2CGZA

Structure of helix pomatia agglutinin with tn antigen
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Recognition of Breast and Colon Cancer Epitopes Tn Antigen and Forssman Disaccharide by Helix Pomatia Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords AGGLUTININ
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cgzA00
3WMPA 2VM9A 2CCVA 4Q56A 2W95A 2VMCA 3WMQA 2CE6A 2VMDA 2VMEA 2W94A 2WN2A 2WN3A 2CGZA 2CGYA
chains in the Genus database with same CATH superfamily
1R24B 3TJEH 3ABGA 3CWGA 1G7JA 2GUOB 1AHWA 4K2UL 1AIFB 1MI5A 4YN3A 1QLFA 3RWFA 2XUWA 2VDKB 4PN6A 5B39A 4ZPTB 1DQLH 1JMZA 3FRPB 4QWWD 1MUJB 4XPGL 2E7LA 2VMDA 5IK3A 2OS7A 2UWEA 4B50A 4X4YA 4ZTOH 4KKAD 1Z9PA 4WU7A 5L7XL 2VERA 3U1PA 1WJ3A 1TVBA 1C08A 4NWTH 4RIRB 1DSYA 4H20H 5DVPA 4P06A 12E8H 2P26A 4Q56A 4R83A 1AQDB 3NJGA 4NGHH 2CHNA 2YD7A 1JGDB 3PV6A 3SDDC 1MI5E 2UXFA 2VXQA 1I9IH 3CVHB 3D12B 3GIVA 2F2HA 3UJIL 2BVQA 2NY1D 3HB3B 3ECWA 3SKMB 1M42A 3X3FL 5CJXC 3ZSSA 3PPSA 2Z31D 5FYJU 5EU7C 4L9LA 1TOXA 4WI8A 4P05A 2PLTA 3UC2A 1XSJA 5HHNB 2CDEB 2BNQA 4XB3A 1X7SA 4PJIF 3L9BA 2NZ9D 3KYAA 3L5XL 5TE6H 4PJGE 1Q1PA 2P42B 5CJQL 3ZO9A 2CHWA 2E86A 3B9EA 4KRPB 3D2TA 4CW1B 5A16A 3HRZB 3VSTA 1LYQA 3W0WE 4BFKA 4HJUA 5A3ID 3M1OA 4UDUB 1KXVA 3L9RA 2F1BA 1IILE 3O2DL 1MJUH 1CXFA 3WN5C 3LQZB 3PJSB 1D9KC 4J3UA 1RZ8A 5D7JB 1VEOA 1MRFH 3TBCA 3BZ5A 1A14H 1D5BA 4HOZA 4HPYL 1MUJA 2RQEA 1DVFB 2OMWB 1GZHC 5FPIA 1XGRA 1YEKL 1SUHA 3SIKA 3U4AA 3BZDA 4GXVH 1F2XK 3NAAH 2ITFA 4GSQA 5CFAA 1DZBA 5IQOA 4XVTH 1HHKA 43C9A 4F80A 1MHPL 5E23A 1SMOA 3GBML 4PM1A 2FHCA 5HP5A 5KSBA 2PWFA 1SXZA 1JL8A 1CICB 2ICEA 2X2YA 3NCJL 5BUAA 4PP1D 2EDOA 4FL4B 4KKBC 1LEIA 3JUZA 2DJUA 4ENZA 1ZLSH 4QLRA 3I02B 5DMKB 5K9QG 2DLHA 4OFKA 3TV3H 1TO5A 4B95C 3TPUA 5KSAA 3TZVA 3QUZA 1A64A 4M43L 4F2ME 2WBKA 4YHKH 4KKLD 3PHOA 4YGAB 1KJ2L 4ZXBD 2W9EL 1GXEA 2C9RA 3V8OA 2V2WA 1PKQE 4MZ3A 1E2ZA 2EC9U 4MAZA 2CM6A 5C0FB 4B27A 4JHUA 2NY2B 2I27N 5BJTB 3M07A 1GS7A 5KSBF 2G75A 4MHHI 2P8PA 1KG0A 2GFBB 5A3IC 3P3TA 1H15B 4HIHB 1S3KH 2H2SC 3KWWB 3OJ2C 3FB8A 2BVYA 4QTFA 1RULL 2R0KL 1NEZA 3L3OB 3UJTH 4JN2A 4LEOB 5EZOL 1C5BH 4JHBA 1J5DA 2MRYA 5FUOH 3OAZK 1PLCA 5IW6A 2HH0L 3RL2A 4ZODA 3VFWB 5D2LE 4AQEB 3WD5L 4JM0A 4YSTA 2P5EE 3Q3GA 3T6QC 1CICA 1MCIA 1JGEA 3AY4A 5E4EB 2Z93B 3JWOL 3WFBH 4OQ1A 4ZOAA 4X4ME 3RWIA 1U3JA 3NOIA 1F6LL 3IFLH 1I3RB 4NENA 2KQMA 3QS2A 1F41A 1ZY9A 4NAJA 2FQFA 3O2VL 5I28A 1NA8A 3FTUA 4U1IB 4GUOA 3DUUB 5GRWA 1GGIL 4LOUD 3UZQB 3R0NA 3WXWL 4B3EA 5KYYB 2ZSVA 2DYRB 3TBTA 2DBJA 3I2CL 4HULB 4XO8A 1WWCA 1BJ1J 4OIIH 2KL6A 1T0NB 2C9SA 4TLSA 3ZTEA 3L3GB 1OK8A 4X9HA 5GRYA 2CA4A 4BSWB 1CLOL 3LD8B 5JA8B 1M53A 3IU4L 2XV3A 3GLAA 4UZSA 3LIUA 5KBPA 4ANKA 1KEGH 3U4EA 2A3TA 2JQZA 3CSYA 3IFNH 1DJXA 5ISZA 3UTPE 4F9LC 3SDCA 4NUPA 1MCHA 4LLDB 4P99A 4N0YH 1HQ4B 1RP9A 3FOMA 4IKNA 4KJWD 3QUZD 2HKFH 2P5ED 1YO4A 4G7RB 4N2IA 2NR6C 2RB8A 4HUMB 4Y2LA 2P7TB 2X6VA 4FG0A 3W11D 4QRAA 1MNNA 1UUSA 2LU7A 3CZLA 4U0RC 2R83A 4TF4A 1WRFA 2H6OA 3BFQG 4OLUL 1A7QH 1TVBB 5DHVH 2FIKA 3K3QA 4KROB 2OZ4A 3FHAA 3KPRD 3UZVA 3FN0L 3NIFE 3ZDXB 5F89A 5CBAB 5IESH 4P3DA 1B3IA 1CF1A 3WFDL 4N8CH 4G2AA 1CLYL 4WV1A 1L9OA 4OB5L 3AXLB 4M8RA 2XN1A 3TPUB 2FX7L 2H2PD 4NZRL 1EEQA 1AHWB 4LPXA 2DLIA 2MCAA 3AXHA 3ESNA 1MVFA 1GZPB 2FX8L 2W88A 3LVEA 2Y7SA 1MCLA 5G5DB 4JK0D 4E42B 1R3JB 1QTPA 3UGXA 4DGVH 1MREH 4V1DA 5D1QC 3VGHA 4ZOBA 5ICXA 2BY1A 5DK0B 1AZVA 1MHHA 4KTDL 5F6HI 2H6PA 1AQKL 3ASOB 3EF4A 1HHKB 2PPCA 1WTGT 4ZPVA 4YHMH 4UBDD 3SGDH 4Q7DA 2WTPA 3OR6A 1TTBA 1IJ9A 3WFCL 4ZSOA 3V5DA 4N22A 4GXFA 2EEDA 1F8TH 2A9BA 2H2SD 4AW7A 3EHBB 1DQJA 3QT2A 4PJBB 2W0PA 5BS0E 1YEJL 1FN4B 4Y16C 1CZ8L 3OG4B 2V33A 3MJ9A 4Z77A 3CDGA 2MFNA 3LRLA 4Q89A 3S37L 1QFWI 4MXVE 2YD2A 3UO8B 4K9JA 2EIZA 3BD5A 4J8QA 3AS1A 4NQED 3L3HB 3F7KA 5J06A 1RUQL 2EDTA 5HJ3B 2XVGA 2DJSA 3V0WH 1IEAB 1UHVA 1Z3GL 3MV7B 2YK1L 4LDCA 4MMZB 4TQHA 4KKRA 3V6FB 4F8QA 3HRZC 1HESA 5CJ5A 1A3ZA 1NJ9B 5G2NA 1CGVA 4PBVC 1IMHC 1N3NB 3NSDA 4JFPA 1B2WH 5I0VA 1KJ3H 1PIFA 4TSBL 2CAKA 1AS6A 5T33L 2FJFB 4M5SA 4JPIA 2P24A 5FC9A 4L1SA 4L4VE 3U83A 1DVFC 1QFHA 4ZFFB 1T04A 2X6MA 1NIAA 4FTVA 4KDTA 2G3XA 4XOEA 2Y07H 1FYTA 3X14B 2BNRA 3AVEA 4PJ8B 5C09D 5HI5C 1O7VA 4X6EB 5JXEA 5LWYH 5EOTA 1L4IA 4JJOA 1UWGL 3V7AE 3IJ9A 2R7EA 5EOTB 1KELH 4KI1A 4TNWF 3K71A 4CL7A 4X5WA 1R0AL 3MRPA 1HHIA 4MAYB 4OM0L 4PJ9B 1CLYH 2IBZY 4DKFH 1WGVA 1R5VB 3W2DH 4M8UA 4PRHB 4J3OC 1RHHB 1QFPA 2IO5A 1AIFA 1SY6H 1UFGA 1IM9A 1WT5A 4XC1L 5JQIB 3GKZA 3H1ZA 4KMQA 3N42B 5ILTH 3ME0A 5BW7C 1X3DA 1HOCB 3KVPA 4N9GA 4GXUN 4TL5A 5C0GB 4OT1H 5AB9A 2X0UA 3V0IA 4PJFF 3TH3T 2C9VA 4G8GA 4TRPH 3B7UX 3MV7A 2VH5H 5F44A 5KVFE 1K8IB 1KLFB 3KLHD 2DIBA 3FQNA 3N43B 3JZYA 2C4XA 2XCMC 3VFGL 1EK3A 1IM3A 3TWCL 1P6WA 2OULB 1T1XA 2ID5A 3AS0A 1UM6H 3IDJB 5GGTH 3US1A 3DUSA 5J4MA 1GTFA 3A4DA 4OLXL 1S7QB 2ED6A 1V05A 2UY7A 3ZKMC 4Y1AA 4R90H 1OM3L 3T71A 3RHWF 3OGCA 1E7VA 2DN7A 1M9WA 3QPXH 1G9NL 2N3JA 2IH1A 5JTWA 5E2WH 3OAWA 3E38A 4RFNB 1T4WA 3P02A 3E6FA 3UJIH 2Z4QA 4X98A 3I9GH 3VFSA 2Q86A 3BT2L 1OTSD 5JHDE 1F6FB 1L9SA 