2CGZA

Structure of helix pomatia agglutinin with tn antigen
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords AGGLUTININ
publication title Structural Basis for Recognition of Breast and Colon Cancer Epitopes Tn Antigen and Forssman Disaccharide by Helix Pomatia Lectin.
pubmed doi rcsb
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cgzA00
3WMPA 2WN2A 2CGYA 2CGZA 2VM9A 2WN3A 2VMCA 2VMDA 2W94A 2CCVA 2VMEA 4Q56A 3WMQA 2W95A 2CE6A
chains in the Genus database with same CATH superfamily
5ANHA 1DVUA 1P4LA 4AKPA 5IEHA 3CZSA 3OAZH 1KELL 4OVUA 2WOBA 5DS8A 3VD9A 2LHAA 3IYLW 1MI5D 1VGEL 5E6IB 4YWGH 5D8JL 3GF8A 3INOA 2ZPKH 5DEGB 1K6QH 3IJ7A 4M7KL 2XJLA 4HKXB 4R90H 2OL3A 1MFCH 2FEJA 3V4UL 3ML9A 3G3LA 5HYSB 1ZGLB 1U36A 2E0PA 4KI1A 1YYMH 3BRGC 3SDCD 1II4E 1CLOH 4F9PA 1I4FB 3RFZB 3KH3A 1O9VA 4Z95H 4F1ZA 2IOIA 3PE9A 3HA0A 3CSTA 4GKOA 4YHZH 3BUQA 2W95A 4HUWA 4HK0A 3UMTA 5IESH 3PAYA 3WNPA 4NZUL 1TMQA 3L3IB 2KZKA 4ICWA 3K1DA 1A6ZA 1SJMA 1UWXH 2I25N 4QHNA 4LNRB 1JWMB 1XH3B 2CA3A 1V05A 4L5FL 5HHXL 1L0YA 1MCIA 4LF3B 1RU9L 3T0VA 3GSVB 2XTJD 3CIAA 1OIOA 1UWFA 5EEVA 3C60B 3W82A 1Y0LB 3FQNB 3ZGHA 5IFJA 3R0MA 4AJ0A 2ICWJ 2QQLL 4OM1L 5AZ2L 5KVGL 3HNSL 3VI4A 3D6GA 3G5WA 1MCBA 4GUPB 3INUL 2YRPA 3M17B 2OSLB 3HMXH 5EU5B 1S8DB 3L1GA 4NQTA 4FLQA 1Q94B 2YK1H 4OD1L 4R97C 4JFOB 4MAZA 4BYHA 3ARFB 3VFSA 3MTRA 5IW6B 2DYPA 1NA8A 4NKMA 4U0QB 5C7ZA 4HF5L 3HN3A 4BFFA 4S1RL 1JJUA 2XWBA 3Q1EA 2GC4C 1CU4H 4H0LC 5HGDB 3SPGA 1SBSL 1M2OA 2OMUA 1N9PA 4I48B 4FFVC 5ALCL 1YEDA 5E99H 1TQWA 3KPQA 1MQKH 1EJOH 2MFNA 2M8XA 2IPTH 3W39B 2QQKH 3GI9H 4PJHA 2P46B 4PCSA 4A2FA 3UH8A 1WWBX 3L81A 1NM9A 4GI9A 2R0LL 4H0HB 1YNLL 4IDJH 4RFNC 3W2DH 3G7TA 5FO8A 1D7FA 4PJ8D 1W72A 1KY6A 1G9NH 2H3XC 3KYMB 3CPLB 4IBVA 1OTSC 1ZLEA 1G6RB 4OFPA 1KB9K 4X8CA 2VJ0A 25C8H 5C0JA 1OPGL 4E9YA 2NR6A 3NQKA 3FBQA 4OM0H 4BSVA 2FR4A 4U2ZA 5TQ0L 2LU4A 2EE2A 4IEFB 4GKZB 4NJ9L 1IBFA 1NTDA 1R5WA 1P7QA 1S7XA 1HHIB 1SN5A 1T7WA 5H37A 2HJLA 4XMXA 5KOVC 5C0ND 5K59E 3T6WA 4XP9L 2YBRB 3EO9H 4X5QA 5J1AA 4WFHE 3V4PH 3NIGF 5EEZA 1J1OL 1OAJA 4KKZA 2DLHA 5T5FL 1JFQH 1KCLA 3GUTA 4N8VB 3NCCB 1AE6H 3HLAA 3KWWB 4P3WA 3WHE1 1FG9C 3T3MF 3CDZA 3L3OA 5BRZA 5TF0A 3ZYOA 4KTDL 3Q44A 1UVQB 2H2SC 2HKAA 4ELKA 1A65A 5E8NA 2D8KA 2F68X 4WI0B 4X6DE 5IKCA 5FDWB 3HS0C 1H8SA 1XQ4A 3Q05A 3BVVA 5D1ZB 2OXHA 1G1OA 1MW0A 1SDDA 1C16A 1ZDQA 5I66A 3T5WA 1Y7VA 3GS4A 5IR1B 3IJEA 2VLJE 3FXIC 5DWUL 2WXMA 1FNGB 4H1LB 4YX2H 4A39A 5KYUA 3T8XA 1PZDA 3L3KA 5I6NA 1XB8A 1KPVB 4XR8C 4OF7A 3UBXA 4FXGB 1QFUH 1F1GA 2AXJA 4KK8C 5AOIA 2ZX9A 3DVNA 4XCFH 4X5XB 5EC1B 5HI3D 1IGIL 2ICEB 2IFFL 2XWXA 1RSYA 3KS0J 1PKQE 4L3EB 3S3SA 5HYEA 1EUUA 2EE0A 3MREB 5HHOB 4XNUH 3QI9B 1TTBA 1XSIA 4BFBD 3V79C 4PGJA 4U31A 1D3CA 1FO0H 4GKNA 4S1QH 2Q0ZX 4QRPE 4UINH 4X6EA 3FB7B 4YDKH 1KN4H 3WTWA 3QEQA 4TULH 4F2MB 4XWOD 2N7BA 3KYKH 2FECL 3GKZA 2AF2A 1HXYA 2B39A 1AQ8A 1A8ZA 1XIWA 2EE9A 3TJEL 4F15C 1YQVH 4CMHB 3QNXA 3ZKQD 4FQHB 5KS9E 3HE6A 5TE7H 2CD0A 3QCUL 3TVMC 5J1TC 2A9NL 1ZHKB 5D1XB 2VLRA 5HGBB 3SBPA 1I3GL 3CUPA 1SNRA 5FK9A 2FB4L 5FWQA 1LVEA 1MFBH 3IDGA 2Y6TE 1OGAE 5F71A 4JFFD 1FZMB 4WEEA 4LP4A 1HEZB 5D6DC 4N2BA 3WNJA 2YA1A 4F2EA 4KKCD 3EBAA 3F05A 1N6QH 2W07A 2PETA 3HI1B 3W38A 3QXUA 4ZUSB 2XZQL 5CEZH 3V95A 4HG4J 1K4CB 2X4OB 3E38A 4P07A 4XNYH 3TBYA 1J9CT 3IDXH 1M42A 3O2DA 4QXGH 4J3UA 3WFEL 4BIKA 3KLKA 2Z64C 4AVKA 2J12B 5IEKA 3GEWB 1KTDB 2VXSH 1HCVA 4P2YA 4XH2B 2FNBA 1U8IA 2L04A 1SEBB 1FBIH 3U0PB 2CBPA 3RFZC 1CTNA 3WS3B 3TA3A 2O61B 5KVDL 1JPGB 2A1WH 3VD5A 3LEVL 4YZFE 5HGHB 3PWLB 3JV4A 1A1NA 2C4FU 5KVEL 4FC3E 4HFWB 1QRNB 2QMJA 4HJSA 1CFSB 2OR9H 4X9IA 1KIRB 4Y0GA 4PJGB 3MJGX 1XR8A 3SDXF 3D08A 2FJGA 2MCPL 5FOJA 1MUJB 1WT5A 5EUKA 4PBWD 3B1UA 2FJSA 1JCKA 2CDFB 1WFNA 2J8OA 5FB8A 4OZGF 4OD3H 5KVFL 4TQIA 4Y4FA 4ZT1A 4KK9D 2ADGB 1C12B 2J1ZA 1BM3L 2LLLA 5BZXA 2DM3A 4AV4A 1XMEB 1T3FB 3QDMA 3O9WD 1S9XA 1A6VL 3ZSSA 1MZYA 1WBXA 1KCRH 2EXSA 2W38A 4AX3A 1DJXA 3JBG7 1C08B 2DQCH 4ZTOH 3QZWG 5EIIG 2EZ0D 2NSMA 1SUJA 5FYLL 1QQDB 1UFUA 2DWEB 3EFOB 3ARVA 1EAOA 5AAWC 2Q1EA 1HINL 5ILTL 3HC0B 3OHXC 4DKTA 2IIJA 4ZSOA 5TPWH 3ZTJG 1GZQA 1HVXA 2HFFA 4EN3A 1GHFL 2H1PH 2MCMA 2J6EH 3LRLA 5ENWB 1FGNL 3OAYK 4KTEL 1KTBA 4YMPA 3ARBB 1OAQL 1E8YA 1MI5B 1A4AA 1ZD6A 3BCDA 4GQQA 4X4YA 1HSBB 1HESA 3P0VH 4ONOA 1AKJA 4GSDL 1QNZH 4MJ5A 3PY9A 1T5WA 3DRTA 1QSVA 1VCAA 1YEHH 2Y5QA 4TVPL 4K7PX 4Q9RH 5TK2A 3TT1L 5DQJA 2MQ0A 4L48A 5E8EA 1DJZA 2UWEB 1BLIA 3A4FA 2DWTA 3A6BL 4KJYA 1TU2A 2I5YH 2O5ZH 4XE0A 4I2XB 4LSPH 3WXVL 4V2BA 1DDHB 3LZQA 2VOTA 1KLUA 3P1VA 5AVTB 1FLTX 4G43B 1D7DA 2B59B 2RFXB 2XKSA 1KTRL 2DBLL 3KPRB 2YSTA 2BY3A 3FCUB 4YDLB 2GCYA 3W0WB 3RUGE 1P4UA 1SHMA 3LHAA 4P2OC 5F0LB 4DN4L 1BM7A 1NGQH 1IKFH 1T0MB 3SO5A 4JBSA 4HPYH 4N0CC 4EE2A 5J8OA 3G6AA 4I88A 1F4XH 2D2CC 2F1AA 2QSCL 4WTQA 5JOPE 1UB5A 4N8CH 2A9DA 3QXDB 4KOBA 1T20A 4F7TA 3WUWB 5TE4H 4WRLA 3RX9A 3X13B 4PVBA 2FZ3A 4NNYB 3SDDC 2DLGA 4PI0A 4HBCH 4NYLA 2WP3O 3S4SG 1CGSL 1WFMA 5JORA 5E03A 3WEXA 2W9DH 1OHQA 4JFPA 4XAWH 5FX3A 4MA7L 3LSOB 1P7KA 4L23A 5E2UL 5IM7B 2ZSVB 