2CGZA

Structure of helix pomatia agglutinin with tn antigen
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ
publication title Structural Basis for Recognition of Breast and Colon Cancer Epitopes Tn Antigen and Forssman Disaccharide by Helix Pomatia Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cgzA00
4Q56A 3WMPA 2W94A 2VMDA 2WN3A 2VM9A 2CGZA 2VMCA 2CGYA 2W95A 2CCVA 2WN2A 2CE6A 2VMEA 3WMQA
chains in the Genus database with same CATH superfamily
1BX2A 3GKWH 3WEOA 4PJXA 4G6AC 5F70A 2M8XA 1E3FA 3BAKA 4PREA 1LHZA 2G5RA 1GYUA 1IC7L 4QJ3B 4F8QA 4HWZA 5HPOA 2QVIA 2FWOA 3KCPB 1VLXA 4NKMA 3SCMB 3TFKD 5IQ9B 3N40P 3JTTB 5I1EH 5CP7B 3OMAB 5CJ5A 5D7EA 4ZTOL 3DXAD 4D0CB 1T1ZB 2UZYB 3TO2A 2DLFL 3GXNA 3Q6GL 4NZDA 5HVFB 4OB5L 5C09A 1WZMA 3FFCA 4HG4K 3ME0B 3GIZL 2PABA 2XCMC 2DWSA 4N68A 4FA6A 3RWCA 3NBNA 4DNLA 1NGWA 5E1GA 3K71B 4JDVB 4G6ML 4G43B 2WLZA 4QTHA 1I1YB 4Y7MA 2J73A 3T0WA 4MB5A 4UNTA 4HIHB 5JIIA 1GC1H 2ARJA 2X4NB 2ZKHL 5HVWA 4TVPD 4TN9A 3AWEA 2JKJA 4A6YH 2J6EA 2IBGA 3BKCH 4GXFA 1MCRA 2VOTA 3LH9A 4TPRH 4DT2A 4U3XA 4YHKL 3ZZ1A 2B9AA 2J2ZB 5T33L 1U3YA 4H20H 4GRWE 3OBAA 1VENA 5L9DL 3OJVC 4MA3B 2QMJA 1IX2A 5DLML 1W0WA 1DBKH 1QX1A 4XPBL 5HTSA 5GZOC 3V9FA 1OF0A 3O3BA 3GRGA 3QNYB 4M7LL 1R9FA 4MQXC 2OMTA 4HHAB 3DHUA 2J21A 3UTQA 4XP4L 4RH4A 2R1YA 3OAYK 3HB3B 1MRCL 2TSBA 1FZMB 2WC7A 1G0DA 1AGFB 1HU8A 2P3YA 2Q7AA 1O6TA 3BE1H 3FF7A 5J3HC 3T6XA 3C6SB 1JIBA 4RWHA 3KYMB 4TXVB 1IBGH 2XLLA 2Y5EA 1NUDA 3Q1SH 4X4YA 3VXMB 2BVOB 3GSRA 3LEYH 4WU5B 1CGYA 2PXYB 2CJUL 4KVNL 1A3LL 4YBLC 1OAQH 3C60B 32C2A 4E68A 1SYSA 5DK0B 4NLAA 5IQLA 4YLQT 1OAZL 3QDGD 4TM9A 4BDVA 3VFTA 3VGEA 2IIJA 5HP5A 1PKOA 3QYMA 1EZLA 2XKNA 5EU5B 4AH2A 4ZMXA 3X1EA 5KVFH 4JL1A 4HIXH 1F02I 5ICXB 4NPKA 3N06B 4TUJB 2JELL 3SDCD 3MOQA 4P23C 2WQAA 4JO8A 1XWVA 2WSDA 4MQXD 3RE0A 1IEHA 4PWJA 2OKMA 4KV5F 2YPVL 4WJ5B 2UUDK 2PPEA 2QDWA 3LKSA 4OFVA 4UOQA 5D7LE 3TPUB 3VGFA 5DJ0A 4KH9A 5J3HD 1G6RB 4YIQA 4M93B 4HS8H 4ZOEA 1AO7D 3X1GA 1ZPLA 5MEPB 2KQNA 1A7NL 5EO1B 1RJYA 1RU9L 2LOEA 3EGSA 2MFNA 5TTRA 4BXSV 1KXQE 4CNIA 2ORBH 5CN1A 2H26A 1U92A 3CH1A 4A6YA 3BKJL 2FGWH 3LXBA 5C0IA 3ARFC 3FTUA 3IDYC 4M3KB 3UYRH 2PW2B 5KSAA 2ZUTA 1XB8A 4JNXA 1FO0A 1KB5A 2VERA 3ZDXE 2VDNB 2BZ7A 4K71C 3MREA 1EGJL 4W6YB 3IFOA 3J7HA 1KUMA 2BNQD 5DO8A 1E7VA 4TSCL 3P73B 3IMUA 3WXVH 2FJFB 2DYPD 2ZSVA 2DWEB 2OTWB 3U6XS 5LXGL 3BPNB 4PLKC 3ATBA 3V4UH 1XDTT 3AGWA 2WAHA 1C12B 4P23D 5B39G 4DFIA 1A8ZA 1N5AB 3NPSC 4G6FB 4F2FA 4ZTPL 3GLEA 3CPUA 5K1JA 1N6QL 4ZQKB 5FUZH 2E76C 5CFAA 4DZBA 1JZGA 4OCNC 4XNBA 4YJZL 1QWUA 4IGBA 4OSUH 4WDIA 2VJ0A 3U9PL 5CUSL 5BJTA 2E56A 1F1GA 4HEMA 3WNOA 2NTSP 1IBFA 2FGZA 1KEMH 2Z3FA 3D2UD 1T0NB 1P4LB 3GSNL 1RUPL 3EAKA 4HIPA 3SJVD 5LO7A 2A4ZA 3U30C 2D03L 3VXPB 1JPFB 2JQMA 4G80A 3PAZA 3Q7JA 2IPKB 1G1OA 3ARFD 1DVFA 3MLZL 4Q4EA 1XL6A 1I8KA 4PI2A 1Q38A 2EUWA 2O26U 3TV3L 2QADC 2GJZB 3QO1A 1PY4A 2BERA 4LBEA 3MKGA 3UZVB 5F7YC 1JYVA 3ILPA 1MHCB 2E4FA 1MLCB 5BW7A 4HKJA 4XPTH 2Z4QA 1XGYL 2ESVA 4PLKD 4J8RA 3ABKB 1Y6MR 4KUCD 3ISWA 1ZA3B 2JF1A 4Z7WA 4LSRH 2F5BH 2GFBA 1IKOP 1J05A 2XPYA 3EJRA 3GRWH 4NS0A 4G9DB 4H8VA 5D1QA 1EEZB 1F4AA 1U8NB 3CX2A 3Q9QA 5IK3B 5IJVB 4GB9A 4IIQC 4LAQH 4WO4A 2ITDA 5A2JH 5J9PB 3R19A 3MUUA 4JEGB 4TNGA 2LLNA 3GLDA 3WKQA 4DESA 2LFEA 3F64A 4L9LA 3G3LA 1LEGA 3QG6B 1G84A 4QY8A 3D3VA 5AKTA 1RZJC 3C75A 2BY3A 5IHLB 4IRSA 4DP8X 5JIDA 4N2OA 4BCZA 4YHLL 3DX6A 1BGXL 2RMNA 3BEVA 3IFPA 5DGQA 4JDZB 4PRIB 3UGXA 4FHKA 4X99B 3X11B 1FAIL 4FQIL 2IH3A 2QADD 3H9SD 4HBCL 5EOQL 3PV6B 4WWKA 1QABA 2BOCB 4OY9A 3KJ4B 3QS3A 4D3CH 4LL1A 3BMWA 1AFVL 2BP0B 4QRQA 3QFJD 2ZUYA 1UM6L 3HRZB 2FUTA 3FB7B 1TVHB 4PJIF 5C07D 3MLWH 5A2KH 3WIHH 1CBVL 1FL6B 1PEZA 1PLBA 5D5ME 1I1RA 4AMXA 1B4JL 3FO1B 4ILDA 4UT9H 1HCFX 3VD4A 2DQHH 4PJ7E 1OCWL 2ADIA 1E2WA 4JM2C 3HNTH 2Q10A 4M61A 1JP5A 1ZA6B 3RFZC 4R8WH 5HHXL 4X5XA 1JF1B 2ILLA 3M7OA 5F1NB 2FLMA 2OSXA 1QFOA 1WEJL 3FU8A 4WFHD 5J0BA 1NFDB 1MF2H 4XPGH 2CH8A 4DKTA 3POCA 3OSVA 4OBSA 5LAPA 5BRZD 3IS1X 1G9HA 5JIQA 2YPKA 1N4XL 3GMMA 5E00A 1OTUC 3QUML 3F3HA 2HH0H 5G5DB 2W9LA 2OXGB 2AK1L 3T4YB 5DTFA 4EI5C 4FQXC 3C8KB 3U7YL 2OZNA 3LZPA 5LBVA 3T2PA 5H35B 4O4YH 1MNUL 3ARRA 4BKTC 1A9VA 3T0EE 4HZAA 4LSTL 1QASA 1DJSA 1IM9A 3JBG7 4IKIA 3VU2A 1QRKA 2DBJA 2VCOA 3D4CA 2XYCA 3GI8L 4P5TD 4XBEH 5D1XC 1ETJA 5IQOA 4L4VA 4YX2H 5FO7B 4ZAKA 3BGFB 3U46B 3U4BL 4ZO9A 3JXAA 1WT5A 5CHNA 1H3WM 3V4LA 2A83B 4WV1C 4Y9CA 5D72L 3KYOB 4OI9A 4FNLH 4S1QH 5E1AB 3PAYA 4TMPA 2CU9A 4PD4J 4JM2D 5L6YL 2X9WA 4LRIA 1PSKL 1XMEB 4L4TE 4K9EC 2GI0A 5GS1C 3W1ZA 5SWZA 3FO2B 4JJ5B 1P1ZB 3AUVA 2ZYSA 4WNSA 1LDPL 4E9YA 4YO0B 3N1MC 1M6UA 2YPLD 4XP5H 1GPOL 5C9KA 3HJEA 4KVPA 2WQSA 3BEWA 3QUKB 1F56A 1Q90A 2FATL 2LU3A 4IHBA 2WW8A 4LVNC 3UGUA 1OTUD 4HIJB 2HG5B 5GJTH 3RIFF 4E42A 5DQJB 4EI5D 5EF2A 1AXTH 1Z9NA 4FQXD 4YZFE 3NIDE 5GSRA 3WLWC 3GI9L 1O9VA 3L3HB 4NXSA 1X5ZA 4P48A 4JMXA 2ED6A 4N22A 1R5VB 2XIIA 5JOEA 3PXLA 4DGVL 1RULL 2WXNA 3GNML 3Q8BA 5D1XD 5EOTB 4ZUSA 3TA3B 1CLCA 3S34H 3WIHA 1YEFH 5EU7E 5KVDH 2I25N 2DF3A 4AVJA 1VKXA 1S8DA 5EUOA 4L5FL 