1P5UC

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
130
Chain Sequence
b'PARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein Caf1M
molecule tags Chaperone, structural protein
source organism Yersinia pestis
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
total genus 28
structure length 130
sequence length 134
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5uC00
1P5UB 4AYFB 4B0MB 1P5VB 1P5UC 3DPBB 3DOSB 3DSNB 4AZ8B 1Z9SB
chains in the Genus database with same CATH superfamily
5E2WH 1OZTG 1UQSB 4M4PA 5FAAA 4JANB 1BVLB 3KLAB 1QHOA 2AXGA 3BVVA 4LLVB 3P3RA 3T0BA 5PCYA 4UT7H 3EYUL 2X9XA 1VFOA 1FZOA 4KTGA 4IGBA 3WI9A 4CILA 4Y4HB 3MO1B 4YBLC 3RFZA 4JUTA 4UQDA 4ZTPH 3VXRA 1XHHA 3SE3A 3RWGA 1T21A 3G5YB 4J4PD 1K5NB 4FQQB 5IB4A 2W0FB 3H8NA 3G7TA 4GG8B 2QVIA 5AVZB 2UXTA 5T1LB 3UZVA 1RUML 4KNTA 2GJ6A 4JM2C 4NWUL 3ORJA 3B3IB 3DX4A 5KUMA 3BIKA 5E8OA 1JWUB 2ZUQB 1TNNA 3TCXA 3BGFC 3QFJD 1AFVL 5E4OA 3WFEL 4XAWL 3PQYA 4ABVA 3MOBH 4PJHE 3ZW3A 5PAZA 5DUBB 4HKBB 4L1TA 1S7RA 1S3KL 3MJ9L 4KKLD 4MLSA 4EQ2A 4GLRH 4P9HC 1LO0H 3N44B 4X5QA 1KBPA 3AY4A 5JNYA 4JDEB 3M1BB 3DX6A 5AEAA 43C9B 1UJ3B 4H88L 5D7LD 5DMKB 4Y4FC 2XX0A 4P5MA 4WENB 3REVB 3HR5B 3H3KA 4M7LL 3WAJA 3ARVA 4XTRD 4O9HH 1T3FA 3CK0L 3DOIA 1ZPLA 4N8VA 5FYJU 4GMTL 3U0PB 1J0ZA 1IKFH 3PJNA 5HYSA 1DJGA 2PYEB 1JV2B 2BP8A 4PBDA 2BNQA 3L54A 2ATKB 3ULAB 3G08A 2GJPA 3DX7B 4A55A 4GG6E 4Z3IA 4PRHA 4GEJA 4UF7C 1OAJA 1N70A 4ODHL 2H32B 3RYMA 2VIRB 5AW5B 4P04A 3T0EC 3M88A 4Q8BA 2JKJA 3MRJB 2NY1C 2Y22A 2WO2B 4NFCA 3C6EA 5ESAB 3LRGA 4UQ9A 1U58B 1WWBX 2Z91A 4GSDL 4APQC 5H94B 4BCYA 1V3LA 4HV8A 4N3UA 4R26H 5HHQA 1R3HB 3SJVA 5HHMD 2FIKB 1JK8A 2NZ1A 5DUPL 1JXJA 1HDMA 2V9UA 2ITEA 2ESVA 3BUBA 3PWLA 4YLCA 3KPQB 2Y69B 3ARGB 3ZE1B 2XWJB 3EDKA 4XMVA 1BQ5A 1RUAL 3GPEA 1G9EA 5B38A 3FUJA 2FL5A 1ZGLB 4OLVH 3X3FH 3GMQB 2HG0A 3KBEA 2YPLB 1GTFA 4B7IA 1B0RB 4EUPB 4DP0X 4MAYA 2XLLA 2O61A 1D7FA 1JG9A 1U0QA 3V4VB 4XNQA 4K4KA 4UIMB 2L04A 2VLRA 1O9VA 1A8JH 5T3XL 2EDFA 2CMRH 3H9YA 3EUDA 5EZLA 3CDZA 3CZNA 3L6FA 4V1DA 2DYPD 1NGZA 1ADQH 5F9AC 3SGEI 1QO3B 5I0ZA 4XP6L 1IAOB 5F7EL 3DUUA 4NAQA 5IUCA 4E41D 4YBLB 1KGWA 1TMCB 3MRQB 4M6MH 3HI6H 5JW4Q 2C5DC 3ILPA 2YLKA 3LKNB 4J3OD 1HEJC 1E6JH 2UZPA 1HH6B 4NJ9H 2JQAA 4FL4B 5JORA 3REWA 3F5WA 1G7IA 4IQHA 5IR1B 1MCCA 1D5ZA 5TGBA 4R97C 3M17A 3ZDYF 3PWNB 5JW4R 1QASA 4KPHH 5BV7L 5E4EC 5DMKA 2CK0L 4GW5A 4KKBD 3QR2A 1CT8B 2MNUA 2QQKH 4Y16C 1CL7H 3HLAB 1YMHB 2RFXB 1B0IA 1I85C 4Q9CA 2PP7A 1A7PL 1J9RA 2GT9B 1KV3A 1VEMA 5AOKA 5C7ZA 3UAFA 4JRYA 4TL4A 4ZPVA 2VAAB 3IMWA 3QDMA 5CJOL 1RK1B 4XODA 1H3WM 1MRDL 4OZFH 5F8RC 1HXKA 3OTTA 5DJYB 1SYSA 5CEZE 2CDGB 4LHUA 1HL5A 4HD5A 1JHTB 2V5RA 4OD2B 3UG3A 3LS5L 2EAEA 3QEUB 3FHAA 4Z7UE 4Z8FH 4OIIH 1NKRA 4KGLA 4TTGA 4F7TB 5D1XD 3VFSB 3F84A 4PP2B 3CH1B 2B9AA 2QHRL 1T2QH 4JQVC 3M7OA 3D18A 5DS8A 2CU9A 3QPKA 3FH5A 1HAUA 5LG1A 3GLEA 4KX8A 3QAQA 3LV3B 4FG0A 2H6UA 3RILA 4U6VL 4OKVA 3HG1A 5GRXG 1WFTA 5DYOB 2X87A 1LNUA 2NDGA 4FS0A 5C07A 5I6KA 3F58H 1B9KA 4TUJA 1UD5A 1WHOA 2JCCA 4NZJA 5LXVA 1CGUA 1NCBH 3DV4A 1I1FB 1MRDH 2Y7QA 3S37L 4QOKE 3GC3A 3CSPA 5EZIL 5B8CB 3NDYE 1NGXA 3ARGC 2VZOA 5D7JD 2IFFL 1X4XA 3BJ91 4FQ1L 3BZEA 4MRCA 1ACYH 2H6OA 3RVTC 3IFLH 4LBEA 3IYLW 3RDTC 1MVUA 3VXMD 3FHEA 1QTYT 4F92B 1HOCA 1T0PB 3BP6A 3KEDA 5DRNA 5C0GA 5LGYA 2ZCLH 2X6VA 4X6EB 3HBPA 1NDGA 1ZT7A 2V2XB 4AC2A 2DLEA 5FM5M 4PWGA 3MBEC 1TQSA 3GBNH 1CYWA 5D4IA 1UURA 3C6LB 5DR5H 4YXKL 3S5LB 1MHPH 2JE8A 1U8PA 4W9EC 3AG2B 1JGUH 3T8XB 1E28A 1A4AA 4HF5H 1OAQH 1HE7A 5C6PB 5JORB 3BAKA 2M2DA 5I6PA 3DMMA 3KHOA 2IAMC 2ADYA 2PCFB 4ODTH 4DQOH 4GQRA 2EDBA 3PHQB 3HC2A 3WNLA 4I1NB 4XVTH 1M9WA 3AROA 4PJ9A 3D3VD 4RGNB 4MJ5A 3G3LA 3JWNH 3PDDA 1S7UA 1Z2KA 3KYNA 4RMUA 2MCAA 3IDYB 1OTTC 4RX4A 1F97A 4N0FB 1BOGB 3SE4A 2E9IA 5FX3A 3EG9A 3QJZA 1UB5A 4LO9A 2P48B 2IAND 4ADGA 4O2FB 3JSSA 4HDIA 3PWPB 4JFFB 1N5AA 3KGSA 4KMQA 1G84A 1B2YA 3HG5A 5T5FA 2BSTA 1T7WA 3U4BH 3HRPA 4M6NH 2AMGA 4HBCL 3ARBC 3OB0K 2E8YA 3L5WB 4AIOA 2YQBA 3ZHDA 5DUPH 1QLEB 3BP7A 5E8DH 5C0BD 5HDBF 3EG9B 1NAML 3JWOC 1A7OH 3MRDB 1MIML 3IU3B 3TX4A 1WWAX 3RHWK 4FNUA 3SBWA 2WTPA 1UFGA 1KXQA 4JN1H 1YAZA 4GSDH 4LT7A 5EOCJ 2X3BA 2XKUA 4MDJA 3KAAA 5AQ0A 4U1HB 5IM7A 1QSEB 5B21A 1J1OL 4U4IA 3VD1A 2EUZA 2UYLA 3DKHA 4J27A 2JVUA 1FH2A 4KZDL 5FO8B 4JGNA 1N2RA 3QDMD 2AQ2A 4E41A 2ZKHH 1AGEB 5H2BB 4MQ7B 4DCQB 5KG9B 1WZAA 4MHHG 5I1JL 4YDJB 1CPUA 4NCC1 3T65B 3WN5B 2NY6B 4YXHH 1BF8A 3RIKA 3T0ED 3IRPX 4PG9A 1C08B 1GS7A 1MWAL 4LVNC 3PWJA 2E9JA 1KPRB 3QCUH 3OC5A 4UT6A 3LKQB 1WTGT 2E7LC 4LLQA 3NPZB 3KMDA 2JNZA 4HOWA 5B1CA 3VI4B 2WC7A 1A6AA 4ADIA 4B96A 3HZVB 3L48A 4I87A 4M48L 1WIOA 1T03L 3TVMA 2DB8A 4GRLB 2WSDA 3WUWB 5L4FA 3MFFB 1MH5B 2BFGA 5CZXD 1S3KH 4ZYKB 1AP2B 5LUMA 2NXYB 5GRJH 3VGDA 1OGAA 2DQIL 3MLSL 4MAYB 5KOVC 3ASWA 1II4E 4QRUA 2IEPA 4BFFA 5C8JB 3FSAA 4KTEH 4IKIA 3FTWA 2XWBA 4FYRA 3BSZA 2CMRL 3FU3A 1HZLA 1A3RL 3FQXB 5IF0B 2YUVA 3NPSC 4I0KA 3DJ9A 1PEWA 1A9BB 1XIWC 4PPTA 2H2PD 2P8MA 3MV9D 4QJ4B 5A7BA 1KCLA 3SKJH 2J5LC 3QXWA 4U33A 2GQHA 1LO4H 3AAZB 1E4KA 