2CGZA

Structure of helix pomatia agglutinin with tn antigen
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
b'RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ
publication title Structural Basis for Recognition of Breast and Colon Cancer Epitopes Tn Antigen and Forssman Disaccharide by Helix Pomatia Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cgzA00
3WMPA 2CGZA 2WN3A 2WN2A 2W95A 2CGYA 2VMEA 2VM9A 2CE6A 4Q56A 2VMDA 2W94A 3WMQA 2VMCA 2CCVA
chains in the Genus database with same CATH superfamily
5DJYA 5J1AB 3EW3B 2ITDA 1F3RB 1GC1L 2NCEA 3OSVA 5GRZA 1M7IB 5E8EB 3X2QB 1KCLA 3HNSL 4PRIE 5TFSH 3ZIMA 1R9FA 2B5IC 5A2KH 1AGFB 3RKDC 3DGCR 1MIMH 4GS7B 1KUMA 3BI9X 3ARPA 1LK3H 2YUWA 3I6KB 4LIQH 2IFFH 4P4KB 5G4MA 1QMUA 4XVOA 3KPRA 3GMRA 4KHTH 1IGJA 5GS1A 4JMXA 4PJ7A 4A7SA 4A2LA 1F3DH 3AWEA 4H0GA 3ECUA 2GK0A 1SXCA 2L7UA 3LPFA 3SDDD 1KCWA 2ADGA 2QHRH 5KS9A 3WLBA 3JYBA 4JHZA 2DQCL 2NY5L 2NY4B 2V8LA 2GJZA 4GSXA 1N8ZB 1WA0X 2VDPB 4RMSA 1NLDL 4GXUN 5FYKU 4YSPA 4NHUB 5C9JB 5LCVH 4M43L 1UH4A 5HI5C 5F88B 2G9HA 3DX8B 4DK3A 1FBIH 1A7BA 5CD3B 2X5PA 3LHPL 5LBVA 5CCKH 4L8CA 1EHLH 4DKDC 4IRSB 2VN6A 5T3ZE 4ODSH 5GS0D 1JP5A 4G1EB 3HN5A 5TE7H 4QI3A 3PWJA 5IFJA 5EA0L 5AD0B 3PJNA 2IWFA 3BYTA 4CMHB 2VXSL 4ZZFA 2BNRE 2G3NA 3VTAA 4PJFE 3PIQA 3TT3H 5ESAA 4PVNA 2Y06H 4XGZA 2DQJL 3FT2B 4HHWA 4UT9A 3PYCA 3SKMA 3WTWA 4TVPL 1FLRH 1B0RB 1EFXB 2E7DA 1TQSA 3BCFA 2FBJH 1LO4H 1WPCA 2VDMH 1RLWA 3I50L 2WMPB 1BEYH 1W72A 2A6JA 4NYLA 5FKPA 4ZFZA 4FABH 5AZ2L 2GHWB 1HHKA 5HGAA 2H2PC 4DZBA 4PRNA 5J9PA 2I7OA 1Z0NA 2LQRA 2CK0H 5JHLA 1DVQA 1HWHB 2XX0A 2GT9A 3AB0C 3S96A 4ZNCD 3OLIA 4RZCB 5I5JA 1KEGH 1PAZA 1KJ3H 3CFJB 3U4EA 3QCVH 5HHMB 43C9B 1T5WB 3LD8C 5I1EH 3UEQA 4F9LC 4LEEA 4P3WA 5JYLA 1IEBA 3QA3A 3VWKD 3BISA 3HE6D 3SGDH 1W15A 1Z3GL 3ULUH 1ECZA 3BP7B 5CSZB 5HDWA 1HSBB 2OYPA 2HX8A 2CR6A 2VL5A 3U48A 5EUOF 2R59A 2DWEA 4MJ6A 1S7QB 2E86A 1M2OA 4J4PC 5K59E 1SOSA 1IGYB 5H94A 1TITA 2Y07L 1KLGB 3QDMB 3RJQB 2QQLL 4OZIA 5B22A 2IXQA 3IVKA 1FL5A 1QA9A 1HH6A 4NZ8A 5D5ME 3MFGB 2XIIA 1GGCH 1LP9E 3QARA 3ABGA 2RALA 1XDTT 1L7IL 4MD5B 1P1ZB 3AW5A 3LZQA 4NWTH 3QUYC 1B4JL 3BD3A 3E8UL 4KI5C 4BFIB 2BIPA 4QD2E 4NM4L 4H1LG 5CP3H 4QRPE 2LTQC 4ZDHB 5CP7A 1F58L 2Y24A 1UXWA 5C0BA 4OZHF 2GK2A 4HIIA 5CGBA 2J3SA 3ZR6A 4D7PA 3LZOA 4XCYB 5CS7A 4TKWA 2DLHA 2NZ1A 2XX1A 5DMJB 4BIKA 2CLRA 3C6EA 3IJHB 2Y7QB 5AVSB 1JPGB 5AKSA 5CUSL 4LCWE 4LRNH 1IFGA 4HFWB 4JPSA 3BWAB 4OGYH 1V7NL 2BZDA 2V17L 2R69L 3T3ME 3MBEA 1MRFH 2MCMA 2HT4C 3GMQA 2K1MA 1YYMH 5E2JA 4PCKA 3W0WD 4PVBA 1K9TA 2ZAGA 1NEPA 3DPDA 1T7ZA 3DUHA 5ILTL 1FL6B 2OMZB 3WEBA 1OE2A 3AUVA 3K6FA 4FZEH 2YXFA 2DEYX 4PJCE 1OZTG 5FB8B 5D2NB 2F0CA 1OP9A 5I1KL 2WTPA 1H3PH 3ZRFC 1YSOA 4P5KB 4U33A 3IJYB 3FUDA 2CUHA 1P2CA 1ZT4A 2FTAA 32C2A 4AQ1C 2B15A 4FFTA 5F9WC 2ITFA 1RZIA 1CXFA 2GSGB 4WK4B 1NAMH 5HYQA 1AHWB 2J8UE 3GJFA 4RFEA 1A7NL 3MXWH 3PWPA 3MNVB 3MLYH 2A9AA 4AW4A 2WVVB 3DGGB 3A5VA 4KQ4H 4C56E 1HWGB 4YE4L 3LKNB 1VKXA 3T1WA 3LQZB 1D2OA 3IJ9A 4ENZA 5IMMB 1SJVA 5EZLB 4D2NA 4XC1H 4WAFA 2EC9T 1TTUA 1L9TA 1YY8B 1PEWA 2X4NB 1UD2A 4P59H 4Y9EA 3WO4C 4ADIA 3WNPA 5LQBH 4LARH 5CU5A 4Z7UA 5F9OH 2PCFB 1CGVA 4OVUA 1VGKB 2A77L 3WUZA 1UXSA 3TEWA 2PYEB 5I66A 1ZSDB 3MJ9L 5I71B 3KPSD 4KJPC 5LXGL 2X09A 5F3BB 4JPWL 3IJEB 5HPMB 3WTUA 2W5PA 4OFYD 1CPUA 1S78C 3ZSTA 1NC4A 4W9HC 5B38B 2VYRE 3UTPD 2DQ6A 3FHAA 3KGSA 1NCCL 3PREA 3TZVB 2O5ZH 1MEXL 1OAKH 1RU9L 5MEQA 1BIIA 5JXEC 3DMMA 2VAJA 4M6OL 2OSLB 4ZAKC 4ZNEE 5B39B 3T6ZA 1RJLB 5JDJA 2EH7H 4OJEH 3NZ8B 3D9AL 3S6CA 3BW9B 4JPVL 1SUJA 5JHDA 5IQ9B 5L9DL 1HKLH 2VMCA 1WP6A 3CLFL 3QXAA 3MGTB 1NFDB 3U9WA 4Y9FA 1AIFB 2C4FU 4ZO7A 2DJSA 1L9NA 5TPWL 2AEPL 2G5UA 3BRGC 3TNNB 5IM7B 1EIBA 1AGDB 4LSDA 2WCPA 1E5BA 1YO4A 1CD1A 3GMPA 5AALA 5CMAA 2H6PB 4Q9QL 2FAUA 1TTGA 4AKQA 1AHWC 3COOA 3C5JB 2ZYHA 1TZHB 2YOCA 1JGUH 4NM8H 3AITA 2KPWA 4ZTPH 2I5YL 1BYOA 4YZFF 3UOAB 1IVLA 4HXAL 3UBXB 3QNFA 4AVKA 1CG9B 4NLAA 2DWYA 2VDPL 3OD3A 3MI6A 3PV6A 4LOUD 5EN2A 3WD5H 4BUHA 1E6JL 2BP0B 2Z92A 2VR9A 1QO3A 1G0YR 4POYA 3K2UL 4NPJA 1OPGH 3VWJA 1PKOA 3AQXA 3IWVA 5GJSH 4W6YB 2FECI 2LAAA 1MZYA 1EDYA 1ZLVK 3WS3B 2WUCL 3ZZQA 4X8CA 4X6CF 3P9MA 5IB3A 5GGRY 3MMEA 3LRSA 4BFEA 5KVDH 4OQTA 1XFPA 1N0LB 4L9LA 1FFQA 2P5WA 4MLSA 3ZUNC 2N4IA 2Z0UA 2RFXB 4KKAD 5H2BA 4L1HA 4WY7L 3BO8B 4AL8H 3GMOB 4XOAA 5ESQA 1KJ2B 4M48L 3RGHA 1JYVA 4F9PA 1H9DA 3T0EB 3GUTB 3APDA 1S2EA 5HVHC 4PUBH 1CDBA 2J6EL 4M8RA 3RWEB 1MCQA 2Z0BA 3TO2A 4G42A 4Y4HD 1JNJA 1U58B 1QTSA 1H8NA 3TT1L 1S9XA 1FGVL 3D39E 3V4UL 3PP4L 4F8NA 3VGAC 1KGUA 1RFDH 4LRIC 2F7OA 2O26U 4Y7MA 1ICTA 3TO4B 2R51A 3SBWA 2X4UA 4CGUB 1PSKH 1AS7A 4FXGA 4QHNB 3HI5H 1BIHA 3KL0A 3TYGL 4QHUA 1U3HB 2OSYA 3P40A 4V1DE 2B2XH 1VENA 1TCRA 3DTDA 3UZVB 4G82A 2XETA 4XB7A 3DGDA 1KTRL 2CLVA 1PL3A 4PJGA 3RVVC 4XZUB 5FM5M 3OXSB 3QB7C 4HWBH 5MEND 1MNNA 5BS0B 1ZTXL 3CK0L 4I3SL 3P9LB 35C8H 4PJEB 1HCFX 3CZUB 3CZGA 5BOZG 2HMID 1GTFA 5GRVK 1U8PA 4XCEB 2Y36L 4P2OD 2ZAIA 1U3JA 5F1NB 4AC4A 5HJGA 3C60C 4LF3A 4Q9RL 1IEAA 2CLZB 4I18C 1NH6A 3EFFA 3EHBC 1YEJL 1X5LA 4UDTA 1ZA3B 