1P5UC

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
130
Chain Sequence
PARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, structural protein
molecule keywords Chaperone protein Caf1M
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
total genus 28
structure length 130
sequence length 134
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5uC00
1P5UB 3DSNB 3DPBB 4B0MB 1P5UC 1P5VB 1Z9SB 4AZ8B 3DOSB 4AYFB
chains in the Genus database with same CATH superfamily
4UQ3A 4A6YH 8PAZA 1KTRL 3MLZL 1FYTE 25C8L 1KEGH 4IBVA 2O5NA 1G6RH 3A6CH 4LLWA 5BRZB 1IILE 2XWBB 3NDYE 5INDB 3ZHDA 2EDJA 2MQ0A 2GAZA 4W9FC 2BCMA 3H0TB 4NXKA 5CM1A 4K9EL 5DMKA 4N8CH 4NZRL 5EBWA 1J5IA 3GSVA 1BOYA 4GI8A 3DJZA 4HBQA 3ULUC 1SF3A 4DCQA 2IDQA 4I87A 4QO1A 3VFPA 4P5SA 1N6UA 2HP4A 4MWFA 1MCSA 5DD6B 2BZCA 3M8OL 4JCMA 4N0FA 3GSNA 3ZYZA 4GEIA 5FUZL 3TBCA 1ZCRA 3SGJC 4N3TA 4BH7B 1G4MA 2FWSA 4JY5H 3OXSA 2JLLA 5DS8A 1MRFH 1JI1A 3NSXA 4K5OA 4MCZB 2DWEA 4BFIA 2COQA 4BZ1L 3I6SA 5HYJB 4IBWA 4YHZH 4ELKA 3C08H 1G7IB 4JM4L 4E0RB 2YD9A 1W72B 1UB6A 3VMPA 2BINA 1FBIL 3EJJX 2AC0A 2H8PB 1MHHA 1ZSHA 4P5RA 4Y4HA 4KMTH 1IC5L 1YEJL 4MMXB 4JM2F 5A43C 1KG0B 3GIZL 4U33A 4EN3C 2WQWA 5D1QA 2X42A 3VXMD 1X7QA 1OAZH 5IFHL 4APXB 3RWCA 3V6FA 1AI1L 1JGIA 1DR9A 2WO2B 3S2AA 1IO4C 4S1SL 1JZFA 4MB3A 3APNA 3GSUB 3OD3A 1VGEL 4HK3J 1T2QH 4ZUUB 3QZWB 5JTWA 3K0YA 3K8MA 5F96L 5JA9A 3DDFA 3P54A 3BE1H 3MCLH 3V8OA 4EEEA 2VXSL 2ICEB 1KXQA 2BWDA 1NUDA 4F15B 4JJ5B 2NT0A 4U7MA 4KH2A 4M7JH 4WNQB 3MQIA 4XN5A 5JIHA 2NY1C 2WC7A 1ZA3A 3FBKA 1NLDH 4F92B 5IVXF 1ADQH 4DFHA 3VRIB 1JRHI 3SBPA 1AHMA 4M7KH 4Y4KD 2B3RA 4WV1C 3L5HA 3EOBB 5J1SC 2V2WB 4KROC 4NO5B 1N5AB 5K9OB 1A1OB 2WVUA 3C60B 3ARBD 5D6CB 1MLBB 2WYTA 2FD6H 3TU6A 3PL6D 4TQPA 3T2NH 4X5PA 1OSPL 1FCGA 1UJ3B 5H35A 5FXCH 2CBMA 2EEAA 5AW1B 4FMFA 3FT4B 1PKQE 2WUBL 3H1ZA 4XBGB 5LGHH 4WTWA 5CUSH 2FSEB 3RGHA 1MAMH 3N50A 3FQUA 3WS3B 3OKDB 3IJEA 1KTDB 3L1FA 5CP3A 4ZUSB 3GWJA 1EERB 1TJIL 4X0KA 5SV4A 3S48A 4F9LC 4WWKA 4YHKL 3VXNB 3NFSL 2FJFB 3VJ6A 1E3FA 2ZWNA 3BFQG 1M6OB 4HS3A 1SNRA 3DX1A 5TDOB 2WIMA 2XG4B 2HG5A 3GHEL 3PUUA 4KTEL 5L8KB 1N5YH 5C0AD 3IE4A 1Y1DA 2PTVA 4S2SB 1JFQL 1NBVH 2PP8A 4U6VL 3AREB 2W59A 1U8HB 2B14A 1M2VA 1IAOA 4XPHH 1BD2A 1I8IB 1KYOK 4Z7UB 3FU3A 4JANA 3I3BA 3ZQXA 1DJYA 4YNYA 2IG2H 5EIIG 4BFRA 3CE1A 4N6RB 4TTGA 5ADOL 1JV5B 2BH0A 1XEDA 1QFHA 4V33A 5DFAA 2CDEA 4OGZA 5B8CA 5AW5B 2DMBA 1X9LA 4MASA 4MQ7A 4F7CB 5DMGC 1R5IA 4D0CA 4UOQA 4F7PA 2A1WL 3JUYA 5HYSB 1JZ3A 4I2XB 1KCVL 5L7XL 1OXYA 3ARZA 3KPQA 1YEIH 4HFWB 4FTVD 4MJ2A 2GBUA 5LB1A 2K1MA 5DUPL 2DYPD 2VKXA 1BZOA 4Y1SA 4UT6L 3AB0C 4HS6A 1G7HB 1DJHA 2EADA 1C7SA 5JQHC 5CLWA 4DOHE 1XF5A 3AROA 3POHA 1GRWA 3VQ2C 4AM0B 4DP9X 4RNRA 3U2JA 4EKXA 3ZKXC 2H47C 3G5YB 4YC2B 3H6AA 1T1ZB 2OX5A 5AW9B 1IM9A 3ZQ9A 1TDQA 4LHUA 2D3NA 2WQXA 3M1BA 1EXUB 1L0YA 4FFZA 3T71A 1MHEB 5I2IA 1FLTX 3V7AE 1A3ZA 2KPWA 4KI5D 2ITCB 3IJSA 2OW6A 3ABMB 3NRFA 1EVUA 1EV2E 1I8KA 1FFQA 4YFLI 2BSED 1XWVA 3JWOL 1J05B 3P1VA 4RMQA 5J89A 1ZS8A 4E41E 3OHXC 3LQZA 1O75A 4PJBF 4PJGE 5IOPB 3PHOB 2A0LD 5AWNL 4UDTA 1KY6A 3ATBA 4F1SA 1DVTA 4N2CA 3GXNA 4PGBA 1VFAB 2PR9A 1VPOH 4NJ9H 4PVNA 4YWGH 1I7UB 4KKZA 5FKAB 4NQDA 5AQ0A 3VI4F 5C0DB 3UBFA 3RB5A 1OQOA 4GQ9H 5IHUH 3ECUA 4DKAA 6PCYA 4U1LB 2EDFA 1NBZB 3B2XA 3RL1B 2I85A 5JORB 3P9WB 4QXWA 1AQHA 3QT2A 1XF1A 3FPYA 2CO2A 2NOYA 3RBGA 5F7FA 1OE2A 3ULVF 3RPKA 3VXMB 4JHAH 1CVRA 3RNQB 4ZW8A 1HXYB 3L4UA 3ZYOA 1AO7B 3VWJC 3SDAD 1WAEA 3TBWA 4Z5RA 4HSAC 2R8SL 3BKYH 1A1MB 1RIUL 1UD4A 4PJXB 5CZXC 5FECB 1GYAA 1TKWB 3T4YB 4OFVA 4XCEB 1OD7A 1TJHL 1X7SA 3FONA 1CT8B 1JHKL 1HHJB 3KPLB 4ZDHB 3BRFA 4XMVA 4F8LA 4L05A 3TLRA 2CCVA 4CNIB 5C7ZA 2Y06H 3RY6A 2W9DH 3MFGB 4WZ9A 1OVZA 1INDL 1J9SA 5CSZA 2WTRA 1LLAA 4AKQA 4PRNA 3L5JA 2VE6A 1CDGA 1K8DB 2X12A 3UAAA 3W2DH 5C6TL 1E30A 3LQMA 1YNKH 5A6IA 2DY2A 2O6CA 4Y4KB 4FN0A 3JV4B 4MXWL 2HT4C 5DRZA 3U25A 2AK4E 3UFIA 4WI9A 1NFIA 1OL0A 4M1DH 2Y7QB 3Q0HA 1UHVA 4GINA 4N2EA 4W6XB 3RPBA 3PL6B 5E1QA 4YBLB 4XNQA 1F3DH 4HPOH 1OAKL 4WJKB 4JZOB 5FKPA 5IESL 1Z1WA 1E9PA 3S3PA 1F8TH 2R0WL 4AH2B 3I9GH 3O6LL 3WNPA 5DWUL 1HHGB 3GIVB 4OZFH 3VFOA 2OP4L 2WBJC 3LNIA 2CKBB 4JS7A 1ED3B 5IMMA 3K81A 4R83A 1JYWA 1IMHC 4L1HA 1RERA 3X14A 2J6WA 3PWUA 4JFQA 4JPIA 1CLZH 5IVZB 3QQ9D 4HOXA 1MJUL 1UB5B 3L3GB 4MQXD 3KBEA 3UEZA 2J4WL 1BSIA 1Z7JA 4GT0A 2V2TB 4NNXB 1MG2C 1W8NA 4P5TA 3MROA 5C0AB 4M3HA 1HIMH 4G7YH 5I19H 2XHNA 4WI6A 3WTVA 1K6QH 1U2CA 1LMKA 4B9PA 2VWEC 2AQTA 3EYFB 1G6RB 2VZ1A 1Y0LB 1IJNA 5I16B 5EU3A 4H8UA 3QNYA 3NACL 4WWNA 2ROYA 1FVCA 4KJYA 1BPVA 2QDWA 1KENL 3PAUA 3GZPA 4JO4H 4M6OH 2XQBL 4DPCX 4RA0C 5J3HC 1SEQH 4ZFOA 5I1LA 3C12A 2NQ3A 5F88B 3L2NA 2WCPA 3OZ9H 1S5HB 3C6SB 4A6YL 3U0WH 4JLRA 3Q44A 1GL4B 5HBBA 3SPCA 5D1ZI 2XWBA 5INDA 3KAAA 4Y7OC 2V3FA 1O7DC 1XF3B 3BVWA 2JH2A 3GEFA 2DQEH 4S0HA 1OCOB 2WXFA 1OSZB 4JG9A 4UB0H 2RAMA 4KO7A 5EWIL 2F8OA 1JMZA 1YJDC 1EAPB 4FTVB 4OM1H 2D0HA 3K2UL 2DYPB 4I4WA 5KYYB 1NFDF 3T04D 3QJQB 3CZGA 2ICES 2R51A 4G6MH 4F57L 5EZOL 3T8VA 3NCFB 1X7TA 5AVYB 1J10A 1MY5A 2AXWA 3ZZSA 