2Y2WA 5ESVB 3D4CA 1PD6A 3QS2A 4ZMYA 1U3HA 1XBRA 2WCGA 1LE5B 3QFJB 2CIKB 1XH3B 3EFOA 3K6DA 1BF2A 3ML9A 3B6SA 3DGDA 4H25B 5GGVL 3IMVA 1C5BL 5CSZA 3SOBL 3VH8A 1KJMB 4PJFA 3NBNA 5DFWH 3QDME 4FQHB 2XA8H 1RU9H 2QQQA 4O51B 4KZCA 3OKDA 3DX2A 3Q2VA 1A7NH 2ZSWB 4JGMA 5ERWB 5E08L 5DJAB 2ZAIA 3L1GA 3IPEA 3KZ8A 4GKOA 5INDB 3J7HA 3BH9B 2A6IB 3NP4A 1NMAH 3N42F 2CK2A 4X4XA 2EJ1A 4PGJA 5IFHL 2O30A 4F80A 3VH8B 4MXWL 4L37A 4TPRH 1FRGL 1LO3H 2PO6A 3U0TB 3O4OC 5LJYH 4OLYL 4YOKA 4WNQA 3K4DA 5ISZD 4A7GF 2BVUA 3EDEA 1WWWX 3NIFE 2F74A 5GQBA 1IBBA 1P7QA 4AIZA 1EV2E 5D72H 1U92A 3EOTL 3F7QA 5F7WC 4KOCA 1BECA 4PRHD 4X9HA 1WP6A 3GSWB 4AI7A 1UT2A 3IN2A 1YVLA 3RY5A 4ZUTA 1XCXA 5JLZA 5TK4A 4G8AC 2H47C 3CCHB 5IVXB 5EZLB 4DZBB 4A2DA 3GBMH 2QL1A 4HC1L 2I26N 5I1LB 1Q0YH 4HW6A 4NAMA 3VWKA 1JPFB 4RQQA 5IB4B 3G6AA 2ZYRA 4DPRA 2HUEA 1QHQA 2AJYL 3D05A 1AP2A 4QWWD 2E47A 4XN7A 2HA1A 1M7DB 2Y7QB 4IM8A 4XZUB 4AENA 5KVEE 4PLJD 5IROD 5JXEC 4EDWH 1LQBC 3WXWL 3I9GH 1RUMH 2YPVL 4U49A 3LOWA 4JCWA 1EZLA 4JHUA 4JO8A 2BVOA 1DE4B 5HVHB 1YQVH 4ETYA 1C12A 3U6RB 4IIZA 2J88L 1YEEH 3QWNA 1P84J 1JDDA 1PGRB 5SX4I 2FNWA 4Y1AA 1N6UA 4G9FA 3RGVA 2AQQA 3CHXA 4PYGA 1R5IB 4KO5A 3HCVA 5IUSA 1I9EA 4MXVE 2PWDA 4MA3B 1MI5B 2ZCKL 3EO9H 3SE8L 3WJMA 2GBTA 3HZKA 3CHRA 2C9PA 5TTRA 3G04B 2FJSA 4QOKD 5E5MA 1JPST 5CM1A 1JF1B 5DWUL 4ZS7H 4MWFB 1H3PH 1FAKT 3NIGE 2UVEA 2I9LA 3HUJF 4JPIA 3L95B 3UPRB 4XCCH 2MRYA 3TEYA 2PYEA 3QSKB 1AH1A 4FI8A 1T4KB 2FHFA 4HS8L 1I8KB 4X4MA 4YPJA 1EK3A 4PD4K 5GS0H 4ZRGA 5MENE 3GGWB 3QA3A 1KB3A 3O2WH 5EUOF 1BVLA 3KLAA 2IWGA 3N55A 5H37H 2ADFL 5J12C 1KJ3L 3HZYB 2Y25A 1DQTA 1MCPH 1Q94A 4MMYB 3NCYS 5JQIB 5EN2B 3ROLA 1CDJA 4G7VH 4JFQB 2IAMA 2XBTA 2WLIA 3IDUA 4JHAH 4Y4KC 1XTMA 4ZFQA 2QSCL 3WJJC 4KK8C 5JYLA 2HMID 2VMDA 2I32A 5IB5B 3HW7A 5C0JB 1JK8B 1T20B 2BWIA 2EO1A 2H9GB 1MJ7H 2X89A 3P9LA 3PLYA 4ZO9A 2OK0L 4FHBD 4NKQB 3TN0A 2G3XA 4J28A 1YPZE 1MCLA 4PRIE 4NJAH 4FYQA 3T6ZA 1AJ7H 4AEEA 2JWYA 5DQDL 2ZUTA 1PKQE 1XR8B 4ICWA 1EO8H 4NZRH 3JV6A 1KIRA 4M5YL 1FZKA 3JTTA 5E2VH 4HUCA 1QUPA 4MZIA 3C6LA 3S5LA 5I1EH 2GCYB 2VERA 1KGJA 1KBVA 1T3FB 5ECGA 3TOPA 3FN9A 3VXNA 1SLWA 1ESOA 3D2UA 3L3GB 4G7VL 1GXEA 1FAIL 1Z3RA 3O9WD 1DBJL 1FL3B 4Q0XL 4M1CD 5F6IB 4LLUA 5HGDB 2P47B 1E4XI 4XMTA 4NZUL 2XNAA 3RY4A 4YHOH 12E8L 1JXKA 4OI7A 4J2QA 4PB0H 3SPHA 3I6SA 5KJRL 4PCKA 3I6GB 4UILL 1BVKB 1OF2B 1T5XA 3BKCH 5ICUA 4C4BA 3WIIL 5HVHC 3QHZH 4UV7H 3WJMB 2CUAA 3MA7A 4AQEA 4E5XA 4P46B 2AABL 3KL0A 5JHLA 1QSEE 2GJ6B 4IEFB 2QPUA 4LB8A 4XCEB 1FV1B 2XNAB 1AO7A 3QQ4A 5AKVA 4X50A 1T04A 3ILDA 5I1DB 1NCJA 4OGYH 4KITB 4TS6A 3EJJX 3WE1A 2FJFB 4L4VE 1JF6A 2BPBA 4HPOL 4F24A 2Y23A 5GRZA 3KWTA 2KZBA 5L88L 3EDJA 4F7CA 1HHHA 5I75B 3H0TB 1CFTA 4MNQB 1B4JL 5KS9F 5JIDA 3AADB 1BVNP 3O8XB 4G11A 1NQBA 1Q0XH 4HZAA 4IMKA 3DTUB 3QDJE 1U8LA 3MLWL 2AJSH 2J8UB 4GLRI 4HA1A 4XX5A 3TTYA 5J6HA 2RD0A 5G55A 1DJHA 3PWPE 3QUYA 4GIPD 4TL5A 4CMMA 1TJHH 4FXKC 1DUYA 3W9EA 1SVBA 3MRNA 4AYGA 3MRKA 2PR4H 2YAHA 4Y19A 1HX0A 3GS7A 3B5GA 4E9SA 2OBGA 3BZFA 4Z3EA 4J3OG 4OZHB 2DQMA 1WD9A 2M26A 2WXFA 3LKOB 2VM4A 5DK0B 5CP3H 5DJ6B 2C3VA 5B1BB 4HZ1A 3OHXA 3GSXA 3MKKA 1I1AA 1JPSH 1OB1A 2XWRA 4NQED 4YSAA 4JVUA 3U7YH 1CC3A 1S6NA 3DX8A 3Q13A 4JMXA 4R4FH 4LDLB 3VWJD 1NC4A 2JLPA 3APFA 2ICWI 2DLHA 3SCMB 4ZG1A 3G6JE 4LQ1A 2AK4D 2R4SL 2W60B 3SYOA 4WFED 2W07A 2D0FA 3ISYA 2MQ0A 3QEGL 1KGCD 4EXKA 1JJUA 1ZA6B 5E9DD 4YLBA 3NCCB 4ETQB 1X5MA 1DQDH 1MWAA 4IIQA 1WBYA 1NCWL 1WCQA 2PF6A 3IAGC 1A0QL 1MG2C 4N4YB 1EFXA 1AQHA 2P8LB 4YHPB 2K70A 3VXSB 5KYXA 2GTWA 1UCBH 3U2JA 5T1JA 5E6IC 5EUOE 1M6UA 3B1UA 2UXFA 3IDIB 3QUZB 3NRPA 2YOCA 4DP2X 2SEBB 5D93C 2I9TB 3PGDA 2OP4L 3QC6X 4A7SA 2A77L 3BYTA 2OJEB 4JCMA 2R56H 2VDQL 3G5ZA 3PWVA 1PCSA 1D9KA 4TNGA 1NFIA 3C9NB 2OKMA 5HHME 3RVWD 3VM7A 4N1CA 5CJ5A 2FCBA 4S0TD 5CJQH 3ZE2B 4AYBA 2XQYA 2WO3B 3VRLF 1L0XA 1H5BC 4L0ZA 4DVBB 3SHSA 2XQYK 5HI4D 4UB0L 3FN0L 1CD1B 1RZIA 4G71B 1I31A 1TZGL 1T0NB 2D31B 2ODHA 4IHOA 4L9LA 5HGHB 1M05A 4GMSH 4QHUA 2I07A 2QPSA 4GS7B 1RZFL 1URZA 4TUKL 1BQKA 2EIDA 1G7LA 4QYOB 2RH0A 4S1SL 1CFNA 3LV3A 2UXGA 3GWJA 3L3OA 3QNZB 4QD2E 1AE6L 2Y1YA 4Y1AB 1E8ZA 2EILB 1RZKC 3GT6A 4HFUL 4KI5E 2EH8H 4YSSA 4HQQH 2BXYA 3HPLB 3SBWC 3STLA 5J3HC 4F7CB 2VLJD 1PDKB 1ICTA 4HUXB 5EIQA 3U79A 3TA3B 2C1OB 5DEFB 3BPLC 4X4XB 1UWEL 1WZKA 1MNUH 3TN0D 3ARFB 1T2XA 2BNQE 1G6RB 1IAKA 3QW9A 4ES8A 5K9OA 4M3JA 4MDJB 1MDAA 1U91B 1XF5B 2NY2C 2WLNA 2DEYX 3LRSA 4PY7A 5DC2A 3T2NL 1FQ9C 4HPYH 1QKZH 5D1ZI 1CE6A 2YRZA 3EFDH 4BUQA 4I5BA 4MSWA 2ICEC 4P4KC 3ES6A 1OGPA 1RK0A 1A6ZB 1HHJA 4YHZH 1N26A 4EN3C 4MNQD 5H37A 1NEPA 1P2CA 4NB7A 5A2JH 4PJIF 4QRTB 1A7RH 4H25A 1BD2A 2AEWA 3FUKA 4KKQA 4P5TD 3E2HB 4JFYB 2A5UA 3IS0X 5AAPA 2LU7A 2AEIT 4Q6YA 1BJ1H 3MACH 1QI3A 2PXYA 2F7OA 3KYKH 4XRCB 4NRZA 3VG0L 4ZMQA 1USQA 3QCTH 1FIEA 3H9SD 3D6GA 4WFGE 1CXLA 1ZVNA 3CVHA 1BMWA 1YEGL 5C08B 1VACB 2CLZB 3TBVA 1UCBL 3QCUL 3HFML 4EDXB 3MROB 4YHIA 4LOUD 3BUYB 3LRKA 3D87B 5A2IH 3H3PL 5DVOA 4GSRA 5E2TL 5DGRA 4C56A 3CDFA 2NY0D 3GYRA 2PO6B 3NN8A 5LNGA 4MXQD 1SMOA 4NO0B 2R69L 3NG5A 5EU6B 1VPOH 4ICXA 1AI1H 4XMKH 