1PG7H 4JLRA 1NGYA 3IU3B 5IJKC 4IOSA 4X7SH 1WT5C 3B3BA 1NGPL 4C83B 5K39B 3GRWH 2X28A 2Y1ZA 4Y89A 1ADQH 4Z7NB 1V55B 3T0EC 4MNGA 2A0LD 3FRUA 4NKMB 3QEQA 4OJFL 5J1AA 2COQA 5KOVC 2F54D 1JZDC 5HDOA 1M7IA 5KAQG 1CUOA 3NG5A 4BE5A 1AGFA 1QW8A 1DTUA 3I6KA 1NIBA 4P4KA 4YL4A 2UX7A 3HE7D 1WWBX 2MQGA 3FRPB 3T09A 5F9DC 3GHEL 1BEXA 3EO9L 1YY9D 3QR0A 4L1LA 5T5FL 3IFOA 4GSRA 3QORB 1U41A 3CFEB 1IC5L 3RB5A 1MNUL 1VPOH 2DIBA 1AC6A 1U3HC 1ZGLM 3Q9PA 3TV3H 3BE1H 3BVXA 3CTTA 3H3BC 3MOAL 4FP8L 1N8ZA 5H4ZA 5I30L 4AG4L 4U1HB 4RGMC 4NHUA 4OCNC 5C9JA 3B3IB 5F88A 3DX8A 3GXTA 4X6DF 4KOCA 1CF8L 3FT1A 2HKAA 3VXSE 3VXTA 1D5IL 3FS9A 4XPBH 4D9LL 1LJMA 4IRSA 1P5UB 4ZOBA 5IVNA 1UFUA 4G1EA 1GA2A 1EH9A 2B1HH 2WXKA 3A67L 4LSPH 5AD0A 1H3TA 3F01A 5HDQH 2V4LA 3IDXH 4FLQA 4X5XA 3ZXAC 1EJ8A 2C1PB 4AEIL 2I9TB 4LL4A 3FT2A 4XZ4A 2L3BA 2NDFA 1B0RA 4HXBH 3QI9D 4W81A 1PX8A 3AM8A 3P77B 2Y0SA 4MMXC 2R0ZH 1YEEH 1S8DB 4U6XB 3DOHA 2ESVB 4MDJB 1KF9B 4NRXB 3CVBA 2WMPA 3MFFB 4FFVD 4NKIH 1IBHA 1ZS8B 1DQJB 2XYCA 1A6UL 3S48A 3QQNA 2P43B 2RIKA 3NCYP 5IGXH 4RLDA 4Z3EA 2HLAA 3NJLA 4UM8B 1Y6KR 3VNYA 1IL1B 2UWEE 4YEEA 1TIUA 5IVOA 3H9SB 1A7OL 4K5MA 3WLWC 1GZHC 5HDRA 1G9NL 3TWYA 2JKLA 1QFWL 3MLUH 43C9A 1IBZA 1T5WA 4FEMA 3QR1A 1M05B 3QC5X 2D2OA 2EXWD 5FC9A 3SGEI 1F45A 1P6FA 4PS4L 3NCFB 4WU5B 2WHVA 4R0LB 2R2CA 4NQDB 4DVRH 3U30C 1E3ZA 3KPLB 3BP7A 5CSZA 1HSBA 1KN2H 2NY6D 1UM4L 5B4MD 1GZQB 4HC1A 1CDCA 3N91A 5EO0B 2DV6A 1Q90A 4GAAA 1I8IB 1XR8B 3V9EA 3CHSA 2F7QA 2XV2A 1NSNH 1S7QA 3BGFC 4XBEH 2AJSH 1IGYA 1KLGA 3QDMA 2DMBA 3S35L 3UTQB 1L9SA 4HUMB 3DSNB 2W9EH 2AK4E 4OSUL 5BRZB 4NAQA 2X87A 1T0NB 4L05A 2CGYA 4JKPH 4MAUL 3S7GA 4KRPC 4MD5A 5G55A 1P1ZA 3HG1E 4LLAA 5HHVL 5HDBE 4BFIA 5E0QA 5D7EA 1WAPA 5DGQA 3LPOA 2HH0H 4ZDHA 3KCWA 4LSUH 2UXGA 1JXJA 3IMTA 2EP6A 3SJVB 4NNPH 5F96H 1INEH 4AYEC 4XCYA 1VSCA 3OC8A 1NIEA 1XL6A 1AY1L 4XO9A 5L2KB 3QIBB 3NJXA 3IJHA 2Y7QA 4F8PA 1HYRC 4LHUD 1JPGA 3U1SH 4XNYL 1OCRB 4LHQB 4IRJD 5DHDA 4HFWA 4DO4A 3ROLB 3BWAA 1JXGA 4ZS6C 1AZZC 5T5FA 3JWNG 1XB8A 5DJ6B 4CC4A 2PCPB 1RSFA 4ZMLA 1Q72L 1FL6A 1KJ2L 2OMZA 5JIKA 2VQ4A 3DKHA 4GSDL 4NFBA 3ZKQD 3ATDA 5AOLA 5KUMA 3SE9L 5FB8A 5D2NA 1E28B 2F58L 4I0KA 2AVGA 4G3YL 4P5KA 3RRQA 2EIJB 3ZDYE 4AQEB 2A1WH 3RIAF 1OSYA 3X13B 3OHXB 4EI5C 3V8CA 2GSGA 3O11B 4I48B 1Z66A 4KNSA 5IROC 3NABH 5TE6H 3ULAB 1GYWA 3V55A 1AHWA 3N85L 3LH9A 5CZXD 3T2NH 1E8ZA 2YK1H 2VSKB 3MNVA 1ZCRA 3MRFB 2WVVA 3DGGA 4X9FA 3RDJA 4PP1C 1PY0A 4PJ5B 5C6TL 5C0BD 2XSKA 1KY7A 2C5DC 3FT4B 1OV8A 3VXUB 1F8TH 3LQZA 5DD5L 3KWTA 1N6UA 1SRDA 3QZPA 3VVVA 5IMMA 5EZLA 1XGQA 3QEGH 4C54A 1WBXB 2EYRA 1F13A 1YY8A 2CUAA 2X4NA 1M56B 3HKZA 1DE4B 3J7HA 4PFEA 1MWOA 3OKMB 3QFJD 4JB9L 1NBVH 2PCFA 3FFOA 1E30A 1VGKA 1A7PL 3BUTA 2F1EA 4XWOC 3D2UB 1CQKA 3QG6B 2PYEA 2P9RA 2WXFA 1ZSDA 3EFDL 4G7YH 4PR5B 2QELA 4TNWF 3IJEA 5HPMA 3ARGC 1HAWA 2EDFA 3D08A 1CO1A 4RSYA 3ESOA 5FXCH 4F24A 5EOCL 5B38A 1BYNA 3TZVA 3LS5L 4U0RC 2FJGB 3ARVA 4TNWK 1QHPA 3KPOB 3QQ9C 1CICB 3DV4B 2J57A 2VLKB 4G5AA 1CVRA 3G6DH 2OSLA 5B39A 1RJLA 5BW7C 1GRWA 4HZAA 3LMJL 3NZ8A 3BW9A 4AKPA 3PXLA 3HJ0A 3IU4L 3U2JA 5IQ9A 1JDAA 2UXTA 1NFDA 1JF1B 2E9JA 3GFUA 1AIFA 1TF4A 2WPGA 3L7FB 2BIHA 1PZDA 2JKTM 2X2UA 4LDLB 4NJ9H 5L6YL 4ETQB 3PWPD 3TNNA 3QZWB 3T8VA 1AGDA 3IETB 4NUPA 3VFUB 3WKPA 2YIHA 3OM3B 4NN6C 4Z7VE 1Q0YL 1UZ8B 3LHAA 2VE6B 4HIXL 1TCMA 1AAJA 2AJVL 2H6PA 2VLLB 3K2MC 3STLB 1RUKL 1P84K 3C5JA 4A7TA 4ELKB 3QDAA 4M6NH 5SWSD 2AS5M 1UJTA 1VFUA 3SDCC 3APMA 1ZLWK 1U2YA 4PWHA 1DBBH 3IGLA 2R27A 3UBXA 1TNMA 5JW3H 1EUTA 2A9NL 1CG9A 2F8OA 3IS1X 5I0YA 1GIGL 3OKLB 2BP0A 5GRYA 2M83A 4WEEA 3EDJA 2FE0A 5DDHB 3WS3A 2V37A 1MFDL 5I15H 3CXDL 1CD8A 3S4SB 5I1IH 3PQYE 3T1FB 1N0LA 1UVQB 2FCBA 3FNKA 4TQIA 4LAQL 3NP3A 3L5JA 2RFXA 5FW7A 1U8KB 3BO8A 1FYTD 5JIDA 2VT0A 3ULVC 3GMOA 3KH4A 4NQCB 3T6QC 2Q8AH 1KJ2A 1HL8A 3WN6A 1ZLDA 3T0EA 5EF0A 3EOYG 3GUTA 3NPZB 5BPPA 2AC0A 2GITB 1RIVH 1RVFH 4QRRE 3RWEA 5IVZB 4R90H 3T4YB 3DSFL 1NIDA 1U58A 4NO2B 3WSQL 3BPCB 3W5MA 4Y5YB 3UTPE 2Z31C 1DFBH 4ABVA 4F15C 4TQPA 4MJ5B 3BDBA 3UAJA 1YPZB 1JPSL 4X9BA 3WAJA 1F1DA 2VZUA 3IMVA 3S88L 5IQMA 4YEFA 4ZMXA 4KTDL 3MA9L 3TO4A 4JMNA 4DH2A 4QHNA 1E9PB 2EIMB 4OJDH 4M5TA 2AK1H 4A6YB 1U3HA 2ZG1A 3IFLH 1JG9A 3QYCA 2XFXB 4PJDE 4KZEL 4MBRA 4OKVB 5KVGE 4JPKH 4QTIH 3UZVA 1TTCA 1LO0H 3EBHA 3RGVD 3FU3A 4UOQA 1RJCA 5EMYA 4XZUA 3S3DB 4TN9A 5JHBA 3OXSA 2DMGA 5E08L 1QLEB 2WBWB 1MXGA 2EO7A 5TK4A 2EH8L 1TO5A 4N5ED 5BS0A 1C9SA 3ZYJA 4G6AD 1QLRA 3H4FA 3P9LA 4PJEA 3SE4C 1B0IA 1QWNA 2P5WD 4PCSA 4R8WH 4K8RD 1PVHA 1CBJA 2OULB 3BUYB 3Q8AA 3DX1A 5F1NA 2IDQA 2KLTA 3IDYB 1DJZA 1JYWA 1MRCH 2CLZA 2Y22A 2Y7OA 3CHOA 3ZE0F 1BD2D 2HN7B 1CLYH 4H8WH 1ZA3A 4DFHA 3T0DA 4H0IA 3IU3A 2XVBA 4Z18A 3N44F 5I1JL 2WBJC 4JFFB 4JRWA 4AIEA 3WFBL 4LLDB 5K39A 4C83A 2K7PA 4AQAB 1UQSB 2CHDA 2WWKT 4XOBA 2J8HA 4JO1L 3MRNB 5DZPA 2XU9A 2DQTH 3GI9L 4NKMA 3RFZC 1BBDH 4DP2X 2OMXB 1ROWA 3BKCL 4EMZA 4Z5RB 2XPZA 1KOAA 1MSPA 1KLFB 4GIAA 3UTTB 3VXMD 4ALAC 1HZHH 4NO0B 1PIGA 4AENA 2E3VA 4NZJA 4WJ5B 1GZHA 3FRPA 5EBGA 4P23B 3O6KH 3W9EA 2CA4A 2H41A 3QAZB 1A1OB 3QORA 5HI5D 