4FDWA 1I1YB 5G4MA 2R56L 2NY0D 1E7VA 2EDKA 5GSRB 2BIIA 5JPNA 1JERA 2WYIA 6TAAA 1EGJH 4FXGC 2G2NA 4IJTA 4MMXB 4PRDA 4TSAL 3WKPA 4GSXA 4ZJ9A 2LFGA 1C5BH 5D93B 2UZYA 1G0XA 1DVFB 2ICEC 1QD0A 1W8EA 3B9KD 1E5ZA 5HHMD 1Q0XL 3WMQA 4UTAL 4OCLC 4NKDA 5IQNA 4U3HA 5GGSB 4X4XB 2CGZA 3D9AH 2IEPA 4LMQE 1MIML 3ZDZE 5GXBB 3OMNB 4QRRB 5BRQA 2HT4D 4PJ8B 5I8EA 1F4YH 5I1AB 2CJSA 4W68A 5F9WC 3RGVA 5B38G 5H4ZA 1XZWA 5HJDA 3W37A 3IGLA 3O8XD 4WCYL 5I1HL 4PU2A 3O3DB 4DK6A 4B9FA 1MCWM 1J9TA 1JGEA 1S9VB 3GZPA 4NNPH 2WK2A 1UJ3B 4MJHA 1MJ8H 3V5HA 5DHYB 1QBMH 2XIIA 4BZ2A 2NQCA 3OX8B 3HE7A 4AC2A 3VQ2C 4JN1H 4JVWA 1RJYB 4WEBH 4Z7WA 1U33A 5D1XC 4WSJA 3HI5L 4D8PB 5DUMH 5C0AA 1N12A 4G9FA 2C7UA 3ORJA 4FQ1H 4JQIH 4EBQH 3P3RA 4N5EC 3SKJH 4PRPB 1BEYL 5F0MB 3SGKA 4MQ7B 1PD1A 2FJFB 2NX5B 4EZJA 4OLZL 3VWJD 1IEBA 1KF9B 2DM4A 3FN0L 3BEVB 4HAGA 4CW1A 3BKCL 1H19A 4MA8L 4EI5D 4OY9A 3CFBA 3NQIA 3PUUA 5DXWA 4AC4A 3APCA 1DQDL 3BISA 3EDJA 1E4HA 5IVNA 1H3GA 4XPTL 2IQAB 2CCVA 4QYOB 4L29B 1SMAA 5DRNB 3WXWL 1K2DB 1RZFH 4YE0A 1G7MA 3WIHH 4U7KA 2EDOA 1X7SA 5IFAL 3TF4A 2ZZUT 3CCHA 3NOIA 2FQFA 3M1BB 5CGTA 4KI5D 4PWGA 4X6DA 4OZIE 3FO1A 4BFEA 4FULA 3D3VE 2BM3A 2X0UA 4M5YH 4ONGH 1MCCA 2QDWA 1G7QA 1J86A 2WLLB 3FSZA 3ZL2A 2RACA 2A5UA 3RU8L 1D6EB 2A73B 3VRLE 5C3LD 4HUVB 1I7UB 5CBAB 1ACYL 4HKJA 2HG5A 3MBXH 5LJYH 1CLCA 3QR1A 4GW5B 5DJCB 2K3HA 5E1IA 1FN4A 1NEZB 5SWZD 4I77L 2Y7OA 1CPUA 1RFDL 1Z9MA 3LH2H 2XG5A 3O4LA 3LY6A 1FSKB 4LHUD 3GSUB 2PMZA 1ZA6A 2NDFA 3GDBA 4PHZA 1ZJAA 3Q6FB 3TONA 3GWJA 5CEZD 4EQ2A 1XTMA 5IIEB 4M3HA 5KBPA 1WS7A 1GVIA 5BV7H 5FYKH 3HJ0A 1FE8H 3VGHA 2FATH 1X5KA 2E4TA 3L2MA 1NMBH 1CTMA 3GXTA 1E9PB 2A9BA 1ASOA 2ICES 5KOMC 2NZ9D 2Z93B 1KYUA 4IGBB 2OL3L 3UAFA 4D0BA 2Y7QA 3VE0A 1CDYA 3KLAB 1QYGL 1DN2A 3WHXA 3D51A 1G7IA 1BIIB 3GSRA 1RK7A 3CC5B 1HN1A 1OZTG 1G4MA 3U4EA 4NHUA 5C71A 4NERA 4PJDE 1AP2B 4O02A 5A16A 1UKSA 1GYAA 3QWOB 1J11A 3I2CL 4LCUA 1AS7A 1UA6H 5KS9A 5IB3B 1MW1A 2XJKA 4YXHH 1KT2A 2VL5A 2BK8A 1YMMA 4JZOB 5GIRA 1CE6B 1DANT 5IT2H 4JY6B 1A0QL 2O72A 3GPEA 3MJWA 5FHBL 1PLGH 4LASL 4CUCA 5I0XA 2D2OA 4NQEA 2VUKA 5J56B 3ELQA 1HI6A 2EDDA 3UG3A 1E27B 4LQ1A 3SDCC 1DJSA 4JFEB 4NAQA 2OMWA 2A3TA 5EV7A 5KZCB 4Q14A 2IWKA 2ZOTA 1SOXA 4D9RE 1DQLH 1PQZA 2EIZA 2CJ3A 1TCMA 3QYNA 2ICWI 2OTPA 3OJ2C 2W60B 5B21A 1V54B 4XPBH 3UTZA 2VDKL 1N18A 2X2JA 4I9WD 4M6NH 2AV1A 2H45A 4YDVA 3PGDA 1I1CA 1P5UA 2BNRB 4K15A 1IGYA 1TIUA 1XF3B 1JNJA 4CC4A 3KPMA 4P2RA 4UI2A 1DJGA 4YDNA 4ILDA 2XTJC 1VKXA 2NY3B 5DQ9A 1CR9H 3MVSA 1I8MA 5D7JB 3WN5C 3NEOA 5IVXB 4JFDD 3TESA 1J9RA 4N2DA 1JRHI 1X7QB 1CBJA 2C8NA 2JK5A 2WOYA 1IBGL 1VGEH 2FK9A 2N56A 2X53A 5DD0L 5D8JH 2VL4A 4JCMA 2XXGA 3O9WB 1SF3A 4M7KH 1A7NH 1KTLA 1SVBA 1GGCL 3D52A 3V4UH 5AB0A 1X5ZA 2X6BA 2UY7B 1XR9A 2AC0A 4QF1B 3V6ZB 2YMTA 3DUSA 5E94B 4JLRA 5MP6L 2VZVA 3N40P 3IETB 4DPCX 4YHMH 1W72L 1KXTB 1OE2A 3BAWA 5EO9B 1CURA 5ANMB 3VFMB 5EEUA 5HDWA 5LXVA 1S9WA 2EUWA 1YN7B 2P5WA 4N90D 5ID0A 4NZUH 4OF6A 4PJFB 2CGYA 3SO3B 4QHKJ 3PGFL 4PCTA 2WNKA 5E0QA 4L5FH 2MNUA 5HHXH 5JNYB 3AFLA 3FU3A 3VNYA 4KO9A 1LLAA 3QHFL 4PJ8C 3CN2A 2Y36L 2I07A 4F1SA 4PJ7F 1LO5A 4I13B 1U30A 5ERWA 4RDBA 4XNXH 3U6XA 2TRHA 4M5ZL 4M56A 4R4ND 5C0BB 2AJSH 5TFSL 4DSYA 2W88A 1MWAA 1B0GA 3OAYH 4DO4A 5IMKB 4AEIL 1I1FB 4OM1H 2QQLH 2BP0A 5AZ2H 3RPIB 3ARUA 2BOCA 2VE6B 3INUH 3GS0A 2PCPA 4PD4J 5MEQB 4OAWB 5IF0B 2BINA 3KPPB 4OD1H 5C0NC 1A21A 2PWHA 3FU8A 3QJOA 1JZ2A 3DECA 4F2FA 1EAPB 4HF5H 3N41B 4UQ3A 1JZ6A 3TCTA 4E68A 4S1RH 3RTQB 4FI7A 3KPSA 5IVOA 1SBSH 3ROLA 2XVLA 1AHWA 4HULB 4KQ3L 1A9BB 3J07A 1OAZH 3MCLL 5EIVA 3VXRB 1TUPA 4PW4A 5B3NA 3SHSA 5HVFB 1AY1L 3TV3H 3BT2L 2P43B 4MB4A 4WI4A 4ZO8A 5FGBC 3MRCB 5BQDA 5FCSH 4JDTL 3LN9A 4JCLA 4BH7B 4NZ8A 3P4MA 1JV5B 1KPUA 2R0LH 2ZXWB 3UTTB 1YNLH 2IDUA 3E6HB 3JV5A 2C9RA 5C08B 2MJWA 2CG9X 3WCYA 1M6OA 1KJMB 2BVQB 3C5ZD 3FONA 5TDPA 1D5XA 4W9ZA 5ESVA 3WIIL 5E1AB 1D5ZA 2V8LA 3P9LB 4HMCA 5DHDA 1U8JA 3B83A 4FKHA 5TF1H 3AXIA 2YD4A 2JI3A 2DL2A 2X0VA 4XVUD 3ECWA 3CK0H 3QQ3B 5TQ0H 3DHJA 5HI3C 5HYSG 4UQ2A 2YQ2A 3CX2A 3K6OA 2KLSA 4NBXB 1VFMA 5EZOL 1GH7A 2D9QB 5FV2A 3TBTB 1VADB 1J1OH 3BKMH 4RMTA 3HUJE 3CFEB 3B2MA 4GY4A 3DJRA 5T3XE 1J5CA 5GZND 4K23L 3BZ4B 3S5LA 2VR4A 4KTDH 4XWOC 5DI8B 5LVEA 4YHNA 1TNNA 3MRBB 3F8UB 2EYTA 1AQMA 1INDL 5IHWA 4ADJA 3IFPA 3KYOB 3QULA 3VJ6B 4GBXA 4JPIB 4PGDB 2VN6A 1ZTMA 3MNVA 3UTSE 3P9MB 3X11B 1L4IA 2CIIB 5DWUH 3PDDA 1WIOA 1EHXA 3BE1L 3SIKA 3O2DL 3TU6A 1ZHLB 1OOWA 3NCYS 4OJDH 3ZRFC 1NBZB 3PFUA 4NQSB 4MTMA 5GJTH 1EEYB 1MHCA 4UBDD 4KKCC 1AZVA 2NW3B 4N8PA 5E9NA 4WNQB 3BDXA 2NTFB 3CV5A 5FM4A 1BA9A 4GLRI 4P8QA 3UYPA 2WKOF 4FKKA 1PF3A 3VXSA 2VISA 3U6RB 1IGIH 2IFFH 2J8UE 3GMNA 4W70A 4PV8A 4LLVA 3MXVH 4O2CB 3SJVE 5JZ7D 1DBKH 4GRLB 1PYWB 1J8RA 3IXAA 5AVQB 1FO0B 4LGPB 1YAZA 4NC0B 2IV8A 2OR7A 1MJJB 3FSWA 3MUJA 3VH8A 4QRFA 2IDCA 3L95B 2GJ6D 3QUYD 4ZUTB 3BDBA 2ESVD 1NCJA 4ENZA 2YGVA 3DYMA 1FZJB 2EACA 5FYKD 1CL7I 1F13A 4ISVA 3NZUA 4PWIA 4M7ZB 5HHPB 3TJEH 3CFDB 4JJ5A 4MNQE 4X98B 3PFQA 2YKKA 2UX6A 1U3HD 4K2UL 3F7VB 1O7VA 4C83A 2AI0L 5C9JA 2B4CC 5IFHL 3QCUH 1ZHNA 2A9NH 4Z9KB 