2R0ZL 1CU4L 2Y07H 1DSFH 3IU4L 5KSAD 4L1TA 2Z31B 4DFIA 4RVBA 3IAGC 2ZJSH 1G7IA 1M1XB 2E9IA 3CBRA 1NGYB 2EEFA 4P2RD 1VDGA 5B1JC 1W72A 2K8MA 4HBCL 5ELIA 1WFUA 2FX7H 2H32H 1Z3RA 2H8PA 2QQNL 4PMFA 1EJ8A 5DVNA 2GFBA 2R69H 5DUML 1LNUB 3CQFA 1JG9A 3QAQA 3B9KC 4PCKA 1JIBA 1MI5D 1KG0A 3MV9B 4K94H 4OJFH 1G1YA 4IHBA 3QWRD 3M6DA 4XMLH 1A7QL 1OAZL 1EEUA 3EYOB 3MNWB 1AD0B 2GTQA 1RFDL 2BXZA 1PG7X 4K15A 3GSUA 3D7PA 1EBPA 2D31B 3QZWA 4IRSC 5D8JH 2ZOLB 4IEFB 5I5RA 5IUCA 4FZ8H 1BAFH 4LPCA 2LFGA 1UADC 1L9OA 4Y1AD 3S5ZA 1FH5L 2NR6C 3U4BH 3MCLL 1XR9B 5DJAB 3D1MC 5E5LA 1PZ5B 4K8RH 4QHMB 2EXWC 3M88A 4JRXE 4WNQA 3UGEA 1B4JL 5A7BA 3S88L 2XKSA 1DUYB 1RUQL 4F8QA 1AH1A 1D9KD 1GCYA 1BLNB 1PX4A 1UH2A 3VRIA 1DEEA 1O6SB 4ZO9A 3UGUA 4KITB 4NM8H 2LOEA 2E7LA 3SDAB 2K9UA 1I4FB 2V2WA 3ILQC 4XHQA 4NO5A 2E9BA 1N5AA 5K9OA 1A1OA 3C60A 5D6CA 1MLBA 4I5BB 5JLZA 3BX7C 4LPTA 5A40E 1EXHA 1ZXQA 5IZ7A 1UJ3A 1UOKA 5E2TL 2XA8L 4E9QA 3L2MA 4HWZB 5CKAA 4JCLA 5AVZB 4L0YA 5I1AB 1Q0XL 2YARA 1MFDH 4XBGA 5I0ZA 3DUHA 3RB7A 2J1WA 3IDNA 4J8QA 5GGVL 2J1KA 4YSSA 2FSEA 1EIBA 3QWNA 3P4MB 3BKCL 1F0LA 3WS3A 1J11A 3OKDA 1KTDA 4ZUSA 1SBSH 2D7PA 3QNXB 3US9A 4Y7MA 3IWVA 4JM2D 3VXNA 2BP5M 2XG5A 1YSOA 3NGBB 2UZIH 4JGUA 4XPTL 5IQLA 4F7EB 5CCJA 1M6OA 3LY6A 5KVMC 4JRLA 5TDOA 5SWZD 2FH8A 2XG4A 4QRRA 1G9NL 1K4DB 2WIIB 2WLIB 4WSGA 1IC0A 3RA7H 3HNVH 1BXXA 5CMAB 3VA2C 3MRLA 1OGPA 3UG5A 3WL9B 4ZTPL 5ID0B 4S2SA 1JFHA 5D72L 3HUJA 2AJVH 1Y6MR 5E8NB 1YEWA 3AREA 1U8HA 2WYZA 4MAUH 2ZKHL 5E1HB 3SGEI 2JJUA 4JUSA 1DQLH 3PUCA 2XIDA 5C86A 3OAUH 5LXGH 1CXLA 5JQ6L 5KVFE 3A6BL 4N6RA 1BZ9B 3NQIA 4ZZFA 3NJNA 1OP4A 3IBOA 4G7RB 4BUHA 4OY9A 3OR7A 3K71B 1J48A 3EUDA 4HW6A 4UTBH 1NWOA 1NJ9A 1M9SA 4KKNA 5MENE 1QRNE 2YUVA 4GKOA 2A77L 2F9BT 3K2MC 2CKNA 4I2XA 1AFVH 1JTPA 3IM1A 3R1GH 4HFWA 4FQIH 4JY4B 1WO2A 4N9OB 3M1OA 1CK0H 2CR6A 4XCYA 5D1XD 5EF2A 1SM3H 1JGVL 2YPVH 3KE0A 1B2WL 1G7HA 2NCEA 1W0VB 2ICWA 2EACA 3LEXB 5TE6H 5GSRB 5IEKB 1Z66A 1DBAL 3QCTL 4AM0A 4YXHH 6TAAA 4GUPB 3GSRB 3RY5A 4PJ8C 1T1ZA 3ZGIA 2F7QA 3QQDB 4N9GB 2R29H 4ONGH 5DLML 2DAVA 5FV1L 3EH4B 2PW2B 5IB1B 5FGBA 5E4IA 7FABH 1EXUA 2BZDA 5F7KC 5B1BB 2VXQA 5J11C 4OLXH 1FNFA 2ITCA 2ZF8A 3THMH 4PRHD 1BBJA 1FC1A 4J3UA 5D2LE 1XDTT 1J05A 4QY8B 5FM8A 1E5YA 3MHZA 3VA6A 3SDXE 3PHOA 3T3MB 3BMWA 4K8RD 1RIHL 2ZCZA 4TTDD 1HEJC 1VFAA 1S78C 4YEFA 1GGUA 2IBZY 1P7BA 3JVGC 5FKAA 5C0DA 5KSAB 2I9TB 4P2RB 4TRPH 1E6JL 1M53A 3MI6A 4IKLA 2CRIA 2E75C 35C8L 4DGIL 5IP4A 2C1OB 2ADFL 2VR9A 4LPYA 5JORA 2E4FA 1IGTB 4LHUG 3I2CL 1YEKL 4AG4L 4WKZB 3SQOH 3OSVA 3Q6FB 2NY6C 3VXMA 3OLDA 4YZWA 4BA8A 5L8JB 2XX0A 5MEOB 3BYYA 2UWEF 3P3UA 2ZUSA 2YJLA 1AO7A 4ZXBD 2CUAA 1BG9A 4NP9A 1KJMB 1A1MA 1INQB 5FECA 3Q5OA 4A37A 3MMEB 4AL8H 3NCJL 5A2LH 4XCEA 1HILB 1ORQB 3G9AB 2AJ3B 3JVFC 2D7TH 2VR8A 1V7NH 1CT8A 4X80H 3WY4A 1HHJA 3KPLA 4UAHA 1RURH 4RAVA 4EKJA 4ZDHA 1EDHA 2NLJB 3TO4C 4Y1AB 4X4XB 4M62L 5KBMA 4UV7L 5LN4A 3DOSA 3Q7JA 4CNIA 4LLMB 4X4YB 2Y06L 3E1F1 3GDBA 4NM4L 3S96B 3MRGB 5IQOA 5I6PA 2XQYA 1K8DA 3OMIB 3I9IA 1SDDB 3GBML 1D9KB 3P0VL 2JF1A 5F8RC 3DJSA 3EG9B 3HN3A 4Y4KA 4AV0A 3PDDA 3CFKB 4J3XA 5BOZG 3JV4A 4MX7B 1T0NB 3AMKA 2YAOA 2WZ6A 4NRZB 1PY4A 4OZFB 2XNAB 1XGPB 1WAPA 4JKKA 5HJGA 3PL6A 3IRZA 2OTWB 3D87B 5F0JB 2O6PA 4YFEA 4BGLA 2V9TA 3CX2A 2A6KB 2AGJH 4NGHL 4NPJA 2J20A 1YQVH 4ZQKB 3QZLA 5AW8B 5EZPA 2WLJA 1HHGA 3IJYB 1FFTB 2VZVA 3GIVA 2CSPA 4DNLA 4KUCD 3NABH 4NB7A 1D5ZA 2CKBA 1ED3A 3CSYB 4JFPB 2WM0A 4HIXL 2EQDA 5DEZA 4XH2B 1VRSA 3LRSB 4BFFA 5DHMC 4JM2B 2ZUYA 4V2BA 5IVZA 4ILDA 1UB5A 4FKKA 2F1EA 3L3HB 1ZSDB 4W4NA 4NNXA 4OD1L 1KGJA 1O7VA 3IMTA 5C0AA 1FWXA 2H0FA 4FERA 3DRTB 5DJXB 5EORL 3WBDA 4FQQB 1HIML 4XMXA 2QMJA 3C8KB 3EH3B 5JO5B 2IPKB 3CAFA 3GO1L 4KJPC 4M7ZB 3DO7B 4ISVB 2PW1A 4UU9B 1EO8L 2J6EL 2GHZA 3ULAB 1G6RA 2J5LC 3K46A 2IQAB 3QXVA 1Y0LA 3AXIA 5K1JA 4XBMA 5A2IH 4ES8A 2XN1A 1A7RH 5BV7H 4NAQA 2Q8BL 4KBPA 1K5NB 4M6OL 3LZFL 1U33A 5AG8A 2WQAA 5EEYA 5IVXB 5F88A 3MACH 3RTQC 1S5HA 2G60L 3OF6D 3QC6X 2BW5A 2VRKA 3U0WL 4R4BB 5F72S 5CJXC 1IGFL 3DUSB 3N06B 3QDGD 2EXYC 5BMFL 5CLTA 4L1SA 4UT9L 4R90H 4GG6E 4UNIA 3AS1A 1OSZA 3AG2B 3AABA 4UB0L 4KX7A 3NIDF 2X3CA 3ARGC 4P46C 3VSQA 4CADB 4OFDA 4FTVA 2KZBA 1SHSA 2DYPA 2H32B 3EGDA 4BBWA 2XRAH 5KYYA 4KK9D 2V17H 2X1XR 4DQAA 1RK7A 2XV2A 3O45B 3RVTD 4FNTA 2C9XA 4H8WC 4AMKH 3JTSB 3O8XA 5MEQB 1S3RA 3LS4L 4FNRA 4NQED 4QRSB 1K4CA 1BQSA 2FNBA 3DPBB 2Z31A 1W0WB 2NXYD 4TQ8A 1M1XA 3LNEA 4AGNA 1QZ1A 1L4IA 5EG6C 5EV7A 1HSAA 3KBHE 5CCHE 3V4VH 1OGTB 2AZAA 2FTAA 2HH0H 12E8H 1L7TH 4JPSA 3CZFB 4K3DL 4MMYB 4MQTB 4XPFL 3MV9A 4L3EA 4PRHB 2VC2H 3GRWH 2Y7LA 3G6JE 3V0WL 1F90H 3EYOA 3MNWA 4WI5A 3VGBA 1AD0A 1XH3B 4K5MA 1T7ZA 1ANUA 3BSZA 1OF2B 3GRBA 3V0JA 4LT7A 2ADGB 4QXUH 3UROR 4FFYL 1ADQA 4R97C 1IE5A 1H6FA 3RJDA 1NPJA 4Q0XL 4HALA 3K1KC 2WO3B 2OMBA 1L9PA 4L9LC 5KZCD 1MNUL 3C5ZD 1HOCA 5FB8B 2ZX5A 4XRCB 3HR6A 4L4TD 1UWGH 2E9GA 5DR5H 4E9XA 2ENYA 1PZ5A 4IIQB 4QHMA 1JXDA 2NY3D 2OCFD 3NVQA 4K8RL 4MA7L 4OUUB 1UURA 3FU5A 5E24E 2MKWA 1BLNA 2IFFL 3GI8H 4G71B 1O6SA 1JNLL 4ZXBB 5DVKA 3CC1A 3ZE1F 3SDAA 3PREA 2DYRB 3KS0H 