1E8YA 4Y5XB 4JFQA 2EYRB 3TBWA 2WWKT 2XQBH 2NQCA 1DSFL 1QI3A 4P9HC 4V1DB 1QLRA 4I48B 1JDAA 3HI5H 4W93A 2ARJB 1O6TA 1IC7H 3TJHD 3W9EB 1B2WL 4O02B 4W1TA 1VSCA 4FQHB 3FS9A 1NCNA 1Z9OA 4N86A 4F91B 1LLAA 1JZ4A 3VW3H 1QX1A 1N0XL 3NEOA 4OGZA 4XVUD 5LG6A 1GMIA 3MV01 2DMBA 4JZNB 2DQDH 4LAQH 3I9PA 5D1ZA 5DZAA 4R4ND 1R5IB 5AW2B 4N2BA 4HXBL 4LPWA 1DBJL 2MQ0A 3VRLF 5IWLC 2IF7A 5KSAC 2VDNL 5HGGS 4FFZH 4DGUA 1TTFA 3N55A 4GSXA 1YEHL 3KNBA 2W07B 2J55A 4R3SA 3TXAA 1TPXC 1MG3C 2XWEA 4GAJL 5DI8B 1JK9A 1QSZA 2N7SA 3Q5OA 3QH3B 4NKOA 2NX5E 4AYID 1CD8A 1OE3A 2YS4A 2ICWB 5EIVA 4CADA 6PAZA 4U3CA 1L7TL 3SGJC 4JPIB 4Y1SA 1V3KA 3GINA 1N10A 4XP5H 4UT6A 4XPAH 4EI6B 2YEZB 4JL1A 2VXQH 4QTIL 2AABH 2AI0L 2BSRB 3Q8AA 2EDHA 3FO1B 3T6VA 2ZKXA 3WYRA 4DZ8A 5IY5B 1EDQA 1GYAA 1ZEAL 1S5IH 2DIJA 3TO4C 3D25A 5I16A 4RQQB 2I07B 1TZHA 3T8MA 1F1DA 3G5XA 5TDOA 2EDXA 2JKLA 4JPWH 4H2CA 4K71B 1U8IA 4B97A 5MI0B 3KPSD 4OZFG 2D0HA 4PU2A 4M1DH 3L3IA 5F0PB 5IV2A 1BD2B 4YHKL 3G6AA 1T1WA 4G6AD 4G9FD 1RUAH 4YHIB 2HVJA 2GIYA 3M7FB 1ID2A 2E7DA 1IM3D 1HH9B 1UA3A 4EZMA 3OX8A 1T5WA 2YBRB 4QHKI 5D7IE 2R69A 5I8KH 1VADB 1G9NH 2D4DA 1EEUA 1VA9A 4NDMB 4Y4KA 4B53A 1W8EA 3NN8A 3TASA 2EDWA 4U7MA 5IVZB 1VFOA 1DN0B 1JZ2A 4YBHA 1M7DA 4PVMA 3SPJA 4YXLL 4YHNB 4I9XA 3QORC 2ENYA 3NUKA 5ITFA 5JYMA 5BPPA 1BJ1H 4LCIH 4XCEA 4NZFA 2CBTA 4BQCA 3OJVC 2X3AA 3D09A 3TGXA 1R3JA 4N8VA 2WXKA 2H32H 3IJEA 2AXFA 4P3CL 4BXSV 4WI0A 2A73A 5EO1A 1OALA 4L1BA 5TDPB 3BSZH 4JKNA 3LS4H 3PWPE 3S97C 1QR1A 3FU8A 1A6UL 2OLDA 4ZS7H 5AFAA 4LP4A 1Q72L 1H3WM 4UTCA 5HD8D 3SDYH 2CRIA 3VB9A 1I9EA 1N8ZA 2X4UA 2ZCZA 2AV1A 3KJ4B 2XN9E 3CXDH 5C2UB 5D8JL 2OCFD 4K0OA 4JZOA 1KBGH 3U4BH 3OAUH 5BQ7B 4N5UA 4QXGH 5KJRL 2VMFA 4PJHB 5GRJH 4QMEA 3IFLL 5DMJB 3OKEB 1YDPB 1NUFA 2ZUYA 5HDBB 1CJYA 5LBVA 1AG6A 5DDHA 3KH4A 1SFHA 3T9WA 2Q3ZA 3OKDA 4PJFA 1W15A 1JK8B 1AACA 4KPHL 3DPDA 3TIDB 4NHUA 5C0RH 1L7TH 3MJWA 3MRCA 5IVXE 4DQOH 4PY7A 1A9BB 2BPBA 5CO1A 4XPAL 1WA0X 2NXZB 1JPTL 1ADQA 3MOAL 4WQOA 4D2NA 3B3IB 2ADFL 1IFGA 1VB9A 4FQLL 4WKZB 2Y2YA 4OLYH 4C56E 3QUZB 3IDJA 1WICA 4IIZA 4I3GA 3STZA 2CO7A 3OJDA 3U2IA 3BVUA 1K5WA 1H8OA 2HJFB 5BVJB 3AT8A 5DZPA 3PWPB 4J6RH 3KWVA 3QDGD 3UBXG 1J0YA 4PR5A 1MHPH 1XB8A 2J4WH 3MCG1 1U8CA 3MV8E 1Q0XL 3KJ6H 4BM7A 4ZO9A 3NTCH 4HIIB 4ZUSB 2MCPL 2IDFA 5C0GA 1ET7A 4IRJC 5D7LA 1XXDC 4B9PA 4UQ3A 1HJCA 4FKHA 4M61B 4FQQA 4URTB 1YY9D 3E7JA 3LPWA 2ZWKA 2A4ZA 2Z4TA 5FA4A 1ZRUA 4ZFOL 1OAQL 2VZTA 4XNMB 3IMRA 2BOCB 3APNA 5FHAL 5HDBE 2YAMA 4YIQA 4M43H 4H0GA 4KVNH 2HWZH 4I13B 3B2MA 2ZOOA 3B2XA 3EO9L 2OMNA 4KUZH 5LDUA 3TEZA 2X4RB 1RFDH 3IBOA 4ODXB 5CCHE 1EBAA 5JHLA 3OLIA 3BUTA 4GKNB 3UC0L 4OJFL 3GI8H 1Q38A 4PJ8A 2GK2A 4OB5H 1NFIB 1S78D 3IJHB 2BW5A 5HPMA 2FX7H 2NDFA 4NZRH 3M1CA 4FP8L 4XMPH 4TS6A 3MLPA 5DSCA 3ECQA 4PRHD 5E5UB 4FHJA 1JZFA 5FO7B 3BVTA 1L6ZA 1XBRA 1RSFA 2WO3B 3QUMH 2X53A 2B59B 1ANUA 1QKZL 3HE6C 3ROLB 3KH3A 1GVIA 4M6AA 3OKNA 4HUXB 2VKXA 2KZBA 2L7JA 1TYJA 4J4PD 4LU5H 5E1AA 3W56A 2R4RH 1DLFH 4FTDA 4QHUB 5E1QA 3L3HA 5D7HA 2C1OB 4J3SA 4C54A 4X0KA 3DGDA 4K7PH 4Y5XC 1JGVL 3U9PL 4AEIL 3S7GA 1E30A 5I1DB 1DJSA 5HHOA 4LSUH 1JAEA 4X5XB 3AITA 3DGGB 3BE1L 4LPTA 1U8HA 4MD5B 4OCWL 4MVBD 1M7UA 2F6AA 2VLLA 4Z7QB 1JPFB 4WK4B 4U6YA 3FT9A 3GDBA 3UROR 2Y1ZA 2OZ4H 2AQ2A 1MI5B 2D03H 2BFVH 4PJIE 4WI7A 5ETUA 3REWB 5CSGA 4EEEA 2C3VB 2YN3A 4PB9L 4ZS6C 1HHHB 1T89C 3GSVA 5SWQB 6CGTA 1PS3A 5D7SH 3UBXB 5GS1A 2V8MA 1ACCA 3F2LA 3HN5A 2FWOA 1YYLL 3T09A 1IE5A 3IDNB 2MCPH 1RI8A 1YVLA 3O81A 1TJXA 3G6JF 2QPFA 4XN5A 4ALAL 4ODTL 2X44D 1LMKA 1WAAF 4YHOL 3IETB 3KPLB 1Q8MA 2BJMH 3R4DA 1CGSH 3FTVA 1FSKC 4L5FH 2XN2A 2UVEA 2R51A 3BZFB 3QEHB 4XHJC 3SY0B 4P2OD 8FABA 1BAFL 5I1GH 4BQBA 4JFXB 3R8BB 4TV3A 4AUJA 4HCRA 1M6OA 3VVVA 1E5UI 4KVNL 1RP8A 1TLMA 3ZR5A 1OSPL 1LK3H 2V17H 3I3BA 1MVYA 3O11B 5FDWA 1UKQA 3TEYA 3UABA 1Z9MA 4XOAA 3TESA 2BS8A 4H88H 1DJGA 1KELL 1NCDL 1XCTA 3EJPA 1QFWM 3L6FA 4Z7QE 4PJEF 1YMHB 1MHEB 1HEHC 1NPJA 3E3QE 2FLRT 2G30A 1MCOH 3MRIB 3GMQA 1CGYA 1T6WA 2K78A 4KKLC 4PJIB 1YNKH 2J8HA 2WYIA 4NFDA 3VXPB 3EH2A 2F19L 1UZ8B 2FO8A 3KPSA 3V0VB 1U8NB 4KRPD 2ZP0T 1B4RA 4LMQI 3O8XC 4M93C 1LD9B 1OAYL 4Z7OF 4B96A 3J8F7 2WTOA 4GBXB 1BM3L 2ZP8A 1PCSA 1GC1H 2DLTA 4RGMB 4EDWH 1HINH 3A67H 4M9OA 5C9JB 1R3LA 3H9HA 2NY6C 2E47A 3IE4A 2D7TH 4I1NB 2VDPB 4KQ4L 1MCJA 5DMIH 1U8QB 1MW3A 3RTQA 3NRPA 5I1HL 1Z0MA 3CVHA 2H9GB 2V0AA 1DUYA 3G6DH 1A3RH 1OP4A 1TQWA 1EXUB 2WVVA 4MZIA 2A9CA 5DHMC 4YR6A 7PAZA 4ODXA 1HCFX 2APWA 2MNWA 2R2HA 2Q87A 2UX7A 5A43C 1KNOA 2FX9H 4HIXH 4WU7B 5EULV 1SBSH 2PO6A 3BUPA 1I1FB 1VEMA 3AS3A 4R90L 5HHPA 5CZKA 3EFDH 3OZ9L 3MV9D 5LBGA 3KL0A 4WWID 2AXGA 4F5CA 4AM0Q 3TYFB 1G7QB 2YGPA 3VGEA 2CO2A 4RWHA 3QIBB 4OZFB 1LL1A 2QGEA 4JG0H 1LDPH 4QRQA 5FM8A 4GBXD 3ETBJ 5E2UL 2FJGB 1A02N 3DNKA 1U58B 3Q8CA 1J9RA 4HK0B 4N0UB 4X6CE 1FNGA 1ZAGA 5CD3A 2Y36L 3DBXA 4Z0XB 4ALAH 5BRZB 1CD9B 4L1LA 5HI5D 4TUOB 3KM1A 4HGKC 4FGMA 3SCMB 2A5UA 2E9GA 3HZMA 3VXSA 1OAXL 4D3CH 1S9YB 2DMKA 1E4KC 5F71A 4ZK8A 5DUPL 2QBWA 3BCFA 4PJGB 2VDLB 4LQFL 1JDDA 3V6OE 4RGOL 2DWEA 2E75C 1BAFH 3KPTA 3LPFA 4FQIL 4HZ1A 