1B4RA 3GJEA 4AYFB 2R1WB 1TITA 2FB4H 2G3NA 2PYFB 4HCIA 1DTUA 5SWZB 15C8L 3GSXA 5EZJB 4M29A 1GC1H 4LHUB 1LEGB 3SKOA 3C8KB 5L8LB 4B0MB 4M7LL 4KK9C 2XZQH 4PB9H 3BZEA 4LVHB 2AXGB 1IBDA 3CN0A 4JANA 2AJUL 3TNMA 3Q9QA 3FB5B 3O9WC 5F1OB 3VXUE 1SJEB 4N8VG 2JIXD 3GMPB 2ARJB 4OUUB 5CMAA 3VSVA 3WFEH 3C09B 2IXQB 1I3RA 2HWZL 2APBA 2CO1A 4LLWB 4ONFL 3DSNA 5H4YA 2EDXA 3PL6B 4RRPM 2FJHB 1KBPA 2JELL 3UL4A 1AMXA 2B1HL 2BP8B 4PP2B 3C87A 4PJAF 5KVDH 3LEVH 4HS3B 4U7SA 1I85A 5KVEH 3AADB 2OYKA 1FJ1B 3O6LH 4BELD 4U1NA 5DZVA 1A4KA 3SO3C 2X1WL 2CPUA 2YC1B 3MRLB 4H1LG 1Q72L 1YEIL 2XN2A 3QFDB 2CU9A 1P69B 2P5EE 2V2WA 5EUOA 1U91A 4IMKA 2VDMB 1NGZB 3VO0A 3HAEA 4ZI8A 1K5NA 4UZUA 2BSDA 4ZTPL 3BRFA 4XZUB 3EYOB 3DOHA 2F58L 8FABA 5KVFH 1S7WA 3A0OA 3BZFA 4YNYA 3O11B 1BM3H 2AJXL 4HAKA 1DBMH 4EOWL 5GGRB 4LEXH 4XE5B 1A6VH 2EIKB 4GFXA 4XPHH 3U9UB 1BVNT 2LU7A 4P2CG 3QO0B 5FYLH 1GOHA 5LBGA 1GA2A 3BGFB 2FYYA 5E8DL 1L9TA 5J9PA 4QOKE 3RKPA 1AGBA 1GGUA 1VZGA 3ZMNA 1VA9A 3JZ7A 3AXLB 3KM1A 3GHBH 4TUJA 3OZLA 1GHFH 3ECQA 4Y19B 2OJEA 4I1PA 4MKTA 5FKPB 4GJTB 3VMPA 4KTEH 1RIUH 4G9DA 3BYTA 3VXPA 1OAQH 2EUXA 4RX4A 5EIQA 2EYRB 4LEEA 4EIBA 1YRKA 1CT8A 5TJWK 3MLRL 4K7PY 1P6FA 3ESPA 1WZLA 3QFJB 4U6HB 4Y2DB 5CLZA 4JRYA 2ZYRA 3VFOB 2ITEA 4G1MA 1G9NC 1MY7A 3KJ4B 3MRJB 1BMGA 1SFHA 5LGKA 4N9OB 4MSWA 1RSFA 5KTEH 2NY0C 3MROA 1OSYA 1RUPL 1T6VN 1YEEL 3VI4F 2JTDA 3TT1H 1EZUA 1EUTA 2ILLA 2Q5BA 4FTVE 5GQBA 2B3IA 2FT8A 1PG7H 2WYZA 4KY1H 3WXVH 2OW7A 4NQCD 3B9KC 2HRGA 1MY5A 2JV6A 2VMCA 4KBPA 3MV8E 5BO1L 5CU9A 1G6VK 2DBLH 3KPNB 3MRGB 4G3YL 2HVKB 5EU4A 4BZ2L 4HV8B 4NQDB 3C5JA 4XN7A 2AVGA 2KHAA 3DV4B 2P47B 2HT4C 2DQFA 1L9OA 1SMOA 4IU2A 1DQJB 5GGTA 4Y9CA 4RMQA 5KEZA 3O8XC 4L8CA 2F54E 1NDMB 1RPUA 1B6UA 4PJHF 2KI6A 5AVVB 5IQLA 3T3MB 4GH7B 4Z5RB 1T4WA 4PJIF 2EXWD 2JMRA 3LDBC 3TO4A 4FQQB 5IY5B 1Z6JT 5D7SL 1JGIA 3T4AB 2JI2A 1CGSH 1QATA 4KJWD 1KBBA 5E8PB 1BZOA 2YWYA 5ITFB 4MA7H 5E2UH 2R56H 4UQIM 3NIDE 5MENE 2EO7A 3IGAA 4LSQL 4P5MB 3ZE2E 5T8IA 1A7OH 1HU8A 4TSAH 3VWJC 4JM0A 2YZ8A 2GUOB 3IDUA 3O3AB 3VCLA 4EI5C 1LWRA 4QDGA 3Q2VA 3ZDWA 3NZ8A 2DAVA 5E2VL 3AITA 5JIHA 5MEOA 1D6VL 1TJIH 2CXGA 1AQHA 2CR0A 3H2PA 4ABUA 3LN5A 1JGUL 4UTAH 3ZPDA 1DZBA 4JM2A 4JQVC 4L9LA 1TZHB 4LKXB 2O6CA 4LEOB 4LRIC 4ELME 2EH8L 3BPCB 4JDVA 2V17H 4LL9A 4YR6B 1BG1A 4LAJH 4KI5C 5B22A 3VMNA 2XWTA 3RGHA 4Z3FA 4NN5C 2JKLA 2JJTA 4HMEA 4U3SB 4F27A 1OGPA 4HGWA 4WCYH 5I1HH 1BXVA 1I7TA 4BDVB 5KG9B 4IBSA 1T1XB 4M7ZC 2BSSB 4Q9BA 4XXWC 4ANVA 2EKSB 4LBEA 1HZKA 1B0RB 4F93B 1SLVA 3BVDB 4ZPTB 5FO9A 2WXHA 3VB9A 4P4KA 4MJIE 1XF2A 3GSOB 3IFOB 1ZSDA 2FL5B 4Y1AE 2DMKA 2J55A 4QHLA 3ZDXE 1OP4A 2YS4A 3HI5H 3DI2B 1BYNA 1B2WL 4X5WA 3DJZA 2P26A 3BWSA 2DZEA 1BEYH 5I73C 1KEGL 4LCIL 1GW0A 2IO5A 4R26H 3AJ7A 4AL8L 3UZVA 5I6XB 4OLZH 4M43L 1O9WA 3FN0H 2EXTA 4XMLH 2YAOA 5IB5A 3BKCH 3QZNA 5DJ6B 3NAAH 4W1TA 2FD6L 1FYTE 1QUPA 3MOQA 3WS6A 3E0GA 3LH8A 3QVAA 2WMPB 4O02L 3IB4A 5FPIA 3HUJA 3RFRA 3CXHK 4NENA 5I1KL 4CNIB 3WDHA 3KL3A 4XPTH 5DJXB 1EQWA 5L2KB 4RFEB 1FDLL 3WXWH 2NZ9C 4YEEA 5IFAH 3AAZB 4HFUL 4C55A 4UU9B 3WUWG 5ADOL 1WLHA 2AKRA 1NC4A 1LQSR 3QC5X 5I26A 3TPKA 5I75B 1PZ5A 1OQXA 5I8CB 4JL2A 4MZRA 2CPCA 2JCCA 1KPRB 2IDSA 1WAAF 5BPPA 1U8LB 5F1IA 3RU8H 3S3CB 4PJ5B 1T2QH 2WBJD 3GRGA 4ZMWA 3H54A 3EKCA 1UM4L 3PNWA 4GSQA 4IKJA 2R23A 3R19A 3L3JB 2J20A 4GXUM 2EEXA 2WY3B 2VAAB 4JG9A 1SXSA 4I77H 3OHMB 5C0FB 2VQ1A 4LCWD 5DR5L 3LPOA 2OJ1A 1MHPH 1N26A 2CGRL 2ESVB 3SDXB 3MA7B 4XNMA 3EOTL 5D2NC 4ZW5A 1JPSL 2JFCA 4CKVX 5E5MB 3I9IA 4YHLL 5BV7B 4HIJA 1JDDA 3B9VA 4M8UA 3F64A 2CCLA 1FRGH 4JZNB 3L17A 5EBMA 4OZGB 3ZQWA 5DVOA 4HOMA 5M94B 1V27A 4MD4A 2CO7B 1OB1B 4PGBB 1JGLL 3L3GA 2OMNA 5DD3L 3CVHB 4B9GA 2OL3H 2QGDA 2ZWNA 3DXAD 3KG5A 3GT6A 4I85A 4IRJA 5DEZA 5KN5A 1QP1A 5I1LB 2CUMA 2P7TA 2CJTA 4J8RB 4XPGH 3TBWB 2XC8A 3FQXB 4JDEA 3VYNA 2R8SL 1ZOXA 4CVWA 2ZOKA 3LQZB 1OSPL 3I2CH 4E41A 3ARGD 2QVKA 1WFTA 3LH9A 3LRKA 1HSAB 4OT1L 2E5EA 1EAJA 1KUMA 1LHZA 4BUQA 1A0QH 4JRXE 5I76B 5FHBH 3BP7B 3RL2A 4HGMA 4OGYL 2BXZA 4QHKI 3U79A 4O2EA 2XG4A 3NT0A 1JMXA 2V7NB 3CZJA 3KWXA 5IHUH 3WBDA 2AJVL 1DLHB 1FIEA 3BQUD 4GO8A 3FK3A 3MLSL 4KXAA 5MI0B 1CZ8L 3OLGA 3RWCB 3GJFH 4YBLB 1BJ1H 1HIMH 1MWAL 3K1KC 4AY0A 1ID2A 3IGFA 1RK1A 4JPWL 3ILQD 4B60A 3CHQA 5JIMA 4TLTA 1WC7A 3JSSA 1PKOA 3GBNH 3LAFA 2VDKH 4NC1C 2NY5H 2BXYA 1EX0A 2N3JA 3CN4A 3K0WA 4X8JB 5FYLD 5T1LA 4Y2NA 2I9TA 2F9BT 5I16B 3WY3A 2JQMA 1E4XH 3MTXA 3NTCL 4A7GA 3CGTA 3RPBA 1KACB 2CXKA 1QABA 3A67L 4R4NC 4UNIA 1DBJL 4WO4B 2WSDA 4FLHA 1ZLVK 5J11C 2G2PA 4U1SA 1Z5LA 4HX1A 3K6IA 1BZ7A 3UGEA 1JF1B 4ZMLA 2X4TA 2Z6FA 4PRHB 4A2LA 1CF1A 5B8CB 4RA0C 5DD0H 3T4AC 4YL9A 2O6FA 1SZNA 3M1OA 1GGCH 3DX7B 1NUGA 1SVCP 3BHBB 5A2FA 3UGXA 3WI9A 4D3CL 2K8QA 4HHAA 5FW8A 4C8XA 2DQDL 3IMSA 4DCQB 2NMSA 1QSEE 4QNPE 5MP6H 3RY5A 3U2SB 1A6WL 1W72H 2X9YA 4HKBA 1HS6A 2VAJA 4Y5VA 2FUQA 2AMUA 3OXRB 4FS0A 2X6AA 4ZMOA 4JJHA 3CSYA 1OSZA 3PGFH 4MBRA 4M6OL 1BWWA 1JNLH 1ZMYA 3NCBB 4K5OA 4Q8BA 1PD6A 5H37H 3ZW3A 5LGYA 4A68A 3C5ZC 3O4OB 4W9KC 2WXQA 1FVCB 2Y36H 5FF6B 3T2LA 5I19L 4HEPG 4O5LH 5I1DB 2R59A 1JWUB 4M5ZH 