4RISH

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
228
structure length
228
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYYDSSGYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Envelope glycoprotein
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4risH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4risH01
1G7IA 4TULL 1LHZA 5DRZB 5I15H 4UU9A 4PJGB 2FNBA 5IROA 3CH8A 1U8IB 1J0ZA 3IS0X 3MJGX 1TZIA 4L4TA 5IBLC 1GAFL 3H6JA 2HRPL 3VXMB 3VXPA 3CNKA 5DD5L 4EJ1C 4R90L 3T77A 5I75B 4PJ8C 5GRUL 1SHMA 4I77L 2X4NB 3LD8C 2Y1VA 4DGIH 2V5YA 3L3OA 5DO2D 1G7HA 3EYFA 4AG4H 3BP7A 2ARJA 1MIML 2BOCB 1MJUL 1XGQB 2H2PC 5D1QD 5FDYA 4JM2D 4R3SB 3I3EA 1ZT4B 5AEAA 3LHPL 3FO2A 3DURA 5EDXA 3D85A 1EUTA 4M93C 4LCCB 4LSQH 1LNUA 1F42A 4PJ5B 4U1NA 1UYWL 1TTGA 5IM7B 3RIAK 3MRGB 1UKTA 1JF5A 2MKWA 3O8XC 2V2XB 3RIFF 4ODTH 4Y2DD 3HMWH 1JFQL 3OXRB 5CS7A 3NPSC 1IAIH 5CEZE 3K8MA 5A3IC 1ZANH 1RUAH 3WFEL 1BQSA 1Q9KB 2AK4E 1SJVA 1KEGL 4NRXA 1UEMA 1FE8H 3FONA 3JZ7A 4HBQA 3CVHB 3BPLB 3H0TB 4WENB 2BY2A 3L3IB 1CL7H 3C9NB 1N4XH 3ZDYF 1AHWC 3KJ6L 5EIQA 5GIRB 4ZYKA 4Z7OE 3BGFB 5T5NG 4N0UA 1VADA 2PKDA 2FR4A 4XBGB 2YHGA 3DVNB 3M17B 4I3SH 4W68A 5HVHB 4R0LC 3U7YL 3GSNL 1FLRL 4N8VB 3PXHA 3O3EB 4WU7A 4ZFFB 4OZIA 1SY6L 3ECBA 4QHLA 1CFTA 3BDYH 2E6JA 2QADB 3C60B 3FT3A 4LQ1A 4P2OA 5D6CA 4K3JL 4ODTL 5GGRB 5T1KB 3HRZB 3RL1B 1BIHA 3HMWL 5I0ZA 1DN0A 4RA3A 4LHJB 1JK8A 2FB4L 2CIIB 1ZANL 2CKBA 5DWUL 1R24B 3DX8B 15C8H 5B39A 3RKDD 1IQWH 1WCQA 2APFA 3T8XB 4LGSB 3KPNA 1FE8L 4G8IB 1R5VB 1H9VA 4XCEA 1MVUA 3NA9H 4JPKH 3HS0B 1CL7L 1XGRB 4DWHA 4XH2B 1JHTA 4HC1A 4L4VB 1KYOJ 1QBAA 2P8MB 1KTDB 4G6JH 3U30C 3ULSB 1N64H 5D8JL 4RIRB 4IIQB 4JO1L 3UDWC 4ZFGL 2WAHA 5IWLC 2YZ8A 3ULUH 4ELKA 1YQ2A 3RVXD 1NJ9B 3IVKB 4R96A 3DROB 3BDYL 4PR5A 3RA7H 4RDQG 4TVSa 2R23B 1MFCH 1Z9LA 4Z77A 4UZGA 3AUVA 1UZ8A 4NCC1 3UEZA 1KC5H 4AH2B 1YN7A 5BRZB 1U9KA 4ISVA 4KHTL 1QP1A 3QDJB 3MRLA 4U1MB 4UNTA 4NKDB 5ISZE 2XZQL 1TPXC 4TVPL 1UEYA 1ZMYA 4RNRA 4H20L 1BGXH 4RMWA 15C8L 1ORQA 5KSAB 1MIEL 5MERA 5EU6A 1C08A 1IGMH 3T0XA 1KENH 3EIFA 4FOMA 5EN2A 5EUOB 2ZUSA 1FNLA 4YE4H 4CU6A 1YUHA 4KY1L 4GG6F 1WAAA 2W9DL 3B9VA 2J6EH 1N64L 4NO5B 2IC2A 4JFFB 32C2A 4UUJA 1G6RL 4K8RH 3G08B 5K59F 5IB2A 1FGVH 2FH6A 4NBXB 5F3BA 5DSCA 4Z8FL 3BDXA 4POYA 3BZFA 4HAGA 3FO9A 5E2JA 1JGEB 1UVQA 1ACZA 2CDFA 4LHUB 4OM1L 1I1YB 2NYYD 3DRTB 4XCYA 3RKPA 3RZCD 1AGFB 1OARH 5E1HB 1JPSH 1QSVA 4YHIA 2JELH 1OT2A 5FYJU 3V4UH 1MHEB 5E95B 3N85H 5MEPB 2X89D 2OK0H 3MXWH 3WL9B 3ARDC 3TJHC 3KYAA 3ARUA 1JPFA 3CXDH 5DK2B 2ZPKH 3Q0HA 5C09D 4JRYB 2XWBB 4MDIA 3S5LB 2DIJA 5HGGS 5DUPL 5CAYB 1FZKB 2O5YH 5IHUL 1QA9A 1FVCB 5HVFB 1VESA 1IM3B 4G8GB 2NY7L 4RMTA 4XVSH 4OI7A 4DVBA 2C7UA 3CUPB 4IRZH 4LSUL 1GIGH 1KB5H 3KG5A 4GAGH 2EKJA 5E5RB 4K8RL 5KVGH 2VLRD 5I8EB 2OI9B 2VXTH 4HCRL 2BFVL 4TUJB 1Z2KA 1H3WM 3RWFB 4MQ7A 5CKGA 5EBWA 2VLJD 4JRXA 3V0WH 1R3LB 4NQDE 3G6JA 3K8KA 3NMEA 1OGAA 1F4XL 1MFNA 3MRDB 1JPSL 4PJBE 1DLFL 4P0DA 1INQA 2OK0L 4U1JB 3RVTD 2P5EE 3GUTB 4MNHB 1CDUA 1EERB 1VEOA 5T1MB 2DQCH 3UX9B 5DMIH 1SYVA 5HYJE 2XQYK 5CINL 1CGSH 4DQOL 5L88L 4MQTB 5GRYA 1EA9C 5D5MB 2XYCA 4Y16B 1QEWA 1QLEL 2G75B 5IJVB 4KMTH 4XPTH 1A02N 3AXLA 2GK0A 3I75A 3L7EB 4JY5L 3GM0A 2VLLA 4PV8B 5I9QC 1U93B 4D9RE 1MCNA 5C0CE 4N1EA 4IMKA 1A7NL 5JHDB 4QNPF 2Y6SC 3ES6A 3LH2L 4PRPA 4JM4H 4FQHA 3KPSA 4LNRB 5EPMA 1N6QH 3NIDF 1CICB 1ZLWK 1BBDL 5I1JL 2QQNL 2XZCH 3DHMA 1PG7H 3S96B 1NSNL 3H9HA 5DD3L 3VDAA 2H32A 3G6DL 4F8TA 4ZOBA 1YYML 3FQRA 1CGXA 5LQBH 1H0DB 1OAUL 3BT2L 2D31B 3I6LE 3TT3L 2PN5A 1GH7A 3WFHB 4P9HC 4H1LH 4E9LA 5F3HB 2MCG1 3L3KA 3CX2A 3JV6A 1WISA 3VD4A 5C7XH 1CGSL 5CCKH 5I1DB 3GO1H 1EGJL 3WHE0 5BO1L 5DRZA 3F8UB 3QHZL 1BFOB 4PJGA 2AJUL 1U8IA 4NWTL 5DT1L 1U8KB 2AS5M 3VXMA 5E03A 5DZNA 4M02A 3MCKB 1BM3H 3NPZB 5HYSG 5LWYH 2X4NA 3TBVB 2F74B 1GCFA 2JB6B 1E4KA 4MNQD 1Y6KR 2EXYC 5TDPB 4LLUB 1VHPA 1DEDA 2BOCA 1XGQA 3M45A 4HWUA 4LRNL 4R3SA 3SCMD 1ZT4A 1BJ8A 3GRWA 2RB8A 4LCCA 5IIEB 4PJ5A 2DRUA 1NEZG 5C7XL 5IM7A 3MRGA 5CCKL 2D2OA 4CJ0A 2V2XA 1Q0YH 2BERA 4P4RB 5DD1L 1EEQA 2F19L 1FZMB 1B2WL 5GRXG 3GNML 4EXKA 1QBLL 2YD8A 3OXRA 3QI9C 4LLDB 3V6BR 2E7CA 3WYRA 4J4PA 1VPOH 1WEJL 5ANME 1I9RH 1IEHA 5FCUH 1FRGL 4X80H 3SDAD 1Q9KA 1AD9B 4OGYH 3QQ4B 1T5WB 4IRJB 3CVHA 3PWUB 4UILL 1P4IH 3L3IA 3SGEH 4WW1B 3ILQD 3S4SG 3C9NA 3WUWB 3TEUA 1KN4L 3V7MA 3BJ91 1NAKH 5GIRA 5C0FB 2YC1B 3NABL 2F53D 3NA4A 4MAYD 1NMAL 3DVNA 3M17A 4XBGA 4KDTA 4N8VA 4OQTH 2DQJL 4ZFFA 3TJEL 4EDXA 1RU9H 5LCVL 2CRMA 1MCFA 1WT5C 2FX8L 3C60A 5H37H 3T0EA 3SY0B 3ZMRA 2EDNA 1F3RB 4Q58C 5T1KA 3RL1A 3HRZA 1E6JL 3BUYB 3FT2B 2R39A 1IKFH 1B4JL 4Q74A 3TN0B 4DJMA 1VPOL 2CIIA 2V9TA 1AJ7L 1R24A 3DX8A 5FCUL 4X80L 3W5NA 1QVOB 4HIIB 1DE4B 3T8XA 3KPQA 4NC0B 1EH9A 4G8IA 1R5VA 4YHPB 1KLFA 4LMQE 1LE9B 3HS0A 1XGRA 4XH2A 3RTQC 2HKFL 2BC4B 3GJFB 4L4VA 1NAKL 3ARTA 4MCYB 2XN9D 5FYKH 1YEHH 2P8MA 1KTDA 4D9LH 1M7DB 3P30H 4WHYG 3ULSA 4RIRA 2E3VA 4IIQA 5CGTA 4OZ4A 2OMBA 2XG5A 4EOWL 2PW1A 3RWDB 3DNKA 1NJ9A 3IVKA 1RU9L 3DROA 4YK4C 1GGIH 2R23A 4XPAL 2Q6WB 3K1KC 1PW3A 3U36B 