5HHME 4UT9A 1XB6A 2X0WA 4R3SA 4Y2DB 3HNSL 2X6VA 4H0LC 2OA9A 3HG4A 4DW2L 1BZQK 4OGYH 4JB9L 2EQDA 3ZQXA 1G6RH 3EDEA 5I17A 3O3DB 1X7QA 3FRPB 4WFGD 5SWSB 4KGJA 5GGSY 3SKOA 3I84A 1UA6L 3MNVA 3AJ7A 3UPRB 3H6JA 1RK1A 3L5XL 1C1EH 4Q2ZA 3O41A 2AP2A 4AEIH 5FFLA 2ZOLB 1UGKA 3O45A 4YPJA 1V7NH 3CLEH 4IBTA 3D52A 4LLQA 2GSGA 3BXNB 3WLWD 4PRPB 5IOPB 4NZFA 1E4KA 3T1WA 4BFEA 3LH2H 2LU4A 2OSLA 3UG5A 5GHWH 1EHAA 4XMLH 4U1KB 1S7XA 1FN4A 1DUZA 4CJ0A 2ERJB 1EX0A 4JQVA 4L29A 5DXWA 3VJ6B 3P11L 5CJOL 1EO8H 3S4SG 2XWCA 2E4TA 3APNA 3DI2B 1R24A 3DPBA 3SBRA 3BDBA 2GEQA 3AS1A 4WAFA 1KYOJ 1P4IL 2HVKB 1JZ4A 1MRFH 4WKXA 3CN4A 2BW4A 2Y2WA 3LNEA 3VFUB 4EI6A 1ESOA 3PGCA 1PNCA 2ENSA 1I9EA 1RZ7L 4C56D 4N85A 5I16B 1I1CA 4ZS7H 2WOBA 2RACA 3Q2NA 4N0CC 4KAQL 3X2QB 1IAII 2XWEA 3RZCC 1H0DB 5D2LA 1DEDA 5FHBL 2NNFA 4M6OL 1FG2A 4JFZL 4Z7OF 3VFPB 4LHUA 4GW1A 5I9QC 4HIIB 1RL1A 2YUVA 2OTUA 4UM9A 1HHKB 2AJXH 3WFHA 4J6RH 3VI3B 2BSRA 3HG1A 5HHNB 4ZSOA 4LEBA 1RUQH 1YEHH 1ZPUA 3N42F 3FZUC 2PKDA 2UWEF 4KXZH 2FO4A 4IDJL 1QQDB 4L8SC 3LYRA 3N1QC 4P2RB 1EAPB 4XMTA 1GJIA 4RVBA 4AGMA 3Q6FA 5DUBA 2VMEA 4ZTOH 2WV3A 4YWGH 2C4XA 3GBML 3T4AC 1CD8A 4MAYC 3G04A 3NCFB 4QR7A 2FJGB 3QHFL 3VFGL 1OSPL 3BKML 3TESA 4S2SB 3APCA 5HJGA 3EDFA 4OZHF 1T0PB 2R0KH 2G9HB 4R7DB 3S3JA 2H41A 4R7XA 4AM0B 4G8AC 2JJWA 1DJYA 2ATKA 3SQOH 3RL2B 5MHSE 4XOEA 5B22A 1U6AL 3F7RA 3BZ4B 1MFCH 5BVJB 3RZCD 5DHVA 3QUMB 1KCSL 3AREC 3G08A 3D5OF 3PWVB 1J0IA 4GSQA 1NDTA 5HGAA 1JWMA 2IWFA 1V5JA 5E8PB 4A2MA 1MZYA 3EGDA 1RZKH 1UB6B 2G2PA 5L9DH 3N85L 2Q8BL 3VWJB 1CLVA 3FZUD 3U0PA 4AQAB 3C6LB 1A02N 3UJJH 5EV7A 1MIMH 4AG4H 3LD8C 2Y7LA 3ZDYB 4XN1A 2G60L 1G9EA 5AVQB 2P5WD 3MRFA 3E2HB 5DJ8A 3FUEA 3AS3A 1I1AA 3KPSA 2QHLA 3VI4A 5GSVB 3NZ8B 2ITEA 4BGLA 1X4XA 4F7EB 1SJEB 3GGWA 4XP4H 4MAYD 5IF0A 2YAQA 4LLVA 3GSVB 4UDUA 5EPMB 5CD3A 2OL3A 3GLZA 4FZ8L 5C0CD 3Q8AA 5DUPL 3ESUF 3GBNH 1QUNA 3TIDA 1NPNA 3BP5B 1G0YR 4LL4A 2AZUA 2UYLA 3MLVH 1XCXA 2CJUH 1A3LH 2WKOF 5C7XL 4ORGA 2AJYH 2NY2B 2CO2A 4L18A 2VZUA 1IEAB 3ARED 4F5CE 4TQPA 3VXRD 4OI7A 2ZX8A 3C8DA 5C0EB 5EEWA 3BC9A 1FNGB 1ZHLB 4TNVF 3DX4A 3V9CA 1W72L 2Q8AL 1TQVA 4PJBF 4E2OA 2IGFH 2B7DT 3FFDA 3RX7A 3NCEB 2BSEA 3RNQB 3D0AA 2VWEC 4QT5A 5IMOA 1TDQA 2UVFA 3ZR6A 3CFIC 4FN0A 3GSOB 4YHOL 3DUSB 2GG1A 2OJ1A 5CILH 4NOFA 5EU4B 5IHUH 4IS6B 2HA1A 5DZPA 1LO2L 2YPVH 1QPXA 1WC7B 4FHBD 1QTPA 3LV3B 1QSFE 1IQDB 2KL6A 1H5BC 2LLGA 2OYMA 3KNBA 3BPOB 4OAWA 1X9QA 3TVMC 1EFXA 4G42A 4MQ7B 2LVCA 1RU9H 3RX8A 4PSRA 3ML9A 3QUXB 2L7QA 4XODA 3HN3A 4QXUL 5DD6A 5I0VA 3FB5A 5L2JB 2EIEA 4ELMA 5LUMA 4RQQB 4HUVA 1U93B 4AQ1C 2IH9A 1V27A 1KJMB 1QEWB 3MGTA 3Q2WA 5E4AA 4TNEA 1EGJH 2JB6A 2G75A 4Q56A 3EJZC 2DLHA 2NSQA 4BBWA 1IBYA 3QHZL 1FPTH 4J3WA 1HEHC 4PJGB 4JHVA 2AAVA 3OKMA 1G7JB 2AAAA 1F4WH 2C1OB 4K94L 5DD3L 3E9UA 1WAAF 3BP7B 3INUL 1DFXA 2O5XL 1MCSA 1IL1A 1G6VK 3CDCA 3IDMB 2W9DH 3FUFA 4GRMA 4BH8B 3QYCA 1EXUB 4Y4KA 3UZEC 4XXWC 1EDHA 4K3GA 1FC1A 2OJZH 2Q6WA 3HLKA 2AEOA 1T66D 3ARGC 1SQ2N 2XN0A 5EU6B 1CZ8L 3U4AA 4U1NB 4LPWA 2A6KA 1WFTA 5EIIB 3RZWA 3HUJE 4TQIA 3W0WA 3LRSA 5JW4N 3PP4H 2A1WH 1PCXA 5DJ2A 2Z92A 3EJYC 4PH8A 4HLEA 5ACLA 5IW1A 5JNYA 3RWEB 1HHJA 2K7QA 4ZO7A 4Y1SA 2YD7A 4HUNB 5C0GA 4S10A 3HAEB 1TG8A 2VR5A 5JOPD 3DGGB 2QR0A 4HUUB 2Y5QA 5EFIB 3B2MA 3QXVA 4X8JA 5FGBC 3V0AC 3G9AB 1VGKB 3WFEL 2VLKE 3KPMB 1PDKB 2BVPA 1S9WA 5AYUH 3GDCA 1ZSDB 4NPYA 3G6JB 4MAUL 3MV9D 1QACA 2OW7A 3MBEC 2CDEB 4CADB 1PZ2A 1L0QA 3C2AL 1SY6L 3GHEH 3TBWB 4G1EB 1Z1WA 5C0JA 5IM7B 1NKRA 2O5NA 4NLHA 5E6IC 3RJOA 3O4LB 3TNNB 1EZUA 4WGKA 5C3TA 1BP3B 3HS0C 5IBLC 5KYNA 1A7OL 3RB5A 1MOEA 4OLEA 3U4KA 1FBIH 3ESVF 1AI1L 3SE3C 3LZLA 4YHLH 2GIMA 2BWQA 4UIKL 3EJYD 4WWID 2V2TB 2BCKA 4G8GB 1TJIH 2XN9E 3SDDB 4AIXA 4LLWA 1BOYA 4Y88A 1Z5HA 4JO1L 2ARJQ 1HSAB 1MFAL 4Z7UA 3IDNA 2FYVA 4GP8B 3CZUB 3O0LA 4X9HA 1SXCA 3D05A 4YQXL 1FFNB 4J3UA 2XPZA 1M7DA 2Y1AA 3GDBA 4GQZA 5HYJA 3K5SA 4NKOA 4V1DB 2IAND 3EYVB 3D30A 2BS9A 2Q76B 3O3EA 3MCKA 4F9LC 1FIGL 3F7VB 4RA3A 1B4JH 2V3DA 1DTUA 5FA3B 3CHSA 3MBED 3IDJA 5DD5H 3RWHB 1GZQA 4U1MA 5HDBF 4AZ8A 1OCWH 2CNYA 1NL0L 4MRCA 3PHQA 4QHLB 1RUKH 4ONFL 4U7KA 2D0GA 3UIZA 1HYSC 3CGTA 5J1TC 4YE4L 3A24A 5E6ID 1QI3A 2NY1B 1HHHA 3K81A 3NZHL 1A66A 1NGZA 5E6UB 1P2CA 1S3KL 5B1JC 5IBLD 1M3JA 1MFVA 3CHXA 1H6FA 4X6DA 3OC5A 3DPDA 5AW9B 1G9NL 3CDGA 3QUMH 3U2IA 3PP3K 2AK1H 1W72B 1KPVB 3KYNB 1AHWB 2CHDA 1EWHA 5K1VA 1O7DE 3NRPA 1J8HA 1JNHB 4A7TA 4I0CC 2JXMB 5L7XL 5IMKA 4HJIA 4GMTH 8FABA 3LMJL 3VXME 5I8CB 5AD0B 1MI5D 3SKMB 1Z66A 1NANH 5DQDL 1IC5L 1NDGA 1JNJA 2MH4A 1K85A 1CFSA 1U8PA 1S7TA 3WFBH 3VSVA 4N2AA 4OVUA 4H13C 4MJID 4PJAA 3TJHC 3KPTA 3VRJB 2AJZA 1HXYA 3Q1EA 5HGDB 5DR5L 2R4RH 3SOBH 3VRLE 4F2MA 2FJHB 1UD3A 3P2DA 1E27B 1HYSD 3FH7A 2MNWA 4P07A 1XVSA 1G4MA 1GIGH 2A9CA 3E6HB 5JPNC 1LDPH 3KBHE 1IC4H 4OCYL 2H2SC 1DDTA 1F11A 2WINB 3PREA 3MVSA 1GPOH 5I6OA 1YMHB 3BH9A 2ZUQC 4BELD 3HEIB 3DVFA 1BBJB 2IGLA 3MRGA 3FUNA 4NEHB 3WJLC 3QIUB 2YC1A 5K69A 1IC0A 1IBBA 1N59B 1R3HB 2DAVA 2YGNA 4MX7B 3HMXA 4NIYE 1HHIB 5FO9B 4FMVA 1IU1A 4Q6IA 5TPWL 4Q9RH 2PO6C 4FKHA 2HKFH 5B38G 4PWIA 