6PCYA 5TFSH 2BWQA 4IOIB 5ALBL 1TTRA 4NO0A 1N59B 1I82A 2N01B 1OM3L 2DLEA 2CRMA 1A9EB 1JD7A 4XVUC 5EPMA 1J10A 5FS5A 3JYCA 3QJSB 2PR4L 4NQQA 1E3XA 4GQ9L 1QPXA 2QVIA 4NQCB 5AW4B 3GMQA 2GSGA 5T5NF 1CYXA 4LLDB 1HC1A 2FQGA 4LOUD 4ERSL 3QJXA 4N0RA 4YGAB 1IGML 3W81A 4MNGA 3QWRA 1E5CA 2BSBA 1J5DA 5GZNC 4NKOA 3IS0X 4FTVA 3X2QB 4JRWA 3FSAA 1EERB 4RAUB 3MCLH 5IJVB 1Z9PA 3JVGA 4GG8A 3IDMA 5HYQA 5I24A 1Y18B 1T5XB 1U8OB 2OMZA 2WWOA 1F42A 3BT2H 2GFBB 3Q3GA 2BVEA 3STZA 5SX5H 2J5WA 2YD6A 3KLDA 4YHKL 2Q6WB 1CGTA 2VZUA 4LLUB 4TUOB 5E6UB 3T1FB 3RWIB 2XBTA 1F6AB 4B9IA 4G6JL 1SFDA 1G9MH 1QG3A 3CVDA 4MASA 2DY2A 4AW7A 4FQCH 1TTFA 4FXKA 5IQ9B 4IRSD 1UZGA 4KX9A 4GXUN 4EVNA 3PHOA 1GGBL 3FFCE 4L3EE 5AW6B 2XQBH 3KS0H 3WIIH 5AG9A 3D33A 4EDXA 5HHOE 1MFEL 4UBDC 2FIKA 1WSST 3FPXA 3BAKA 2ICWA 2YN3A 4YHOL 3QWNA 5JTWA 4S10A 1KGCE 1HQRB 2X38A 5DDHA 2YPLA 3KWVA 2Z65C 4F2ME 4Z7WF 3WFHA 4UWQB 2FWUA 5EZOH 3FOMA 2VXTL 4G8EA 4W81A 5JZ7C 4ESKA 4XNDA 5HYJA 4HIHA 5AVYB 5KYXB 5FAAA 4O4YL 5MENA 3LKSB 2YFOA 4K23H 3D2UA 1E8WA 5CN2A 5KSVA 4D8OA 3QUYC 1NJ9B 5LWYL 3PWUA 3VRIB 3H2WA 3SPIA 1CFQA 1CXEA 3K8KA 5FM5M 1R3LB 4JCWA 5BV7C 4MA3B 4HJ1A 4Y5XB 2H32A 3D87B 4ZUWA 5K5YA 3D4GA 2PTVA 3CFIC 1INDH 4TNFA 2COVD 2HH0H 2Y5TA 4EPSA 1U3HC 4ZYKB 3WO3B 5A40E 3QJQB 2PTTA 5SV4A 1ASPA 3PWPA 3MHZA 4JUSA 4P2QA 3O2DH 1ZT1B 4X6DF 4LO9A 4ONHB 4XNZC 3UCQA 4APQD 3VD2A 2XN1A 4N2EA 1IEHA 3NH7L 2YD5A 3MRHB 1T66D 3AREA 1FFOA 3MRDB 2N59A 4IMLB 1TEGA 2PWGA 2DEYX 2E9GA 1XZ0A 2ZXDA 4AQAA 2EIMB 4Y1AA 2XVGA 4OLVL 1U8CA 3AACA 3FQ4A 4K7FB 1I53A 2D3VA 5KYWA 3B9EA 1QRNE 3D50A 4D0DB 3BWAB 1WA0X 3T6QC 2NXYB 2BVYA 2PPAA 4NPYB 1Z2KA 2CE6A 4PI2A 2P80A 4LDCA 4FLSA 3JTTA 4PJGE 2P8LB 4A6YH 4XB3A 5CJ5A 1RPKA 5DD5L 5GRJL 2WXIA 5F3FA 3MJ6A 2J57A 4KDWA 5AALA 4D0CA 3HNTH 4Z7QE 5CNHA 1RK0A 2X4RB 4UAOC 4YPGB 3EJJX 3MRNB 4AH2A 3BXNB 4K2UH 5I0WA 5DMGD 2AI0H 3R0NA 1ICTA 3VXMB 4J7RA 2XBDA 4PSPA 4ACTA 4XPAH 1QNIA 1DQTA 3FW6A 3OKKB 2A9ML 2GIXA 3ILEA 3K8MA 4G42A 2DH2A 4K94L 4JREB 3VGEA 4KK6D 4XNAA 5IJKA 15C8H 5FEBA 3FO9A 4LCWB 1ETZB 4GW4B 1K4DA 1I8KA 3ZT6A 2NT0A 5L88L 3LS4L 3DGGB 5KS9F 1QBLL 3CFCL 1XSOA 5B8CC 1F0LA 2Z92A 1REIA 1FFQA 3B2UD 4HUKB 3WMPA 1YECH 1H15A 5EO0A 2FLRT 1NWOA 5D2LA 4F24A 1E7UA 1QEXA 3DGDA 5DMIH 2HWZH 1TLMA 2O30A 4NQVB 1NGWB 2EDTA 3WE6A 4HWNA 4P3DA 2NY2D 3IU3A 3DXAB 5AUMA 4EI6B 1FFNB 3T6VA 3P2BA 3VW3L 2ZUTA 1XF5B 2AJ3B 3IJ8A 1BMZA 2PPDA 5C1MB 4KNUA 1GTFA 4E9LA 4X0NA 2BY1A 5J1SC 5EZIL 3UBHA 1NOAA 3ARGB 4XP1L 5LGHH 2F19L 3GDCA 1Q72H 1YEIH 3OKLA 1YDPA 2WWKT 2XWJA 4TMPA 4HWZA 5FDYA 3D69B 5LAXB 3BKYH 2N1TE 4I2XE 4PP1D 1OK8A 3O4OC 3DHUA 1YCSA 4YZFF 1LWHA 2P4AB 2KL6A 3KBEA 4ZTPH 5HVGB 5EA0L 3KPRE 4JE4B 4RRPA 1BOYA 2J6WA 2ITDB 3W0WE 1NCWL 2F58H 4LLAA 3L16A 4K07A 4PJ7B 5GGTL 1ZPLA 3TBVB 3CHRA 2AJXH 4IIQB 4EOWH 4JRXA 3II2A 1PZBA 4OTXL 3GD1C 3VFPB 3K71A 3OKNA 3PWJB 3QO1B 4HUXB 1U8QB 4ALAH 4BE6A 1RPQA 2H3KA 3ATBA 4FFYA 4GRWE 3S88L 3PJLA 1CFVH 5TQ2H 5DRZB 2FGZA 2BO0A 4NUJB 2E8YA 5E8DH 2WTPA 2EDQA 3MJ7A 4J3OG 3RL1B 3RWDA 4PRNA 1ZK9A 2EE6A 4EIUA 3I02A 2EDRA 3NJXA 4YDJB 1GYVA 3W9DA 1TZ8A 5J7CC 3TO2B 2CLZB 2DDQL 1IKNA 2F74B 5BJTB 1K85A 3W57A 2X9WA 1ERNA 2EXWC 1R5IB 1M05B 3M6DA 3NJFA 1R5VB 5KAQG 2IPUK 3RVWD 3MLRH 2PCFA 1S8DA 1S3RA 4KJWC 5HGAB 2V9RA 3PDOA 1CDGA 4HPOH 1BZ9A 4KUZL 2ROXA 3I50L 4LHUG 3B5HA 2V2TA 3IS1X 1CIUA 5D72H 2R2HB 1RUPH 1YEEH 1SRDA 3JZYA 2CAKA 4S2SB 2A6JB 4BQBA 5KSBE 5BRZD 3HHRB 3MRKA 3VG0L 1FPTH 1CICA 3MMEA 4QRRE 5CSZA 1FZOB 3DIFA 2NYZA 4EZMA 5BO1H 2IADA 1JZ5A 4DHLA 3GXPA 4MLIA 4G3YH 2AQSA 3TBSA 1N6VA 1QSEA 4NBYB 5MEPA 5F9JA 4BUGA 1ND0B 1T04B 2YEZA 3AMKA 4ZAKA 3WTSA 1MPAH 2PP7A 2IH8A 1E67A 3ELAT 4N22A 4PGCA 4QO1B 3VI3A 3AU1A 4PRPE 3TH3T 3RUGF 4XBPB 4BQ8A 2F53A 3NJJA 5C70A 4J8QA 2NX5E 2GT9A 5D7SH 1P9MA 1E9QB 4OZ4A 5E5RB 2P8MB 1HAWA 4N9GA 4U6XA 1UGNA 4LKCA 5ICXA 1N19A 4UM8B 2AXHA 3V4VA 4I5BB 1XGYH 3NESA 1IU1A 2BCKB 2BFGA 3QG7L 5T3XL 4Z23A 4U4IA 2WQUA 1CC3A 4LSQH 2HPTA 3NFNB 3E9UA 3G9VA 3QEQD 3OC8A 3ZTCC 1OCRB 3LN4A 2ED7A 5A2BA 1FL5A 2R4SH 4AM0B 1NGXA 3E3QE 4WI0A 5J6GB 5E2VH 3D18B 1XIWD 1D6VH 3DYPA 1H3TA 5E00B 5FA3B 1TJMA 1JGUH 2MPAL 5HY9B 5HHNA 3VD7A 1M71A 1V3JA 3MV7D 4V1DB 2NXYC 2EH8H 3SDAB 2WANA 3P02A 2VLRD 4XHJD 3P77A 3KGRA 3OXSB 1CIDA 4AGLA 2FWSA 4AZUA 1ED3B 1MXGA 3GUFA 3CDGA 2D7NA 4G7YL 1Q9KA 3TIDA 1TVBB 4L1HA 1KCVL 1S7VA 4L1TA 2ZXAA 4WHTB 1J0ZA 4DVRL 3MI6A 4JPSA 4GPVA 3ULVL 4HIIA 5CGBA 3ZDZF 4DWHA 4ZFGH 4MA1C 3BQVA 3FCSA 4BA0A 4ORGA 3P4OA 1EJ6A 3FFCA 4KZ0A 5CILH 3ZTEA 1USZA 1X5XA 4JR9L 3ECUA 2P8PA 3GMRB 2OZ4A 3BUBA 2PXYB 2LABA 3LNHA 3WUZA 1GC1C 1OF2B 3FJTA 4G80B 5DQDH 3P0GB 3RA7L 4PCKA 1KEGH 1ROCA 1XGUB 4LCIH 3ZT5A 5EDSA 4AL8H 4OD2B 3EF7A 1TNMA 3L3DB 5E56A 4B0MM 4M43H 5C0GA 4DOHB 2VLKD 2FD6H 4MDRA 1H3VA 2QKIA 4L4TB 4F7PB 1ACCA 3D0LA 1FC2D 2I9LA 3NCXA 1IE4A 4O02H 2W0KA 5J0BA 4CADB 3V0VA 3E6FA 3O6KH 3DI3B 1FDLH 2NY6B 2IAMA 2APFA 5EEYA 3S36H 4YDZA 3V8CA 1EFQA 3FUDA 5DJ0A 2DQGL 4HFUH 4AEFA 3QUXB 5JXEA 3DOIA 3BIKA 1BX2B 1DQKA 4GP8B 1M6UA 3QIUA 4U0RB 4G7SB 3S3DB 5TTRA 1E43A 1WAPA 1CGVA 2YGQA 4JFEE 3MCG1 