4AH2A 3VMPA 5BRZA 1OW0C 4Q6IB 4PRIE 3QDJA 4U1MA 4G6ML 4NKDA 4DEPB 1KN2L 5TDNB 5FF6B 4JFDD 2HTLC 3L3GB 1G9EA 1AY1L 4HF5L 1VFAA 1IGTB 2E6QA 5KSAA 4JDVB 4MJIB 3O6FC 2F53E 4YHOH 4B50A 3PQYE 5IBUB 5EUOA 3UXFA 1PZ5B 1NCAH 3O9WD 4GKSB 5I1CH 4D9LL 4YZFF 4OFYA 4NO5A 4JFFA 1OB1B 4FFYH 4WRLA 2GJ6B 3G08A 2WIIB 1F4HA 3K4AA 3S8WA 1I7TB 3B2VH 2R0LH 5BMFH 1ZHNB 1T0NB 1JGEA 4LHUA 4NQCE 5E8PB 2F5BL 2VLKB 3B2UD 2GAZB 4GMSL 4PB9H 4KKAD 1I1YA 3FQTB 3NIDE 5IV2B 5EWIH 2VZTA 1H3PL 1AGFA 1UM5L 5IF0B 2OR8A 5TFSH 4M6OH 5DMGD 1KTKE 4ODBD 4ENEC 5MEPA 4N90E 3M8OL 4NFBA 1MAJA 3WL9A 2EDYA 1EO7A 2DAVA 3CAFA 2X1PA 1CXKA 4UV4L 5DK2A 1RUPH 3RUGF 4JRYA 2XWBA 1OTTC 2NNAB 3S5LA 4ALAL 1FZKA 3VXUD 5KSVB 4HK0B 2XICA 1FVCA 1IM3A 5KSBE 1C7TA 4G8GA 5I1CL 3ARBD 3CUPA 4R2GB 3QUKB 1LQSR 4APQD 3T3ME 4RX4A 4XTRD 5I8EA 4XCNB 3SE4C 4UMGA 2FBJH 3HE7C 2R0LL 3QUYB 3TBTA 5BMFL 2APVA 4ZNEE 3RWFA 3IDUA 2I5YH 1DVFD 3MLZL 4M6MH 2ZUQB 1J1OL 1R3LA 4JFDE 4LCWE 4P23D 4YEFA 5F7EH 4P46D 1DBAH 4M7KH 1PDKA 3MRDA 4PJFF 1R5WB 1ZLUK 4U1JA 3PL6D 3GUTA 3H9SD 4D2NA 4MNHA 1WBYB 2HTKD 4B7IA 35C8L 4OGXH 2KQNA 2FBOJ 5FECB 3RWEB 4KC3B 1XZ0B 3EZ8A 3SDXE 5FDWB 3ZKND 5D5MA 4U0QB 4Y16A 3ARZA 1V3JA 4U6TA 1MH5B 2G75A 5D70H 12E8H 5IJVA 4WFEE 1KB9J 3JWOH 1K4DB 3L7EA 4PV8A 3T2NL 3IJYB 4IJ3B 5JHDA 4XGZB 4I0PC 2EEBA 2ZKHL 5CIPB 4LNRA 4RWYH 2EZ0D 1CICA 3D3VD 5IW1B 5TJWK 3LEXB 2O26U 2WWMD 3S96A 2F58L 2FO4B 5KN5B 5LXGH 3MV01 2I24N 1UB5B 5D9SB 2D31A 2B5IC 3WFHA 4WTZG 4PUBL 5F3HA 1HHJB 4JR9H 5AZ2L 3QWQB 3X13B 3IDIB 3UPRB 4P2YA 3E2HB 3EKCA 1PKQE 3S35L 4HIXH 5I1DA 4JPIA 3NFNB 3DXAE 2WZPD 2P5WE 2UZIL 1T2XA 3EDJA 4U1IA 1NBVL 1BFOA 2AJSH 3FOMB 3MCLH 3VXOB 4Z7QE 1U8KA 1IGCL 3U9PL 1MI5E 4XNZB 5B21A 3OAYH 5HHOD 2IGFH 2RGSA 3MCKA 2QQKH 3TBVA 4FQJH 2F74A 1HYSD 1J87A 2JB6A 3L9RB 3MA7B 4PLNC 4Z7VE 4NBYB 4KI5F 5TDPA 4R8WH 4LLUA 1R3IH 2KZWA 1DQTA 1FYTD 1OHQA 5JXED 3B8YA 1WIUA 3OJ2C 3ZE1F 2BXYA 5KG9B 5IIEA 1PX4A 1ZHLB 3S34L 4D3CH 2UVFA 2L7JA 4AL8H 4FFWD 4IEFB 4KV5F 4ERSH 1AR1D 4WO4D 3O2VH 5ILTL 5HHPB 3MX0A 4N9OB 3FZUD 1FZMA 3TZVD 1TJIL 3EJYC 1P4BL 4R4FH 3VFGL 4CMHC 4K3EL 3F65A 1UACH 4IDJL 1AD9A 3MLSL 4KROC 4JANB 3QQ4A 1T5WA 1MOEA 3DJ9A 4LPYA 4KPHH 1KCSL 4G6AC 4IRJA 5BOZG 3PWUA 1MWAH 2XG4A 3J8F7 4RCAA 1RZKH 4WW1A 3SDCC 3WUWA 3FL7A 3HPLB 5DO2C 5SWZB 2C4FT 5C0FA 2YC1A 1AQKL 3JXAA 2JLLA 4MD0B 1CDGA 5HGHB 4KDWA 3D0LA 4KJPD 2W38A 5ISZB 4ZUUB 3P77A 2EIEA 4KKBD 1XCQB 2N4IA 1MCBA 1I8LC 2NY3D 4J3WA 4AL8L 5HHOE 4Y5XB 1WFTA 4R26H 2W0KA 3M1BB 3SY0A 5D2LF 1L7TL 2IQ9L 2V5TA 4AY0A 3QDGE 3BUYA 3PDDA 3FT2A 3HUJF 3TN0A 2XKNB 1KXTB 3VXNB 3VXQB 2J88L 1BOYA 1C16B 2IH3A 1QVOA 1LO5B 4HIIA 2EC9U 3REWB 3WNNA 1DE4A 1C5CH 5C3TA 2DLFH 4YHPA 1TQBC 3DMMD 1BIIB 1LE9A 4JHAL 1YNKH 3GBNL 4UIKH 3QHFH 2BC4A 3GJFA 4UT7H 1OP5H 2AQ3A 4MCYA 4P4KB 5J3HD 4QRPE 1M7DA 4ZFOB 4C4KO 3L3DA 5EOCH 1HNGA 4PJCE 3RWDA 3ARYA 1EJ6A 4RZCB 5JR1H 3D48R 2EH8H 3OGOE 1OSZB 4K7PY 1UXWB 2J7LA 1MREH 1AI1H 4OJFL 1FIEA 4PRHB 3U36A 4Q6IA 4NUJB 1TTUA 3ALPA 3VXRD 2VDNL 3JWDH 5TDNA 5TF0A 5FF6A 4XPFL 2R29L 5SWSD 1CTOA 2VZ1A 1IGTA 1L4IA 3CXHK 4JDVA 4C54A 4MJIA 4X4ZA 2DLFL 4PLOB 2C1OB 1X5YA 1PZ5A 4NQDB 5DJDB 4GKSA 1ADQA 4Y0GA 3RNKB 1MRDH 1A7RH 2FHFA 1OB1A 1R3KB 5AG8A 2GJ6A 3H8NA 4PJBB 2WIIA 3LB6D 1IARB 4XHJD 4F7PB 1I7TA 1W72B 1ZHNA 3FO0H 2P5EB 5CMAB 1T0NA 3U6RB 5E8PA 2VLKA 2GAZA 5IV2A 3FQTA 5HYJB 1F4AA 2PYFB 1Q1JH 3S35X 5CKAA 5IF0A 3CFCL 1EXUB 1AXTH 1JUFB 2NY2D 4MS8C 5JXAH 3VGEA 5C0DB 2Y07L 4ONOA 5J6HB 3CVIL 4JRWA 1EK3A 4EKXA 4AIZB 2NNAA 3QQ9D 4ZUSB 5KSVA 1DBBH 4HK0A 4Y2OA 2X9YA 2OQJB 5IW6B 3OAUL 1II4E 2WBWB 3VU2A 3A67L 4ZO7A 4JFED 1E4XI 3FAXA 1KTLB 4XCNA 3T0AA 3GHEH 1VB9A 4ONFL 4F37K 3QUYA 2YPLE 4WY7H 5E0QA 1LO3H 3FO0L 2DTMH 5CD3B 2EDDA 5BV7L 2XXCB 1EBPA 2EYTB 3P4MB 2HFTA 2FRGP 1Q1JL 4MA3B 3EJZD 5KOVC 3BW9B 4Z0BH 4OF0A 1R5WA 4JB9L 3VWJC 3QNZB 4YC2B 4X5XB 4OZHE 5K9JH 3FJTA 5ABDE 1MCHA 3PV6B 2XRAL 2ESVE 3L95B 3FFCE 2VABB 3SKNB 5FECA 1QKZL 3RWEA 1MCWM 4YHZL 1XZ0A 2AXFB 4Y4KD 3C5ZD 5FDWA 3GSRB 2BVEA 1MH5A 2DS4A 3H42H 2CMRL 3GIVB 2CKBH 4D9QE 1K4DA 3V52L 1XIWC 3DX7B 3GHEL 4XXCA 3IJYA 1YYLL 2DKMA 3LY6A 5DEFB 1LO3L 3U0WL 3QR2A 4P5TD 5DJCB 4X99B 2PYED 4BH8B 3V0VB 4HC1H 2AJYH 5CIPA 4P59L 2ZUUA 3K74B 4CDGC 5IW1A 1LVEA 2CO6B 4JM2F 5FGRA 4G8EB 2FO4A 4Y8AA 5KN5A 4JO3H 1UXSB 2FHBA 4ZD3H 5JW5B 1I8IB 1UB5A 5D9SA 3WFCL 3AB0B 2DICA 3IDXH 5I6XB 4B0MM 1HHJA 5DVNA 3X13A 1WZMA 3IDIA 5T3XH 2LTQC 3UPRA 3NFNA 1I8MB 1D9KD 1IKNC 1NFDE 3H42L 3STLB 3L7FA 3PP4H 3FOMA 3QIBB 3VXOA 3B9KC 5FHAH 3Q2CA 5EU5B 5MI0C 5GGUB 5DFWH 2JK5B 1RUKH 4KDVA 1CDBA 3W82A 4PG9B 5C0RL 3CDGB 3L9RA 1T1YB 3MA7A 2CPCA 4WHDA 1HQ4B 1V7MH 1J1PH 3EO9H 1I3GH 1FZOB 2D9CA 3SDDD 4TVPD 1DFBL 1I85C 5FIEA 4K23H 2A6IB 1F90L 2JJWA 4N1CA 5F44A 1MJ7H 4Y19B 4V1DE 3PG2A 4KK8D 4MA1B 1BD2E 4NJAL 3OXSB 4MMZC 5KG9A 1AE6H 2VZOA 1ZHLA 1U3ZA 5E6ID 5KTEH 4J8RB 3VWKB 3I50H 2JJSC 1HN1A 2Z31C 3ULVL 5F6IC 2ZOKB 2XFXB 5HHPA 2DQTL 1CTNA 4P2QA 5C07A 5KVEH 4EI5D 2B20A 2DWDB 5CBAB 3ULUD 4ZOCA 5ACLA 1EDQA 1GRWA 1HZHL 5H37G 4XP4H 3F7RA 4PJ8B 4JFQB 3RPKA 4YX2H 2ENSA 1K3IA 