4LZKA 4TQIA 5E0FA 4XBPB 1RPUA 1W72B 5EFIA 3MUGA 2FD6L 3FT1A 1ET5A 2HVBA 2WYHA 1FP5A 4EVNB 2GITB 3FUMA 2GFBA 4A66A 3QUKB 4G1MB 5C6TL 1T80A 4OD3L 4MJ5B 1AYRA 2EP6A 3WGVB 1TQTA 1MCOL 4TSCH 4AEFA 3OC5A 2MTPA 2NTFB 4N2AA 2YFOA 2ZNXA 3GM8A 3MJ8B 4OCRH 4Y9CA 3PY9A 2C8NA 3DYPA 1TZAA 2E4TA 4DOHE 4H26B 3SKNB 4MLSA 1XT5A 4S1SH 4Y2OA 4ZAKA 3S5LG 1B0IA 3MBWA 1IAMA 4KX7A 4M1CC 3ZL1A 1H3XA 2ITDA 1WFOA 4G43A 4XNDA 2G5UA 2FRGP 3BP5A 4OD1L 1G9ML 4JQVA 3MYJB 5EPMB 1K6QL 2NXZC 2ZOKB 2CIKB 3A22A 2XJKA 4HPOH 4G82A 1DYZA 1IGFH 1IGCL 3BWAB 4JFYA 5HYIA 2KKQA 3FFDB 3WLWD 4FXTA 4PCTA 3I6KB 4TQEH 1OD9A 2EQDA 4GY4A 1T0MB 1XZWA 1DBBL 3ZE0B 3GMOA 3Q44A 1F42A 1P4LB 2R1WB 3R06A 3QJXA 5CKAA 1FGNH 1KMGA 1RURH 2VR8A 3G9AB 4QRBA 2IGFH 3HCVA 4M4RA 4LDOB 3OKMB 3VFTA 7TAAA 2EYRA 3TBWB 2SEBA 5DTFA 2WW8A 4EE2A 1MWAB 5IJVA 2F0CA 1N5YH 4IGBA 1BSIA 1CBVH 5D93C 2ESVD 3EFDL 5CZXC 2OMTB 2K4WA 5ABDE 4A1RA 1KYDA 1AR2A 4YSUA 3UP1A 3GYRA 3EYOA 1COBA 3MRNB 2CGRL 3ABZA 1RIHL 3UTQA 4QJ4B 1S7QA 3ESMA 4YDVA 3QEQD 3FSVA 4X6BA 4A2DA 4KNTA 4IJ3B 2JF1A 4DW2L 3H54A 5IKCA 3CH8A 1T4KA 5DD6A 2AANA 3MRBA 4PFEA 4OW6A 1F02I 1O9WA 2NY0B 3CH1A 4FFYL 1CE1H 2V5MA 4IM8A 4OD2A 2YD0A 2ZAGA 3AQZA 1K4DA 2XY1A 4FNUA 2BZCA 4KK6C 2AVGA 3D25B 5I16B 5F70A 4NP4H 3ZIYA 3LRMA 1UVQB 2NX5B 4N9GB 3CLEH 4YPGA 1H9VA 3QCVH 3NESA 4XAKD 2NY5L 3MREA 3MRMA 1AO7A 1FLTX 1OXYA 3MCKB 4X4XB 3ARFA 1IEHA 3DJZA 1F4WL 4WHYG 1S7WA 3ARFD 1ZJBA 4MCYB 4EI6A 1R5WA 1QUNB 3G04A 2JKSA 3PDOA 5DC0A 5AG8A 3ECUA 2X4OB 1BQHG 3ATBA 3KLLA 5D96C 3AABA 4XVJL 5B3SB 5KANI 2H0EA 3LN9A 3MRPB 2V5RA 1U4EA 4M7LL 5J11B 4KKBD 3K71B 3IXAB 4KPHH 4KH2A 2VLJB 5D7IA 4OCRL 1EGJA 1OAUH 4XRCB 3IDMB 1P9MC 1DVQA 4NM4H 3UYPA 1WD8A 5LGYA 2DKUA 3ULUF 3ARRA 2UWEB 1OTTC 5D6DA 2VZSA 2OBGA 1F1AA 2CR3A 3NCXA 2AQ1A 3QO1A 4HLJA 5EBMB 4Z3EA 3NIGF 1S9WB 1L5GA 4UANA 2CU9A 4J6RL 2LVEA 3SGKC 2O1AA 3L7EA 1WVZA 4JFSA 3DVNA 1D3CA 1WFNA 3GKWH 5HGDB 3WEXB 4A6YB 1YCSA 1KXVC 2RD0A 1FGNL 2X70B 1J5CA 1PZCA 3DURA 3W9DA 3P77A 5F96H 4EI5D 3VH8G 4GNKB 4EJ1C 1QBLH 5JPMC 5CEYA 1ZLUH 2Z4QB 2PXYA 3R7RA 3HEIB 3FT3B 3QUHA 2B2XH 4TNVK 1TUPA 4ZO7A 2IH1B 4LPYA 3UACA 4PW4A 4KK6D 1S7SB 2MPAL 1FSKB 4KJYB 1N9PA 4NAMA 3D8MA 4L2LA 2AEQL 2G2NA 3JWNC 4YSSA 3II1A 3CFCL 3S96B 4RGMC 4O9HH 3NIFB 5IMKA 1L5GB 4QRRA 2VISA 3ARDB 4UV7L 4ZMZA 1IM3B 3D6GA 3HG0A 2A77L 4R2GD 5T1KD 1BXXA 4HS3B 4JO5A 1VCAA 4TXVB 2BIPA 5DJAA 1A6VH 5D9SB 1DQIA 5A6LA 1EH9A 1CXLA 1ZHKA 3ARYA 2OYKA 1FUNA 1NWOA 3SPVA 4RISH 4KVPA 5AW5B 3CLEL 5GHWH 3VFMA 4Z7OE 4E9RA 5B3JE 4JO3L 2HFFA 2W0KA 1GZPA 3C60C 2OM5A 3TH2T 2WXJA 4OZHE 5T33H 3CHOA 4JGMA 5JHDA 4Y5VA 3WUZA 4GP8B 2AVFA 2IAMC 3G5WA 2AJXH 3N3EA 5IROC 1TNNA 2OYMA 5AG9A 3BC9A 2Q10A 1F3DH 2IALA 4HS8L 4HJIA 4NQCE 3BEVB 4NPJA 4P3DB 4X83A 2XICA 5FWQA 4Z7QF 4K7PL 2C3GA 3UAJC 3S6CA 4DUVA 5BRZE 1F5WA 5IB1B 1PD0A 4XN4A 2I60H 5CR1A 2WSPA 4OAWA 5L9DH 3P9MB 1XDTT 3IXAA 5MENE 1CG9B 4OD2B 1YPZF 3VWKA 3NPSB 2HJLA 2UVFA 1S4IA 1MCDA 2EO9A 4M5YL 4JFHD 3N5AA 1IBHA 1I3UA 1GCYA 2YXFA 4JJ5B 1RZFH 4OV5A 3CIQA 5HGHB 3G04B 3MV7E 4NO2A 4NHCH 5FHBH 4PRAB 3V6ZA 5A2CA 1IGTB 5IBLD 1BQRA 1AO7B 4FN0A 1G6RL 4G80A 2VM9A 1I1YB 4LCWA 4S11A 3KLHC 4IRZL 1NDMA 3W5MA 3Q01A 1X5GA 1ZS8A 1BZDA 2F7IA 4ZYKA 5AW9B 4JFDA 5C0CB 1D7DA 2VN3A 3QUXA 2Y69B 4QRFA 4DWHA 4F57L 1CD0A 1NKOA 3C5ZB 3NACH 4PG2C 3OKMA 3S3PA 5I1GL 3G7TA 4HWUA 3STLB 5BUPA 1FORL 2DRUA 3FRUA 4UTAL 3GS7A 1P4LA 3R06B 2WZAA 2FT7A 5DF0A 4ZFQA 1G5AA 2DD8H 1E6OH 4YXKL 2ETWA 3HG3A 1W72L 3N1GC 4LHUA 1JNNL 3FTXA 3RHWK 1BOGA 4MS6A 3H6AA 3IVKA 4PGZA 2WZ6A 4ZNCD 4MAYC 2FQEA 1AYOA 1G1CA 4N3UA 7PCYA 3ZE0E 4WDIB 4F7PB 4E9LA 2BMKB 3RIAF 3WUWG 3ZTNH 2V9QA 3MROB 2LU4A 3WKMH 4DTGH 5D5MF 3O0RH 1MOEA 2AERT 2W60B 1HU8A 3HE7D 3BDXA 1EDHA 3ILQD 3VXUB 4YHPB 1T0MA 3RDJA 1F3JA 4L8BB 1CFMA 3TO2A 2EH7H 4PREB 2X1OA 1UD6A 1Z5LB 2AMUA 5HGAB 4JN2B 3H3PL 1C5BL 4FFZA 4QOKB 1QD0A 2L3BA 5GS0D 1DR9A 1YPZB 3LZQA 4RAUB 3BP5B 1TF4A 1GGUA 4HEPG 2H3NA 1NDGA 5JHDD 3PRZA 4ENED 2K6YA 1KF9B 3FU9A 4KOCA 4IBWA 3U0TA 4FYRA 3B5TA 2NY6D 2YR3A 2ZX9A 2AAAA 3QAZB 2JI3A 2QV2A 5ESVB 2A9MH 2CJUL 4XNBA 1NLBL 2DWTA 4K8RD 2NTFA 1ETJA 1AHWC 4Z3JA 5DZ9A 3C60A 5I8CA 4YO0B 4Z0XA 1ZLUK 4DPCX 5A6IA 3DX7B 2V2WB 2WQRA 4LB8A 2O6CA 3AROA 1DQML 1UCBH 4J8RB 3LKSA 1GOHA 4Y4FB 1NFKA 3MKGA 3DTXA 1PX3A 4NCC2 4NO5B 2WCSA 1UT1A 5EFIB 3JXAA 4WHDA 5LCVH 4AE0A 4P2QA 4DH2A 1UXWB 1TMCB 5DJ2B 3SDXF 5A2BA 4P5KA 4P4KD 4R7VA 3MNVB 4AXWA 3M17B 1Z1WA 3HAEG 3P0YH 4JHWL 5I0DA 3WN5A 3F6IA 2R0LH 1DQDH 4QRPE 4K3DL 4QEGA 4Y9FA 4Z7UE 4JZJA 5CD3B 4HWZA 1EXUA 4YR6B 3MTXA 1ETZA 1W0YT 4U4IA 3ZX1A 4JFVA 4S0SD 4JFWA 2AC0A 4HT1L 2BVEA 1TKWB 1M3JA 4LASL 3V4UL 1DQKA 2PXYC 5K33A 2HKFL 4KGLA 5DA4A 5ITBH 3U2SB 1FE8H 4KKPA 3QCTL 2MOGA 4G9FB 3S34H 3ZO0A 3SKJH 5IB2B 1JP5A 2BS71 4H8QA 1CXEA 4LBEA 3PE9A 4NRYB 4WJ5B 4H0LC 3TBVB 5EORH 1N6VA 2ERJB 1X5HA 1G9NC 2HJKB 3L9RB 4H88L 2K6WA 4JVUA 2R56H 5FM5M 1BBJA 3TLRA 1CGXA 2ZOLB 3K2UL 1RAMA 4N0FB 5I8CB 4GIAA 3N44B 4FJYA 3OHXC 3R1GL 3JWDL 4YDJB 2DF3A 1G9MH 1AY1H 3CFKB 4YSRA 1G9EA 1GY2A 3MLUL 1X5AA 4LEOA 2VLKE 5I1AB 1WZKA 3WIHA 