3CFEA 5CZVH 2YRBA 3BSZH 1CLVA 1MFBL 1MAML 2WTOA 2KLRA 3LPGA 3QGVA 4U1LB 3PWNB 5CLTA 2WXIA 4B9PA 4MB3A 4X6EB 4XXCA 2DLTA 2P80A 3J2PA 4N3TA 2OI9B 4U1HA 3QDGB 1QTPA 3B3IA 5AW9B 2VRKA 5TD4A 4B7IA 2PKDA 2LGNA 1FFTB 2Y72A 2A74C 1P5UA 5F7MC 1ITBB 2XZZA 1GHFL 1OTTD 1U92B 3G5VB 3PXJA 4N28A 1FNHA 5E6IC 1A5FH 1ZS2A 2L7JA 5H37A 4POUB 4IOSD 1TZGH 3KM2A 3ZTDC 4MDRA 4ELDA 1H9VA 5IHUH 2C1PA 2IJ0C 5EU3B 2I9TA 4LKXB 4JFOB 3H3PL 1P4BL 3KL3A 3QJXA 2WJ5A 4QR7A 2FJFB 2TAAA 5F7FA 4KKCC 3FQXB 3QEQD 4OUUB 2H2PD 3T2LA 2WZPA 3P77A 4I0PB 1CDHA 3EH1A 1PLCA 5DVOA 4P04A 1EZVX 1S8DA 2O5XL 4U6XA 3OJVC 1L6ZA 2ESVA 4MDJA 4NRXA 4KRNA 1HI6B 4RAHA 4EOWH 5C0JB 2DJ4A 1XL4A 3MFFA 4P4KD 5IF0A 1ZS8A 1DQJA 2ENPA 2ZIDA 3QWRD 3S3CB 4UNUA 4GP5B 3HFFA 1JTTA 5I0DA 1K6QH 2YA1A 4UM8A 4XNXH 4GUQA 2H9GB 1IL1A 4F8LA 1KELL 1PTZA 1JPTH 3BZ5A 2NW3B 3VQLA 1NGWA 4MBOA 4A7VA 2FATL 3MRCB 3QZBA 2OXGB 5I2IB 3QUXC 3EGXB 2ZUUA 4WI0B 5GS3A 1HFUA 2VC2L 2X38A 4R0LA 1XZ0B 2W0PA 4NQDA 4L5FH 2FRGP 2QVIA 4JQVA 4AEEA 3KPLA 5GRXG 5DMIL 3O0RH 4RBPH 1A8JH 1EZUA 1EAPB 2EC8A 5F6IC 1ZE3H 1SMDA 1GZQA 2NYZA 2E7LC 2PTUA 5EO0A 5J06A 1XR8A 3U6RB 1DDTA 4AGMA 2VCOA 2WQWA 3L2MA 2GUOB 3ZT7A 4AC2A 3VXPB 1RPQA 3B7SA 2VR3A 4E36A 4F7EB 1NJ9B 3QUYD 4KI5D 1RULH 3UTQA 3VI4B 3K0WA 2O6FA 2XVKA 5DUPH 5BRZA 5B38G 1BF5A 1BVOA 1OAYH 1T0NA 3KYNB 2NDGA 3F7PC 3HI1B 4XP4L 3TJEL 2IVFC 1MLBB 3RYMA 1E5UI 3VSQA 4RFNC 3BYYA 2ZUQB 4P2AA 2JJTA 4NCC1 4K15A 4FNTA 1YYCA 3SJVA 5CEZE 1ZLSL 3WG7B 3NZSA 3BAYA 4OCMC 3RX5A 2NXYB 1MVYA 4JRXE 4PJIB 2HT4D 4YBLB 3K8KA 1ET7A 3C6LB 5HBBA 1XAKA 2ZKXA 3QIBA 5HHMD 4L4TE 3HR5B 4E41B 3TA3C 5I6XC 1A3LL 4J5VA 4ORGB 5M94B 4BHUI 3BUIA 4TULL 3ROLA 1I7UB 4RMTA 3QZOA 2CIIB 3A23A 1CDUA 3FQYA 3GM8A 4U49A 4IMKA 5LBGA 4JFUA 4TVSa 5DJ6A 2PCPA 3T6XA 1E4KA 1RZQA 3KPRE 1XGYH 2UXFA 2Y2TA 3DUUB 4RGOH 1AIZA 2NNAB 4PJ7E 3UBXG 4NGHL 4URTB 2UXVA 1E28A 3B9EA 1CBVH 2Q86A 1TMQA 5B21A 2X3AA 1UOWA 2JCWA 1PGRB 3K4ZA 2G3ZA 4AQEA 3TURA 3I3EA 5F7AA 2DH2A 2FEDD 2N0KA 3QDMD 1YNLH 4EN3B 1T20B 1P9MA 5KOMC 3OHXA 4G8EA 2JKIS 4MJHA 5AL0A 3O11A 4FGMA 2WKGA 2RR3A 4I48A 4LP8A 5JDSB 5J1SC 4DGVL 4UTAL 1CT8B 1VZGA 2MNWA 3VFOB 4YC2C 1ZOXA 4YDLB 5ALCH 3SKUD 3MRFA 1R6VA 3RI5F 4CVWA 5ANMB 4A6YL 2EKSB 5I16B 1AGCB 2E9IA 5BO1H 5JPMC 1JPFB 4ZK8A 4PJ5A 4D8PB 1O6VA 3ISWA 1CXKA 3KJ4C 4JQIH 1GC1C 3VXUA 4UQCA 3KWWB 5C3LD 3RI5K 1FF5A 1WBXA 2BY3A 4N2CA 4OFQA 5CGYC 4YK4C 4YHOH 3UAAA 4CN1A 4MNQB 5EC1B 3EYSL 3KHQA 1IAMA 5IJCC 2B14A 1S78D 1DE4A 1QLEL 2AZAA 3VCLB 3OKMA 2N7SA 4PWEA 4F7TB 2AW2A 1T5XB 3FL7A 2VUKA 1JFQL 3IFNH 5E6ZA 5IEKB 3D2UA 3NCWA 3QG6A 1CC3A 4PR5A 3ALPA 4ZAKD 4HJJL 4NT6B 2YGNA 3ESPA 3MACH 3BDYH 4HWUA 5C0CE 1AXTL 2BWIA 4GAJL 3B6SB 1HSAB 2FJGA 1NAKH 3GBDA 3KPOA 1CICA 1FIEA 3DV4A 2VLKA 3K80A 4MA3B 4G70B 2VOTA 3MGTA 3DHJA 3WFHB 4N20A 3BSGA 3BVTA 4MJID 4X80L 3N9GH 5IHLB 3O81A 4UTBH 3ARUA 3RWCB 5F93C 4UZSA 4LLVA 4HJ0C 4RCAA 5DD0H 3LNEA 2HJFB 1JF1A 3L7FA 2A2QT 1I8MB 3QJVB 1R3LB 2AMGA 2XICA 2WXGA 4ETQA 2YD9A 3QZWA 3IETA 1WWAX 3VFUA 3MRPB 2B39A 2AXJA 5E6SB 2PXYC 1EQWA 2Q6WB 2IALB 5HHPB 2QDVA 1UZ8A 1EFQA 2VE6A 4OM0L 5CINL 1WVZA 2ATKB 2O5YH 3WEMA 1PZUB 4HWEL 2VLLA 1B0GA 3UDWA 2IV9A 2OSXA 1S3RA 2DL9A 4JFSA 4GW4B 1QSZA 3GRGA 4FI6A 4DP7X 4DQAA 3C8KB 2D7QA 4HPOH 3EF4A 4OZIE 4S1SH 1E8YA 2Q7NA 3V95A 1A6ZB 5KWYC 3U9UB 4H8PA 2PWHA 3T04D 3V7AG 2XXGA 4UIKH 3THMH 4XN7A 3OKLA 2W59A 3OC5A 3V4PB 3SE4A 3MNZB 4KY2A 5FUCC 5DDHA 3MCYA 3VRLF 5CHNB 1CU4H 2XLLA 3WI9A 3ATBA 4JO2L 3TZVD 4FRWA 4P5SA 4N0CC 3S4SA 3M17B 2AJYH 3FC8A 3T1FA 3PWVB 5J89A 1UVQA 1DLFH 1FZOB 3FRPG 3STBA 3CZKA 1TJHH 4WUUD 3ZDXB 1P84J 1EVUA 1B4LA 3EH4B 5I1AB 3GIZL 2FX8L 2OMNA 5EZOH 4NQCA 3UBGA 4OT1H 4YS4A 2BHZA 1OF2A 3FT3B 4G7VH 4M5SA 3PCYA 4NXKA 5AB2A 2GITA 1BAGA 3WIIL 3VU2A 1NUNB 2GJJA 4FHJA 4PRPB 4WSKA 5IVZA 1RIUH 3T4YA 4U2YA 3EG9B 3R8BB 1IAII 3AWGA 3B9KB 4NO2A 4JE0A 3S34L 1GGIH 3BPCA 4GG8B 4ONHB 3GPSA 4U7KA 4J3VA 4Y5YA 4FQXC 5DRNB 3RA7H 5HPOA 4MJ5A 2M2DA 4HJSA 4H44C 1LP9F 1YPZA 5D5MF 5ID0B 1QAWA 4L0YA 3FT9A 3PJSB 2QTVA 3OF6D 2BIOA 4W9GC 4YBHA 3X1NA 1D5BB 1E7VA 4UTAA 3H2WA 3LNFA 1XF5B 3VB9A 1BYPA 3S9DB 5H37G 2DM3A 1H8OA 1E9PA 1NIFA 3P11H 4UNIA 1BOYA 3FTVA 3RVVD 4D94A 4A6YA 2YGPA 2XFXA 2Y2YA 4FQCH 4GXVH 4OKVA 3L1FA 2JCCF 1RURH 3EJPA 5LDUA 3PNWB 1MG3C 3GZQA 4MSWB 3CMOH 3NJMA 4Y9BA 3QZMA 4TVPE 3APCA 4ZT1A 2F68X 3EHBD 3LEVH 1XEDA 4M1DL 4NZFA 1FVDB 2E4TA 1OIOA 2YPLE 3BUYA 3V0WH 4R4NC 4OCSL 1KY6A 4PIRF 5AWNH 1F6FB 2FX7H 1FIGH 4XCCL 4Z7UE 2ZJSH 1BQUA 4KQ3H 2NLJA 4PJCF 3T0ED 2ZSVB 5FM8A 2HN7A 5HJDA 4I88A 3ETBF 3IGFA 4NBZB 1DDHA 1XF4B 4JFFA 4LLDA 1U3NA 3QT2A 4K4KA 4AQAA 2AEIT 3NT0A 4YWGH 1UQSA 2CXGA 1PZAA 1G84A 1IC7H 3IM1A 3LQAL 3OG4B 3MRNA 2L7EA 2LLGA 1T7XA 2J8UF 1VESA 2OMXA 4OI8A 3TN0C 1N9PA 4HCRL 3TO4D 4Z5RA 4Q56A 4PIBA 3UTTA 1K8IB 1KLFA 4BGLA 2Z4TA 4NO0A 4U3SB 5JHDE 1HX0A 1OAZH 2IEPA 3O6FC 4HQQH 1BXVA 4WJ5A 1U3HD 5FCSH 2XCMC 4P23A 2CBPA 3OAUH 3TBBA 3A0OA 1BGXH 1E9OB 1FAIL 4NEHB 5ICYB 1KXQA 4UIMB 4LHJB 1LQBC 4IOFC 4Z0XB 4GRLB 5KVFL 4K7PH 1A1OA 1QZNA 1GMEA 4Q8BA 3F65A 4U1LA 3PHOB 3PWNA 1NKRA 1NCAL 4LSVH 