3FSVA 3ARSA 3WO4C 4I5BA 1LQBC 2AV1B 5IREA 1CF1A 1TZOA 1SF5A 5IWLA 2W95A 2ZF9A 1RLWA 3QUZC 3K0WA 3CHRA 4HWZA 5DVLA 4KHTH 3FQ2A 5I1AA 1DHKA 3FFCB 2HRLA 3HEIB 2DS4A 5KVEE 3TC9A 3UTZA 3MRNB 2CRZA 2VH5H 3P4LA 5DHEA 3P4MA 2QBWA 1IGCL 4J3OC 3SPHA 5J1TC 4ZX6A 3EF7A 3HB3B 1ETB1 4NQQA 4GI9A 3QNXA 5DVMA 2DLTA 3EYUH 5HDBE 3HNSH 3LPFA 4RDQF 2Y72A 2VDKH 1CD1B 3BKJL 3NJKA 2OXHA 3FXIC 1GHFH 4XNYH 4OLYL 1KDJA 4HP5A 3LVEA 1QOKA 1IBGL 2F5AL 2WIIA 1K4DA 4PJBB 4EI5D 2ATPB 3POCA 3KCWA 4MVBD 4UMSA 5CMAA 3HNVL 2HT2C 4OCRL 5ID0A 1NCGA 5AOJA 4XN9A 5EO1B 2IPUG 5I75C 5E8NA 5DJ8A 1QR1B 1YDPB 3ZE2F 4L8CB 3SDDD 1YNTF 2X6MA 1ILSA 1VIWA 5EOCJ 4HWEH 2ZE0A 4NN5B 1J88A 3M07A 4HF5H 1I3GH 5GJTH 4YXKH 3HC0A 2W0KA 4U1HB 5GGSY 2X88A 1J8RA 4Y88A 2FSDA 1VGKB 3PXJA 5LXGL 1E40A 3GT6A 5J57B 4W1TA 5JYLA 5FC9A 2BNQE 3QG7H 4KHXL 3JTBA 1JZDC 4HU8A 3EJRA 4U3CA 4HJGB 3WKPA 3V10A 4XVTH 2KQMA 5DGQA 4J2XA 1E27B 2BPBA 3O2VH 4M93B 3TBSA 1M4KA 4X6FB 4UT7H 3GLAA 1UD6A 2PPCA 2VW7A 1MFBL 4OGXH 3ILEA 4JY4A 4XE0A 2YR3A 3MA9L 4FULA 2Z91B 1MQKH 1JGEB 1HCZA 2E7MA 1GGIL 4KY1H 3LEXA 2IOMA 3KJ6H 5GSRA 5IEKA 2MTAA 4EBQL 4JG1H 4GUPA 5E99L 4JDVB 1R1CA 4N9GA 3T2QA 4DO5A 4FX5A 1S9KC 1X5XA 5IB1A 1NCAH 5EFIB 4YDIH 3K5SA 3QDGB 4Y1TA 4AVKA 3T6XA 3D06A 2X6CA 1NGPH 3B7UX 1QBBA 3OJDB 3T0DA 2WY3B 3TF7C 4OLXL 3S34L 3KEHA 1PZBA 3II3A 4GS7B 1U3ZA 1IZJA 5F1NA 1GPOL 1V55B 5T1KA 3DECA 1F2QA 1P4BL 2FQFA 4IDJH 4A7UA 4NQEB 4K23H 3EJSA 4GO6B 2UXGA 4JHWL 5L8LB 5KSAA 2I9TA 2R2EB 2NXYB 3LS5L 4P2RA 3UAJC 7CGTA 2YBRA 2HRPH 1F4YL 3CZKA 4XC3L 1FPTH 1TYJA 2YWZA 2C1OA 2BIMA 3HG5A 5JHLH 2PPEA 1MREL 1CDJA 2N4IA 3RYMA 2X2HA 1IGTA 1OT1A 3L3IA 4AZUA 5CCKH 2IALA 3HG1A 5FUCE 4WKZA 3LZNA 2WZPA 3OQ3B 3SQOL 2NT1A 2IJ0C 5T8IA 3CVCA 4X7EC 4YBHA 3AUVA 4G80B 4BE5A 4E41D 2GBVA 5MEOA 2ZWKA 3Q8EA 4OUOA 4Q6IC 4RMUA 1HZKA 4G70B 2X4NB 4JR9H 1KJMA 1INQA 4IS6A 2DQDH 4DEPC 2CIIA 3MMEA 3SKJH 4Z3JA 1WFOA 1HILA 1WEJL 1ZT7B 1XX9C 2AJ3A 5FYLL 1DP0A 1KCUH 1V7NL 2XFXB 2NLJA 5KZCB 4DPBX 3C5ZB 3C8HA 4X4XA 3NPZB 4XC1L 4Y1AA 5EN2B 1HE8A 2P4AB 4LLMA 4X4YA 5EUKA 4YX2H 4L4TB 3DTXA 4G7VL 4LLQB 3MRGA 4LP8A 3RWEA 3S96A 3ALWA 4N1CA 1C16A 2VN7A 3DSFH 2Y7MA 3T2OA 4LE8A 4JQIA 3AM8A 1SDDA 1D9KA 2XPYA 2NY5H 1JNNL 5HI5D 1P4IL 4LIQE 4ZPVB 4MX7A 1T0NA 2NY2C 4NRZA 3RE0A 2XZCH 4DTGH 2BSSB 2XNAA 1XGPA 4Z7WB 5IFAH 4LCVA 4OGAC 4Z76B 3KLHC 4OJAA 3KXFA 2OJZL 5DJZB 2IEPA 3FUHA 3V5HA 4CKVX 5I0XA 1XO8A 2QV2A 4ZQKA 1E0OB 1JD9A 5I9QB 3IJYA 4IJTA 4HK0A 5T1DL 1CYXA 5E8DH 1FJ1A 4GQQA 4GW5B 3K6SB 3ZE0E 1FF5A 4PV1C 2CO1A 1G9EA 3CSYA 3QUKB 1NCIA 1FGNL 3REVA 5I1CH 3LRSA 1H8NA 1PDKB 4YK4C 4U0RB 3AY4A 2XQYG 4JM2A 4G8GB 2CCLA 4FXKB 5E7BA 3RWFB 3FOLB 2HT3C 3IAQA 5KBKA 3EBIA 5LVEA 5C2BL 5AB2A 2J8UE 5FWQA 4FJYA 3MRQB 1ZSDA 4WO4D 5E03A 1X5MA 4P2OD 5IROD 4M6ML 4EI5B 2HLEB 2IPTH 5DJXA 1CLOL 5BV7B 3DRTA 4M4PA 5ADPL 4FQQA 5LGJB 1IX2A 1PKQB 2DDQH 3QEQD 3WIIL 3DO7A 4UU9A 3SDDB 2B1AH 4AUUA 4P4KB 1CG9B 3G5ZB 1FV1B 3U2IA 3O3AB 5K59E 5JW4M 4JGNA 3PABB 2X89D 3KD4A 3DVGA 3GTNA 4PWFA 4GAAA 2G3NA 1F6LL 1Y18B 5IT2H 3AQDA 1K5NA 4B50A 2G2RB 1GKOA 1MCQA 3L3OC 1USQA 1BMZA 3O3UN 5IVXA 1JUFA 4PW9A 5HI3C 4GAGL 5IQ9B 4G6KL 4PP2B 5HSFA 3EJQA 1KN2H 3FCSB 2DICA 3LH2H 4HZLB 4NZ8A 4R4BA 5BUPA 3NT0A 1NPNA 4JKPL 3DUSA 3B8SA 5DD1H 4BFOA 2VERA 1V27A 2VMEA 3RAJL 4L1LA 2EDTA 1BFOB 4CN6A 1UACL 2ZX7A 3B3IA 2G4GA 4B60A 2CRMA 4ENED 4L3CB 4M5TA 3OKEB 4CADA 5L9DH 2XTSA 4ZUVA 1R24B 3RX9A 3VTTA 3R0NA 1QFUH 2NYYD 1M2OA 2EAEA 2XRAL 3V4VB 1HSBB 4A2DA 5CGYD 3O45A 5B38B 4F8NA 2H41A 3IFNH 4ODSL 2AABL 2B15A 3DHPA 3IXAB 4MDJB 5MEQA 1AZZC 3IDYC 2C34A 3OLIA 2VC2B 1NM4A 2QGBA 4N24A 3SSGA 1A2YB 4ZFFB 1W0WA 3DK2A 2R1YA 5C6PB 4J4PA 2FQDA 1C5CH 4FHBD 4IHOB 4R3SB 1OGTA 3V4VL 2YPKA 4W4OA 4UQDA 1T4KB 1G5GA 1OSYA 3CZFA 4MMYA 3JSSA 3SKMB 4WEUD 3O11B 2FT8A 4BCYA 5GS1C 4OB5L 4KK6C 4I0CC 1Q9OB 3T6ZA 2AKRB 1URLA 3Q13A 1VEPA 1RMFH 2GI7A 4DOHB 7PCYA 1G0YR 1IARB 2MJWA 5D7LB 1G7PB 1KELH 1OF2A 4BH8A 1ZIBA 2ADGA 4FEMA 2JKNA 5F6IC 3AGWA 4JO1L 3EDEA 5BRQA 1K9TA 4ZOCA 2KYIA 3BGAA 5HYQB 5FB8A 4XRCA 1TQUA 2VT0A 1QSEE 4LEXL 2RH0A 3K3QA 4JUTA 2GTWA 5ICYB 4IIQA 4LSRH 3SOBH 2D03H 3RGVB 1JXJA 5CBAB 4TF4A 1PD0A 2CO3A 2WJ7A 4E41B 4ALAC 3GI8L 5DSCA 5I6XC 1DJXA 4QUOA 3HAEH 5DQDH 2PPAA 4MA1B 3BEWB 2AI0L 2X1OA 2FH6A 4QJ5B 5I5IA 2XVGA 1DFBH 2YGNA 4GOSA 1ZGLB 1FZOB 2ZXDA 3QCUL 4DGUA 3U6XS 3SE6A 2VDKB 3FTYA 3UJTH 4N2BA 2FAUA 2QSVA 2VLJE 3CFDB 3IGAB 4PGCB 4ZYKB 4Q2ZB 4WFHE 3VTMA 4F3FB 2APSA 4PVMA 3FFCA 5ERWA 3C75A 4DQOL 4JL2A 3P30L 4JRXD 2YMOA 5AVRB 5CBEB 4ECNA 5DZJA 4H44C 3MRNA 1M7IB 2OSYA 3BAEL 3AQXA 4GKLA 4XNUH 2VIRB 3HG0A 3PJNA 3W39B 5IB5B 2FHCA 3H4FA 1FZKB 2O5ZL 3OG4B 2Q7AA 4QRPE 1CD1A 1BECA 4YDLC 3VXSE 2BS71 2VDKL 3N43F 4JO3H 4XNYL 4PG2C 1S2EA 5IW1B 2VYRE 1U8PA 2N3JA 2O30A 1UASA 2H2SC 4PJBA 1CD9B 1JSYA 3FQ4A 2ATPA 5HHOE 4NCC1 4C83A 4FNLH 5ESQB 4EXPX 3PDGA 3PWLA 2BHFA 5MI0B 5EO1A 3X1EA 1QR1A 4MMZB 3VI4A 4XNAA 5ETUA 4X50A 5F0LB 2NY0D 3WI9A 2OBGA 1J1PL 2N1TE 4U1HA 3MBXH 4XCCL 2P28B 1VGKA 3FL7A 3DROB 4MNQE 1DBKH 2LFEA 2OFQA 5C3LD 4WO4B 1RUAL 3GZQA 4PJHE 4YHMH 3K6DA 