3ARGC 3N3EA 4Y4FD 3KLHD 4ZODA 3VWKD 4PJAB 4ZUSA 5TK4A 2GPZA 3LZFL 3I6KB 1UM4H 3HZVA 4FI8A 3WEAA 2GUYA 1IZKA 4LDLB 3SE9L 3UJJH 3HPLB 1WZAA 4DW2L 3IGUA 2VSMB 1OF0A 1JYWA 1DLFL 5DR5H 3RWHB 1Z7JA 3BQUC 5F88A 2QVFB 5CN1A 1R1CA 4W9HC 2JKNA 1JGVL 4U1HB 3VRLF 3G5ZA 1IC4L 1IT9L 2BNRE 2CGRH 1D5MA 2WM0A 2XIBA 5GS0L 3EOTH 3AG2B 3T71A 5ICYA 5LUMA 3D85A 2CMRH 4EN3D 1WJ3A 2OLDA 4HUCA 4YHLH 3ILQC 1F97A 1P4LB 1DEEA 3FN3A 4PQXA 5D4JA 1L3NA 5I23A 5IEHB 5IVXE 5DS8B 4YLQT 1P53A 2CHWA 2WVTA 1Z9OA 3CN3A 4A7QA 5AFAA 4PBVC 1G9HA 3ZZSA 1MCHA 2D7PA 4HLZH 1JGLH 3FU6A 5DD3H 2OL3B 3RP1A 3DX1A 4I3RL 3D07A 3HZYA 4B96A 3QDGA 4HWEL 2F5AH 1AFVL 2A7BA 2VZ3A 4YFLI 4PS4L 3SDYL 3LRHA 1DDTA 3ATEA 3RWFA 1OSPH 2WBXA 2DEXX 3K6DA 3PUCA 2E7HA 2IF7A 2LOEA 1BVNP 3CHSA 4HUWB 2AAAA 4HK0B 3EZ8A 3TH4T 5EUOF 2ADFL 4X7TA 3AXHA 1A6ZB 1JTPA 4OGYH 3ZY7A 3QK0A 4QHNB 5IGXL 4ZMPA 1BAWA 3PP3K 4I9XA 4IM8A 4WWNA 3UYOD 1MNNA 2AJVH 2NY2B 1KCBA 4JPVL 1QFWI 2ZKHL 1B0WA 2FX8L 2FBJL 5IFJB 1AACA 1MWAH 1OGTA 1FQ9C 1PDKA 4JPWH 4XVJL 4JMXA 5C0BE 3CX5K 3VI4B 3VTAA 3BPOB 2IGFH 5IHBA 2VDKB 3HG0A 4E5XA 1AR2A 4OIIL 2J71A 4PLKD 1UC6A 5DURD 2ITCA 3TURA 4FRWA 1H5BA 2JLLA 5L0QB 1J5IA 1O6TA 2HUHA 1S7UA 4MXVF 5D71L 5HD8D 3NTCH 3VFSB 2L7EA 3V6OA 2DYPB 4DP1X 1CO1A 3A67H 1DBJH 3A21A 4LPCA 2XWBB 3CMOL 4QR7A 2OMUB 1EA9C 1U8HA 3RWJA 2HX8A 5B4MD 4HAFA 3IJSA 1YEDB 1Z9LA 1DANU 2WBWB 1U6AL 3HC4H 1XGZA 2AJYL 3KPQB 4M7LT 4RQQA 2DTML 5CO1A 3VXRE 1UH4A 4PJHB 3SPJA 4A2EA 4LOUC 2BNQA 3GZQA 4IRZA 3WN6A 3D1MC 2R0WH 3FUJA 3AG1B 2V5TA 5CIPA 3Q43A 5FO8B 3UTTE 2Y06H 4YSPA 2GTWA 1W72B 1A6WH 1EWHA 5C08E 3WTUA 2GI7A 4ODSH 1J5OL 4AT6A 1GKEA 1I9RL 4FG4A 3HLKA 4POZD 5C0JB 3QSKB 4AGNA 2VM4A 1R33A 2FR4B 4W9EC 1N0LA 4RESB 4M6AA 5IB1A 5BXFA 3RZCA 3GXFA 1TENA 1R5WB 1P7QB 1S7XB 4K5LA 2I60H 2XNAA 2HJLB 4LIQL 4Z3IA 1OK0A 4Z7OF 1BXAA 2YD1A 3N1QC 2EABA 4IRSC 4K5MA 5J1AB 5JDJA 3FO2A 4JVPA 2C9UA 5I19H 4F58L 2BP3A 4G9FD 4Y16D 3GUTB 3NSCA 5ALBH 5FIEA 3OD3A 1AJ7L 2D0HA 3B37A 4K7PL 3HLAB 4Y5YA 2A74A 1OM3H 1U8PA 3PQYA 1NCBH 1RMFL 4G6FD 3CDZB 3L3OB 2XZZA 2COQA 5BRZB 4ZW3A 5IW1A 4ELKB 1JRHL 5E8NB 2PR4H 1TO4A 1XF4A 5I18L 3DX3A 3QXVA 5IKCB 5AW7B 3S97C 4WFHD 5SWQA 1LEKA 5EH1A 2OXHB 2YPKA 1F45A 1SDDB 5JUEL 1C16B 1W9XA 4IKKA 4ERSH 5I66B 1IGMH 5JHDA 3IJEB 1NQBA 1URIA 1X9UA 4BXSV 1ZVYA 5KSBA 5CGYD 3H3PL 3U30B 2NYYD 4MAYA 2X41A 4AKQA 2YD9A 1IIIA 2O5XL 3T8XB 5KYUB 1J9QA 1P7BA 5ISZA 3L3KB 3ZIYA 4N86A 2N7AA 4N8UA 1T0NA 2Q20A 3UBFA 2VQTA 3UBXB 5C09A 3IFNL 4EO5A 3BMWA 4O2FA 1XL6A 4YPJA 3T2NL 3B3BA 3GTVA 4LHJB 5AYTA 3LRSA 5DGQA 3UCRA 1JD9A 3DVNB 2VLJD 4HCFA 1I9IL 3CHXA 4FQLL 5HHQA 1KSRA 1AIZA 3RE0A 1LL1A 2J44A 2PR9A 4KKPA 2UVEA 2X42A 3SKMA 2QPSA 3GRBA 4U33A 2Z0UA 4GKNB 1MFEH 3V52L 3G04A 2VITA 4APQC 5BMFH 1ZLUH 4X6EB 1KGYE 1T66C 3ZTNL 3QEQB 5B7MA 4LSRH 4YHOH 4BKLA 4F80A 1TTAA 4L4VA 2ZONA 3W11D 4EAEA 1HXYB 3IEAA 1XIWB 4DEWA 1SDYA 3VFNA 3IAGC 1ECYA 1ZANL 1YYLL 2VXTH 1H6UA 5EWIL 3BO8A 1XF1A 1XVSA 3QNXB 5EG6C 3VA6A 3HE6B 4O4YH 4QRPD 1T4KA 4QTHA 5T1MA 1MHEA 3ULUL 2VLRB 5AKRA 2ZXBA 3CUPB 1X5GA 1BFOA 5FK9B 5LWYH 3IDGB 4DZ8A 3CU7A 4V2CB 2KLTA 5FR3A 5A2CA 2W07B 5SWZE 4M1GL 1BXXA 2YOAA 3BN3B 4M4RA 3HUJF 5GGRY 4F8QA 4JFVA 3ZO0A 4Q56A 5EU3A 4L3CA 5KBLA 5DMGC 1YMMD 3K5RA 3QCTL 1V3KA 4J3TA 3TBYB 4KDVA 2XYBA 1RUKL 3AC0A 3GMMA 3WLWD 3FQRB 5IEKB 1OGAD 3G5VA 4Q2ZA 4KK6C 2BH0A 1FGVL 1KULA 2PTUA 3V0JA 3L7EA 1U8IB 3H2QA 2ZKXA 3S37H 2JCCF 4QXUL 3KL5A 2WQWA 5L4JA 3BESR 3FSVA 3FUHA 3TA3B 3EDKA 1J48A 3B2UC 4YHYC 5EOQL 3JV4B 1A1NB 2LLGA 2FE0A 4FG2A 4YL4A 3QDJE 1PIGA 4OLVH 2J2ZA 2CHXA 5LN4A 4PLOB 2WXGA 2KQNA 1JI1A 2C9QA 4K8RL 4TUKH 3K91A 2PCYA 2NY2C 1OT1A 1CJYA 1HX0A 3LKQA 1XR8B 3BP5A 3DX6A 3ULVF 1O7DC 1ZTXE 2FJGB 3E1ZA 3HAEH 4OVVA 3BFQG 4ZPVA 3ZDYE 4LPWA 3Q9PA 4XP4H 5DD5H 4RNRA 4PIRF 4W93A 5GRJH 4AI7A 1T03H 3CG8A 3JWOL 2H0EA 4ZRGA 5EOTA 1J0YA 5EUKB 5BVPL 4HPHA 5JW4Q 4XN5A 4AM0Q 5FB8B 4Y4FB 4B53A 4GIOA 2NY5C 4NSKB 3GMLA 3TZVD 4DH2A 4IQHA 2WZPA 2ZWKA 4KKBD 3K72A 3QDMB 1S9XB 2CSPA 1WBXB 4PP1C 2ADJA 4K94H 4FFYL 4LK4A 4P57A 5GGUA 1EBAA 3JT0A 1NGPL 4MWFA 4YZWA 3GYRA 2JCWA 4HD9A 5L88H 3LS4H 1BD2A 2P44B 3OKYA 4ZSOB 1O6SA 1GZQB 4AMXA 4GO9A 2HFFB 4EN3B 2C9XA 4JY5L 3PG2A 2YFNA 2HFEA 3HBPA 5CLXA 4UB0L 4Y19E 3VTMA 1EMTH 4G8FA 4G59C 2CIKA 3L08A 3GXDA 3MLZH 2OS7A 4X4YB 3BYYA 1AKJB 3L4YA 4MJ5B 1T5WB 3DRTB 1XF3A 2UX7A 3QFJE 4QJ4B 1U3YA 4HGKC 3DBXA 3TN0A 5IJCC 4W6YB 3VW3H 1OAYH 3LV3A 5JHMA 5D7JA 3U4AA 3CFNA 4C56A 1A7QH 5DQJB 5E8EB 1VZIA 5EZIH 4UOW1 4KJYB 1TU2B 3DURA 3NP3A 1CL7L 4XP1H 3TOPA 2F19H 4GP4B 3RVWC 1AD9A 3MO1A 4NWUL 3UEQA 4EXKA 1E4KA 1KLUB 1Z5YD 3U48A 5LHDA 1IV8A 4A7GF 2P1YA 1IRAY 3GEFA 1EHNA 2FX7L 1JSYA 1FG2A 2PKDA 2GCYB 5AW8B 3IT8D 3DIDA 3E8VA 5EA0H 1CDIA 1DVXA 4UOW0 2B1OA 4NQDE 1NCWH 3G6AB 3HG1A 2N0MA 5DJYA 5GGTH 3NBNA 1UB5B 2CO3A 3VDCA 1JPST 2B08A 2V0AA 3RNQA 2VERN 1T20B 4UV7L 4F7TB 5IMLA 1AHKA 4OTXH 4CSZA 2FZ3B 3LKPA 3MKGA 5EF1A 5DURB 3VSUA 3T3ME 2DWYA 3ETSA 4NYLB 3S88H 4UT6A 3PJSA 5JORB 4JW3A 1K8DA 3U30C 3WEXB 1CG9A 4JFPB 5BZDA 1P7KB 3V4VL 5JOPD 1XH2A 2NQ3A 2R29A 4YK4C 1IQDA 