3ULVD 3MREB 4FFZL 1XR8A 5C8JA 2Z35B 4QO1A 3VXRB 2RHEA 4R7VA 4QRRA 1KGXA 3I9PA 3MYJB 3MJ8B 4I77H 1EEYB 2VN4A 4Z7NF 3CXDH 2LLLA 2O4EA 1P5UC 1MH5A 3RZCD 1X5XA 2PTVA 4JANA 4K8RH 5GZOD 1RMFH 3T71A 4K71C 3OKNB 4FXGA 3L9RA 2DAVA 3OBAA 3CU7A 1BZEA 4PWHA 3GSUB 1HXYB 3N2JA 4KI5F 2EE9A 1S7WA 3QJHB 3AQXA 4FJYA 1A1NB 3HZKB 3MBXH 3V52L 3S88H 5D1XB 1U3HB 4ZUSB 4QAWA 3ARYA 3R06A 5ICYA 1FYTB 4MNGA 3GZOA 1OZUA 1Q9WB 1MFNA 2AQ1A 3VB8A 4FNRA 2QKIC 5KYWA 4DEUA 5DJXA 3BSGA 3P40A 4XNXL 1TLMA 4TQHA 4G2AA 1OCWH 2X4QB 2CR0A 3DMMB 4PJXF 5FO8A 2QLYA 3LH8A 3O11B 3K7UA 4X8CA 3LEVL 4FQIH 3OF6D 4ZXBC 2XIDA 4WTZG 2IV9A 3KLHD 2VLKE 1I7RB 4O5LH 3QJFA 5EOQH 5MP6L 4PJDF 3U9PL 4E9VA 2OCCB 4DO6A 1ZDQA 1KJMA 3UZEA 1RJYA 4GAYA 4FQHA 2R0ZL 3BSZL 3FUDA 4QI3A 3SOTA 1LVEA 1FZMA 2Z8VC 4A37A 4TRPL 4K7PX 4LLQB 3CMOH 1M2VA 3DO3A 1XH2A 5FW8A 2AXHA 2VN5A 2D7MA 5SX4H 1G6RH 3PWPA 4FFWD 3WIIH 5L7XL 3BH8A 2VR6A 4ODUA 2ZOOA 4JJ5B 1QUNB 3KVDD 2J1YA 5KJRH 3X2QB 4P2QB 2G5RA 1WUZA 2E7CA 5G5DB 2PP9A 1BQSA 2VXQA 3CXFA 3PE9A 3U7AA 3HMXA 4RAVA 3K8LA 3DVNB 3O3AA 5FYLL 1D7CA 4I0PA 4Y8DC 5E6IA 3PU7A 1KCRL 2C3HA 2VH5L 3IFLL 3LXUX 4BZ1L 4UDTA 3L3JA 2F54B 3B2UC 2DQEH 4GKSA 3NABH 2AQ3A 2MFNA 1KGYE 1AHMA 3FRPG 4PW3A 5EZIH 3DOSB 4XMUA 1QSEA 2EIBA 3RWHA 5HDBE 4UYQA 3HHSA 4AQZA 2W0FA 4OT1H 3BAYA 1F4HA 1IM3A 5T1MA 3DYPA 1QSFD 3KCPB 4MAYD 4WQOA 1T6VN 4KAQH 2VR3A 3UYRL 3I50L 2ED6A 3DC0A 3T6WA 4XBPA 4G8EB 1NDGB 1XBDA 1ZT7B 5JUEL 4MKTA 1E65A 1UJTA 2B8OT 2GBVA 2CM5A 2PO6C 4LPVA 4YHLH 5FKAA 1KN4H 1ODUA 5JW5B 5B38G 1EFXB 1I85A 2PUQT 2WP3T 3OKLA 4P2RA 4PJDE 4RMTA 3WFZA 4IBLT 3DXAD 2WWKT 5D1ZA 3RPKA 3WJLA 3I6LE 4IRSB 2QSCH 3ULVH 3TIEA 2CIIB 5DC0A 3CHPA 1VA9A 5EBMB 4W6XB 2L7QA 1MFDH 1P5UB 4TN9A 4HZLA 3DIVA 5KVMC 1D5RA 5C0CA 2R7EA 5JUEH 5I0DA 3TZVB 2AK4B 1NA8A 1JN6A 3HOGA 5JHLH 3H2PA 4FD0A 4OF5A 1F45A 3FSOA 3MRQA 2V0AA 2CALA 3MNDA 4JO3H 4X9BA 4JRFA 3L16A 4HG4K 1U3HC 1DQLL 3FPXA 1Z32X 4HK0A 4K73A 3WENA 4AVJA 4GRMA 4Z9KB 4XMZA 4EBQL 4LF3A 3HE6C 4WJ5B 4UOZA 1PY4A 4MNHB 2ZXAA 5EIIA 1OSEA 1HWGB 2EIJB 1ZVSA 5CJBA 4XBGA 1CZ8L 3BP7B 4OF6A 2MEJB 3RB7A 2VLKA 3ZGHA 5D7JA 5JW3H 2FB4H 4KK5C 4X80L 2IADA 3NEXA 4KTDH 3NACL 4PLJC 4EKJA 4P8QA 3EO9L 2AZUA 4M8VA 4UQAA 1E43A 2VDML 1U3YA 1YDPB 2HRGA 1JGIA 4HCRL 3S97C 2PCXA 1J9SA 5G4OA 1E8YA 2Z92B 1HDMB 2PW2B 3DI3B 5HHVH 1E27B 1FDLL 3D39D 1JHTA 4DEPB 3O2VH 5F9JB 1WSST 2RTTA 3CMOL 3M86A 2CJSA 3MHZA 4ODXA 2NQCA 2D3JA 2W94A 5E99H 3VD2A 2BHUA 4TVUA 3QIBA 3AU1B 3WD5L 4IBVA 1AGEA 3ESUF 2MKLC 4NKIH 2OW6A 2TSAA 1CGSL 4V33A 2BY1A 2IG2H 5D7IB 3TS8A 5KTEH 1MI5E 4LSUL 1XEDA 1OPOA 3MRBB 3O4LA 4KVNL 2WVVA 3FB6A 5SWZA 4JFYA 1FFNB 1WHPA 4JPVL 1P1ZB 3T1FA 5CJXA 2ROYA 1BIIA 3ZQ9A 4BHUI 1XGTA 2J2ZB 3VFMB 2E46A 3HHMA 2CGRL 1UXWB 1YY9D 3HZ3A 3NIFF 1JK9A 2YXWA 4D0DB 3QORC 4L8SA 3BPNC 2W95A 2XZAL 4Z7VA 3V0GA 3MUZ1 4C56E 5FKAB 2VE6A 2WNXA 3NJHA 2RJMA 3JBG7 4LOEA 3MBXL 5B8CA 2GFBA 4CDGC 1HT6A 4Q56A 1ZHLA 2Y5TB 4FYTA 5DHYB 3RY6C 5IB3B 1KELH 1IRAY 5IGXH 4J3XA 5SX5K 1ZLUK 3NFNB 3TYFB 3PFQA 4PEEA 3PYCA 4WK2B 1M2OA 1G9MC 3BVNB 3HIZA 3QZOA 1RK1A 3MREA 1SN5A 4GRWF 1M53A 5KSBA 4G6ML 1ZGLA 3HPJA 1Z6JT 2PCPB 3C6LC 4P2AA 1AGCA 1KJ2B 3AB0B 4HCFA 2IFGA 2J1WA 2VNCA 4D9QE 3FT3B 1RSFA 4YFEA 2WXOA 4M62L 1WH0A 2NX5D 3LQZB 5DHVH 4G6JH 5E2TH 3F3HA 3UC0L 2BW5A 1BWMA 2P1YA 3OAYH 2X9YA 2NYKA 3HFMH 2B59A 1IBZA 1PNCA 2NZIA 4G5ZH 5BVJA 5GHWL 3ILEA 3OSKA 3CN3A 4XB3A 1EERB 1AXTL 4N0UE 4P5SA 2GIXA 5CLYA 4RBPK 2N56A 3RJOA 5K9QG 1ZEAL 4MDRA 3FZUC 1A6ZA 2CKBB 2O5ZH 1GKEA 1Q1PA 1NH6A 1A7RL 1QBLL 1UB5B 4JG0L 4MJ4A 5IHUH 4ZFOL 4Y19E 1RZJH 3KS0J 2IDQA 2NY5C 4HH8A 5CZXC 4YHNB 1TJGL 2XVBA 3GM8A 4LZKA 2ZXEB 3MBEA 4ZAKA 1KGCE 3T4AA 1BVNT 4OFYA 1YEWA 3V6ZB 4DP8X 4IKLA 3BLBA 4E9RA 2AV1A 2R1YA 3WGUB 4G9FE 4KZEL 1A6TA 1XGUB 3CZGA 1V05A 5I1GH 3MRMA 4FTVB 4ORZC 4Q52A 4DO5A 4KTEL 3FQ4A 4NQEE 5LGKA 3LQMA 4U6XB 3EW3B 1RKRA 2BERA 4JX0A 3X12A 2EUXA 4NC1C 3ARRA 3F7RA 4DKEH 4OSUH 5HSFA 1ASQA 5FO7A 4JJOA 1IILE 2EH8L 1MIEH 1X5AA 3GIVB 4HFUH 4AQAA 1T03H 2E75C 3L7FB 4XO5A 4AMKH 5FOBA 2YUXA 4P5TB 1IC7H 1YN6B 4UDTB 1UA7A 4H8WL 5CILH 4AQEB 3A6CL 4KVCH 5JHDA 4HCGA 1E7UA 1HHGA 1KB5B 1FJ1A 1BFVL 1NGQH 4JG9A 5JXAL 3MRGB 2VXTH 4KH2A 4FRWA 1MWAH 5JIHA 4GKLA 1HAWA 1VSCA 1CLZL 2FATL 1Q72L 2D03H 5IB3A 1HIML 4QLRA 2QMJA 4LCWE 2FAUA 1TCRB 2P5EA 5D71H 2VLRB 3CWGA 3MRFA 4Y2LA 2YD3A 1JYNA 3BUTA 4DSYA 1J8SA 4J8QA 5FWQA 4LFHD 3W2DH 5LCVH 1A7QH 3QUZA 4OCMC 5GZNA 3ZJAA 5DXWA 4YIQB 5DTFA 2VDQH 2Q86A 1CIDA 2R56L 2XZCL 4P4KD 3P1VA 4DH2A 2ATPA 4TSAH 1ZHBB 4JO1H 2BK8A 2YD6A 4ZTEA 1W9XA 3ZDZB 1CTOA 3CFTA 3L3OB 4P3CH 4XN9A 4OV6F 1SHSA 4UIKL 1NUFA 3HS0B 3RX7A 2LU5A 4PHZA 3U30B 4X7TB 5D7HA 1XL6A 1MIMH 5IWLC 1G7IB 4QGYA 8CGTA 2QT6A 1E5UI 1S7RB 3CSGA 1JUFA 4N2CA 3OV6A 4YAQB 1CT8A 5F3HB 2NR6D 2HZHA 4EF3A 4BHUA 5GGTL 2XV3A 1AYRA 3GMRA 5TFSL 3K71B 2XIIA 4KJQC 4FKKA 5SWZD 1R3KB 1GPOL 1EMTH 5FYKL 2DJMA 2CBTA 3EFFB 2X09A 5HYSB 1U2CA 1EGJL 1F3JA 1PU0A 2QV4A 4MA8H 3SKOB 2ATKA 4BELD 5IMLB 3HZYA 3PAUA 5B7EA 3H42H 2IQAB 2X7LB 5DJXB 5KSAA 4KKRA 4YPGA 1GGUA 1NBYB 2FBJH 2JKLA 3VD7A 2DIBA 4ORGB 