4N0CD 4P2OB 1ZKAA 5AAMC 2UWEB 3HBPA 4HJGA 1IGIH 1MFNA 2YPVA 3FPXA 3H9SD 1E27A 3LD8B 2VM4A 4KQ0A 4IOIB 1NCWH 1KSRA 3P77B 3NCYS 2WINB 5D7EA 1DVFC 2OLDA 3PWVB 3QEQB 4UT7L 5AW3B 4YHOL 1YAIA 5E6RB 1BM3L 4WI7A 3VXQB 2R29A 4D0DB 4L48A 4PV9B 3CHXA 4NRYB 3TN0D 3F5WA 3T0AA 2W07B 2Z91A 5J6HB 1YO4A 4PJ5E 3VGDA 2TRYA 4JREC 2APFA 4YSDA 2KDYA 4JX0A 5ABZA 1A21A 1WBYB 2BCKA 4LO9A 3AVEA 5AVWB 4JDVA 5ITBH 3VG9B 2X6AA 3DX9B 4FQPA 4FAAB 4YSAA 3ZDWA 5EFIA 3VVWA 4EN2A 2MEJB 4I0KA 3QDGA 1BPLB 2GJPA 1QRND 3BXNB 3DGCR 5MEND 5AOLA 4GIOA 1JF6A 4WSJA 2AJYH 5D7KD 5GS0C 1PEZA 2FR4B 4CGTA 5BRPA 1NANH 5HJDA 3QPQD 2DIAA 2EH8H 3UACA 4LOEA 1SHXA 4FNPA 4MAYB 3Q06A 1FFRA 4NQEA 1HCFX 4IDJL 5TH2A 2YBGA 4PBVC 2VDNL 4P57B 1IU1A 3NEEA 1NMAH 2P8PB 5I15L 4W9GC 4FYQA 1KIUB 4NO0D 2HRPL 4LKCB 1GZHA 5I66B 1V8HA 3GSWA 3DA0A 3N40F 4PLNC 3D09A 3G5VB 4GEJA 1UM6L 4B53A 4B41A 1BZ7A 2BVEA 3UABA 1Z5YD 2MSPA 5DC9B 2O5YL 1M71B 2NNRA 5D5ME 3RVWC 3WMSA 1DN0B 4LVHC 3I6KB 1USZA 1G5AA 3SCMB 1XGRB 3W11C 3BUTA 2X4NA 2W60A 4TSBL 2KZKA 4RGMB 4X9BA 5FV2A 3FRPG 1PNDA 3WNOA 3D69B 2VMDA 4OCLC 3TWCL 1DQMH 3OJ2C 1QAWA 1JZ8A 4JCWA 1O6VA 2WO4A 3C5ZA 5EN2A 2FWLB 5K9QG 5GZOA 3Q1SH 4L4TA 3RX7A 3ZUNC 4AEHL 1BX2A 1UKTA 5BS0D 5DHXB 3TFKC 1WFTA 2PABA 2VL5B 3US1A 4AMWA 3FDWA 3NIDB 1L0XA 4ZPVA 4RZCB 2D2CC 4F58H 2DI8A 1A6WH 1F3RB 3MLSH 2BSSA 1IFHH 1NFDA 1YEFL 1UA7A 3FCUB 4ODTH 4Z7WA 4HAFA 3L13A 3TYGL 4Z76A 5JIMA 3QORC 5C0BE 2Y5EA 4GKSB 1XGYL 1BDYA 3B6SB 4PP1C 3BQUA 5DJZA 4F9PA 4ODBD 4Z7OE 4MRCA 3VD9A 1PS3A 2MFNA 3C2AL 3C09B 1SLXA 5CO1A 3QUXA 4ONFL 3U4EB 4GW5A 4E9VA 2YAFA 1FDLH 1QQDB 3A4DA 3GDCA 3QUKA 3NCYP 4OI7A 4MRBA 5D2NE 2WQ8A 3GXDA 2Z7UA 6FABL 3ZL4H 4G8GA 3TIDB 3RWFA 4XWGL 1HDMA 4ZMZA 5DUJA 4HGMA 4A7GF 3GBDA 3MRQA 3IK2A 5E51A 4PHZA 1UXMA 4ETYA 4EI5A 4HJ0D 4AT6B 5FEBA 4Q8BA 3VFMB 3QPXL 4JB9L 4OCMC 4AQOA 3VE0B 4AYSA 1LO0H 1R5WB 3UTPE 5LGJA 5SWSE 3MU3A 1UD2A 4UOW1 4JPWH 5I26A 4ANXA 3WNMA 3SDDA 1UJTA 5CHNB 4P4KA 1LDSA 1CG9A 4M56A 1FV1A 1SMAA 3O3AA 3QR2A 2NY0B 2WZ0A 5KANI 1CBVH 4FDWA 1NEUA 2I24N 1KV3A 1MWAA 2XPGA 3KZ8A 1KWKA 2VAAB 4NERA 1Y18A 1DEDA 2D3VA 1JDAA 2G2RA 2KT6A 4DJMA 1T2XA 5KVEH 5AALA 4PP2A 3E8UL 4KOCA 5T5FH 5TDNB 2WBXA 3ZE1B 4HZLA 4H40A 3H9SB 4DKDC 2E47A 1KN4H 2VDOL 5EZJB 4TNVK 3WKML 3L9BA 2YKLH 1BFOA 5I0YA 4BZYA 4QGYA 2IXQA 2CE6A 5E6ID 1ET7A 1AY1L 3LIUA 5DVPA 3LQAC 2GK0B 1R24A 4YPGA 3TN0B 4Y16C 4UCFA 5B38A 4ONHB 2V7NA 3EUUA 3TZVB 2V3EA 1ZHNB 3IXAA 4MDJA 1XZWA 4DK6A 3A4FA 2ZOKB 4ONOA 4ANKA 1MFMA 4OU3A 4ZFFA 3GRWA 5C1MB 4JE0A 4PB0H 2XWJB 2VO5A 3SGKA 1T7XA 4BZ2H 4AEEA 1QRNB 4IHOA 4R3SA 1C5BL 1DJIA 5KVFL 1ZRUA 2XFGB 5CJBA 4TULH 4P49A 4YUEH 1CXFA 1PSKL 3EOAB 3PFQA 3SKMA 3O11A 4IK7A 4GSUA 2XN9E 2F7PA 3OKMB 3ZE2B 2XVBA 1DE4B 2C3XA 1S6NA 1F4XL 3QHZH 2R4SH 5D7LA 3P69A 5DEFA 1LVEA 1UTDA 2NX5B 4PJ9D 1QHOA 3IMBA 1OGAE 2K78A 2R39A 1CTNA 4HIPA 3F6IA 4CC4C 3WFHB 3HAEB 3HFML 4GAJL 5DLLA 4NO0B 1VCAA 3F7KA 2ZG1A 2VLLB 3LN5B 5DRXB 4HIEB 5HYQA 2XETA 1PLGH 2E8YA 4WFFD 3Q3GB 5F1IB 4AX3A 4ZMQA 1Q0EA 1PX8A 5ICYA 3MAWA 5D7SH 1SOSA 4XVSH 5GZNC 2BIPA 3CFCL 3PRZA 3RGVA 3T0BA 1A3LH 5JZ7C 5CBAA 3O6FB 3KPSE 5IVOA 5L2KB 2E86A 2YPLA 1E3ZA 4FNUA 5D1ZC 1LE5A 1NGQL 4K2UL 3SDXB 2HKFH 3SPGA 5JA8B 3P3TA 4GJTB 5ECJE 1TNNA 3BEWA 4ODUB 5F6HI 2WNGA 1H8SA 1RK0B 1L6ZA 3VNZA 4NHCH 1OALA 4RDBA 4KGLA 5CN2A 1BJ1J 1VESA 3FU8A 2A6IB 3DI3B 3LH8A 3QZOA 1ZGLA 3ZBMA 4FKHA 4TL5A 3CFDA 4F3FA 3IGAA 4PGCA 3WNLA 2WZ5A 4Q2ZA 4ZYKA 1XH0A 2NY4D 2C3VB 3JWDH 2R1WB 5D7JB 5FDWB 3MXWH 5BS0B 2BJMH 1BYNA 1EO5A 1M7IA 3SOTA 2KMWA 2VIRA 3W39A 3BGFC 2HUHA 3IBEA 4JDEA 4Z7AA 5IB5A 4LL4A 5KBLA 1FZKA 4JN1L 4KRLB 2JKLA 1JOIA 2OI9B 4ZBJA 4X5WB 2DEYX 1RU9L 5IB4A 4H8VA 2E7CA 1MCLA 4KDTC 5IW1A 3WS6C 4K3EL 5T33L 3CLFH 3A24A 1ZJBA 1OM9A 3RDTC 3D4ZA 2XBTA 2ID5A 3FCGA 5KWYC 3KPPB 1K72A 4MMZA 4CUCA 1KY7A 1NCCL 5I30H 1EHAA 1THCA 3V4PH 2Y2WA 2QLVB 3ULUF 5LUMA 1EUTA 1PGRB 3G9VA 4PJ7F 3DROA 1SXNA 1RL1A 3QIWC 4LLVB 1YYCA 4R7LA 3BP4B 2HFTA 1DBKL 4FA7B 5KYUB 1A4CA 2FYYA 3LZOA 4WO4A 1WWBX 4X4MA 1WLHA 4P2OA 3T0WA 3UJIH 1ZV2A 2UWEA 4PWHA 2YLKA 4HFUH 3TV8A 1OP9A 3HZMB 5IJBC 5KBDA 3CSGA 3RIFK 4ZFQA 3WMQA 2JB5H 3MLRH 4DP6X 5K9JL 4IOIA 4QCIB 1HE7A 3P77A 2J5WA 2WINA 5JHDE 3PWVA 2UXTA 3QEQA 3RFRA 3S36L 3QGVA 3GBNL 3VXQA 4IU2B 4D0DA 4PV9A 1FZJB 1IKNA 4KKAD 4NRYA 3LVTA 1F00I 3TVMB 4GRWF 1HS6A 2W07A 4JO2H 5ALCH 3SQBB 2V2XA 2BNQD 1MAKA 2YQGA 2H0EA 1WBYA 3F85A 1FO0H 1BFVH 1B4LA 2VUOA 3BPLB 3NESA 5ITBL 3DX9A 1JPGB 1Q9LB 2J2ZB 3DRQB 4I0PA 3RUGE 3CH8A 3AWFA 2BNRB 4HGWB 3TPKA 5IV2B 3A0OA 1S7UB 1SQMA 4QNPE 5E6IB 3OPZH 4BZ1A 2FR4A 1DQDH 5E2WH 1EUUA 3U30B 2GC4C 2ZUTA 4XPGH 4CVXB 5JHLA 3JQOB 1KTBA 1A02N 2EH8L 3EO9L 5CN3A 3MRRB 2B7DT 1DJZA 4MAYA 4RX4A 3B9DA 3CSTA 1AJ7H 5IG7B 4KTYA 2X41A 4EOWL 4YXLH 2X4TB 3U6RB 1KIUA 5I66A 2IQ9L 4GG6B 1ZHLB 3VXRE 3W0WE 4UUJB 2DKSA 1H15B 1OAUH 2CBQA 3G5VA 1HQ4B 1TSHA 5EF0A 3UCRA 3MV8A 2XN2A 2Y24A 4YBQD 4Y2DD 3WJJC 3PPEA 4JRYA 1P9MA 3SYOA 1FHGA 4N5EC 5AL8A 3T0EC 5AVUB 2DBJA 1I9JL 1WAAF 1LL1A 1N64L 1UEYA 2WV3A 2X4QB 3D30A 3I6KA 3SCMA 4DW2H 4Q97A 3HRPA 3P3RA 2NUPB 3CJJA 