1RUKL 3LD8B 5D7KD 1IILE 5EO0B 4K9EC 5E2VH 3DARA 3P4OB 3WXWL 4EUPB 4JANA 2UY6A 3T1FB 5GRVK 3EBAA 3HPLA 1ED3B 5SWZA 1S9WB 4M7LH 4OB5L 4K23L 3JSSA 1S7QB 3LQAC 2H9GB 2BDNH 3ZSTA 4MD0A 4G3YL 2DQEH 3MRPB 4M93B 5DI8B 5HGHA 1A4KB 3G5XB 5ISZA 3SCMC 4ZUUA 3KAAA 4UBDD 1XCQA 3HI6H 5KTEL 4Y5XA 3O8XB 3M1BA 3MLRL 4XP1L 3SOBL 3L5XH 3PQYB 4P5KB 1T83C 4K8RD 2V2TB 3NPSB 1MSPA 2XKNA 3VXNA 5D72H 3VXQA 3QCTH 5E2VL 1C16A 4XMLH 1LO5A 3REWA 3K4DA 2LU4A 2XV6B 4CUCA 1BIIA 4KQ3H 4LSVH 3SDAC 1AHWB 1SJEA 5HI4D 4NQCB 1EV2E 3ZT6A 4D94A 4QHNB 4P4KA 4ZO9A 3V5KB 5KAQF 4S1QH 4ZFOA 5DVOA 1FIGH 4R0LB 1JWUB 1KJ2B 1ONQB 3JTSB 1E6OH 2E7HA 1BX2B 4NJ9H 3EZJB 1TTFA 4RZCA 2QQLH 2RBLA 2VDMH 3ULUE 3CDFA 1RZ8B 5FAAA 1PG7W 1OSZA 1LK2B 4NGHH 1QD0A 1UXWA 3QXDB 1HKLL 2BMKB 2H32H 5D7KE 4PRHA 3WFDL 4NUJA 4BFEA 5L9DH 5KSBB 1EBAA 2AK1L 1UCBL 4LEXH 4ZPVB 3QCTL 1H3XA 3WKML 3UC0H 3B83A 1MF2H 3OKKB 4LLWB 4LVEA 4Z7WF 2EDJA 1S5IL 4GRLC 3JWOC 5C6WH 1QNZH 2N7AA 1JGVL 4ZQKB 4K7FB 5D2NE 3TA3D 2C1OA 1NDMB 1CI5A 4N0CC 5B38B 4LCWB 4NQDA 5DJDA 3RNKA 3MLPA 3IETB 3U30B 1C1EH 1JGUH 1FFPA 1HSAB 3ARGC 1CFSB 4JHWH 5I1HL 1R3KA 1OP3H 5JW3H 1HSBB 4PJBA 1D3CA 4F7PA 1AR2A 3DETC 4H88L 4ETQB 1W72A 1PSKH 2VDML 3TIDB 5CMAA 4O02L 3U6RA 4N5UA 2RAMA 2NTSP 5DC4B 3OAZK 1AO7E 5HYJA 2PYFA 3V6ZB 3GRWH 5I2IB 5F9WC 3SDXB 3ARFC 1TPXB 5L9DL 1EXUA 2W59A 2EDRA 2VXQH 3T0BA 2X4UA 2ZNXA 1JUFA 2VDQH 4X6DE 1NLBL 4NDMB 5C0DA 1ZTXL 5T33L 5J6HA 2Z9TA 5BVPH 25C8H 2HKHH 4AIZA 5CSBA 4P3DB 1GJIA 4ZUSA 1TZGH 5AYUH 4FTVE 4HWNA 2A9NH 2OQJA 5IW6A 2ADFH 3F7PC 1CL7I 2BVOB 3O9WC 2VNCA 5JOEA 2MCPH 1KTLA 2BVYA 2DD8H 3MCG1 1RIVL 3CVHH 3CSYB 4I9WD 1IGFH 5CD3A 4M1CD 2H45A 1RZJC 3VMOA 5HJ3B 2EYTA 3Q5YA 3P4MA 4NZTH 2IPTL 3D69B 2PO6D 4MA3A 3CK0H 1PKQB 3BW9A 4HJJH 3HFMH 2YSSB 1LEIB 4LSSL 3QUXC 5C0AD 2PNDA 3WCYA 2IPUG 4TQEH 2VDQL 5C1MB 3QNZA 4X5XA 1MFAH 4WFFE 4D0DB 1MI5B 3RWCB 1ZVYA 4R6UA 3PV6A 3AREC 1DDHB 4XPBL 4ZNCD 1T7VA 3L95A 2VABA 2AXFA 3KPRD 4BM7A 3GSRA 3OKNB 2AERT 4Z7VB 2ADFL 3GIVA 4G6KL 4EIGB 3BP6B 1YMHB 5I18L 2MQ0A 3DX7A 2MPAH 4PS4H 5DEFA 1OAQL 1J18A 4XX1G 5DJCA 4X99A 4BH8A 3VRIB 1DBJL 5E2UH 5CILL 4OGZA 2VWEC 2R9HC 1DVFC 5F7NC 4HJJL 1SBSL 2DLGA 4G8EA 4WCYL 4JCLA 4S1SH 1OP9A 2AAVA 1UXSA 4RGNC 2UZXB 4GKNB 5JW5A 3LZFH 1YC8A 1I8IA 1MFAL 2MJWA 5T5NF 5KZCB 4MWFB 1MCJA 4MXWH 2Y36H 1BEYH 4DVRL 1V3MA 4ETYA 4M62H 2X4PB 3MO1B 5H2BB 2W1NA 5DUBB 3PNWB 1I8MA 2QHRH 3STLA 1NFIB 4NZRH 4FQ2L 3QIBA 1RAMA 1CLZL 5EU5A 2WBJD 5I9QB 2A0LD 3MLVL 1D5XB 5GGUA 4I4WB 3UZEA 2JK5A 2EE2A 1J0JA 4PG9A 3HAEG 3CDGA 1T1YA 1ZLVK 1HQ4A 3A6CL 4F37F 4F3FB 1P6FA 1U8JB 4L8SC 4UI2A 1M4KA 4JFHD 5CP3A 1FZOA 2JCCE 3CMGA 2EZ0C 3OB0H 2A6IA 4UTAL 4Y19A 3WNOA 2X09A 5EA0H 3OXSA 1OAZL 1JZ6A 3VWKA 1E0OB 4RDQF 2ZOKA 4RMRA 1CD9B 2XFXA 4M43L 2DTSA 4DK3A 5DFTA 5GZND 1WQVT 3RUGB 3VA6A 3CFEB 3T3PE 3QDME 3BDBA 2DWDA 3FN0H 5CBAA 5EZLB 4QHUB 1L6XA 5F9AC 4L3EE 1HINH 1FZJB 2LQRA 4PJ8A 4JFQA 4QRPB 5EO0A 5JQHC 1KELH 4XAWH 4C56D 4HBCH 3VH8G 1AKJD 5ICXB 4GLRH 3UTPE 3P4OA 4EUPA 4PJCB 4ZODA 2UWEF 4KHXH 3D2UB 3T1FA 1HYSC 1WC7B 3CH1B 1ED3A 1S9WA 5GJTH 2FIRT 5BQ7A 5BCAA 1S7QA 2Y06H 2H9GA 1OWRM 3BN9C 3MRPA 1XCTB 5DI8A 1F4YH 4LSTL 1A4KA 3G5XA 4Y5YC 4G5ZH 5JXEC 2VLMD 1F11B 2FJHB 1QO3B 4LKCB 4ZTOH 1NGYB 3HZVA 3O8XA 1YDPA 2NCMA 3PQYA 4P5KA 1J1XL 1QSZA 3N1MC 1L0QA 1QSFD 3QI9B 5MEQB 2V2TA 1AR1C 3FN0L 4NRZB 4AEHL 3MACH 1JNLL 5GGSY 4YBHA 4LVNC 2AJXH 3TZVC 4PJIF 1KELL 2AI0L 1FAKT 4XAWL 3RGVC 5BZWB 1FVEB 2X70B 3OWEA 1CDCA 1MCRA 2R1YB 5AD0B 3BQUD 1KGCD 1AHWA 1CE6B 4NQUA 4NQCA 4Y5VC 2NLJB 5D7IE 4QHNA 3TCLB 3ELAT 1IGYB 1QG3A 3V5KA 5FYKE 2IFFH 4R0LA 1JWUA 1KJ2A 1ONQA 3EYQC 3TYFB 4BZ1L 1BX2A 4KJQC 1U8LB 5FM4A 1FNFA 4Y1AE 4M03A 4XPGH 1RZ8A 2HJKB 2NY5L 1LK2A 3QPXL 3VXSE 4ZTOL 3QXDA 2BMKA 3MXVH 4KI1A 3SO3C 1GGTA 4JGUA 3WO3B 3TFKC 5DJXB 1EVTC 3QSKB 5FFLA 5KSBA 2EDKA 4ZPVA 2BVPA 5J8OA 3CD4A 3OKKA 5F7KC 4LLWA 2F54A 1H8NA 2J5LC 4HIEB 4CN6A 4DUWA 2IBZY 2Y5TA 2YPLB 4ZQKA 1T21B 4K7FA 4FQQB 1KB9K 3MLUH 5GS2H 1NDMA 3RTQB 5B38A 3ZTJG 2FGZA 4LCWA 1T89C 5IFHH 4UOW0 3IETA 3UO1L 1HSAA 3UDWA 1CFSA 5IWLA 3ZKQD 4LRIC 1HSBA 1VEMA 4EN3C 4QXGH 4KZEL 1CLOH 1X5LA 4YK4B 5T3ZE 4LPVA 3TIDA 5IGXH 3F62A 3O4LE 4OZHB 4BUHA 1KULA 5DJYB 5F9DC 2ESVB 2JB5L 4LHQB 1FJ1B 1YNTB 5MEND 3FFCB 1FDLL 3V6ZA 5I2IA 3N1FC 3SDXA 4ZTPH 4PJDF 2QV2A 3DSFH 4WHCA 3GKWH 4CAGA 1MAML 4M5YH 5E5UB 1CU4H 2EE3A 4NDMA 5AUMB 4FQ1L 3SEPA 3IDNB 3ZO0A 1CXFA 3NAAH 4P3DA 4Q9BA 5I1EH 4WUUD 3BMWA 2R0WH 4JO2H 1FNSH 4JKWA 4OZFB 1RV6X 3SGEI 5GGQL 4WUKH 2BVOA 4NYLB 4JFYB 5IW3A 2W60B 3EHBD 4Q0XH 3WMSA 3CZFA 3T2QA 3NTCH 2EXWC 4MJ6B 5TE4H 4XHJC 5B39G 5FUZL 3RWGB 3IDJB 3SKJH 3D69A 4OLEA 2CK0L 1T7XA 1EX0A 4YHML 1PKQA 1HIMH 2YSSA 3WFZA 1LEIA 1EEZB 1MHPH 3GKWL 1NFDB 1X5KA 1LO4H 3C2AH 1CU4L 4JZNB 2FYYB 3OKYA 2VXSL 1QTYT 4D0DA 1MI5A 3DGCR 3RWCA 4F58L 3RGHA 4K2UL 1DDHA 3NGBC 1QR4A 4CKVX 1P7QD 3HUJB 5I8OL 2VAJA 1CFBA 3ZYIA 3DX9B 3NAAL 3LKPB 4NNPH 3OKNA 4Z7VA 5GHWL 3BP6A 4N9GB 3L1OH 2CQVA 5IQ9B 4GG8B 1NGZB 1INEH 5IB5B 5JPNB 1QHOA 4PLKD 5MP6H 1BFSA 1C5DB 4V1DB 3C08H 4NQVB 1PYWB 2CGRL 1BD2B 