB 1JV5B 1T1WB 3IDMA 1DJWA 1DQLL 4FJYA 5AG8A 1KB3A 4CC1A 4QYOA 1OAKL 3S97C 4AV0A 2DYPB 5KYXB 2R29L 1PAZA 3BQUD 4KK8D 3D50A 4PY8J 1YVLA 1YQVH 2P26A 1D7FA 1WTGT 1AE6H 3GXDA 3QZWA 3IMWA 2X1QA 4ODVH 4PJXA 2FL5B 1CWVA 2I26N 5E8EA 3IRCA 3LN4A 4P4RB 3WN5C 2WQ8A 5A6IA 1KTRL 3WNMA 2ZUYA 2ENSA 3VNZA 3STZB 5D9SA 2M83A 1NA8A 1DQDL 4G59C 3OHMB 4P4KB 1OOWA 3I85A 2CGRL 3L7EA 2A74B 5CJQH 4OB5H 1WBYB 5AVSB 2G5RA 3DXAD 1FYTA 3L81A 1WG3A 2M8XA 5T1DH 1O9VA 3L5WA 3VXOB 2CJUH 2ENJA 3D08A 3O0RL 5BS0D 4WHYG 4JUTA 1JD9A 3WMQA 2MQCA 1NBYB 3BAWA 5CGMA 2VLJD 4G8GD 5DD5L 1R46A 1OE2A 4ODBD 3ZL2A 4RESB 5ACZA 1ZS8A 3I3EA 3O11A 4HS8L 4AKQA 4CRPA 2BNQD 4ELMF 3FU7B 4H8WH 1FHGA 5JTWA 1IGFL 1NCWH 3W81A 4ZFOL 2B16A 3FOLA 3HS0A 1W72B 1YEJL 3D8MA 4L4TB 3FSZA 2JQMA 3GSRB 2QKIC 2GBVA 4IMLB 3FB7A 4M7KH 3VSTA 1FLRH 2VT0A 5AZ2H 4LSRH 2UXTA 4MMYB 5C6WH 1N0XH 3SBRA 3TLRA 4TSCH 3K6OA 3QPQC 4PWEA 2BK8A 3KGRA 4ZXBC 3V95A 5D1QE 2B15A 3LZOA 2R1XB 1D5MB 3H85A 4F33A 1PL3A 3HPLA 3TWYA 1AGCA 3QEUB 1T7WA 5JORB 1ZEAH 1S2EA 3FCUB 4G8FB 4R84A 1A4JB 4GAAA 2JJTA 2VWEE 3PWJB 1MW1A 2VE6A 4ZUVA 1JK9A 4P59H 5IBUG 3KH4A 4M1GL 5HYJD 3ZO9A 3K2KA 1UATA 4TVPE 4U31A 4AXWA 1OY3B 5TF1L 3QK0A 5E99L 3MRMB 3PQYD 4M7ZB 4A37A 3MLYH 3HN3A 2K6ZA 4BRJA 5DI8B 4DEPC 2OMUB 4PB9L 3UEQA 1BAWA 3NCBB 3G6DL 1XF2A 5DRWB 1Y7VA 5E2VH 3BPNB 4HOWA 5JPMC 4OKVB 1ANUA 5DLMH 5D1ZB 4KO6A 4EI5B 3CC5B 1JL8A 4U4IA 3SYPA 1JPGB 1MCDA 4CKQA 3BAEL 4YX2H 3HG1B 5FYKE 4C57C 4HLZH 4DZ8A 5F9WC 3KD4A 1XGYH 2P24A 3NJGA 3EYVA 3P0GB 1JGLL 4NQVA 2G2RB 2GPZA 3JUYA 4I77H 5E94A 3KPSA 3QEGH 4CU6A 1NGZA 3VFUB 2JCCA 4NWUH 5E08H 3WTUA 2AJSH 1RP9A 4WJ5A 3S37H 3SKUD 3IDJB 1HDMA 4XP5H 5DD1L 1T2XA 1CQKA 4N2DA 1I8AA 1G0DA 5T3ZH 1T4KB 3D18B 4UCFA 2ADYA 2KQNA 2PYFB 1IZKA 5DEJA 4ABUA 2HXAA 5D4JA 2A9ML 2I9TA 1U92B 3MV9B 3OLEA 4AQ1C 2L8AA 5CBAB 2ZPKH 1KBWA 3LEYH 3QIBB 3QNZA 4G1MB 4YEEA 3QPQD 3AG2B 2CD0A 4W68A 3WLBB 4ZXBD 3KG5A 1MKFA 4V11A 3IFOB 4CC4A 2O6DA 4JG5A 4WUKL 5IMMA 3DTXA 4XN7A 2WKLA 3CHXA 3FFCD 3QDME 5LN4A 3X14A 5CZVH 3FTYA 3QISA 2A6JB 