4QT5B 4X6EA 5BS0D 4MCYB 3I6LD 4PYGA 3OPZL 4O9HH 3QDGA 1JZEA 4KK6C 3WNNA 4KK9C 5C08B 4X5LA 3TONA 3JWDH 2AEQH 2KHAA 1CFNB 3ULUC 4WFGD 5DZNA 3UYRH 5C07E 5J3HD 4B5ZA 4PI0A 1UATA 2VDLH 4XI5C 1U92A 3G5VA 3CAFA 1B4RA 2VUYA 1QHOA 4UT7L 4YDKH 2X1PA 5I23A 2KZKA 5KJRH 4ILDA 1SQ2N 5EU3A 4LKXA 4JFOA 4JO4L 1KWGA 1RKRA 3V6ZB 2FJFA 2QEJA 2WN2A 3KGRA 2YSTA 5T33L 3ATAA 3FQXA 4OUUA 5E2WH 1DQKA 1GSMA 1OPOA 1XGPB 2EIBA 4P2QD 4XPFL 1H5BB 4I0PA 2AMUA 3DOSB 2Y7MA 2BRRH 1CR9L 2FNBA 2R9HD 5C0JA 2GFBB 1E43A 4HH9B 3UJTL 4ADGA 4DKAA 3ZKMD 4YX2L 1QNZL 5D1QB 4LB8A 4EUPB 1X9QA 5C0ND 3D87B 4FFZL 5GIRB 5DEJA 2D03H 2H9GA 3MV9D 4X9IA 1ZT7B 1MFUA 4HEME 2HX9A 4ONFH 1FFOB 5LO7A 3HEIB 1QPPA 2YHGA 3MRCA 1FHGA 4ELMF 5I17B 1WBZB 2OXGA 3FFDB 3UX9B 5I2IA 2P80D 2ZYRA 1KGYE 2WLLB 2V0AA 3EGXA 3VDCA 3X1BA 4J2XA 4WI0A 4XMZA 4A68A 1B0WA 2GC7C 1XZ0A 3EZJB 3VD5A 3US1A 2CCVA 1CYGA 1Q8MA 3VI3B 1OALA 1RZGB 4AKOA 4U6YB 1JDCA 1JRHL 5L0QC 5GSRB 2M1KA 1KIPB 3NRFA 5C09B 1EAPA 2BIQA 4RFOL 1KC5L 2OR9L 2W9DL 4WEBL 1I8KB 1K72A 3IE9A 3L6FA 3U6RA 3AG1B 1YN7B 3JUYA 2VERA 1SPDA 2ICEC 2Z1PA 4WJG3 3QR2A 4RAVB 4PJGE 5CBAB 4ZX4A 4YXHH 1FORL 4QXUL 1MPAL 3VXPA 3GSRB 1E7UA 4F7EA 1UG9A 5JYMA 2OK0L 1IC0A 3FOMB 1AR1C 3CN2A 3NCYS 3VI4A 3LJ3A 1LK3L 3FAWA 4N2HA 3X3GL 4BZ1H 5IB2B 3VFGH 1JTOA 4PRHB 1UCBL 4HPYL 3KYNA 4Q97A 1BLIA 4DOHB 4WFFE 3HI1A 2ESVD 4KAQH 3MCLH 3JTBA 1HWWA 1MLBA 3QCUL 1JGVL 2C3HA 2F6AA 3ZQWA 5FYLH 2AGJH 5GRUH 3BEWB 2JNZA 2Q7YB 3KVQA 4M7LL 4S1RL 1S3KH 3NIGE 1KPVB 2MJWA 2W95A 3V4PL 6FABL 2V5SA 4PJIA 4ZS6D 3DBXB 1QYGH 3VMPA 3TEXA 3C6LA 2XZQH 2EVIA 3ECVA 2R2BB 4MNGE 5B8CC 2VN7A 4YUEL 1NCJA 3HR5A 3NBNA 1T2XA 3HMXL 3QZWG 3RGBA 4E41A 4ORGA 5KSBE 5KSUA 4Q6IB 2JI3A 1KCUH 1QSFE 1I7UA 1X5GA 4KKBC 2CIIA 4E2OA 4NQDD 4UZUA 4G9FE 2VAAB 5FWQA 1MFAL 3ME0A 4L3EB 3LQMA 4AQ8C 2XG4B 3TESA 2B9AA 5DJAB 3TT3L 3I2CH 1FNSL 2VISB 3DUUA 3N6YA 4EI5D 2NNAA 3AREC 2H5UA 1MZZA 2W8CA 5DVKA 3WKNA 2G2PA 1J1OL 2DYSB 2OSWA 2E5EA 3ZE1B 3DARA 2JIXB 3QUZC 4EN3A 3H1ZA 3JWOH 3ECWA 3LNDA 5IMLB 1T20A 1A6AB 1BEYL 4R7DB 5FO7B 5E8NB 3TJPA 3KE0A 4PP1D 5BRZD 4BQCA 2DKUA 3BFWA 2FGZA 3LIUA 3NEXA 4M4RB 5JDSA 3ZGHA 4I9WD 2DS4A 3WKYA 2G2NA 1CT8A 3S4SG 3Q13A 1JZ7A 3VFOA 2IFGA 3T4AB 3GSNA 5AKVA 1V54B 3CH8A 1TYRA 1U8OB 2BXZA 3WHXB 1UURA 5ANMA 2EKSA 3A6CL 1AGCA 5I16A 3LNHA 3BKJH 1BW8A 1JPFA 4NJAH 2EVJA 1DJYA 1G94A 1TJIH 3MRHB 4NS0A 4D8PA 2M26A 4DEUA 3RZCB 4WV1C 3KWWA 3SJVD 5GISH 2FVNA 3MN8A 4ZFQA 3ARFC 3BFOA 3H54A 2F18A 4JUSA 4MNQA 3ARGD 3P0VL 5EC1A 3HC3H 3RAJL 2FJUB 3QIBD 3SO3C 3W11C 3VCLA 3AGVA 1NCDL 1T5XA 1J87A 4IDJH 2MTPA 3RP1A 5IEKA 4FFZA 1E4XH 3F6IA 3MV8B 6PAZA 4IS6A 3R1GL 2QQNH 3E6FB 2CZNA 1CJYA 4NT6A 1GCYA 3NCJH 1KDIA 1WAAA 2APWA 1GCFA 2HWZL 1S7TB 4MXWL 4OIFA 3B6SA 3NZUA 2FSEB 3CSPA 2AITA 1RP8A 2VLRA 5DRWB 4MA3A 3D50A 1U93B 3O2WL 5CJOH 5IT2H 5K1JA 4PRBB 3WFHA 5D1XB 3RWCA 2DQEL 2H8PB 1JOIA 5E2TH 3SGKC 2HJFA 1B4TA 4S11A 3AACA 3AG3B 1I8MA 5AW1B 1HE8A 4G6KL 4AYSA 1R3LA 5D9SB 2JI2A 4F5CA 3P3YA 3HB3B 1EXGA 1ADWA 3EJYC 4B9YA 4HIQA 3VFMB 4J3XA 3MRPA 2Q6WA 2WZ5A 2IALA 2AFNA 2LFGA 5AB1A 3VJ6B 2A4CA 2ATKA 1TFPA 4PJ5D 3K4AA 1ZTXE 1WCQA 2EE6A 3VXUD 2JJWA 1R0AL 2JKNA 4GW4A 3C8KA 4OGYL 4S0HA 2DQIH 4GBXC 8FABB 1NANI 3JV0A 2BVOB 2WO2B 3L3IA 1AACA 5D6DA 4DN4H 5AAMC 4AMKH 3ML8A 1YYML 3T2OA 1A6ZA 4IU2B 4ZQTA 3U9UA 4QRBA 3ESMA 5MHSE 2UWEF 1Y7VA 3APFA 1Z1WA 5CJ5A 1UWFA 4HWNA 5LB1A 3L5IA 3SD2A 2BZ7A 3V4PA 1BM3H 5GGSB 3MNZA 1UACL 3ZYZA 5CHNA 3PUUA 3ULVD 4PSPA 2O6PA 3NSCA 2D7MA 4GMSH 3VGEA 5FCUL 3HMXA 6PCYA 3M17A 5FFGA 1CICD 1Q0XL 3PWVA 1N19A 1FZOA 1SBSH 3DWTA 3OKKB 4YSQA 2VM3A 1ZMYA 3EGSB 5E6YA 5I1AA 2NTFB 3KYOB 1YVLA 3R4RA 1KJVB 5D4HA 3O2DL 3A6BL 3WFEH 4YXKH 4KH9A 1Z2KA 3OWRA 2WLMA 4PRPA 1P7QB 4YLQT 4ZD3L 3EG9A 2D3NA 3B9KA 2AABH 4OLZL 2DBLH 4GG8A 4ONHA 5DRNA 1GS8A 5ID0A 2FIKB 2FEEL 1J1XH 1JHLL 3D1MC 5D2NE 3L9EA 3K4DA 5IW6B 2C7FA 4U05A 1D5BA 1XF5A 5HDBF 3F6LA 4WJKB 3LRLA 4N8VB 3RPKA 4TOYL 3IDIB 1Q1JL 3HZVB 5BVJB 3CFTA 1EXHA 1JDDA 1WEJL 4GFTB 1QBBA 4M7JH 3RVUC 4W9CC 3T0WA 1R3IH 3HZYB 4P9HH 4Y19D 4J3OH 3P1VA 3PNWA 3BJLA 4HFUH 1Y6NR 4MSWA 1CFTB 4F20A 1JD7A 5E1GA 1JGEB 3S3SA 2YARA 1PBYA 4FQ1H 4JRYD 1TQVA 3U2IA 4DK6A 4JM2B 4WK0B 2G30A 3WMPA 1FVDA 3L48A 1UFGA 3TWCL 1CS6A 2WBJD 4JG0L 2N7AA 1JZGA 1QKZH 3UZQA 3C75A 1IM3B 4LOFA 2NQ3A 5JO5B 1F11B 4Y4KB 3O4OB 4Z0BL 1AYRA 2ZSVA 5KANI 1UJ3C 1URLA 2PYEE 3EO1B 1XH0A 2X6BA 3FFCE 1XF4A 3C5ZC 4JG5A 3ZDYF 3SDAC 1ZIAA 4TLUA 5ABAA 3GRBA 4Q9CA 3RJDA 4XO5A 4BSWB 4ZUUB 2GBTA 4M5YH 3FO2B 3S3JA 1HNYA 5E1AA 2H7WA 1A66A 2OJZH 2YLKA 4H5SB 1IBGH 5D55A 4D9RE 1HINH 2VB5A 1K4DB 4U3SA 1ZHBB 4P06A 3LAFA 1UD5A 2ZOKB 4V11A 4D7BA 3OBAA 1RQ5A 2J88H 1E9OA 5ICYA 5I6NA 4UIMA 1NBQA 1YG9A 5DI8B 4Z0XA 1S5IH 3BKMH 3S35X 4GRLA 2XTJB 3KVPA 1KYAA 2FHCA 3GJEB 4JFEA 4DAGL 2J7LA 2W92A 5EF3A 4KXZI 1NKGA 4MCNA 3VG9C 3L4VA 3TASA 4NUJB 4QAMB 3PHOA 1GH7A 2K6ZA 4TMPA 4AL8L 5IB5B 4WSGA 4D0DB 2P5EB 1ZANL 4MCYA 5A3IC 2DWDB 3K6SB 4IRZL 4YDVB 1V5JA 3ETBJ 4JFVA 5E6ID 1F42A 1BFOB 4MMZB 1OL0A 5FHAL 3FBQA 1CFNA 4YXLH 2VRQA 1OAXH 2R0WH 1A6TB 2LE9A 4R84A 3MLRL 1QRND 