4RMUA 3VXSD 3ULVF 4DGVH 1JZJA 1I9JL 1NDMB 2CE6A 2HLFC 4AK2A 3BX7C 4ZPVA 1KLGA 5LBSA 2XA3A 4RAHA 2H9GA 2HN7A 1QVOA 4UOZA 1MCBA 5BZWB 4L1BA 5I0YA 2YD4A 2J8UA 1WBYB 2BNUB 4X9BA 3NH7L 4RGOH 4P5KA 3SE8H 3TJHD 4Z0BL 3UBFA 4A7UA 2NMSA 3W5NA 5HPMA 4R96A 4PJEF 1YNTA 2R59A 3LKNB 3MACH 2DH2A 2H32A 1JXGA 2YA0A 4AT6A 4F37K 3MR9A 3PWJA 3RDJA 4X80L 4PMFA 1IV8A 4P46C 1CFTA 1XIWC 2JIXA 2H2SD 5E23A 5C0RL 1D5IH 2XZQL 2ZOKB 1DO6A 4IMKA 1INDL 1KIRA 2Q86A 2ZXGA 3QRFM 1SEQH 2NY6C 1KIPA 4LGRB 3DJRA 1QLFB 5IJKA 1EHLL 4HP5A 4RX4D 2BIMA 2GBVA 2VLRA 4H26A 2R69L 1LO5A 5AOLA 3LQAH 5DD0L 5H37G 1AQHA 3M6DA 1NFIB 1FORH 1XGPA 3ZKNC 1IRAY 4GLRI 4NQDE 4DQOL 2GHWB 4GP5B 1AC6A 2WUBL 1XF5A 2RCSH 3MCYA 4R97B 2HLFD 3P11H 1E5ZA 4L4TD 5HXMA 2HT4C 3MLTB 4YR6B 1ZANL 2F15A 1E6OL 3O8XC 2OSWA 3AADB 5TD4A 5I15H 2CD0A 3HZMA 4G1MA 4N2FA 5DU7A 1KENH 4FFYH 1YYLL 3VQ1C 2XWTB 5AW5B 5I23A 3UAEA 2YO3A 3P77A 3E8VA 4H4NA 5MP6L 4DGYH 2J88L 1JZIA 3X3GL 2MRYA 1QLEL 3VG0L 4P46D 1XIWD 1ZVSA 3PDGA 4YFDB 6CGTA 1M1XA 3REWA 1FFTB 1RZPA 3DRTB 2NZ9C 2NY6D 4X8GA 4Y2OA 1E5YA 4ZQTA 1YQ2A 3V0GA 3ASNB 3HAEH 3TN0A 3AG2B 3HC3H 3QIWB 3T2NH 4H8HA 2C9QA 1NGQL 3AFLA 3ZKND 4DEPC 2KKQA 1BAWA 3ELAT 1UEMA 2OS7A 4YXHL 1CGVA 3OPZL 3GBMH 2F2HA 1PD6A 5SX4I 4D9RD 1J1OL 2A74B 2B2XH 4FEIA 2YJQA 2R2BA 4RIRA 3VFGH 4O5LL 3L5IA 1OSPH 4PRIE 4Z0XB 4DKEL 4C57C 1E2VA 5JO5A 3D09A 5FYLH 2QHRH 3TEWA 2EKJA 3LPFA 3R4DA 3CZLA 4AIEA 1V3JA 2FT6A 4NP9A 3GSQA 2VM3A 3IDIB 1C5CL 4UINH 4Y19B 4MZRA 3B3BA 1U6AH 5IVZB 5IREA 4E41E 5F7MC 5CINL 1U8CA 1DVUA 2B1AL 2WBJC 5FECB 2P8MB 3PUCA 5DZOA 4XP9L 5DEGB 3HHSA 4LSUH 1X5IA 2YZ1A 3A23A 3ES6A 1CVSC 2NZ9D 2WANA 1M57B 4NQXB 5EH1A 5HYSB 4XO5A 1S9YB 1P7QB 3QDMB 1HQ4A 4JVUA 2JMRA 4XVTH 5CZXC 5ESQB 5JHBA 3IU4H 2G60H 9PCYA 1UATA 3RGVB 4ZYKB 4L8DA 2EUXA 1KCVH 3U36B 4C4UA 3PWPD 2Z65C 3X14B 5JOFA 3RQ3A 1NEZB 3TVMA 5EO0B 3T3ME 2DM3A 7TAAA 3L2MA 4AJVA 5IQ7H 3B5HA 5DSCA 2YKLH 2WXIA 1KLFA 4B3VA 4FAAB 4FZ8H 4JHWL 4K7PL 4AY0A 2CRYA 3LEXB 2X89A 1QSED 1JZ8A 4MJ5B 4FFYA 1MCFA 1OT4A 1SFHA 2WWOA 3Q3GB 5BMFH 2NYKA 3ABMB 4AXWA 4CVZB 4RFOH 3LDBC 2X12A 4PJIB 2BWIA 4FFVC 3HG5A 4YC2B 3DO3A 1LNUA 2WYHA 4HXAL 2X1PA 3L7FA 3LIZH 1CQKA 3T6VA 4MNGA 3V6OC 1YEIL 4JFQA 4OFPA 1N68A 2OR7A 3R0NA 1NMCC 1OQOA 2FX7L 2VUYA 1OM3H 5D7LA 1BEYH 4HGWB 1EH9A 3QCVL 4FZEH 5KSAD 1E9QB 1KCKA 1VESA 1XZWA 5I76B 2XA8H 1CD1B 1UJ3B 2Q8AH 2WQWA 3VFMA 1XF4A 3C6EA 1F4HA 2GJ6B 4YGAB 5AEAA 3TU6A 5CZXD 1KXQA 2WLIA 5K9OA 2CK2A 1QP1A 1BHGA 2F53E 3NK4A 4FJ6A 4KI5C 5B1BB 3VCLB 5T3XD 2HP4A 2R0LL 3F6JA 3HRPA 4H88L 4XXWA 1CE1L 1I8AA 5GRUL 2WP3O 3KLAA 1S46A 1LVEA 5EC2B 1LEIA 3G5XA 1JV5A 3OKKB 2G2RB 2H6PA 5J6GB 5JZ7C 4GOSA 4PY8J 3IBOA 5DFVC 1G7MA 1TU2A 4KZEL 3GMPA 1N19A 1NBCA 4NQCD 4XC1H 2VRQA 1JDDA 1MHEA 2AF2A 4FS0A 3O9WB 4QXUH 3VM7A 4FFVD 2CALA 1YNLH 1J5OL 1EJFA 1JPTH 1KTDA 1OF2A 5E8DH 1T3FA 3VB8A 5T1JA 4PJDE 3V0JA 5B3NA 4NUJB 4NNYA 1X6LA 2EP6A 5FGBA 1NH6A 4ANUA 4W9HC 3EOAB 2OR9L 2CHXA 4JX0A 2XI9A 3QFDA 1UZ6E 2BFVL 1EAQA 5EOCL 5DS1A 1DBML 1JV2B 5SWSE 2FHCA 2V37A 2V9TA 5DD3H 1MCWM 4KDTC 2AEQL 4KI5D 1Q9KB 2GW5A 2J1YA 2WIIB 2OMUB 3ZN6A 3ZVVA 4CVXA 4ONOA 1AKJA 1BXUA 2ESVD 2ICWA 4I3RL 1HZHL 1ZMYA 1J0KA 1PQZA 3SE9H 2CBQA 3BQUA 2QQNH 5DJ6A 1EV2E 5I1KH 4QHPA 1IFRA 3RDTB 4MNQB 3WIFB 3UTOA 2OXHB 4WY7L 4N1EA 3CFMA 5JZ7D 3BZEB 2Y2TA 5DFVD 1GR7A 2GTWB 4WJG3 3T0BA 4W9FC 3EF4A 1A3RH 3CFQA 3ZE1F 1N26A 4XVUD 2YLKA 2JJSA 4KJYB 5BRQA 1QFWH 3KPQA 4RGNC 1ND0B 2CO4A 3LIZA 3D3VD 4IBQA 4NT6A 5D7SL 3Q5YA 2QJDA 3RLSA 1PLCA 4ZPTB 1VGEL 2GUYA 3GWJA 4FXKA 3EGXA 2CGZA 3OHXA 1AGBB 5D2NC 4ZX3A 5IESH 1KPUB 1NJ9B 1MCOH 3UP6A 4JRXD 4FYRA 5KSVA 2OMYA 1SEBA 2ISDA 2G3NA 2DJSA 1JWUA 2P47B 2EYRA 1NGXB 4EN3A 3F7PC 4ZUVA 3IKCA 2AJSL 3VXTB 1G5GA 1WGVA 4YSRA 2XG5A 3W11C 4X0KB 2XQYG 2F7OA 3HLAB 4JUTA 4PJHB 3SOTA 3OKDA 2VT0A 3LZQA 4KWUA 3X1FA 4P3WA 4ZFFA 1FYTB 1HDMA 3VI3E 1FIEA 3I02A 4KGLA 3OR6A 1HZKA 1RK0B 4HC1A 4BINA 4C4KO 4Z3IA 1HQRB 3ZRCC 1L9NA 1T5KA 5B1JA 2X4QA 2ZZUT 1WVZA 3RHWF 3PDOA 3R06A 3T6WA 1I3VA 2VR4A 2NRDA 3CJJA 3BZ5A 3FTSA 2K0RA 1WS7A 1MELA 2XWDA 1ACXA 1BVZA 3TONA 2PCFB 4RGND 5F9JA 1G43A 4JZNB 4MMYB 5D5MA 1BZOA 4OV5B 2K9FB 3GINA 4UIKH 2AABL 3EYUL 2I5YH 3P0VL 2P42B 5E2VL 3BAWA 4JO1H 4JRYB 3TBTA 1N10A 4ZDHB 4U1JB 1KGYE 3CC5B 4U05A 5E8EA 5ICYB 1CPUA 1D6EB 2DN7A 3PJLA 4BFGA 1MCLA 1FGNH 4Z7OB 3DMMB 2IF7A 2AXFA 5FDWA 1I4FA 2BIHA 3MRNB 3W11D 4XH2A 5GZNC 3SCMC 5JW4Q 5L8LB 4O2EB 4O02L 2X3BA 2XQBH 3FQTB 1L9OA 2NW2B 4XZUA 5F2FA 3U7WL 3N42B 4FFWC 4G6KL 4JZOA 2UWEB 4GS7B 3D4ZA 5T5NF 3BSZA 4PJ9B 3CSYB 3OLIA 4ONFH 3T0EA 5DJDB 5E94B 1YQVH 4HUCA 2F54D 4PGDB 1DFBL 1F3RB 4WEBH 3L95A 4PB0L 4I0PD 5I75B 5DURD 3L3DA 3MNZB 3SDXF 5I6PA 1S3KH 4TUUA 2IG2L 4U1SB 1RPUA 4L37A 5FLVA 2PTTB 4Z77A 4QRAA 3CFBB 3CFKB 1J1XH 4DHLA 1L9PA 3ARTA 3DV4B 5FO2A 3PY9A 2PO6A 3OAWA 4WWPA 4FI8A 5MEOA 4JDEA 4OZHB 4NP4L 5T3ZD 2JKNA 5C0DB 4EVNB 5M95B 5MENB 2PN5A 3D85A 1YMME 3QI9B 3T6QC 2Y7QB 5FA4A 1UT2A 2YBRA 1WGOA 3LN4B 1IC5H 4NFDA 5EBWB 4FNPA 2I9TA 4EDWL 1ROCA 4HDIB 2QPFA 4M5ZL 2WNWA 4ZMNA 3S8FB 2BSSB 3UIYA 2CA4A 3IJSA 3L16A 