4XNXL 1XD1A 3QIUC 4H8WL 4DKTA 1ZDQA 4EIUA 4OR1A 2GSMB 2KKQA 2XZAL 5EU6A 1XB3A 4JFFB 1UA6H 3T4AC 3FTUA 3KBPA 2BVOA 4KVCH 5CJQH 4DAGL 3GZKA 4N2GA 3HE7B 1AQMA 1ITCA 3OWEA 4S1RL 4Z78B 2BIOA 3Q1SL 3S37H 3PNWA 1FL6A 4PJIF 4ORZC 1WA2X 2VL5A 4MSWB 1NUFA 1N18A 3FUIA 4KZCA 4UOW0 3G6JB 5JYMA 1MPAH 2YXMA 2FATL 1DVXA 5B3NA 2WBKA 4N2FA 4Z95H 1CYWA 2E8ZA 3EFFB 3DARA 3FU6A 2FO4B 2EVFA 3DV6B 3WXWH 2Y23A 5D96C 4GKSA 2BSRB 4QHNB 4TV3A 5IMKB 2VLRD 3H42L 5MEPB 3EYQC 2NY4B 3H2QA 1OTSD 2FBRA 3MLYH 4I8DA 4N8VA 3ZL2A 4TKWA 5FHBL 3U4EA 4PQXA 3KDMB 2IOOA 1QQDA 3R7QA 1J0YA 1OAQL 3FUNA 4X8JB 1ZE3C 3UBGA 2X9WA 2GJ6B 2VQUA 3TIDA 3OKYA 2PMZA 4HETA 1NCHA 3LXCA 2ZP9A 4XMUA 3LMJH 3DVFA 5JXAL 1QI5A 4AGQA 1KB3A 1MHCB 2Q7NA 4P3WA 4AT6A 3FQRB 3KLAB 1E50A 2XT1B 3VE0A 1R5WA 1GXEA 4OTXH 2DD8L 5F7LB 5CHNA 4RBPH 1CLVA 4UAOB 4PJEE 5LBGA 1XCWA 3ABZA 5FCSH 1A1NB 2F6AA 3ARRA 3L1EA 5HDBB 2FIKB 2VAAA 1J8SA 4NSKB 3UJJH 4R5TA 1FG9C 2VN5A 3KEDA 1PCXA 1ZVYA 3MUGA 4RAUB 4YR6A 5EZIL 4D7BA 2RCSH 5KVEL 3WLWD 1RP9A 4K4KA 5CSBA 4LAQL 3BDXA 4MJ6A 3H9SA 2VR5A 2A9NL 3N42B 4LU5H 5LJYH 2OK0H 5G4OA 2OXGB 4OGYH 2CO6B 3OAZH 3MYJB 4Q56A 5C09E 5SX4I 4AENB 5C70A 1KB5H 1T5KA 3IXTB 5HP5A 1EK3A 3LB6C 4Z7QF 3AQYA 3F6JA 2GK0A 4PJGF 2X9XA 1XL4A 3TN0A 4D3CL 1YEEH 3ESOA 1TXKA 1UG9A 4WWPA 4ONHA 1IGMH 1OW0A 3TZVA 4YQXL 3MBEC 2BNQB 1EJOH 1ZHNA 2A4EA 5GJSH 3LDBC 2YA1A 4MCNA 2CBOA 5IB3B 2ZOKA 1PFCA 2FT6A 5EC1A 1IEAA 2XWJA 3BDYH 4KXBA 5B4MC 3VWKB 3SO3B 3N43B 4XVUC 1OTTD 4BZ2L 1XXDC 3FQYA 3K74B 1V10A 3SBWC 3CHQA 3U36B 2EUXA 4HJEA 2R1XA 3RILA 3WIHL 5F7EL 4TULL 4U2YA 4HDIB 4B97A 1CFQB 5KJRH 5PCYA 3HVDA 4JAMB 1XAUA 5MP6L 3OKMA 1MCOH 3HI6H 1PLAA 2J44A 3FQNB 1DE4A 4JN2B 4NKDA 2XOTA 2R0KH 4HS8L 3BD5A 4LSUH 1R0AL 3TT3H 3QYNA 1KLFB 1SY6H 3HMWL 2NX5A 2ZSWB 4PJCE 1KXHA 2I5YL 2M1KA 5ES4B 3HAEA 4NO0A 3W9EB 1SMOA 1WZMA 2VLLA 3LN5A 5FUOH 3ZSSA 4RRPA 1P84J 3Q3GA 5CN1A 5C0RH 1LWJA 3QDJE 2E7DA 2DM7A 4XVSL 4JFUA 4Y2DB 2P7TB 3O6FA 4JKLA 4R7DB 5L2KA 3AZUA 1QFWL 1AXSB 3SDXA 4Q9QH 1YN7A 3F05A 3KWVA 3MSPA 1ZK9A 2HKFL 3DMMD 4E9WA 4ODUA 3VI3E 5CEYB 2ZP8A 1MWOA 1O5DT 1RK0A 4WUUE 4HUMB 3OZKA 2ADYA 4RFOL 1TYRA 4ZUWA 1IBZA 3ES6A 3QFGA 1XH1A 2J25A 1IAKB 1OAXL 2HKHL 4U7KA 1DSYA 2UXVA 4HGKC 5H37H 1U3HC 3CNKA 1QSED 3UYPB 2P5PA 2R1WA 5D7JA 3ZDZE 1EJ6A 4LCYB 2PCFB 4N28A 4TSAL 5I5JA 5BS0A 2HJKB 1M9WA 2EDYA 4MJ5B 4FQJL 1NIBA 4P9HH 5CF3A 1A3QA 2ZXCA 3ZYIA 1CIUA 5C0CA 4PFEA 2FJUB 4I3SH 4JMXA 4MXQD 1U6AL 4LFHD 2HJLB 2MNJB 1IC4H 1GGYA 4KH9A 3DPDA 1L9TA 3V4PB 4OF7A 2NPLX 5DJCB 3DKHA 5I8CB 3QAZC 3D25B 5L6YL 4LAJH 2UZPA 2VLRB 3EOTL 2VLJD 3NJIA 4K3HA 5JW5A 1T0OA 1E5ZA 3VGEA 3KPPA 5KEZA 5CR1A 3MLPA 4I9XA 2AEQH 2WLNA 2EIDA 4RISL 2AQPA 1BBDL 4KK5D 5ENWB 1Y6KR 3BH4A 1RJYB 4QRPD 1INEL 3VXSD 3E0GA 2DQ6A 3K4DA 1YPZF 1V5JA 3BP4A 1FG2B 1FNSL 4YHYC 4H4NA 5KYUA 3KYOB 1MFEH 1RZJC 2WQSA 3IF1B 2OR9H 4KJQC 4CC0A 1G84A 5T3XE 3EJCA 5AKSA 4HFUL 5M7QA 2NZ1A 2WXMA 1QX1A 4U1JA 5I8OH 3FMGL 2VN6A 3MLRL 1VZIA 4HIJB 4B5EA 4LIQL 1FO0B 1G9MC 1WSST 3BLPX 3GKWH 4QXVA 1TZGH 5ACZB 5IHWA 3A23A 3DGDA 1H3VA 3TVMA 4XTRD 3SQBA 2VNCA 5EB9A 3UYRH 2JQMA 5FDYA 2J8UB 1D2OA 5HDOA 3V0FA 4BKTC 4QJ4B 1S9YA 1RZPA 1N4XH 1BFVL 4NLAA 2IMMA 1NA8A 2IGFL 4XZ4A 4HWBH 5D1QE 1Q9LA 5ICXB 1JDCA 3ZJAA 1TJGH 3DRQA 4KV5E 3U9PL 2PCXA 3NH7L 4AC2A 3QJFB 3ETSA 2BNRA 4HGWA 5IV2A 1WPCA 1X5HA 5C08A 3HZ3A 5E6IA 4I9WE 3FSAA 2VDRH 2WKOF 1DQDL 1EHLH 4PYHA 4X6CF 1JCKA 2XSKA 3ISRA 4CVXA 5AKRA 4C47A 3GK8H 6PAZA 4PJ5D 1RULH 2GABA 3GJEA 1SFDA 3CDCA 3HMXH 4IMKC 3D0VB 3S6CA 2NXZB 1EPFA 1ZVNA 4ODHL 2B2XL 2ZOUA 1KXQE 1Z3GH 4ZD3L 3IMVA 3NIFE 1HWGB 4HLZG 3H8NA 3IVKB 4N2HA 4NNPH 3U6RA 4QIRA 1UUSA 3JWNC 4P59L 4GG6A 4PRAB 2FJHB 5T5NF 1ZHLA 2ZAHA 1BYPA 3GYRA 4UUJA 1LWHA 4ZO6A 1JGDB 1H15A 3JUZA 5JUEH 1HQ4A 4HSCX 4Q6YA 5KBNC 1P7QD 2CJUL 2CHDA 3S3DB 2B5IC 4YSEA 4N2NA 1HL5A 2MCPH 3EBHA 2AXGA 3ZK0A 2X4QA 3ZMNA 2GVYA 4UYQA 1B4RA 2H26B 3M7OA 2WSKA 1QYGH 2NUPA 4DW2L 3QQ4B 5KVGE 2XZQL 3QZPA 5DO2D 3UTSA 2XA3A 4NN7C 1NPUA 2ITDB 4JFFA 1MCIA 3UBXB 1L9QA 3STLB 4ZAKC 2YO3A 1VZGA 4Y9FA 4EIGB 4B3EA 3HE7A 4BUQA 4TNWF 4Z78A 3CMOH 4N86A 2V0AA 2DJMA 3X1NA 1P1VA 5GS2H 4MSWA 2BP8A 4PJAF 3WIFB 5CZVH 1HFUA 1BQRA 2Q7YB 4PLJC 1W6LA 4DF9A 3EFFA 5EO9B 1WGVA 4H20L 4AQ1B 2FO4A 2YSSA 3DV6A 4NUMA 2LVCA 1BD2E 2FWUA 3IDXL 2AQRA 1HZHL 2BSRA 3B2VH 4QHNA 5IMKA 3FUKA 4FEIA 1UKQA 1IAIH 4D8PB 2EIMB 1QSEB 5CD3A 3NUKA 1NGXA 1V3LA 1UXLA 2KZWA 1E8XA 3MLYL 3DK0A 3BLBA 4TSCH 3UOAB 4J23A 3HBQA 3DTDA 1DQQB 3KDMA 1BQLH 1IRAY 1SMDA 3K6IA 1AHWB 2UYLB 4N4YB 3MV11 1MN4A 1RCYA 1H5BB 1OCZB 4ALAL 4X8JA 4YHNB 3BSHA 3RVVC 5FF6B 2GJ6A 5DI8A 2EH7L 4JFWA 1TR7A 5EOTB 3BWSA 1VERA 2EDWA 2G3MA 4B9GA 1JPSL 2ZXEB 2RA1A 1HHHB 1MHCA 3HE6C 4MLSA 4NJAH 1RH8A 4LHQB 3FQRA 4MB1A 1WFIA 2CA4A 4U1NB 4K3GA 1AE6L 4DK3A 1TU2B 2YMXL 1CDHA 4X9FA 2PR4H 1BMWA 2ITEA 3BCFA 5JHMA 1ZEAH 5T5FA 1NUNB 4L4VD 3O0RL 4HK3N 4P4RB 3VX0A 1FRGH 4OD2B 4N8VG 2A6DB 3BC9A 4FP8H 5F89A 5JIKA 3NOIA 2FIKA 5LG6A 1FCCA 1KB5B 3G04B 2YN5A 4NSKA 3L4XA 5F9WB 2KPNA 4AIEA 4B0MM 1PZAA 1T2JA 1A4KA 2ADJB 3RTLA 4E36A 2YD2A 5GGRY 4HKXB 1UWEH 