2KS0A 5G2NA 3KD4A 4DKEL 1KJMB 1IAIM 4JFFD 3CG8A 3P3RA 4HSCX 1QSVA 3H56A 3RWFA 3SPCA 4WW2C 12E8L 2F8VA 3ZRSA 1DSFL 1MLCB 2CRMA 2HUHA 4H25B 3NJVA 1DVZA 3CNKA 1DQDL 1S7WB 3QXWA 3V6ZA 3O2DA 2VH5H 1LDSA 1LLAA 1J9TA 3KMDA 1XGPA 2RGSA 3NYKA 2YUVA 1H5BA 2O5NA 3QS3A 3DOSA 4ZX3A 2EE2A 2WN3A 2B2XL 4O02B 5CO1A 2C4FT 3MTRA 1JNLH 3KW8A 4NO0D 4Z7VF 2GFBA 4HAKA 1MCOH 4HH9A 4KUCD 2ZWSA 2A9MH 4P23D 5D1QA 5MI0C 4EUPA 2KBGA 3R4DA 4OAWB 4DGIL 2QGDA 5GIRA 3QUXD 4HUVB 2ZXGA 3VQ1C 4CA4A 1ZT7A 2MNUA 1UA7A 1BVZA 3QZNA 2R1XB 1TOXA 1FFOA 4FCAA 3IN0A 4FQQB 2VZOA 1YNKH 2HT2C 1UUNA 1IKNC 4FYRA 5I17A 1WBZA 3FFDA 4QXWA 2KERA 5CLZA 2WLLA 3CVIL 3G5ZB 4XWGL 1DUZB 2DPKA 3QDGD 1NCBH 4P46B 5D1ZC 3OLGA 2PO6C 3WY1A 2V3EA 5I0WA 5MEPB 2NUTB 1OB0A 3OMAB 1CWVA 1RZGA 3VI3A 4U6YA 1GGBH 5GSRA 2VZ1A 2PTTB 1KIPA 5D93B 5DFVC 5C09A 5DJXB 3NSXA 2WSKA 1HK6A 5ISZB 1I8KA 5EZPA 2NZIA 2O61B 4XP5L 2WNKA 4RAVA 3NGBC 5CBAA 3OJMB 3GNMH 3H2PA 3GSRA 3RTQC 4EO5A 1GTNA 3FOMA 1N10A 5JOEA 2K8QA 4BQ9A 5IB2A 4PJEE 5GRJL 4PRHA 3LIZL 5L8JB 1AP2B 3LKPB 3NK3A 5J56B 5LUMA 4N5UA 4Z7WB 4ANUA 1IFHH 3AT0A 3F83A 3PAUA 3WOVA 2DBJA 3Q8EA 2F7RA 2BNQB 5FW8A 3BEWA 4F37F 5TF1H 3INOA 2Q7YA 1TUPA 1F0LA 3UGXA 1KPVA 2E27L 1H0DB 3G08B 3PE9A 2V9RA 3DBXA 2WVTA 5C0FB 1CFVL 3C08H 4F37K 1LMKA 3NJIA 1Y18B 4NN5C 4X5RA 5INDB 2R2BA 4XNZB 1DBJL 1WF5A 2VDNH 4E9LA 1I7TB 2DJMA 4M4PA 4Q6IA 5EIVA 4MRCA 4W9LC 3C6SB 3TU6A 3FQ1A 2EIDA 2VAAA 5K9QI 1GJWA 3D3VB 4L3EA 5D7IB 1U2CA 3BOVA 1AQMA 4OZFH 1RUQH 3Q05A 2XG4A 5LGHH 4P3CH 5DJAA 1CFMA 4X4MA 2RCSH 3WXVH 3Q6GH 2GW5A 4DF9A 2VISA 4KJWC 4L8SC 5DURB 5E5UB 2LR4A 1U42A 4IRZA 2OR7A 2XWZA 5LNDA 4WGVB 4AJ0A 2D7OA 2YD6A 5FFLA 2F1BA 1KXVC 2JIXA 2O4EA 2YD0A 2C3WA 1N4XH 5A1AA 1JBJA 2ZWNA 5IMLA 4XPTH 1NFIB 1A6AA 2Y9RT 4R7DA 5KVMC 4PG9B 2ZONA 4M4RA 4OQ1A 1G7HA 5IGXL 1IGCH 2QL1A 4JY4B 2QLVB 5B7EA 3HZ3A 3ZU8A 3T4AA 3MRJB 5C0RL 1U8OA 3WHXA 5LG6A 3WN5B 2D7NA 1MFCH 1QWUA 5AW8B 1BFSA 2ADFH 4LDCA 3MRHA 4UMSA 3RZCA 3MLUL 4AGNA 3FPYA 4EF3A 5E2UL 4WZ9A 3V0GA 1VIWA 1WS8A 4XMPH 3LKOB 5T3ZH 4E41D 4LFHG 4ONGH 3V52H 4AZUA 1R47A 5JOPE 1KN2L 3BESR 4XPGL 1XB3A 3DVIA 5FW6A 3BT0A 3MV8A 4JFQB 1RZJH 4HOWA 1E6OH 2DF3A 3E6FA 3L5WB 2VLJB 3CIQA 2NQDA 4WHYG 4ZS7L 3FUHA 4G8IB 2HX7A 4XBEL 4DKFL 4EI0A 1BDYA 2X4RA 3KH3A 1S7TA 4FL4B 3EYFB 2FSEA 3FDWA 3CHPA 3VW3L 2VXVL 2Q7AA 2ZD0A 3TEUA 1I53A 2EILB 5DRWA 4Y8AA 1U93A 3BD4A 4MXVE 4C8XA 1WITA 3H9SE 4PRBA 1OE1A 5D1XA 4FHKA 3BZDA 4CBZA 5JIHA 4GQZA 4XN4A 5IZ7A 3CLEL 1A64A 4XVSH 2PXYD 4WWID 4RISL 1QEXA 2H8PA 3DIVA 1DBAH 3CDYA 5I8KH 2AJXL 1C1EH 4BH7B 3AG2B 4OCWL 3WTSA 4OGQC 1PZCA 5D9SA 5GZNC 1MJ7H 1KCVH 4KTEH 4WWKC 1YMHB 4G59C 3VFMA 5FYJL 4W9JC 3ZL2A 3VJ6A 4U6VL 4KU1A 3QJRB 1KFAH 1EJOL 1BXUA 4M9PA 3LIZA 3BAKA 4LLMB 4LU5H 2EVFA 8FABA 3ILQC 2CGRL 1TR7A 2BVOA 2ZX5A 1DFXA 4IU2A 2BIIA 2AJUL 1NGQH 2VITB 3MGOB 4W9ZA 2OZ4H 4JZNB 1MDAA 2P8PB 4L37B 1MWAB 1T0PB 1J9CT 1K2DB 4AUYA 2QSCL 1NMCB 5GGSA 3RILA 4EZKA 2XIDA 2Z7UA 3WE1A 5FPIA 5DK2B 5I6OA 4FQLL 3F58L 1ZA6B 3LXCA 3M6DA 3B7TA 1FAKT 1OGAD 2X41A 2VLRD 5E03A 5FLUA 3OKKA 3Q1SL 1VAHA 1TJXA 5AUMB 5TE6L 2YD3A 1H3GA 3O6LH 4WHDA 3NQIA 3EGSA 4CILA 4WF7A 5L2KE 5FK9B 4PJ9B 2NTFA 1UD6A 3KYOA 4K2UL 1KJVA 4HWZB 2C3GA 4FQXD 2NXZC 4NZDA 4PG2A 2D4DA 5K9JL 2OJ1A 4NENB 1G7LB 4UINL 1AS6A 4O02L 3FBKA 1P7QA 3A22A 4U4IA 3UPCA 1F8TL 2OZNA 2AV1B 4FD0A 2V5TA 4R26L 1F90H 4Z76B 1XWVA 5JZ7C 3QYMA 2FIKA 5IW6A 3DK0A 2ZWKA 2J5LB 1MJUL 2R8SH 1FGNL 2HFTA 3ASOB 4PLJC 1CK0L 2F19L 4H8VA 4M7KH 2CNYA 2ZKHH 3GS7A 5DF0A 5EUOB 4N8VA 5HHXL 3UTSB 3IDIA 4BCZA 1MCLA 3E3QE 2H0PA 3IMSA 3QRGL 5ACLA 3HZVA 5IMOB 5BVJA 1QEWB 5IESH 1E5AA 4OVVA 2ZXQA 5AW6B 2D7TH 4NX0A 3JUZA 3HZYA 4OM1L 4LVOB 4C47A 4BGDA 2B1AL 4R4ND 1CFTA 1UA3A 3GZKA 1I1AB 1WIOA 1I8LC 1JGEA 3CPUA 4M6MH 5TTRA 3V6FB 2X42A 3FH8A 5AZEH 4RVBA 3VXUE 3PGFH 5LGJB 4JM2A 2DQUH 5DR5L 1QACA 3L5HA 1IAIH 4AW7A 2X44D 2RBLA 3FCUB 3FQRB 3VQ2C 3QPXL 4NZRL 4EUPG 2ZXAA 1KBWA 5F1OB 3ZQ9A 4UQIM 2CE6A 1EAOA 1IAKB 1YECH 4AY0A 5KBKA 2ERJC 3HTLX 2X4QB 2G2RB 2JKXA 3M1BB 4Z7QF 1IM3A 5JO5A 1F11A 4Y4KA 2FT7A 1L9MA 3IRCA 4FLHA 5DMYA 2X2JA 2JK5B 4NC1E 1OP5H 3HNTL 4PRPD 1HNFA 5GGTH 1E2ZA 2BOBB 3B9KD 3EYUL 1NQBA 1ZVHA 4LSTL 4GKSB 4QOKD 3BVVA 3FHEA 4XP1H 1YZZA 3UTOA 3DVNB 4ZUUA 4ABQA 4BSWA 3O6FD 3FO2A 3P73B 1X5KA 2KL6A 2VLKE 4IIQB 2P45B 4N1CA 5D4IA 4M00A 4H5SA 4IOFD 1MHCB 3QIUC 4AYBA 5KSAC 1K4DA 3VNZA 3U7YL 4D0CB 4FTVB 1J86A 2YKLL 3DPBA 1ZHBA 4Z6AT 2DH3A 4CDHA 4W70A 1IKNA 2ZOKA 1C7SA 1PX3A 1X5AA 4GYBA 5DI8A 3IPBA 2X1OA 4BA0A 3GJEA 4G8AC 3DX2A 3GXUB 2VW7A 2K0RA 3B1UA 1BAWA 2BS8A 4KK9D 3RURA 4NUJA 4CMMB 2HVJB 5AEAA 3ULUD 1ILUA 5ES4B 3FTGB 4D0DA 5IB5A 4NZUH 2P5EA 2O6CA 3QP3A 2IMNA 5I0XA 2DWDA 5T3XL 3K6SA 1IM9B 2VR4A 4K7PY 4YDVA 5KW9L 1TEYA 4YSOA 1BVLB 1BFOA 2I7SA 4R97C 4MMZA 2WNXA 4KROB 2DDQH 2C9QA 4MWFB 3FULA 1SOXA 1H8LA 2FK9A 3FOLB 4PWJA 5L88L 3WNJA 5HHNA 1A6TA 1AKJD 2BHFA 3WAKA 1GVIA 4GI9A 4GPVA 3L4YA 1KJMA 3DX6B 4RRPM 2HRGA 2ZE0A 2DM7A 2CDGB 4NZTL 1KYFA 5FWRA 3FU0A 4PBDA 4OCLC 1MLCA 1OGSA 4H25A 4WKXA 3KLDA 1JWMB 1IZKA 4ZG1A 3BAEL 4B60A 3ABLB 3TH3T 3WS6A 