4TULH 4OF6A 1HE8A 4R7NA 4XB7A 3KPOA 1MLBB 5A16A 3BMVA 4MDIA 3LZNA 5AAWC 3QQ3A 1JAEA 2R2EA 4FCAA 3RVVD 1V7ML 4FFWD 4K23H 3WS3A 4K3DL 1A7PH 3HB3C 1F58L 2QSCL 4QHKI 1CWVA 1UCBL 2J44A 5CEXB 2CK0L 1VFBA 2G3XA 2EABA 3DVGA 2X6CA 5EIQA 3LXCA 5F0MB 5DS8A 3CVCA 3D9AH 1P0SE 5EORL 2H1XA 3VQMA 2KZKA 4JPKH 3NSYA 3J27A 4XBGB 4N6RB 2EEXA 4LEOA 5E99L 2PXYC 4DO6A 2E7LC 1BAFH 3MRLB 3LHPL 1L7TL 2F5AL 3C60C 3L54A 2XY2A 3IJYB 5HI5C 2W88A 1ECYA 2FTAA 3IETB 1P4BL 2BNRB 3QEUB 4OJAA 4U6XA 4DZ8B 3A4EA 2MPAH 3WNLA 3L6FB 2ZUUA 1BZ9A 1HYRC 3INOA 1WTGT 3O8XA 4PGBA 4U2ZA 4NZTL 5JIPA 3C5JB 4TOYH 2WNKA 4RMVA 4TUOA 3RY5A 3ABLB 1QOKA 2OBGA 3CMOL 2CLRA 2EYSB 3E38A 3BFOA 2VQTA 5H94B 3V5DB 4LRNL 4KO9A 3X13A 4B9IA 4PJBB 1OE1A 3L4WA 3DRQB 4OKDA 4ZD3L 3HB3D 5CGBA 3T09A 3V4PB 2V5TA 5EZJA 1CT8B 3HE7A 4Y4FA 3G6DH 3V6ZB 4M93C 5E95B 4FQ1L 3JV0A 4X80H 1NANI 1DQJA 1GVIA 5KN5A 2L04A 3CCHB 3DA0A 1WPCA 4FTDA 1H6TA 2KH2B 3OPUA 3MUGA 5D7KD 1EZSA 5FYKE 3V5KA 3C60D 4JFPB 1D5XB 4X7TA 2I60H 3RKPA 2R69H 3AQZA 2CRZA 1KIQA 3V0EA 5DD0H 2V4LA 1NAMB 3JVGA 3RY6C 25C8H 1Q94B 4OM0H 1RLBA 3FNKA 5EU6E 3VXOB 5AOZA 1SLWA 4LPCA 4HS3B 1MHHA 4GPVA 3NESA 2VZVA 6PCYA 4ETYA 4KJWC 2WTOA 2BY2A 3BPNC 3L48A 4TS6A 4KUCF 5I1DB 1BM3L 1G1YA 1KWKA 1UB5B 3B9EA 3CNKA 4FTVB 3ZKQD 3EFDH 3W9DB 4PHZA 2FX9H 4OM1L 5ANMB 5BCAA 4KK5C 1BQHA 1U8MB 2WBJA 1PIFA 1PY0A 5AVUB 3UTTB 3WGVB 2JNZA 2CCLA 4HBQA 1EHNA 1DLFH 2J88H 3ULVL 3ULSB 4WCYH 1ORSB 2PCPB 5E1IA 3CV5A 3B83A 2X1XR 1JF5A 3EHBB 4ZZFA 3K2IA 4PEEA 4UAHA 2EDKA 3G6JE 3NFPA 3OR7B 3W9EB 4P9MH 5ITBL 4YVNA 2EVGA 4PWHA 1ZWIA 2VLJD 4HK0B 2YMXH 1AQDB 3SDYL 3K1DA 4Y16B 3VD3A 4WHDA 3DJTA 5DGRA 1NGQH 1JPSL 3ISYA 4HJ1A 4A68A 1S9KC 3JTSB 1OK0A 3FS9A 4IRJB 5DEJA 4O02B 1N2RA 2IOIA 1FJ1B 5HDOA 1FNFA 4KJWD 1J1OH 5C0BB 4O2FA 3MX0A 1QYGH 1T22B 3FRPG 1CVRA 1HNYA 1M7UA 35C8L 4G8GE 4DKEH 4JFDE 1XQ4A 3RVTC 4M7ZB 2E0PA 1LYQA 2AQRA 3TIEB 1IM3B 1T0MB 4YGVB 4JANA 2EE9A 7PCYA 3IRPX 4PJ8B 1REIA 1I8UA 4PB9L 2FR4A 2R8SL 4CRPA 5FHAL 1UQSB 1X5YA 1A64A 4N2HA 1ODUA 2D4DA 2CO3A 1XZ0B 2CMRL 3BCFA 3HI1A 1KT2B 1S5IL 2PW1A 5DHEA 4JN2B 2AJ3A 4N87A 4OIBA 2X42A 5LGYA 5KVGL 1DQMH 2NDFA 2I26N 3N43F 4ETQA 4ZUTA 1CXHA 1C7TA 5AKRA 1UKSA 1RHFA 4NDMB 4AC4A 4FXLA 1XR9B 1BIHA 4X6BA 2PF6A 2V5YA 4MD0A 3HPLB 4MKMA 3WN5B 2C7UB 3EYSL 1DJIA 3KJ4C 4OBRA 1PZDA 4OIIL 5SV4A 4DVBA 2YSTA 5H37A 4F5CA 3NJXA 4L3EB 5KJRH 4GKSB 2ZG2A 3HRZC 2J25A 1DLHA 1COBA 3OMZA 4RAVA 2MNJB 1E9OB 2P5EE 4QKXB 4WNJA 1TTAA 1BPLB 4XN9A 1F86A 4K7PH 4BIKA 5EO9A 3FW6A 3RVTD 1SXZA 2WOYA 4GEIA 1U2CA 5IMMB 4HWUA 1X9UA 4YHIA 3HBGA 4L2LA 1ED3B 4U1IB 5D7HA 2G0KA 3CFNA 4LNRB 2ZWSA 4TRPL 3MRHA 1CGUA 5C6PB 5FEBA 3EF7A 1YEIH 1V54B 2D8KA 4TL4A 1FFRA 3ATEA 4RZKA 3NFNA 3R7QA 5HDBB 1QSFA 4JM4L 4M56A 2D2OA 5DHYA 7FABH 3HPJA 4WTWA 2Z31B 4GAJL 4PV8A 2ZXEB 5A2AA 1U8QA 3HE6C 5D8JL 3RUGF 3S37X 4UT6H 1LDSA 3RNKA 3POHA 3P9WB 4BZ2L 3JYCA 4WI8A 3EO1B 3ARPA 2R0LH 4Z7IA 3FQWA 1E8WA 1CR9L 3LHAA 3MA9H 3BPCA 6FABL 3I50L 4FNSA 3KL5A 2D31B 1JVOA 5BQ7A 5I30H 4PP1C 5E03A 5HVGB 5KANI 4FFZH 2Y1YA 5I5IA 3BGFC 4GO6B 1OSZB 4OKVA 5F1SA 3QW9A 3SYCA 5KJ4A 4FF9A 4YNYB 4CKQA 1AGDA 3BVVA 3T0VA 5HHQB 3LKRB 1OARL 5HHVH 1F4XH 1JK9B 1ES0A 1FZJB 5F88B 4MCYB 1NIEA 3QNXA 1U8HB 4KROB 2HWZH 1JHTB 3DVNA 4ZFOB 3V8CA 4F58H 2O5ZH 1JSYA 4NM4L 1EUTA 5TE6L 3BH4A 5D4QA 3PWNB 3VFSA 2VRAA 4EMZA 4B97A 2NNAB 5HHPA 4I4WB 3WHE1 4YDIL 3SD5A 2OAAA 1UFGA 4LLMB 2F1AA 3MV01 3PYCA 4NRXA 5IB4A 2C9UA 3LSOB 3R8QA 5AL0A 1UCTA 2BFVH 1F6AA 4LQ1A 3U1PA 5IIEB 2CJ3A 6PAZA 2NUPA 4ODTL 4N24A 1I1FB 3WG7B 2X2HA 3NIFE 4WHTA 4JR9H 4WTXA 4BA8A 2PP7A 3RA7H 1HZHH 2AXGA 5C97A 3M1BA 4M4RA 1IGYA 5ERWA 2CNZA 3HBZA 4PP1D 3QJHA 1SOXA 3TA3C 1S7RA 5IVOA 1Y07A 1CFMA 1YHPA 3UDWC 4DTGL 3PHSA 2PPCA 3FOMB 1RUAH 4V2BA 1DQLH 3IDXH 1U8JA 3IGLA 4Y2DC 2VLKA 1AAJA 2BVYA 3V4PH 1JNLH 4N2MA 2F58L 4D0DA 2WLJA 1WFIA 3DDGA 3H8NA 2B5IB 1TNMA 2Z93B 4CA4A 3LY6A 3RILA 2QVTA 4JRWA 3EJCA 3QB7C 5AB0A 1R3JA 1S7WA 4MJ6B 2VE6A 4YDZA 4MZIA 2BK8A 5FYJL 1F41A 4BSWB 1CYXA 1PCSA 5BO1L 1AHKA 2EKSB 3K72B 3QEHB 5ESVA 4KDVA 5GZNA 2IOOA 4OR1A 2G0LA 1NAMH 1XT5A 4RZCA 1YDPB 3GM8A 1T1ZA 1U3HA 1UWGL 2FNBA 3FFOA 1OXYA 3EJSA 4I89A 4X7SH 4HKBB 3PXJA 2ERJC 2F1BA 4CL7A 2K6YA 3APMA 1NQBA 2XN9A 4FFZA 4P59H 2VN3A 4ANVA 1I75A 3RVUC 4BCXA 1JZ5A 3T65B 1UWFA 2M83A 1OP4A 2J55A 4LASL 4NWTH 3KM1A 1PG7W 4PRHE 1F1AA 1K8DB 4FQHA 4PGEB 1I82A 4HIHA 1N3NA 1AXSB 3MV8B 4ISVB 2NSMA 3UC0L 2Y6SC 1GGBH 1ONQA 2P7TB 1KTLA 4IDLA 5J4MA 1GL4B 1KTRL 2ZCLH 4HUXA 4ZOAA 4Z76B 5CIPB 5DRNB 2CJTA 2EACA 5SWSD 1OCCB 3OZLA 1NTDA 1QO3A 3CZNA 4S0SD 2VIRB 2WXGA 1OSYA 1RZ8B 3LX9A 1AMYA 1CFQB 4X7DC 5SX5H 3QULB 1GGCH 3NFSL 5I1CL 5DT1L 1NCOA 2JKWA 1LWHA 4FI7A 3MRJA 5ECGA 3O3UN 3AC0A 2HYMA 4HJEA 3BUTA 4PRPD 1R19A 2FRGP 1FAKT 1H6UA 5DJZA 1DQQA 2OV0A 3KBFA 1MHPH 4HHAA 1T1XB 4MXVF 3D39B 5IROC 4O02H 3WTVA 1FZMA 2CG9X 2A73B 1TZHB 1SXBA 43C9B 1IKFH 3MLUH 4IBZA 1BVNT 4G6KH 3L13A 1JF6A 1HI6B 3ET9F 5EIIG 1XR8A 4YSTA 3RVUD 1RZIB 1SMAA 1UD6A 4XPHH 5HY9A 4DUWA 1OAKH 4U4BA 3UZQA 4W6XB 3VXMA 4R4BB 4DN3H 1I8IA 3DOSA 2PXYA 2Y6SD 4L0PB 4P2CG 