2GJZB 3KLAA 3KYOB 2ERJC 5AWNL 2H26B 2H2SC 3VRIA 5KS9F 5CP7A 1LDSA 3U0TB 3QUZD 3SKUD 5JUEL 4P9ML 1P1ZB 3H3PH 3PGFL 1OOAA 5I30H 2E8ZA 5C0EB 3MRBB 3QEQD 3ROOA 3U1SH 5ACMA 4Y4HD 2WUBL 4GKNA 1HHIB 3BKYH 2PETA 1HE7A 3CDYA 4MWFA 5KSUB 1X5AA 4OTXH 4NNXB 4MCZB 2NXZC 3DO7B 2X4PA 3MO1A 4MA7L 4NQXB 5H2BA 5DUBA 3LS5L 4M7LT 4NNPL 3PNWA 2YA0A 3E6FB 5DHXB 1NC2B 3RQ3A 4QTIH 2YKLL 4E41B 2EYSB 1NFIA 1TCRB 3BWUC 4YBLB 3MV9A 5GGTA 5D96C 3SE9H 1AC0A 4KAQH 1INEL 1D5XA 3QWRA 4JKLA 5IMKB 4I4WA 3DI2B 2GQHA 1S7VB 5D71H 4I0PB 2NY6D 1XAUA 3MBXH 2V6HA 1ADQH 2G2RB 3C6LD 4OI8A 4F3FA 4M7JH 4JHZA 1U8JA 4LASH 1E4WL 3RX8A 1FORH 3BKYL 4HLZH 2QL1A 3Q48A 4HPYH 1FC1A 1AGCB 1M05B 4L1DA 1EEYB 4LSRH 4BJLA 4WW2F 4N0FB 5CGMA 4YGVB 2YA2A 2ENYA 1WFUA 4HH9B 2BX5A 3LPWA 4YFLI 2OBGA 2EIBA 5IQ7H 3RUGA 4X6CE 2JJVA 3K8LA 5EZLA 4QHUA 2R0ZH 3SKOB 2EDHA 1F2QA 1FZJA 3HZYB 4L1HA 3QPQC 4JQIH 4YHYC 5ICXA 4M1GL 4RSVA 1U36A 5E70A 5I0DA 1I1AD 3N06B 1J9CT 4PJCA 4BFIB 2DM3A 3QXWA 3HKFA 3MJ8B 4HULB 3QXTA 3D2UA 3NBNA 4U1GC 3G04B 1OPGH 4H8WL 4LASL 4HKJB 1WC7A 3CH1A 4ELMF 2OJEB 2X7LB 4UV7H 1G9ML 1FORL 1NDGB 4BZ2L 1NANH 3SDDC 1XCTA 4ZDHB 4U2ZA 5DEZA 3AMLA 3HN3A 3V4PL 3IDGB 3PHQA 4QRQB 3VI4E 3WO4C 1S3KH 1F11A 4L4TD 3S3PA 1YEFH 2FJHA 1QO3A 4LKCA 4Z78A 1NGYA 2BSED 1EPFA 5E6IC 3SBWC 2OJZL 4RGNE 4FMFA 5IEHA 2PUQT 5GISH 3QI9A 3ZKXC 5MEQA 4XCCH 5KVDL 4FABL 4YPGB 4I18B 3F7YB 3X11B 2A38A 4CMHB 4K94H 5BZWA 1FVEA 5IEKB 4CW1B 1T6VN 3MPCA 2X70A 4KROB 5FV1L 3BUTA 3K80A 1IMHC 3VFSB 2R1YA 4U1LB 3CZJA 3NZ8B 5AD0A 5KVFH 4OBRA 3SDCB 4PJAF 4GOSA 1CE6A 4UV7L 2NLJA 1YQVH 2V5RA 3VDCA 1AO7B 4RQQB 5FKAB 3TV3L 1GGYA 3CLEL 5DURB 4E0RB 1MCOH 3TYFA 4QRSB 3FCTB 5CIPH 3CU7A 4CU7A 1YEGH 4X6DB 1GOGA 2HJKA 1WT5A 4N8CL 4ZXBC 1S9KC 4J3VA 4LLAA 1DP0A 1YEDB 3BD4A 1B6DA 4UBDC 3KJ4C 4LAJH 3M07A 1M6OB 1DQLH 4CVXB 3D39E 4U6VH 2AEIT 2P1YA 5DJXA 4FTVB 4AEEA 1B0WA 5ERWB 1FAIH 5CEZH 3V5HB 4DZBB 1WVZA 2P24B 1PX3A 2X4OB 4DCQB 1JZ8A 3FB5B 4K94L 3IT8D 3EYSH 3KR3H 3IFLH 4HIEA 4KKCC 5GS0L 3V8CA 2R4RH 2AQ1A 1TQBB 2YPLA 3I6KB 1T21A 4OCXL 3V4VH 3RVUD 4FQQA 1QSEE 1RJYB 2Y72A 4KRPC 1MCDA 4JZOB 3RTQA 2NXYC 5CHNB 3THMH 3UTTE 1QBBA 3T2PA 4HS3B 5ALBH 1YC7A 4P2OD 4KUCD 3UTSE 5CLWA 4OLWH 2ZUTA 5JW4N 5DGRA 1JTPA 1LMKA 4OZHA 2YD6A 1ZWIB 5DJYA 2DM7A 2GI7A 2ESVA 3W5MA 1FJ1A 1YNTA 1CFQB 1OW0A 2EDXA 2JF1A 3RP1A 4GH7B 5TQ2L 5CEZL 2I60L 3ZDZE 1YEJH 5DRWB 3V8OA 1FFRA 2HT3D 3LN5B 3PJSA 5AUMA 2FEDD 4KK6D 2R4RL 1NCDL 2H1PH 2O5ZH 3BP5B 2HT2D 3IDNA 3V4VL 1KNOB 5IFAH 4MB3A 1S7SB 4XC1L 4OZFA 4HJ0D 4U1HB 4NYLA 4JFYA 2N7BA 2W60A 4NFCA 1Z3GL 3ZKMD 4OLWL 3KS0H 2GITB 1V7NL 4DKFH 1X4XA 2O5XL 3ULVD 4MJ6A 5IB1B 4HV8B 1NQBA 4XPHL 1CD8A 4S2SA 3RWGA 3IDJA 2HVJB 4PRAB 4PYGA 4OM0H 1P69B 2BSRB 4N0UE 1EEZA 1TNNA 1YEJL 2ADJB 3WSQH 1RIUL 1DJSA 1NFDA 4O4YL 4UOJA 1BFVL 1MFEL 1G7QB 3QCUH 4JZNA 2FYYA 5IK3B 4HUMB 4KKNA 5D1XD 4OZIE 3H9YA 2O5ZL 2BK8A 3HUJA 3P4LA 2LE9A 3GIZH 3DX9A 5DQJB 2A1WH 3LKPA 4IBLT 5F70A 5IFAL 3IKCA 3BEVB 4AMKL 4L8DB 4MD4B 1YY9C 4N9GA 5DRXB 4JFOB 2JCCB 1DQMH 3OSKA 4IMLB 5F1NB 3VI3F 3SE4A 5GS1C 4GG8A 2V7HB 1NGZA 3DO3A 3HE7A 5I8KH 1OAXL 5IB5A 5JPNA 2IAMC 1R5IB 1T20B 4LL9A 4NQVA 4ODSL 1PYWA 1BD2A 2GJZA 3KYOA 5HI5D 2H26A 4FZ8L 2YMXH 4HUWB 1HILB 2GEEA 2M8XA 3U0TA 1AFVH 5IMOB 1P1ZA 4WNQB 4NUGH 4Z7NF 4M1CC 2WUCL 1R6VA 3MRBA 3NOIA 3EYUH 3VWJB 4HX1B 5DLML 1HHIA 4FP8H 2AGJL 4HXBH 1TJGH 5KSUA 1CR9H 4NNXA 5GJSL 4MCZA 4L3EB 3MGAA 3DO7A 3GIZL 4NQXA 4PRBB 4JQXC 4KTYA 4YHKL 1OAKH 3E6FA 5T3XE 1NC2A 3QEGL 3HNSL 4CBPA 4E41A 1DL7H 2G5BB 3DUSA 2EYSA 1GC1H 1TCRA 3MRNB 4JRXD 2ITDB 1DQML 3UJJL 1XIWB 2IG2H 5JO5B 5I8KL 2X4QB 4M6NH 5FGBC 5IMKA 1OGAD 5EU6E 1DBKH 1S7VA 4U49A 2F9BT 4TSAH 4I0PA 3Q5TA 4M1DH 2C1PA 5F71A 5FB8B 2G2RA 2RHEA 4YWGL 2C5DC 3X3FL 4YLQT 4ZFOL 1BQLL 3OZ9L 4NUGL 4HKXB 5E6YA 3MGOB 2C3GA 3GB7B 4NQSB 1J05B 1J8HD 5F8QC 1W72H 3IU4H 4D0BA 1AGCA 2VRAA 1M05A 4TYUA 1EEYA 1A5FL 4XC3L 1SM3L 2DN7A 3UP1A 1N0XH 1JCKA 4N0FA 3RY4A 4ODXB 2LTQB 5EU4B 4YGVA 4XVJL 3S6CA 3ILPB 3TO4D 1RMFL 3EJJX 4DN4H 4HH9A 3I2CH 2IPUK 1RK1B 4GQ9H 3U83A 3ZYOA 1X9QA 1OLZA 4PRPD 3B9KB 4M5ZH 2B4CC 3KPSD 2IG2L 3MRIB 1GSMA 5MI0B 1QRNA 3SKOA 3TIEB 3HZYA 1L9NA 1U3HC 2H6PB 2ZCHH 4JVWA 3JVGC 3O2DL 1CGUA 3TYGH 3I3DA 4BFIA 4JFPB 3MJ8A 5F93C 5GZOC 3G04A 4POUB 4Y1AB 4HKJA 2NX5E 2VC2H 3VXSB 2EEDA 1CG9B 2ITCB 2OJEA 1D5IH 2X7LA 3MRMB 1BWWA 1NDGA 2YBRB 4R4NC 2AABH 3E3QC 4ZDHA 2VDOH 5E8DH 1Z9OA 4S0TD 3IDGA 4QRQA 3AM8C 5FYJH 3RBGA 3OAYK 4JRXE 1CXEA 2EIZB 2W9LA 3G6JE 4OCNC 2QKIB 2Z31B 4DN4L 3VXMD 2MFNA 5F6IB 3TLRA 4UB0L 1P53A 1E28B 4ODVH 4WEBH 4BK4A 3MYJB 1UM4H 3RY5A 5IHBA 3VW3H 1TQCC 4YPGA 5L8KB 4I18A 4EVNB 2HFEB 3F7YA 3X11A 3I84A 5IOPB 5IVOA 5IEKA 4CW1A 3RWJB 3TT1L 1U2CA 4LVOC 4FFVD 3MV8E 4U1LA 3NZ8A 3SDCA 3AFLA 3O4LB 1IAKB 4PJ5D 2L0DA 4WFHE 5I19H 1Y6NR 4RQQA 3BKCL 5FKAA 2OYPA 1T1XB 2VDOL 4E0RA 3FB7A 3MBEB 5DHYA 4DAGH 4QRSA 5EC2B 4FNLH 3NCJL 4KK9C 3FCTA 5D7LE 1PLGH 4GMTL 4DK6A 1I8LA 4XI5D 2C3VB 4X6DA 3TVMD 3TWCL 1K6QL 3BWAB 1YEDA 5FUCC 3EAKA 1M6OA 4CVXA 1A14H 4FTVA 5IVZB 2BJMH 3VW3L 5ERWA 1BECA 5C6TH 2IMMA 3V5HA 