4E0RA 5IJKC 3L81A 5HVFB 1F5WA 5EULV 1J87A 2IDUA 4R5XA 2HN7A 4PYGA 5HHVH 4MZIA 1U8QB 1T80A 1UOWA 3PGFH 3UTPD 2EDKA 2FNWA 3L9YA 2Q8AH 4C56B 5A3ID 2CO6A 4EDXB 3MYJA 2ERJC 3CSPA 2IAMA 2TSAA 3IXTA 1V3KA 2NTSP 5PAZA 1HJCA 5BQ7A 5B1CA 5IR1A 4PR5B 1A3RH 4NQDE 4GO8A 1OARH 4Q52A 4KX8A 3B2PA 3J8F7 1KCRH 1T83C 2EIZB 1JZJA 5LNGA 2IDSA 3H7BA 1DUZA 3FRUA 1N0LB 2AP2A 1CF8H 5IB3A 2Y4SA 2WOYA 2YEQA 2J57A 2OCJA 3G5WA 2CGRH 2BHZA 3DX7A 3RFZA 4FHJA 1MIEH 4I3RH 1XTLA 1RVFH 3MRFB 4N2KA 1ZLUK 2CMRL 3VWKA 1G7LB 1VADB 2VUKA 1A66A 1ASPA 5E2UL 1I8LC 1ROCA 3U36A 2X5PA 4HDIA 2AS5M 1CFQA 1SJHB 2W0PA 4JAMA 1HKLH 1A9BB 1W15A 2C4FT 3FQNA 4PJ5B 5DTFB 1KLGB 4OV5B 1F3JB 2F19L 3F7LA 5LCVL 4OZIE 5GS2D 5A1AA 3WCYA 4DP4X 2F53E 3MRMA 4LVNB 2L7JA 5TE4L 1KLFA 3QPKA 5ICUA 2YIHA 2ZSWA 1T3FB 4OGQC 5HHQB 3APDA 3C5JB 2WNWA 2VXTL 3IGFA 3W9EA 3PFUA 4C4KO 5L4MA 2CRYA 2X6BA 4RDQG 5G2NA 1P7QB 2DZEA 5K9KB 3QDMA 4A68A 4Y2DA 2ZUXA 1KTLB 2CUIA 2P7TA 4E9SA 2XN9D 4PRPB 4R7DA 1BREA 1YJDH 1X9RA 4HD5A 1E4XL 1AXSA 4WLCA 2F8XC 4WEBL 1NIAA 5E23A 3ZVVA 1TPXC 1V05A 4XP5H 4MYPA 1IEBB 5E2VH 4JKWA 5CEYA 2WANA 3PP4L 2ZYRA 1II4E 4JO5A 5BO1L 1OGAD 3QVAA 5EBGA 3MRJB 2WCSA 1SYVA 2RIKA 2P8LB 1IAKA 3JXAA 1YEGH 3CTTA 1IE4A 4DGVH 4MNGB 4DGYL 3UYPA 4GBXC 2LTQC 3ATDA 4JBSA 2PCFA 2ZNXA 4R0LC 2Y36H 4BINA 4U6HB 1CGYA 2K70A 2GG1A 5D5MB 2PUQT 3LXUX 4P9HL 1KGXA 1XH2A 3NTCL 4RRPG 1CWVA 4H2CA 8FABA 2F1BA 2GTZB 2ZPKL 4LCUB 4QRAA 1TZ8A 2HJLA 2CDGA 2NMSA 1D2PA 3TXAA 3RNKB 3V4PA 1N7MH 1I9IH 5DJCA 5I8CA 4XXWA 4FQ1H 4AYDC 3D07A 3D25A 4DN4H 2NY1B 1F4WH 3F7PC 2HG0A 3SO5A 2VLRA 4X7TB 1GJWA 4P5TC 4LSVL 1U92A 1FE8L 4Y5YB 5I1EH 2O26U 1GY1A 3WSQL 4WV1B 5DJDB 5GRWA 4KROB 4DKFL 3WEAA 5FAAA 2O93L 1DYZA 1CD0A 5IY5B 3IS0X 5I1JH 1KIRB 2R4RH 3EJZD 5ENWA 2HWZL 4N0YH 1ROWA 5F8QC 1I82A 3HNTH 3TNMB 5JPMC 2C8NA 3QRLA 1RJYA 5IHZB 4U7SA 3U2SA 1NWPA 1WF5A 3U1SH 4DVBB 1FG2A 4C4KT 4WVRA 5K39B 2RHEA 3KYOA 4PB9H 3IF1A 5GGQL 2EUZA 3VYOA 2XTJE 4Z7OB 3TJHC 2C3GA 2R23A 5DMYA 5AZUA 4HLJA 1S7XB 3TEUA 3VRJB 2A9AA 1FO0A 3NZHH 1I1FB 1QNIA 2GEQA 4NQVB 4L4VB 3R06B 1A47A 4M43L 1NSNL 4NLHA 3WGVB 2O72A 1WS8A 5D2NB 4P23D 2FUQA 1ASOA 4Z7NE 1CGXA 4ZMPA 4PJIB 1I9RL 1ETA1 4UT9A 2F7RA 2VDRB 1F45A 2VXVH 5G4NA 3ZO9A 3L1OH 1B9ZA 3EHBC 4XVJH 5EC2B 3PLYA 4TNWK 5I1IL 3GM0A 1A7NL 4XAWH 3HZVB 1ACYH 4LGSB 1KTJA 5ICXA 4Y9BA 5TE7H 1TCMA 1U8JB 4PRIA 4YH6A 5JHDD 2IWGA 4KTDH 3GNML 3NP4A 4PIBA 1P6FA 9CGTA 1EEZB 3DC0A 2ZUWA 5KVDE 2OTUB 4MMXC 1DBML 4R26L 1KBKA 1NFAA 1EHLL 4AEIL 2Q86B 3GSOB 4LPXA 5GRJH 1I3VA 3HHSB 5DZAA 2NSMA 3D0VA 4XPAH 5AYUH 4URKA 5CINH 4ZS6C 1KBGH 4BHUA 1DZ0A 1KXTA 3DVNB 4MDIB 5GRUL 5D71H 4ZJ9A 4LVEA 4RGOH 3VFSB 5DQ9B 2G0LA 3MZGB 2DB8A 1A6VL 2D9CA 4X42A 1BP3B 5E4AA 3IVKA 4WU7B 3DBXA 4A7GA 3AB0B 2FJHA 3TO2B 4PS3A 3X1BA 2HZHA 1JGDA 4GSDH 2KLTA 1L7IL 4NWTL 2ICEC 1CE1H 5HHMB 3LQAL 2EDRA 3WTYA 4G3YH 3ZW3A 3MJ7B 3BWUC 2VDQH 3MNMA 2YQ2A 4TXVB 4JPVL 2ED9A 4U1GB 4J3OF 2E7LC 1FC2D 3VX1A 3NYKA 2HA1A 3QCVH 3EH2A 3RWDB 3C60C 1OHZA 1ID5I 3DHJA 4WU5A 1F56A 2ITDA 3QHFH 4PJDF 1OM3H 3UBXA 2QVTA 3N1FC 3STLA 3HC4H 3DLQR 1XIWA 3VXRD 4W9CC 1GMEA 4E9YA 3UDWC 3N1MC 1R3HB 3KL3A 2YJQA 2GITB 2BVYA 3BYTA 3GHPA 1SHWA 3L4ZA 1GC1L 3ECVA 4QRRE 2XN9B 2DLHA 4G9FE 3WIFA 4W9KC 1CR9L 4OZGF 5J12B 5E8PB 2AXJA 1WBZB 2Q7YA 1J1OL 4Z7QB 2Z7WA 4NZUH 4ZS7H 5EO9A 2YGPA 1OT2A 3HUJE 4TPRH 1SYSB 4AQ1A 3COOA 1OGAB 3FHEA 4GRLC 2XKUA 4PGZA 2C9VA 1NOFA 2N59A 2B8OT 1J5OH 1ACXA 1KDIA 2DQHL 3KR3L 2XY1A 2DQTH 4LSSL 4D8PA 3DURB 2J1YA 1FAIH 2ZKMX 2AZUA 3ILQD 1MNNA 2PCPB 4GW4B 1LYQA 4XP1H 3OKOB 5T1MA 1DQQA 1VACB 2D4DA 2ZIDA 1AHWA 2UYLA 2EE9A 2QKIB 3FO0H 3N0PB 4YHNA 3T3PF 2YGOA 2YN3A 4QR7A 3SJVD 4DO4A 1URIA 2JKRM 1DLFH 5EOTA 1UZ6E 2DJ4A 2RALA 4D0BB 4Y8AA 1JBJA 4FLOA 3E1ZA 4FOMA 3FZUC 1CIDA 1ZLVH 4U1NA 2X1WL 2QLYA 4H5SB 1UZ8B 4TUOB 5IJVA 1AIFB 1YYLL 4GYBA 1RZ7H 3WEBA 3GD1C 2NW3B 4XX1G 3FN9A 1A6ZA 4FL4B 3SDCC 2WXOA 2YUZA 3OZLA 1ET8A 2WQUA 4LGPB 4P4RA 4FS0A 1YY8A 3FHQA 3P73B 4GNKB 5BQDA 1PMYA 1KB5A 5AVQB 2J71A 2H0PA 2LT9A 4P9MH 3V6OC 2O6FA 2UY7B 2EIBA 2OL3H 2ADJA 2X3AA 4HKXA 4KJWC 4KQ3H 1HNFA 2DJSA 3LPOA 4K55A 1RJZB 4Y4FA 4DZ8B 2OZ4H 5CJOL 3ML9A 2VM9A 1U8QA 2ZCHH 4C56A 4F8OA 1U8OB 5DZVA 4FMVA 4KRNA 4O58H 4EDXA 3PGDB 1ZY9A 2R56H 4DKEH 4K7PH 5I5MA 2VDMH 3WFDH 1RXLA 3O3BB 5I6OA 4PR5A 4APQC 1JPFB 3WNNA 4FHKA 4P23B 5C7XL 4JFOB 1NCUA 3I85A 5FCUH 3IRCA 4Y8DC 2EIZA 5EU7C 1EGJL 5L88H 3STZA 4WHYG 4J8RB 1CF8L 1QEXA 1CS6A 1TEFA 2AAVA 3MXVH 1N6QH 4JNXA 3ARTA 2F5BH 2ODIA 4PWGA 3MRFA 3EZ8A 3KPMB 4RGNE 4JFXA 3VXME 1G7LA 1HL8A 3QJTB 3H2WA 5JHDB 2GHWB 5C09D 3V9CA 1P0SE 4CRPA 1AO7E 4NUGH 1JNJA 5CKGA 4G2AA 4N90E 4FQXD 5I6MA 4AZ8B 3IKCB 4TN9A 3KLSA 4XCNB 1VHPA 2I9LA 3CLEL 1GJIA 1SJHA 1R33A 3V0DA 1FFNB 1KYUA 2Y6SC 4FFWD 2AJXL 5T3XH 2ATKB 2HJFB 1MEXH 1KWGA 5DTFA 1KLGA 4K5LA 1TTUA 4OV5A 3GSNH 1WYJA 1OCRB 2BFVL 4QOKA 4QRQB 1RZKL 5AAWA 3TH3T 1PY9A 2IBGA 1T3FA 5HHQA 4PJ7A 2IWEA 2X2JA 4WF7A 5DEJA 3VFRB 4BWUA 2NCMA 3EFDH 2WKLA 2WXNA 4UTAA 5EA0H 2HXAA 3SGJA 1H3WM 2LHAA 4FI7A 4OQTH 5AENA 5IGXH 3UTTA 5K9KA 1FVEB 2OULB 4JGMA 1KTLA 4DPAX 