2CGZA

Structure of helix pomatia agglutinin with tn antigen
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ
publication title Structural Basis for Recognition of Breast and Colon Cancer Epitopes Tn Antigen and Forssman Disaccharide by Helix Pomatia Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cgzA00
2W95A 4Q56A 2WN2A 2CE6A 2VMEA 2CGZA 2W94A 2WN3A 2CCVA 3WMQA 3WMPA 2CGYA 2VMCA 2VMDA 2VM9A
chains in the Genus database with same CATH superfamily
1AZCA 3CC1A 3CV5A 3MUUA 4L1LA 1I9IH 4QY8A 1KY6A 3CPUA 2G75B 2WLIA 3L4WA 3EIFA 4KOCA 4Y5VC 3AQYA 5D70H 4JZJB 1CFQA 1Q8MA 4KI5E 3V5KB 1KLFB 3VFMB 3ABGA 4WWKD 4X5PA 2BXYA 5HJBA 5ITFA 3VI3A 1ID5I 5GIRB 2BY2A 1LO3H 3ZT5A 3L9RA 1QFWL 2B0SH 4GMTH 1K8DB 2B1AL 3CBJB 4JN1H 4JY5H 4AMWA 5JXAH 2GG1A 3OKMB 2NSMA 3EADA 4C4UA 4FXGB 1T5KA 5JA8B 4APQA 3UO1L 2VDOL 4YHPA 4MCNA 4HWEL 2X1WL 1EEQA 1Z9LA 4MJIA 5C0BA 3SDCC 4Z77A 1C7TA 1R24A 4IBWA 1E4KA 4X7DC 5E8EB 5KYUB 1P7BA 5D7SL 3BP6B 2XYBA 2DDQH 4KFMA 2N01B 4XNMB 3HFML 2FEJA 2LAGB 4AZ8A 4LCWA 1DBMH 1ZT7A 5IVZA 3BD5A 5CBEB 2OZ4H 4G71B 3FTGA 4JM0A 2HPTA 3RAJH 1RPUA 2GSGA 1AG0A 1R5VB 4OLXL 4H5SB 1FFPA 3BHBA 2DL2A 1WFTA 2X0WA 4JHAL 4M3HA 5EH1A 2OLDA 3WEBA 4XCYB 2WQ8A 4YR6B 2DI7A 2XG4A 2AJ3B 3FFCD 3GIZL 4G7YH 4QCIA 4X6CA 1MJ8H 1QP1A 3PU7A 4PRDA 1YEJL 3NZHH 4GLRI 4J6RH 3MRLA 2VRQA 4HIJA 3TA3D 4AEHL 2Z92A 4WK0B 2Y6SD 3QZOA 1UJTA 2XIIA 3I3DA 4YJZL 5KSAB 1JPTL 3PDGA 4ZPTB 4HBQA 3HE7B 3JV6B 4POZC 3RHWF 1MCIA 2J2ZA 3HZYA 5IFAH 2P28B 3D4YA 1NGXA 2GBVA 5HI5C 2M26A 5CCKL 4J4PA 4YEEA 5FGCE 5H94A 4XXDA 3II3A 2BVTA 3JVFC 4LLUB 2YAOA 1AJ7L 2GSIA 3ZE1B 4DHLA 4F92B 2I9TB 3S3JA 3RDTA 3C5XA 2XWJB 4QRPA 5DYOB 2Y6TE 1E42A 5CR1A 2X70B 4LP5A 1DN0A 1W72L 1INDL 1GYCA 2CKNA 4ODTL 3SPGA 1T3FA 3SDAB 4YC2C 1FNHA 4XPBL 3FQRB 4BFNA 1N6QH 3TCTA 1U8CA 2WYHA 2ADIB 1ADQH 1QLEB 3O2VH 1TIUA 2QHRL 2WV3A 2CO1A 1KPUA 4IBZA 4N2HA 4Y9GA 3NESA 5TTRA 1X9RA 3MUY1 1HNYA 3G3LA 4TVPD 4ELMA 2HP4A 2VLKD 2FK9A 4JVUA 1HOCA 5CIPH 2NXZC 1FZMB 5I1CH 2XTLA 3WKQA 2E5EA 3CU7A 3QIBC 4KWUA 4ZMZA 2JJWA 3GB7B 4PJGF 5D1ZA 4L18A 5ICXA 4WO4A 2DM7A 1FAIL 4YSUA 3D4CA 5F6HJ 3DI3B 1CGUA 1AVAA 5MHSD 3HG3A 3W39A 4ZFOL 1FNGA 4A2GA 3RTQC 3BRDA 1HI6B 5L6YH 4W68A 4HDIB 4NHUA 3IDNB 4PGZA 3JTSA 3T1FB 4QOKE 3U2SB 1F1GA 2EE9A 1BXVA 2AAAA 2DYSB 3L3GB 3ZRFC 4PJHF 5DVOA 1BSIA 1KV3A 5J5EA 1ZANH 3MV7A 1BYPA 5SWZB 4P2OA 4EBQH 2IPTL 2QMKA 4WDIA 1ZCRA 4YXHL 1WVZA 1AR2A 2UY7B 4N2GA 2O5XL 1E27B 3CZJA 2QMJA 5JPNA 3LRHA 1NPUA 4YDNA 2QFRA 4H8UA 1XGPB 3K91A 4QRQB 1HU8A 4Z7AA 1UUSA 4NUJB 4R7NA 5CILL 4XZ4A 1W72A 4AQOA 2VMFA 3CZKA 3OX8B 4YDZA 4R0LC 4BZ2L 2EZ0D 3SKOA 5KSVA 3LB6C 4O2CA 5I8CB 1QO3B 5T5FH 3MV8B 1OCOB 4Q9RH 2R1YB 4EN3A 3E6FB 1EVTC 4HCIA 1YCSA 3IXTB 3PP4L 1WP6A 4X6FA 2UV3A 4GG8A 2BSSB 4P23A 2IV8A 5DQ9A 5JZ7D 3LKNA 2R8SH 1KLGA 4HQQH 1JGDB 3U9PH 4YXKL 2DQCH 4DGIH 3TOPA 2OTWA 4F58H 1T5XB 2EDOA 3DTDA 2X0UA 3MBEC 4LCYA 2QZ5A 5KVMC 2FDBP 4HLJA 1K85A 3CMGA 1AQDB 1A3RL 3R4DA 3SKMB 1J1PH 1E9PA 4N24A 1M05A 4O2FB 3FMGH 1EZVX 1Z9NA 2Z91A 5D2LB 3BN9D 2HRLA 3L4XA 2K8QA 4CADB 3FKUS 4Y19A 5D93B 1G9NC 4ZFOA 2X4RB 4JAMA 4PVBA 4MA1B 4H26B 3S9DB 5CEZH 4NM8L 2X7LB 1YY8B 2PETA 3EGDB 3IRZA 4OCYL 4IGBC 1PZUB 1HZLA 4MA3A 4XX1E 4UT9H 4G7VH 3WMPA 2MPAH 2BSCA 3SQRA 1N5YL 3OKYA 3SYAA 4YBQC 1LYQA 5ERWB 4QGYA 2OPCA 2ZWNA 5IOKA 4HISA 3LHPH 3IFOA 4Q58C 1CQYA 2A6DB 4ZYKA 2YPLD 1NCBH 3BGFC 2QVFB 4L9DA 3M6DA 3TYGH 2OSWA 4I0PB 4F33B 1E4XH 1GW6A 1WUNT 2F5AH 2ZOUA 4HWZA 2L4OA 3DV4A 2XVBA 1O7DC 4LIQE 4BZ2A 3WXWH 3F5WB 4D2NA 5L88L 1I8AA 3OAZK 4A39A 3VW3L 4G7SB 5EPMB 3MCLH 2CHZA 5IR1B 1OWRM 1MHEB 4XBGB 1GL4B 1A0QL 2DQTH 3FUJA 5IEHA 1NLDH 1GZPA 4OJFL 1KB9K 1MCPL 4P9ML 2J56A 4FABH 3FOMA 5CMAB 5BW7A 4UMSA 1YPZB 3NSJA 4JFQA 2ZCLL 1IGYB 3V0JA 3UZVA 1OAZL 3D34A 3ARDD 3BE1L 4LAQL 3CDGB 3OLDA 3IDMB 1BZDA 3EBHA 3LIZL 4XZUB 5IVXB 4LNRB 4L1DA 2VQ1A 3WY4A 3EAKA 4JG0H 3ERXA 1QHOA 2Z1KA 3TGXA 2PCYA 4P46C 2FEEL 1SN5A 5E2VL 1ZLSL 4Z7QE 5I8KH 1KJ2H 3OXSA 5LVEA 2PR4H 4LVOC 2XC8A 3B2XA 4QRBA 2Q6WB 4UT7H 4WGKA 4N2KA 3ZGHA 5C0JB 5AW3B 3H4FA 3HJ0A 4MDJB 1T4KB 2X3AA 3O3BB 3JTTB 5SX5H 5L8JB 4GQPH 7PAZA 5F3BB 2BNRB 1NGQL 2D7QA 5F97E 4PLJD 2C9AA 4ENEC 5BVPL 3WJMA 1I7RB 1ID2A 4F37K 1JBJA 5SWSD 3WHXB 5FA3A 4WWKC 2VDPH 4GS7C 5F1NB 2Q9OA 1JWSB 1KIRB 3II1A 3MRBA 4JO1H 5AVSB 1NUNB 2ZSVA 1OT4A 3RQ3A 4N2BA 5FGBA 2B4CL 4DESA 5EF1A 3VDCA 2WCGA 2Z31B 3K2KA 3QUYD 2QKIC 2R0LL 2XWBA 4D8OA 4MB4A 2ROYA 2D7OA 3MRDB 1PDKA 1EZVY 2NQDA 1TCRB 3PJSA 3TJPA 1ZXKA 1OGTA 2HKFL 3ILQD 5D7IB 4ISVA 5A2AA 2CK0L 2DM4A 1R75A 1T0OA 4MX7B 5HHPA 1B3IA 3DX9A 2EVJA 5IJVB 3N2JA 3K71A 1A6VH 