2PO6A 1P2CA 3CE1A 4ORZC 1J1XL 5JPNB 1OXYA 2VN4A 3IM1A 2DDQH 3LJ3A 1DO5A 3ZO9A 4PRDB 4UNUA 5L4IA 1G9MC 2DJMA 5F89A 4LVNB 2UZYB 5B1AB 2BS9A 1QAWA 3AU0A 1IMHC 4KUZH 1F4AA 3I50H 4NKDB 5CZVL 2X1PA 4I89A 5I82A 4R2GB 2NNAA 5H35A 1AR1D 4LAQH 3V9EA 1GAFH 3RIKA 1JK9A 1QZ1A 3OVUB 4NM8L 3RTQA 5I8EB 3IGKA 2VDPL 4M1DL 3MLXL 4P9HL 1XL4A 4QRQA 3VG0H 3L45A 1CGYA 3LZLA 3RGVB 5FYKU 3EJQA 2ZG2A 3MRFA 1JP5A 1GW6A 1SPDA 4FD0A 4UMSA 5DVMA 1XIWC 1SHWA 4FYQA 1JGEB 4LVOB 5I1CL 3SQBA 5KW9L 1XSKA 3AS2A 3V5HB 4MB5A 2Z8SA 3HE7B 5HHVH 2CRYA 1F4WL 3HE6C 4Z7WB 4OV5A 2F7RA 1JHKH 4XHJC 1R24A 4F8PA 1PCXA 2H8PA 3V6FA 2OZ4L 5C0AB 4G9FB 1PZSA 4GT0A 2C7UB 4OBRA 3CZLA 1HQ4A 1HE8A 4TUUA 3G6JA 4DFIA 3FHQA 3APNA 2A6DA 1IM9A 2ZUSA 1G87A 1IEBB 2QV2A 4XMPL 4CW1B 5IG7A 1T80A 3BAEL 4RVBA 4DP4X 3CFBB 4AV5A 3VXSD 5IHHA 2V8MA 3FT1A 2QZQA 4C47A 3GHPA 1MJUL 2IOOA 5LDSA 2VUYA 2GJZB 4NRZA 2OULB 1HKFA 1ILUA 1GJWA 4J6RL 1FL6A 4OLWL 3V55A 3ZTJH 5I8OL 1VFUA 3QG7H 3H0TA 5T3XH 1G7MB 3FRPG 4KXZI 3CCHB 3QH3A 3B5GA 3L1OL 4HWBA 4N2CA 5L2KE 2X3BA 4BWTA 4XVSL 2GB2A 3FO1B 5F2FA 2PPEA 1T7YA 2YUVA 4EQ3A 4XO8A 3UYRL 1G7QB 5EBGA 4PSRA 3UDWA 4LSTL 4FMVA 2IANA 1UD5A 4HKJB 2HG5B 3I3DA 3OQ3B 1A02N 2VMEA 4ABWA 4MHHG 4PJ5E 5I5JA 2BVOA 4A37A 1FN4B 1LDPL 3CC1A 3EBHA 2HJKA 3D3VD 1NUFA 1NBZA 3OTTA 2X89D 5DVNA 4A1RA 1KCVH 1B9KA 3O4LB 1AZCA 2XG5B 3IDYC 5DGRA 5TGBA 4EKXA 4DVRH 1ZA6B 4KHXL 2A99A 3KLHC 4Y4FC 3SGDH 1X4YA 3ULVH 3VWKC 3FUKA 4NCC1 2WLJA 1NCNA 4KROD 2J72A 4OZHA 3SDXE 2VB5A 3NCEB 5FYKE 1AMYA 4KH9A 5FUCE 1OY3B 4DP7X 4CU6A 3RA7H 4OZGE 4X6CE 1E8XA 4H88L 4I0PD 2Y7QB 1JHLL 3VE0B 4D0BB 7PAZA 4QWWD 5AKVA 3WHXB 1WDAA 1G7IB 3WMSA 4OGQC 3L95A 2ZOLA 3GSRB 4ZW8A 3REVA 3TCLA 1F00I 2ED8A 3U4EB 1I75A 4NHUB 4HJTA 4EN3C 4FFZA 1R9FA 4KNQA 3WNNA 1UXMA 1UJTA 4O02B 4QMEA 5A16B 5B3JE 3LQAL 5E9AA 4XO5A 4BCXA 4LCUB 4Y1SA 4XXCC 1G9EA 1KT2B 2OP4L 2VL5B 1KLFA 1YMMB 5GIRB 4GIPD 2Y1AA 4JUTA 4QEGA 2DQGH 3RKDD 4NQEB 4DO5A 5JPMC 2VRAA 3LIZA 1HI6B 3CBJB 3LKRB 5GRXG 5IWLC 2Z4QA 1FI8C 2OMWB 1KYAA 2X2YA 4JKPL 2Z91A 2BFVH 4P5RA 2NYKA 3P0YH 2NNXA 2OFQA 5JO5A 1PQZB 1NAKL 2EIZB 4N2NA 2XIDA 1G84A 1L6XA 4RFOL 2FO1A 1RURL 3ULUF 2VLLA 3LNFA 1GYUA 3UTZB 4F8NA 5JQIB 3SE9H 2HKFL 2AV1B 4OJAA 4DW2H 4YDVB 3PGDB 3MUGA 1P5UB 4LU5L 4ODWA 5D7KE 4XN9A 1IGYB 1DLFH 1NC2A 3KPMB 4P2RB 2F8XC 4D9RD 5EIIA 2JKJA 5D96C 1BJ8A 1JGVH 5GS0H 1VKXB 5DQ9B 4X5PA 4IIZA 3LXAA 1I8MB 2WGNB 5E1HB 3X1FA 2GKIA 3ARZA 3QDJA 4LL1A 5D2LF 2V33A 3WO4C 2GI0A 2DMBA 4ALAC 5A6MA 5IK3A 3P4NA 2JK5B 4HT1H 4PLKC 4RX4D 4HETA 3RB7A 2VJXA 3AT9A 1CUOA 4YXLL 5CF3A 3NSJA 4X6BA 3BH8A 4PRHE 5HD8C 1GRWA 1KTLB 1BF5A 2YZ1A 3HN8A 2V2XA 1XR9B 2ZP0T 3CN1A 4IRZL 4I87A 4HWEH 3N40F 3DUSB 2Y3NA 4PS4H 4JLRB 5B4MC 4XBGA 2XQYA 5DC9B 3MRQA 4QHUA 1JG9A 3KXFE 3RJQB 4CVXA 4M6ML 3WAJA 1S9WB 2P5WB 1LILA 5ID0B 5JIPA 2QHRL 1JXFA 2DB8A 4ZXBD 5EOCL 3RJOA 3JTBA 3R06A 5IGXH 1B2YA 1URZA 2WQRA 4I18A 4Y4HA 4K3JL 2VUOA 4ZZFA 2I07B 4L5FE 5F9DC 1LO5B 2MWCA 5ERWB 5IB2A 5KBKA 2ZKHH 2FX8H 1OAKL 1DBBH 1MWAB 1B0GB 2FBJH 4KGLA 5DA0B 2HPOA 5IHLB 4POZC 4XVJH 2BP0B 4N0UE 3TIEA 4LVOC 2BOCB 3AW5A 3TA4D 4FQIH 5D70H 2PWDA 5KVGE 2PCPB 1S3KL 5A7EA 4OIIH 1U8MA 3TO4D 4AGPA 4AVHA 2NRDA 4DAGL 5INDA 1TR7A 3GBEA 4G7VH 4QHPA 5D71H 2RCSL 4NT6A 3NJMA 4NQCE 3GS7A 1WBZA 4Y16C 4UQ3B 2FH8A 1G5AA 3CMOH 3KPSB 3ROLB 2XY1A 2JJSA 4YDMA 4Y88A 1A2YA 1U6AH 3MRPA 3RYMA 1CK0L 3TPUA 3BPLB 3IBEA 2DTMH 4Z7VE 3VU2A 4ANUA 3LTVA 4YUEL 4DEPC 1N0XL 1XFPA 4GOSA 1Z0MA 3P4MB 3DC0A 4WQOA 1KPUB 2AP2A 3QIBA 4E0RA 5CGYC 5K1VA 1KIPA 2NYYC 4OH2A 1M6OB 1IILE 3FONB 5TDPB 1D5XB 3QS3A 5ESVB 5I1IL 3HRPA 1D5ZB 4IK6A 2AK4A 4BHUI 5JW4M 2KT6A 1U8JB 1YEWA 1I9RH 1J5OH 2BZCA 3KPLA 4LNVA 1PX3A 3I85A 3MV11 4AITA 2OV0A 3A4DA 5EU6A 3CFJB 1O75A 2DQJH 2VDNL 3GSQA 4UQ2B 1BVKA 3ARDA 3PP4L 2OBGA 2JI1A 1GOFA 4NGHL 1NMCB 4QPEA 5JOEA 4J6IA 4FOMA 1LO4L 3EFDL 3VI3F 1AJ7H 2E9BA 4K7PH 2XACC 4BK5A 1ZT7A 3S5LB 1RMFH 4LPYA 5A7BA 1RZQA 1PZAA 2EE3A 4PMFA 4YHNB 1JRHH 3DX8A 2Y23A 3W11C 2EYTB 2VMFA 1V3LA 2H32H 5K9QI 3IFPB 3QULB 1CYGA 1OW0A 1W80A 2WYTA 2VWEE 4U3XA 4JHUA 4GBXB 4KZCA 4J5VA 2XA8H 3ZDZB 5T3XD 3MNVB 4GSUA 4LPXA 1F58L 3WENA 1NZRA 4ACPA 4AL8C 1BDYA 2JB6A 4HIEA 4PYHA 1DBAL 1EDYA 3PPSA 4P23A 5F96H 4JGMA 1X5YA 1MHCB 5JR1L 4KC3B 1NMAL 3K2IA 2RH0A 4U6YA 3T2NH 2ZX8A 2GSMB 3MLTA 1BGXL 3UYPB 3EJTA 3UTSD 3VXSB 1M7DA 2VISB 4FQLH 3GMNB 1UM5L 2BW5A 3GO1L 3WLWC 4PV8B 1KB9J 4LLVB 4Q89A 5F72S 2ZTBA 1RJCA 3APFA 4ZMQA 2V5MA 3IXAB 1IAKA 2ZP8A 3V52H 2VC2H 4NIYE 2XDHA 3QIWA 4N6QA 1KOAA 4YSEA 4CGTA 4NQXA 3VH8B 3ZTNH 4MDIA 1RHFA 3QEHA 2ED6A 4FHBD 5HDBE 1IO4C 1W15A 2A83A 3BPNB 4FNLH 4ISVB 4RSYA 4AVJA 2VERA 4N4YB 2K9FB 3SJVD 4JJ5B 5EWIH 3PABA 4XPFL 4JY4A 4C83B 1P5UC 3SGJA 2Z9TA 3CD4A 1BOGA 1MCOH 5D55A 1ZHNB 2ZCKH 4XP6L 2ETWA 1F02I 3GJEB 4WFEE 4X4ZA 1JZ4A 1KCUL 3VXME 1MAJA 3GSXB 3ROOA 1KYDA 3ZRCC 3AG4B 3BVWA 3EF4A 3SKOB 4XO3A 1D9KD 4ZDHA 4M1GH 1HHJA 4MNQD 1I8AA 2FQEA 5H37G 5K9OA 1GZPA 5DZNA 1UD2A 3BZEB 5E4OA 5FUZH 4U6VL 3TZVC 4JANB 4KKBC 3TNMB 1JAEA 3QCTH 2VW6A 5BW7A 4JPKL 2EKJA 3MLWL 5CMAB 3PAZA 5C0IA 4R5TA 1I3RB 3OSKA 