3NCMA 3WIHL 4N0UB 4ZMOA 3V6BR 3VO0A 5AVVB 1N12A 4O02A 4RMUA 5BMFH 1XF3B 2QFRA 2QR0B 5KAQF 4NQCE 1TT6A 2DB8A 3TLRA 2WVUA 3SDYH 3X3FL 3Q44A 4OAWA 2NNFA 2WM0A 3GO1H 5GHWH 1A3RL 3U9PH 4HUVA 2D31B 2IOIA 2Z34A 3FT0A 2IPTH 3HPJB 1FH2A 3NA4A 1SFDA 1XHHA 4JFED 2C1OB 4DVBB 2R1XA 4HS8L 5HVWA 4OZIF 3KBFA 2Z35B 4FQQA 5GGQH 3VMOA 4R83A 3DI3B 3D8MA 4XMKH 4A2FA 1K3ZA 4GRWE 4NQSB 4C4KO 2V2WB 4DW2L 3CPLB 3G5ZA 4P4RB 1DUZA 3SODB 4B3VA 3HOGA 4P46A 4ZMAT 4Q7DA 1GR7A 4ZOCA 5MEPA 1DVFC 1UEMA 4H8WL 3ZPDA 2NUTA 4CN6A 2ED9A 2PTTA 1TZAA 5DVNA 5DJXA 3AADB 2GG1A 5FECB 1TTBA 2WBXA 3AU0A 2X4PB 3WFCL 1PQZB 5BCAA 1XR9B 2O61A 3U4AA 3LZNA 4M62L 2QVKA 3EOTH 2DD8L 5D7LE 3UMNA 3O6ML 3ZKXB 4XVJL 3B37A 3WHE1 1TJGL 3HC4L 3FXIC 1BWWA 1KV3A 2J25A 4FQIH 4BZ2H 2ETWA 1AE6H 1YEHL 4JO5A 4D3CH 3TBSB 2PPFA 1NL0H 1OCWL 1OKEA 1AP2A 3LKPA 4G8GD 4X6CB 5J6SA 4UM9B 1Q0EA 2IANB 2ZG2A 4Z7WA 2FT8A 1IU1A 3LN5B 4JE4B 4G5ZL 3HS8A 5K9OB 2BNQA 1X5FA 1AANA 4QRFA 3U7WH 3GKZA 3EYVB 3OL2A 2NY1C 2PPDA 2AJZB 4Z95H 3O4LB 1W16A 2ZX9A 1MWAL 2FWOA 3LH2H 3MRGB 1IVTA 1Z5YD 4AM0Q 4KKBD 1H0DA 1ZPLA 1YEIH 2ZX7A 2ZCKH 3G08A 3L45A 3ZKNC 5C0FA 3LKRB 4AK2A 3AJ7A 1Y18A 5CJXC 5INDA 9CGTA 5FF6A 1XH1A 4XO3A 2EDKA 3SO5A 4FNLH 1I7TA 1SUHA 2YGOA 1KGCD 5EORH 1XCTB 1YEKL 5F8QC 3IE4A 4AYGA 4U1MB 4CVZB 4DUWA 3C6SA 3NACL 3TXAA 3ARED 3QIWC 3UTTE 3D3VA 5D7IA 1N5AB 2CBTA 2NW2B 1D5XB 1SXSA 2ZUWA 2EXSA 1PNCA 5KN5B 2J1WA 2BSEA 1TSRA 4S1QH 3BZFB 4PLOB 3SDDB 1UGNA 2WP3T 1KXQE 1WDAA 1G6RH 1T1ZB 5AVZB 4B0MM 3V5DB 2Z1KA 3UZEC 2JMRA 4OGXH 2DMCA 5KYUB 4ODWB 4Y0GA 4EDWH 3D85D 2OFQA 1NFIA 2GAZB 4A39A 2X89D 2EUXA 3PHSA 4PG9A 2MOVA 2Z93B 4Y5VB 4PRHD 3EDDA 4MAZA 4M93C 2GJPA 1F4WH 2XJLA 2Z7YA 3QYNA 5E8DL 3RDTB 1PFCA 1ROCA 1JXFA 4JY4A 1JF6A 4M61B 5FKAB 3GHBH 1AZVA 3MRJA 1BXXA 5EDXA 3BP4B 2R56H 4PGCB 2X6VA 3WN5A 4QGTA 4E5XB 3LQAC 1S7UB 1O9ZA 3H9HB 3W11D 1RL1A 4F27A 3KLKA 3NCCB 4NQVB 5EU6B 3WIHA 1LTXA 3RX9A 3QUML 3UJIH 5C6WH 3HI6H 3FYIB 2Q76B 2PP8A 3LKOA 1VB9A 1NUDA 3SKOB 1LHZA 1H6EA 2BZCA 4JFQA 3TPKA 1VACB 4WFEE 2N56A 3L5WA 2VLJA 3FTYA 3GQFA 5E9DD 1TTAA 4G8IA 4PGDB 5ESVB 5EDSA 4JHWH 5KG9B 1J8HD 3L3OB 4A38A 2C3VB 1YEDB 4XPHL 2YBRA 4N8VG 2KMWA 3US9A 3ARSA 1D6VL 4DN3L 1JHKH 1I9JH 1N18A 1U8MB 3FN0H 2JIXD 3PF2A 1Z9OA 4MCMA 3VWKB 5EBWB 2GIXA 2ENSA 1QFUH 2K45A 1OWWA 4ANWA 4DPRA 3ISYA 1PCXA 2G4EA 4FLRA 2NOYA 3H7BB 3GKWH 2VR6A 2MCPL 1SHSA 3HNVH 4BH7A 1SHWA 5TQ2L 4N0FB 4PB0H 3U79A 1KZQA 5EUKB 5D7KE 1MH5B 2Q9OA 4XB8A 1YMHA 4GBXD 1FVEB 1XMEB 4FFWC 1IIIA 1I9EA 1QI4A 4NUGH 4QRSB 3FJTA 1VEOA 2UV3A 4X6DB 3CU1A 3RZCD 3LYRA 4KVNL 2X05A 4HALA 4UDUB 3ZL1A 3HA0A 3EJRA 2BDNL 4LLMA 1FSKB 5AVTB 1SEBB 5HYIA 4D9QE 3MOBL 1ZKAA 2Y25A 1N7ML 3KWVA 4CNIB 3C09B 3VI4E 3LXUX 4TSAL 4Q0XL 4UQBA 2GJ6E 1SY6L 2VITA 3MGOA 5F6HI 4JZNA 2P8PA 3HHMA 1G43A 1MWAA 2PMZA 3US0A 5DUJA 1KCRL 1K2DA 1UC6A 2BVTA 4UV4L 1CL7I 5KJ4A 3MLPA 2R7EB 3QJQB 4OV5B 1NC2D 3BEVB 4OFKA 3WEXB 2H3XC 1MRDH 2OMYB 2R4RH 5DK2A 1G1KA 1YAIA 2R0LH 1OOAA 1YEFL 1MFEL 4LZKA 1N2RB 4WENB 2VXQL 4YR6B 2VDLB 4PJIE 4DQOH 3ZYIA 1GGYA 5EG6C 4GG6E 4Y5XC 4U1NB 5AUMA 5ABZA 5FK9A 4PJ9A 1ZJAA 3H6AA 3W0WB 2X12A 4E9VA 4FXKC 3BPLB 4PGEB 3BGMB 1G7JB 4QLWA 4C59B 1EO7A 4NENA 2CRIA 3QJFB 1XAUA 2VW6A 4UB0H 1G7LA 1R46A 1MXDA 1CYWA 1X7TA 1JERA 3E0GA 4PJGF 5KVFE 4PTTB 3KYMB 2AV1A 3K6NA 2OL3H 5KSAA 4IGBC 4Z76A 3RY6A 5IWLC 4IOIB 1J0JA 4XX1E 1SJEB 2E7BA 3WGVB 2QHLA 4K3DL 3RVUD 3T6VA 4K23L 2VMFA 2YS4A 4XNUL 2IDTA 5EUOA 4RGNC 3UTSA 4HSQA 5DS2A 3GPEA 3LEYH 1O7DC 1XXDC 4LSRL 4ZOEA 1KXHA 2Z8VC 5SWZE 1BHGA 1QEWA 3ZHLA 4I77L 4E9RA 5HHQB 3NIGF 2FHBA 1GPOH 1MW1A 4Q74A 4LQFH 2FH6A 4YPGB 5FA3B 1CZ8H 3GM0A 1S6NA 4Y1SA 4ZXBC 3QO1B 1C5BL 1IKFH 3M86A 5D8JH 4JCWA 4U1GC 5DYOB 1B9ZA 1W80A 5KSBF 4LLQB 3V6OA 3V6FA 3U0TB 4PJHE 5LGJA 4TQEH 5EULV 4HD9A 2CALA 4HGMA 1F3JB 1BMWA 1Q9OB 3FQRA 3V0IA 2VQTA 1MDTA 4YSTA 3C5ZD 4DTGL 3UJJL 3SDAD 1IAKA 1S5HB 4MNQE 2CDFB 3KPSB 1T3FB 3U0WH 1W8NA 4GRMB 2X4QA 3M1BA 5G4NA 3JWDC 5KBDA 2XXFA 3QPQC 3B5GA 5DHMC 5EC2B 3SQOH 5MP6L 2JK5A 4G7SB 2H32H 3NA9H 3IJ8A 4JVPA 2VDOH 5IJVB 3NJNA 3MROA 2BOBA 2ZKYA 4PAZA 4PBVC 4PS8A 4B9IA 1WAAE 3BLPX 4J3UA 3O45B 2R4SL 4GKSA 4QGYA 4S1DC 4JL2A 3OXRB 4PRDB 5AKRA 3VQMA 1QUNB 1Q38A 1W0VB 3DVNA 4HPOL 2ENQA 4K71C 4POZD 3P73A 3TBTB 3ZJAA 3RHWF 4F57L 2WV3A 5ACZB 1J7VR 4IIQA 4F93B 1OSZB 5E6RB 4P2RE 3DC0A 2X1QA 1MHCA 2O6EA 4D0CA 2CHNA 2F53D 4FTVA 3K7UA 3RHWK 3OGCB 1I7ZB 4MMYB 4RMQA 5C0AD 2OS7A 2AQ2A 2HFGL 4N90D 5JR1H 2RAMA 1W6LA 2EIEA 4LK4A 4OTXL 4Y9CA 4BKTC 1T22B 5A3ID 4F5CE 3SE3C 2JELH 5JUEL 5I76B 3GXDA 1BFVL 4KUZH 3GXMA 3RU8L 4CMMA 4OLUL 4PWKA 2HVJA 1TJHL 2YEZB 5K1NA 5IUSA 4LCIL 1FNAA 3GINA 1LE5B 3HFMH 3LDBC 2AV7B 3FTGA 4TVUA 1SY6A 3D06A 3GLAA 1IM9A 1MREH 3WKQA 3KBEA 2PN5A 1SDDB 1BVLA 4LCCC 3BP6B 4KDVA 2YLHA 4O5LH 1WFIA 1IKOP 3G5YB 1IM3D 1N6QH 1ID5I 4K9EL 1O7DE 4FX5A 1XTLA 1OK8A 1G9HA 3FOLA 4Y4KD 5AAWC 4DCQB 3CFQA 1GGIL 3T2PA 5IQ7L 2NX5B 3EIFA 3U4KA 4AQZA 4W4OA 5GRVL 4GH7B 1LEGB 4BK4A 5GS0L 5KJ7E 2YPVL 3DX6A 4NCC2 2VXQA 2I60L 1YNTF 2CDGA 2AAVA 2D3JA 2FZ3B 3JZYA 5KYWB 1UCTA 1KZYA 4MAYB 1JWMA 4Z78A 2YMXH 