43CAB 3X3FL 1CI5A 1JXDA 2YXFA 3LQAH 4WFEE 1UOKA 4GW4A 4P2AA 4FQJH 4J2QA 5FB8B 4DT2A 5I0ZA 3O3EA 4KUZH 4PGCA 5GRXG 3EOAB 3H42L 4WHTA 4IGBA 4X9IA 4F8NA 5D71L 3PAUA 2XQYA 5GISH 5JW4Q 4XNXL 3JZYA 5KW9H 2ZOKA 3QWOA 2F0CA 5CCKH 4M8QB 1Z5LB 2BVOA 4PV9A 1GSKA 1MLCB 1SOSA 4EXPX 4NAJA 1QP1A 3MOBH 5DJ6B 4BCYA 1BD2A 4ESKA 2DL2A 1JZGA 3BOVA 3I50H 1FL6B 4NZ8A 4LDOB 3F05A 3RAJL 2ICEC 3F7YA 5EC2B 2D9CA 2QVIA 3PAYA 4ZFFB 4DP8X 1O9WA 2IPTH 1LD9B 1RSFA 3NACL 2CO6A 3R06B 1ORQB 3QFJD 4FNSA 5DVPA 5ELIA 5AKRA 4TXVB 1MRCH 6CGTA 4FDWA 3BHBA 4N90E 2XA8H 5ECJE 1Q94B 2Y6SC 5ID1A 2OXHA 5GGUA 5KYWB 2B2XL 5MP6L 5D72L 3BEVA 2OYLA 3KYMA 2L4OA 2V5YA 2F58L 3E1F1 5CGYC 1OD9A 2WAQA 5FYLE 5DD6A 4XCYB 4JZJC 2AK4B 4OGXL 1Y1UA 4QHKJ 1XF3A 3ZYJA 1O7DC 2WO4A 1NMBH 2CIIA 3RGVB 5IGXL 4LASL 3KWWB 4E9XA 3QFDB 1M1SA 2H47C 1IC4L 8CGTA 1IKFH 3PJNA 1TPXC 2I07B 4NP4L 4MB4A 4C59B 2OK0L 1IKNA 2ZXWB 2F8VA 2F1EA 1QFPA 2DH3A 1OT2A 5CUSH 2C3GA 4EIBA 3RL2B 1NFIA 1ZKAA 4XP1L 3ZDZE 1FIGL 2WOBA 3ROLB 4OIBA 5LBGA 1MRDH 5EIIB 4BQ9A 5E56A 3IJ9A 1NGQH 4TUKH 4P49A 2R1YA 1KBPA 5HHNA 3OF6A 3KL5A 2V7HB 1OGAD 1ZSDA 4HF5H 5C0DA 4NFCA 1L9NA 1UWGL 4C4KO 1M71B 3Q9PA 1LWRA 3CDZB 1JZ8A 1AGDB 1T0MA 1YEFL 1WBZA 1H3VA 4E41B 1RUPH 1JPEA 1AY1L 3RA7H 3U4EB 5DZ9A 5JHBA 1U58B 5D7LA 3GUTA 4PYGA 1ZXQA 2Y6SD 5DZLA 1WP6A 3MO1B 5LBSA 1NUGA 4PRID 3V0IA 1JV5A 1T1WA 4JK0D 4QOKD 1OE1A 3HC2A 4A67A 1E4XH 3PV6B 1P6WA 4G8IB 4EBQL 3OKLB 4YPJA 1DBML 3NIFE 3QQDA 5E6ZA 4M7JH 5CGYD 1GGBH 3ARBC 3IDGA 3N5AA 4G72B 4OVUA 4XBGB 1LO3L 4KPHL 1HCFX 4EQ2A 1XO8A 1SJVA 2FL5A 5I74B 4P4RA 1KNOA 4WTXA 5ISZB 4TVPH 3JSSA 2X2IA 2ZAIA 4NCC1 5ADPL 4OZGE 2VERN 4ZSOE 4ISVB 5EORH 2R0KL 4JDTL 5GQBA 3D5OF 5BRQA 1EZLA 2A74A 2BZDA 1WBYA 2UZXB 4JKNA 5DJZB 1MHCB 4DQOH 3MGOA 3WE6B 4CMHB 1TF4A 5C0RH 4TSBH 4UUJA 3VGAC 2DIEA 4F7TA 1MFCL 5JXEA 3L6FB 1IJ9A 5CP3A 5BUAA 2C4XA 5FYKH 1AZUA 4JY5L 3QS2A 4DK6A 1YC8A 1EZUA 2J6EA 4ELMA 3QEQE 4KMLB 1NBYA 1J5OH 2WUCL 4OGYH 2J43A 3KM2A 4CSZA 2DL9A 3WN6A 4PJEB 1I7TB 5LWYL 4Y16C 1ZGLM 1VCBC 5F7EL 1B9ZA 4BCXA 