1FGVH 3HS8A 4FQPA 5DUBA 2WTRA 3DSNB 4LFHD 3ZR5A 2VLME 3VXNA 4ZS7H 1QBAA 1TETL 3B9AA 3QUGA 4QXUH 3U7WL 4PJEA 4PLJD 2HVJA 4ANWA 1TF4A 2W8CA 1XGRA 5ABAA 4CBZA 5EOQH 4IHOA 1GXEA 1L9MA 2K45A 5KVDE 1FHNA 3C6LD 4AENA 1H3PL 4DGVL 2BSED 4U1NB 4YBHA 4PB0L 1A4KB 3LEXA 5KVEE 2BY2A 4X6CA 2PYEE 3HR5A 3VXOA 3THMH 4QRTA 2V2WB 4AIEA 1DVZA 3ETBF 5EUOB 1U91B 3I3BA 4DGIL 5GS0D 3UBXG 1X4XA 3HAEB 1K5NB 5I1GL 5LB1A 4FNRA 2WB7A 3CLEL 2WJ5A 2WO4A 2Q86A 5BVPH 3QNYA 4UILL 2QTVA 8FABB 4NDMA 1S7WB 5I9QB 2G0KA 3IAPA 2R69A 4YNYB 4HDIA 4MMZC 5DCCA 3LHPL 5FXCH 5EB9A 5KVFE 2VMJA 3FQTA 2P5ED 3O6FD 4M9PA 4PJGF 5CFAA 1P4IL 4IKIA 4XB8A 2WXLA 4FFYH 3ZX1A 3ZOAA 2FYYB 1UA7A 5J9PB 1AGBB 1AHWC 1AO7A 2ENYA 4Z7QF 2YSSA 3HR6A 3VG9B 1BEXA 4TUJB 3DDGA 3S2CA 2YGPA 4DKEL 1E30A 1L6PA 2R29L 5JW4N 3FTVA 2OJEB 3Q8BA 5SWSE 2BMKA 4OCYH 4ES8A 3HS0A 5ID1A 3T0WA 5F93C 4G9DB 3VXPB 3V0EA 3VGAC 1IBHA 1FNSL 1CT8B 1NOFA 3JXAA 1A25A 1JF6A 5I71B 1GTNA 4X8JA 2L7UA 2O5NA 4QOKD 1FA4A 2XKUA 1IARB 1T1WA 1YHPA 4JRYB 4G1MB 2YKLL 4HSCX 4MSWB 2BRQA 3MROB 3O2VH 2L4OA 4HK3N 4TVPE 4L1DA 2BSRA 1CD1A 2YJQA 1JF1A 2JF1A 2NY4D 3CFKA 1G94A 3KW7A 4RMUA 4J3VA 1SQMA 3J27A 4K3HA 2QV4A 1XEUA 1JZHA 2FX7H 2JKWA 1J1PH 5EU4B 3BHBA 2ZAIA 4ZFZA 5BUGA 4DKDC 5ES4B 1AR1C 1CVSC 2O1AA 3C5JB 4HYTB 1TMCB 1P6AB 2OSXA 3GGWA 2G4GA 2RQEA 3KXFA 2DQFB 4Z7OB 2J73A 4JN2A 1RH8A 2BWIA 4FTVD 4IU2B 2RTTA 5DJDA 2IMNA 3EO0A 2OMTA 2YAMA 4PJCA 4L8CB 4KWUA 4UV7H 1G6RH 3AVEA 3MV8D 2YIHA 2EVFA 4Z8FL 2Z31A 4NI3A 4WI2A 3TO4B 4BH8A 3OPZL 4OCMC 2LGNA 1QWUA 2Q76A 1VERA 4IOFD 4JFWA 3TVMA 2EH7L 1MLBA 2GBTA 4FABL 1I8IA 4N0UA 1JWUA 1W91A 2SEBB 4AYBA 1J1XH 3IGAB 5KBDA 4OBSA 4HWBL 1HNGA 1TJHL 4GRWF 3U6XS 3VCLB 5T3ZL 1T6WA 4GAFB 4LXFA 4M5TA 5D4IA 3NZ8B 1FV1A 2L8AA 3FF8A 4MVBD 4E9RA 4MX7A 3QJTB 2AANA 5MEOB 2WVVA 3LN5B 5A6IA 1WISA 3ETTA 5CZVH 4HS8L 4JM2B 3NSDA 3NPSB 4XAKE 3MOAL 4L9LB 2R0KL 4F33A 1UENA 3WEBA 1UZ8A 3S48A 5MEND 5CP7B 3HC3L 5F1KC 4NM8H 2WCGA 4JDVB 4LARL 3S96A 1NBQA 1XAKA 3H9SE 2VDPH 2X6MA 4M1DH 4P9HH 4V1DE 1IE5A 2XWTB 5F9AC 4AGOA 4ES9A 4XOCA 5CZRA 4Z7VA 2RQ8A 4HGWB 2IH1A 2PW1A 1I7TB 2ADYA 3TASA 3N44F 2PLTA 3WFDL 3V7AE 5K9JH 1AGDA 5KW9H 4LBEB 4NN7B 3T1FA 4LLUA 1U0QA 3D25A 5FO9B 1BG9A 5KSBF 4P4KB 3DHMA 2GYSA 5H94A 1XF2B 4P2QD 4QHMA 1S2EA 1ZSDB 4NKIL 3C08H 4QHLB 5AOLA 3PHQA 5FM5O 1CBVL 4A7UA 3PDGA 2FBOJ 4X5WB 3LMJL 1BPVA 4W9JC 4RZKA 2F61A 1WVZA 3BAYA 3UZVB 1P5VA 3ZQ9A 4MBOA 3DRQA 4XMPH 5IB5B 3QRGL 4OFYA 3BAEH 4Z1PA 4AKOA 5C97A 4FFZL 4KROC 4MJID 1ONQA 1K5WA 5FCUL 1MCEA 4DOHE 4Y1AD 4KXBA 3WNOA 2NPLX 3A6OA 4NENB 3EFFA 4OCSH 4J6RH 5I8OH 4OLWH 3KDMA 4L4TE 4R7XA 4OIAA 5M95B 4I0PC 3LKSA 5IROA 5AAWA 1RD6A 3L1OH 4L0PB 4QWWC 3CLFL 2ZUWA 3OHXA 4XVSH 2AKRB 1NC4B 2QQQA 3LIZL 5GGQL 5LBVA 1PZ5B 5DJZA 3RIFK 1VB9A 2NZ1A 2JCCB 1PY4A 5F0PB 4WFFE 5F1IB 4TVSa 5T5NG 4LSTH 4G6KL 5EFIA 4ZFQA 2VN5A 3RNKA 1KGIA 2E7DA 2CM6A 2IQ9L 3PNWB 1NEPA 5AOMA 3RKDC 1KB3A 2XICA 2R23B 1LDPH 4N2OA 3WDIA 1DVTA 2JB5L 2VQ1B 2VMDA 3MBED 1UOWA 3EUDA 2VDLB 1CFMA 4M03A 2NY7L 3FHEA 1RP9A 4KHXH 2DMGA 5KVMC 1E3ZA 4XNMB 5I9QC 1OKEA 4PTUA 4XVTL 4WW2A 3X12A 2ZOUA 4HIJB 2E9WA 2ZKWA 2W92A 3N43F 4E36A 3IJHA 4YDIL 5JA9A 1RZ7L 4TVUA 5LCVH 5DUPL 5EBMB 4K94C 4MAUL 1J8KA 4BSWA 4DP6X 2J43A 4MD4B 4UUJA 5INCB 1G0DA 3LPWA 3L3GB 4P2OA 1E28A 5HI4D 3B7RL 3QDHA 3TT3H 3QAQA 3SCMD 4WW1A 1F4HA 2FHBA 4H88H 4OCXL 5KN5B 1JHLH 4GAAA 4IRJB 4CN6A 5DRWA 1HCFX 5CCHE 2P7TB 4F58H 4OLXL 4RMSA 2WNXA 4JDEB 3WJMA 3WTVA 3CQFA 5BVJA 1OWRM 1IGFL 1IM3B 3PWVA 2ZOKB 1RERA 4XO9A 2YARA 3SDDA 1G4RA 4E41B 1NOLA 1VENA 2CR3A 3ZUCA 3EXJA 2OP4H 5I71C 5I5RA 5J12B 5DRXA 5E6ID 2YMXL 4GI8A 4P99A 1MH5A 3VXMA 3RL2B 1S7SA 4J23A 4EUPA 1MRCH 2P42B 4H8HA 3GBML 2KZWA 4O2EB 4L0YA 1TTGA 4YXKH 1X44A 2XG4B 3MA9L 3HC2A 2EECA 1LM8V 2BHZA 2QLVB 1NCGA 4FTDA 5F6HJ 1BCIA 3T04D 1U9KA 1NAKH 4NUMA 5I1JH 3MV9A 1FH2A 3BH9A 4JRXD 4JFUA 4RFOH 4HIXH 4DP5X 1RURH 1Q8MA 2ADIA 2WXNA 4ZXBC 1WC7B 5KYNA 4PJXB 1RHHA 4CBPA 2HKFH 3VI4E 3RIFF 5T1LB 2I9TB 3GLAA 4R9HA 2HFTA 5ADPH 1UD4A 1RZKH 4IKLA 4BZ1A 1U95A 3DVIA 3D4CA 3C8DA 4U1SB 4GUOA 1Z5LB 4HX1B 3BWUC 3U2JA 5KSAA 3C60D 1BZ7B 2R2EA 2X4TB 3V9CA 2CO6A 3EDEA 1PAZA 2PYEA 3FT3A 3TO4C 4OFKA 3KLQA 1AZRA 4YXLH 1U21A 4TKWA 1XGQA 3UAJA 1QPPA 3EYFA 3WTXA 3BEWA 1LGVA 2P28B 3ARFD 4HHAB 4IRZH 1FCGA 4PJHE 2W65A 3N85L 1L0PA 4P5SA 1NLBL 1R0AL 4HKBB 3K81A 1SOKA 2OCCB 4Q6YA 5F9OH 4UTCA 3U7YH 4Y5VB 4M6MH 1CICD 2NY1D 3OMZA 1JZEA 4HZAA 4IBTA 1ZY9A 3PPEA 5C0DA 3V5KA 1OGSA 1IC1A 2QHRH 3Q1SL 3WIFA 2XXFA 3CSGA 3ILPA 2CJUL 3CSYB 1CB4A 2W59A 3KPOA 4GRWH 1OSZB 1SY6A 2YWZA 1QSED 1W8NA 5A1AA 2FRGP 3P11L 1HL8A 5LQBL 2PCXA 1R19A 4K3JH 1CFTA 4TTDD 4HZ1A 4GYBA 1YNTA 4I7ZC 2NUTA 1ORQA 4JVUA 4U6TA 4ZAKD 2JJTC 5SWSA 1OAKH 4NO0B 4JKKA 1FHGA 5CJOH 1FH5L 2OK0L 4BZYA 3KVDD 4GRMA 3I9PA 4NBZB 4NN7C 4PRBA 1IFRA 2NY4B 4UM9A 4P05A 3WY4A 3NIFE 3R1GL 4DAGH 4R4FH 1KLGA 1KBGL 1VFAA 1X6LA 3QPXL 3GMQB 2GSGB 1S46A 2WVUA 1LYQA 4RMWA 2RCSH 3NRFA 5AYQA 3RVTD 5E9DA 3IVKA 1N5YL 2FIRT 1TQTA 1KBWA 1S4IA 4MNGB 1SF5A 4J28A 4FNUA 2C9SA 2AEQH 3ZMEA 4N2KA 4NKOB 3RX8A 3FT0A 4N20A 4ZMAT 