4DZBA 5GXBB 2P24A 1A6VL 2X4OA 4DCQA 3OV6A 3FB5A 2W91A 5JOPD 2MSPA 3HMXL 3I6KA 4NM8H 5DFVD 4LAQL 3SDAB 1RJYA 4JZOA 5CHNA 4LU5L 4DN3H 1V3KA 2EDFA 3L6FB 2VZVA 3RJDA 4OBSA 3BQUC 4HS3A 3VG0H 4BH7B 2QADD 3PP3H 4HXAH 3U4BL 4KZDH 2P45B 1DCLA 5T1KD 5EO1A 3RDTD 3EFFB 1MNUL 4JG1H 5CP3H 3G6AB 2DBLH 1ZWIA 4NO2B 2DL2A 5TE7H 4X6BB 4YDIL 4QCIB 4FQCL 4L8BB 5J89A 1CFQA 5IESH 2D03H 2BJML 4Y4FC 5HGDB 4QOKE 5DRWA 1PEWA 2PR4L 4TSCH 5BJTB 1K4CB 3LN5A 4L4VD 3QRGL 4G8FB 1DANU 3BSZL 1KIPB 3GM8A 5K9QI 4GRLB 3UJTL 3BP5A 1L9MA 1S78C 2PF6A 4TNWK 1KNOA 4PJ7F 5DR5H 5DJAB 1S7SA 4HK3J 2UWEB 4MXQD 4U1HA 3ARGB 3T1WA 1XH3B 1P2CB 1TENA 1NH6A 5AZEH 1WZ1H 5HVGB 1HHGB 3UYRH 5BRZD 4DW2L 2GITA 4C59B 3X3GL 3QDJD 4G43B 4JG1L 3W39B 1UWXH 5TGBB 5IB1A 4HV8A 3UTOA 5HHXL 1JTTA 4GW4B 2V17L 4PRAA 5F9WB 4OSUH 4UT9H 5KSAD 5JOPE 5DD6B 3FQXB 3LEVH 3ARFB 2BSRA 1UWEL 1Z9SA 5BVJB 4PPTA 2ADJA 4BKLB 4I3RL 4N1HB 1G7QA 3PWPE 5IK3A 3O6KH 5JQ6L 3MZGB 3CFBB 4FXGB 4LSDA 2CR3A 1N6VA 4OFYD 3T0EE 1ZXQA 4HUUA 5DQJA 1U8MB 2IWGA 1ERNA 4YXKL 5CZVL 4MLIA 5AYQA 5HDBE 3BYYA 2YN3A 3BEVA 4XNXL 3D87B 4L8DA 1WF5A 4MD4A 2VXVL 3BE1H 1EHXA 5DRXA 1O0VA 1XF3B 1S7XA 2JCCA 4IMLA 5F1NA 1A7OH 3K4ZA 2V7HA 1KJVB 3VD7A 2F8VA 2C9AA 5BS0D 2VQUA 1R5IA 1T20A 3FQUB 1HKFA 3U7AA 2KBGA 3O6ML 4X7TA 4HUWA 1HILA 1QLRB 1A7QH 1N26A 3LS4H 5L2JB 4OSUL 4KFZC 4YDKL 5IMOA 4WNQA 1KJ2H 1XGYH 3QUXB 2Z8VC 2J4WL 2HH0H 1KCVH 3VWJA 4JRYD 4MMXC 1NUFA 4GRWF 4HX1A 3C6SB 4UOW1 3GMRA 5SV3A 4M9PA 1G1YA 4X6CB 4P2CG 3VGAC 2VXUH 4UDUB 3AREB 3EFDH 4L3EA 2GSIB 4KRMB 4PRBA 4N8PA 4HQQL 4RX4D 1AP2B 2B2XH 5BRZE 4HT1H 2G5BA 1C5BL 3MRNA 2ITDA 1A7OL 1XIWA 2MQ3A 5JO5A 1FFOB 2X4QA 3K1DA 2E27H 1CBVL 3S36L 3B4NA 3S3SA 5FB8A 3QIUD 4XP9L 3EOTH 4XNYL 4W4OC 3FB8B 2NW3B 1DVFB 3C5JB 2VZ3A 4LIQE 4XNQB 1KJ2L 2KH2B 4HKXA 3MGOA 3GB7A 4CRPA 4JFFE 1NCCL 4NQSA 1J05A 1F3DH 4RGNB 1INDH 3SGKC 2A9MH 3EDEA 4GAJL 1SMOA 5IFJB 4Y16D 3NCEB 4G6FB 2OP4H 4XB8A 4OF5A 5C08E 4HH8A 4FQIH 4QGYA 4ODXA 3H9SB 5EU4A 4JPVH 4HMEA 3ILPA 2HMIC 3DGGB 3QFDB 1KF9B 3NVQA 4MXVE 1IKNA 1RK1A 2R4SL 1TVHB 2VH5H 4YXLL 3KPMB 3B9KA 1VENA 4X5WA 5CUSH 3MRIA 3VGGA 3F5WB 3TIEA 2H6PA 5DS8B 1DUZB 1DUYB 1UH3A 5DD0L 4GAYA 2FX9H 2CR6A 5E1AB 4BUGA 4JFPA 1CZ8L 4L8SB 4Y1AA 4G8GE 3WXVL 5HYSB 3FFDB 3VXSA 2ITCA 5JPMB 3K3QA 4NO3A 1I85A 4GXVH 3MRMA 3C6LC 3OPZL 4KJYB 6FABL 5EORH 2D7PA 2YBRA 2DLTA 2M2DA 5E4IA 5TPWL 2HLFD 1ZEAH 4YFLF 2ZG2A 5DK0B 1NUDA 1D7FA 4H0GA 3OKMA 2VR5A 3IU3B 2EIZA 3D9AH 4KK5C 5GS2D 2Q8AH 2JJSA 2QKIA 2Z31A 3CFKB 2GY5A 1E28A 2VH5L 5TE6L 5FK9B 3WNMA 4W81A 3KS0J 4MD5B 4QWWD 3RU8L 1NEZB 1QSEB 1CFVL 3MYJA 2EDOA 1X7QB 1J12A 4NQEE 3F58H 1FO0B 3V79C 4W6XB 3UTTB 1I3VA 3MV11 4ZUVB 1XR9B 4EVNA 2H3NB 2HFEA 2W9EL 3O81A 2X42A 3WLBB 5F89B 1RZ7H 3UTSB 5IOPA 1LDPH 3RWJA 4PP1C 3DTXB 1JPTH 2XI9A 2B1HH 5D5ME 1G7HB 3OKEB 3BP7B 3O4LA 1D5MB 1IAKA 5INDB 2YUZA 5KS9B 4XNUL 3P9WB 2GYSA 5JHDE 4NIKB 1WCBB 3AC0A 4RRPG 4Y5YB 1IC1A 3FO2B 1FYTB 5EC2A 3SCMA 3RVVC 2P4AB 3P9MB 3UBXG 4ZSOE 5E7BA 2C3VA 1JNNL 4XAKE 3BWAA 1UZ6F 4QXTB 1U42A 4LCIL 1TDQA 5GRVL 2DYPD 3QEHB 1X5HA 4NZUL 1T83A 3OBAA 5B3JE 3WUZA 5IVZA 1U8OB 4XBEH 4LVNB 2X6MA 4XMPL 2YRLA 5A2KH 3RGVB 5IVXE 1RZ7L 1T7ZA 5IP4A 4PJXF 4H5SB 4G9FD 1SQ2N 1KPUB 3D18B 5LG1A 5FYLH 1QRKA 3KPPB 3SDAA 5GGTH 4Y5VB 4OCYL 3L6FA 4M8QB 3OTTA 4DZ8B 3BPCB 3DRQB 3VFNB 5JHLL 4BH7A 1YPZE 2G60L 1B90A 2X9XA 2OS7A 5IHZB 2FO1A 4PGZA 1MJ8H 1ZK9A 4NN7C 1N8ZB 1IC5H 3EFFA 3VFMB 4K3DH 1HCFX 4WU7B 3G6AA 4JREC 1NLDH 2DLHA 3SQOL 4NO2A 2IMNA 4X6BA 3ZDXF 2ARWA 4QCIA 1ORSB 4L8BA 3SO3B 4JO4L 3ZL4H 4FQLH 2OZ4L 1L6ZA 4P9HH 5HGDA 1NCNA 2Y9RT 4U3HA 4U4BA 1NCWH 1DN0B 2LABA 5E2TL 2E5EA 2NW2B 5BJTA 1K4CA 1LP9F 2K7QA 5C86A 2J5LB 4G8FA 2CUMA 1ZE3C 3MJ9A 4GRLA 4JN1L 3NFSH 4OCMC 1KXVC 5EBLB 5L8JB 4GLRI 3S36X 3TBYB 5DJAA 5E9DB 3O4OB 2UWEA 3RVUC 3MOAL 3E6HB 3ZE0F 3ARGA 1NUGA 2DI7A 1XH3A 5J11C 1P2CA 3IJHB 3MLYL 4EN3B 4ELMB 4PGCB 1CE1L 1HHGA 5C9KA 1UWGH 1YEKL 1RUQL 3HG1E 2HA1A 5A2FA 3W39A 2BNUB 5TGBA 4BK5A 4GRMB 2AV7B 4GW4A 2Q86B 1IC4H 3QCVH 2EDBA 2CXKA 4K7PH 5DD6A 1BP3B 4PJEF 3FQXA 4MJID 3ARFA 4AEFA 4M48L 5BVJA 4LLVB 3U82B 2VN7A 3G9AB 2XTLA 4BKLA 5C3LD 2FX7L 3LEYL 3VXRB 3BD5A 2GKIA 4PJ9C 3CFBA 4FXGA 1OP3K 2WP3T 3VRLF 2GJJA 2ICES 4HEME 4NNYB 5T5FL 4LDLB 1LK3L 4RISH 4PJIA 2GJ6D 1FGNL 1U8MA 5EN2B 4U1KB 2DB8A 2HT2C 1UENA 4O5LH 2A77H 5E94B 2MHAB 5J6GB 3V9FA 1UJ3C 3O9WA 4PD4J 2VLKD 1XF3A 3UTQB 3RX7A 1KJVA 1UWGL 4BSVB 5EU3B 3FQUA 4FQPA 4J3TA 1VDGA 3FO9B 5L2JA 3QCVL 3ULVC 4PP2B 5L6YH 1RURH 1VGEL 3QUXA 1IRAY 2Q87A 1KUMA 3C6SA 4OLUL 2XWJB 3TC9A 1ZV5A 1KJ3H 4IOFD 4Z5RB 4X6CA 4UNUA 3HE6C 1WTLA 4UDUA 3AREA 3HC3H 3NGBB 4U6YB 2GSIA 1TJHH 1ZOXA 4R2GD 5F7DB 4RISL 4KGJA 1ZHBB 4JEGB 5D1XC 1AP2A 3KWWB 5ADPH 3MA9H 3QUYD 3KNBB 3DUHA 4O5LL 4GSDL 1GGCH 1DQDL 1Q8MA 1H3TA 4RGOL 3QISA 3VXUA 2NX5B 3Q1SH 5KAQG 2YS4A 1FFOA 4XWOC 1HNFA 5I73C 4JFEB 2BY1A 4MJIE 4CU8A 5HHQB 2ERJB 3UPAA 2QHLA 1RIHH 3GMNB 4KMLB 3RJQB 4DGVL 3FB8A 4LPCA 2NW3A 1DVFA 2WW8A 3C5JA 3FMGL 5EBGA 3A6BH 4XNQA 4JZJC 3RAJL 1EMTH 4S1DD 3ISWA 4MA8H 2K3TA 3MUY1 4JHBA 3SDYL 1X5IA 5GS0D 