1OAYL 3FU7A 4OM1H 1MJUH 3ABMB 1KIRA 4FLOA 5MI0B 3SQOH 1E5CA 3U36B 4QGYA 1FNSL 4PJEF 4OJFL 1W72A 4L4TA 5EF0A 4Z95H 4HGWB 3GSRA 3OKOA 3QHFL 3M88A 4IMLA 4PH8A 1YYML 1KGJA 3R7RA 3QUYB 1TZGL 2H5UA 5CU9A 5AZEH 3SKOB 3T0VA 2QQKH 4G9FB 4PQXA 1TQTA 3AREC 4FFZA 4X4MA 2Q87A 4DKEL 1TZIB 4MAZA 1NCBH 4BYHA 5G5DA 3V4VA 1AO7D 1D5MA 1YUHA 2F5BL 4F7EA 1ZMYA 2JKXA 2NPLX 3AWFA 3EJCA 5KVDL 1PPIA 2NSQA 4ODWB 3QEUA 5JORA 1JPSL 1KENL 3P3RA 4HX1B 3H7LA 4G8FA 4UOW0 2R2CA 4U1SA 4ABWA 5A2FA 3UTTA 3QPXH 3ARBD 4H4NA 3PWJA 4LESA 2K8MA 1T03H 1NH6A 4UT9H 4JPSA 4MA7H 4QHUB 4WSGA 3CVHL 3KLKA 4X80L 3DROB 2WLLB 4DN3H 3HMXL 2EYSA 2M2DA 3MRMA 4AK1A 4PY8I 4TRPH 1YMMD 2OMUA 5ES4B 3STLB 5DRWA 4JRXD 5D7EA 5GS0C 1AOZA 4JJ5A 4OKVA 5FLUA 2E56A 4NM4H 5D1ZA 4G42B 1RUMH 2Q76A 3CC5A 4WI2A 4Y5VA 1I8UA 1ODAA 3ASOB 3TCTA 3TNNB 2QADB 4L4VE 5C07B 3BLKA 3G6AB 2BWDA 3VFUA 5E1AB 3BP5B 3ME0A 4Y16D 3BI9X 1DQQB 2GABA 5CLZA 2UWEB 4V1DD 3KPPA 3GLEA 4AJWA 1I8LC 3LHPL 5DD0L 1KCUL 2AVFA 4ANUA 1JGVL 4U6VH 3D18A 4LARL 3RYMA 1UWXH 2E4FA 1AKJD 5CEZD 5J4MA 1NCIA 5KTEL 1OQXA 5HHOA 5FYLH 2IMMA 1U92A 2QLVB 4OTXL 3MV9A 1FFTB 2QSQA 3DBXA 4AMKH 4OCXL 4G1MA 4PREA 5J13B 2Z1PA 3ARED 1AYOA 1HINL 1MI5E 3TYGL 1BDYA 4UIKH 1XF5B 1FL5B 4PRHD 3BP4B 3IFOA 4F27A 1Z9SA 5E7BA 5I82A 4M9PA 5IHLB 1FVDB 4G9DB 1TU2B 4LSSH 4AEHL 4DGYH 4EN3B 1D7BA 43CAA 4RFOL 3M7FB 4A7SA 4JPIA 3L4ZA 5G2NA 2ARJQ 3DECA 3TTYA 1JF6A 5I5MA 2EE0A 1M7IA 1MCWM 2XQBL 5EEZA 3IVKA 2O6EA 1AZVA 1N0LA 2MRYA 3MXVL 1Z5LA 3EBAA 4M8QA 5T3XE 1MLCA 3NJVA 2XN9E 4PYHA 5F2FA 1C8PA 2W95A 1GOFA 5DJ6A 4CVZB 2P5EE 4ANXA 1FL6A 4U2YA 2E9JA 1QX1A 1F90L 1PZ2A 1N2RB 2UYLA 4KQ3H 2HH0H 4RMTA 5GS0D 3O2DA 3DX3A 1FUNA 3QUML 1TZHA 4OZIE 2DMGA 4WW2B 3H7BB 2VRKA 4ZFFA 3NJJA 5AVWB 3QQ3B 1KIQB 1LD9A 3MLTB 3LPPA 4K8RC 4QTFA 1N9PA 5TQ0L 4K7PX 2DLTA 1ORQA 3WDHA 3PP4L 1E28B 1LK3H 1NBQA 2AGJL 3GFUA 3MRHB 2EXWC 2FATL 4ZUTA 2X3BA 5DD3H 5KUMA 3MRLB 1MLBB 5GS0L 5JDJA 4MS6A 2WXRA 2YQ3A 4QYAA 5HDBE 5KYWA 3KDPB 3EF4A 2MOVA 2W5PA 1UYWL 1WJ3A 3WFBL 4MB3A 5SWQB 1UWEH 3IFNL 1X6LA 4D9QD