2BNQB 3TBSA 4GAFB 2CDEA 1SJXA 2YQBA 1DQTA 4Z7UB 4LCWD 2G0KA 5DZOA 4BFFA 4D8PB 3ZDYE 4Z7VA 4Y5VC 4AY0A 1YPZA 4XP9L 3K8MA 1RZKC 1HAUA 4TMPA 2QADC 2N01B 2LW3A 2C9XA 2CJUH 4H1LA 4LGRB 5BJTA 4KI5C 1HE7A 3HG2A 1ZHNB 5F3HB 4KROD 5DQ9A 5C7XL 1JIBA 1IC5H 2Y2TA 4ONGL 3I75A 3QIWD 3PWPD 5C0BB 5DUBB 4DZBB 4XN9A 4AZUA 4BRJA 2VOTA 4OI8A 1QSVA 4F7TB 3FRPG 3O11A 3HIZA 4XNUH 4MSWB 4LOEA 5SWQA 3PHOB 1LO5B 4MJ6A 3TONA 4DW2H 4LMQE 1FZJA 2X4QA 2E76C 5AW7B 4DAGH 4FMVA 1I8KB 2NLJB 4GI8A 4GKOA 2H26A 4NNXA 5KTEH 1LDPL 2FL5A 4Z23A 5MI0C 4J3OG 2IQ9L 4RSYA 4AQZA 1UWXK 5IBUG 4ENEC 3UH8A 1J05B 2H3XC 4KNUA 1WEJH 5E9DE 3DX6A 4AM0A 2BVOA 1MXDA 4JLRB 3VGAB 5LXVA 3KEDA 5C7ZA 5K69A 2VSMB 5F3HA 1TSRA 2C1OA 3OD3A 5H8DA 2CO3A 4GKLA 4OR1A 3PGCA 1T1YA 4JHAL 3ZMEA 4JDEA 1FVEA 2DQCL 4P9HH 2IPUK 3B9KA 3LN5B 5AW8B 4DKEL 1PKQA 1JZ5A 4U7KA 3N0AA 5JXAH 3UP6A 1UWGH 1TO4A 4NO2B 1WZLA 1QI5A 2R0ZH 4LLUB 1XF5B 4NKIH 1BIIA 4TTDC 2VDQH 2Y7OA 1O7DE 4GSRA 5DURB 4IDJL 3QZWA 3CN2A 5DC2A 3LAFA 5TQ0L 1UXLA 5G4OA 4ODSH 5KZCB 3BWUC 3P9MA 1FNLA 3LHPL 1KGJA 1FAKT 2ZOLA 3PG2A 3QZWB 5IQNA 3S5LA 3WUWB 1GIGL 3TM6A 5HYSG 1YC7A 4Z6AT 2VERN 1K2DA 1YNTB 2F74A 2VDOL 2J71A 3VI3E 1IBBA 1XCWA 2IG2H 1KN2H 3EH1A 3CG8A 3UTZA 3RL1B 4GS7B 3TNMB 3AGWA 1W2KT 4B41A 5M95B 4PLNC 1I75A 3LS5L 2XFGB 3CJJA 1L6XA 1R3KA 5IJKA 2EVIA 2G9KA 1BBDH 1MHCB 1Y07A 4G1EA 4LSQH 5SV4A 4R5TA 5D5MB 4WI3A 4I0CC 3BAKA 1AKJA 4RDBA 2NNXA 3AWEA 5GZND 5INCB 5BO1H 4MQXD 3GB7B 5EMYA 5ESQB 4ZUVA 1J05A 3A5VA 1CE6A 2VDPH 3EYFB 1B88A 2WINB 1AZNA 1UJ3B 4U6VL 2GJZA 2IBZX 3VRIA 3MNMA 4WJG3 2QQNH 1NPNA 5D72L 1FZMA 4XODA 3KCPB 2A74B 4G8IA 1IT9H 3S3DB 1CYGA 2HLFC 3QQDB 5I2IA 1KFGA 3ULUH 1UWEH 1W6WA 4XNZB 1SFDA 4ZBJA 2WGXA 1F4AA 3EJTA 3DIVA 4FQPA 4NM8H 2EDKA 2GBAA 3DSNB 4MNQB 4XP1L 5J6GB 4WWKD 3DIFB 3KPOB 1HK6A 3U7YH 2EUWA 5JPNB 5HGBB 4EAEA 3CFEB 4TLUA 2VIRA 5EIIA 2CO7B 3OJDB 1F97A 2PO6C 4MMXB 3SE6A 2OJEB 1KJ2A 4J12A 3KXFB 5D4IA 3QPQC 4Z7UF 2O5YH 5IF0A 2VJ8A 2XNAB 4JRXE 3NCYP 5DVMA 3PDDA 2OR9H 4UQ2B 1C7TA 1J8RA 3RGVA 5CIPH 3FFCB 5B4MD 4XVJH 2Z8SA 2XZQH 3RY4A 3WAJA 1YRKA 4AYDC 4MD0B 3QEQA 4Q74A 4K9EH 2DM4A 3HI6L 3NZ8B 5SWZD 2FBRA 3IGFA 5EEVA 2R9HC 5KBDA 1BVKA 1E4XI 5AWNH 2QHRH 3WNKA 4DUWA 2PETA 4ZMPA 3BPCA 4UQAA 4Y89A 4P3WA 1INQA 2VLJA 1XGYH 4H5SB 5D7IB 4Z0BH 2AQPA 5DJ6B 2F53D 4W9FC 4DGYH 1FG9C 3GJEB 1HL8A 2R59A 3NP4A 5E4IA 4NQCD 5FOBB 5EUOF 5HJGA 4E5XB 4HWEL 4PBDA 3T5WA 4E2OA 3O45A 5KWYC 1LK2A 4OH2A 4WNQB 2XLLA 4JPWL 3ARFB 1BGXH 1I7RA 2HVJB 4MXVF 4L8SB 3OB8A 5D1QE 4PWFA 4HU8A 3NH7L 1MN4A 3S48A 3AM8A 3RDTC 1OOAA 1ASPA 4P4KA 1BW8A 1RUAL 4GFTB 5IFJB 1GC1C 2WP3T 2FX9L 4HIXL 1Q0EA 5D2NA 2XBDA 4KZDL 5IQ9A 1M3IA 3A21A 3WN5B 3KLSA 5B3NA 5IVZA 3E3QC 2EZ0D 2J1ZA 2BNQE 2HH0H 4MD4B 5D7JC 5I30H 2YGOA 1F4XL 4MRBA 5I15L 2OMVA 1KTDB 3MRBB 4XNYL 4HUUB 2OXGA 2P5WB 2PO6D 2B3IA 2BVPA 5D7KD 3ZDYB 1FZKB 1PD6A 3FT4B 3ZT6A 2DQFB 3NSJA 4PRPD 1UD2A 5F7EH 1UWEL 3S4SG 1JHKH 1AD0B 2VXSH 3OMIB 4PRAA 3QRFM 2BVPB 2ROXA 5DMGD 1RJZB 1UYWH 4E9SA 1HKLL 1V8HA 3EIFA 4XPFL 4EN2A 3LV3A 1CR9L 3V5HB 3TP4A 1NLDL 1YYML 3CTTA 4U1LA 2WN2A 3LKRA 3GBDA 1LO4L 3UTTA 4MA3A 5HYEA 1G43A 2HTKC 5DO2C 6FABH 4OAWB 4D3CL 2GUYA 3O6FD 3HMWH 4KXZH 5CZVH 4XXDA 2IAND 1QEWA 5DD3H 5HDRA 1HDMB 2WUCL 2A7BA 5D8JH 2D3NA 2QJDA 4XWOD 3ZQWA 3PXLA 5HHQA 1BLNA 5LGKA 5I1LA 1R5IA 4MXQC 3D39A 5FGBA 1M2OA 2ZG3A 5KJRH 2XZAH 3MGAA 2NY2C 2R27A 3M8OH 4K9EL 4OZIB 5EDXA 1UOLA 1SLWA 4JGJA 4Z7WA 1NWPA 2ARJA 2YRZA 3FPXA 4P2RD 3ZMRA 4AK1A 1DBAL 5TPWL 1MCKA 2O6DA 3FB6B 5IMLA 4L3ED 5I1CH 2GSMB 2DM3A 4G7QB 1JV5B 2IWEA 1MLBA 4OLYL 1OOWA 3L2MA 1KBBA 2AK4B 2WO2B 3ILPB 1IGJB 4WWOA 5HI4C 43CAB 4PTTB 3H53A 4UQ2A 4B0MB 3IVKB 1GGBL 2NMSA 5F1IB 5ELIA 4X2UA 3CN4A 3KS0H 3DHMA 1B4JL 5AOMA 1AXTH 1KV7A 3NK3A 2RFXB 4MGXA 1H9DA 1CLVA 1S5HA 3QUGA 3LJ3A 3TT3L 4LVHC 2LAAA 3N06B 4OZHF 4M7ZB 4G8AC 1OSZB 1EV2E 3QBTB 5B3JF 3W9DB 1BAWA 1DQLL 1TJGL 3WSQL 4MA7L 2OCCB 4OJYA 5M94B 2ZX7A 3FQRA 2MMXA 5JORA 1T89A 2ATKB 5HI3C 1C12A 5IJCC 3L4XA 2DW5A 4POYA 3X1BA 3B7SA 2Y6SD 3EYVA 2JKTM 2Z64C 3LEXA 3MRGA 4KAQL 3ZT7A 5BOJA 3WNMA 2A74A 4G8IB 1OAJA 5IEKB 3F8UB 1CR9H 1XIWC 2EXYD 1SLXA 3MV9B 1I9IL 1NFDA 2YC1B 1NOAA 1E67A 3D3VA 3TNNA 5AD0B 5D2NB 3G5YA 4MVBC 3O0RL 3T8VA 1CZ8H 5T1DL 3JSSA 3QWNA 5INCA 1U3HD 4JO8A 4EIZC 1UCTA 3K8LA 5BRPA 3HC0B 2VSKB 2BIHA 5F7YC 4ALAC 5DQDH 3RWDB 1PBYA 3MNWA 4JM2D 1ZK5A 3GBEA 4ZT1A 4MZ2A 4KBPA 4L0ZA 2XWBA 2DQJH 4P48A 1MJUL 3ULSA 2QSCL 1FH5H 1IGIL 3MLSH 3A23A 4LSUL 3QULA 1X5KA 2A6KA 1M7IA 4A2MA 3FU0A 2PCFB 2ZJSL 1FL6A 4KROC 3G5ZB 1T7ZA 4KTEL 3QEQB 1HYSD 2YZ8A 2Q20A 4K4KA 1HJBC 4BE5A 4HS3A 2HT4D 1UACH 3L48A 2Z31B 3MRFB 1FPTH 3QNYA 4W6XB 1T4KB 3D30A 5DD6B 1BXUA 2XACC 3BUYB 4AT6B 4ES9A 3DRTB 1RZPA 3UAFA 3VQ2C 4ZFGH 1GPOH 1B0RA 3H6JA 5JPNC 4YLBA 4Z5RA 4N85A 3B9VA 4G42A 1QQDA 5FGCB 1AD9B 3NRQA 2H45A 2P5WA 5DRZB 4DN3L 3Q9PA 2C3XA 3NFPA 4LRIA 4WU5B 2JI1A 5D7IF 3EOTH 4NQVB 3D0LA 1AQ8A 4NSKB 3QUMB 3DIFA 1DQDL 5K1VA 3E80A 2EJ1A 4X5RA 2J72A 1R3HB 1JZHA 3DSNA 5I1IH 3U79A 3A6CH 1A2YA 2Q2LA 1PEZA 4MA7H 3RVWD 3TN0A 3WEOA 1KTRL 1RQ5A 1P9MA 4DK3A 2R1XA 