3MX0B 3RBSA 3A6OA 2VQ4A 3T3MF 4BA0A 1PJ9A 1V27A 1AANA 1AC0A 1IGMH 3MNZA 3QARA 1MQ8A 3CG8A 4Z3GA 4HXBL 2ALAA 4OTXH 1HSBA 2R69A 4WSKA 4J8RB 5D7KD 3DYOA 4OF8A 1WGVA 4X7DC 1A9EA 3GBNL 3SYPA 3TPUB 4NRYB 1G1CA 3Q6GH 2IDCA 3WS3A 5LGHL 3D06A 4RNRA 3MGAA 3TYGH 4GKZA 3TBSB 1MFAH 5GGSA 1XB6A 1IGJA 3D30A 5CU9A 3X1BA 4NUJA 4WY7H 1G7QB 1ACYL 5AOMA 5JPMC 5DQJB 3LEXB 4FNQA 1F3DJ 1MFCL 4R4NC 4Z7QE 4IGBB 1L0YA 2GJ6D 3E0GA 1NSNL 2GTZB 4XPBH 1HQRB 4OFYD 3T6XA 5IJDC 3OAZH 4DGVL 3Q6GL 4P06A 3BEVA 4QHMB 5LGHH 3C5SB 3BVDB 2CKBH 1S7XB 1HNYA 4K3GA 1UXSA 4NGHH 5LCVA 4BKTC 2HX8A 4L4TE 2ZJSH 4N9GB 3ESPA 4XI5D 1M7XA 1OEZW 1S7VB 3O41B 3ZRCC 1NIDA 2OXHA 5ESQA 4QNPF 2DQCH 4JKNA 2Q7YA 3D2TA 2DQJH 1IGML 3E3QE 4LCIL 5F72S 5C0AB 4IIQB 1QEXA 2CLVB 3DV6A 3W3BA 5B22A 4LHJB 5TE7L 3UBXI 4PRNB 5C08E 4PG9B 2BIIA 1U91A 5CLTA 1M7DA 2K4AA 3HG1E 3S34H 4XPFH 4MCYB 2YA0A 3RWHB 1MJ8L 1OAXL 3P77A 3QHFH 4PGEB 4ZUWA 2E6QA 4LEOB 4WTXA 4A2MA 3MLXL 3DUSA 3ZHLA 1IV8A 1RCYA 3RURA 4MA3A 1ET7A 2B1HL 4QTIH 1NCOA 4IU3B 1W0VB 4N22A 2Z7UA 4Y4FA 1RLBA 3LB6D 5FA3A 3VAEA 3EDDA 4PGBB 4RZKA 1KYDA 2YPKB 3BP5B 3G6DL 3C5ZC 4KZ0A 4UDUB 2OYMA 1S9VA 3KDMA 1RI8A 3TT1H 5BVPL 5MERB 3FSWA 4G8GA 2W88A 4XCNA 3S96B 3UX9B 3D12B 5DT1L 2AP2A 1TZOA 3SGDH 1ZE3H 2VN6A 4H20L 2C9XA 1QA9B 4MZ2A 3ECUA 2HG5A 2WUCL 3K2UH 3ERXA 2ZP8A 2Z65C 3B9DA 4S1DD 4GSQA 4Y8AA 3RX9A 1FLRH 1ZA3B 1HI6A 1MCPL 1RERA 2N1KA 1MRFL 1MW2A 4AKQA 3SDCC 2P24B 2HTKC 2H2SD 2WLYA 1E6JL 1XQ4A 3T2OA 4WI8A 2X12A 4RQQB 2V17L 4OKDA 5EZOH 3CCHA 5BUAA 35C8L 4YFLI 4PRAB 2F5AH 1ETZB 4NQUA 2YGPA 3DHPA 3PJLA 3SY6A 4XCCL 3VFRB 1NWOA 5F93C 5LAPA 2KT6A 3CN1A 2JV6A 2HN7A 3RDTA 1DJXA 4YBQC 5JXAH 1JFHA 1OPGL 1LO2H 4ZS7L 3TNMB 5IFAH 4KXAA 2DTML 5KVGE 1OTTD 3ILQD 4ZODA 1Y1DA 5HHMB 2VRAA 2CCLA 3CVHH 2FR4A 1ANUA 4L37B 3D5OF 3MSPA 3ZSTA 3OKOA 5A1AA 2QADC 3AXHA 2CHXA 3UG4A 5JHDE 5FYLE 3W11C 4JR9L 1DZBA 3P0VH 2WGXA 1OF0A 3RPBA 2XV2A 3FRPA 1A14H 2K6YA 4CUCA 2FYYA 4AW7A 2H26B 5D5MB 4HJUA 3II3A 4DTGH 5DI8B 4NPJA 1J0IA 4JFEB 4HUWA 5C0BA 4RH4A 1JTOA 1E5BA 1P53A 4OLXL 4KQ3L 3IJSB 2A4EA 3V0WL 1JZGA 1CF1A 1LQSR 2D73A 3NOIA 5EU7E 3H1ZA 4M56A 1BJ1J 3WE6B 4S1QH 5HYSG 3EFOB 1G94A 5E23A 3AABA 1Q0YL 1F6LL 1QACA 1H15B 3RJDA 5AZEL 4OR1A 3EYOA 5TDPB 4CKVX 2E27L 4WO4C 1DSFL 4Z7WA 4A2GA 1KXVC 2R4RL 3QXDB 2W38A 2AXJA 2E8ZA 3V4LA 1IU1A 1YAIA 3T09A 1GGBL 4P99A 3WKYA 1EAPA 2WZ5A 3VSQA 3MA7B 1RZ7H 3II1A 1MJJA 3ZDXB 1R34A 3GUTB 3BD5A 2LV4A 5L8JB 4CGUB 4PYHA 3UIZA 3TFKC 3QXAA 3ARDB 2CXKA 5K33A 4MNQE 4WTWA 1NM9A 4N2HA 3VI4F 1TITA 4H88H 5F3BA 2RALA 4FGMA 1MEXL 2PO6D 4XR8C 5AZEH 3AU0A 2ZD0A 1HNFA 3DO7A 1IGIL 3SKMB 3D85D 4MXWH 3B2VH 2KERA 3P54A 3O8XC 2NY7H 2NR6C 2P46B 4LRNL 4FQCL 3QDGE 4GT0A 2V7HB 5ADPL 2DKUA 3RBGA 2YGQA 2DBJA 3PQYE 2OL3H 2VDRH 4XRCA 1IGFH 2HFFB 2O5YL 4GW5B 4OM1L 4PUBH 5DO2D 3S36X 3N5AA 3D2UD 5IMOB 4M00A 1PSKH 2VN3A 3CTTA 3TNMA 4GBXC 1P7QB 2Z93A 4YGVB 4TUOA 1VCAA 4K3EL 5ITBL 4K3JL 1J5OH 2I24N 4ZTPL 2EVGA 4HWBH 3CFEB 1BPLB 3X3GL 1MY5A 1R3JB 2E4TA 3R8QA 3LHPH 3UADA 5HY9B 1EZSA 4JFHD 3GBLA 1GJIA 4XCYA 1PZ5B 5F44A 3VXQA 2DYPA 1MLBA 3LPWA 4UTBL 4L4TB 5L0QC 2VABA 2VERN 2K0RA 1RIVL 25C8H 2BZ7A 4ALAH 4UAOC 3ZYOA 1IGCL 2ARJQ 2FE0A 5HDLA 1G7QA 3M7FB 1I1YA 3AGWA 4ISVB 5DZAA 4AIXA 4LLVA 5IESH 5KSUB 4D2NA 5BRZD 4YHPA 3HZMA 1X9QA 3CBRA 3MLSH 1OP3H 2IADB 4HSAC 3DECA 3KLHC 1L3NA 1IGYA 1EHKB 4RAUA 4UU9A 2XACC 1AGBB 1CFBA 5HYEA 4AQ1B 2IIJA 3C5XA 5MEOB 3IAPA 2GSIB 1Q4NX 2YBRB 1NGWA 1I9IH 3WDIA 1BQHA 3PCYA 3SKUD 1FIGL 4K7FB 3NTCH 4XP9H 2DM3A 4KRLB 2DQDH 1CF8L 5B7MA 4N0UA 4UNIA 2W92A 4KV5E 2XG4A 4FJZA 5MEPA 4L8DB 1Y18B 4WKZA 3R4RA 3TH2T 4B9FA 5D2LF 5TE6L 1T4KA 3D34A 3U6XS 2X0UA 1R3LB 2YWYA 3GMMA 3QJXA 4R6UA 4OZHE 5KYYA 1IVTA 3MFGB 4UAHA 4WO4B 4PJXE 5TQ2L 5A7EA 4PVLA 1QQDB 3MBEB 1NBYA 3LH2L 3WLWC 4BGLA 5IW1B 1X9RA 1V7NL 3RFRA 5C0AD 4Y5XA 1XSOA 3X11B 2JB5L 3DGGA 5JHLL 3WTSA 1SJXA 2VO8A 3E6FB 3QEHA 3ULVF 3MZGB 4H1LG 5I1AB 5IW6B 2R9HC 1SOXA 2G2RB 1RZPA 3ARDC 2J6EA 2RGSA 3L3KB 4JN1L 1ND0A 1DR9A 3SKNB 5IIEA 3ULUD 4RGNC 5F0MB 2FJHB 4GB9A 3C60B 4ENEC 3EYVA 4PM1A 5AYTA 5GJSL 3RUGA 3VFPB 4D0CB 1T04B 3PNRB 2CO6A 2Z31D 3HKZA 4PV8A 2DWEB 5I1DA 1QR1A 3FT9A 4MQ7A 5AW6B 1KTJA 1MRCH 3MRMB 4HBCH 1NIAA 3DRTB 1LD9A 2HWZL 2V2WA 4RFNC 1CLCA 4R8WH 4LLDA 3RKDD 2PXYD 3F8UB 2GJ6E 4DPBX 4OBSA 3FO0L 3D0LA 5KSBB 2ZX7A 3HAEB 5L4IA 2WQSA 1KCUL 4MCMA 2O5NA 4Z7WE 4Q14A 1DVFC 4OCNC 4XCFH 1IGTA 2YQ3A 1LM8V 5AVUB 1DVXA 1WA0X 2XPGB 3WFHA 1WT5C 4GBXB 4GNKB 1N8ZB 2DWDA 1QFHA 1Z5LA 3DARA 2KZ1B 4JO2H 4UOQA 4NYLB 4PWFA 5B1AB 1XCTA 4YC2B 5F21B 5IVNA 5CEZH 3LPOA 2AVGA 4FG6C 1KCSH 5HJDA 1LL1A 3WHE0 2VL4A 5IVXA 4HKZA 1MFAL 3GHBH 4H8VA 2AXFB 2HT2D 4PJFF 4M9PA 2HSIA 3GEWB 1U93A 3SIKA 1EJFA 5IFJA 1OP3K 2CLRB 3HE6D 4H13C 1ZJBA 1W0VA 3D51A 1DN0B 4AZ8A 1J5CA 2VTFA 4Y7MA 4HXBH 4LCCC 4E5XB 1M6OA 4KMTH 3MXVH 4KJWC 4XN8A 4RA0C 1NGPL 1ZLSL 3GNMH 1T5XB 3DIDA 2ZE0A 2D7QA 2R1YB 3ARSA 1UGKA 1BZOA 1EGJA 2P80A 1VB9A 3FT0A 3H42L 5EFIB 4CN1A 4Z5RA 1IZKA 1PZ3A 4NM8L 1X5ZA 3AWGA 3QFDB 4FABL 3PWNA 2EDXA 3LEVH 4FQIL 1W6WA 5IEKB 1EMTL 1FYTA 4P3WA 3RAJL 3K8MA 