5LAXB 1MCJA 3HAEG 2PYFA 4IKJA 4ELKA 3NAAL 5E2TL 3ZBMA 1JZFA 3WEXA 3H3PL 3FO0H 4KHTH 3U83A 5FB8B 3KLSA 4EAEA 1BMZA 1T6BX 3SQBB 2P8LA 3GSXA 1KJ2A 1FNSL 1AGCB 4FLHA 2MCPH 1UOLA 5F8QC 4NP4H 1R5WB 1JGIA 1CLYL 3GJEA 1K8IB 1A4CA 3TNMB 2OQJA 3QDJB 1X7SA 3VWJC 3TBCA 4QO1B 3NRFA 1GZHC 1JRHH 3C6LC 4LESA 1WA2X 3MCLH 4KTDL 3WTXA 3KZ8A 2OYPA 2CKBA 4FXGB 1EFQA 5K9JL 2CGYA 4TVPL 4P2RD 4PLJD 5IROD 3E2HC 4X4ME 3FTGB 3RX9A 3NTCL 2A9AA 1PNDA 4MKTA 5I0WA 3U48A 4P57B 1E6JH 1F58H 3EBIA 5K39B 5KANG 3TYFB 1FFPA 1UCBH 2MNUA 3ZKMC 1H3XA 1OEZW 2CK0H 3QQ9C 1OZUA 3H9HA 3SY0B 4CSSA 4JO3L 4KTYA 4K7FA 1H3GA 2PYEE 2DQGH 1GY2A 1NCDH 4WF7A 1JHKL 3H1ZA 4AK1A 4E5XB 2EXSA 3LQZA 5FGCE 5JLZB 1L7TH 3PFQA 3FU5A 2NY2C 3FCSB 4M5YL 1RFDL 3KLHC 1I7UB 4R9HA 1P4BH 1RURH 1U8KB 4I87A 4PVLA 2FJFA 1HOEA 1ZHBB 2Z9TA 4BH7A 3MODL 1FZOA 2ZT9C 1HOCA 3O6LH 3B2UC 4Z78A 4ZUUA 1JUFA 3VWJD 4NZTH 4GO8A 3PJSA 5F9AC 1LEKB 3HBPA 4LVOB 2NSXA 2EVJA 3X17A 4ZFZA 4J3TA 4PY8I 1SUJA 1ZHKB 3IJEB 5DDHB 4F33A 2HJKB 4K07A 2V3EA 1JGUL 3UAJC 3LPPA 1HHGB 4BZYA 2HFFB 1AVAA 2CBMA 5IT2L 2KI6A 3QR2A 5FS5A 4IYKA 1O6SA 4NQDA 4WUKL 5GQBA 5I19L 3QQ9D 2R2HB 3DX7B 3QCTL 3BPOC 1NBVL 4FQ1H 1TJGL 4UNIA 1Y1UA 3A21A 1XEDA 2HJLB 5EZIL 5CBAB 5FYJU 4D0BB 4KY1L 3IU3B 4KKLC 1CLZL 1FLRL 3QUXC 5SX5K 3TC9A 3V0WL 4AKPA 1NBYB 4P4RA 1U21A 3VMOA 5EB9A 1TYJA 2NY2D 2AV1B 3GMRB 3OKLA 4JQXA 3KLHD 3N55A 4MNQE 2FQDA 1Q1JL 4JFFB 5KZCB 1SHMA 1WIUA 1YC8A 3WJMA 4ZMZA 1MEXL 5L4MA 4UAOB 3B2UD 4ONHB 5DUML 2WYIA 1OB1B 4YXKL 4XP1L 3D69A 3KPPB 4P2OA 3NG5A 5HD8C 1BLNB 4JW3A 1M7IA 2YAOA 1A1MA 2IFFL 1A6WH 1TJHH 1MCPL 1ZEAL 4FLRA 3FQXA 4YSOA 1SHWA 2VC2L 1YECL 5LQBH 1J8RA 5DO2C 1A2YA 4Q9QH 3UAJD 1XH0A 3GXTA 1RZFL 5AVXB 4NQVB 4KUZL 3EOBB 3IJ8A 3ZE2F 3V4VL 1IGFL 2AGJH 3C9NA 1A4JA 3BP4B 4U6VH 1C9SA 3QG6A 4YVUA 1SYVB 3ULVH 1MJJA 1MY5A 3CN0A 4GI9A 2XTJB 4YHPB 2VXVL 4CJ1A 2DWYA 2D0HA 1CE6B 1U58B 2J12B 1B4RA 1G1CA 4KKLD 4WW2A 1TPXB 3QUXD 4PJHE 2O5YL 1W80A 5B7FA 4TSAL 4XMXA 3WKPA 1AACA 2W81C 4PRIA 2MQ3A 4JY5L 4B6ZA 1IEBA 5J56B 4F3FB 3KPLA 3G9VA 2J4WL 1PAZA 2VR6A 4BQ8A 4JQIL 3DK0A 1KB9K 2VRKA 3FQRA 1PG7L 1AOZA 3NACL 3NSDA 1RIUH 5FYKU 2MPVA 3UROR 1A6ZA 3ZE1B 5JHDB 2ZKWA 5HJ3A 2W95A 4C8XA 1KG0B 5D1ZB 2R27A 4E41A 2JKRM 4HWBL 2Q9OA 5INDB 3TF4A 5HD8D 5K59E 3BVXA 1CG9B 1SBSH 3PHOB 4I77H 2OMXA 1FHGA 2OJEB 2FEJA 2EDNA 2WVUA 1SHSA 1TKWB 4R26L 5DO2D 2JK5A 4M1GH 1ZRUA 1IIKA 2RD0A 5DJAB 2COQA 3ETBF 4PD4K 1JGEB 5CBEA 2BRRL 5BO0D 3DO7A 1JF1A 2R15A 3ESMA 1SNRA 4Q6YA 3UO8B 1RSYA 3BWAB 3L4TA 2ZYHA 3MFFA 4AKOA 3WHXA 3RYMA 1GH7A 5J6HA 4ZMPA 1YG9A 4H40A 5EU6D 4C4BA 2FBOJ 3G7TA 3MRRB 5L4FA 4A55A 1IJNA 3JSSA 2ZCZA 4YSCA 2HFEB 5GGQH 3HE6A 1S5IH 4DPCX 4JKKA 1TCRA 4HH9A 1IT9H 1E4XH 1WO2A 2ZTBA 2QZ5A 2VDPH 4QXWA 3B9DA 1D2PA 4XGZB 3SDDC 4MCZB 2IVFC 4FI6A 4DP1X 3NCJH 3KEDA 2MQ0A 2V5RA 2VKXA 3IMWA 1S78D 5I0XA 2A6JA 4U1LA 3REVA 2EDTA 1PZ5A 1QHQA 2A83A 5FK9B 3SKJH 2IAMA 4OFIA 5KYUB 5ANHA 2XUWA 2E8YA 5E1AA 4G5ZL 1N0XH 4AEHH 3L3OB 4OZHE 5JQ6L 4DN4H 1L9TA 1FH2A 1QG3A 5FYLD 3CFUA 3GMNB 4CSTA 2F53A 3TTYA 2GUOA 4R7VA 4XX5A 1T03H 5D93B 1T2QL 1FNEB 3BCDA 1UXSA 2YRPA 2R1XB 4RFNB 5T5FL 2NY1C 3O4LD 5CZVL 3I3BA 4C54A 3MBXL 3A6CH 5J57B 3MLXH 4XAKD 3QUZB 4P0DA 2VYRE 1Q0EA 1VRSA 2ZONA 1Y18A 3GXDA 3MXVL 5D8JH 3SDDD 1AHWC 5DZAA 4MYPA 4CUCA 4WTZA 3SDXB 3TBSB 3QEQB 1VERA 4BZ2H 4GRLA 1RJLA 2YN3A 3OKNB 1U4FA 3TA3A 2BMKB 2E75C 3F7YA 5L88H 4AEEA 6FABH 2MTPA 1QSVA 2OPCA 4Y8AA 3ECWA 5LNDA 4X50A 4PJDA 3CIAA 5IVXF 3KPNA 4GW4B 4V1DD 3DBSA 4CU6A 1KYOK 4Y2DA 5DK2B 5F7UA 3VE0A 1CLOL 3S98A 3QJFA 2WVTA 4KTEH 3DURA 3D50A 4X6FA 4MXWH 5AW0B 3GSNA 4M6NL 4XNYL 4P9HL 4P8QA 5HYSG 2W60B 2EUVA 5MERA 2NY5L 4G9FB 3SDCB 4KZCA 5JORA 1PS3A 3ZHDA 4Y5YB 1CFVL 3ECVA 5KBKA 1AIZA 1WBZB 1BFVL 3QH3B 1YAZA 4QRFA 3TT3H 1A3QA 3GEWB 1G0XA 4N0YH 4HD5A 1NIFA 2DQCL 4GMSH 1ZLSL 4XMKL 3UAFA 5EHFA 4JCMA 4QOKE 1YY8A 4U3SB 1NEZG 2MOVA 3B2VH 3QIUC 2EZ0C 2Z0BA 4PJXF 3BYTA 3E8UL 2W80C 4LKCA 4TYUA 4ZFGH 3AITA 3B3IB 1HIMH 5J8OA 4K94C 1L5GB 4EN3D 4WUUE 4AQOA 2DIJA 2VSDA 4NRZB 5IB2A 4PGCB 1DHKA 4W93A 4QOKA 1INEH 5DRZB 4EZLA 4BFIA 1SJXA 2YOAA 3V4VB 4DTGH 5EBMA 4NJ9L 5F6IB 1XB3A 4BZ1H 2BNQB 3OQRA 1HNFA 4DP5X 2NY4B 4XCYB 4BM7A 4PY7B 5JIKA 2NY3B 3VXNB 3GS4A 5MEQB 1VF5C 4OJYA 2X9ZA 3BIKA 3S8GB 3H85A 1G7HA 2ATPA 1A7BA 3MRIA 1TYRA 4GAAA 1IGTB 3EO9H 1OVZA 1FVEB 4RGMB 3KGUA 5A3IC 1LXMA 2XWJB 4QCIA 1XF3A 4G7QB 1HHKA 2AERT 2N7SA 4M5SA 2RR3A 2XVKA 2WSKA 2COVD 5FYJH 5AZEH 3S35L 4EUPH 1MVUB 3KVDD 3SDAA 3GK8H 5E2WH 4GXUN 1GOGA 1OHZA 2ZICA 3ELQA 3QIUD 3UTTE 5C8JB 3N2JA 1AS8A 1O6VA 2IQAB 3U0WL 4HV8B 5CJ8A 1O75A 1GKEA 2EH8L 3D2UB 4NHCL 3R1GH 1P7KB 4CU7A 4L8CB 5ESAA 2YXFA 4QMEA 4R97C 1NBZB 4S1RH 4DUXA 4WKZB 4WSKA 4A7QA 1HINL 3WBDA 3BVDB 4HX1A 1QBAA 1NWPA 4H25B 3ZSSA 4GIOA 3KR3L 5FGSA 3HZKB 3B9KB 3KWTA 3BAYA 4XVJH 4B41A 5CEZE 4AM0A 1BQUA 1HFUA 2OP4H 4OZIB 2W38A 4I18A 1BXAA 4PIBA 4G7VL 4M6ML 3GRBA 2X7LA 1ZTXE 1MW1A 1SVZA 3GSWB 1SN5A 4JBSA 5HHOA 5A3ID 1XHHA 1F2XK 5C0BE 1DZ0A 1SDYA 4LE8A 3L3JA 1GRWA 1XH3B 2FSEA 4JREB 1JWSA 1GZHA 4LT7A 5AW6B 5DT1H 1XCQB 3C6LA 4XOBA 