5FUOL 3NCJL 1MFMA 1MFAL 4K7FB 1KCRH 3MJ8B 4NDMA 4E9RA 4PRNA 1E9OB 2AXWA 3JBG7 4WUUD 5GRUH 3X14B 3C5ZB 2KZKA 32C2A 1YC7A 4G8GE 2VERN 3LIZA 4L3CB 3TEZA 1FDLL 3MA9L 5L4MA 3MLRL 5ICYB 2H9GA 4G9DB 1BQ5A 2WXOA 4XRCB 1T0MB 1WBXB 5MEOB 4OCNC 1PZ5A 3RIKA 3QUZA 3RUGE 2AS5M 3MLVH 3IE4A 2AP2A 3EFFB 3BAKA 3WS3B 2IXQB 4HOWA 1M71B 1CGYA 4R2GD 1DQTA 1NFDB 3T2OA 1TVHA 3L3KA 1BX2A 1RFDH 1I85C 2YFNA 3KLDA 4YDJA 1AXSB 1EFQA 2Y6SC 3PF2A 4JFYB 5SV3A 3FH7A 3FOLB 1MIEL 5H4ZA 1B0GA 3PNWA 2HMID 5CGTA 1IGCL 4HUWA 3V6OA 4HOMA 1ZEAL 4RMQA 1I8KA 3F7QA 4ZW3A 1CXLA 1VEMA 2Y7LA 3T65B 5E6ID 5GGVH 1A21A 4K3JL 4ODHL 2HAZA 3GHEL 4ODBD 4W9ZA 2PW1A 1NPNA 4P57B 4WU7A 2D31B 1NCCH 5TQ0L 5JW5B 4OUUB 3PCYA 2MNJB 1KWKA 1OAUL 2X10A 2YD5A 4BIKA 4DAGL 5DHMC 1NL0L 3CHRA 5E9AA 3JWOH 3S5ZA 4J1UB 1JPSL 1JNLL 4KTEL 1DL7H 4PBXA 5ALBL 5I16A 5C0AD 5DWPA 1A9BA 2GUYA 4MXWL 4ZUTB 4M6NL 3NSFA 4R7LA 2ITCA 1FJ1A 2J3SA 4JB9H 3WNKA 1IIIA 1W15A 4XE0A 1YEDB 3UABA 2OMWA 1D9KC 4BWWA 5CCGE 1F56A 3GO1L 4KO6A 1SM3L 4GI6A 3UEZA 4JDVB 3ZDWA 5E70A 4WIQA 5K39A 1U58A 4DN4L 4NO2B 5HGDB 1CT8A 3ATAA 3Q7JA 2QPDB 5ABAA 3GQFA 3UPRB 1TZGH 1KPRB 2JCCE 2B16A 3N85L 4TQ8A 5EDXA 3EHBB 4YS4A 2VDRL 2FSEA 3RFZC 4W9LC 3DJSA 4N0UA 1ZHNB 1PG7L 2ETWA 3GIVA 1X5FA 3P4OA 2GYSA 3DLQR 3V5HA 2EIZB 4ABWA 4A2LA 3PWLA 1R3IL 4NYLB 1NDGA 3ESUF 3BXNA 4MQ7A 4PJEE 1TQVA 1J5OH 3IVKA 1R3LA 4PJFF 1KBWA 3MR9B 4OBRA 4ZBJA 3D5OF 4KQ4H 3G5YB 4GKSA 1JD9A 5GXBB 4D0DA 3NEOA 4JFFB 2VLLA 3L2MA 5ADPL 4RCAA 1FYHB 5D96B 3GJFK 2BZDA 4WJ5A 2B9AA 3SD5A 2UUDK 4FA8A 1X7SA 4PH8A 4ZTOL 4W4OC 3AGWA 2YSSB 2EZ0C 3DO7A 1JRHH 1CUOA 2XRAH 3G08B 2EVHA 2YD3A 1VA9A 4ADGA 1N0XL 4X4ME 5CP3A 4M6OH 1OQOA 4YSTA 2Y5TB 3I2CH 1RZGA 2GTWB 5ESQB 5F0MB 4IHOB 4WNQA 5C08D 2VSMB 3L95B 5AOLA 1UM6H 1J9TA 1QG3A 3NDYE 4ELDA 3VXMA 1PF3A 4J3BA 3P9LA 2Y9RT 3QO1B 2G5UA 2X6UA 4PJAA 5ANMA 4QKXB 3ZMNA 2J1YA 1A25A 3UAAA 2AHIA 3JVGC 4OZFH 3PGCA 3BN9C 5FW7A 2FJGA 3J7HA 4RQQB 3OBAA 2JIXA 4ZTEA 4P49A 4GRLA 4TN9A 2VLJB 4TPRH 4XWGH 4MASA 1WC7B 2Q7NA 1DVXA 1KNOB 2XWRA 1VADB 5T33L 4KO7A 3MVSA 1LTXA 2YD6A 3L6FB 1U3JA 4Z7NE 5HGAA 5D72L 4HT1L 3PL6D 4U4IA 4ZXBD 1AIFB 3H53A 3WN5B 4NNPH 2KLRA 1X3DA 1CIUA 5A2JH 3C2AL 3I6GB 4BKTC 1KDIA 4N2LA 3O2WL 4I3RL 2VWEE 3LN4A 1RIHL 3IDXH 2FL5A 4A68A 1G4RA 3P9MB 5HYJE 4BQ6A 1CICB 4R4ND 1XF3B 3GMPB 3ZE0E 4AM0Q 4XMKH 2QGDA 4TQPA 5K1JA 5MEQA 2DWXA 3UTSA 1UOLA 3MV11 3BUQA 4FQJL 3U1PA 4RFNC 1KB5A 1MKFA 2AVFA 5T5NF 1NLBH 4DTGH 1AHWC 3SQOL 1ZLDA 3T8MA 2VL5A 1EA9C 2Y07H 4Z7OF 1V55B 3MLSH 4PJIE 2J88H 5DMIL 1PNCA 3D52A 4GRWE 4ZFFB 5IZ7A 4X5WA 3O9WC 4Y1AB 5AAWA 2EH8L 3IFLL 2NY2B 2X4UA 1GC1C 1BLNB 2VMJA 1FWXA 5DS8A 5E2UL 4AJ0A 4E9XA 4LSVH 1IAIH 4Y2DD 3ZDXB 2GJZA 2ZXQA 1DJZA 4N0FB 3T71A 1U8QB 2NY4B 3SO3B 4R90L 4IRSA 1E5CA 2JCWA 3HN5A 4M9OA 4HHGA 4P9HL 2O26U 1YHPA 5TF0A 5D6DC 15C8L 3VXUA 4EZKA 4RZCA 2DWEA 2BP5M 1A2YB 4NN5C 3VVWA 3CFCH 4RBPK 3PWJA 1KYDA 4PTUB 2C4XA 4TULH 2B59A 4HKJA 1E5BA 5D1XD 2QZQA 1A02N 5I8OL 1NJ9B 2E27H 4NC1C 3O6FD 1BBDL 4GY4A 4R0LA 1H19A 4FXKA 4UM8B 2ZUQB 4PLJC 1EO8H 6PAZA 1EHKB 4K07A 4HPOH 5LUMA 2P44B 1GYUA 1DQML 2DS4A 3IRPX 4JM2D 1ORQA 4RAVA 1P1VA 4DGYL 3MC0A 5CWSA 1NFIB 3OR7B 1HNGA 3QG6A 1SEQH 1ZTXE 3STLB 4G6AD 5AVYB 1A7PH 4CBPA 1QKZH 1JDAA 3QUYC 5IOPA 1CE1H 1PLGH 2XXMB 3ARQA 3OKEB 2VR9A 3I9GH 2MCMA 2C4FT 1N4XL 2Q7YA 4EI6B 4I4WB 3ABZA 3HB3D 4JRYB 2CJUL 4TVSa 2NTSP 1WWAX 4L37A 1V5JA 4HX1B 1UQSB 3ILQC 2XV3A 2ERJC 4PB0H 4PBWD 5I9QB 1KACB 3QAQA 1QWNA 3GK8H 1MCQA 4X7SL 1ET5A 1EHLL 3IGAB 1LD9A 4AK2A 4KVPA 5C0DA 3QCVL 3AG4B 1RUAL 5D5ME 5F70A 1S7VA 1JUFB 1EMTL 1SBSL 4UNIA 5DRNA 2NQ3A 5CGYD 1XGTB 3E7JA 3LDBB 3QO0B 5DS1A 3LPPA 3V4PB 1T6VN 4WVRA 2FB4H 2HA1A 2R83A 3QNFA 1XV8A 2RHEA 4P4KB 2YJQA 3RFRA 4K5PA 1NIAA 4NQDE 3TCXA 5ILTH 3WO4C 4F15B 3BWUF 3KJ6H 2NSQA 4R2GC 4P5TB 1YECH 2QKSA 4MDIA 4W9JC 3KMDA 2MQGA 3ZBMA 1IGFL 1L9SA 3RPKA 5AW6B 1MH5A 5TQ2H 4PJXB 1C08A 2WINA 2HMIC 1SYSB 5GQBA 4NN7C 4NQQA 2IH3B 4Y1TA 3CXHJ 2P8PA 1IQDB 3H9ZA 1EGJH 3QNYB 2NY1B 4GAGL 4WV1B 3FUEA 5BO1L 4NO0D 3EYQC 4HVBA 4MTMA 4Z7WF 4UTCA 5E6IC 1KCSL 5DZJA 3LNGA 2OJ1A 2BIHA 4KV5F 4N6QA 1AS6A 1HJBC 3FCTA 1EJOL 3MRNA 3TBBA 4ZX4A 3NSCA 4M1GL 1S7SB 3BWAB 2PPAA 3QAZC 4XP9L 1FORL 1DBKL 3L3OC 2Z9TA 4Q2ZA 2H1LM 1ONQA 3P4MB 4YK4B 4LEXH 1U3NA 2HFFA 2YEZA 5C97A 2Z7ZA 4G8GD 2F7PA 1DVFD 1UM4H 5FKPA 2FH8A 3LN5B 2ORBH 4N8CH 2V5SA 1SXNA 5BCAA 1A1NB 4P5RA 3WDJA 3LZFH 5GS2H 4S1SL 1P53A 4IEFA 5KWYC 2JF1A 3CZLA 2VR4A 4LQ1A 3W0WD 3N43F 2C9PA 4XVJL 5I6OA 4GO9A 5IWLC 3FQNA 3HIZA 2NUTA 3N41B 2E3VA 4G70B 5KVGL 1WAAE 3W9DA 3ULSB 3Q8BA 4U1MA 1P1ZA 1Z2KA 3GZPA 4IK6A 3EFDL 1CBVH 