4MD4B 4PRPA 5HVHB 1KPUA 5H37A 1CCZA 2CDFB 3WLBB 3U82B 3TCLB 4QLRA 1XD0A 3B7YA 1IEBA 1A8ZA 2DQJH 4J3VA 4XR8C 1JYXA 4NKMB 5B1KA 4TUJB 1V7MH 3KGUA 4BM7A 3B9KB 1S3KL 3ARBC 5JR1H 1GGTA 4FXGC 4DVRH 4EN3A 5I1KH 4XCFL 2NY6D 3PL6C 5CJ5A 4YBLC 2OMUA 2YAEA 3VXRB 1BMGA 4MNGA 4BCZA 2A9DA 4DGVL 2X70B 4YEEA 4KMQA 3QDJD 3ZZ1A 3PHQB 4FZEH 1QP1A 3PV6A 3MC0A 1JF1B 4PU2A 5C0AE 2GTZA 4IM8A 4LCUA 2EIJB 3LRKA 1A8JH 1E5UI 3AWEA 4ADJA 4WUUD 4ZI8A 3UO1L 1FGVH 1AR2A 5AUMA 1CQKA 1RZ8B 2PPDA 4FQ1L 4FLRA 3N85H 1YECL 4H0HB 3E6FB 2VISB 4Y5YA 4HUCA 4WI0B 4WV1A 1UM4H 5DJDA 5C0ND 3MLVL 2QQKH 5HGGS 5KVGH 3HC3H 3P0GB 3FH5A 1HCYA 2IGLA 3EH1A 3TNMA 2OV0A 2R4RL 1MCEA 3DJRA 5H94B 2EUVA 3SJVB 4MXVF 5F1SA 4DVBA 4Q9RL 3ME0B 1MJ8L 1XSIA 4U1SA 3CBKB 2AMGA 4OV6F 1XAKA 5K39A 1WAAA 2ZT9C 1PU0A 2YXVA 4FTVE 2Z93A 3ZT7A 5KYWB 3EDJA 1T03L 5KSBF 1P5UC 1OKEA 3GUFA 2EDOA 4GMTL 4AI7A 4F9LA 3QEUA 1E2WA 2DLFL 3UXFA 1PD1A 1FL5B 3OAYH 1I1FA 4N2AA 1TQBB 2FL5B 4NQVA 4L4VA 4HWBA 3R06A 2N7SA 5LWYH 3S5YA 3E6HA 1KGCE 1MF2H 1SXAA 3BPOB 4LSTH 4OZHF 4AGLA 4PWIA 3ZPDA 2OMZA 4PJIA 2JE8A 3FH7A 4YSTA 4PJAB 4A2EA 2DJUA 4OLVL 4IJ3B 4OLUL 4KI5E 3ZKSD 4UTCA 2XWXA 2K7QA 1KC5H 5EC2A 1MCPL 4XVOA 5T3XD 2CK2A 2JJSC 3HZVA 3MV9E 1CLYL 4PD4K 4L3EE 2Q6WA 4IW4C 4B3VA 5TE7L 4U1MB 3AT9A 4I48B 3NJLA 1AGBA 1EA9C 2FIRT 4OJCA 2D3JA 3BD3A 1SJEB 1EEZA 2L7QA 3RTQD 2OTUA 3GXTA 2ENQA 4NT6A 43C9B 2HUEA 2ISDA 1Q9WB 3CU1A 3HHSA 4U31A 1PY0A 3C9NB 2EXYD 1T66C 1MRCL 4XPAL 5DWPA 2W9EH 3MRKB 4Y4HD 1XT5A 3DVNA 4MDIA 4YHLH 2BVTA 2B1HL 2OMYB 4J1UB 5DQ9A 3VFSA 1YG9A 3LNDA 5E6SB 5EDXA 2VDQB 4WU7A 2EYRB 4P2CG 2XACC 2XWRA 3TO2A 3SD5A 1E4WH 4FQXB 4LRNH 4AK1A 3H3PL 3BKMH 1KCBA 4M7LL 4OCWH 1BIHA 4NKIH 4OFYD 4HCRL 3X17A 1ZXKA 4NWUL 4FQHB 4X2UA 1GCFA 2VDQL 1FNGB 3SE9H 3WD5H 5E6UB 3NG5A 5J11B 1T20B 3RWDA 3RU8L 4IKKA 1G6VK 5DHYB 2IBZX 1QBLH 1XBRA 3OHXA 3E9UA 1R3HA 3P0YH 5FO7B 1D5IL 4FRWA 5JOPE 1QPKA 4H13C 4F37F 5A6LA 3CDYA 5H8DA 3WIAA 1ZLWH 4YDKH 2XN9A 1NANI 3QEGH 2J12B 5E8PA 1WBZA 4OVUA 1IQWH 1Z32X 2FGWH 3ZRSA 1KGYE 4S0TD 5LQBL 1W80A 1XTMA 4MA8L 1SYSA 4WUKL 2AQNA 2NRDA 3CBJB 4UNUA 3VB8A 3WDHA 2MRYA 2CJ3A 4KZEL 3H2PA 1MCJA 2VM3A 2NY6B 3KLQA 1J0ZA 4LPVA 5FO2A 3O2WH 4Z7VF 1F58H 2AERT 2NNCA 3BIKB 3DURA 1IQDB 4WWKD 4LCIL 4OH2A 3TFBA 1K2DB 3VWJA 3QDJB 3IMSA 2IDTA 1ZPUA 1R4XA 4GW4A 5DDHB 3UIZA 1LO2H 4N2LA 1VACA 4JE4B 4UINL 5H4ZA 1ZV5A 3PV7A 3V55A 1XCQB 3MRBB 4ZMXA 2YRBA 4BSWA 3EJUA 4GUCA 3GQFA 1KCSL 1NLBH 3TO4B 3FO0L 2YA2A 4PJHF 2WUCH 4YE4H 2QPFA 3WTSA 4Z3TA 2VITA 3WJLA 4D0BA 5I0DA 1XGZA 1BD2D 1UYWH 4ZFZB 3QQ9C 4MQXC 4YVNA 3QWOA 4PUBL 4H5SA 2GKIA 1J1XH 3TA3C 1UZ8A 5F7DB 4TUOA 1AIFA 1BQ5A 3R8QA 1IBFA 4H8HA 2OL3B 2NW3A 5E08H 2DOCA 1BZDA 1CFMA 1TT6A 4HEMA 2X4SB 3EBAA 1LO4L 3MCKB 5I1GH 5TPWL 5I73C 3NQKA 1QRKA 2JKWA 3J27A 4FLQA 5DMIH 3P73A 4NIKB 4HXAH 3TJEL 4HSQA 4GFXA 1TEGA 3GS0A 4Z18A 4QTIH 1OB1B 3INUL 3Q48A 3ALPA 2FK9A 2VDMB 1I85A 2APWA 2YAHA 4OW6A 5HGDA 4DETA 2OL3L 3SB3A 2YUWA 3CVIH 2WBJA 2P1YA 3UZVB 4DZ8A 5K69A 5D55A 1X4XA 4N87A 1U8OA 1JMXA 4KZDH 2XJKA 4F33A 1PEWA 3PGDA 4O58L 4U49A 4NN6C 1B3IA 4PCTA 4UQ3B 1AMYA 3D6GA 3G7TA 1IM9D 3D39D 2QHRH 5KW9L 2PLTA 4LHUD 3LZPA 4OIIL 4ES9A 4YDVB 1TZAA 4JFOA 4Z0BL 3T1FB 2F74B 3FT1A 3V0IA 1M6UA 3N5AA 4UILH 1X5IA 5DK0B 2OQJB 3CN2A 5TF0A 4J8RA 3ZGHA 1RZJL 3B2MA 3HG1E 3QUHA 3S4SG 4ACTA 4M5YH 2J5LB 2VJXA 3KPMA 3PXLA 1YC7A 3LRGA 4U3HA 2QSCL 3GSNB 1TQSA 4ZOAA 5KSAC 5KVFH 4ZFGL 3S8WA 5C3TA 2H3NB 4WI8A 1MCRA 5JW4N 2IH3B 4M1GL 1GGCH 3Q8CA 1ML0A 5DS8B 4AZ8A 3IKCA 4ZT1A 1E28A 4XCNA 4Y5XC 3RTQB 4CVUA 4CN4A 1FFNA 3H53A 5DT1L 4ELKB 2ATKA 1LEKB 3OPUA 1RUKH 1KB9J 1MEXL 4N68A 4R8WH 2MH4A 4Y1AE 4R4NC 5E1AA 4Y4HB 4GUQA 2DBLL 1R47A 3V4UH 2JQAA 4EZKA 1WZ1L 3VFRA 1YPZA 3NRQA 1AXTH 4TNEA 5GPRA 4YFLF 4HX1B 1T22A 2VXUL 4XO3A 3GC3A 1FVEA 3S35H 4QMEA 3HG4A 2PWFA 4JMNA 4MD5A 3KXFE 4QYOA 2WQRA 4DP1X 5I0WA 5AW4B 5B1JA 3WLBA 3VRLF 1D9KC 3TCLA 1KXVC 5FX3A 4YSQA 2YZ8A 4JFSA 2F53D 1X4ZA 1C08A 1AR1D 1JTOA 2PYFB 3GSXB 3K2KA 2G5BB 4NKMA 2QPSA 4BCXA 5IQ7H 4E68A 3VFTB 3IB4A 3D0AA 3B9KA 4WFED 4X6BB 1ZA3B 5KVDH 5JIQA 5C71A 3V0HA 3SKNB 2B59B 2P44B 4G82A 2X70A 3L2LA 2MQCA 3DO3A 3IETA 3PHQA 4QRFA 1QFWM 4QXGH 4R97B 4IRSA 4HUUB 1JF1A 4BV1A 2IO5A 5IJCC 2ENSA 1WWCA 4L9LB 2WKOA 4ADIA 1ZT1B 2NR6A 1KZQA 4X6CA 5H37G 2HX7A 2OR8A 3RBSA 4GLRH 1HKFA 1RZ8A 2CK0L 5KOMC 1BXAA 3B8YA 3E6FA 5FGRA 5HGAB 4WWKB 1NKGA 2VDPL 2R9HC 3HJEA 4O4YH 1RV6X 1L3WA 4IBYA 2HFGH 3QEHB 5IVXE 3QXAB 4WSKA 3SN6N 2HG5B 3KLHD 5GRXG 1ZDSA 3O6ML 4F1ZA 3P11L 1QFWI 3QUZB 4X9IA 5CILH 3CXDH 3SJVA 2G2PA 2P42B 3ARVA 4GKNA 1T6WA 1J5HA 4HUVB 1RY7B 1BD2B 1WP6A 4JANB 3GSQA 5KYWA 2GYSA 2WKGA 4JO8A 2XIIA 4DIXA 3PHAA 2M2DA 1GGBH 3ZTCC 4XO4A 2WWMC 4HJJH 1FL5A 1Q8MA 2HT3D 1OAYH 3PP3H 2FL5A 4PJDB 3PY9A 4A2GA 5B8CB 5B7MA 1AGEB 3IT8D 3P9MB 2HTLD 3VG0H 1VF5C 3LTVA 1MF2L 2QPEB 3JV6B 4S1QL 4XMKH 5ACMA 5D1XC 2Z1KA 1UM5H 4CGUB 1R9FA 4HAKA 3EFOA 1QBMH 4PJAA 3II2A 3P2BA 4TQEL 4DGWC 4XP9H 2WVTA 3L7FB 3KPQB 4NX0A 3D3VE 1F6AB 1CFTB 3I50H 2XTJD 4K94C 2E5EA 4PCYA 4F37K 3L9EA 3WENA 3BOVA 3JV5A 4XO5A 3GI9L 3MNZA 3FQXB 