5GGVL 1J9CT 2OZ4H 4J4PC 1OGAE 2X53A 3HZYB 3QZOA 2ITFA 4NHUB 1KDIA 4ALAL 2P24A 4KX9A 1XGQB 2AQ3A 2NR6A 3D85D 1KGXA 1JGDB 5DRWB 1XFPA 4M8VA 1CGSH 3QIWC 4OF0A 1QTYT 3HNVH 3WNKA 1BMWA 2C3HA 4U6HA 5AUMB 5FYKH 5I1JL 4AQEB 4XVOA 3CXDH 1NIBA 4Y5VA 3FCGA 2ZAGA 3NEOA 2OI9B 1Q72H 2YR3A 4JY6A 2A74C 4ODVH 3MXWH 4BZ1A 3H9SB 5IB3A 1MQ8A 4PG2C 1YMMA 3BP5A 1QKZL 3FQUB 1GZPA 1GGTA 5L2KE 2DQ6A 1CK0H 5IV2A 3H9ZA 4DVRL 3RFRA 3NAAH 5C07B 1WIOA 3RG1C 2Z35A 1DCEA 3QZLA 1JVKA 2R7EA 3PWLB 3JV4A 4K3JL 3W2DL 2BY0A 1IGJA 4ZXBA 5C0EA 3WE6A 4OLUH 2EYTB 1OP9A 2FL5A 2Z8VC 1W6WA 4EUPA 4U7SA 5EN2A 4XNQA 1CLYH 3LZRA 4JG0H 4QEGA 1XGUA 5B3JE 3FBKA 3CH8A 2NLJA 4J4PD 1S5HA 4U6YB 1XBRA 1ZE3H 1FHNA 2X4SB 4QXTA 1DR9A 5TF1L 3K6SB 2XZAH 1CDGA 1ETB1 1N6VA 4MNHB 1RSFA 2ADFL 5AYQA 4Q9CA 4U3CA 4XMPL 2Z7WA 3S96A 1LO4L 4XPAH 2C1PB 1CFNA 1T1YA 2N7AA 2X6UA 5T1LB 3AS0A 1K5WA 5JDSB 3QIBA 3RGVC 5BRZB 4XO3A 3TBYA 2WTPA 2FBJL 5IHZB 3MNMA 4C55A 5E9DD 2XX1A 3FQ4A 2YAMA 5FKPB 1EEYA 3TJPA 3N43B 1KNOA 1G7IA 3CWGA 4HEPA 4TSBL 1XF2B 4MQ7A 4A63A 1F45A 4NGHH 5GGUB 1C16A 2FLRT 2YLHA 1KGCE 1AIFB 1NSNL 1TVBB 2I07B 3L3KB 1U36A 4P5TB 5IBUB 3IDGA 5TDNB 3VFOA 4MB1A 4UDTB 2X87A 3ECQA 3UEZA 5I1AA 2QGEA 2MHAA 4Y19D 1T4KB 3OAUH 3VD2A 5D7JB 4HLJA 4YC2C 4BHUI 3H7BA 3RL1B 4U1HB 4E9LA 1RFDH 3CG8A 1ILUA 1N7ML 1ZHNB 3VXUD 1RZQA 3NCWA 4NZUL 5BXFB 3S6CA 1MY7A 3MAWA 4M02A 1TLMA 4HSAC 2OZ4A 5KSBE 1BCIA 1ROWA 3LPOA 3EYFA 1HKFA 1QLRB 1UJ3C 1P7QD 3DIFB 3QDMD 4GW5B 4MA7L 4OCRH 4DAGL 1IQWH 2FQFA 4X98B 4G8IA 4J3OF 2AKRB 1N18A 1R5IA 1H19A 3FT2A 4Q97A 2A77H 5F9OL 1LK3L 1C08A 4K3HA 5EUKB 4BH8A 2H0PA 4U6TA 4Z7WF 2OTPA 3KHQA 1S9XA 4GYBA 1UH2A 3P3RA 4JL2A 3O6KH 2GAZB 3RUGB 1JK8B 5DI8B 3IMRA 1NLDH 4HAGA 1B2WH 3QEGL 2DBLH 2J1KA 1F90L 2V8LA 2VDLL 4X9FA 1DBBL 5EZIH 1DDHB 2KLTA 4KY1H 4KFMA 5KVEL 5GS0H 1CLZH 4Y4HB 2P46B 3O9WC 3CAFA 1C8PA 1R47A 1NCIA 1PPIA 2MSPA 2AQ2A 1WA1X 4XVSH 1S7VB 4GBXB 5CLTA 5E8OB 1AD0A 4IRZL 3SGJC 1Q1JH 2DS4A 2Z34A 4Z3HA 1U8LB 1W0VA 3RVWC 2AK4B 4KKZA 4M48L 3L5WB 4XCNA 4JFSA 3LVEA 1NCAL 5DUMH 1AR2A 1A14L 1ZDSA 1KIUB 1Q0XH 1ZSDA 2GJ6D 2IFFH 5A1AA 3QA3A 1BZ7B 5F72S 4OLYL 4GAYA 3ZK0A 3G5ZA 4KUZH 2E6JA 4O2CA 4PRAB 1DANT 5IZ7A 4GP4B 1IGFH 5E70A 1OLLA 3OZ9H 3TO4B 3RDTC 2F61A 4S1SL 3S36L 1JGVH 4LCUA 4HFWB 2VXVH 2K6ZA 3V0VA 4B0MB 4D9QD 1DE4A 3G5YB 3QWOA 3WNNA 4WI0A 1HH6B 1MRDH 3O9WD 4KHXH 2ZAIA 4JY5H 1A9EB 1TTRA 4FJZA 4JFDA 5EA0L 3BVUA 1K6QH 1J5DA 4NENA 4LLUA 4UQEA 4JQIH 3GTTA 4XCEA 4QLWA 3MLYL 4FQQB 5A6MA 1YEJL 1PKQB 4JRLA 1HX0A 4M7KH 1O0VA 2QKIA 3L3GB 3BVTA 1XD0A 4GKNB 2F1EA 3L1GA 1AS6A 1E2ZA 2IDCA 2V7HB 2P43B 1CICA 3F7KA 5C0AE 2DEWX 2DKSA 5T1KB 3GMQB 2V2XB 1ZT7B 2C4FT 3DX8B 4BFNA 4OLVL 3K2UL 4E9XA 3S7GA 3DV6B 4R26H 5KVGE 4YMPA 2DTML 3GMOA 4H5SB 4XB3A 3TWYA 5CCKL 2XXMB 2VB5A 4URTB 4JFVA 4NKIL 4LCWB 4TQHA 3BWZA 2DD8L 3NSFA 4X4KA 4KO7A 5A6LA 2VSCA 4Z8FH 3BRDA 3RDTD 4RAUA 4MNQD 3VSQA 4HQQL 5TDOA 4JFEE 4G7SB 5DWPA 5KBLA 1DBAH 1ZT1B 3WE1A 3QNFA 1WAEA 3F04A 3GJFB 5D96B 2VLMD 4WGWB 4KKAC 1J9QA 4HXBH 2JFCA 3K2KA 3PNWB 5I6LA 3TURA 2P5EA 3HZVA 1CDHA 4BEIA 4K7PY 3VTAA 1MW0A 3D0VB 3FO9B 1LD9B 1YEEL 4QHMA 5D6CB 4A7GA 5C0FB 4AGNA 1UA7A 4W9EC 4PVMA 4HPHA 4NKDA 3UPCA 4Y1AA 3WEMA 1NCCL 3FUMA 4UQ2A 3AG1B 2IDFA 1BIIA 4K2UH 2R4SL 3UPAA 2X4OB 5TE4L 3D4GA 4DF9A 1X7TA 3OJDB 3RPKA 3RWDA 1D5ZB 3TYGH 5LGJA 4NBYB 4LKXB 4HKZB 1TMQA 4OZ4B 5CJQH 2E9WA 1M2OA 2WSPA 3DMMC 3P4LA 4OD2A 3VFRB 3KWWB 4LIQE 1R0AL 2A9BA 4NRYA 1RJZA 3H2WA 5DUJA 5FO8B 5C6TH 1MXGA 4PJCE 3MYJA 5EUOF 1E27A 3V52L 1QMUA 1O9WA 2BSTA 1FYTD 4MD4B 4JO2H 3IWUA 4PJ9C 1IFHL 4JPQA 3WIIL 3FONB 5ETUB 4P4KA 3V79C 1I53A 3TJEH 3DHPA 5ECJE 2C3GA 4Z3FA 4UYQA 5IKCA 1F13A 5CZVH 2BY1A 4X7FC 3GM0A 3CSTA 4OQTA 5C9JB 4BUQA 2F08A 2NY0B 4XXCC 3CN3A 4XNZB 3PGFL 5IB5A 4WEMB 3MOBL 1IZJA 2NUTA 4UILL 1G5AA 3GMLA 1WD8A 1VEMA 3W39A 4OGZA 5F1KC 4UQCA 4JRYD 2JH2A 1E67A 2LAGB 5CZRA 2VDKH 1P84J 2MEJB 2Y5TA 1NEPA 3OVUB 2FWUA 3AXHA 1CLOH 3B8SA 4LEXH 4ZW6A 1O5DT 4A2LA 3LKNA 1A4KB 4WHYH 2OMVB 2W9EL 2VDLB 4CDHA 5LHDA 3IFNL 3MBWA 1JN6B 4PJ9D 2NY5H 3QZWA 3ZJAA 3QRGL 2NXZB 2CUIA 1BFVH 3ZR5A 3CFJA 4QYAA 3QXTA 2RJMA 1QBLL 4OIAA 3DKHA 5IB1A 3IB4A 4E9VA 2C7FA 1WBXA 2CLZA 1JGLL 3AG4B 3EJPA 4Q7DA 3FOLA 5IFHL 5LGHL 2YD9A 3WDJA 4B53A 2C9SA 4Z7NE 2XOTA 1VACB 3Q05A 2V2WA 4J39A 3LB6C 3X1BA 1B4LA 1XXDC 4TTDC 5MEND 1A5FH 5IP4A 4CC4A 4IOSD 4KKCC 4ODXA 3QI9D 5GISH 1QI4A 1YEGL 2X40A 3ARQA 4JPVL 2YAEA 1QUPA 1PMYA 1U3HD 4F27A 2WK2A 4ZNEA 1SY6A 1GTFA 4HMDA 4HPYL 1MJ7H 1BEXA 2ZX9A 3CE1A 5I6KA 4NJ9H 2JQAA 4WNQB 1HTYA 1T5WA 4CBPA 3KW8A 4JG1L 5FOBB 1E28A 1YN7A 3P30L 3B9AA 4QRRE 5ILTL 2DQIH 5C86A 1JL8A 1FRGL 2WNXA 4RRPG 3E3QC 2NPLX 2Y06H 2A7BA 2NQDA 5C2BH 4UYPA 5BS0D 3GO1H 4B9CA 5KUMA 4XBPA 4HS6A 4PRHA 1O5PA 3QJUB 3OXRB 4H8PA 2FHBA 1F1DA 4PS3A 1GTNA 4OLXL 1UXLA 1HEZB 2HRPL 4AVIA 2BNRD 1MH5A 4MMXA 1MFNA 3LB6D 3Q2VA 4NHCH 2YEZB 5C71A 1EO7A 1OPOA 1OE3A 2HFGL 3TM6A 3AY4C 2A74A 4KKCD 3WHE0 2CUHA 2WLNA 3FB6B 4J28A 1Q9WB 1TT6A 2PWHA 2RGSA 3DX9B 3JVFC 3OXSA 3FSZA 2PWGA 3CX5J 3VI4F 1WZAA 2KZBA 3OB8A 4XC3L 1EMTH 3ZX1A 5H2BA 3VXQB 