3P0YL 3ZMRA 3DURB 3SKJH 4LPXA 3LZPA 1GKOA 3GMLB 4N0UA 3D6GA 1R24B 3BPNB 4IJ3C 5EU4B 4K9JA 4ZFOL 2XZAH 4UTCA 3ZDXE 1XF3A 5J13C 3T0XA 3L5XL 2QR0A 4EBQH 5JIMA 3L1OH 5CJXA 4Y2OB 2X4SB 3KR3H 5JOFB 2D31A 3HPJA 1X5YA 4ZUVB 1Z9PA 3RIFF 1OCOB 4CSTA 2GYSA 2XTJD 5D1ZD 2C1OA 2PO6D 4DVBA 5TK2A 2DL2A 3QFGA 1VLXA 4WUKL 3MRIB 2Z35A 2WK2A 3FTZA 1KPUB 2ZUYA 5DFVD 1D7DA 4ODTH 5I1DB 3RIFK 4NQSA 2P5ED 4JW3A 2V2WA 1N0XL 2FX7L 3CPLA 3EH3B 3K6DA 4P4RA 5E5RB 1COBA 1ZEAH 5D2LB 2CDEB 1DL7H 1WBYB 2IPUG 2G60H 1DO5A 3OHMB 3S3PA 3RLSA 1MCDA 3B1TA 2LU5A 1F86A 3RTQD 5DJ2B 1AJ7H 5FECA 2QPDB 2X4PA 1PQZA 4MKMA 5EWIH 1XR9A 2B3IA 4ODHH 3MUZ1 4UTBA 5MENB 2G5BB 2AZUA 4UUJB 4DNLA 5JMOC 5B1BB 3O9WB 1MF2H 4HAFA 2FYYB 1F1GA 4NP4L 2ZF8A 3L54A 2N01B 1HAUA 2DICA 4OCYH 4JR9H 4MKTA 3TBYB 3EDKA 5IBTH 3JWOC 3VU1A 4UQ3B 3CFCH 1FZJB 1ZK5A 3TBSA 3OQRA 4I4WB 1UKSA 2QQKL 1QFWI 3NPSC 5KVGH 1XBRA 4TM9A 5GZOA 3QDHA 4X6CA 4UM9A 2I85A 1IUZA 2ITEA 4MA1B 1NPNA 2IANA 3BH4A 3WFDL 3LN5A 3P2DA 2VDRH 5K9OA 4XR8C 1E67A 2G0LA 3EYVA 2DTMH 4FE9A 2AJZA 3FO9B 3O4LA 1DQLH 4M9OA 3VFSB 2Z65C 3MRGA 1UYWL 3D0VB 3PL6C 4O00A 1XF1A 5DXWA 5B1JA 4KK5D 1AD0B 4XO8A 4ODBD 5EHFA 4G6JL 1J8KA 3LKRA 1GYAA 3CBKB 4S0TD 4HJTA 4UF7C 5FEBA 4AEHL 3D18B 1XCTA 4CVZA 2WWMC 4U1MA 4P46D 1KTBA 4KJWD 1LEIB 3BN9C 1SDAB 4NQED 4KHXL 3F00A 4OKDA 3HC0B 2NW2A 1N5AA 4KI1A 1D5XA 4XO4A 1EGJH 4IEFB 1MCJA 4Y4FC 5E5MB 4HF5H 5KN5A 3BZFA 3UBXI 5C2BH 5EU5B 2EYSB 5SX5H 5EIIB 4X8XA 1E5CA 3V5DA 4X5PA 1J10A 4OZGE 3E38A 3DIFB 4JKNA 2HA1A 1SQMA 3RNKB 4GB9A 3STZB 2ZP0T 4ODWA 4DEPC 4TSCL 5ITBH 1U8IB 3IBEA 3DNKA 5IIEB 4M7ZC 2HUEA 1HEHC 1KENH 2NY7H 4Y5VA 2Z93A 4OBRA 4Z7OF 4V2CB 1DN0B 1B2WH 1DSWA 5GJTL 3CVHB 2DIAA 3RDTA 2YPVA 4M61A 4UQ2B 5C08E 1RPUA 1HL4A 3ASNB 1JZ3A 3BP4A 4PGCA 4LVNC 4E5XA 2LT9A 1S7UA 3H9HA 3S37H 1P4IL 2CSPA 1DJHA 3NFSH 3BRFA 1MCBA 3CSTA 3J27A 4NQVA 5EU6A 3WIFB 5I8OH 3UIYA 4CRPA 4X2UA 1W91A 3ZE0B 2GPZA 5I75B 3RWGB 2FGWL 1KG0B 4N9OB 4KO9A 2W0LA 1Q4NX 2Q76A 3N44B 4XBMA 1FH5H 1KBBA 3MZTA 4JZJC 3SKOA 2G4GA 3UYOD 5KVEL 2CGZA 1GAFH 2Z8SA 1VACA 2X53A 1YRKA 3GDCA 1M1SA 1HXKA 3D3VD 4UILL 2V3DA 5ESVA 3MLXH 3MCKA 1Z9NA 5E51A 2QVFB 5KG9A 3L3OA 2GK0B 4JFZH 5IFHL 1YEDA 4H88L 1EO8L 2GBAA 2MQCA 5D1QE 5F7LB 5AYTA 1RH8A 2DWXA 4MX7B 2I24N 1BZOA 2GJZB 2HKFL 1U8MA 1N68A 3S36L 3BUDA 4DP0X 2WJ7A 4OCRH 4TQHA 3B9DA 4NPKA 5D4JA 1RK1B 5EBWA 4WWKD 3V8OA 1Q94B 3KGTA 1AZCA 1ZDSA 4DGUA 4Z3JA 2JJSA 3SOBL 2ZYIA 1J5CA 1SLXA 2XPYA 3ZZ1A 2ZNXA 3RB7A 3IDNB 3B2MA 3DXAD 3I3DA 4J12A 4N0FA 4OF6A 1QATA 1HCVA 1DQTA 5EUKA 1D5MB 3ET9F 1T03H 1MH5A 2KI6A 1P1VA 1XCWA 3FQWB 3VI3E 4XAKE 2EAEA 4UNTA 4YFLF 5C09E 3EOAA 4LVHB 3JVGA 1FVEA 3QO0B 5ESAB 4AMWA 1L3WA 1AO7D 4QRSA 3MXVH 4X6DA 1OM3L 3BVDB 2NY0C 3F7QA 1WFJA 4OB5H 4UDUA 2P5PA 2A9CA 4L0ZA 1SEBA 5I1GH 4WI5A 3NIDF 2CUMA 2ZCHH 3AS1A 4CNIA 4PJ8C 1ETA1 5EZIL 4K3HA 5BRPA 2N0MA 5FUZL 2EDHA 4EDXB 1EJ6A 5HGAB 3GSWB 5INCB 4YO0B 2KYIA 1ZV9A 2DQGL 5IBLC 4DOHE 2R29H 2QADC 3D51A 4DGYH 2R7EA 3L1EA 4OV5A 2F5BH 3BEVA 3WEXA 4NWUH 4PY8J 2OMYA 4J3OC 4PJXE 4YHZL 4JFDD 2C9XA 2IAMB 1WO2A 3R06B 1OT1A 3D5OF 3JVFC 1N2RA 4YDNA 5IR1B 3II1A 2NXZD 4LHUB 4P57B 3NSFA 3GXNA 4IRJB 5LBSH 4YR6A 5I74B 2XQBL 4UV7H 4GAFB 2H2SD 1F3DJ 3SD5A 4U1NA 3UO1H 1A3QA 1P7KB 3AVEA 3QHZH 4JDTH 1I85A 4LEXH 5FHBL 3W0WA 1JCKA 4FKEA 3SKNB 1UM5H 4PGEA 1IT9H 3BGMA 5JZ7D 1G7JA 4PGJA 2VL5B 2AXHA 3U1PA 1T4KB 1TQBC 3QJFA 3BKJL 3H42H 3WJMA 5CEZH 2D9QB 4ZMPA 1JYNA 4PLJD 4PTTA 3KYMA 4L3EE 1TZIB 3VD3A 5D71L 5GQBA 5F97E 2XT1B 2I69A 5J4MA 4X4ME 5F3FA 1WA2X 4PJEF 3WMQA 5HHOB 5JXAH 4IOIA 4NPYB 5T8IA 3T5WA 3TIEB 1SJEA 3ZE1E 2VR8A 4FN0A 4JFHD 4JKWA 4OLWH 2NZ9C 4W9FC 1WWWX 5F7BA 2J56A 3QRLA 4YHYB 3ZTCC 3KEDA 2RHEA 4YHMH 1HHGB 5HHQA 1UHVA 3KS0H 1LO2L 1RMFL 3GT6A 3N0PB 1A22B 1KCBA 4YPGA 3EZ8A 5FA3A 3VSTA 4A2MA 3Q43A 3S0PA 4WW2F 3OZ9H 2C9AA 4WU7B 5CJOL 3ZSSA 4PV9B 1N64L 4YHLH 5DYOA 3TX4A 2W1NA 1PKQA 2V5YA 3GEWB 4KMTH 4LLQA 4LSQL 2BS9A 2LW3A 4RWHA 3U0TA 3IGAB 4PP2B 5L7XH 2LLLA 3WV0A 2FNWA 3QFJB 2QTEA 1F3JA 1Q9OA 3N1MC 4WO4C 4LQ1A 5E2TL 4FG4A 3IDJB 4LO9A 1S5HA 2EEFA 2CDFA 2IMMA 1T3FA 5DLML 1UGKA 3BH8B 4WWPA 4GRMA 1M7XA 2DAVA 4PJ9D 3REWB 5BVPL 2BHUA 3FU7B 1BQLL 4K94H 1P4UA 2EICA 2L04A 5EC2A 3DJSA 2VDQH 2WKOA 3OKDB 2A73B 3O41B 1OB1B 3MV8E 2BVUA 2EIZB 1X7QB 1E3FA 2FD6L 5KEZA 3SDXB 1ORQB 4I3RH 5DQ9B 1MFVA 2C9VA 3ZDZF 5IJVA 1YAZA 3L8QA 5AVRB 1RERA 4XXWA 4X0NA 5JHAA 4UT9H 3V0DA 5I1HL 3QIUD 1F6LL 1L9QA 2J44A 3NZHL 3O45A 4Q6KA 3OXRA 4PRDA 5E99H 5KSAD 3B2UD 5BOJA 2VM4A 1QUNA 1W0VA 4QXGH 2VABB 4E9XA 4X7CC 4ECNA 1BAFL 1MCIA 1PG7X 3TBTA 5ACZA 3MV7D 2J4WL 1JGDB 5AW2B 5GXBB 1OVZA 1DVYA 5DGRA 1OSZA 3ZE2F 1PYWB 5D1XE 4KY1H 4BDVB 3FQTB 3OGCA 1CF1A 3IRPX 1I7ZA 4MMYA 3UMTA 3V7MA 4ZW3A 5EF1A 1WHPA 4Y7OC 1JGLH 2YZ8A 1T22A 5DHEA 3CFMA 5ALBH 4JFTA 5I76A 3T71A 1IGIL 5SWSB 3ZYOA 3LRHA 3VXRB 1SLVA 2YEZA 4NIYE 1TTFA 4NSKB 5DQDL 1LE5A 4Z3IA 2AV7A 2X3BA 4WTZA 2B4CL 1K5WA 4I89A 1G7QB 3CD4A 1SDDA 1MJ8H 3Q9QA 5I18L 1MOEA 3BP6A 3WFEL 2EO9A 4FKKA 3O0LA 3H85A 3G5YA 3CXHK 1E3XA 2Z9TA 4CW1B 3RVWC 3KXFD 4DCQA 4FCHA 2CU9A 3AQYA 2NX5A 