3LPGA 1U93B 2P8LA 3MROB 3LPOA 1DFXA 3C75A 3B2DC 4PS3A 4IBTA 5BRZA 3N0PB 3WJLA 3BFOA 1C5CH 3QQNA 3D2UA 4U3CA 5DJ2B 2GIMA 5AQ0A 1CGSL 4WNSA 3EH4B 3ZE1E 3IJ7A 2ZP9A 4JRFA 1Z66A 4NQSA 4HZLB 2RCSH 4KHTL 3V0AC 1Q9OB 4IRJA 3TASA 3G5VA 4YHKH 3WFZA 3CH1A 1G6RH 3QUMB 3QJZA 4FP8H 3SDXB 2P5WD 1JWMB 1KBBA 2ZF9A 1RIUH 4O58H 5B7FA 5D7EA 2RQ8A 2CGZA 3L5XH 3OZLA 4LCCA 2B5IC 3FN0L 3U0PA 1BQHG 3MRIA 3KLAA 4TVPL 5JR1L 2H32A 4DVBB 5EUOB 5JPMB 2FJSA 4J3OH 1AYOA 2W9LA 1T7XA 5HPOA 3SD2A 4WHYH 3OV6A 2WO2B 4RGNC 4GSDL 4LOUD 1AACA 2UZXA 4XPGL 1G9HA 4YL9A 3O81A 3STBA 2ILLA 2FYYA 1R4XA 4NN6B 4H8HA 3WE6A 5C6PB 1ZS2A 3WU1A 5D1QD 1Q9WB 4Z3HA 2DWDA 4NQEB 2KZ1B 3KDMA 3TA3A 4M6ML 5LN8A 1S9VB 4QO1B 1TEFA 5HHNA 4GUCA 4H0LC 1ROCA 4XN9A 1ZGLB 3J27A 4X8JA 3RPIB 2Z0BA 2C7FA 4OH2A 1KBGH 4AQAB 3FCGA 4TTDD 5J8OA 5FB8A 1KXHA 3LNDA 3OWEA 4ZX6A 6PCYA 4JCLA 3UZEA 1G7MA 2DLEA 1GRWA 1I7ZA 3NCMA 5SWZE 5T1DL 3RNKB 4XNUL 3UC0L 3RWGA 3WIAA 4JO3H 4ZMOA 1ZDQA 4H0HB 2BVPB 2Q3XA 4HOXA 1QTPA 2DBLH 4AGOA 1L7TH 1ZA6A 3GRWL 5I66B 2EUVA 5LXVA 3A4FA 4XMXA 3PL6C 4ZXBC 2OAAA 4KX8A 3JV4A 3KPOA 2J4WL 3N50A 2Y1AA 4TUJA 5DXWA 4O51A 3MV8E 3DJRA 3EYUH 1DBAL 3KYKH 2N56A 4U0RC 2CJ3A 4R4NC 1AHKA 4KJYB 3ELAT 2CPCA 5AOKA 1KIUA 1Z3RA 3RDJA 4OLYL 5T1KA 1HN1A 3TVMD 1IC4L 1SXBA 4JNXA 4WI7A 5CD5C 2CO3A 1MSPA 4G6KH 1JTTA 1UJ3B 2N0MA 5CP7A 4EKJA 5IEKA 1FE8H 3NOIA 4I18C 4BA0A 1T2XA 4BFEA 2EYRA 4HV8B 3HN8A 2WSDA 4OM0L 1HE7A 1OPGH 4IQHA 2NX5E 1I9RH 3T8XA 2FIRT 3IMSA 1YUHB 3T77A 3GYRA 3DROB 5DMKA 4B3EA 1FL5A 4AYMC 4MXVF 1LJMA 3UZQB 3MLUH 2V9UA 2BVOB 1THAA 1BFVL 4Y2DC 1I7TA 1XGYL 3TU6A 4BCZA 4MSWB 4XPTL 3WELA 1CE6B 1ES0A 6TAAA 3IU4H 2EIKB 5C0NC 2P7TB 3OLEA 5AALA 1HKLH 1P9MA 2EDKA 2IBZY 5LBGA 1U8MA 3PV7A 3UYOD 3F6LA 5CN3A 1F4YL 1RUMH 4BK4A 5J9PB 2WM0A 4JO2H 5L7XL 3C60B 5DQJB 1T22B 1JL8A 3SB3A 1U3YA 4XCNB 2CJTA 5T3XH 2DQUH 3U9UA 2D4DA 3EGXB 3NK4A 5D1XC 3IWVA 3GRWA 5D7KD 1QLRA 1R46A 2WMPB 5J13C 2BY3A 3O6FC 1T03H 3TIEA 3WL9A 5DJ0B 1F86A 2CRYA 4JFXB 1S7TB 3BKCH 5EO0A 2AJYL 1FH2A 4LGRB 1EIBA 2YA1A 2YAHA 4KKRA 3HAEA 4FFWD 4U1GB 4JJHA 5KYYA 1COBA 2XVLA 4G6AC 2Q87A 2R2BB 2WTRA 3CX5J 4MQXD 2IC2A 1Z3GH 4PJCF 2UZIH 1HEZB 2BOCA 4XVUD 3UGXA 4EXPX 1TNMA 2EE3A 1U2CA 4X98A 1YPZE 4X6EB 5T3ZH 3BUBA 3V0HA 4EO5A 4K8RD 4F7MB 3D0VA 5FYJD 2IMMA 3F58L 5FUCC 3D09A 2G2NA 4KRLB 1GZQA 5IG7B 3VWKA 2NY5C 2NY3B 5IVXE 3NIDB 3WKMH 3NUKA 4Y16D 3T2NH 4M43H 3RU8H 4TSBL 1KXTA 5ACLA 2H5UA 1WF5A 4RDBA 4HJGB 5J3HD 3TTYA 1MJUH 1SOKA 5E2TL 4Z78B 3Q8AA 4FQ2L 3MPCA 5CGYC 5IB3B 3HC4H 2E76C 1V7MH 1VDGA 2LLNA 3NMEA 2A9MH 1NSNL 3BH8A 3ZR5A 1CVSC 2R7EA 5FHAL 4ZTPH 4DP7X 2XJKA 2CKBB 5DRXA 2X2HA 3RWJB 3L45A 4CVXB 5IHUL 2BNRE 1HHJA 2ZX9A 4MBOA 1GGIH 3TEUA 5C0EA 5CLWA 3CLWA 3PG2A 1U8JB 2VH5L 3FB5B 4GW5A 4KRNA 1C8PA 3B5TA 3T0BA 3I50H 2XN9A 2WQSA 5FUZL 3TBCA 2XKSA 3N42F 5HYQA 4EDWH 1HK6A 1P4UA 1P5UA 1G9NH 1HCVA 2XDHA 3CDZB 4OAWA 3MUJA 5AVWB 3S5YA 1QWUA 2DTSA 1GY1A 4LARH 4LSPH 3QRBA 2I5YH 4LSUL 5C2BL 1U8HB 5B8CC 4UIMB 4HBCH 5G4OA 2ZOKA 3OR6B 25C8L 2H3KA 2COQA 2JXMB 3OG4B 2DYRB 4YHML 3QJHB 4NRYA 5D7IE 2Z64C 1XB3A 3OXRB 1ITBB 4L23A 5JIHA 4CC0A 4OJAA 5JIKA 1Q0YL 2HSIA 5E8PA 3GEFA 3TC9A 2AERT 1NGWA 3RIFF 1BJ1J 1BVNT 4JZNB 3ARDA 4PJBF 2BC4B 4HS6B 5IMOA 4LOFA 5ABDE 2HFGL 4GUPA 2X09A 4MYPA 4GAJH 1DVFC 1H3VA 4F7CA 1KEML 3MRFB 4BUHA 3HHMA 4ODVH 5FIEA 4NFBA 3LH2L 4N2EA 4HD9A 3V6ZA 2E7MA 4NQDD 1MDTA 4HUMB 3QZWG 3JT0A 3GSOA 4HS8H 3O3AB 1KENH 4AGLA 1O9WA 2CGRL 1AMYA 1BM3L 1NFDE 2YLHA 3TFKD 1SUJA 3ARXA 3ARVA 5DD3H 4FADA 2G30A 1TVBA 3VVVA 2J5LC 3V0VA 2Y3NA 1G5GA 5INDB 4U1SB 3CXHK 3UACA 1MEXL 3P4NA 1CFNB 1KLUB 3QUXD 1F4XL 3ZKNC 4PV8B 2WXLA 3N3EA 2HN7A 5I1JL 1P2CA 4WSGA 4QRRD 4RFEB 1Z9PA 3RBGA 1I8IA 4LASH 4UB0L 1T5WB 4H8WL 1BWMA 5L0QB 3QIUD 1INQA 2AVGA 5KANG 5FECA 5I30L 5HYEA 4JY4B 5E9DD 3FO2B 2ZQKA 2PYEB 1FFRA 4ZPVB 3B7TA 5K9OA 1NDMB 3WTTA 1CXIA 1CL7L 4Z9KB 2YC1A 5AW1B 5CUSL 3BT2L 3FUHA 2FJHB 3MKKA 4KVCL 5E8NA 1DANT 4AX3A 1R5IA 1RUKL 3U6XS 1KC5H 2ZWYA 1NMCB 1INEL 2Y7QB 4JM4L 3MV9B 2SEBB 3KYAA 4LOUC 1M7XA 3S98A 4HIHB 5DZLA 3QEQB 4OF6A 4EUPH 4FQXC 1N5AB 1IBFA 3MLYL 4QRTA 5BO0D 5KEZA 2Z35B 4G42A 4XAWL 3PDOA 3DX6A 1F6AB 1KCKA 1UB5A 3VAEA 2OI9C 4PS7A 3P0VH 5EN2A 4L8BB 5D1QC 2GJ6D 2BO0A 3Q2LA 4K23L 2DIJA 4M5ZH 1WS8A 3FONA 4XN5A 3V6FB 1U8PA 4LMQI 3AB0C 4PJ9C 3S36H 3AACA 5SWQA 1USQA 4TTDC 2DAVA 2XVKA 4A7GF 3ULVH 7TAAA 3GC3A 3FHAA 1V7NH 4TUOB 3J8F7 3WY3A 5IMLA 5CIPB 3Q2VA 1SJHB 3D85D 4OLVH 1KJVB 4XN1A 4FNTA 2FD6H 2C9RA 2HJLA 5JW3H 4J23A 3UAJA 5E6IA 2PTVA 3ISRA 3C5JB 4NKOB 4JFFE 3BKJL 4QXWA 2OMXB 3KPRD 4MGXA 4HJSA 2WNWA 3D9AH 4PG9B 2UWEB 3TT1H 1PKQB 