4WAFA 4PS8A 5A2KH 1TQWA 2XN2A 3OKLB 3POCA 3BGMA 4BWUA 4PJCF 4UQEA 1MDTA 4JDVB 4Y2DC 5T1KD 3GJFA 3ZMRA 2ADJB 4R4BB 2J21A 4MA1C 2VDOB 2ZCZA 1NEZB 1NM4A 1Z9NA 4GUQA 3NPSB 3D07A 3OMAB 4N2NA 5GJSH 5AG9A 4NO2B 5HHXH 1BBDH 1D2OA 2WAHA 1E4XL 3PP3H 3VRLE 3NN8B 4JHBA 4NZDA 4IRZA 4GH7B 3S7GA 4J12A 4UI2A 4U0RC 4J3SA 3GXPA 1XFPA 4G6KH 4NXKA 4UTCA 1S5HA 5B38B 3SPJA 4HGKC 4QTHA 5FKPA 5TK2A 5C70A 2FT8A 5CP7B 2Y0SA 2ENJA 5K1NA 1P5VA 5I8OH 1HSBB 1V7NH 2Y5QA 3GMQA 5C97A 3ULUE 1KBKA 2GBUA 4WV1C 4PSPA 1GMIA 4XPTH 1A7QL 1XGTB 2J2ZA 5AFAA 1ZDSA 4I89A 1BIIB 4WI0A 2WK2A 3LKRB 4LBAA 3P4LA 3VXMB 4WI9A 2DEXX 5EORL 4RMVA 4OLUL 1NCUA 2ZG3A 1ZGLM 2G3NA 4GXVH 3IXTA 3Q6FB 2YR3A 2RQ8A 3FB5A 1NGQL 3ES6B 1FL6A 1VADA 3CFCH 4CDHA 3A6CH 1IFHH 3ASNB 4YXLH 4UTAA 3ZU8A 1OB0A 5J11C 3T8VA 2G30A 2MOVA 4NJ9L 5CGTA 4TXVB 3RVXC 3BC9A 2OMWB 4P59H 5DRZB 1D7BA 4G9FD 4MGXA 4P5KA 4PJEF 3KCPA 5HHNB 1BXXA 1M4KA 1CBVH 5HDQL 2B4CL 3BO8A 4JFDE 3UC2A 2WB1A 3RTQD 3WKML 4AYMC 4YHZL 1TU2A 3JV4A 4QEGA 2F58H 5JPMA 2K9FB 3B2MA 4P2YA 4Y4HA 4OD1H 4Y19D 4XPGH 5GRVL 3WFDL 2WJ5A 3LD8B 1UD3A 3QXDA 1EIBA 1S7QB 4JG1L 4X9GA 4CAGA 4HPHA 1LDPL 3RVTD 3I2CL 5EF0A 4UTBH 1DVQA 1EO7A 5D6DC 2XZZA 4GO8A 4TVPH 4XHJD 5GGUB 4JFSA 1DQQB 2P8PA 5CEYB 3BIAX 3TZVC 3D85A 3QEQB 1RZJL 1AGBA 1N67A 4D8OA 5ID1A 5JOEA 1TFPA 3WL9A 2WYIA 1QUNA 4QHNB 3FAXA 5FUOL 2BY3A 1AQKH 3OX8A 3QORD 3VFSA 5ECJE 5DVMA 3T2LA 2FJGA 5AVQB 2BJMH 4LHQB 4JFZL 2HLAB 3AT8A 5DJAA 4A7QA 1QBAA 3KM1A 3HB3C 3ECWA 3BZ5A 1TEYA 4FQCH 4F9LA 3QQNA 4YSQA 5GJTH 3FCUB 3FQWB 3OWEA 2NY3C 3L3JB 1FO0A 4IJTA 4K5OA 2V2TA 4FCHA 3OKMA 4RMSA 4XXDB 1OOWA 1T5KA 2JCWA 3N06B 3KWVA 5I9QB 2C3WA 1V7ML 5FK9A 1UQSA 1I1AC 1PLAA 1JPEA 3VWKC 1ZLEA 5FO7B 3VI3B 1IKOP 3B7YA 4WI0B 3MLYL 2XN9B 3OM3B 3O4LB 5BS0A 5KW9H 4U0RB 2FJHA 4X5LA 4WLCA 1THAA 2XJLA 2EXTA 5AAMC 2G2PA 5CD5C 2X4OB 1ZV2A 2H7WA 1LP9A 4DP9X 5HHQB 2BJML 3MBED 4JB9H 4LXFA 3ECQA 1M71B 2O93L 3NA9L 4NLHA 2IBBA 2KBGA 3BFOA 1E9OB 1MAKA 3V0VA 3QEGH 4NT6B 4E9YA 5AB2A 1WBZA 2APFA 3B5HA 3OAUL 2R4SH 2EDEA 1AHWA 4PJDB 2X6AA 5KSUA 1RZJC 1WIPA 2OJZL 4B50A 1T22B 4G9DA 1XWVA 3NJJA 5EU6A 5GIRA 1ZHKB 1PZ2A 2IO5A 1VENA 2X4RB 4P23A 2DOCA 3C6SA 2C1OA 2AVFA 3KPPA 4XN5A 3VFUB 4ANXA 2ZG1A 2ATAA 2V3DA 4P2OB 5C9JA 1M7IB 3DWTA 4HMEA 1EDQA 1ZE3C 1K6QH 3VQLA 2QEJA 1EXHA 1AY1L 4Z7VE 1VGKB 3IPBA 2WMPA 3EYOB 5TDPA 2VR9A 2F54E 1Q1JL 2D4DA 4XO8A 1ZLWK 3P69A 4UT7L 1FPTH 1FNAA 2J43A 1Q0XL 3CNKA 1QW9A 1RD6A 1P7KB 1PZAA 1KXQE 3WE6A 4ABUA 4LNVA 1EXUA 2X1WL 3JZYA 3FPYA 4ODWB 2ADGA 2YZ1A 4QRTA 5SWSA 3DX9A 3MRJA 3QIUC 5GGSY 4B9IA 2ZUYA 2VDKH 3B3IA 3IT8D 4MMXA 4WCYH 4OGYL 1OSYA 2DTMH 3PP3K 2PWHA 4MZ3A 5CINL 4JVPA 3PNWA 3K91A 4OF3A 4LEOA 4PTTA 4Y1SA 3SE4C 2CIIA 4KTYA 5C3LD 3OLIA 4P46D 4EBQH 4KDVA 3QO1B 3BDYL 3ZKQD 4BINA 3EYVB 2XXCB 1BLIA 3TA3A 1NFDB 1DP0A 5FLVA 2M8XA 3ZTCC 5IK3A 1OE3A 4URKA 4HUUA 1D5BA 3L17A 3DHMA 5EHFA 1FYHB 2HKHL 1SEQL 4N8VB 2BRRL 4ZTOL 1PZBA 3TVMC 3PJSA 2Y2YA 3BUIA 4ONHB 4EI5C 1DBJH 1EEUA 1F1AA 5FLUA 3QK0A 4HH9A 3IPFA 5K39B 4J5VA 15C8H 2WKLA 4WU5B 3I84A 4JGJA 2ZKXA 3O9WB 5FOJA 1OT4A 1BBDL 1LXMA 2P9RA 3ATEA 4GKZB 1G4MA 3TBSA 4LSSH 2YS4A 3HN5A 4ZX6A 1SLXA 3FH8A 3ZKND 3K6FA 1QO3A 2WWOA 3EO0B 3P9MA 4KWUA 4GXUN 5DUML 4Q58C 3VMNA 1QW8A 5DJ0B 3RIAK 1AKJA 3U4EA 4WGKA 5IB2B 1HXMA 4KY1H 3LEYH 2JFCA 4FEIA 1ASPA 5DQDH 3UYRH 5K69A 3MU3A 2ED7A 4MRBA 5L6YL 3QZPA 4TOYL 2PXYB 1GGCH 1INEH 4JE0A 5IOKA 4LLYB 4QGTA 5DEJA 3BZ4A 3T77A 4HJ1A 3O41A 2SEBA 4HIHA 2X7LA 2WINA 2X10A 4Z7QF 2ZXGA 4BXSV 3MLXH 5D5ME 3B2DC 3ZOAA 1E2ZA 2JKIS 1ITCA 2HJKB 3P4MA 4JHZA 2YA1A 3F7LA 4RMRA 1E9QA 5DJ2B 2YPLE 4MMXC 3GNML 4WUKL 3Q8CA 3L5HA 5J5EA 1F3RB 1N4XL 4LCIH 2VQ1B 1JMZA 4WNSA 1M05B 4XN4A 5GPRA 3RWJA 4HIPA 4JDTL 1DDHA 3DBXB 3O2WL 2RAMA 4N20A 3QCVH 1IM9B 4G1MB 2BP3A 1Y18A 4XNZC 4A2EA 1TTGA 4OCLC 3AGVA 2IANB 2ITCB 1G6RL 3IKCA 5C08D 3QIWD 1INQA 3DROB 1BFOB 3L4ZA 2J8UF 5FM8A 1ZT1A 3T8XA 1CFVH 2WW8A 2GIYA 4M7KL 3F6LA 1ILUA 1UG9A 4NWTL 4UOW1 6TAAA 5IMOA 2HKAA 4Z7NB 3HCVB 2NQ3A 3CZFB 1DN2A 1FORH 1TJIL 3QHTC 5HI3C 2B4CC 1IAKB 3P4OA 5AOLA 4IMLB 4ELKB 3MV11 3TYGL 3QIUB 2FX7H 3S36L 4WEBL 4BCXA 3H0TA 4DO4A 5HVGB 1HI6B 4KK6C 2FECL 4OQ1A 2N3JA 5DD3H 4OY9A 1R47A 5MHSE 4X6DA 4HWEH 4W9ZA 1X7SA 3SGEH 5BQ7A 4ELMB 3BGFB 5I30L 1BG9A 1Z3GL 5IHLB 1F02I 1MAML 3ECBB 3VGAB 1DSWA 1JGLL 5D5MF 1S7SB 3TIDA 3NUKA 3F65A 1J5HA 5IB1A 1KB5H 3HI5L 2B5IB 3HAEA 5AL0A 2H3NA 1YEKL 4W9IC 3MRGA 1IVLA 2YPVA 4DT2A 4FOMA 4Y4FB 1KIUA 1PLGL 2EIEA 2G0KA 3O45A 4R7DA 1G9MH 1ORQB 3KH3A 3TPUA 4MQSB 1GPOH 4AL8C 4Z7NE 1BZ7B 1RMFL 3GBDA 4DP5X 3SZKC 5KBLA 4GIOA 1EQWA 5K9JH 5MERA 1AO7E 4FMFA 3TA3C 3V0EA 3BPLB 5E95B 5TF1L 3VB9A 4JRXA 1K8IB 2ZP0T 4P2QA 4PIRF 1AC6A 4Y2OB 3H6AA 2PPFA 5BS0B 3I3DA 2VZTA 2HFFA 4OVUA 1HTYA 3N1QC 1WEJL 1AR2A 4FNPA 4YIQA 3HG4A 4N0CD 4ZX3A 2AV1B 3ZBMA 2K6ZA 1KULA 5FA4B 5DA0B 1J18A 1SFDA 5BZXA 2XQYG 1F41A 3TO4C 3L3DB 5CKAA 2ICEB 3DOSA 2N7AA 5HJGA 4WTQA 2Z7WA 4WW1B 1NGZB 4M93C 4ZW8A 3UBXB 4HUWB 3JV6B 5KYYB 1BSIA 4M6OH 2FHBA 1FFOA 1T22A 1QFUH 2HX7A 2VDOH 4WK0B 1F4YL 3VG0H 1AHWB 1I9IL 1KBGH 4P2RE 4PJDA 3WCYA 