5JPNB 4MXVF 1LEGA 4OBSA 1U0QA 4LSSH 3CVHL 2AERT 4U7SA 2V33A 2XJKA 1DCLA 1HS6A 3EAKA 4P49A 2FO4B 2FZ3A 5KYWA 3GK8L 3GTVA 4MAYA 1FYTB 3ESUF 1O6TA 5FV2A 3ZGIA 2AXGB 1UA6H 2BPBA 1JNNL 1QBML 4Y1AE 5BV7B 3WJJC 3DURA 2YD1A 4JDVB 3GMLA 1YQ2A 1R24A 3PL6A 4K3JL 5E8PB 5EU4A 3V0HA 4M7JL 4FTVD 3VXQB 1NZRA 3DX4A 1IGFL 2JXMB 1HNGA 4Y2OA 5I5RA 1IE4A 4Y2DC 5C7XL 1S7RB 4I87A 4RWYH 1GC1H 2X4SA 5E0FA 5JOFA 4YMPA 4JRLA 4B3EA 4TNEA 4ZUVA 3K1DA 1WZLA 4B27A 2IGTA 5DRZB 1DVFD 2IWKA 3MRIA 2X3CA 3L2NA 1KPUA 2Z4QB 4C4UA 5I1DA 2AQRA 3F7YB 3ZTEA 1QKZL 3SCMB 4BSJA 1IM9D 4M5ZL 2A4ZA 3O3UN 4GSQA 4E5XG 5D2LA 2CDEA 1WBYA 4XE0A 5CN3A 2P8MB 3LS4L 4XP9L 5GGVY 1A4JB 1RHHB 3RGVB 3BAWA 1C7TA 1DO6A 4IKJA 4UAHA 5DJ2A 1I75A 2DQCH 1OY3B 2R39A 1NLDH 5MENA 1P4LB 2G5BA 2QJDA 4M43H 4UUJA 7CGTA 4PWIA 1CVSC 4NI6A 3O9WA 4OJYA 4TTDC 2FYYA 5TDNB 1R33A 3P9WB 3LHPH 1I8UA 5DLLA 4RIRB 1XGUB 5SWQB 4PJBF 1U8CB 3TBYA 1LE9B 2WZAA 3CHRA 4UQ3A 4LOVA 3RJOA 5FO8B 1FZJA 2NY1D 4I4WA 4J3TA 5EA0H 5EEXA 4IBLT 4WDIA 4KH2A 1BD2B 3GJFH 1GL4B 1U6AL 2VXSH 2XA8L 2IGFL 4PI2A 4HS3B 3FYEB 5FR3A 1F18A 2DQJH 4OGAC 3BKML 3ZKND 4HKJB 4TVPH 1W72L 3ROOB 2B5IB 1OGTB 1RUPL 4EIUA 3E1F1 3A4DA 3FO9A 4TPRL 3VFSA 2BC4B 2UZIL 3D0VA 3IF1B 1VCAA 4YFDB 2IH3B 4JZJA 1BZEA 4OU3A 1AD0A 1J8SA 5JHLL 4U4BA 3I50H 1ZLUH 1URZA 2P48B 3QIWD 1QASA 2HAZA 4F80A 1QLFB 5AZ2H 3VXMB 1GYVA 5C0DB 2PWDA 4BWUA 3D18A 4HA1A 1YDPB 1QNIA 2KT6A 2QSVA 1JZHA 4P2CG 4OIBA 1LEIA 4A66A 4HU8A 3NP4A 2EADA 1LP9B 1B3IA 1RZJC 3HC0A 3WXWL 4LLUA 2EE9A 2IWGA 5FYJE 4MS8C 4KPHL 2PWFA 3SQRA 3CZLA 2XWEA 1O0VA 5E5MA 3KBPA 4ZUTB 3V9FA 3UBFA 4XOEA 5EU5A 2EYSA 2UUDH 5EIIA 2OTWB 2Q87A 4OD3L 1KIQB 3DIFA 1A6WH 1Z3GH 2WXQA 3HS0C 3RNKA 3STZA 4KKNA 2QV2A 3LN4B 2OMUB 1U8IA 2VNCA 5BRQA 4GIOA 5IIEA 2JCCB 4JO8A 4ES9A 5HJBA 3L81A 2C7UB 3UGEA 5HYJA 3MUUA 1KBPA 3Q48A 4LCWB 2Y07H 4UQ2A 2VWEE 1NMBL 2QQLH 1T1YB 1BX2B 1XIWC 3B5TA 3O4LD 3L4CA 3X17A 4HIPA 2MSPA 2ATPB 3WIFA 1LEKB 4FQHB 1L7IH 3V0VB 1ET8A 2VMEA 1B4JH 1NCBL 3E8UH 3RWGA 1KG0A 4NM4H 1RHFA 1NTDA 3AB0B 1OEZW 4R4BB 3IRZA 1F58H 3B2PA 1V3LA 5I19L 1CI5A 5KBPA 1HKFA 4XP6L 3EO0B 4ZTOL 3BLBA 3LD8B 1XXFC 3C2AL 1L7TL 3B9VA 1UENA 3WDHA 3IFOB 3BAJA 2HRHA 5DYFA 5DEZA 1UWYA 1JTPA 1HL9A 1SLWA 3HCVB 3QC6X 5CUSH 1RPKA 2CJTA 4PLKD 4MX7A 4Y8DC 1V7NH 2V17H 2R69H 3E6HB 2YXMA 4MJ2A 1J0HA 3AY2A 3QQDB 1RK1A 3VA2C 2MPAL 1Q94A 3GZPA 3ZVVA 5ILTH 4FFWD 3VXTB 5DS8B 1QFWM 2VN4A 4TXVB 3F3HA 4QRTB 5I1KH 4DZ8B 1QWHA 3IDNA 1A47A 4JZOB 5D72L 5DK0B 4ZBJA 3ZQXA 3U2SB 3RDTD 1D5MA 3AQDA 3FQWA 2QZ5A 3UPAA 2WNGA 3T8XB 3QHFL 4X5XB 1USQA 4J6RL 1I31A 4L9DA 2HFEB 3QO0A 3WY3A 3HKFA 3CHXA 5TQ0L 5ISZE 3W38A 3QUYB 4L4VD 1SXBA 4ISVB 3PFUA 5CU9A 5EU6D 2LU7A 2LTQB 1MFMA 2EEDA 4P9MH 1A7NH 1CFQB 2FBRA 4HEPA 1FVCB 5HGHB 1U4FA 1SVCP 1WGVA 4AXWB 1EUUA 4TLTA 4UQEA 3FO0H 4YSRA 4YE4H 4EDXA 2ZP9A 1ZSHA 3GSWA 4XB3A 2MMXA 2HLAB 5INCA 3CQFA 4YO0A 3WXVL 1QVOB 4JCLA 3P3SA 3Q8CA 2BVYA 2J1YA 4Z7WE 5G5DA 1T89A 2OP4L 2JVUA 4NHCL 1UWEL 2BNQE 2GVYA 5DZLA 1G9ML 2YSSB 2IAMA 4GRWF 3S3BB 3HJEA 3R06A 2A77H 2X1WL 2QT6A 5CGTA 5IR1A 4N8UA 4LHUA 4P57A 2ZYSA 3MVSA 1JHTB 3MHZA 3MJ9H 1RUAL 4IRJA 5LXGH 4JPWH 5SX4I 3AY4A 1E5ZA 1DYZA 1ACYL 4ZYKB 3QWQB 5FDYA 2I32A 4L18A 1KSRA 2DLIA 1P7KA 2EXYC 4JGUA 2BK8A 4N2FA 1RU9H 3SKNA 3UP6A 1J88A 5BV7L 4JPIB 3L3KB 2NR6C 4N25A 2XPGB 1T4KA 4I3GA 4AQ1B 1MFCL 4M6OH 3U4BL 1LO3L 4A37A 4FFYL 3RZWA 4ELMB 5F9WB 5JW4N 3N40F 4WTZG 1RZKL 5D7IE 1TZIA 4XNBA 1T83C 4JPVH 3AXLB 2M8XA 2AF2A 5JQHC 3K3QA 4RGND 3P54A 5L9DH 3CLFH 5HHOA 4FOMA 3WEAA 5T3XE 5T3ZL 4NPYA 3UYPB 3V52L 3L1GA 3TIEA 5A40E 2H26B 4DPCX 2AEPH 4ODXA 5F7WC 3FN9A 4MA7L 2AI0L 2WWOA 4N2AA 3RWJB 1KIUB 1HHGA 4Q9QH 3WO4B 4XMWA 1NFKA 2CD0A 2ENJA 3KJ6L 4UMGA 1RZFL 4XTRC 4N2NA 4RBPK 3B7RL 2IH8A 2I5YH 4WU7A 4PV9A 2RD0A 4ZOAA 2AQPA 2IO5A 2CM5A 2DZEA 4BK5C 5CN2A 4JKKA 2DWSA 2VDPH 1I9RL 3IGAA 4PP2A 5HGGS 2K8MA 2YEQA 2BW5A 1E6JH 3QFJA 4OQTL 3OLEA 3K2UH 3CFUA 4BQBA 3KPMB 1HYSC 3IDJA 1HEJC 4K8RL 3LOWA 3SB3A 1ZTMA 3GIVB 3BH8A 4ZAKB 2WUCH 3REWA 5K9QG 3CN3A 3PG2A 1KCVL 3D30A 3FU7A 4XN1A 4N2BA 3OKDA 3EJJX 4LP5A 2A73A 3O41A 5DTFB 1OB1A 2EIZA 1X7QA 4YDJB 4C55A 3SDXA 1ORQA 2E4FA 5DQ9A 2B16A 2VLJE 1QFPA 4JY5H 3WJJA 4PYHA 4WY7H 2XYBA 2DOCA 1CDGA 4MJIB 1EZLA 1MCEA 3TM6A 3PGDB 4M48H 2VABA 2A38A 2BFVL 3WDJA 3D33A 2FL5B 4XAWL 1JGDA 2J6EH 5AVUB 2ODIA 4EQ2A 4KZCA 1PYWA 1XD0A 3TT1H 4U1IB 1R19A 1FGVH 4BDVA 1HZKA 3V4UH 3PP4H 4Y2NA 2VSDA 2WIIA 1A6VL 3FQTA 3KYKL 3AAZB 1OP3H 4YHNB 4HLEA 3SBPA 1YQVL 1UOLA 3BQUC 4QEGA 3A21A 1NIAA 5IBUB 2UZXB 1DSYA 2J55A 5ENWB 3JSSA 4PJAE 3Q01A 5SWSA 1XGQB 5E56A 5CILL 4H7VA 3VXRA 2EYRB 3TYGH 2FX9L 4NSKA 4A04A 1F00I 3SPVB 5CD5C 4JDEB 1G7QA 5EEYA 4RMRA 3K2KA 3SPHA 3BKYL 3IJSB 2YD5A 2MQ0A 4CW1A 1CE1L 1ZTXH 1O7VA 3CK0H 4AQOA 4I3SH 3HRZC 3MJ8B 3OX8B 4XNQB 5JPNA 1IIKA 4BUQA 3N42F 3TJHC 3N5AA 2R83A 5HVHB 5JHMA 2PCXA 4FMKA 2GC4C 3IMRA 1VF5C 2FO4A 3CC5B 3HLKA 1E50A 2R23B 4I1NB 3SGJC 4Q9RH 43CAB 4WUUB 1FYTA 4PS7A 2AXGA 5KTEH 5D7JC 1E2VA 5FYLD 1CL7L 1UZ6E 1X9RA 3PGCB 4JDVA 3DETC 4N8CL 3SQBB 3VGAB 4FFYA 1NGPH 5E8PA 2GI7A 4IK7A 5EIIG