4KO5A 2I69A 4NAMA 4TF4A 3DX8A 3AWFA 3QCTH 4GAAA 2YLKA 4WI8A 1TZHB 1CBJA 1I3GL 3FL7A 3H9SD 5IQ9B 5DA0B 3ZTCC 4XGZB 2EEFA 4E9VA 3NSDA 3ARGA 4KROC 1ZT4A 2BX5A 4YQXH 3D06A 1TETH 3TVMC 3V52H 3OSVA 3PHQA 4JDTL 4HSQA 2A74B 3UMNA 1T1ZB 4O02B 1PYWB 5LJYH 1T1YA 4AT6B 3MLWL 1SXSA 3KAAA 3QWNA 1UACH 3SPIA 3HHSB 1JGEA 1UXSA 1UOKA 2HJFB 4L0YA 2WZ0A 4RDQF 3BKYH 2XACC 4X5XB 1U8NB 3HR5B 4M7KL 3HG1E 3SDDB 3OHMB 3B56A 5TE6L 3F83A 1KCVH 2IG2L 4AGNA 1VGEH 1GY2A 6FABL 1L0PA 1YJDL 3N04A 1MQKH 1WHPA 3IDIA 4LO9A 3TO2A 3KYNA 1WZMA 4YLCA 2VLJE 1J8HD 4L8DB 3HS0B 3CH8A 3IJYA 4TOYL 1RZJC 4DEPB 1Q72L 2O6EA 1VEPA 1I9JL 2MQCA 3GBLA 5EZOL 1E7UA 4X8GA 4DCQA 1V3LA 4BYHA 1LEKA 2C34A 3SGEH 3FU9A 2XPZA 3CVHH 4XTRC 4XPHL 2DLFL 3LV3A 4W9IC 4KZDH 1S9WB 1JFQH 1WZLA 2XWCA 4HH8A 3HVDA 4JFPB 4OTXL 5IY5B 4OCXL 1RZPA 2N1TE 5C6WH 5EU4A 4L4TD 4D0BB 5M7QA 5K33A 5TE4H 2DQEL 4L1HA 5HVHC 2BRRL 2RFXB 3QVAA 2Z6FA 1SLXA 4OD2A 5MERB 3W2DL 2PMZA 4CMMB 2H8PB 5HSFA 1ZHKA 2GK0B 1C9SA 5GRVK 5T1MA 2D7TH 2GT9B 1BREA 2W9EL 1EEYB 4FFWC 1JXJA 2GC4C 3IPEA 3LMJL 2QJDA 3UJIH 2QR0A 5D2NC 2GTZB 3AAZB 3MYJA 4ODXA 2FCBA 3U30B 3CHQA 1QSVA 4RWYL 4MQXC 3UL4A 1BMWA 3G6JF 5GJSL 4TLKA 3UYPA 4XVUC 2NW2B 1ZVSB 2CZNA 2NX5D 2XYCA 1P7KA 2OMTB 4Y1AE 2D9CA 3ZJAA 3AXIA 3KPMA 5EF2A 4K8RC 5KW9H 3JWNC 3QRGH 3QDJB 5J56B 1ZA3A 1BLIA 2X2IA 1SHSA 4IOSD 3SGJA 3TP4A 4WKZB 1U6AL 2QQLL 5CCJA 3L3JA 5D7JB 2ZKWA 3P40A 1C5BH 3RLSA 5I1GL 2APWA 3NFNA 3QG7H 4Y16C 1J8RA 1YNTA 3ISWA 5C0FA 4K2UH 2W0LA 4R4FH 5KSBF 3U1QA 5C8JB 5J3HC 2VO5A 5B1KA 4B9GA 4YLBA 1BEYH 2JQZA 4HEPG 5IHLB 2FO4A 3AZUA 3ZTDC 4FJ6A 4MD4B 3TO4B 4WAFA 5A40E 3QQ9D 4PFEA 5FO7B 3SKJL 5BZDB 3BPOC 1M1XB 1XIWD 4WW2A 2J8UF 3S37H 1IT9H 1JGVL 3CFDB 4LIQL 4JFOB 1LEIB 1F4WH 2Y36H 4NQVA 1W2KT 4BZYA 3L3IB 2W92A 3LKRB 2VMEA 3LZQA 2B2XL 1DZBA 2HCZX 2AEQL 4HK0B 3SN6N 4GKLA 2Q86A 4YHLH 5E8OB 1FG2A 1J5CA 2DMBA 4LGSB 5IMMB 4I0KA 5F72S 4F2EA 3FQTB 2V7HB 2LTQC 1HT6A 1FO0H 1F11A 5DUBA 1JDCA 1ZLUH 5BQ7A 2CNZA 4GMSL 2WQXA 1X5LA 3LRLA 2V9RA 5EORL 5BV7L 3GLAA 1KJ2B 4LSRH 2JK5A 2N59A 3NRFA 4K9EC 5IB5B 4FNLL 2JLLA 4HCRL 4GBXD 2NY5L 2XICA 3CWGA 5AYTA 1H5BB 3FUFA 1RIVH 4HLZG 1V8HA 1OE1A 4JKPH 5G55A 2MCPL 3QDAA 5AZ2H 2DEWX 3B7SA 4KXAA 1RZ7L 1DR9A 1TJIL 1LDPH 2FX7L 1DUZB 2PNDA 4DOHB 1EBAA 3BUTA 3ILDA 4G9FB 4PI0A 4HU2A 3BUYA 1KBPA 4ACTA 5GGQH 2OYMA 3RI5K 2X12A 2X89D 2X6MA 4A67A 3PNRB 1HL8A 3C6LB 3EOBB 1MI5E 5B39G 2YMXL 3M1CA 4UINL 3A4EA 1MCFA 3TFKC 4RRPA 4ONFH 3ZDYE 1HESA 2VR5A 1F90H 2YMTA 1GC1H 1HKFA 1M7UA 3ARTA 3S2CA 2XFXB 5CD3B 4PJXE 4U1LB 5EA0H 3PXLA 4B27A 3QUXC 1SUHA 4KY2A 1OAKL 3R4RA 2R0ZH 4JM2A 4PB9L 1IM3A 1CLYH 2IWGA 1QUNA 3GBNH 2IH9A 4QLRA 3VI3B 4MJ6A 4QF1A 1DZ0A 2J1WA 3PABA 1IEBB 1Q94A 3L9RB 4ODWA 3IFNL 3QZBA 4Y8AA 1JGUL 1EQWA 3T6VA 2A9AA 2M2DA 4AL8C 1AY1H 1FNEA 3VUAA 3QIUC 1IAOA 2Q20A 4APQB 3BZ4A 2AKRB 3TYFB 1C5DB 4DFIA 3M7FB 1DYZA 3SKNA 4Z77B 1JZ2A 4GG6F 1I3RA 4YHIA 4B9CA 2DWYA 4K7PX 4YDIH 2WWNA 1NIEA 3B4NA 2HKAA 5SX4H 3P77B 1KELL 4F9LA 1M7DB 4ZO7A 3OKDA 4OF8A 4AZ8B 1BQHB 3QJQB 5KJRH 4LCWB 5FGSA 1AFVL 4L8CA 3L4UA 4X7TA 1HL5A 3P3YA 1RH8A 2H1PH 4KDTC 4PN6A 1FFPB 3QXAB 2O93L 2FLBT 4UOW0 3QC6X 2G60H 4YOKA 2VDKB 2V6HA 2YBGA 3HBGA 3QXVA 1ERNA 3IYLW 1K6QL 4YDLC 5EBGA 1MNUL 5FM5M 1CZ8L 1TOXA 2KBGA 3B9VA 3DPBA 2H41A 3P2BA 4LESA 1AQKL 3MRLB 4HIJB 2LU7A 1VPOH 2X42A 2YJLA 4EDXA 4ES8A 1HXYA 3JWDC 2EDNA 2WVTA 3QORA 4ERSH 3APMA 3T09A 5ENWA 4FGMA 1MWAL 2VM9A 2H3NB 3RWFA 1S7WA 3ARED 2GK2A 2HJKA 5DJ6A 2J2ZB 2WZAA 5EZJB 1E6OL 2CCVA 4PJ5D 4KMTH 5C0GA 2CCLA 5LQBL 3H42L 4NC2B 4BSVA 3LXAA 4QAWA 4YIQA 3SPCA 1D3CA 3L81A 5H94B 1P0SE 2EKSA 1AD9A 2WB1A 1KGXA 5I6NA 4YFDB 2QPUA 5AVQB 3K6SB 2QDVA 4QRPB 4ZODA 2VXVH 1DN0B 3LZRA 2WO3B 2YGOA 5J1AB 5DQDH 1T3FB 5KOVC 2GCYB 2DQGH 4DIXA 3X3FH 2PKDA 3BVWA 4M4RA 5EUOE 4DP8X 1U8CB 1UT2A 5H37H 3RNQB 2FAUA 4P99A 4LLDB 4G8GA 5TH2A 2BDNL 2NY0C 3B5HA 2XQBH 1ZIBA 4EMZA 1HOCB 2BJMH 2Y7SA 4IU3A 4J7RA 4JCMA 1FUNA 4ZFGH 1XXDC 1H0DB 2N4IA 3RUGA 1QQDA 3PP3H 1U8KA 1BQLH 3ARUA 4GRWF 4AZUA 3HC0B 2V5TA 2WXFA 4NQEE 5ICXB 2DH2A 4ZJ9A 4XHQA 4KFZC 1UH2A 3QS3A 4P2RE 3U7WH 1QTSA 2VXQL 5F7LB 3CQQA 2Y4SA 2HFEA 4PGCA 1TT6A 4UZGA 4QXGH 2EILB 3DGDA 4K0OA 1RUPL 4FQCH 3AU1A 3IMRA 2XUWA 1VACA 3N40F 4NJAH 3MODH 4LB8A 1WD8A 4JHZA 2P45B 1FLTX 3UJJH 1BF5A 1OSZB 3QWRD 2WXKA 1ND0A 3AROA 2MOVA 4XP1H 3D08A 5EU6E 1CQKA 2BSTB 2ZTBA 1MWAA 3MV01 4PS8A 4OD3H 3ULUE 5CAYB 3MV7B 3RG1C 1A4JB 3GMQA 1MIML 2D8KA 4JR9H 1TCMA 3THMH 1RU9H 3D48R 5DEFB 4KPHH 2WK2A 4BHUA 4FF9A 5E8DL 3IMBA 1DJHA 2WKOF 1DCEA 4H7VA 3B9AA 5J89A 5DLML 3UXFA 1V3KA 2NLJA 2J6WA 1Q0XL 4TTGA 5HP5A 3PHSA 1W72B 