3GUFA 1U8MB 1DVYA 2HPTA 5D2LA 4AGMA 1FVDB 4M3KB 4WO0A 2BIQA 3DTDA 4O02A 2PLTA 3L3DA 3PXLA 1BD2D 4MXVF 4NBXB 5GS0D 2YK1H 1JF5A 4Y9BA 3ZT7A 1TYJA 3JVGA 4ENZA 2QGCA 4Y9EA 1PLBA 5CMAB 1A7NL 3K4AA 3CAFA 4K5NA 1FL5A 2J73A 5JIKA 2IGFL 1PAZA 4MQTB 3CN4A 1G7LB 2ZUVA 3SGKA 2VLJE 3FBKA 4LEBA 1R0AL 4AEHL 3VWJC 1IGCH 2IH8A 1LWJA 25C8L 2CHWA 2YPKA 1X7QB 4HVBA 2YD2A 4APQB 2VC2H 1LTXA 4GAJL 4FQXB 4HEMA 4PJCE 1JL8A 5DEGB 4AMKL 2PPDA 4LOUC 2CUIA 1WZ1H 1UM5H 1MIEL 1UASA 3EH3B 5KYUA 3NSXA 1BM3L 3FQTB 3UTSD 2QGEA 3GINA 4LARH 2OR9H 4JZNA 2BY2A 3C5ZB 3ME0A 3TV3L 1UYWL 2BM3A 2CHZA 3LRSB 1KCKA 4I0CC 2A6KA 4PS7A 4YDIH 1NFAA 4KZEH 4AEHH 4IBYA 1HHHB 4W6WB 3ULUL 5IJKC 3FRUB 3K81A 1O7VA 3LS4H 5DMYA 1QEWB 2GKIA 4OM1H 4PUBL 1TTFA 4ZMXA 3MGOA 1QA9A 4ECNA 2OPCA 3P3SA 5JOPD 2F9BT 5LLIC 3WL9B 4F37K 2YKLH 1YY8B 4NS0A 3W37A 4DKFH 4PREB 3BVWA 3N91A 1Q9LB 3E9UA 2VSDA 1KPUA 2D3NA 3E80A 3FHQA 3C12A 2DW5A 1BG1A 1UWFA 4ONHA 4HV8B 1DJYA 2JB6B 1RURL 4M48H 4PU2A 5JDSA 5T33H 1BXAA 4U6XA 1F4YH 5BW7A 4LSDA 3H7LA 3CSYA 4JFDD 1JVKA 4M6OL 1ETJA 4AEIL 4AT6B 3QR1A 3TBWA 3FULA 2B0SH 5KZCD 1JD7A 1E6OL 5IMKA 5EO1B 3FW6A 4XMPH 1QLEL 1INDL 4UBDD 4G6JL 5FS5A 2HLFD 5AB9A 3HUJB 3KNBB 3C8HA 4NHUB 3UZVB 3EHBD 2MOQA 1AD0B 4Y16B 2BC4B 1JVLA 3HMWH 1G9NL 4O00A 5ABZA 1ZAGA 2A9BA 3OAWA 5LNEA 3MGTB 1C16A 4NKDA 5FV1L 3FBQA 4WV1A 2GC4C 4BFIA 3O6FB 3F12A 3LX9A 1RIHH 1OM3L 3SDAB 1OAZL 4S1QL 2EUWA 3U1SL 5K9JL 3LNGA 1UVQB 4P4RA 4GUOA 3MNMA 5JNYB 1QPKA 2BXZA 2BVQA 1S78D 3L5IA 3AC0A 4UQ2B 4JM2A 4OLXH 4WI3A 2CCVA 5C3TA 4BE5A 1NAMH 1KT2B 1FL5B 2EC9T 5I23A 4DN4L 3KEHA 5DMGC 5EDXA 3SE3C 2OMYB 2JKSA 4IOSD 3IJEB 4QTFA 1MW3A 1TJHL 1KJ2A 2FLRT 1JVOA 2WQ8A 3QNYA 3U4BL 1WRFA 5BZZA 2DMCA 5C1MB 4Y2DA 3H2WA 4L8CA 2XN9E 3O6LL 2DBLH 3AY4C 5AVSB 4HT1H 1IM9A 1B4JH 3RWGB 2Z1PA 4UNUA 2D9QB 1Y1UA 3C5JA 1EHAA 5ISZA 3KWWA 1U6AH 5KN5B 1PF3A 4W4OA 3S36H 1C7SA 3ME0B 4HK3J 4PHXA 3RRQA 3OR6B 2IG2L 5CWSA 3MRNB 5D70L 1N9PA 4NC2B 4EZLA 5KSAB 3KPSB 4KJWD 2FRGP 1OAKL 3QZWB 4I13B 2XDHA 3ARWA 3ZDZF 2DTSA 1EXGA 3DUHA 4MFHA 2OJ1A 1F3JB 4DQOL 3B9KD 3LYRA 3N3EA 2A2QT 3D25B 3NIGB 3OAYK 4MBRA 4PGDB 4FLOA 2YSTA 4R90L 5IBTH 2YAFA 1LEKB 3QI9B 4WW2F 2PW1B 3MCKB 2KC0A 1HL9A 4LAQH 5I82A 2PNDA 1E40A 2YC1B 5F9OH 3ZZ1A 2FGWH 3MRFB 3V7AG 6PAZA 1P9MA 2E3VA 3ZO0A 2KYIA 4OCSH 5HDRA 3GI8H 3CFUA 3MRBA 3U82B 3NEEA 1PD1A 1BAWA 5K93A 3QUXA 2ZCLL 1HC1A 3HE6B 3CN2A 3FFCE 2F54A 4R96A 1DLFH 4BE6A 1HYSC 4PMFA 1ZK5A 4PB9L 5IBUG 2WWMC 4RDQF 3O45B 1AO7D 4NENB 2LR4A 2IFFH 4FQ1H 3TA4D 4EOWL 3DJTA 4PI2A 1LNUB 2BMKB 4UT6H 3TEXA 2P24A 4Z7AA 4L3CA 5C0DA 5I1EL 4BFKA 4W9KC 1QSVA 2AQSA 3AMKA 5BVPH 2Y6TE 1SBSL 2HKFH 2R29L 3N41F 1ADWA 4NZRL 1D5MB 3KPOA 2FUTA 3Q2WA 4LCWA 5DD5L 2F53E 5DHYA 3VCLB 3ALPA 4PY8I 1AJ7L 1J0HA 1OY3B 1S46A 3PDGA 4QLWA 3SDAA 1NICA 1NZRA 4U1GC 4AL8L 3CLFL 3D7PA 3MV9A 3IGUA 4PR5A 3TA3D 5ICXA 3CN0A 2UVFA 3ULVL 3SD5A 3IAQA 3S48A 4TQEL 3MRCB 5DJ0A 1U30A 3LH9A 3VFOB 3EHBB 3VD3A 1SBBA 1MOEA 2X5PA 4XPFL 3ARBB 2OI9B 4A7GA 15C8L 4P57B 4WU7A 2QSVA 2NY6C 2J57A 4J4PA 4X99B 1NJ9A 4BH7B 3RI5K 2YA2A 3NSCA 5IVZA 4UMGA 1U8QA 2BSRB 3PHQA 4QRSB 4CJ1A 3QO0A 3QFJA 4X7TA 2FO4B 4P3DA 2DLGA 3WIHL 1NMBH 3PXHA 3EJSA 4HS8H 4XO9A 2GY5A 4Y0GA 3RNQB 3HS0A 2NUPB 4PJ8D 5A2LH 1TPXB 1W0YT 3QBTB 3BDYH 3FUEA 3MNVB 1F58L 1VHPA 3EH4B 5ID0B 1XF2B 5C6TL 4LQFH 4BRJA 3OVUB 3Q0HA 4EPSA 1ORSA 4BZ1H 4AQ8A 3O2DL 4OI8A 4WY7L 2IPKA 4K0OA 3MOAL 3WUZA 2O26U 5FYLH 5B3SB 3ZR5A 2KLSA 2EKSA 3PGCB 3KPSE 4LFHG 2Z7ZA 1JWMB 3NSDA 1ITBB 3ATAA 4F57L 3S8GB 5I8EB 1ID5I 2QKSA 2Q3XA 1EZVX 2PW2A 5FW7A 3NZHL 4LAQL 5DC4B 1E4KC 2HJLA 4RVBA 2M1KA 4NNYB 1E3XA 2R83A 1EJ8A 3MV7A 1QFOA 1V5JA 4RFEB 2WXQA 3F6IA 4JQVA 2XHNA 2DYPB 3QIBB 1IL1B 4MS8D 1SJHA 2CJ3A 2VOTA 1PG7X 4I9WE 3C60C 1GAFL 4L3EE 4WU5A 5CN2A 5AAWC 3VA6A 1TETL 1PX4A 1F42A 2VLME 4WI7A 5D70H 3WKPA 3QJVB 3NGBC 4O5LL 4EDWL 3NH7L 4FLHA 4GEIA 5FC9A 4JDZA 1P1ZA 5DHVB 2YSSA 3C75A 3VFTA 4I4WB 5BO0D 5HYJB 4MMYA 1NBVH 2NY3D 5A2BA 5F3FA 1C8PA 4X6EA 3CH1A 5T5FH 3P3YA 3TBCA 3HZMB 2OJZH 3DXAB 5GS0C 4PBVC 4W68A 1EPFA 1EVUA 1QLFB 2IF7A 2Q8AH 2NUTA 4NRXA 1Z9OA 1IC4H 3FOLB 4PG2C 4NQSA 4UMSA 1W8NA 4NHUA 3TZVD 1IC0A 3W1ZA 4KGJA 3HUJA 3KNBA 2HT4C 1VFAA 1F00I 2VDNB 2D3VA 4HIJA 4MASA 2I27N 1FSKB 1R3JA 2AZAA 3CXDL 2ZXCA 2OULB 2X6UA 7PAZA 1JV2A 2BP8B 4TSAL 1XSJA 1G0XA 3J27A 2BNUA 5KSVB 5C07B 5FUCE 2RIKA 5ID1B 4QXGH 1V8HA 1FLTX 1N5AB 4RDQG 5EBMA 3S8WA 1DQQA 1JNLH 1VPOL 3PJSB 4ZDHB 5CEYA 2DJUA 3VFWA 1AMXA 2GSGB 1P4UA 2R69H 4CJ0A 1DEEB 1D5IH 1HIMH 4YVUA 2IJ0C 5E08H 5LGJB 3QUKB 3W56A 4J4PC 2XA8L 2VR5A 4FFWC 1FN4A 4BZ1A 3K6NA 1HOCB 1TO4A 4HJ0C 3AWEA 5DRNB 4DN3H 2NNAB 3MNWB 1HQ4A 2F54D 3R0NA 2E0PA 2OXGA 5JZ7D 4MTMA 1HE8A 3DO7B 1CK0L 1YC8A 1WK0A 4OZ4B 5IV2B 2PABA 5FUOH 1XF3B 5EU4B 3UZQA 2P45B 2YN3A 3S3BB 5I74C 1TVDA 4OCYL 1LEGB 4J3OH 1WFIA 1BVZA 1DL7H 4U6YB 4LOVA 5IQNA 4LVHB 2WQWA 5I0YA 1WISA 1G5GA 3ZDXE 4OAWA 1V54B 3EFDL 2AJ3A 1RIUH 1WZMA 1JV5B 3VXUB 2W0KA 3RVVD 4PCTA 1CDYA 1TENA 5CFHA 3PV6B 1FHNA 3ZHFA 4G7SB 5A2CA 2FNBA 3NJNA 2R0WL 3OKYA 2JI2A 2BS71 1GA2A 3VXPA 1TJGH 3NJIA 5CU5A 3WNKA 