3T3PF 2NCMA 1G9MC 5JXAL 2WLYA 3VXNA 3O3AB 4WWPA 4F15B 3IAPA 1YEEL 2KLSA 1N5AA 2VLKA 4GLRI 3HHSB 2W9EH 4BKSC 3UYOD 5TF1L 3WNOA 3LN4B 5J0BA 1QG3A 4LKCA 3S3BB 1NCDH 3QW9A 3JVGA 3GXFA 4Y16B 1Y1UA 1YEIH 3KCPA 3PP4H 4R96A 2VKWA 3O6MH 2HN7A 3CHSA 3GJFA 4KKCC 4QLWA 3VWJA 1U2HA 1SXSA 4ZAKB 1O9ZA 1NMBH 5I19L 3PV7A 1A3LL 3S2CA 5I1DA 4UIKH 1OB1B 1E0OB 4AV0A 4C83B 4KJQD 1E5YA 4S1DC 4Y5YB 2AJSL 1PYWA 1O5PA 3PHSA 5ESQA 1IQWL 2OSYA 1B9KA 5E99H 2XZZA 4LSVH 4E41A 4B9JA 2P45B 1TR7A 2VZUA 5DQ9B 5AVSB 3GLEA 3T0EB 2BXZA 2E7LC 1JV2A 5PCYA 3QQ3A 2H7WA 3V4PL 2F7PA 2WWMD 2XQBL 3DUHA 2D7NA 3QUXC 4PRIB 3ESVF 2XNAA 4LARH 2G60H 1G87A 1IZJA 3T6ZA 4GO6B 2OX5A 4IS6B 2JWYA 1RULH 3TBSB 4BHUI 3WFBL 3V0FA 3BUQA 2XX0A 4NBYB 3CHQA 2ZXGA 3RI5F 1SBSL 3D51A 1S9YA 2JFCA 1IBZA 4LRNH 4MA3B 2QZ5A 4HJ0C 3O2VH 4UDTB 1A9EA 2A0LC 1IC5L 3QCUH 1MJ7L 2CHXA 3QIBD 3C9NA 3IF1B 5AOKA 5E2TH 4NUMA 2OMZA 4H13C 1HQ4A 3GRGA 4JCLA 5GGRA 3VD1A 1I1RA 1ULVA 3DJRA 4N2EA 5D1ZD 4CAGA 3VG9B 4YSEA 4TKWA 4AQ1C 1C7SA 2UZIH 5ISZB 2R4SH 3UZQA 5C2BH 1PFOA 3BD3A 4QTHB 5AZ2H 2IMMA 2OXGB 1LHZA 5FUCE 1JNLL 3B1TA 4E9YA 3F00A 2WSDA 4Z9KB 1WZ1H 4G72B 4XP5L 2VDMB 1TKWA 4JFZL 1WIPA 2UY6A 4FDWA 3TT1H 4UQ3B 4PGBA 5TE7H 3VE0B 1NQBA 3FTSA 3D3VE 5LB1A 4OCLC 4S1DD 5H37H 2WC7A 1HEJC 3QWRD 1U9KA 1R17A 1DUYB 4PWKA 5J5EA 4RGND 3F7VA 3QC5X 1ZTXE 3FN3A 2TSAA 5KVGE 1ML0A 1CQKA 1SOQA 3C2AL 1ORSA 5DHXB 2JCCE 1R3LB 1E5BA 1NEZB 2P48B 2DJMA 5DD0H 1JRHL 1L0QA 1PL3A 2F54A 4J3TA 3MSPA 5DZJA 5ADPH 3TYGL 3FB8B 5FGBC 1UH2A 4FLQA 4WGVB 3QZWG 2IFGA 1TYRA 4NCDA 5F88A 1RZJH 4UNTA 2R29A 4YC2B 3JV6B 5F93C 1H6UA 4B3VA 3WOVA 2FBOJ 3CC5B 3WFDH 1F3DJ 2CGZA 2BSDA 5KS9A 4QRPD 4HDIB 3WEMA 3QYMA 3CPUA 1LVEA 3H3PH 3ABKB 3VB8A 4HGWB 1MEXL 4L48A 1PJWA 1IVTA 1UD3A 4DP5X 2AV1B 1WUNT 2QKIA 5LN4A 2WBWB 3CCHB 3G5VB 5J1TC 1F58L 4NOFA 2D31B 3HBPA 2E8ZA 1FVEB 1DQQB 3DROA 1L6PA 1NMAH 3QEHA 2PW2A 5DFVD 3O9WD 2GY5A 3TO2B 3O9WA 3IETA 3KPLA 1LEIB 1A5FL 3CVCA 1VKXA 3PREA 4N8VB 4NNYA 2WVSA 4AJYV 3WFCH 4DGVL 2X4SB 3EBAA 4KI5F 5MHSE 1M4KA 2WV3A 3POCA 4QR7A 1MIMH 4P4KC 3TBVA 4OZGB 1FGVH 4MXWH 4IRSD 2FTAA 4JG9A 3RZWA 4Z3GA 1NC2A 4RMVA 5IIEA 2WNXA 5D72H 4F7CB 5JPMB 1ZHBB 3B9DA 5BXFA 1BZ7B 2EC8A 2CKBL 1FO0L 1VGEL 4PV8B 2WM0A 3GSNH 4KO5A 5E9NA 1T03H 1EZVY 1X5JA 2P8MB 4F7KA 3V0WL 1N5AB 1LO3H 1I1FA 1ZDQA 3P3SA 2D3JA 2FE0A 4MSWA 4NYLA 1Y6KR 3RAJL 4E41D 5LUMA 3L1EA 4RGNB 1I9JL 3VE0A 4PS8A 3QUMA 2VJ0A 2EDLA 3M6DA 3FQWA 3RB7A 2Q2EB 4Q14A 4GMSL 4JFDB 4UTBA 3WG7B 5ITBL 4RSVA 3CV5A 3NJKA 1RKRA 5DJ2A 2OTWA 2DYPA 1N0LA 2KDYA 3G6JE 4ZFOB 2AS5M 1XR8A 3K6SB 4XBEH 5CLYA 4O51A 2FQDA 4KI5E 4L4VD 4KRLB 3CX5K 1NCBH 1NSNL 3IS0X 3PS6A 1SY6A 4JFEE 5C07B 4JGNA 4E68A 2ICCA 2BNQD 1XVSA 2BIOA 1GSMA 5DU7A 4BFNA 3DX7A 4L8CB 4Q9RH 2FATH 4N90D 4EUPB 2IADB 5A16B 4K3JL 4L3CB 1CGWA 1YJDC 5AAWA 4CA4A 5AW0B 3RNKA 4HIQA 5C0AB 2IQAA 2UZYA 5IHZB 1M7IB 5DI8A 2BRRH 4NQUA 5EO9A 4ZMAT 2Y72A 4LLUA 2J56A 5EU7E 4WFEE 4HCRH 1RK1A 2IANA 3IN0A 3LKPA 3T1WA 4XCNA 1I8MB 4DN4L 5A2FA 1WC7B 2K9FB 4DGYL 3EHBD 1AGEA 2GT9A 3GI8L 1RZ7H 1E3FA 3HG1A 3OPZH 4ZPTA 4JDEB 1S2EA 3S2AA 2AW2A 4LIQH 2ZYIA 4WZ9A 1NMAL 1YG9A 2BNRD 3WXVL 3QR2A 3LNHA 3BO8A 1JE6A 1XCQA 1UWYA 4ZFZB 3QDGB 1QZNA 5CGYC 2DICA 3JV4A 4N2HA 5K93A 4JHZA 4Y5YA 1QKZH 3BEWB 4OLXH 3T0EE 3MBED 1KJMA 3HOGA 2D7QA 3BH8B 4YDNA 1CQYA 4ZMWA 4GKZB 1MQKH 5CUSL 4NC0B 1MELA 3PHQA 2HAZA 3BQUD 3VFGH 4FABH 3MNVA 4AXWB 3CXFA 1J5OL 2AEOA 2DL2A 1HHJA 4PRIE 3LQAH 4I0PD 2YD8A 3ZE1F 3VI4A 3A4EA 4PLOB 3OKLB 2AEWA 3QUZC 1KJVB 4LKCB 4MZRA 4UINH 4F7CA 3CDZB 4JG5A 4HETA 2VLKB 1UQSB 2I32A 1TJIL 1KCUH 2CJ3A 4QRUB 2PYEB 1XQ4A 1IAIM 3Q2CA 2NYYD 2PCXA 3QORD 1RL1A 3DX8A 3IAQA 2CQVA 3ECBB 2I26N 2X1PA 3EBGA 4G7YL 4M62H 4Z76B 3BHBB 5TTRA 4GT0A 4NSKA 3E6HB 4N2OA 3BT2H 1XIWA 4PRHE 3O9WB 3I6GB 1HXYA 1BVNP 1I82A 3KPPB 3NIDF 3U6RB 4QF1B 2JSFA 1PG7W 4H1LB 2HB0A 4XE0A 2PR9A 4A6YA 2IPKB 2WUCH 2Y4SA 4HWBH 2IV8A 2VDNH 5DHYA 3LB6D 1MVUA 2N7AA 3OB0H 1CLZL 4OF6A 1FL3A 1NBYA 2QVIA 2LLGA 1IEBB 3TV3L 1XXFC 3ARSA 3KLAA 1M1XB 4GAJH 2AF2A 4HCGA 3QO1B 3BIKB 3MRQB 5L88L 3VXRA 5ACMA 4MDIB 4G6FB 3EYQD 1NOFA 2YAFA 1SN5A 3HPLA 5CD5D 3SQRA 5E8PA 4KK5D 1LK3L 3T6WA 1BJ8A 1E2VA 2G2PA 3V8CA 3L4VA 3OGOE 4OGXL 5EUKB 4DP6X 4IRZA 1CI5A 3T65A 2AK1H 2WQSA 1UZ6E 1RJYA 4X6CA 4Q2ZA 1JJUA 4F8PA 4HZLA 3U82B 4L9LC 1YNKL 3F7QA 4GQQA 1E27B 2ZNWA 3LRGA 4X8JA 1ZIAA 1BLNB 4HXAH 4UV4H 1OAYH 1HDMA 3ZHDA 5EZLA 5D7LB 4ZMOA 2APTA 3Q05A 1RZKL 2E3VA 1A7NL 1QRKA 1NGXB 2ED9A 4UU9A 1E4XH 2AEIT 3ZKSD 2B1AL 2QFPA 3ZE1E 1U8CB 1U8IB 1YNTF 2X2UA 4AJ0A 5DMIL 1O7DC 4HLEA 1WTLA 5I0XA 4ONOA 3GSRB 4G6JL 2VWEC 3GFUA 1G0YR 3V9CA 3LQAL 1NAMB 1P6FA 5TQ2H 3S96A 1XGQA 5ISZD 3WEBA 1AIZA 1KLGB 3H0TB 3SDCD 3Q6FA 3W0WD 1F2QA 1FYTD 3GTVA 4WCYL 2GAZA 5JHAA 1C8PA 5FYJL 1QLEB 1KTDA 4J4PA 4JM2C 4R26H 3GMRB 4PJFB 3L3OC 1CN4A 4XMVA 5E6SB 2I9LB 1W16A 3MJGX 3WJLA 4D9RD 4PG9A 3WXWH 1JWMB 2NPLX 3CHPA 4TL4A 4LCVA 1KTKE 2XRAH 2K3TA 3CU1A 2DQHL 4ZTPL 1EMTL 1F4YH 5HHOD 2H1XA 5DXWA 1Z7JA 4OIIL 5DGQA 2B15A 3NBNA 3CQPA 4I2XE 1PLGL 4L9DA 2VAJA 1KBGL 1I4FA 3UJJH 4QHLB 1JZJA 5LQBH 3AT9A 