2WINA 4FTVB 2RJMA 2GC7C 3GMOA 2A6JA 1ID5I 4GG8B 3IDMB 5HYQB 1CK0H 2KQMA 4F7MA 2OMZB 3Q3GB 3STZB 1H6FA 4X0KA 4YUEH 3WS6C 1EEZA 3WFZA 1N0XH 4OF0A 4A55A 3GTNA 3T4YA 5IOPA 1HZHL 1ZVNA 5D1ZD 1KMGA 2F7OA 4FXKB 3T6XA 3VDAA 4EVNB 1TDQA 3PHOB 5I1IH 4F20A 3M8OL 1HH9A 4EDXB 7PCYA 2BIHA 2FIKB 4ODVH 3UIYA 4PRAA 1PW3A 1WHOA 4HLZG 1FNEA 4PJ9A 1E0OB 2ICWB 1F1DA 4FL4C 4EDWH 3H9HA 3TBBA 5DDHB 1LO3L 2YPLB 4XBPA 2VDNH 4F57H 5J5EA 2EDMA 3WFHB 2QZ5A 5SV3A 4BFGA 1N8OE 1ACXA 3FOMB 1N8ZA 3PP4H 4G8EB 3FFCD 4L3ED 4I3GA 4NGHH 4UT9A 3UO8B 3FN9A 5HYJB 5HHOD 2IWFA 2CALA 4G72B 4HIHB 1LO4H 1TO5A 4NRYA 2CK2A 3QI9D 4IBZA 3EFDH 5MENB 3SDCA 3O41A 1EPFA 4A7TA 3D2UB 4M4PA 5KSVB 1KGCD 1BW8A 2YLKA 3PWUB 1CFQB 4MYPA 43CAA 2XV6B 4CGUB 5I6MA 3KVQA 1TCRA 4ZUWB 4AM0A 1IIKA 2H32B 3KAAA 3ZJAA 2A2QT 3JUZA 5BCAA 2GAZA 4NC2B 3DSFL 3GSNA 3BZ5A 2Y5TB 1UACH 3EAKA 4N1HB 1F58H 2PTTB 3PWPB 4JO1L 3H9SA 1MJ7L 4P2QB 4IRJC 2VXUL 1OLZA 4OGZA 3TS8A 2GK0B 3TFBA 5JXED 1DFBL 1SYSA 4JKNA 3GLZA 3WN5A 4HK3J 4ZTEA 1TYJA 2K4AA 5JR1H 1CXFA 1D9KC 1XSJA 3CWGA 6PAZA 1NMAH 3AREB 3EXLA 3F00A 1FFOB 1BGXH 2AQ3A 3NDZE 3BAIA 5ACLA 1XZ0B 5J12C 4AQAB 2C3HA 1SHSA 4G5ZH 5CP3H 1UM5H 3GO1H 3KGSA 4Y1AB 2B7DT 5IUCA 1U8CB 1UURA 5CLWA 5KYWB 1I7ZA 2O5YL 3B1TA 1SHXA 4ZK8A 1T89A 2QR0A 5DUJA 1NDGA 3CDCA 2IFGA 3UP6A 1YPZA 4PLJC 2Y24A 2DWDA 3JTTB 4DKAA 1EJFA 2OCFD 3FH5A 1E90A 4YSSA 4OZHF 1J05A 4RCAA 3C6LC 2GEQA 5D7HA 1GGTA 2X0WA 1R47A 4D0CB 2HA1A 3PXHA 1RK0B 2XQYK 3IPBA 3DHPA 1QRND 2R69L 2Y5EA 4CVZA 2Y7SA 3ESVF 4M3JA 3RY6A 2EP6A 4LCCC 3GZOA 5LNDA 3NA9L 4G42B 5GS0C 5J13B 1H8OA 1KCUH 3QDME 5GSVA 5DWPA 3QDGD 3DUUA 4ZQKA 2EVJA 3FO9B 4CVUA 1UD6A 1LO0H 2VQ4A 3D4YA 1L0XA 4FGMA 2L0DA 1K4DB 3NEXA 1I8KB 4JAMA 3N50A 2YRLA 4F37K 4JO3L 4XC3H 2Z92B 4U6VH 1KZQA 2LT9A 4KRNA 4KQ4L 1PZUB 1QOKA 3O6FC 1H15B 1NGYA 1LXMA 5EO0B 4ZSOE 5D2LB 2AQ2A 1EHLL 4JPKH 1PG7W 4K0OA 3ARSA 5HYIA 3S5LG 3HJEA 3HRZC 1UT2A 5CN3A 2IPUG 1J12A 3WE6B 2YD2A 3B3IA 4P3DB 3U9WA 3IU3B 3BT0A 4HUUA 4BHUA 3HZKB 4KFMA 4TLKA 5AUMB 3U7WH 3VSQA 3VSTA 3NGBC 4KPHL 2VZ1A 2QSQA 2VR7A 2J21A 1MDAA 1J88A 3V10A 5FGBA 2B2XH 4Y89A 4PMEA 4DGVH 3IDIA 4TQ8A 4FLOA 4PB0H 3V4LA 3GIZL 4X99A 2JXMA 3ARBD 2FLMA 5I0YA 3OKLB 1YDPB 1N10A 2XWJB 2K78A 3ATDA 3MPCA 4HWZB 4M8VA 4PHXA 4DGIH 4S0HA 5AW9B 5I1GH 2IWGA 3NCWA 3CLEH 2F2HA 1KWGA 3O3EA 5CINL 1KC5L 5DLML 5JMRA 4UILH 1R75A 3D06A 4N0FA 2UZXA 1K8IA 4WFGE 2NY4C 2ZCZA 2QL1A 1RLWA 2ENQA 4JRXB 4LLMA 4GINA 4LLYA 5EBLA 5AZEL 5K1NA 2H3NA 3K71B 1VDGA 3B8SA 3OKNB 1P4IH 3ZDYF 3BLPX 4XI5D 2BNQD 3VH8G 4NWTL 3IWUA 5C8JA 1SM3H 5D5MA 5K69A 3KPRD 2XTLA 5GRWA 4Z7AA 1AGFA 3W0WD 4KUCD 3QR0A 3MJ7B 1AHMA 3RWDB 1BJ1J 4PRNB 1ODAA 3I02B 1GY1A 4DKEH 2R29H 3ZHLA 3W9DB 2B3RA 3G08A 2VDRL 3RWEA 4H5SB 2Q3AA 1YY8A 4V11A 2CNZA 1FNSH 5ETUA 3MU3A 1QVOA 43C9A 3IJ9A 4IOFC 2PCFB 5DT1L 4EF3A 4BSJA 3PDOB 4F37F 5E23A 5GS2H 1BZ9B 2V2TB 2YKLH 2CUHA 2BIMA 2NW2A 1KZYA 3FT9A 3OZ9L 4JFFA 2BDNL 2BS8A 4B97A 1LE9A 4O9HL 2NOYA 2F1BA 2ZQKA 4OKVA 1YSOA 1RV6X 3FU7A 1AIFA 1MIEL 5E2WL 3MRKB 1PG7X 2FGWH 1B3JA 2EAEA 1CICB 2NY1B 3MMEB 1F5WA 4U2YA 5F7AA 5CSZB 2EDYA 3SY0A 1F56A 2KERA 4R83A 4MVBC 3DIFB 1DVFD 4K3GA 2IADB 3MNWA 3TBSB 1W0YT 1QSEB 4NN6C 1GS8A 5MEPB 5F9JB 2JVUA 3W5MA 4NO2A 2DJ4A 2YEZB 1MCSA 2XT1B 3LNEA 5A2AA 3V0AC 4MQTB 4QRRD 3KEHA 4Z7WE 4ZAKB 3EHBB 1Y6MR 4HXAH 2LE9A 3QAZB 4PGCB 3VI3B 4UYPA 5C0AE 4G9FE 3AU1B 3ALPA 5FFLA 3M1CA 5C09D 5I8KL 1LNUA 1ET5A 4Z8FH 1NFDB 2F53B 3MKKA 2GT9B 3DMMA 4CAGA 3OPZH 3HAEG 4OZ4B 1INEL 4MXWL 4N9GB 4U6XB 2CHDA 1DSWA 2KMWA 2EH7H 4LKCB 3UROR 5ICXB 3KHQA 2OTWA 3BSZA 3EOAA 3V4VB 4FABH 1KENL 1T83C 5HJ3A 5EORH 4KAQH 1HL5A 4HJIA 3K7UA 1HWWA 1CS6A 2XWZA 3UADA 3X14A 4PRPD 1GR7A 3WFBH 2O6DA 4HWBH 3LN4B 2ISDA 5F6IC 2NX5D 1FL5B 4XBEL 1NGXB 4MFHA 3FAXA 2DQ6A 1N5AA 4FLRA 1Q9WA 4X6FA 2R15A 3MUUA 4EIGB 1CYWA 3IJYA 4HS8H 5HHNB 3U4BL 2W94A 4HXBL 1M71B 3MOAH 1XCXA 2R0KH 1NCTA 3WHE0 3HC3H 3CH1A 4LARH 4ZZKA 2VDPB 3P77B 2K0RA 3CDGB 5CD5D 1Q9KB 3U1SL 4WWPA 3TIDB 3IFLH 1S7VB 2UXTA 5EMYA 3ZXAC 3BLKA 3WFDH 2XXCB 3S6CA 3O4LE 4A04A 4HIIB 1JN6A 3FUNA 1THAA 2DLIA 2I85A 3FCSB 3IN0A 3V0WL 4ORGB 1ZXQA 3P4OB 5AW3B 3FFCB 4NCC2 4NJAL 2P8PB 5D1QE 3VM7A 2K3TA 1CBVH 3AQYA 3LMJH 3MBEC 5T33L 4GB9A 4WNJA 2GIMA 2FECI 1S7RA 2D0FA 4PS8A 5LLIC 2XWRA 3S3PA 12E8L 5C0GB 4NOFA 2DS4A 4FMKA 3QRGH 4XMKH 2GHWB 4JZJC 3ZSTA 4FFZH 2ALWA 5L6YL 2QKIB 2A9CA 4J3OH 3D0LB 2I9LB 4Y4KA 3MR9A 2AZAA 3MLPA 3T0DA 3BD3A 2E7BA 4NKQB 2DQTL 3V0VB 3E6FB 5LXGL 1RI8A 5HI4C 1QI5A 3BN9D 2IAMB 4NEHB 1XGPA 1FVDA 3I6LE 4NB7A 1QSZA 3SCMC 3CSBA 5DJ0B 1UB6A 1YMME 2OI9B 3CLFH 4IGBD 1WTLA 1QSFA 3LIZH 1YA5A 1WEJL 3BIKB 5E7FA 4NQEE 5GGQH 3ZZ1A 4NUGL 5DC4B 4X7FC 2AFNA 1QO3A 3EUUA 3QIUB 4WDIA 3SQOH 2WUBL 4WI6A 2YLHA 4PG2C 1KBVA 4H8VA 4W4OA 5PAZA 3EJSA 1DCEA 5E6IC 5AVXB 3OR7A 1HJCA 2IQ9H 2MCG1 5CFHA 1KFGA 3HZVB 2X9ZA 4C4BA 2E27L 2I7SA 3OMIB 2UXFA 4AJYV 5FECA 5AW0B 4KZDL 3FQRA 4WU5A 3ZKND 5AVZB 4CU7A 2VRKA 2JB5H 2E4FA 4IDLA 4ZFFA 2YAHA 3H56A 2G5UA 2M83A 3LB6D 5F88B 4XBMA 3DOSB 2OAAA 4UTBH 2NY7H 2W1NA 4JFED 4Z7UA 1KIUA 3ESNA 3G5ZB 3STLA 4AYEC 1D5MB