5IFJA 4J6RH 2NXZB 1VFOA 1TETL 2FGWH 4F7MB 5CD5D 3H9SA 1A9EB 1DBMH 1V5JA 3DGGA 3QFDA 2GUOB 4OD3H 1GGBL 1RUMH 1TVHA 1A7PH 1CIDA 3MV8B 3KPMA 3IJSB 5D96B 1C8PA 1P7KB 5F8RC 3F5WA 2GK0B 3I75B 4KQ4L 4YR6B 3GSNB 5DS8A 4Z95L 1DUZA 1DUYA 3B6SB 1QBML 5D7LB 5E1AA 1FG9C 1GHFH 4OZFH 2AEQH 4L8SA 4AK1A 1E4JA 1QQDB 3A6BL 4PLJD 4RFEB 5CEZD 3EOYG 3FFDA 3LV3B 5HYSA 5JPMA 2YD1A 2DI8A 4MA8L 4KJYA 2QSCL 5DHVB 1KLGA 3H9HB 4ONHB 4GKZB 2R69H 3K46A 4YJZL 2AK4D 1CGVA 4Y8DC 1ZLWH 4M8VA 1F6FB 5ESVB 2YK1H 5DK0A 5FUOH 4NSKB 1FH5L 2K7PA 5JW4R 2A73B 1LO0L 5H35B 4WHTB 4AEIH 2OMNA 4XX1E 3CFKA 3PHOA 4UQ2B 3WNPA 1JHLL 4JFZL 1A7PL 5FK9A 1IEBB 1QFWL 4MD5A 1NEZA 1QSEA 3TO4C 5HHMB 1U8NB 1X7QA 1FO0A 3BXNA 3UTTA 1GOFA 4OF8A 1G7MB 1XR9A 1NL0H 1OCWL 4ZUVA 2H3NA 3ZE2E 3OB0K 4F7EB 4YHYB 3HZMB 3WLBA 5F89A 3UTSA 2OL3L 2FSEB 4JKPH 4A6YA 3EDFA 3DTXA 4HAFA 4U1GB 1X6NA 3OKEA 1AGDB 3BPNC 1URLA 1D5MA 5EOQH 5HY9B 4OZGE 3WS6C 1KBGH 5INDA 1HWHB 1PZUB 5KS9A 2P49B 2F5AL 4KUCF 4YUEL 2R69L 4LARL 5FHBH 2I07B 3RL2B 1WCBA 1A6AB 1FBIH 4Y5YA 1FYTA 4QOKB 5CJQL 3WO4B 5A43C 5JXEA 3BHBB 3P9MA 4AEIL 2JE8A 1KXQE 1MFBL 3GJEB 2VITB 4QXTA 4YAQB 3WIHL 3QEHA 5E6IB 3HTLX 3AS1A 2B1AH 3G5YB 4YQXH 5I15L 4DOHE 3ZKXB 4WI9A 3MRKA 4HG4J 5FGSA 3FHAA 1U8OA 1T03H 2DLIA 3TZVA 3GDBA 1G6RB 4MGXA 3RGVA 3VCLB 4H5SA 4JKPL 1KPUA 4OLXH 3D18A 4LLQB 4DGIL 1QFUH 3BZDA 1WBXB 3KPPA 4AG4L 5ISZD 2RCSH 3OG6B 2BRRH 5E2WH 4Y5VA 2D3VA 4M8QA 4DZ8A 2R2HB 3BPCA 3RZWA 3DRQA 2ED7A 3W11C 2OR9H 4KJWD 3VFNA 4U33A 1UC6A 3MZTA 2AXJA 2VISB 5IHZA 3AY4C 5L2KE 1N8ZA 4LSQL 3ULVF 5EZIH 3VFMA 2GTZB 3PWPB 1KEMH 4RMVA 3R1GH 1CD1A 4X9IA 4ZXBB 3WLWD 4EDXB 5J06A 4WU5B 4RAVB 1ORSA 5F6HI 4EUPG 3TVMC 2Y7QB 3T0EB 2BVUA 4WI2A 1UFUA 2R2CA 4C57C 1WAAF 2JJTC 3QJFB 1IAIL 2NW2A 4QTHB 3UJIH 3VMNA 1RHFA 1A6UH 4P4KD 1JL8A 1RUAL 4HD9A 4N5ED 5INCB 4LDEB 4WEMB 1CK0H 5EBLA 1F3DJ 2OTPA 3W2DH 4KRPB 3KPQB 4ODHH 2NXYB 2BRRL 3TBYA 1T89A 4P2QE 4GS7C 4ZS6D 5C07E 5E9DA 3ZTNH 4QHKJ 1SEQH 1N4XL 4KMQA 4Q2ZB 3E6HA 3NACH 2BZDA 3KPLA 4LRIA 3IJHA 4EN3A 4ELMA 4PGCA 4I3SL 2EE9A 4OZ4B 1T66D 3HB3D 4OAWA 2PW1B 5I66B 4IRSC 2BNUA 2X10A 4GRMA 3RDTC 2AV7A 4M00A 2DDQH 3AU1B 5SWZE 4J1UB 2Q86A 4TUKH 1RFDH 3BMVA 1YEIH 3L5HA 2IH1B 3R8QA 4LLVA 1F45A 2FATH 3I6GB 1T1ZA 1IT9H 2AW2A 2IADA 3UJIL 3VXRA 2XKSA 4NQDD 1A6UL 4K55A 1VFAB 2P47B 5HYFA 4HIJB 4NNYA 1IQWL 4NWUH 3W2DL 3WD5H 2XY1A 2APWA 1N5AB 3EYVB 3HI5H 4U1KA 4E42B 3NA9L 4JPKL 4Q6YA 2CRZA 3CPLB 1SEQL 5E94A 3O45B 1CVRA 2P5ED 1P84J 4EXPX 3NACL 2MHAA 3GKZA 4ONGH 3V6OC 5J6GA 2BNRE 4OGAD 4G6JL 1OTUC 5GGVH 3UTQA 4PJAA 1JMZA 4HFWB 3RHWK 5HYJD 3P3YA 3GK8H 4U3XA 4BSVA 4M9OA 3ULUL 5EU3A 1A6WH 1JYXA 4HGWB 3FAWA 3NIFF 3NCMA 3RA7L 1MFCL 5C08B 2G5RA 4TUKL 7CGTA 4PP2A 1YEIL 1KC5L 4D9RD 4JY6B 5C0CD 5B38G 1HK6A 4M3JA 2XWJA 2VL4A 1G1CA 3MLXH 4Z5RA 4XMKH 1BGXL 5I76B 2XTJC 1EIBA 4HUNB 4U6YA 1MRFH 5F7DA 4XRCB 2OXHA 1IGML 4PJHE 1ZHBA 3SJVE 1KENL 2DQIH 1WZKA 3NCYS 4PRHE 4XP6H 3GHBH 3KWWA 1A4JB 4N0YH 4YE4L 3SGJC 3GBLA 1D5BB 3KNBA 2ARJQ 5DA4A 3I6LD 2NX5A 3UBXI 2ZP0T 2J6EL 5GS1B 1X5GA 3GK8L 1JYWA 4JFEA 2IAMB 1FGVL 5HHQA 4OIBA 4ZUWB 3VDBA 1X5XA 3W81A 1PQZB 2DQUH 1B3JA 5HI3C 3TBTB 4MHHG 3GMNA 4FQXC 3ZYZA 1DSFH 2PCPA 1A3LH 5D6DC 1I4FB 2YUWA 3E8UH 4Z7UF 5MHSE 1OARL 4EDWH 2HFFB 2YD3A 4NO0B 1GPOH 2JELL 3V4UL 1MRCH 1JGDA 3N85L 4PJGF 4X6EB 4XMKL 3MXWL 4NQEB 5D7SH 2NR6C 2WP3O 4F7MA 1A9EA 4U7SA 3CXDL 4L3CB 2ZPKL 4Z18A 4N0YL 4CN1A 3H3BC 4HDIB 2GUOA 2Q76B 3GJFK 2O5YL 3K2MC 4WTZA 3MV8A 3IJSA 4TSBH 4Q9QH 4XVSL 3VA2C 4HWBA 4IRZL 4L5FH 4Z9KB 1GIGL 1KB5L 1P7KA 4GAGL 1YMME 5ESAB 2P43B 2EKSA 5KVGL 4YR6A 4UDTB 3GSNA 2VXTL 4RGMC 1BLNB 3B6SA 1SY6A 2AJZB 3NZHH 5D7LA 3KPOB 2NY5C 3V0WL 1DSFL 4ZSOB 4NKIH 1QQDA 1A3RH 4RFEA 3A0OA 3MQIA 3LV3A 3NH7H 3QIUC 3HNTH 3BRGC 1V8HA 1NMBH 4OCLC 5DHVA 3O0RH 3O41B 4ONHA 3C5SA 3VGBA 4GKZA 3ZDYE 6CGTA 4O9HH 5ESVA 3TBSB 2Z0BA 1RULH 3P4NB 1ZA6B 4NSKA 3QXAB 2A73A 4YEEA 5FYJE 5H35A 4WHTA 2DQCL 5IVXB 3JBG7 5DMIL 2QR0B 4D8PB 3SPVB 4UQ2A 5ADOH 3BRDA 4JPIB 2OTUB 1KCRH 1IEBA 1OAYH 3PWLB 4X7SH 4IOIB 1ZSDB 3PWJA 4U1IB 2C3WA 1LILA 1U8NA 4PB0H 4KMTL 4XPTL 1JPGB 1U3HB 1G7MA 3EDDA 1J0YA 1J5OH 4F7EA 5EO9B 1MCPH 4BSJA 3MRFA 3HZMA 5KVMC 1YPZB 4HGMA 1M7IB 2FSEA 3EW3B 1U92B 5ICYA 2HWZH 4JM4L 3QH3B 2YD4A 2AV1B 2YD7A 1KPRB 1A3RL 1AGDA 1N6QL 2B0SH 5HY9A 3HNTL 2XZCL 3VGDA 3LIZH 3GZKA 1PG7L 5CEYB 5D7JC 5BXFB 4C4KT 2I07A 3RL2A 5EIVA 1A6AA 5LQBL 4ZUTB 4QOKA 2GCYB 3BHBA 5HDQH 2Y25A 4L8CB 5IBLD 1REIA 3GJEA 2VITA 4YAQA 2UUDH 2EIDA 3HR5B 4LOUC 4PJ8D 5E6IA 2EDWA 4U05A 2BSSA 3GO1L 1KCRL 3G5YA 1OAYL 4AQOA 4X7SL 1RZFH 1HXMB 2VJXA 1U3JA 3F12B 3I3BA 1G6RA 4QWWC 2H2PD 3VCLA 1BM3L 1O5DT 1UH2A 3JWNC 5LWYL 3CMOH 5JA8B 4LLQA 4MAUH 1F6LL 4KVCH 1WBXA 3HG1B 4PRID 4C56B 3QNXB 2R2HA 4QF1B 4LFHG 4GG6E 2QSTA 3O8XD 1UT9A 2BNQE 2VISA 3UTZB 3BPOC 3PQYD 4OLZH 3D0LB 3J7HA 4Y7MA 2GTZA 5I1IH 3MGTA 3P77B 3PWPA 5K59E 4ZXBA 1MLBB 4WU5A 4RAVA 1CF8H 4F80A 2HVKB 2DWEB 3ME0A 1T0MB 2Y7QA 3D6GA 4L9LC 2CLZB 1Q0YL 1N7MH 1NBZB 3BVNA 5EUOF 3FO1B 1RZIB 4Y19E 1SJHB 2IQAB 5EZOH 4PGBB 3FOLB 3QJFA 1QSFB 4QTHA 3GMOB 