4BH8B 1RL1A 2XBDA 3R18A 4O2CB 3QQDB 4AOFA 1E3XA 2F5BH 1JNNH 1UCBL 1CLVA 1AXTL 2IALB 2ZNWA 4AVKA 4EN3B 1U21A 3AXLA 4Q6YA 4P23B 4LCVA 3T9WA 1TQSA 2CSPA 5I76B 2JCCA 5ID0B 1O5PA 2OTWB 3NRQA 4OJEH 3PHOB 4NB7A 1PX4A 1VCBC 5DTFB 1LP9F 2GB2A 3SKUD 4PGJA 3DGGB 5EUKB 4LCYB 3V4UH 3K4ZA 3TZVD 4NSKB 3WTVA 4PIRF 2VSKB 5HJGA 2I7OA 2PYFA 3BH9B 2FNBA 3IBEA 4N2AA 1L6PA 3LRKA 5E4OA 3WNMA 2Z91B 2CE6A 2AXHA 4G1MA 4CJ1A 3ZKMD 2E9GA 4JAMB 4PJEA 1WCBA 5JW4Q 3QH3A 1PZ3A 5DD5L 5HHQA 5GGVY 5K5YA 1M56B 1AKJD 1HSAB 1IGJB 1IU1A 2SODB 1UH4A 4MA3B 1TKWA 2LE9A 4AYFA 4AWJC 1SVCP 1P4LA 5HHMD 3VGEA 4PRAA 4LP8A 3O6KH 4OIIH 5A7BA 3UCQA 3QQ9C 2FYVA 5J06A 5DK2A 4RISH 4I1PA 3LNFA 3I85A 3OTTA 3IFOB 4YHYC 3JYCA 1XIWC 4ZYKB 4LLYA 3RZCD 3GJFA 2E9IA 1FSKB 3SGDH 3KXFB 2DQJL 1JI1A 1LMIA 2RACA 1L9RA 4YN3A 4WI0A 4MHHI 1IC5L 4X4MA 4YHZL 2HVKA 4P5MA 4E0RB 1UWXH 3D18A 1CK0L 1S7RA 3NPSB 1LO0H 4OSUH 4FCAA 3MLZL 1JHTA 2CAKA 1UENA 5FYKD 1TQTA 3MJ9L 5IEHB 3FTZA 1KULA 1IFHH 3I74A 1GZPB 4M56A 2ZOTA 2BIMA 3NN8A 4GBXC 3WNIA 3H2QA 3TBWA 5E08L 4HUXB 4JFQB 1YEGH 2BWIA 1EZLA 1ZD6A 4TLSA 1K8IB 3NIDE 2CJSA 3ALWA 3QR1A 4W9DC 3UZVB 4ABVA 2EDRA 3QQ3A 3MRRB 4GEJA 2B39A 4JKLA 4R8WL 3KPNB 4MAYD 1BZEA 3DVGB 2O5YH 5DWUL 2DOCA 3QXDA 2WBWB 4AMKL 4OT1H 3WBDA 3NJGA 4F5CE 1ECZA 1ZSDA 4WW1A 4UILL 4PGDA 4YGVA 2YPVL 2VKWA 1XMWA 3ZMEA 1JK9A 1URZA 2WBKA 4PY7A 3DTUB 1FBIL 4Z7VF 4NQXB 4MMXC 3SYOA 4LFHD 3TV8A 3ZL1A 4HOZA 5MEND 4PJDB 4UQ2B 2PW2A 2IGFH 1WK0A 2RTTA 4TSAL 1I9EA 3FUIA 4NRZB 4QAMB 4XNZB 3QZWB 3V7AG 3D39B 4Q74A 2O5ZH 2BCMA 1A6TA 1Z9SB 1ZTXL 5HHVL 5GHWH 1GSMA 5HYJA 3EO0A 3KNBA 5SX4I 3O8XB 4UQBA 1UG9A 3V7MA 1UA6L 4GSRA 3SE3A 2P43B 3CC5A 5FA3B 4WUKL 3DIFA 4N1HB 3H9YA 3W11D 2VDQL 3WTXA 4XWOD 3ZT6A 5EIIA 2JJTA 3GTTA 2W5PA 4K9EL 4DN3L 1KV7A 2HX7A 4JFDD 3A4AA 1MFBL 5FF6B 1BBJB 4MNQE 4ZAKA 3BWUC 5J6GA 3VSTA 3FU3A 1MCEA 1P4BL 4KHXH 1NC2D 4PJIA 4C4KO 4NCC1 5I0VA 5J6HA 1BVKA 2Y5EA 3PJSB 4FL4B 4OB5H 1BYNA 1IKFH 4LSQL 2R4RH 1DEDA 1OWWA 4JQVA 3E9UA 1B3JA 3MJ9A 3MLTB 3DX9B 4JPIA 3VMPA 2D7MA 5GS1A 4EI5A 2ATKB 4KK5D 2D0FA 2KHAA 3BDBA 1EZUA 2OJZH 5H8DA 4KXZI 2EUWA 2KH2B 4NBZB 1QSEE 2OX5A 1D5XB 3O41B 4HIXH 3N9GL 1A4BA 1MI5D 5DJXA 2DQIH 1NFAA 2R2EB 3IRCA 3MRGA 5DD0H 1MHCB 5C09B 4WRLA 5I1LA 1OB1A 2YPVA 3QUZB 3IU3A 1SYVB 3AVEA 1PY9A 2H0FA 3QJFA 3KDPB 1JPFA 3NSYA 1JD7A 1YMMB 4U1NA 4YDJB 2BRQA 3VXQB 5HVGB 3KWTA 2XZAH 5I23A 4J8RB 3JT2A 5DHVH 3O6LL 3OKKA 4AL8L 3AREC 1B0GB 2BHUA 3B83A 3FZUC 4HWBH 3GSWB 2L8AA 5IESH 3B34A 1UYWH 5JOPE 2JI3A 2DB8A 5H35A 1GR7A 1P5VA 1D7BA 4OGYL 2YD1A 1A3LL 1PX8A 1T1XB 1LQBC 1OXYA 1KFAL 2PYEE 1SBBA 5C0IB 4F57H 4G80A 4WU7B 1XCQA 1H3PL 4HMCA 5IFJB 2BVQA 1DVYA 3L7FA 1XCTB 4C56D 2J43A 3GMMB 1BMGA 3W82A 3OAYH 3MQIA 4QRSA 3WJJA 4LQFL 5I16B 5D5MA 1KCBA 3ETTA 3MV9E 4F7EA 1RJYA 2C3VA 3Q13A 5KYNA 3BCDA 2BS8A 3MOAL 3QEQE 3VFOB 5I1KH 3VX1A 3O4OC 2CRZA 2OMWB 3C8HA 3V8CA 1ETZB 5DHEA 1UURA 2A6IB 4QI3A 4N9OB 1SDYA 4NQDA 1YNLL 3HE6D 2QSTA 1GGBH 1U58B 1UD6A 1CT8B 5D2LF 5I74B 4JZJA 1LK2B 1RUQL 3V5KA 4IKIA 1KLFA 3VFMA 4ZMXA 3FYEB 2RD0A 2CNYA 5TFSH 5GIRA 3GM8A 1RV6X 1JHLH 3OPUA 4MVBD 4N0UB 3MRJA 1JZ3A 1EXUB 3RKDD 1K8DA 2WIIB 4GH7B 5CCHE 5E4IA 5DVPA 1X7TA 3BKMH 2PWHA 4FXGA 4HFUH 3MCKA 2BIIA 2IPTH 4YPJA 3LRSB 1QACA 4NIYE 3QT2A 1UEMA 1B4TA 4MQ7B 1OAXH 4GXUM 1OEZW 2GIXA 5CJXC 4JKWA 2F19H 4PWHA 2EEAA 2PPDA 3B9KD 4GKSB 1WZ1L 5E8EA 1K4CB 1SJMA 3BP6A 2APFA 5DZ9A 3L9YA 2ENSA 4D0DB 2VLLB 4PRID 2AJSL 2UWEE 3BVTA 1PKQE 1AS7A 3MGOA 3T0VA 4WJ5B 2W0FB 5CBEA 4HUCA 2A9DA 4AC2A 3CBKB 1D5IL 2Q2EB 4H5SA 4PBDA 1D5BA 3CUPA 3HBQA 4CA4A 3GBDA 4U6YA 2YMOA 4XCYA 4YR6A 3UG4A 4Q6IC 1XGQB 2AJ3A 3A6BH 2CIKB 1HAWA 1YPZF 4KMQA 1RZGB 2EABA 4WNQB 3ZHKA 1JZDC 5DHXB 5HBBA 2PTTB 3VXMB 5KSAA 2DM3A 4ZPTA 4Y4FC 2I7SA 1ZVNA 2JB5L 3CMOL 3TS8A 4F24A 3ZE2B 4YZFE 1WAAA 3JV6A 3TZVC 1T89A 2KYIA 2MMXA 1DSFL 1MUJA 1ZHLB 4N2CA 2HG0A 5KAQG 4UM9B 2VDRB 3BGMB 3SODB 4Z23A 3BVVA 3SGDI 2H45A 4LLUA 4KI1A 1E9QB 2FJGB 3ZKMC 2VQUA 2I9TA 1JHKH 2F9BT 2XWJA 1UHVA 3NABH 5DYOA 4GRLB 3D07A 3SSGA 2X70A 35C8H 3M1BB 3TN0C 1D6EA 3SDAA 5JOFB 3CXDH 3C08L 4JLRA 2BY1A 5LLIC 2ADIA 1PVHA 4YC2B 1FYTB 3HZVB 2V17L 1ETB1 3IN2A 1HXMB 3TT3H 4BZ1L 2W80C 3QIWD 4HJJH 3TWCH 3RZCC 3GSRA 5FM8A 5EO1A 2NDGA 3LN4B 1ZTMA 1CFVH 5CEZE 4ZMLA 2FL5B 1FZMA 2FT7A 5HVWA 5F71A 3QDGB 3L4CA 4L4VD 4YE4H 4Y4KC 3OSKA 5MEQB 2Q8BL 1OF2A 3EOTH 3GGWB 3UTSB 4L9LC 1PG7X 1F6FB 4A7VA 5CSZA 2Q10A 2DKUA 3ZOAA 2EACA 1NCWH 2WJ7A 3HNVH 3ZKXC 1G9ML 4FQHB 2VL5B 1MELA 2VLRD 1HI6A 4YGAB 4PLNC 3QDJE 2IDCA 3IDNA 1OLZA 1E2WA 4LRIC 3T1FA 2P52A 3U2SA 2WVUA 2EDMA 4X5WB 3HG0A 4XH2B 3RTQB 3SDYH 2VQ4A 3LIZH 