4DP6X 3F7PC 4LARL 5I1CL 5G4NA 4PBWD 3BFQG 5I28A 4PWKA 3LZFL 4U0QB 1SUJA 4XT1C 4I3GA 1ZEAH 1WZ1L 3VFNB 3UAEA 3JQOB 1JV5A 1KCVH 1U3NA 3ZYJA 2CRIA 3BP6B 5C0GB 3VFRA 1I4FA 2DJSA 2GJZB 3INUL 1R0AH 4GINA 4UV4L 2NUTB 4G5ZL 5DMGD 5DZVA 2FEDC 3CHSA 3KXFA 2VW7A 4GMSL 1R24A 2XICA 5IMMA 4N2FA 3VGEA 4HEPA 4O58H 4ZSOA 4AH2B 5D7LA 1YMHA 1U3HD 1CYXA 3VXRE 3H2QA 3F00A 2Y7OA 3QWRD 4FTVD 5FYJL 4XNAA 3S5ZA 4RZCB 1LK3H 3AQZA 2DRUA 4PY8J 3Q1SH 3GZPA 1HOEA 4JREB 4K7FA 4XTRC 3TJPA 4ZW6A 3FT2A 5FGCE 2KH2B 5TDNA 2AITA 5LWYL 2JTDA 2MPAH 3IMSA 1CVRA 3PWJB 4BK4A 1PNDA 4JQXC 1SYSB 1JAEA 4B41A 3GSOA 1ZTXE 5IGXL 1ES0B 2Z1KA 5FF6A 5CP3A 4C83B 4IGBC 2LQRA 3GKZA 1FV1A 3LRMA 3MV8B 3UG5A 5C09A 2F61A 3MRHB 1MCKA 3BQUA 1FWXA 4X99A 2XUWA 2NY1D 2VDNL 3CVIH 5JYMA 3ISRA 2H2SC 2WOYA 1J11A 5CJ8A 3BEWA 3V2AR 4Z77A 4IKKA 1WBXB 3M17B 4YK4C 4JHWL 3FF7A 1ODAA 2J1XA 3LIZL 4IKJA 1RZ8B 4R7LA 3EJPA 1ZA3A 2A4CA 2VDQB 3L3KA 4L2LA 3VW3H 5EULV 1WUNT 2YC1A 3A6BL 3L5JA 2ROXA 4Z3HA 5AB1A 2GT9A 2GVYA 2OA9A 4H26A 5DLMH 1I7TA 4I8DA 5AW1B 2HVKB 3DTXA 1MHEB 5BOZG 2R27A 4U1IA 2FHCA 1KB5L 3HS8A 3QDHA 5EB9A 5IW6A 1MCWM 2JTYA 4KJPD 3X13A 3CVCA 3HPLA 3NAAH 3STLB 5BO1L 4BFGA 4YJZL 2FWLB 5KEZA 1MAMH 5JDSB 1EZUA 4N26A 3E3QC 3NP3A 4ODTL 5BCAA 4G5AA 4KMTL 5I30H 3HNTH 3O2VL 1DO6A 5IG7A 4HFWA 1G6RA 2XTJE 4L5FE 4U3XA 1QTPA 4L48A 3T65A 5K9OB 5M7QA 2NT0A 1KENL 3L3IB 3LKPA 1MHCB 2F6AA 3JTBA 3L2LA 1C5DA 5FCSH 4FQXD 4HS6A 4E41B 3FOMA 3QNXB 1KIQA 1KY6A 4L8BB 4UM8B 2Z8SA 2JB6A 5CGYD 1GYCA 2WXJA 4JY4B 1AOHA 1S9XA 1CDIA 2LFGA 4BDVA 2DJ4A 3BE1L 4NKOA 4RAVB 3C8DA 3S37X 5C0JA 2VB5A 4O2CB 3PL6B 2PW1A 1QSZA 1TYEB 2VR7A 4MB3A 2G2NA 1ONQB 4CVZA 1VIWA 5E5LA 3B83A 3BDXA 3A23A 1E9QB 5DJ2A 3EAKA 1SJEA 1QYGH 5EBLB 5EOTA 2Y7LA 1NMBL 5DQ9A 2DH3A 1DQLH 4N9GA 4OD3H 1DQMH 4OF7A 1MCJA 1KPVB 4B0MB 3VXTB 1HJCA 5FO9B 2GTWB 4LPTA 3OZ9L 5F1KC 1GOFA 1M9SA 1Z0NA 3C9NA 3F01A 4DFHA 1BA9A 2NNXA 4XVUD 4AMWA 2WXIA 1B6UA 4YUEH 3VXQB 5L2KD 4O2FA 3ABGA 4NO0A 4UQ3A 2H6PB 1I7RA 3H54A 4NKMB 2OMTB 1RZIB 5AOJA 2H0PA 3RVVC 5EU5A 3DSNA 1BQUA 5CBEB 2CPCA 1RY7B 4Y7OC 1PZSA 2C7FA 3RDTD 4D8PB 4L5FH 2OMYA 3CLFH 1NCCH 1THCA 2YXFA 3VFPA 1U8MA 4Y5XC 2QADB 1EO8L 1BQHB 2R1WB 4ONGL 3L8QA 4HZLB 4K3DL 3I50H 4ONFL 4WWID 3WIHA 4ERSH 3Q5YA 3WV0A 4KBPA 3LKSB 4AUYA 2X40A 3P11H 3WFCH 4AYEC 1YJDC 1NL0H 2EEBA 1BZ9A 2AS5M 1DE4A 1SF5A 4ZFZB 5IEHB 1UATA 2R0KL 2P7TB 5JDJA 4ZNEA 5BUPA 3HMXL 4LRIA 5HJBA 3R19A 3V0DA 4V1DD 4ES9A 5CCKL 4X0NA 2HVJA 2ADIB 3KPRA 5ANMB 1H5BB 3D0VB 3DPBB 3DX7A 2CSPA 5I5JA 2X6MA 3H9ZA 3I75B 3VYNA 4XPHH 1OTUC 5ACZA 2WIMA 2NNCA 3QUYB 2OSYA 1G9NC 3HI1B 2J8UA 2APSA 5J6HB 2O6DA 1BZ7A 4FXGC 5HYQA 2FGWL 4I7ZC 2NY6D 2ZWZA 1F4WL 5LBSH 4QRAA 4YDKL 3QUZC 1LWRA 4OUUB 1HCFX 2XQBH 4FLSA 4TLSA 1L7IH 5DD0H 3DJZA 5GZNC 1FG9C 1JGVL 4XE0A 2DEWX 1I8LC 3MJ7A 4MJ6B 4R7NB 3P4OB 4JM2B 1U95B 1LD9B 3BAIA 2EIZA 1DQKA 2CBQA 4GSXA 3FB7B 3U9PH 3EBAA 1TIUA 1NCGA 4R83A 2KHAA 3CD4A 2JJWA 4EN2A 1KSRA 3BYYA 1JZDC 1RIVH 4HS3B 4RGND 3OJDA 4YQXH 1PL3A 3MC0A 1U6AL 4PJ8A 3PP4L 1Y07A 1E4WH 3MQIA 4LOFA 1X3DA 2H1XA 1OCWL 2YHGA 5JW4M 4RESB 3S6CA 2EICA 3BRGC 1BLNA 1NC4D 4GO9A 4N6RB 1UZ8B 3NJLA 4EN3B 4ELMF 1PFCA 3UTZB 1UTDA 1P4LB 1NCHA 4TKWA 2VISA 1KN2H 2E9WA 4F8OA 2DDQL 2AJVH 3VXSA 2F7QA 5AW7B 4G59C 4OGZA 3NIDF 3LZQA 3AM8C 4P2CG 3WXWH 1MUJA 2NPLX 1A7BA 1MJUL 3V4VH 4W70A 2Z93B 2ZPKH 2DY2A 2X4TB 3OZKA 4YGVA 4PJFB 3IGAA 4MS8C 2VDRL 4NNPL 5ICYB 1SN2A 4XC1L 5ADPH 1I53A 5GRUL 3U4KA 4UINL 4G7YH 1TTCA 2FJFA 4PGCA 1J8HA 3QRFM 1MCBA 2QDWA 3COOA 3REWB 2R9HD 1GW0A 3BXNB 3A22A 5F96H 5C0EA 4LSRH 1T0NA 2D31A 1GZHC 3HBZA 2EXYD 5FM4A 5CP7A 5HGHA 1GL4B 1T1ZA 4DP4X 1JPGA 4JB9L 1AXSA 1WF5A 2P8MB 3DX3A 4Y5XB 4YFDB 1A9BA 3GIZL 4PH8A 3ZTNL 2E9BA 2NDFA 2HUHA 4FQPA 3CK0H 2B0SL 3SDYL 1R46A 3ZX1A 3WEXB 1NCDL 3BZFB 2ZZUT 3EIFA 1CE1H 3I6GA 2G75B 4J3TA 5BRZE 2OS7A 1DSFH 4AW4A 4Z95L 4Y9CA 4ATWA 5DHMC 3KYKL 1M7UA 5F96L 2ZOLB 1KOAA 2VUYA 3CZUB 3S5YA 4X4YA 1XMWA 2DM4A 3FQRB 4LSTH 4ZJ9A 3ARGA 1SM3L 1SMAA 1I7TB 2JF1A 4YWGL 4WKXA 3TO2B 4FTDA 3WG7B 3II2A 3ZVVA 1Q9KB 3J8F7 3T9WA 1MW0A 1E67A 1P0SE 3NDZE 5EV7A 2ZCHL 3S35L 1N6VA 5JIIA 3I85A 2W07B 4ZK8A 2R2EA 3OXRB 4AM0B 1DJZA 4X6DF 3KL3A 1CVSC 5I2IB 1N64L 4FHKA 3CMGA 3W5MA 3K8KA 2HT2C 4CC4C 5KVDE 5F7DB 1C5DB 1E8XA 5E00B 5HI5D 2ALWA 1OP5K 3EYUH 3LN5A 3H85A 1UWEH 5DK2A 3S4SA 3FSZA 4RIRA 2R2HA 2OMUA 3QQDB 3ZDZE 3ZTDC 1AD0A 4G1MA 2V8LA 5FUZH 2R2EB 3HN3A 3PQYD 3FUMA 5IY5B 1L9RA 2EDJA 1G7PA 4BKLA 2ZXBA 3RDJA 1AE6H 1B0GA 1N64H 3H4FA 3WY1A 2MQ3A 4KK9C 1A5FL 1UHVA 4JPSA 1RP9A 5IFAL 3D9AH 4PRPE 1FBIL 4TUKH 3LN5B 2YJLA 1BQHG 1K5WA 3TO4B 2ZCHH 3WIFB 3T3ME 1OGAD 3ET9F 1KPVA 2DQIH 2JLLA 1MI5D 3TBYB 2WANA 1A4KA 1JCKA 2N0MA 1NPUA 1YHPA 3BISA 3CZFA 4HKBA 5CIPH 4Y2DD 3MJ6A 1N5YH 4JCLA 2ZF8A 5IHZA 2YFNA 3MYZA 5CIPA 3CZEA 1KLGA 2ATPB 3O0RH 3CDGB 5I73C 4ZFOA 5CEXB 4DK3A 1JXDA 1NBCA 1P4IL 5IHWA 1ZS2A 3HBQA 3OSVA 1YEJH 1FLRL 2YEZB 4FNSA 3MCYA 4OLUH 4H1LA 4NQEB 1A0QH 4LNRA 1RHHA 2AJZB 3VWJB 1NFIB 1R5IA 2MOGA 1X5FA 1GR7A 4JFQA 4MDIA 3C5ZA 1AZCA 4G9FB 4QRQB 2APVA 2JELH 4OLWL 2DMGA 1PAMA 4IRJC 1NAKL 3NZSA 