4NQCD 1I75A 4HCRA 1I9RL 5EBMA 5INCA 2IH3B 3D25B 4NM4H 4OGYL 4JFXB 2CDEB 4M4PA 2NZIA 5C71A 3IFOB 1P4IL 2NTFB 4LPTA 4N90D 4Q2ZA 4FG6C 1MJJB 1GOHA 3GMLB 3Q6GH 4KI5C 1YJDC 3L3DB 4OLZL 2FEEL 3SN6N 4RWHA 4MVBC 4OQTL 1YZZA 1GVIA 2NY1C 2EC9T 4BQ9A 5I66A 3GI8H 4URTB 5GQBA 1A47A 4HPOH 2FL5B 2QSVA 5M7QA 1A3QA 3AU1A 4J1UA 5ITBH 2XXMB 1N7ML 1AD0B 4Y4FB 1N6UA 3ET9F 5FXCH 2IFGA 2IH1A 4M7ZC 3RIAF 2AKRB 3FTGB 5T1DH 1IKFL 3I6GA 3U7WH 2V5SA 3MUZ1 4LCWD 4X7EC 4HIJA 1H5BC 3UZVB 5DQ9B 2YRZA 3CGTA 2PTVA 3QAZC 1N5AA 4KTEH 3EYVA 4E42A 5CZXC 2NZ9C 3T65B 2L7UA 4YHNB 2DIAA 3CPLA 3O45A 2Z93A 2JIXB 5FYKL 4K9EH 1YEHL 3GSOB 4OCRH 3P30L 3BESR 4U1SB 4AENB 3RPIB 1FCGA 4HFWA 4XCFH 1J0HA 5T3ZH 4NHCH 4PFEA 4HGWA 3OF6A 1RVFH 1GGIL 4QNPE 3LQAH 4UT6H 4WFED 5C08A 5ITBL 4P2RE 1EGJA 4TTDC 3I02A 4O58H 4UINH 1MCIA 4NN6C 2KPNA 1WICA 4JY6A 5MENB 4NC2B 4FMKA 3ETBF 5I76A 4TOYH 1I9JH 5IBTH 1Q72H 4Y88A 4XRCA 2FJFB 4Z0XB 1A0QH 3TPUB 5SX4H 4DKEH 4P5MB 4YHOL 3W0WB 1WBZB 3DVIA 4BQBA 1A4JA 1CD0A 3WS3B 1D5BA 1EFXB 3QUMB 1NCAL 3N0PB 1BF2A 5DQDH 1G9MC 3S88H 4DTGH 1QHPA 4F8QA 5GS1A 4FFYL 1PG7X 5E56A 2F54E 2AJVH 2IAMA 4ZUWA 4LPUA 3B2VL 3DXAD 4NHCL 2P5WD 1PQZA 3UAJC 4Q9CA 4NZDA 3TJHD 5C8JB 5T1LB 1MI5D 2ZSWB 4PB9L 1I4FA 5EWIL 2J8OA 3CLFH 5GGRY 1BF8A 2R0KH 4IOSD 4P3CH 5DZOA 2HFFA 4NO0A 5TFSL 4M6OL 1RJCA 3VGAB 1YN6B 3Q6FB 4X6EA 1KPVB 5GGSB 4NQEA 4K3HA 5IBTL 1Q0XH 3I9GH 4L29B 2YD5A 3OX8B 4JQXA 1WLHA 1D6VH 4L3CA 1RUPL 3I85A 1BBJB 4HDIA 2Q76A 1W0WB 2XY2A 4MZ3A 4LMQI 1EHLH 3IF1B 4JQVC 3MV7E 3CU1A 5DQDL 4DTGL 2M26A 4OZGB 2BVQB 4LGRB 3MJ9H 5I1AA 5ESAA 2RFXB 4OCWH 3SQBA 2B7DT 4S10A 4UDTA 4POZC 1BJMA 2FBJL 2YOCA 2J8HA 4Q9RH 1WITA 2DQDH 5D1ZC 1BLNA 2AJZA 2I5YL 1HYRC 4M6ML 2NY4C 1EO8H 3KPOA 1B6UA 4U0RC 3HC4H 5KZCD 4PIRF 3RHWF 4ZSOA 3V6OE 5I1KH 3QFJE 2G9HB 5F7EL 1DBAL 4M7KL 5GRJH 3MRRA 3O41A 2E7LC 1S5HB 4DOHB 5K33A 2P8PB 3TBSA 4PJEB 5FYLD 4S1DC 4DGYH 3P4NA 1ZA6A 3QXAA 4OGXL 5GS0C 5C2UB 5IVXA 2BXZA 3BKJH 2QR0A 2ZZUT 4D8PA 1JRHH 3SPVA 1EHLL 2Y6SD 2OTUA 5EFIA 1AIFB 5E99H 3PWLA 1N59B 4IOIA 2PXYC 1ZSDA 5D70L 4KUZH 12E8L 3L7FB 2AVGA 1JPGA 3JWOL 4IJ3C 3CDCA 1U3HA 1NC4B 4PRDB 2VDPH 1T2JA 2D4DA 5EO9A 4Q9RL 2VDKH 1YPZA 3JVGA 1Q9WB 3RWIB 1M7IA 5BZDB 4QXUH 4NFDA 1U92A 5L2KB 3HC4L 5C0BE 3QH3A 3QDGD 2AV1A 3IAQA 5I1KL 1KPRA 4OLYH 3SGDI 4AYFA 4RWYL 3WN5C 5F96H 5DJ6B 3C6LB 1YA5A 5GRJL 4D0CB 2FLBT 5F21B 5CEYA 5LXGL 4XVTH 3RIFK 4LBEB 5BXFA 4LFHD 2V5MA 3AM8A 4ZUTA 1RZJH 4LCUB 3GEWB 2GCYA 1U8QB 3E2HC 1JGLH 3LMJH 4L8CA 4LLYB 4OT1H 3BKJL 4JR9L 1QPXA 1IVLA 2KQMA 3HR5A 4ZAKD 4HIXL 4QRPD 4PREB 1ZGLP 1HXMA 2AJSL 3FN3A 2WINB 3MCLL 5TDOB 1KFAH 4P2QB 2EXYD 3D2UD 5C07B 4PV9B 3F12A 4X5LA 1MCKA 2AEPH 2IGFL 2ZCKH 2QQKL 5LGHH 2WSKA 4FQJL 1MCWW 3U48A 3HG1A 4WWKD 1OD9A 4C56A 4RMUA 2F8XC 5FYLE 3C2SA 4PD4K 3MODH 3FRPA 3QNXA 4R8WL 1IL1B 4PGEA 1G7LB 3MV9E 1R3IL 1CLYH 4QF1A 4NN5C 5JW4M 4ESKA 1BAFH 3TBWB 1Q38A 3UTZA 4JPWH 4X8XA 4YZFE 1H3GA 5D1QC 1YEEH 5IB4B 2ID5A 3QI9D 4JM2C 1P4LB 4FFZH 4QHKI 1MLBA 4NCDA 1AH1A 4D3CL 1JHKH 4TRPH 4ERSL 4TTGA 3O2VL 2HVKA 2DWEA 5E4EB 1T0MA 4G42B 4X7DC 2CLZA 3STZB 1NBZA 3FO1A 4LQFH 1EHNA 1U2HA 1RZIA 1SJHA 5ITFB 2IQAA 3ZZ1A 4PGBA 4MHHI 3FOLA 5L0QC 1QSFA 2AEPL 4R4FL 3GMOA 5L7XH 2GK2A 3GSXB 4JY4B 4PY7B 2BNRB 4Y2DC 3NIGF 3WDIA 3G5ZA 1JI2A 1UACL 3D25A 5F72S 4BFBD 4GJTB 1M1SA 4JFXA 1QFOA 2CDEA 4KPHL 3IFNH 4GKOA 4XHQA 3DUUB 1MWAL 3DSNA 3IFOA 2NTFA 1RZKL 3RUGE 4XP5H 1SJEB 3BQUA 2X41A 2OX5A 3KXFB 3PGCB 1MJJA 3WEXB 3GMLA 3MROB 3QRFM 4NN7B 1YEEL 2E9IA 2BP3A 2EH7H 2ZUXA 1JZ4A 4R4BB 3VGFA 2WQ8A 1HQRA 7FABH 4JREB 3QO1B 2FL5A 4R26L 4OD1H 3KHQA 4PJHB 2J8UF 3SJVB 1AD0A 4Y4FA 3O11B 3MRHB 5E24E 1A8JH 2YPLD 2AKRA 2R2EB 3FTGA 5B8CC 2XZAH 4PJFE 1YY8B 1MEXH 1OQXA 1IBGH 5LBSH 3ORJA 2NQCA 3LKQB 4M6AA 1J8KA 1C5CL 1NBYB 2FLRT 5DQ9A 1E4XH 3BH8B 2A6KB 3T65A 1FO0H 4N5EC 3RKDC 1YNKL 4YHNA 4UIKL 3QHFL 3V6FB 2FWOB 4UT7L 2JIXA 5J11B 2VDRH 3IDYC 5FGCE 2F15A 3GSOA 3S98A 4ZS6C 2ESVD 3LAFA 4U1SA 4AENA 1FFPB 5C2BH 4A6YH 1G9NH 3RPIA 1MQKH 3FFCD 3QG6B 5EOCL 3P0YH 4R97C 4F2MB 5JR1L 3VFVB 4WWID 2EH8L 2HTLD 4D9QD 3W9DB 1MREL 1UB6B 4CMMB 2Z92B 1AI1L 4HWEH 3RVXC 4HSQA 5MENA 1VKXB 4RAHA 3JWDL 1B9ZA 4PJ9B 2X4UB 2QSQA 4YPJA 1YMMB 1HEZB 1XGPB 3TPUA 1PEZA 2FJFA 3CFJB 4Z0XA 4P5MA 3W0WA 4PTTB 1WBZA 5DJ8B 3MUJA 3WS3A 1FO0L 1UWXK 1EFXA 2YXMA 2VE6B 3QUMA 3N9GH 4OLVH 4YHLH 5TQ0H 4L4JA 1UJ3B 1MRDL 1A7RL 4WUUA 4GXUN 4YXHH 5DJ2B 4WJ5B 3BH9A 3DIFB 3AVEA 4JG0H 1I7RB 1CDHA 3BAEH 3CX5J 1CXLA 5C8JA 5T1LA 4DUVA 2ZSWA 1MFDH 3S3JA 1N5YH 4KI5E 1OTTD 3O6LH 1L0XA 2NPLX 1AXTL 2NYYC 1P5UA 3HE6B 4WHYH 1YN6A 3Q6FA 3VD5A 5JXAL 1FL6B 1KPVA 5GGSA 3RZCC 1ROWA 4L29A 3ZE1E 2ICWB 3OX8A 3VD9A 4Z7OF 1EJOH 1QFHA 1LP9A 1BBJA 4HG4K 3QNYB 5IT2H 1W0WA 3IF1A 1DBBL 5ALCH 4V1DD 4YHLL 3OKOB 1WK0A 4KV5E 1BD2D 2OXGA 1RI8A 4H1LG 4OZGA 2BVQA 5IG7B 2RFXA 3RY6C 1JYNA 1G84A 1PGRB 1QR1B 4WY7L 4O2FB 4UTBH 2I27N 3BAEL 2DTML 4W4OA 3VE0A 4WI3A 4JZJB 2G9HA 5KW9H 4Z0BL 1JBJA 3D0VB 1S5HA 3SGKA 3KPTA 2H8PB 2P8PA 1NC2D 4U3CA 4PJEA 3TCXA 4E41D 4Q97A 5K9JL 3VGHA 4X6FB 3TF7C 1R0AH 1FV1B 3KGRA 1EJOL 1A6PA 