4XCCL 1HZHL 2A9ML 4BQ6A 5DR5L 4I0PC 4PJCB 5GS2D 3T2PA 2IVFC 3HR6A 2BSSA 4X7TA 4FA6A 3IS1X 2YXWA 3MI6A 3EYUH 1G84A 1SJHA 2Z35B 4WK2B 3QUYB 4LLAA 5GISL 4N0YL 1JZ8A 4XX1G 4QXGL 2EADA 3COOA 5LLIC 1QOKA 1JPTH 4ZQKB 2OYPA 1B2YA 2J43A 3GLZA 3F12A 2QPSA 2W91A 4OZIA 3NJVA 1CDIA 3ARXA 4P2RB 3BGMA 4YEEA 3RVWC 2KUTA 4NKMA 5AB1A 4ABVA 1DANT 4QRRB 3GSXA 2KZWA 4RLDA 3OX8B 4XMKH 2AKRB 2GAZB 4UNVA 3MOAH 3IK2A 3UG3A 2JJSC 4G6ML 3EJYD 1Q0XH 3ZOAA 5D7JD 1VZGA 3QDHA 1QYGL 2ZWSA 3GMNA 4MQ7A 4L5FE 4AMXA 2HRPH 2TSBA 3IRPX 3KLDA 3HZMB 2I69A 3GWJA 4NB7A 2I9TB 3G5XB 5TDOB 4U1LB 4KJQC 1MWAL 5LNDA 3OM3B 5EU4A 2Q7NA 2VLRA 2R2EA 3MRJA 5HHMD 4L37A 4R4BB 2A6JB 4BH7A 4RBPH 1RIUH 4G80B 4QRQB 3UTQB 4JMXA 4WEEA 5EORL 5H94B 2A83A 4WUUD 5I6OA 2VDRB 5ADOH 3BAEH 2EKJA 2DQIH 4H40A 1J9TA 2DEWX 3DK2A 5FYJH 4YGVB 3UC0H 4YXHL 3QG7L 4PRPA 3SCMC 5AAPA 3R1GH 3VFOA 1QEXA 1CCZA 3IMUA 1CG9A 4ZTOL 4A7TA 2PO6B 3ASWA 2SEBB 3D2UB 4BZYA 1A3LH 1U92A 2DWSA 2IV9A 3B2VL 5AB0A 4XE5B 1RMFH 2W07A 1X4ZA 2AJSH 1AZZC 3OBAA 4A2EA 2Z93A 4ZTPH 3ULSB 4PJXE 3E9UA 4QT5B 2JH2A 3QISA 3QIUB 4X7CC 2XQ0A 1ZTXH 3HMXH 3BWAA 1CE1L 3QIBC 5AYQA 5LQBL 2ZOKA 4OUOA 5CINH 1HCVA 2W65A 4CSSA 3NSXA 5I1KL 3IWVA 3BP7A 3K1DA 1JZ3A 1FV1A 4QHMA 3LEVL 3M8OL 4ICWA 4Q2ZB 4MWFA 3U0WH 1FFNB 3DETD 3HPJB 2EYSB 2A74C 4JHVA 1INQB 5AYTA 1HQRB 1TJMA 2J6WA 2VUYA 2YSSA 4U6HB 5GGUB 3JZ7A 4O5LH 5MP6L 3KGUA 3N91A 1FNEB 1SYVA 4NFCA 1OT2A 3UG4A 4PJIA 3FQUA 4KXAA 5HJ3A 5ALBL 2NTSP 2YA0A 1ID5I 3LZFH 2DLEA 2ICWJ 1OL0A 4M6NH 3TA3C 1U8JA 5LWYL 3C75A 5JA9A 3K8KA 1SHXA 3QHZH 5FDWB 3ES6B 4Y1AB 1A65A 2DQGH 1TDQA 1ZGLP 1SPDA 2WLNA 4D9LH 5IZ7A 1OPGL 2D0GA 1A66A 4OJEH 1E65A 1IKOP 4RZCA 1KJ2B 1UEMA 4N2GA 1T1YB 4MMXA 3PGCB 2P47B 5ID0A 3VXSB 5E6IB 5JDSB 3QRBA 5IJVB 2BNUB 2CO4A 1MWAH 4JFFD 3GKWL 5BV7B 4Z76A 5KEZA 2VWEE 3S36L 3NQIA 1S5HB 3MQIA 1XIWD 2G9HA 1J18A 4OZFA 1IM9B 4M5TA 5F7KC 5IHWA 1CTNA 2UXTA 3GC3A 2F58L 2V9TA 1MJJA 3V79C 5T3XE 2GHZA 3FO0H 4BDVB 4K3JH 1SXNA 2J8OA 2X42A 2AK4E 3IDXL 1LO5A 4G8FA 1IBGH 2QDVA 3D18B 3MJ6A 4KHTL 4YBLC 1FNFA 2JJUA 3E1ZA 2FEJA 3ULUD 4H26A 3SKNA 3UYPB 2CLVA 3GDCA 1OM3H 4C57C 3LSOB 2P5EB 3WLBA 3FQ2A 3B3BA 3HRZA 1IKFL 1FL5B 2AJUL 4X9GA 4HMEA 3HG5A 3UFIA 3WKPA 1Z0NA 1E43A 4GRLC 1U0QA 9PCYA 3PWJB 1AGFA 1KYOK 3NK4A 3OHMB 1F6AB 2OMXA 4R7NA 5GZOA 4LIQL 5CEZL 5FA3A 4NZUH 1TJHH 5FYLL 2EIKB 4AH2A 1JYNA 4PG2A 3NDZE 3NIGB 5GGVY 1F58H 1RK1B 2IANB 4GW4B 1EO7A 1T2QH 1XR8B 4KFMA 1TITA 5FKPA 3RIAK 5ES4B 4ZDHB 3MOBL 3CFKA 3MRRA 4K5PA 3SCMD 3AG1B 5E70A 4L1DA 4EZJA 2G4GA 3FW6A 4D9QD 4L3CA 2XPZA 4EUPA 1QBBA 3S0PA 3UBGA 4GRWB 3SGJA 3CVHL 1K8DB 2NXYD 3QI9C 4WHTB 3MV9E 1BIIB 4G8GD 1CO1A 1NCCL 3HNVH 2QQLL 1YEHH 3T04D 1YNLH 1JHTA 5D96B 4X6BB 3SDDD 1D5IH 1FNSH 4G6FD 2PP7A 3DX1A 3BIBX 5HHVL 2Q8AL 1SYSB 3NA9L 3RKDC 2YMXH 1FIEA 4OZHA 3FSAA 3L3DB 3PWLA 4AJWA 3UBXI 4CSPA 1ZLEA 2NSMA 4YIQB 4PVLA 1EDYA 2V37A 3WKQA 1QLEL 3ILDA 4FD0A 1CS6A 3U7YL 5AUMB 2QSVA 4NT6A 3X1FA 3FONA 4R97B 2HFEB 1XF3A 2VXQL 1BFOB 2YOCA 1G5GA 4M4RB 2ARWA 3ZDYF 2OJZL 3CFIC 1JGEB 2O5YL 3VG0L 1OLZA 1GYCA 3JTTA 4NNYB 3MRKA 2IANE 3NRFA 4L8SA 2B20A 2Y7LA 1UM4H 1YY9C 2R39A 3QI9A 5HVGB 4XO9A 4HPHA 3QFJA 4FKKA 4K2UH 1E42A 3VA6A 2WKOA 5ETUB 5DK2B 3LRSA 2IAMD 5IROD 3OR7B 1KXQA 3MYJA 3TF7C 4IEFB 5L8KB 4XMXA 1JF1A 1Y18B 3AU1B 3PWUB 2VB5A 4YSCA 3IU3A 2V3EA 4WWNA 1WO2A 3PYCA 4JQIH 1I9RH 2Z1PA 2NRDA 4I0PB 2G5BB 3H9SE 4XPBL 3RUGA 3BPCB 5KBLA 1ZVSB 3BI9X 4CVXB 1G94A 5I8KL 3VFUB 2AK1L 5B1CA 3THMH 1BVLB 5FYJE 5KYXA 3C60B 2P28B 3DX3A 4OGQC 5SX4H 3VXSD 2AP2A 1YDPA 3D4CA 2PN5A 4A7GA 1WCQA 2N7BA 1LE9A 2C7FA 3FFCD 3DROB 3ULVL 3ZTCC 3Q1SH 5F88B 1UGNA 2ZUQB 1ZLWK 1OVZA 2WQAA 5FYLH 5LO7A 1W8OA 3VJ6A 4QYOB 4CN6A 2WKGA 2X4UB 3H85A 3W38A 3CSYB 1RZ7L 2F18A 4OD1H 5ACZA 2CKNA 4A7QA 4AG4L 1EGJH 4LCUA 3VXMB 3F7LA 1TQSA 3CFEA 3F7VB 3HE7A 3C09B 3K6IA 4GRWF 3AG3B 2Z7YA 2WGNB 3PUCA 4GKNA 4X50A 3DBXB 3P4MA 4GO8A 3X13A 3WIHH 4FYQA 2DWDB 4G9DA 3U4BL 4HJEA 1LEGA 1T21A 3LZLA 2BLFA 43C9B 4WCYH 2EXWC 1N5YL 4G5ZL 2MOVA 2BP0A 3KYOA 3PFUA 4MAYD 3A47A 4KX8A 5AW1B 2YWZA 2FCBA 4CSZA 5C0RL 3DOSA 2B08A 4OZHB 5J56B 1D5BB 1SYSA 3BDYL 3A6BL 3KVQA 1A6AB 3WY3A 4L4VB 3OQRA 2WZPD 4TUUA 3CZFB 4PLJC 4PHZA 4AYMC 2A6DA 4MASA 3EYFA 2R2HB 4PRNA 2ADFH 4G7YH 4GW5A 1J1XL 2VRAA 1KWGA 1VPOL 2A38A 4FI7A 1XL4A 4N25A 2X9XA 3KMDA 5LGJB 1DVTA 4TNGA 4ELMB 4HHAB 3RL2B 3VFWA 1A1OA 2FSEA 3PCYA 1JXGA 3O8XD 4XHJD 4G1EB 5E9DD 1Q9LB 1YEWA 4WW1A 4CBZA 1D7FA 1C1EL 3ZYZA 1FYTE 1NDMB 1P1ZA 2VXVH 3IMTA 2GEQA 4AMWA 3L3JA 3T4AC 4C4UA 3DPBA 4IJTA 3VJ6B 2XTJB 4OZGE 5L2KA 5EO0A 1AGDB 1FVDA 1DBAH 1K2DB 2F74B 2Q6WA 1OCCB 4N5EC 1ITCA 4R7DB 4HC1L 3C9NB 4U49A 1FNAA 1CF8L 5FUCC 2VDML 2OMYB 3B34A 2AZUA 3X3GH 3Q6GL 1H0DA 4WFHD 4EZKA 3ELAT 2FECI 1E8ZA 3SYQA 3VTTA 5C0FA 3C08L 3DA0A 5BNXD 4NXKA 1NUNB 3L16A 4RDQG 4OGXH 4BXVA 5CIPA 3ZJAA 2R56L 4YZWA 3HKZA 1BYOA 4G8EB 3N1FC 1BVOA 1Y18A 4PW3A 1XGUB 2Z3FA 3STBA 4HUVB 2E6JA 4UWQB 1EEZB 1II4E 1MJJB 2V2XA 2YUXA 3MZGB 3HJEA 3GO1H 4PW9A 2EILB 2OW6A 3B2UD 5E4OA 3SD2A 4PGJA 2UZPA 3DDFA 4IBTA 5FFLA 4UOW1 3GZPA 4JB9H 4LIQE 1KB9J 