3EYFA 5HPMA 5DS8B 3PAYA 4F8NA 3OKNB 3WNOA 2W0PA 3ML8A 1E30A 5SWZA 1KXVA 5FA4A 4MAYC 4UIKL 1EDHA 1QFWI 2UY7A 5IJKA 1E27A 1DVSA 3EYOB 5HJ3B 2QSCL 4X6DB 2YAQA 3VXUB 1XGPA 2ZZUT 4NQUA 4QRQA 2DWEB 3ZIYA 5C3LD 4NQCD 4NUJA 4PW4A 1U4FA 4I2XA 4DQOH 3LXBA 4FFZL 3O11B 3RWDB 5I8CA 5B39B 3MV8A 2H7WA 3A67L 2R1YA 3O6ML 5DUPL 1JFHA 4R0LB 5AW4B 1GIGL 2WAHA 2APBA 1P4IL 4BZ1A 2BSSA 4RAVB 1G7IB 1GGYA 1AQ8A 1JGDA 4WJKB 4JEGB 5CWSB 3MN8A 4XVTL 3MXVL 3W11C 4XWOC 3UPCA 1T5XA 4FZ8H 1RZJH 4IBQA 5D1ZI 1A6UH 3VXRB 5AVZB 1JYNA 1AKPA 3P3RA 4XE5B 2PPFA 4IMKA 5EWIL 4AV4A 3R1GL 2FEDD 4M62H 3GWJA 1P6FA 4OM1H 4D3CH 3MBEB 2NX5A 4L37B 3ZW3A 2J25A 1U30A 4ZMQA 2QTEA 3SE4A 2CDGB 5G5DB 1I1AD 2YKLL 2EVIA 4IOSA 1NCAL 3RA7H 3FO0H 2X7LA 2CXKA 1YY8A 1XB6A 3EGDA 4KK5C 2RQEA 4OGAD 5DJCA 1TJMA 4FZEH 2WXRA 1LD9B 3MNZB 5C0DB 4GPVA 1L5GB 4UT6L 4HXBH 4IGBB 1QBML 5ERWA 1QZNA 4GFTB 4V1DE 4F8QA 3LXUX 4NUQA 2A6DA 4MQTB 2ZWKA 3V0EA 3BVDB 1F97A 4DO4A 3GXUB 4K8RH 3JWNH 2FBOJ 4Z3GA 1ZXQA 5FYJH 5I1IH 1BECA 3SBRA 1MF2L 4FFZA 2D3LA 1G84A 1ZOXA 3DO4A 2F8XC 5EPMA 3HEIB 1XSKA 4S1QL 3I6SA 1QNZH 2FGWH 1MHEA 3QHZH 4XBGA 4OVUA 4HCFA 3O3DB 1TYRA 1UT1A 4MNQD 4F7PB 3D1MC 4OLZL 4IRZH 4U6HB 4JHWH 3QDMD 3GKWL 4Y5YC 1OAUH 2E74C 5DVMA 2A9BA 1O9ZA 5A7EA 4L0PB 2DZEA 4Y9BA 1O75A 5IT2H 4HF5H 4XZUA 4MXWH 5IVXA 4LNRA 1WZKA 5DHDA 4XMTA 3S34H 1KZYA 1NMBH 4AQ1C 1BFOA 1ZJBA 5C07D 5FOJA 1ONQB 3KZ8A 4XX1G 3TIDB 1T83A 1HZHL 2X9YA 3JTBA 2OL3L 1QSED 4BRJA 2W9DL 1FP5A 2MPVA 4FMKA 2HH0H 1NIBA 4DF9A 2Q6WA 4MMXA 5HGBA 4UT6A 4IEFB 3O3BA 3HE6C 3ESMA 3NGBC 3FO9A 4R5VA 5GJTH 5F3BA 2BNRA 1FH5L 1LDSA 3MSPA 4WEEA 1I7RA 1Z9MA 3R06B 5BMFL 1QNIA 1MCCA 2ICEC 2WY3B 1QA9B 2NUTB 2OZNA 4GIPD 5F1NA 1JWSA 1ACCA 1MAML 3NCYP 1PLAA 3L5HA 4MVBC 3W9DB 3LEVH 1CPUA 4U1MB 1P1ZB 4WWKB 3OMIB 4GS7B 4GXVL 4U3HA 1F00I 3RKDC 2P8LB 4XCFL 4BH7A 1I8LA 4KUZL 5BRZB 3MRDA 3ETBJ 4M5YH 4HS3B 2ENPA 2NNFA 1TCRA 1KYAA 1IKNA 3QWOB 1G0XA 1KBKA 2D2OA 5D7IA 4NQSB 2ODIA 3DOSB 1F41A 4QRPE 1K72A 1NWOA 3UBHA 4PI2A 4PGEA 4GKNB 4MX7A 4BWTA 7FABH 4TRPL 3G5VB 3B9KC 3IMWA 2H3XC 4PW3A 5IJVA 3CH1B 4GYBA 3VXOB 3L3DB 5CF3A 1U33A 1REIA 1FLRL 3MJ8A 3D3VE 4GQ9L 4L05A 3T2QA 2X6BA 1E9OA 5FAAA 1KB5H 1FL6B 3UPAA 1DN2A 2X6VA 3DKHA 4CNIB 2PWEA 1N0XH 4L3CA 4J3OF 4Z7WA 2FATL 3RY4A 4N87A 5E5MA 4G9DA 4HMDA 4PY8J 1T0MA 1WBXA 4XRCA 5MEOA 2UZXB 3LYRA 1CGTA 2IAND 3QFJD 1OARL 3WS3A 5IHZA 1DFBL 1M71A 2FYYB 2OL3A 2VN3A 1NFDA 3W37A 3WUZA 3RGBA 3L4VA 5BXFB 3WE6B 1IQWL 2CLRA 3EH2A 3K2IA 5LAXB 3FFCB 3IJ9A 4TNVK 2KMWA 1AXSA 3ZDXF 1MG3C 1BAGA 2DWDB 4YX2L 3UCRA 4JFYA 1NGZB 3D0LA 3E38A 3AADB 4YHOH 4XI5C 3TA3B 3FOLA 2YUZA 5LDUA 1SEBB 1FGVL 4LPYA 2CLVA 5HHNB 3OM3B 4YH6A 1WIOA 2VABB 3ENEA 2V5RA 1S5IL 1BAFL 1BW8A 5FB8B 5KBLA 1GJIA 4WEMB 3CFBA 2Y5QA 4PJ5A 3RB7A 2QSQA 3Q3GB 1YN7B 1XAUA 3GFUA 4P57A 1WCQA 2XU9A 5JW5A 3AG3B 3U0WH 5A2CA 1G94A 2DF3A 4MKMA 3NAAL 4OUUA 5AZUA 3WS6A 4HT1H 1JPGA 4FYSA 4OFYD 3ESVF 3X3GL 2AAVA 1JNJA 4J1UA 2EDJA 4ZUTA 3US9A 4YO0B 1GYAA 2QQQA 2QL1A 2UZPA 4M1CC 1RIHH 4ZMVA 3IGLA 2BNQE 2VLMD 3JWDH 3KPOB 1N3NB 3QIWC 3WHE1 5JHDD 1YEDA 4TUJB 4POUB 4AW7A 3GI9L 1OPOA 2L0DA 4JDVA 2PO6D 2XKNB 1A4KB 3NIFB 5I15L 2VLKB 1CLZL 4G59C 4HH9B 4XBMA 1L0QA 5HGDA 2XPGB 5E4EC 3UPRA 1TPXC 4XBEH 4N28A 3H3PH 4YFEA 3NACL 1SDDB 4M8UA 1B9KA 3OL2A 3REVB 2FEEI 4CUCA 3CVHB 1E50A 2FQEA 5CP7B 3KYMB 3FU0A 3BD3A 3CFUA 4MAUH 4KJWD 1ZHNA 5GSRA 2X44D 3A24A 5FO9A 2IQAA 1JTPA 3VGAC 2EIZA 1XZWA 3T77B 4B53A 5DMKB 3RWEB 4DPRA 1FL5B 5JQ6H 3JZ7A 4AYEC 3HJEA 4DVRL 4JPKL 1CLOL 1I7TB 3QWRA 1OSYA 4H1LH 2AEIT 4UI2A 1X7QA 3MU3A 4UNVA 4KNUA 3MR9A 3NA9H 5BS0D 3G5YA 3HN3A 1F2QA 3ARWA 2WXJA 4P59L 5DFWH 2NYYC 4JFFA 1GJWA 1U8MB 2IOOA 4MA7H 2F54D 1QWHA 5DFAA 3EO9H 1SJVA 3DI2B 1B0WA 3LS4L 2YSSA 2EDWA 2EE6A 1AR1D 2O6DA 3V0FA 3KXFE 4XMPH 5CLTA 1QLRB 2B3RA 2I60H 5CEZD 2XA3A 3UGUA 4WU5B 2QVIA 5GRVL 3WDHA 2EEBA 3ZKQD 1A14L 4FLSA 1FN4B 2UY6A 2Y5TA 2GTWA 5ESQA 3S6CA 1BPLB 4TUKL 2NT1A 2J20A 5ES4B 3FB8A 4IHOA 4AIZB 5FYKL 3L95A 3UDWA 3ARZA 3KVDD 3SE8H 3NRPA 2VM4A 4RVBA 3SYPA 4A2MA 3QO1A 2YGPA 4Q4EA 5GISH 5JQIB 1IX2A 1OM3L 3KBHE 2D0GA 3UTOA 1FRGL 1RD6A 1B4JH 4U7MA 1CDYA 4D7PA 3HG1A 3RL1B 2EH7H 3S2AA 5FHBH 3RURA 4F2FA 1E2VA 3VFNB 5B1JA 5CZVL 2VDLH 4LT7A 1M1SA 4F9PC 3KJ4C 4RQQA 1GZQB 3VRIB 3WAJA 2AF2A 4WY7H 2D9QB 2VLJA 2BFVH 4OGAC 3GXIA 1SMDA 4ETQB 1OGAE 5BNXD 3PAZA 1F2XK 1KNOA 1VADA 1BXUA 4HUKB 3K8KA 4N2NA 2FX8H 4KC3B 5F9WC 3RWIA 4UOQA 3PWVA 2KERA 4IIQC 1HFUA 4PJDE 3S35L 1HE8A 3HCVB 3ECBB 3BH8B 3N41F 4LRNL 4FAAB 2DLIA 3I6GA 4RMUA 3RWCB 3UTTD 3D39E 1XB8A 3NPZB 1R17A 2RR3A 3BQUD 5C0EB 2YPLB 2HFTA 4Q97A 5IQ7L 3PWNB 3QCUH 