2WMPA 3VFPB 1X5FA 5K93A 4MB5A 3RVTC 5A1AA 5C70A 5IT2L 3WKNA 1B0RB 1OF2B 1AIFA 1N59A 3BKMH 4I0KA 5D2LE 2DQHH 2CKBL 3NN8B 1JZ2A 5GS3A 1NC4A 4PRDA 3FT4B 4HHAB 4GG6B 3ZYJA 3HUJE 1XR8B 2BNQB 1Q9WA 3RWIA 3WFBH 5BZDA 5L2KA 3F6LA 4HC1L 4O2EB 4Q7DA 5F7WC 1NCUA 2AJYL 1KYOK 1L0YA 5HSFA 4AJ0A 5DJ6A 2ZCLH 4LPWA 3C6LA 1X6LA 4NCC2 4OCSH 1ZLSH 4D0CA 2IANE 3AB0C 4I2XE 5FO7B 4JO3L 4LBEA 1FLTX 1RSFA 2XACC 4ZD3L 1X4YA 4LCUA 1U8QA 1R0AL 4TULH 4LLYA 3IDXL 1XF2B 1F8TH 2KDGA 3R0NA 1CFNB 5T3XL 1W0VB 1QZ1A 4PREA 3OB8A 2HRPH 3TO4B 1BVKB 2DQHL 3IDMB 5DD5H 4R90H 3PP4L 2WINA 1FPTH 5TDOA 5GRUH 3ALWA 5FHAL 4PV9A 5FCSH 3QULB 1HWGB 3JTTA 5SX5K 5KBNC 1MIMH 1MJUH 3BPNB 4QRUB 4C58B 2WK2A 4E41E 1V7ML 1J1PL 2ZCLL 1IL1A 1I3GL 3EO9L 3LHPH 3X12B 4OCSL 1G7LA 1ZLSL 2Q3ZA 5BQ7B 1ES0B 3TBWA 5BOPA 3BGMB 1Q94B 3MNWB 1UYWH 1MJ7L 1BZ9B 1U41A 1I1FB 1T04B 5CWSB 1WWBX 1AE6L 5IB4A 5SWQB 1FFQA 1I8KB 1JNHB 1P4LA 3EJYD 2XNAB 1F8TL 1MLCB 3I50L 1XF5B 4HZLB 1U91B 3V5DB 1JFQH 3HZVB 5GPRA 3B43A 4G42A 1YDPB 4TPRH 4KROD 3STZA 1K85A 1FPTL 4DUXA 1XEDA 2FIKB 4G6AD 5KVEL 1QFWI 5ITFA 1NGWB 3WFEH 1FHGA 3SDCD 5DYOB 4NHUB 1KEGH 3GSXA 4XP4L 1K8IB 4JY4A 2BNRA 4PY7A 4WI6A 4YX2L 5C9JB 3JUZA 1AO7D 4PJBF 5DURD 1EEUA 3GMPB 4WV1C 5F88B 2HG5B 3KJ6H 3C87A 3DUUA 4HWBH 4UNVA 2EDEA 5JOFB 4OV6F 3U7YH 4M7LL 3GSNH 4P2RB 1FLRH 3ZSSA 4JKKA 3KXFA 3PGCA 1QRNE 3KYKH 3WHE1 3WEXA 2BDNL 3P0GB 3MROA 1SY6H 2DQEL 3ILQC 2VUOA 5E8OB 4R4BA 2DJUA 4FTVD 3BISA 3QEUB 3HI6L 1TIUA 3T08A 4K3JH 4MNGE 3QIWD 1BVLB 3K7UA 4MAYC 3QO1A 3TVMB 3IGAB 5DHVH 4J3UA 3EUUA 1C7SA 4PJHA 4TPRL 3SJVA 3L5XL 2FB4H 3O11A 3MRHA 4WGWB 4NKOA 5DWUH 2R2EA 1WWCA 1W8NA 3B5GA 1YY8A 5D72L 1DEEB 1J7VR 2BVPB 4RBPK 43C9B 4EBQH 4XMLL 3LKQA 3DYOA 2F54B 4GUPB 1NBYA 2Y5TB 4NT6B 4HWBL 3BH8A 2A6KA 4GS7B 1NCTA 4KQ3L 4LSVL 3OJMB 5D8JH 3V6FA 4JO1H 2FWOA 4ZFGH 4WFFD 3KYKL 3V7AG 4S1QL 1FIGL 2ATPB 1H8SA 3KDMB 3QG6A 1E6OL 1S7TB 1UG9A 5KJRH 4NJ9L 3RI5K 4IRSB 4F2MA 4FHBD 1KCKA 2QQLL 3VFVA 3RDTB 4KHTH 4NGHL 3W9DA 1UB6A 4YDVB 4CMMA 2Z92A 1PKOA 2XZQH 4TVPH 5AAWA 4H20H 2HN7B 3MV7B 1VKXA 4P49A 1MIEH 1ZS8B 2WANA 2ICCA 4LEXL 4PJ9A 3H7BB 4EBQL 3UC0L 1YMMA 1HEZA 1IAII 1MF2L 1XGPA 4KY1H 3OHXB 3CFJA 3D1MC 2VIRA 3MFGB 2W9DH 1A6ZB 1QNZL 4PTTA 4NPYB 5DJ8A 2DI9A 2GIYA 5HHVH 3CFDB 2VE6A 1JZ3A 1G6RH 1UH4A 1UJ3A 4BYHA 3QFJB 4ORZC 4Z8FH 4X9GA 1C1EL 1JGUL 1JZ7A 4JHWL 5IVNA 5JW3L 5KJRL 5DJ2A 3OL2A 4WJ5A 3KLSA 3LQZB 3DIFA 3CZFB 1PSKL 4OM1H 3T0WA 4MS8D 1I7RA 3PGDB 2A74B 1OVZA 2VZUA 3GRWL 4J3SA 3TGXA 5HDOA 2ILLA 3B2UC 2VXQL 4KKAC 3HE6A 3P9LB 4GQPH 2XTJB 1FL6A 3ARDB 5I8CB 3O2WH 4XBPB 5DUPH 2ICWA 5DMGC 5IHUH 4OIAA 5D1XA 5BVPL 2NY7H 25C8L 2HKHL 3QNYA 4LSUH 5HHVL 1TZGL 4QRRB 5AYUL 5C0BB 2A9NL 3OKOA 5HGAB 1T6WA 4CVWA 4PBWD 4V2CB 4HCRH 3FQWB 2BFVH 3C09C 2MQCA 5IG7A 1EZVY 2MCPL 2Z8WC 2DD8L 1EAJA 1QR1A 3ARBC 4WFGD 3SE3C 3CVHL 4O2FA 4ORGB 3VWJD 4FQXB 4APQC 1IGFL 5BS0B 1F4XH 1G0DA 3KLAB 4LNVA 4XTRC 4LCYB 5K9KB 5CP7B 3QDMD 4NZTL 4JZJA 1DLFH 4L3ED 1XT5A 3CK0L 4JCMA 1TFHA 3HFML 5IJKC 4HKZB 3D0VA 3ROOB 1GGUA 3UTPD 4P23C 1KG0B 2H8PA 4TQEL 4P46C 2BY3A 3O2WL 4QY8B 5CINH 4CNIB 3G9VA 4X6FA 4DQOH 5L88H 4PBVC 1K9TA 1FV1A 1XIWD 3AAZB 2DKUA 3VFPA 1QLEH 2QQQA 3PL6C 1WWWX 2CIKB 2HTKC 1B0RA 4JY5H 1OF2A 3DV4B 5EOCJ 4AQ1B 1F58H 4KWUA 1NUNB 1WWAX 3NN8A 1A7NH 2N56A 3MV9B 3LH2H 3ZKNC 2NY0D 3FT4A 3QQ3B 4HHAA 4HUXB 4RGMB 4GG6A 2MPAL 2AP2A 4PS4L 1XR8A 2BNQA 5D4QA 3T04D 4ZMAT 1BBDH 3HI1B 2QQNH 5DVLA 5I1JH 1WIPA 3CIQA 1RD6A 4O2EA 1IAMA 5E2UL 1NSNH 1J88A 5DD3H 4X83A 3G6DH 4LIQH 4ODUB 3QIUB 1MCCA 1YYMH 4M61B 1RZGB 1H8OA 1LE5B 1OAUH 3BT2H 3TT3H 2GSGB 4OFVA 5FO7A 4S1SL 3DECA 1I7UB 3HHRB 3LZFL 1J8HA 2VYRE 3PWVB 2WWMC 4MXWL 3B9KD 2Y36L 1BEYL 1EGJH 5BO1H 3PABB 1XF2A 4PRNB 1VEPA 2VDLH 5A16B 3QHZH 4M62L 3VG9C 1CFNA 1WV7T 1W0VA 2AJUH 4NWTH 5DT1H 4HIHB 5FYKD 2QHRL 3NFPB 4WFGE 1F58L 2BCKB 5D93C 3TO4A 1BVKA 3IDMA 3BJLA 4OKDA 4NZRL 4H0HB 4L9DA 3QT2A 4Y1AD 1IGJB 3VXSD 3RNQB 4M4RA 3QULA 4R7DB 4Z7WE 1JV5B 4QRUA 1G9NC 4LIQL 4LRNH 2R1XB 5C09E 1A64A 3WS6A 4RAUB 3X12A 2AXHA 3T4AA 2A6JB 3SKMB 2Z31D 3DLQR 4G7VH 5D7JB 3W9EB 1ITCA 1ES0A 1JN6B 3AMKA 3BGMA 1Q94A 3MNWA 1FVDB 1BZ9A 2VLRE 1X3DA 2D7MA 3MRJB 4Z7UA 1I1FA 1T04A 5CWSA 5EA0L 1S7RB 5C0ND 3PHQB 2APBA 1I8KA 1JNHA 2YEZB 4PJFB 5SWQA 5KSBF 2VDLL 2XNAA 5FO8B 5DD1H 1BQHB 1MLCA 2F19H 2P8LB 1B2WH 1XF5A 2VLJE 4HZAA 4HZLA 1U91A 3O3UN 3GNMH 3V5DA 3T3MF 4Z78B 1QBLH 5JLZB 3VFRB 4W6YB 5IEHB 4ZAKC 3QDAA 1WEJH 4NC1C 2FIKA 4FFWC 1NGWA 1FFNB 4WO4C 1HI6B 1FRGH 5T3ZD 4GAFB 5DA0B 3O4LD 1HINL 5DYOA 4NHUA 1K8IA 5FGCB 3FZUC 5C9JA 2OSLB 4UILH 4I48B 4HBCL 3GMPA 3R06B 3MBED 5F88A 1KN4H 2HG5A 3T0VA 4KHXL 3NABH 4ZO6A 5JOFA 1NMAH 1FCCA 4WWKC 4P2RA 4G7VL 5GJTL 3ARQA 2YUXA 4TNVK 2DQJH 2Y06L 3AY4A 2DMCA 3BPOB 3TJEH 1F4YL 5LCVH 1ZT1B 4MJ4A 4V2BA 3SDXF 5IR1B 2FX8H 5E8OA 4G5ZL 3QEUA 3ARRA 4G9DB 3ARWA 1BVLA 1E6JH 3TVMA 1U0QA 3IGAA 4KJPC 4L9LB 4KKBC 5F7UA 1B4JH 2DYPB 3V0AC 2NY3C 1EUUA 3DVFA 5C0IB 4WW2C 1AJ7H 2JJTA 1T0PB 3MACL 4H25B 4OKVB 2AJXL 1DEEA 2EO9A 1CCZA 1G6VK 43C9A 2R8SH 3H0TA 4GUPA 2MKLC 5J57B 2XPGB 2HKFH 4NT6A