4LVEA 2CMRL 5E00B 2IDSA 4QOKD 2FLMA 2YEVB 4JKMA 4GMTH 1A7NH 4OZ4A 4RFOH 1JS4A 1C5DB 5DYFA 5AW3B 4AQ1B 3RVXD 1Q9KB 1XF3B 2LFEA 3T3MB 4V1DE 2YA1A 4JFFA 3CFCH 4IGBD 2CNYA 3KDPB 2IAMA 4NP9A 4YWGH 2Y5EA 5IROA 1QASA 2NW2A 3EJZD 2L7UA 2VISB 1X5XA 2LOEA 4YDLB 3QDMB 2XVBA 3GSNL 1T5WB 2GK0A 5T3XL 4K7FB 2UY7B 2HKAA 3KXFD 5F9JB 2VZ1A 5KJ7E 4GYBA 3M86A 3MLWL 3BUYA 2ZT9C 4AL8L 4TM9A 2JIXD 2BNRE 5CCJA 2W92A 3I75B 4DZBA 3WIAA 1TTGA 2PXYB 3LCYA 5I9QB 4WFED 2CRYA 2JI2A 2XV2A 4KUCD 5JIHA 1HTYA 5CKGA 4ZDHA 4RQQA 4NXSA 5F8QC 2HX7A 1MXGA 2Z8VC 1UA6H 3ZKNC 3ZE2E 3QDGE 2DY2A 4QRTB 3O8XA 4A04A 1EAPA 1QAWA 1BFSA 5KUMA 1D9KB 4AENB 3MVSA 4AC2A 4FQJH 1IKNC 5KBNC 3RILA 4NJAL 4MQXC 3T0EC 1FC1A 4HC1H 1FG2A 2ZWNA 1BREA 1D9KD 3WIIL 4YHYC 3EJYC 3O3BA 4LPUA 3VWKB 1E4JA 2AQSA 1KB9K 3MA9L 1IAIH 2BVTA 4ZMQA 1HSBA 3ESUF 3CFDB 3EDEA 5D7LD 4FLOA 4XRCA 1GPOL 4YZFE 3PWVB 4TOYL 3GRWA 1J0KA 4X6EA 4YHNA 1KB5A 4X4YB 4AITA 2E0PA 1LGVA 2RBLA 4M7LT 3D48R 2R29H 1S78C 3QDJE 1IBYA 4Y4HA 5DMGC 5BVPH 5FO8B 4WIQA 1CICC 1VFAB 3K91A 2X40A 3FH7A 2F19H 3MUJA 1R5WB 5FHBL 2WP3O 2A83B 1MCBA 3NGBB 5AOJA 1D6VL 4O02A 3D69B 4YHIA 5L8LB 5GGVL 3CFBB 4XWGL 5D1XB 5BZWA 2NT0A 1KCLA 4POZC 4GMTL 4AKQA 5KVFL 3L8QA 3KYNB 2ZXDA 3PFQA 2GTZA 2OSLA 2V4LA 4LESA 4Y5XA 5EU6D 1M71A 4D7BA 4ZD3H 4O4YL 2X41A 3O0LA 1DLHA 5I1HH 3PQYA 2EIZB 1TZHB 2ZTBA 1J5OH 2PXYD 3OZKA 1FHNA 1J1OH 3F5WB 4KZEL 1HCYA 4JRYE 3FAXA 4B7IA 3UPRA 1N59A 1IBGL 2X4NB 4KHTH 2W80C 4R2GB 5T1KB 2D9CA 5IJBC 1HL9A 2JKWA 1SXAA 1YEJH 3F7YB 3OPUA 4KU1A 3QDMA 1IQWH 4M5ZH 4KZEH 2C9PA 1KBKA 4MCZB 4MB1A 4S2SA 3BGMB 3ILPA 5HYJD 4YO0A 3GUFA 1R46A 2LQRA 2XWJB 3IJYA 4QO1B 1MLBB 2WXPA 1JXKA 2DYSB 2X4TB 3VFVB 3V6OC 2XBTA 1FNEA 1SYVB 3SPGA 1UM5L 1WGOA 5FR3A 5CCKL 3FU3A 2E74C 2YSSB 4IIQC 2FWLB 1SDAB 1PTZA 4OVUA 3HNTH 4X80H 5C0BE 1NDGB 1MJ8L 1KJ3L 1X9RA 4AYGA 5JO5A 4LSTH 3GM0A 4BFJA 1OCRB 1CLZH 3BSZL 4DP0X 3SZ6A 4AGOA 1Q4NX 1A6TB 4U1SB 5ERWB 5ERWA 1QSEA 4OI9A 3N0PB 4CN4A 5KAQG 2A73B 3UL4A 1X6NA 4RMSA 4RAVA 4YFEA 3F6LA 3UBFA 3D0VB 2XWTA 1F3JB 3FB6A 1T6VN 2EUZA 1P7BA 4ABUA 3PNWA 4NNPH 4XXDB 4BJLA 3VMOA 4J39A 2RHEA 4XTRD 2Y9RT 1PVHA 4JS7A 4ZTEA 3A24A 1M7DB 2UZIL 5L8JB 4F58L 3EYQC 1X4XA 2Q86B 5FAAA 5LCVL 3FHQA 4O02L 1RCYA 4M6NL 4KXCA 1P0SE 1IAOB 2WMPA 3BPNC 4CVZB 4U33A 1DVUA 5TK4A 1D5ZB 1DVYA 2OL3L 4TUKH 2NY3B 2HX9A 3LKQA 1D6VH 1MAMH 4H8UA 4X4XA 3SO3C 5JQ6L 1SGKA 5GJSL 1KLGA 4LSRL 4DP1X 3UPRB 4FQLH 1YYCA 5T1MA 1YAIA 2CUHA 3TX4A 1TFHA 1KIRB 1TENA 1ZLDA 2R2EB 3GSOA 1UB5B 3C6EA 3MRJB 1ZT7B 3RVTD 3TPKA 4J3WA 4OKDA 3MV11 3SY6A 1X44A 1MAKA 3KL5A 3CN3A 3VVWA 3S98A 3P4OA 3QG6B 4Q6IC 2Z8RA 3GTNA 5I17A 5IW1A 5DWUH 2J4WL 3T3PE 1J1OL 1X5YA 2LLLA 2Y5QA 4EO5A 1WFUA 1ACYL 2NNCA 4AVJA 3MX0A 1AO7D 1FYHB 2GJJA 2UYLB 2LR4A 5CEXB 1AZCA 1OF0A 3IE9A 5DT1H 4XPBH 3LKQB 1LK2B 4DPBX 4AL8C 3CDFA 2WQUA 4PRHA 2AXGB 4WFFE 3IGLA 1KY6A 3KHOA 4JO1L 1AGCB 1UJ3C 1H8SA 5L7XH 3GXNA 2NT1A 2YPLD 4L0YA 3S35H 4DVRH 1HXMA 2G3MA 1DHKA 2CBOA 5CMAB 3K2UH 2RTTA 1A7PH 2YD4A 3VI4E 1SJHB 2Z35A 3GXTA 3QI9D 1ONQA 2PWDA 4QY8B 3G3LA 2UZXB 1VFBB 4K3EL 3WV0A 1HZHH 5D1QD 2BINA 4U1SA 3RGVB 4IBUA 3BPLC 1E8WA 3II2A 1TJHL 4DK5A 3V4LA 4TVPL 3EO1A 4FQXC 5JO5B 3WD5H 1TVDA 3QEUB 3DYOA 5F89B 3KWWA 3VMPA 1EAPB 4JFDD 1OCZB 5CP3A 3VQLA 1H15A 4HIHA 1EJOL 3KPRB 1OP3K 1WBZB 1NJ9A 4IYKA 1KG0B 4PV9B 1WFMA 5JNYB 3L5XH 5TE6L 3VFSB 2LLNA 3RWCA 5KG9B 4HAKA 1MHEA 3MRIA 5BV7L 1QA9B 3PHAA 4KWUA 4P49A 4C47A 3CDGB 2EC9T 1JWUA 1ZVSA 1QSFB 3ZHLA 1NIEA 2FGWH 4FZEL 1CLCA 1SM3L 2MSPA 3NZUA 1N6QH 1M6OB 4HAFA 5I1CL 4YZFF 5JIIA 1MW0A 3QJQB 1I1AD 3U4EB 2OZ4L 5E6UB 1S5IL 4X6DB 4I2XB 2K9UA 1MFAH 3SE3A 2P46B 5JPNA 3FZUC 3ZSTA 5SWZA 4FULA 1PLAA 4UZUA 4TUOA 2YLKA 1WDAA 4PP2B 3U0PA 1RZIA 1YSOA 3KYNA 1C5DA 3DSFH 3EDKA 5D93B 1WEJL 3VSUA 4ELKA 4NWUH 5E5MA 1J8KA 1GSKA 4J4PC 5AVZB 2JJVA 4X7SL 35C8L 3FCGA 5JW3H 5C6WH 3APFA 1FHGA 2J2ZA 3EOBA 4CKQA 3BAEL 2H1PL 3ARUA 2ALAA 3DDGA 4I1RA 1S9WA 3TYFA 1VFAA 1EEZA 2DQCH 4P9HL 1EFXB 2FT6A 5TQ0H 1A8ZA 1R5VA 4P2RE 4HZLB 5EZJB 4WV1B 1NGQH 4M56A 4UCFA 4PGDB 3RKPA 3HBQA 5IVXB 1G4MA 2WINA 1AQHA 3DVGA 4LL4A 3B2VH 3LQZA 4Y1AE 2BSCA 3T2OA 1CFVL 3BQUC 5TF0A 2J3SA 2WVVB 1XL6A 2C9QA 2WKOF 5FW6A 2Q7YA 2WXRA 3WUWA 2JVUA 2I25N 4N20A 5D1ZC 2XTJD 1GHFL 3MODH 4J5VA 2WIIA 5E51A 5IW6B 4PCSA 3CFMA 1QPPA 1KDJA 3VXRB 2IC2A 2BCKB 3B8YA 4WFGE 1O6SB 5FKPB 3CMOL 1Z9SA 2P80A 4PJ7F 1Z66A 5ESAB 5F1NB 4HQQH 4PCYA 4NN7C 3TNMA 4J2XA 3PP3H 3U30C 3AACA 3FT0A 2CMRH 4JPSA 5E9DB 4EN3A 5EOCJ 3ARBA 4EDWL 2YJLA 1F18A 1OARL 4DO4A 4YHLH 2A99A 2P8PB 2WQWA 5FA3B 4ZX5A 2BH0A 3BJLA 4Q97A 2O93L 5FUOL 4LSQL 1Z5YD 3ECVA 1KY7A 2WAQA 4PWGA 3FQWB 3LZNA 4KK9D 1AZRA 2WCPA 1TCMA 3JWOH 3DX8B 2DQJL 3FSOA 4HA1A 2DMCA 2GHWB 1IGML 4ADJA 1KCSH 2GSIA 2IXQA 3OV6A 2X4RA 5HI3D 5CCGE 1T66C 2Z7UA 3HVDA 3TBTB 4QRUA 2VM3A 3NFSL 4UUJA 2H26B 3V10A 1BPVA 1SZNA 2BC4B 4G6KL 1MFVA 1AH1A 3OR6B 1TTRA 8FABB 4ATTA 3NA4A 4EOWH 2ZYSA 1GZQB 3K81A 4F37F 3D06A 3ZKXB 1DO6A 4AYSA 4PRDA 2W9DL 4LVHB 1R34A 1DBKH 2Z0UA 3CE1A 3APCA 3BFWA 4OZFH 3W39A 4HMDA 3LHAA 3HCVB 3D85A 3VFTB 4AM0B 1TZIA 1VAHA 4ELKB 