4WI5A 4YNYA 2QEJA 5FV1L 5HYQB 3TEYA 4HKBB 4NENB 1EBPA 1U4EA 4OAWB 3FQXB 3L1OH 3SBPA 4HSAC 2P46B 4UQ9A 4HMEA 3H6AA 2VT0A 4RFNB 3SDXF 4M7LL 5DK0B 4NP4H 2C7UA 1E4WL 2J7LA 2XBTA 1AHWB 2NR6C 2ZOKB 2OYKA 3FAXA 2VXSL 3KPSD 4EIGB 2E46A 4Y1AA 4ZFFA 3FQWB 4NRYB 2JELL 4QPEA 4ZQTA 1G7LB 5GZOA 5EUOF 4HJEA 1A4AA 4JANB 4J28A 4MKTA 1LO4H 1TENA 4ZG1A 1J0IA 1NGWB 1CO1A 2HKHH 5DJZA 4UV7L 1TMQA 3ARDB 4O4YH 3DDFA 1OP9A 4E36A 4YHNA 2VR3A 1U3HD 1TU2B 4V1DD 2LLLA 3ZQ9A 1MFNA 5DU7A 2BOBB 5C09E 4XNAA 1LK3H 2A77L 3T04D 5B38B 1I75A 4NN5B 1WWCA 1NM4A 3GSOB 1TZIB 4D9RD 4WHTA 4GUOA 4LSTH 2PWDA 4UM8A 3GMNB 3VTAA 5F1SA 3ZYIA 2L7JA 4YXLH 3PGDB 1YMME 1NMAH 1Q90A 1TVBB 3GSNL 2FE0A 1DQJA 4D9LL 3H54A 4Q9QL 1NFIA 4D0CB 3KLSA 3LKSB 4ES9A 3IETB 5AUMA 5SWSB 4OI8A 3MRMB 5EIIG 5FDWB 1BCIA 4HKXB 4OCWH 3IMUA 2HN7B 1CGSH 1P2CB 2BSEA 3C5SA 2APXA 3IMTA 3QS2A 4N90D 3V6OE 4AEIH 3CK0H 1I8IB 3QI9C 4EI6A 4NHCH 3ZRSA 1PAZA 2KLSA 2V9QA 4XXCA 4YDMA 4AQ8C 3U36B 2IH1B 2OV0A 4HX1A 1UQSA 1EUUA 2XWTB 3WFDH 4MZ2A 2OBGA 2CMRH 3CNKA 2PWFA 4NJ9H 4ZT1A 4DO5A 3JWNG 1HHGB 1OAYH 4OD1H 4FQ1L 1UB6B 1CDUA 3OMNB 4MQSB 2ERJB 3ASWA 3NCCB 4JPQA 1A4CA 1NAML 3SPVB 1FFOB 3IGAA 1L0YA 2VB5A 2B15A 5HDLA 5K9KA 3KR3H 2X4QB 2ZD0A 4CILA 1JUFA 1LE5B 5BRPA 2NY7H 2TSBA 4WEUD 1U2HA 4N0YL 1XGTA 3BAIA 3QO0A 4Q0XL 3L5IA 3RX5A 3V4PA 4JO5A 1FF5A 3DX1A 4PRPD 1E8ZA 4WUUB 1C7SA 1H3TA 1E6JH 2GI0A 1VAHA 2XTJB 4P4KA 4V33A 4ALAC 1B2WL 2YAMA 4PWJA 2MRYA 1W0VA 1G7HB 2VWEC 1J7VR 1MI5A 4G42B 3DX6B 2R4SL 3HMXH 2Y7OA 4P5TA 1UB5B 1F4AA 3B3IA 3WO4B 1PZAA 3FRPG 1ZV2A 3L1FA 5IW3A 2VC2L 3VGBA 4B7IA 4DJMA 4R2GB 4PJXA 3BLKA 3NJMA 1GZHA 1U8PB 4OLWL 5IIEB 1IB5A 4OZHF 2JJUA 5EC2A 4OV5B 3HC3L 4HPYH 1O6TA 1GH7A 3GSNA 1IQDA 5KSUB 4I5BB 2P5PA 4UQAA 3ULVF 1BA9A 1TTBA 4AEFA 4NN7B 5HY9B 2QSVA 5IB4B 2W1NA 3QPXH 3VG9C 2CM5A 4F1ZA 4H20H 4QHLB 5E6IB 1A7NL 2W0KA 1S7SA 3BWAA 2FBJL 1TQCB 4H0IA 1F58H 4WK4B 3MOQA 2E9JA 4ESKA 1QSFD 1NCDH 1NCGA 2B14A 4E9WA 3VG0L 4MJHA 2PXYD 3DO3A 3DSFL 1ML0A 3L3OB 3H9HA 4NWTH 3HAEH 5HHOD 4DP6X 2AEPH 1MFCL 3V6BR 5C0AB 1AH1A 4C83B 1UM5L 3LSOA 4DP0X 1SFHA 1BDYA 2BFGA 4NO3B 5C6TH 3MMEA 5DF0A 3A3YB 2Z8SA 1KEGL 1AHMA 4Z8FL 4Y2OB 1JYVA 4DKFL 1R3HA 2DD8L 5IJDC 2WN2A 1SHXA 3BFWA 4JCWA 3PHQB 4LSSL 5EZIL 1UZ6F 2VJXA 1T1YB 2OP4H 3WXVH 4P3WA 3ZE2E 2WW8A 3P11H 4KJWC 1UXSB 2GSMB 1OALA 4JFEE 4M00A 4OIAA 4LP4A 1TXKA 4XXWA 3U4KA 1U93A 1E8WA 4JW3A 3MROA 2ED7A 3QQXA 3GLZA 1CGVA 4K3EH 4JKKA 3ZHFA 4AK1A 1IC0A 2O72A 3OZ9L 5DJ2A 3ULUL 1PIGA 4F7TB 4XHJD 1AANA 2AJVH 5BUPA 1YYMH 4O9HL 4L3ED 1WFJA 4NZRL 1R9FA 5KS9F 2OMZA 3KYNB 1JZ4A 5FGCB 2C9SA 1DJWA 2XZQL 4MWFB 5GS0D 2PPEA 1CWVA 4I88A 4LLQB 3KWWA 3HI5H 1A7QH 3QUMA 3VTTA 3AY2A 4DCQB 5FO8B 4XN2A 5GSVB 4H88H 1K5NB 1D5MB 2HT4D 4KAQL 5GGTL 1FYTE 3LS5H 4V2BA 4NEHB 2N1KA 3BW9B 1IJNA 3ZZSA 2BNQD 4OCSL 4OFPA 1OANA 3MHZA 4DVBA 1DO5A 1X5HA 4F20A 1UH3A 1AR1C 2I9LA 2B5IB 4GXUN 3ATEA 3T3MB 5ADOH 1DQDL 5EU4B 2YK1L 2AEWA 4B95C 3QDGE 3UYRL 4L5FE 4PS4H 3VACA 2J71A 4HAGA 4LU5H 1OTUC 4XB3A 4BFGA 2P5ED 1ZHKB 1MRDH 3DRQA 5AW9B 4AKOA 2FX9H 5F1IB 1EDYA 3OQ3B 1Q9WA 3GXTA 3L3HB 1K2DB 4NQEA 1S3KH 5D8JH 2H2SD 1WHOA 3MYJB 4ODXB 4P2RA 1QFOA 5C08B 5T3XE 4ANVA 1UWGH 1ZGLA 1JVOA 1XGRB 3AY4A 3RPIA 3UYPB 2YPKB 3VGDA 1AOHA 4HJIA 1P7KB 1ZK5A 2DRUA 2VIRB 3OJVC 5HVFB 4QTHB 4JKMA 2PCXA 4NAJA 4K5MA 3V4VL 5IBUG 3SGKA 1ZA3B 3MNVA 4S1DD 5CBAB 5TDNA 5EU6A 3RNKA 2Z8RA 5TPWL 2HG5A 3VXNA 1S8DB 2CXGA 5E94B 2CUMA 1YNTB 4PRHE 2WXQA 1GAFL 5C0FB 4OQTH 4XCCL 1OSPH 2BVPA 3CVCA 3V0WL 2QELA 1TO4A 1NUGA 2WUCH 4PJ8D 4X6DE 3VXUE 5I66A 4U4BA 4NC0B 4MDRA 4NWUH 5FW8A 4EKXA 3MJWA 2IQ9H 3K6FA 3VH8G 5T3ZE 2LFGA 3Q0HA 5DC2A 1CU4L 3MDJA 4ZXBB 3PL6B 3FCBA 2J12B 2ZYHA 3LQZB 5IP4A 4WW2B 3WIHA 1K3ZA 5GGTA 1YEHL 4P4RA 1J10A 2V7NB 3BQUC 4X80L 4I77L 2VUYA 2FWLB 3B2VH 4KKNA 3FCUB 1J05B 5F7EL 4ZMTA 4U0RB 2Y69B 3COOA 3LRGA 3DHMA 2Q86B 3TH2T 4JFWA 5I6PA 3VXRE 4BSJA 2OK0H 1JXGA 1UJ3A 4HWNA 3ALPA 4MCYB 1KCUL 1AZVA 1RULL 2X87A 3AXHA 4LEBA 4HV8A 1F11B 3HE7C 2WYIA 5DUBB 1MRFH 4WFFD 4XC1L 3TLRA 5BQ7B 5LXGH 1S9YB 4PWIA 5IROD 4DZBB 4I18B 1Q0YH 2ZWLT 1YUHA 3G9VA 3UTPE 3DROA 1YO4A 1UD4A 2D03L 3E3QC 3TV3H 2BVOA 1N8ZA 1TSHA 3LQMA 1N64H 4U6VH 1B4RA 1CE6A 4N0CD 3HRZC 2AITA 4ONOA 4FG6C 2P7TA 1OGAD 2J6EH 3AM8A 4LPCA 1OP3H 4NLHA 1A7RH 4IJ3C 1KGCE 3T2PA 1DSWA 5FKAA 5IHHA 5J9PA 1U3HC 2R1WB 4R9HA 3KWUA 3JUZA 4ZZKA 2A4EA 5DQJA 1T22A 2A3TA 1JG9A 3LEYH 1O7VA 4LBEB 3BUYB 1QRNE 4KY1L 5A16B 1SHWA 1X5KA 3HMWH 4RFOH 1VGKA 2F74B 2G3XA 2JKSA 2KUTA 2WGNB 2IO5A 4QHMA 4AIEA 4NZUH 4RSYA 5AZEL 3QSKB 4NPKA 5IM7B 5DJ0A 5D1XB 2G2RA 4POYA 4JFXA 5EV7A 1PS3A 2YEVB 5J13B 