5BRZB 3KPMB 3D25A 3OB0H 3V0VB 5KYUB 4I9WD 5I1AA 4ZFZA 1ID2A 2FX9L 5KVDL 5F7AA 3NK4A 3KE0A 4XC1H 3GIVA 2LLGA 2NW2A 1FC2D 1E9PA 3AW5A 1MNNA 3K71A 3RVWC 2A9AA 2I9LB 3K72A 3HE7D 5EOCL 3RDTB 1F90H 1OE1A 4XXWC 3UTQA 4WWKB 2NZ9C 1LLAA 2QADD 2NSXA 5AWNH 5LXGL 3GSXB 3LIUA 5DK3A 1JGLH 1KN2L 3VFNA 1JRHH 1HXMB 3J07A 3V0JA 5AW8B 5AAMA 2ITDA 2N59A 4JFOA 2JIXD 1G87A 5F7LB 1ZVYA 1K4DA 3UTPE 5HHPA 4KKLC 3Q9QA 3OZ9H 3EGSA 5DU7A 4JEGB 2B2XH 4J8RA 4N6QA 2CKBL 4QRFA 4YSCA 4O4YL 2VITA 2EC9U 2P5WB 1I3GH 3TWYA 4H8QA 4EZMA 1S7SA 2HJKA 2F1AA 1TKWB 4IBZA 3V79C 3G5XA 5HGBB 1F13A 1FORL 1JHKL 2ED9A 2FO8A 3KW8A 2CO3A 2VWEE 4BH8A 4NI3A 4JFPA 5A2AA 3OMIB 4ZMZA 5IT2H 4TSCL 3HC4L 3T3MB 3EJTA 2QQLL 2BIOA 5D6CB 4H40A 4HS3A 5EF3A 4YBHA 4E9TA 1W8OA 1A6AB 1OAQL 3SDCD 1JGUL 2B7DT 2FEEL 3L81A 1WG3A 3UTTB 1IX2A 2NY4C 3EF7A 2YPLD 3NJKA 1R9FA 3ARDD 2AXWA 5JOFA 2FSEB 3WTVA 1MY7A 1FJ1B 5FECA 3O6FC 12E8H 3RPIB 4B7LA 4LSVH 2YAOA 1GZPB 1URIA 3GDCA 4OQTA 5KSBE 5IP4A 2MNJB 4K94L 5CBAA 2NQDA 4AQOA 1J05A 2QV2A 2JKNA 4JZJB 5AZUA 2P5PA 4I3SH 5D4QA 3UGUA 3OGOE 5I15L 5I8KH 4JO2L 3TBTB 5KSAD 1HH9A 1FE8H 3IMRA 1WV7T 2JKXA 5DLML 5JO5A 5AD0B 5LG6A 4NFBA 4DOHE 4YL9A 3S37H 1EGJH 3IRZA 4F15C 2ADIA 3KPRB 1SFHA 3WFCL 3OMZA 5ILTL 2FWOB 2WUBH 1UM4L 1M2VB 3V95A 4G7RB 3MGOB 3QUXC 4Y2NA 3HG1D 4NJAL 1F11B 2GAZA 4R7XA 1S7WB 2DWXA 4OCRL 4F7MA 5T1LD 5E56A 3QXVA 4YSRA 5J9PA 4OZFA 1W0WA 3OKMB 1FP5A 2DLIA 4XXDA 2RB8A 1H8NA 1WIUA 4IOSA 4AC4A 3IFNH 4OM0H 3LD8C 2HFEB 3T77B 4Z7UA 1T2QL 2FT6A 5GZOC 1KWKA 3QORB 3EYSL 1SHWA 5H2BA 5KBKA 4Y4KB 1TYRA 3BUQA 3ZK0A 1VDGA 1UXLA 1G1YA 3FL7A 4OIIL 4Q89A 1LEIA 3JV5A 4Z8FL 4FI6A 4QTHB 5FKPB 5GGQH 2BRRH 2ADFH 3V4PA 4JRXD 5DHVA 4L1HA 4YHIB 2H4EA 1U2YA 2EDLA 5LCVL 4I4WA 5HYJA 5D1XE 2JKRM 3X12B 3ATFA 1KTCA 2XZQH 3TU6A 4R9HA 3B9KA 4PJAA 1BEYL 5DFVC 5E03A 4ZMLA 1S9XB 1Q72H 2D03L 3SYCA 4BDVB 3P9MB 2IALB 3ULUC 3SYAA 5MEQB 2DD8L 4Q2ZA 2C3XA 4F91B 2DQDL 2W0PA 2PMZA 2Y3AA 3M46A 2OSWA 3FFCA 2OYPA 4Q97A 4QHLB 4ZBJA 2XWBB 3FQWA 3L4UA 4YDMA 4QXWA 5I9QC 4QT5B 2C1PA 3UH8A 2HPOA 2J55A 2AEQL 3MA9H 2J25A 2P52A 4PLKC 4DESA 2YARA 1ROWA 1XF4A 4A63A 5I1CH 1F4XH 2YPLA 2TRYA 3G9VA 2GFBB 4D7PA 1GKOA 1NIBA 2I69A 3B9EA 4HKZB 4HULB 3V10A 4DGIL 4G8FA 5TE4H 2JJUA 1CXFA 4NQDD 3HNSL 4EN3D 4DUXA 1ZV9A 3OJDB 3LMJH 4P46C 1XH3A 4QOKB 1LP9B 2WKOA 2JXMB 1Z1WA 4ALAL 3O3BB 3M1BA 2FO1A 4FKHA 1KYUA 2OTPA 1DN0A 4WVRA 4QRSA 3CZLA 4MB1A 4F5CA 2VZ3A 4KK9D 5IJVA 2YOAA 1A6TB 2YD7A 1GY2A 3AZUA 5MI0C 3EKCA 3O4OB 3PV7A 4H0HB 5LBVA 4XBEH 5TH2B 5B7FA 4JHWH 1O9ZA 4R7DB 4G8FB 4G70B 4JG0H 3V7MA 1CS6A 4LL4A 1RUAH 3OQ3B 1GHFH 3P30H 3SGJA 3O3UN 3NQIA 4IHOB 2WB7A 2OCJA 2Q7AA 2Q8BH 4XVJH 5FF6B 2Z92A 1HKLH 3GMRB 5HI4C 2UY7B 1T6BX 4NFDA 1CFMA 2Z31A 1PFOA 3JWOL 4OLWH 3V6BR 3IJHB 4UQCA 5HHOA 3EOYG 4FZ8L 1HCYA 4D0CA 3WSQL 1PEZA 1IGFL 3BQUB 5KW9L 3LTVA 4PGZA 1MCNA 2F2HA 1PDKA 3FN3A 1LO5B 2GSMB 2QBWA 1IJ9A 1MCDA 1IQDA 4HUXA 4L29A 4CBZA 3RZCC 3TPKA 1FFPA 3RG1C 2RACA 3B2VL 2DQTL 2EKSB 3B56A 1P7KA 1M56B 4KRNA 4A2HA 2X88A 2CAKA 1U95A 2IPUK 3BVTA 2DH2A 4NZFA 3H3BC 1MEXH 2WZAA 5FR3A 3GSNL 1L5GB 4F27A 2XPGA 4XMWA 3SCMC 3T1FB 5EIIB 1NMAL 3WFHB 4QRPE 3N85H 4BFNA 5CWSB 4Q4EA 1KFGA 1JDCA 3BH8B 4TTDD 3T6VA 4AE0A 4GT7A 2L8AA 2ZONA 1K4CA 2K45A 5EC2B 4EUPG 1YCSA 5ACLA 2DYSB 4W9FC 1P5VB 5EC1A 1GGTA 1E50A 1OLLA 2Q8AL 3WTTA 3BI9X 4XXCC 4K55A 2PWEA 3HE7C 2ITDB 2X2YA 4G6FB 3K5RA 4ZMWA 4L18A 1GC1H 5SWQA 1T0OA 4FJ6A 3QP3A 2ZOWA 3SQRA 3SE6A 1KB9J 4MVBC 3MJ9H 4M5ZH 2VR8A 2EECA 3UTSA 4J3WA 3W39B 3BX7C 1ECYA 1GRWA 3F2LA 3WFEH 1XL4A 4YE4H 3SDDA 2Q9OA 5E8EA 3ILPB 1KTKE 1FG2B 4UQ2A 2BP5M 4BV1A 1BZ9B 4F2ME 4PJGA 5GISH 4KQ3H 2EYRA 1UA6H 4Z0XB 1AKPA 4PD4J 2R1XB 3UJTL 3UOAB 4XVSL 3E1ZA 1XF2A 4L9DA 1JZ3A 2E9GA 3OLGA 4NKIL 5FHBL 1GZQA 5EH1A 3RZWA 4CC0A 3WD5H 3HNSH 4XB7A 1F56A 1MWOA 4QO1B 3O3BA 4XNMB 5BUGA 4TQIA 4H1LB 3QFDA 4KK6D 3MUY1 2X38A 5GSRA 5DCCA 1W91A 2OZ4L 3V6OE 1GSMA 1F4XL 1N12A 2AJZA 2F5BH 2WY3B 4N2AA 1PIGA 3JWDC 4P59L 3MUGA 4ZPVB 4QF1B 1OT2A 2FEJA 2R15A 4LESA 4WHDA 4N25A 4UQ3B 3SPCA 3UCRA 4NNYA 3NYKA 2MQCA 4V1DB 2A9ML 4P46A 3TZVA 5CSGA 3SE9L 4OGAC 4DGUA 3RTQC 3CFKB 1SUHA 2WCPA 2APXA 1OPGH 4WEMB 4HXAH 1E2WA 4ZFGH 4NQCD 1OTSC 5EORH 4KO9A 2WQUA 4IBWA 4AVIA 1YG9A 2APWA 4YXHL 1T1YA 1VCBC 4N2BA 4KQ4H 4Z6AT 4NZ8A 2ID5A 1N68A 1WAAA 1A3ZA 3SDXA 3X1GA 3CFMA 5J1TC 3K6OA 3T6QC 4F8NA 2E56A 4NIKB 4F7MB 3P0YL 4ZQKA 3CFBA 2OSLB 4GG6B 1T83A 2QJDA 4JRLA 4ZUVB 3O4LD 4CC4A 4AGQA 3HFFA 1XZWA 3ETBF 4I1RA 4JRYB 4HUMB 4J3OC 4OJAA 5E24E 2PP8A 4NENA 3GTTA 1PLCA 2Z34A 4ZPTA 1VERA 3DV4B 3RZCB 4YO0B 43CAA 4H20H 3ZO9A 4CU6A 1JBJA 3WTWA 4TUJB 4EE2A 3ISWA 1B0WA 2R2HB 2PETA 2XG5A 3OL2A 4IIQC 5DT1H 3VRIB 4K07A 1YEIH 3SGKC 4FFZA 4AM0A 3QAZB 3IVKB 1MHHB 4PGEA 1KN4L 1PY0A 3MCLH 3QQ9C 3TNNA 4AY0A 2XWJA 4Y4FD 2VLJA 1F2XK 1O7DE 5G5DA 5HI3D 3BT0A 4RAUB 4BEIA 2WUBL 3K72B 1WDAA 3ZRSA 5DD5H 5EU7C 3RAJH 3UAJC 2J44A 4G80B 2Y1VA 3RVUD 3AACA 4Z7VB 2B1HH 4QTIL 2CHDA 3BKYL 4FABH 4YHKL 2B9BA 3BCDA 4AV0A 2IMMA 3AS3A 1IAIL 2WKGA 3GXMA 4Q2ZB 4KK5D 2CR6A 2HRHA 2OMXB 3RA7L 3U4AA 4K71B 1QFWM 4MCNA 1MJ8H