3WE6A 2C34A 3NTCL 4UM8A 5DUBA 5GIRB 3P4MB 4PP2A 3U0PB 3UBXA 3I6KA 1HC1A 4Q6KA 2C3HA 4NJAH 4AIXA 5JXEC 2ZPKL 1YMMD 4FG6C 3NJMA 3QZPA 5E6IA 4TUJB 4Y16D 3MGTA 3FU6A 2P49B 5H35B 2F58H 3II3A 4RGOH 4MBOA 4W4NA 4OVVA 4P2OA 3V9FA 2Y07L 3DXAE 5EWIL 2VDLH 1QSEE 1SDDB 3DGGA 3F84A 1ZHLA 1KTLB 1P7KA 4M7ZC 3SO3B 3CDYA 3T4AA 1E7UA 3UTOA 3ES6A 5ENWB 2FIKB 1EZSA 5H37A 1HILB 3CIAA 3QIWC 4OUUA 4PLKC 2HA1A 4G8GE 3HJ0A 2WXHA 4LOUC 2JJTC 4HAGA 1ZK9A 4XZ4A 4CJ0A 2J21A 2GPZA 3OKEA 1MF2L 5T5NG 4HWEH 1SEQL 2EEAA 3C5ZC 3NCBB 4ZX3A 3O4LD 4ODHH 2PTVA 4N8UA 1T6BX 4S1SL 4ESKA 5C07A 4PTUB 5E9DA 3TBYB 4CMMB 3MUGB 4OT1L 4YDZA 4I77H 1E4XL 4EUPH 5DUMH 4P46B 4OU3A 3O2DA 2APBA 3V7MA 5D6CA 4I1PA 1F13A 1EANA 4JB9L 3R18A 4K55A 2EINB 2CNZA 4N0FA 2FBJH 1DBBH 1IAKA 2Q8BL 4QJ3B 4M6OL 2X9ZA 1BIHA 4JO4L 2GSGA 1RURL 4W6YB 3VFNA 4PRNB 4JZJB 3GHEL 4JRXB 2HYMA 3T0AA 5L4MA 4N24A 1ILUA 3D2UA 1RVFL 1ZVHA 3IDYC 2VXSL 1ZLWH 4L4VA 4HISA 3PAZA 2P8MA 1JZEA 2YMXL 3IJ7A 1H3TA 5TGBA 3FRPA 1ROWA 4LNRB 3EBIA 5F6IB 1GTNA 4NQDD 3WNLA 5AVWB 5AALA 1UWFA 1YJDL 2GCYA 5CS7A 4NBXB 4K9EC 2JKIS 2FUQA 2L7EA 3U7AA 5CCKH 3RJOA 4BH7B 4PJ5E 1EA9C 3TJPA 2X9WA 3RJQB 3BKJL 1CXHA 3L3KB 4LLYB 5AZ2L 4F15C 3T4YA 3DV4B 3BH4A 4P5MB 4FFYH 5I17B 1LO4H 1ZXKA 5GSVB 3D4GA 1WZ1L 2XKSA 2BWQA 2YK1H 4L5FL 4AYFB 1GOGA 2XXMB 1BDYA 3QE5A 5H4YA 3FTWA 1NEUA 3ZHKA 3AQXA 2YPKB 1X7QB 3S3JA 1DBJH 5HHNA 3NCWA 1CMOA 1GW0A 5FGSA 2H3NB 5GRVK 1BQKA 1INDH 3BZ4B 3GQFA 4PY7B 4NRZA 3L13A 2Y1YA 2GBUA 4NIKB 3QCTH 1AGFB 3AM8C 3RDTA 4PJDA 2EE3A 4DO5A 1JGDA 3WDJA 3BSHA 3N85L 2ZSWA 5B8CB 3QP3A 3HZYB 1PAMA 4XTRC 5C0BD 2XX1A 4PV9A 5F2FA 4ODHL 2BFGA 4XNQA 2CLVB 1MQ8A 1FAIH 5HDWA 3QUYA 4HBCL 5MEQA 3QUYD 2R23A 3E8UH 4OLWH 2C26A 1Q90A 2ZXCA 1FDLL 2G3NA 5BVPL 3O4LA 3ATDA 3IFOA 1E5CA 5D2LA 4AIEA 4PB0H 1VFBA 3ARWA 2EXWD 1NANH 3QI9B 1X5FA 4QAWA 4WI4A 3C5XA 4M6OH 5KSBB 1RLWA 1T7YA 1A2YB 1N18A 1ZT4A 5KOVC 2XQYK 1QNZH 4XP9H 3STLA 1KGIA 3JTSB 2I5YL 4PLKD 1B3JA 2X4TA 5ITFB 3VFVA 5GS1B 2UXVA 3WN6A 3QUXB 4X98B 5JDSA 3ALXA 4GAYA 4MKTA 4NDMA 1AOZA 1KC5L 3GMRA 3GHBL 5HYQB 2PKDA 4IKIA 3TO4D 2A9NL 1AD9A 4OFQA 5DRZA 4DVBB 2CKBB 1GGIH 2N1TE 4D0CB 2AK4D 1YJDH 4AVHA 5TDNA 4RCAA 5DJ8B 2Y25A 2VO8A 3WJLC 1A4CA 2GJRA 3G6AB 2CBPA 4JVPA 2LHAA 4XMLL 1J9QA 1G7MB 2H4EA 5CU9A 4MB5A 4NN7B 1J1XH 1OZUA 1KTJA 1FZOB 5B7EA 3WTSA 3L4TA 5ANMA 1BCIA 4XH2A 2BZDA 2DTSA 3G5ZA 4CSTA 2F68X 5JHLL 1CLOH 4FNPA 5F21B 2LTQB 2FH8A 1MFMA 1UB5A 2B5IC 3UTTE 3FOLB 1J0ZA 1E90A 4RISL 5D1XA 5BZWB 1BHGA 4QRSA 2FZ3B 5KSBE 1MJ8H 4OGAD 5C3LD 1J8SA 1IGTA 4NKDB 2O61A 3S37X 2XV6B 1RZQA 4YC2C 1NCAH 4MYPA 4X9YA 4H8WC 5F1NA 2GC4C 5I18L 1B0GA 5FCSH 2WMPB 4GP5B 4EN3C 4R7NB 1CF8H 2EH8L 3TS8A 4HXBH 4X5WB 3QH3A 5FV1L 3ZKXC 4U7SA 3EKCA 4DO6A 3OB0K 1TFPA 4FRWA 3BVNA 3C8KB 1DZ0A 2A0LD 2J7LA 4OI7A 2WTRA 3QHZL 4OLUH 3LQAC 5HYJA 4JM4L 5SWZE 3H56A 1U3HA 1AGBB 1FAIL 4FKEA 4MCMA 4CU8A 4PSRA 1JPST 4YDKL 3X14A 3GJFB 1NGPH 2NYYC 4JRWA 4OBRA 3W0WA 4PRPB 4BK8A 1LO2L 1JPGB 1M1XA 4X42A 5HHXL 2BCMA 5B39B 2BRRL 2UV3A 2HZHA 1XF4A 4KUCF 4JFDE 4Y5VB 5KUKA 2M8XA 1NKGA 4FA8A 4UNUA 1KTBA 2KH2B 1BV8A 4KK8C 3CHRA 5JHBA 3D52A 2CK0H 4MMYA 2HFFB 4M7KL 1G6RH 1TSHA 4KJYA 4NZDA 3ZPDA 1QO3A 1JHLH 1ETB1 4V11A 3SDAB 3A6CL 1T5KA 4L37B 4X7EC 4GRLD 5DHEA 2QTVA 4C4BA 1EQWA 2YSTA 4HWBA 3OPZL 2ZXBA 3U6RA 1ODUA 2W0LA 3EAKA 5DJAB 1OAQH 5KYNA 3MBEB 3NIDB 1S7XA 5LBSA 5B7MA 5ID0B 3D39E 2HCZX 3LKNA 3DURB 3EJRA 3KGSA 4Z77B 1KIUA 2WXOA 3K6DA 2OV0A 2IBGA 4Z5RB 1E9PB 1PAZA 1YEEH 2ZX8A 3QDJD 3ZVVA 2FYYA 3CVIL 1TT6A 4IOFD 3C6LA 4AKOA 2YOAA 5J6SA 1RZJC 4WGWB 1PLBA 2ITCB 1D7BA 4L4TA 1IT9L 4P46C 5D4HA 4P2RA 1QNIA 2FLBT 4JR9H 1BXVA 4JFFB 4HIJB 1JV5A 1P69B 2FQGA 3UDWA 1HL5A 3B2PA 3QIWA 5GRZA 4DTGL 3K4DA 1KPRB 2OFQA 3X3FH 2X70A 5TK2A 5DD5L 2G60L 3OG6B 1BZ8A 2AJ3B 5IGXH 3BO8B 2X0VA 1OARH 3ARTA 4X7TB 1KGYE 1OZTG 2BOBB 4CC1A 4OFIA 1ED3B 1RERA 3QC6X 3QEGH 3RX9A 6PCYA 3KCWA 1A6UH 2CO1A 2H3KA 3CXHJ 3MLZL 3QORA 5FO8A 3OZLA 3D39B 1S7WB 1JN6B 3RWEA 1PIGA 1EO8H 4P8QA 3GRWH 3KPNB 4X6DE 2J20A 4HF5H 3UZVB 5GS3A 1O7SA 4Y19B 5F6IC 3ZN6A 1PW3A 1J5IA 2IFFH 3IKCA 4QHPA 4NM4L 2F5AL 1FNSL 4WO4A 3CN0A 2IMNA 3K74B 1SUJA 2NSXA 4TOYH 4OCWH 2QVFB 5TFSL 3U6XA 3ORJA 2Y5TB 3O6LL 4OM1H 1ZD6A 3HZVB 4U1HA 4ZFFA 1FG2B 2C4FU 2HLAA 1YEGL 4G5AA 2BZ7A 4KQ3H 4LCCC 3SJVB 1SY6L 2BHFA 3QRGH 2NW3B 2YARA 5KVGH 5D7SL 1ZLVH 3L5WA 4FTVD 2UYLA 3FT4A 2FGZA 2BY0A 5FYLD 4NKQB 4YPGB 1P1ZB 4Y7MA 3JTBA 1JNLH 5GS0C 2VR7A 2B39A 4UTBL 3VI3A 3SPHA 2J44A 4NO0A 2TRHA 4BQ8A 1F4HA 2VABA 1DL7H 3ZYOA 3OXRA 3EBHA 1GOFA 5E56A 2F1AA 5TE7L 1XSKA 2AHIA 4EBQL 3SGEI 1H3PH 4FLRA 4NO3B 5JIQA 1OWRM 5JW3L 5KYYA 2Y6SC 2YJQA 3DUUA 4HS6A 3RE0A 1RUMH 5JIDA 4PV8A 4ETQA 2OMBA 1D5ZA 1V7ML 4PD4K 4L29B 3S34L 43CAA 5MENB 1TU2A 1SQ2N 3FK3A 1P7QD 2DJ4A 2ICWA 4YX2H 1THCA 2ITDB 4G43B 1A4AA 2D7MA 2HWZL 4IGBB 4ZPVB 3WLBB 1A6VL 3IKKA 5LCVA 3VWJD 3F12B 3LRHA 2YMTA 3SD5A 2EEXA 1X5ZA 1GGCL 4W9EC 1RZJL 3LZPA 1ZT4B 1AZUA 3D85D 3K2KA 3CZGA 3LH2L 3P0VH 1HKLH 3PNWB 4MMXC 2JV6A 4LPCA 4Z3FA 5IQ7L 5JMOC 1L9QA 1B90A 4PWJA 4WK0B 5K5YA 3VI3F 2QHLA 1KYAA 3HE7B 3SE