3IJHA 1LE9A 4J1UA 2EADA 3QISA 4L1SA 4MA8H 1LP9E 4G6JH 5DC0A 3DC0A 4UIMA 4FABH 4G7VH 2PCXA 3PL6A 1TO4A 4B95C 1UM5H 4A7SA 4E9QA 2ZF8A 5FECA 5I66B 4NC2B 3V0FA 5GJSL 1IILE 4PLNC 5ID0B 1MWAH 5CN3A 5DEGA 1WCQA 5HYSA 1VB9A 3FN9A 4AMKL 3EHBC 3ZE2B 4ZO6A 1CL7L 3D18B 1S9YA 5LGKA 3QNZB 4U7MA 5GGRA 3CQPA 3ZU8A 4JMNA 4WEEA 1JBJA 3G6AB 2ZWKA 1R6VA 5IBTL 4G8EA 4Y16C 4J2QA 1Y0LA 4GIAA 1ADWA 2GB2A 2F7PA 3DXAE 4XNXH 4OCWH 1AGEB 1DANU 4IOIB 4N0FA 2F8VA 5F1OB 5GRZA 1KN4L 4IRJC 3BVNB 1YNKH 2UY7B 1MAML 3S88L 1YO4A 1PX3A 4QAWA 3CFCL 4QRPB 4KI1A 2J6EL 5EZLB 4AV0A 2ZCKH 5F3HB 1HXMB 2AEIT 3KYAA 1BYNA 3BUYA 3FK3A 3EYQC 2EAEA 1QKZH 1XCTA 4FTVD 3VD7A 1F4YH 4M7ZC 3K6DA 3LNFA 5IFJB 4EEEA 4EE2A 1QFUL 2X38A 1T0OA 2ENPA 4TVPE 3UTTD 2WN2A 3L9RB 1BVLB 3O6FD 3P4MA 5D9SB 4PJ8C 4X4MA 3QUYB 5E0QA 3HG3A 2XJLA 3BD5A 2H5UA 3ENEA 5KG9A 3IXAB 4JFXB 1ID5I 4P3CH 3EHBD 4ELMF 4OF5A 3L7EA 5AKSA 1JCKA 5I82A 2HKHL 4KNTA 5K9KA 4Z18A 1ZS2A 3MLSL 1IVLA 1AQKL 2C4FU 1SDDA 4GUPB 5F0JB 5TF1H 1WWBX 2PYEA 2WUCL 3BAJA 4Q74A 3H6AA 2ADFH 2APWA 4XPFL 4Y16D 2VXSL 4CC1A 1NC4A 3NQKA 3IPFA 1LO4H 4XNMA 1AD9A 1ET5A 1HL9A 2N1TE 3WN5C 5IMLA 1B0WA 1MFBH 2YWZA 5AZ2H 1XBDA 3KPRA 1UT9A 4OZFB 1U8IB 5F21B 3FQNB 1YN6A 4TSBH 4HGMA 5B8CB 1DQKA 4NUGH 3BP6A 4HJJH 3HVDA 2J5LB 3ZXAC 1PY9A 4HCRA 3GKWL 1NSNH 5EDSA 3QORD 1MI5B 4XCCH 1GW6A 1NCHA 4ENEC 2NW3B 1EPFA 1KSRA 1IM3D 4JJOA 3NCBB 4I9WD 5D1ZI 3CVIH 5FCSH 2EDRA 2HLAA 4PJ8D 1MWAA 2KDGA 3QDGE 4GAGH 1ZVYA 2E9JA 2EDQA 3LKQB 4DOHE 3GHPA 4MJIB 3HC0A 4HOWA 5DRXB 3D6GA 3FAXA 4NZUH 3L2NA 4GH7B 2JTDA 4QRBA 1NZRA 1JV2A 1ZXKA 1P1VA 1TQSA 3ECBB 4MBOA 2Z31C 4F8TA 2X28A 4QF1A 1Q9LB 3ULUH 4NQEB 1TUPA 4MA7H 3CUPA 4RETB 3M07A 3TZVB 3F00A 2DWXA 3QJVB 1GC1L 2K45A 4KXBA 5F9OH 3TCXA 4Y5XA 4A6YL 1WCBB 3G5VA 2I85A 1YUHB 5F6HI 4EOWH 4OGQC 4L3ED 5B1KA 4HHWA 43CAB 2VDRB 3RWGA 3T0DA 1AO7E 5ELIA 1FO0L 3EJQA 2DWDB 2CGRH 8PAZA 4H20L 3F7LA 3DTXB 5KYXA 4KQ0A 2B20A 2E6QA 3VGAB 2HTLC 2NZIA 1F90H 2VDLH 1OW0C 3IF1A 5FV2A 4ENED 1A25A 1FFOA 3M1CA 3UYPB 5KVEH 5IVXB 5F7WC 5ENWA 5SWQA 3TH2T 1DBKL 3U0PB 1KLUB 3ZE0F 4P3DB 1D9KB 1VCBC 5ISZB 4KROC 1P5VA 2VN6A 3PQYB 3P1VA 4G82A 3FB8A 2VZTA 1E4WL 2AEPH 1NJ9A 3MV7B 3IE9A 3QQDB 3D0LA 3O11A 2BNQE 3CPLA 5DVLA 1CO1A 3BE1L 4JCLA 3V0DA 2JKIS 2FX8H 3V10A 1OGPA 2DLEA 1BDYA 4HZLA 4Z7UF 1CDYA 1IBGL 3HIZA 5TFSH 4PRBA 1I7ZB 3HLAA 5FIEA 2JCCE 3Q1SL 4PJHA 3NN8A 5J12B 1GS7A 2QPSA 3LEYL 1INQB 4S1DD 4TLSA 1KFGA 2CSPA 4LDEB 3KJ6L 2H8PB 2VDMB 4XOAA 1X5MA 2DQJH 1BX2B 4E5XG 2Y36H 2CDFA 3ILQC 3R7RA 4PJXB 5CGYD 4MJ4A 2Y7SA 4PREB 4JHBA 1VJSA 1S2EA 1I8LA 3VD9A 4LOVA 2FWOB 2RIKA 2KMWA 2PCFA 4NKMB 4JZNA 3ULVC 1ZLUH 3SJVE 1KCBA 4HIXL 4ODUA 3RBSA 3DYMA 5KVFL 4M4PA 2DI9A 3SGDH 2RQ8A 2B5IC 3TO2B 4KROD 4UZGA 5C09B 1QR1A 1RAMA 2VQ4A 3FFCB 4X6DF 4ZDHA 3VDBA 4JVPA 4U1JA 3RWCB 4K5OA 1NGWB 5LVEA 1USQA 2YS4A 3PABA 4QTHB 4P5RA 4OZIE 2CLVA 4R0LA 4M43H 3WJJA 4HS8L 3L1FA 4P05A 3FT4A 3MRNA 4JZJA 2ARJB 3I6LD 3MJ6A 1LO3H 2RALA 4OLVH 5B7EA 2ORBL 2AMGA 2DTMH 4DP4X 3CSYA 4AIZA 2FGWL 5B1AB 2DD8H 3UYRL 4PGDA 2XC8A 3M8OH 3ILQD 2XVGA 2P4AB 4PJAF 3W5MA 4EKXA 5D71H 1DVSA 2Q7YB 2HVJA 1KBPA 3QJZA 1W0WB 4P49A 4K73A 4XXCA 3ULVD 1BOGB 4GUCA 1V3KA 2PTTA 2N0KA 3O3BB 3WAJA 1DVYA 2ICES 4AVKA 5EBLA 4H0IA 3ZHKA 1G7PA 2OMTB 4JPWH 5TH2A 4MMZB 4NQSA 3P02A 1HVXA 3QJOA 4R90L 2IWKA 3UTQB 2R1YB 5KVMC 3NA9H 5D4IA 4F37F 2BOLA 3H9SE 5HDQH 3RIAK 3LJ3A 2K70A 3M45A 1U33A 1BG9A 4DGIH 3CHRA 4KDWA 2FWSA 5HI4D 1LGVA 1BQLH 3LN4A 2R4SH 3QFJE 3QXWA 4OSUL 4X4YB 1HNGA 3MRMB 3BOVA 3GSRB 2CR0A 3Q43A 4LP8A 5C07E 2OM5A 4M8QA 5BZDA 2F0CA 2NTFA 3FTYA 2OYLA 3IRZA 1KEML 32C2B 1SYSB 3GTVA 4C47A 3ILDA 4HJSA 4N8PA 2DIEA 4RRPM 3VFTB 3TEYA 4O51A 2J8UF 4RNRA 5IWLA 5CU9A 2XHNA 5JXEC 2XKNB 4JFYA 4QHUA 3US0A 4D8PA 4H1LG 3GUTA 4AH2B 2BH0A 2EO1A 2P5PA 4N6RA 4OCSH 4WFHE 4JKNA 2WYZA 1MJUH 3PWPB 1YNTF 3MV8D 4CVUA 2QQLH 2VMJA 4HLZG 1AZRA 4XXDA 5I1IH 4QRTA 3K6NA 5BRZE 4G59C 3ZO0A 4DGUA 1CDCA 2DL2A 1N5YH 2DYSB 5FPIA 3AT0A 1I9IL 1DJXA 2F5BL 3FU0A 4LSRL 5DZNA 5FGRA 1T6WA 3L6FA 5DVPA 4ICWA 4YIQB 4AUYA 4GG8A 4CW1A 2DQFA 1ZTXH 1T21A 1RJYB 4IIZA 5FLUA 2C9XA 3EGSB 5DWUH 3VH8A 2JQZA 1E8YA 4CNIB 2H26B 4PJFE 1U92B 3CH1B 1H3PH 4A6YB 4K7PX 3MJ9H 1FZKA 3ZLQC 4N2KA 5C0IB 4AL8H 4FXGC 4FOMA 1M6OB 4LZKA 5KSAB 2XZCL 2WQRA 2IADA 1TETH 3D39D 1FO0B 3DRQA 1KB5B 1UUNA 3H0TA 1HH9A 3EJJX 2IOMA 5TGBA 4IEFA 3I6GA 3MREB 4PRNA 3MNWA 5JXED 3IFOB 4ZMOA 3DI3B 1ZLUK 2J72A 1B0RA 4L1DA 2ZSVB 1MXDA 1MIEL 1J0ZA 3H42L 4WUUA 3N0AA 4NBXB 3IVKA 2GCYA 4D3CL 4NJAH 4NQQA 3GUFA 3ROLB 4DEUA 4F9PC 3JUZA 3ATAA 3MLWL 3SB3A 3BJ91 3WIHL 2DWTA 3NJLA 4LPXA 4UT9L 4UCFA 4F15B 1OWWA 2VXQA 4IGBB 4WDIB 2DQHL 3QUHA 3VNZA 3ZYIA 5BJTB 3VGGA 3HNTL 5C0NC 5D1XE 4R8WL 3QDJD 2IALA 3U1SH 1WWAX 3WTTA 4LVOC 4HPYH 4XPGL 2ZXWB 2F8OA 4KX8A 4G80B 1BQKA 1U2YA 5HGHA 1DVFB 1AP2B 2XWRA 4RFEA 4A1RA 4JKLA 1I8KB 2YKKA 2ALAA 1U8MA 2IDSA 3BZDA 3E0GA 4GRWF 2QVFB 4JG1H 4N90D 4WI5A 3QO1B 2VDRH 2I7SA 4UMGA 4WFGE 4LBEB 1A4BA 4EN2A 1ORSA 5T5NG 2PCPA 1OAUH 1AZNA 3OG4B 3ILPB 2XBDA 4O4YL 4HKJB 2Z4QB 1W2KT 1RIHH 2ESVB 2ROYA 4DH2A 4J8RB 