4I77H 4U1MA 3IWUA 4I48A 2XCMC 1EEQA 4ABUA 1J86A 4WK4B 3NZUA 2OX5B 3WHXA 3D39B 3ECBB 3M17B 1AS7A 4LHUB 1P4LB 3EGSB 43C9A 3N1GC 1MRDL 1Q9WA 2B0SH 1T5WA 3M1BB 5DFTA 1KMGA 2JQZA 1DTUA 1I7RA 4HMCA 1YC8A 1ZJAA 2FO8A 3WN5B 1XCTB 1R3KB 5D7HA 3IJSB 2OMYA 3F8UB 4K8RC 2EILB 4KKPA 2NDFA 4TTDC 4YHLL 5I6LA 5HDLA 1KBBA 3QNZB 2WLZA 5FM5M 2KL6A 5LAXB 4MHHI 1NMBL 1JRHH 4FFZL 1E4WL 2B9AA 4LRNL 4NUQA 1PBYA 1DBBL 3BKML 3FTXA 4PJ8A 4XBEL 3U46A 4NKIL 4NENB 3V9EA 3LHPL 3GPSA 1UH3A 4HUNB 3T9WA 1OPGH 3K6FA 2FB4H 3PPSA 4L8SC 1Q94A 1FNGA 1GW0A 3FFCE 4KXZI 4XGZA 4ZXBC 3WD5L 1NCBL 3QUMA 4M9OA 3WFCH 3OVUB 2FEEI 3L08A 1FH2A 2L4OA 1V3JA 3QDAA 4OCSH 5DHYA 5FYKU 2BIIA 1MIMH 1Q72H 4AW7A 2EDLA 5B39A 4KXDA 2QJDA 1QBLL 3UTOA 5AB9A 3VDAA 1N0XH 5FO7A 4F2FA 3QHTC 4AY0A 1QWNA 4MKTA 4X7SH 5J6SA 5DK2B 1CO1A 4JHUA 3VGAC 3JVGA 4PJBE 3FONB 4B27A 5GS0H 4OZIB 4G7SB 3BT0A 1FSKB 3CDZB 2F53B 2E7BA 3EAKA 3GHBL 3BP6A 3BZEA 1AR1B 3VI4E 2HPTA 2QELA 4JKMA 1QR4A 3X12A 1QLRB 3QYCA 4FLSA 1BZQK 2QQLH 3BIKA 1E65A 2W88A 3X13B 4HU2A 1K2DA 4OF0A 1FL3B 4O2CB 2BY3A 3ULVE 4DEPB 2YEZB 3S36X 5DDHA 4QRRD 3A67L 1AANA 4G9FD 4WFGE 1K8IB 3RI5K 2HLFC 4CBZA 1XGUB 3L4TA 3TO4A 1NLBL 2CAKA 1CICC 3ARED 2MQGA 4TVUA 3FUJA 1G0XA 2L7UA 4ZFZA 3VFOB 3FQTA 1IUZA 1Z9MA 3G3LA 5IMMB 1KJVA 4HC1H 1CB4A 2MCG1 5DURD 1CTOA 3IDJB 4AJ0A 3MLWH 4X7DC 4TOYH 3PWUB 4JPIB 3VU1A 5E00B 5AZEH 2JTDA 3D52A 1S7TB 4DP8X 2ITFA 4Z3HA 3QZBA 4KVNH 5HD8C 3BIAX 5E08L 2NY2B 3VMNA 3ZKNC 3MCKA 2IH9A 2OZ4A 2VJ8A 4NOBA 2EZ0C 5DD3H 3B5TA 3INOA 1SN2A 2ZCKL 1OB1A 3KPNB 1HX0A 3QDGE 3TBVB 4PG9B 4GUOA 5FYJL 2PXYD 5GHWL 5FYKE 3ZTDC 5EIVA 4JFZH 2X1QA 4ODVH 3UZVA 1LE9B 4KFZC 1QUPA 3CSFA 3KL5A 1AIZA 2GUYA 4FG6D 3KWUA 3U1PA 4POYA 4I89A 3ZMRA 2HX8A 1FVCB 1NGWA 4KJYB 1CL7L 4YK4B 4LARL 4NOFA 1FN4B 4AM0Q 1LMIA 4GMSH 4UQEA 5F7AA 2FX9L 2VLKE 4NQEE 4JLRB 4ZMLA 1MFAH 2YD6A 1TQVA 4PREB 5F21B 3FO9A 2I07A 4YDVA 3T1FA 2ENPA 2F74A 4GS7C 3DOIA 4KK9C 5DK0A 2OQJA 3X3FL 1DVFD 1VFMA 3LSOA 3RVTC 3ZN6A 3UCQA 4P3CH 1G43A 2AEIT 2BM3A 1H3PH 4G42B 4ZFOL 5AFAA 2XTJB 4G5ZH 1A0QH 4I4WB 2ZP0T 3LPWA 5LBSH 2NXYC 2B16A 2H3NA 1ETZB 2GW5A 1NIDA 2L8AA 2L7EA 2IH3A 4YFDB 3WKQA 4GKZB 4D9LH 1PZUB 1F86A 1HQRA 1YLBB 3LEVH 1DLHB 3RTQA 5F7MC 4AL8C 5IM7B 1IC7L 1XSKA 2XV3A 4OFKA 2ZX8A 2JMRA 4YE0A 1JGLH 4Z7NB 1LEKA 5ALBH 5ILTH 3WNKA 1BXVA 3V79C 1QSFD 1G7QA 4OQTA 4WI2A 1J0JA 2GFBB 3PHSA 4FQLH 4X8XA 1QLFB 4L4TE 1KV7A 1MFCL 1DJWA 5L4FA 1KFAH 1SOXA 3ARGA 5MERA 1YYMH 4P46A 2KI6A 5GS0D 4RGND 1PYWB 3MOAH 1U3YA 3VXTB 4M48L 1KCLA 1N8ZB 3OKLB 2FECL 3A3YB 1AO7D 1I9EA 3O2DH 2AJSH 1W72L 3EW3B 4N90D 2BRRL 4BK5C 2E27H 2WTOA 3N55A 4HX1A 4WHDA 4OSUH 4PWJA 3DVIA 5KSBB 1LDPH 2C9SA 1NFDE 3MNVB 2EIKB 1P7KB 4Z7WE 1NL0L 4OFYA 2NY3C 5DFVD 4BUGA 2DWTA 3LEYL 3SGDI 3UPRA 1H0DB 1N59A 2PYFA 3GSXA 2G5BA 4HT1L 4P5MB 1D7DA 3KYKH 3BSZH 3MRDB 1M7DA 3VFTA 5GQBA 4X6BA 1IBBA 4W93A 2P24B 4IKNA 2HTKC 5KVDL 1DEEB 2LAAA 1IKFH 1Q1JH 3FTSA 3RVWD 5GS1B 1D6EB 1TTFA 2B59A 3SKNA 4ERSH 1I75A 4G8GE 4X5LA 4NBZB 1NCDL 1E7UA 4UQ2B 4A7TA 2UY6B 3OSKA 3GMRB 2W80C 1UXSA 5JLZB 1CXEA 1TVHB 4EPSA 2ZG3A 5F6IB 3FF8A 4HUUA 1AS8A 1Z9NA 5GGTH 1FUNA 4ENZA 5DVOA 4L9LA 1OE1A 5DD0H 5D70H 1ZT1A 5FWRA 1YVLA 2RMNA 2DPKA 3IFPB 3UX9B 2DWSA 2MNWA 1FIGH 1WUNT 4F7MA 2V33A 4FXKC 3IDNB 1QVOB 2QFPA 1KYOJ 1RZQA 4PN6A 1NAKL 2XWTA 5HGAA 3L5XL 5BV7C 1MW3A 2XG5B 2OKMA 3KM2A 4QWWD 4JFDA 3GJFK 1XV8A 3ZTNL 4PBXA 2GPZA 5BJTB 3QEHA 1XXFC 4QRRB 3B5GA 3QXAA 1BZ8A 4TLSA 1QSZA 1T1WB 1YZZA 4G9FB 2Y22A 4HVBA 1GOHA 1E4XI 2WLLA 4PP1D 3QUZA 3MRLB 4J3TA 4BYHA 4EZJA 4BFKA 3EKCA 2XVLA 4F7KA 4HG4J 1CC3A 4LSQL 3HUJB 5I0VA 4DP5X 1KFGA 1KJ3H 3MRCB 3AAZB 1B0IA 3BPCA 4N20A 4HUVA 2AJUL 2EEBA 1RK1B 2VB5A 2E9WA 3UZEC 4O02H 5TQ2H 3CXFA 5DURB 6CGTA 4J39A 4JQVA 4X6DF 1GGBL 4YDLB 4PJDA 1BIIB 4J6RH 4NCDA 3OR7B 3Q6GH 2BP0B 4KU1A 1AGEA 4JK0D 3TIEA 3P9MA 1NJ9B 1SXBA 3JV6A 1G4RA 3VG0L 1JPTL 1KPVB 4UZUA 2WXRA 3NSCA 4HG4K 3C6EA 1YNLL 2Z8VC 3AU0A 3W5MA 5T5NG 2PXYB 1TQCB 3C6LD 3O6KH 4OZGA 4XPBL 2Z6FA 3L7FA 4DN3H 4U2ZA 1F6AA 1CFTA 1C1EH 4JG0H 4QEGA 4XCYB 3CFIC 3IYLW 4WNSA 2X05A 3VW3L 1DCEA 1AC0A 3FQXA 2VRQA 2ICWB 5AZ2L 3SGKC 3O8XD 4OCXL 4PJFF 5D7LE 4G6JL 4Z7VB 3DJ9A 3KLKA 2BP3A 4GSRA 1RZFH 2AITA 1KGCD 2Z31D 3D39A 3ECBA 3M17A 4RWYL 4OLWH 1P4LA 3EGSA 1IT9L 5CZKA 4TYUA 2DIJA 3FS9A 4ADGA 4UOZA 5FOBB 3OM3B 2H1PH 4N6QA 2YWYA 3UMTA 2JKSA 1DVFB 3WN5A 1XCTA 1R3KA 2QPUA 3CVHB 1X5YA 3MV9D 3NA4A 3QRGL 4L3ED 3M45A 1BBJB 3QNZA 2YPLE 1FZMA 2HSIA 3C5XA 1NC4D 5LAXA 3G6DL 3LV3B 2OYLA 4JREB 1CDIA 4XN1A 5F7BA 1P1ZA 3GLZA 1J8HE 4HUXB 2VXQL 5F9OL 3V8CA 4NENA 3ABLB 1GMIA 3MR9B 5C0GB 3IDMA 3V95A 1LP9F 1QSFB 2BIQA 2FB4L 3WUZA 1BGXH 3H9ZA 2CCWA 1QUNA 5I17B 3HLAB 4N0UB 4IU3B 4RGNB 2K8QA 1IB5A 5AVSB 2EDHA 3CPLB 5DYOB 1WV7T 2K9FB 4JL1A 3ZDZF 1BVOA 4KKQA 1LEGA 3IN0A 3SIKA 5FGCB 1T0MA 2XXGA 2O5XH 2ZYHA 4NC1E 3U7YL 4HPYL 4BDVB 1JXFA 3V7MA 3SE4C 5DK2A 3UAJA 4RAVB 4Z8FH 4OZIA 3QNFA 1A6UL 3DOSB 3HPLA 1YEHL 2F53A 3CDZA 5HI5C 2N7AA 2GY7B 3N9GL 3V0GA 1SZNA 1QTYT 1PF3A 4X4ZA 1QLRA 5JZ7D 4KXCA 3SGEH 1M7XA 4WRLA 1KYAA 4J7RA 1JWSA 1DO5A 3X13A 4EZMA