1M56B 2X4TA 1UASA 1PYWA 1F3JA 2FD6H 4DWHA 4Z7WB 1JI1A 5AAMA 3QWRD 1KCWA 4WQOA 4YX2L 3PUUA 5D1QB 3WO4B 4OU3A 5DC2A 3OM3B 3C5ZA 4EJ1C 2X9XA 4WO4B 1L6XA 2ITDB 1PX8A 3QJRB 3ZHFA 4UTBH 4FNLL 4S1QL 2YJLA 2WLKA 4IRJA 4L9LB 5I26A 5F3FA 4X4XA 4BHUA 2RFXA 1YEKH 2EEBA 5C0ND 5DJYA 1LEGB 2HFGH 2JSFA 4UAOC 3D3VB 5C0BA 4APQA 1JZ2A 2VITA 3NCCB 1X5AA 4IRSB 4AYMC 4I2XB 3CN1A 1NCWL 5BOZG 1ZJBA 4OLZL 5M7QA 3DX6B 2VDMH 3BEVB 3IFPB 4JRXB 1JFQL 4C56E 5K5YA 5IFAH 1OGAA 3FT3B 2X3AA 4W9IC 2IH3B 5I0ZA 5GJTL 4WWKB 1AXTL 5JDJA 3N44F 1BREA 3MU3A 5DVOA 4PVBA 4N0UE 5I1GH 4QRQB 3MI6A 2E7MA 1E0OB 1XZ0A 1IKNC 2XTJC 1GS6X 1KT2A 2X70A 3NSCA 2CIKA 4FJYA 4NAJA 1LTXA 2R56H 4AYDC 4B96A 3IS0X 1CL7H 1SOQA 1TPXC 1YEFL 4NDMA 2VL5A 2FJUB 3SPHA 5FYJD 5L2KA 2ADIB 5E5MA 4M61B 1K3ZA 1OCZB 4UUJA 2LFGA 3WN5A 3OAYH 4OGYL 3AVEA 5GGTH 4X5XB 4JFFD 1DEEA 5KZCD 1UKTA 2VR3A 3ZTJH 5D1ZC 5DFAA 4NO2A 4LGPB 5KWYC 1KXTA 4FLSA 1R75A 1UADC 2CJSA 2TRHA 4ODBD 2BHUA 5LWYH 4PTUA 3GMMB 5E00B 2Y3NA 4TNFA 1C1EL 4M6AA 2EC9U 1V3LA 3ZDXF 5DTFB 2H0FA 4AEIL 2GITB 2GY7B 2JI3A 1M7XA 1FNLA 4IW4C 4ADGA 1V7NL 1SLVA 3CLEL 1JTTA 1Z5YD 3LH2L 1Z9SA 1IM9B 3PPEA 4PJ5A 3JWNH 1T20A 5GHWL 1M9WA 2E9IA 4XMLL 2BHYA 2XTJD 4ZAKB 4AYFA 1FV1A 1EO8L 2Z31A 5CHNB 5F9DC 4BGDA 5BUPA 4UBDD 4U31A 2G4GA 2HKHH 4JG9A 4HOMA 2D7QA 5I1LB 1AYRA 1MRFL 2XIBA 4JDTH 1SVBA 1VPOH 3MLSH 5ICUA 1QNIA 4I0PB 4UTBA 2OCFD 4DFHA 2OL3L 2WUCH 4PBXA 2P5WE 4PTTA 2Q20A 2UUDH 5IEKA 4IU2A 4ZS7L 5SWZB 1F00I 2B1HH 3FT9A 5JHDD 3NP4A 1UXWA 2JE8A 3HHMA 3BEWB 4YNYA 5CO1A 4NIKB 3EBAA 4IK7A 1F0LA 1ERNA 4F91B 3AU1A 5C0CE 1SF5A 3LKRA 3R0MA 4E42B 2ENQA 4H0GA 5JMOC 3I2CH 2EEFA 3OAZH 2AJXL 5GSRB 4J6RL 4B60A 5KSBA 2WXMA 3AQYA 3L3OC 4ANWA 1RUQL 1YEHL 1KJ3H 1UZGA 5F3BA 3CU7A 3ARVA 1RV6X 5DMJB 3IXTA 8CGTA 3EFOA 1RZGA 2ZF9A 2ED8A 3VSUA 3PWNA 1KWGA 5D93C 4ZUSB 1URZA 2GK2A 3VXRE 3HJ0A 4RFNC 1CTMA 2IH1A 1I85C 1VKXB 1S8DB 2B9BA 2R9HC 5EUOB 4YWGL 1P9MC 3JZ7A 4UV4L 2EUZA 1IGML 3WNIA 2CBOA 1IIIA 5AVWB 3NMEA 1ACZA 2G3MA 2WBKA 1VZGA 3QUZC 1WZKA 4KVCH 2YFOA 4KRPB 1N9PA 4MZ3A 4Z7VB 5I17B 1X7QB 4HWNA 5GGTA 3AWFA 4QGTA 3MRBA 4AGQA 1CMOA 2AQ1A 2R0KL 3SKOB 3NABH 3FT0A 3U25A 3WGUB 5JW4R 3MNVB 1P5UA 4IM8A 3SQOL 4YSEA 4LARL 4FYSA 4Z3JA 4BD4A 1PFOA 4W9DC 4Q2ZB 1IAKA 3O41B 1MFCL 2SEBA 1AQMA 3O45B 2JJUA 1FO0H 1KB5H 3ZQWA 4E0RA 4V11A 4LLQB 2GSGB 4B3EA 3JTBA 1RZKL 2OSLB 5DJXA 3SE4A 1WHOA 1DQVA 1ZLDA 2O4EA 3L5HA 3A6BH 4GNKB 1S7XB 1FN4B 2DQUH 1U8OA 2DYRB 1DUZB 2JKXA 3GS7A 5TQ2H 4L29B 1X44A 1MIML 3UJJL 3CFEA 4AG4L 4CSZA 3SDCC 4FNQA 4Y5YC 1R24B 2GJPA 3DPBB 4ERSH 1E4WH 4NNXA 1PLGH 2CR6A 5D5MF 1CGTA 2KPWA 2R9HD 3NIGE 4NB7A 2LR4A 1JYNA 2Z7UA 2RHEA 3X12B 3PGCB 1THCA 2CDGA 3TF7C 3QUZD 1YPZE 3RTQA 3V0HA 1TZ8A 4JY4B 3I9GH 2VWEE 3QPQD 5BUAA 3NJNA 3GBNL 3BDXA 1A6UH 1DVTA 4FKEA 3QEQD 1CICD 2H3NA 3MLVL 5C1MB 2MOQA 4LSQH 2XVBA 3MN8A 1FG2B 3KJ6H 4XE5B 2AJYL 2ZNXA 4PCSA 5IBUG 4LHUB 4GW1B 1TQUA 1T7YA 2P28B 2YUXA 3HCVA 3I6KB 2F74A 5F71A 4BQ9A 2OTUB 4UM9B 1K8DA 2BSRB 2GBTA 3HG1B 4ZSOB 1Z0MA 3W38A 5F6IC 4Z7QE 2X2IA 3SY6A 4R4FH 2DTSA 2H1PH 4HMCA 1TZGL 4AYEC 3SEPA 5C0AA 2FO4B 2A9MH 2W92A 2NY4C 2G3ZA 5CXPA 2IGFL 2NY3C 4J3OH 4W9ZA 1L6ZA 1MSPA 1RMFH 5DUBB 5E6YA 4A2DA 1RZ8A 5GS0D 1NGYA 4G9FD 2WZPD 4RGMC 3G04B 2W1NA 5CILL 5JOPE 4FQ2L 5J13B 3GHBH 4XX1G 3L3IA 5IHUL 1J48A 2QEJA 3WFDH 3NQIA 4X5RA 1YY9D 4JFEA 1Q9OA 4UQBA 3I75A 3WSQL 1JI2A 4Y1AD 2BZCA 1ZIBA 4KMTH 3STBA 2ATKB 2CO6A 2B14A 3PG2A 1BFOB 5LN8A 2E59A 43C9A 3E6FA 3HC4H 3JV6B 2YD1A 5DHVB 3MV9E 1T5XA 5F7HA 3OAZK 1TZIA 4Y9EA 3G08B 3QPKA 1U0QA 4X5WA 5HGAB 5DYFA 5CN2A 1JWMB 2VLJB 3D12B 3S5LA 3EADA 3EGDB 5EIVA 3BO8A 4YZFF 1AR1D 3NIDF 4HAFA 2RA1A 3B9KC 4YE0A 3MRQA 1RI8A 2XX0A 1H3VA 3DROB 5T1DH 5GS2H 2NY4D 1FPTL 4KXAA 5FB8A 3MRFB 2NY3D 5DJ8B 3KPSB 1I1AB 3BDYL 2G2NA 3SQBA 1E4JA 1F4WL 1HILA 3VI4B 1A21A 1E7UA 1I3GH 2AXJA 4R90H 4WTQA 3GGWB 3IJ9A 4HUWA 3MNDA 3BI9X 4PJCA 5IF0B 1CFBA 3WKMH 4LLVB 1S7UA 3JQOB 3OWEA 2A9DA 2GI7A 3J2PA 4UDUB 3JWDL 1EBAA 5CD3B 1JXKA 3GD1C 3LNGA 2OL3B 4JREC 2W9DL 4N2IA 3WCYA 4WGVB 3TIDB 2OJZL 1IB5A 2IANE 3SYQA 2UYLB 3EDKA 2JLPA 1DJHA 3UO1H 3VD1A 2QPUA 3C8HA 1KZQA 1OPGL 4ORGB 2P80A 4PWGA 4WK0B 1HWHB 5L4JA 3PIQA 4YH6A 4IBUA 1LLAA 3ASWA 2BVTA 5HGGS 3L1EA 3PP4L 1KELH 3HKZA 4KK9C 5E5UB 2A1WL 2F7RA 3T6ZA 3L81A 3WDHA 3AM8A 5BOJA 5J5EA 1BPVA 2OI9C 4PYHA 4UQAA 5E56A 3B9KD 1GGUA 5FUOH 3TX4A 2EXWC 2YD0A 4E9WA 2IDUA 3NZSA 4QT5B 4GKLA 5IMOB 3UCQA 5JLZA 2BC4A 5CEYA 2R83A 1I7UA 5AYUL 4OFYA 1I9IH 2MWCA 5D6DA 2W65A 3LEVH 1ORQA 5CP3H 2YGOA 5JPMA 1KTBA 5F9WB 3S5YA 3FCTA 1HAUA 2FE0A 3AXLB 3M17A 1GOHA 3KNBB 4OAWB 5E51A 4E9SA 1EFXB 1AY1H 1MI5E 3GHEL 1J5IA 3A4DA 1TENA 1LEKA 1ID2A 3G5WA 4K5PA 4AQ8A 3EOTL 2R51A 1RP9A 2Y7NA 5DD6B 3ARBD 2CM6A 4JHAH 3FB5B 5JTWA 1HHGA 3C12A 4FYTA 4ELMB 4HUVB 4K0OA 3RAJL 1NC2A 4WK4B 4MJIE 1IMHC 4UQ3A 1FBIL 2XZCH 2VABA 1EJOH 5I5MA 2EO7A 4KK9D 3MJ8A 4OF7A 2JB6B 1UACH 2G75B 2R2HA 1TJIL 2Y1ZA 2YD5A 3FRUA 3C09C 3EYOA 3QQNA 4P9HC 1MIEH 3H42H 3HMXL 3IU3A 3D07A 3IKKA 1AJ7H 2NY5C 2UXFA 1F3DH 2EXWD 3OKMB 4UOJA 3TLRA 4A2GA 5J1SC 4HPOL 4MS8D 4P5TC