3S4SA 2KPWA 3DIDA 3O6FB 4EQ2A 5JORB 4OZIE 3HG5A 2ZAGA 5B7MA 1MFVA 3MA7B 3QZNA 4Z76B 1O7DE 4UBDC 1HZKA 3HA0A 3T5WA 2YARA 1WE5A 4JM2B 5DD1H 5DVLA 1A3QA 3BZFB 1CN4A 5EO9B 2R2BA 4UDTB 5L2KD 1AG6A 1I9IL 1T2JA 5D9SA 1HEZA 3CGTA 1DBBH 4L8SC 4FQPA 4ODWB 4AG4H 5D70L 4BWUA 2K9UA 4X6EA 1KMGA 3ET9F 2YKKA 1FNEB 1UVQA 3NJKA 5DJ8A 5ESAB 4F7MA 1IAOB 1MXGA 3HB3B 5CUSH 1YC8A 5IG7A 4RETB 1LO3L 5I71B 4GMTL 5J11C 4JN1L 3DARA 4JY5L 4UTBH 2JLPA 1I1AA 3MXWH 5JXAL 5D6CB 3NCYS 1E65A 4WGWB 4XMUA 5JXEC 2JH2A 3RX7A 1TTAA 3OKDB 1SY6A 2ZPKH 3ROLB 3WV0A 4Z78A 4F5CA 1WWWX 5IB3A 2N7AA 3GLDA 4L8CB 3BIKA 2CUAA 2GEEA 5EU5A 2DDQL 3RWJA 4CVXA 4P3DB 4CSTA 4N4YB 1WICA 1RZKC 1URIA 4JQXA 4BINA 3RY6C 1U8JA 3FB5A 1DBML 3ATFA 1A7OH 2A7BA 2OZ4L 1J86A 3DPBB 3P0YH 4MYWB 2ZKHH 1LHZA 3CDZA 2XN2A 2D3JA 3FSAA 2I32A 4Y5XC 4EDXB 1WH0A 5AFAA 3GS7A 3QJVB 1VRSA 4BKLB 1G1OA 3RWFB 1S7WB 4G7YL 4KBPA 4UIMA 4PJ6A 1MJ8L 2HJKB 1V3JA 1HEJC 3GZOA 4M7ZB 3NZHL 2FECL 4J6RL 4PPTA 5C0GB 3INUH 1GW0A 3QJHA 4MNQA 4BSVB 3OXRA 2IFFH 2WLHA 4YIQB 4A2HA 5AVVB 1ZVHA 4NO0B 3MREA 3QDMA 1MG2C 3BGAA 2AABH 1KIQA 2E6QA 5IUSA 3LX9A 1FVDA 5IFAL 2EIBA 1LWHA 3K2UH 3H4HA 4JZNA 2BC4A 4XO3A 1QHQA 3NJVA 3GBMH 5EBLA 1RZ8B 2XZZA 3ARBD 2OJEA 3MJ7A 4L3AA 4M4RB 2EE2A 3IT8D 4JPSA 5J6SA 3MRFA 2E8YA 3V0DA 3DUUB 2C3XA 3IF1A 4E9SA 4QXTB 4G8GB 2CK2A 1DVFB 1WT5C 2CHWA 1QSEA 1KGWA 4DGVH 3HFFA 4KDVA 1N6QL 2Z8WC 4PQXA 1HINH 3WNJA 3QJXA 1TNNA 3DXAE 1ADQL 3FBKA 3H2WA 1U8KB 3GSUB 3FFCE 5FWQA 3O2VL 4PJ7E 2NY6D 4KK9D 4LXFA 5INDA 3W0WB 1KLUA 4UQEA 1QBLH 1W6LA 2XWXA 2XN0A 4J3OD 3BUIA 2OMUB 4KJQD 5I1CL 1E0OB 1WITA 3IKCA 4BM7A 4MS8D 1EHXA 4Z3IA 4XC3H 1D2OA 2NW3B 1FIEA 1IGTA 1T5WA 3CSBA 3Q6FB 3DA0A 3SBWA 3CVIH 2Q7AA 5A3ID 1P7QD 3LKOB 4H2CA 1AO7D 4WEBH 5ICUA 2YXVA 1EH9A 4JY4A 2AK1H 4S10A 3LZPA 4KUCF 4ZZFA 4LHJB 5GS0C 2PYEA 5FWRA 1NDMA 5L6YL 3EYSH 3QPQD 3Q48A 2GITB 4ZUVB 1F18A 2WVVA 2HT4C 3ZYOA 5LKNA 5I1HH 1JZ6A 2P5WB 2HZHA 1AOZA 1ZANL 2Y7QA 5CJOH 1EVUA 1PBYA 5DRWB 1A6WH 1X9LA 2NLJB 3MV9A 4EBQL 3T2LA 4LCUB 3T6XA 4HIHA 3QEQA 3T3PF 3NIFE 1WBYA 1N5AA 1YQ2A 1GGCH 2VLKE 2HTKD 2Z35A 2B8OT 1DJSA 2VZSA 2WLKA 1F6AA 3E8UH 5IJCC 5IK3B 5LWYH 1Y1DA 3AXLB 3MFGB 1HCFX 4L8BA 1HH6A 5KVEH 1KXQE 4DKEH 5FK9A 2HT2D 4C57C 4JS7A 2H2SC 1HDMB 5KTEH 2OI9B 1LE9B 4W9EC 4JFED 5T5FL 4GOSA 1OKEA 2ATAA 3D30A 4Q9RL 5D1QB 1QMUA 2OTPA 1BD2D 4RAHA 3B43A 5MHSE 2JQAA 1PZSA 2NTFA 3D25B 3MX0A 3AB0B 2R8SL 4HQQL 4NKMA 3U9PL 3U4EA 2DQCL 3DGCR 3F64A 4S1DC 4TUOA 4DGIL 4F58L 1WAEA 5CIPA 4A55A 1SJHA 1MCBA 1KJVA 5AYUH 3SE9H 3B7YA 2YD2A 1UZGA 1IE4A 1V10A 4LSDA 1WCBB 3P0GB 3G6DH 4GP5B 4JO8A 4PJEB 1T7VA 3EDJA 1NBVH 1J1PL 2LVEA 1H8OA 4GLRH 3FMGL 4PJ8C 5K59F 3GUTB 4AYFB 2OMXA 1KN2H 1FNSH 3VI4E 7CGTA 1HNFA 2YOCA 4BUQA 1XGUA 3OB8A 1JGVH 2MEJB 2UWEA 4PG9A 4XOAA 1BIHA 3T0ED 5CEZL 3VI3F 5DK2B 4CMHC 3U25A 1ACYH 5D7LD 4UT9L 1TZHA 4G7VL 1N68A 1A1MB 3V7AE 5IQ9A 5MI0C 2MPAL 5KG9B 2IWFA 4PJHB 5D4JA 3TF4A 3PS6A 4PV9A 4FD0A 4XGZA 1RZQA 3CZSA 3HI6L 2YRZA 2WUBH 2PO6A 2HVKB 5I6MA 5DJAB 3QIBD 3LHPL 1GTFA 2A74A 1T1ZA 1PYWA 4AT6A 3V0IA 1NCBL 1R33A 1S7RB 3HHSA 3T0XA 5F0LB 3TYGL 3VFTB 2G0KA 5EOTB 1E4XL 1TF4A 4JREC 4CN1A 1GVIA 2F5AL 5IROC 1U8NA 2XXFA 3HR5A 3B37A 4CN4A 5AW0B 1F5WA 4E5XG 3PGFH 1F0LA 3QR2A 3WXWL 3L4TA 1DLFH 4FLQA 2OMVB 5T5FA 3MCLL 1JZEA 4J2XA 1FNAA 1DQIA 4L8DA 4N0CC 4PRHD 1ZLUK 2DQTL 2ESVD 3U6RA 2VZ1A 1NLDL 5KN5B 1UWEH 5DZAA 4ZW8A 1FIGH 2J1XA 4FABL 5BS0A 3QXDB 4X6CF 4KXBA 4QNPE 1ZSDB 3FULA 4OF0A 4PGDB 5E5UB 4ZNEE 3ES6B 3IWUA 5T3ZD 3GS0A 3C09B 4JBSA 1JK9B 4Z7NB 2YMXH 4JFPA 5EU7C 2PW2B 1QEXA 4X9GA 1QD0A 4JG0L 1ZPUA 2YPLE 1CL7I 4Y7OC 4I3SH 2RFXA 1WEJH 1T1WB 1D5RA 5BUGA 1AZRA 2GK0A 2GJPA 3E1ZA 4FNRA 1A6TB 5I8KL 4MNGB 2ZX7A 5HVHB 5HYJB 1KJ2L 1XR8A 2GT9A 3SBQA 2GUOB 2PR4L 1EEYA 2EAEA 4UT9A 5F93C 2GHZA 3EJQA 4UT7L 2GTZA 3AAZA 1AQHA 2WOYA 1BZQK 2CR6A 3SCMD 1MCNA 5EEZA 2QPFA 3G9AB 5D2NB 2OMTA 4O2EA 4U49A 1ZLVH 4HXAH 1HQRB 2QLYA 4C8XA 5J6GB 2VDPL 3QDJA 2FUQA 5IKCB 5J6HB 2WO4A 4JO1L 5GZND 1BVKB 4KTYA 4WKZA 2FHCA 5D7JA 1DEEA 5A2BA 4ELMF 1CURA 5DVNA 4JPIB 4YPGB 1JWUB 3L7EB 4R97B 3IJEB 43CAA 5C8JA 2VXTH 4A6YH 4Y16B 2EO9A 2PPCA 3UBXG 2PF6A 3ZRCC 4PV1C 3UBFA 5JW4R 3U9WA 1X5IA 3VQLA 3TO4A 1XF2B 1QRND 4YBQD 4NO5B 3KVPA 2ZCZA 1CD8A 2GABA 3HZKA 2ZKXA 1A6VL 3G5ZB 4M48H 3H1ZA 2OX5B 4LLMA 5BZDA 5IBLD 4MMZA 1HHIB 1CXEA 1FGNH 1M1XA 3ZN6A 5DJXB 3CFDA 5I1LB 1KCRL 1LEIA 2ZJSH 1OB1B 3WKYA 3RVXD 5GRUL 5IB1A 3L3IA 4NC1E 3LKRA 3QJFB 4LL4A 3W57A 4HK0A 5HXMA 3FRPB 2VDNH 5E8OA 1L9TA 3KPTA 5SWSE 4HKZB 2BINA 3QHFH 5IMMA 2IAMD 3REWB 1KCLA 2V7HA 2XBZA 3WIIH 2QGBA 3MLVL 5DDHB 3WFBH 1TFHA 4QHKI 1KJ2A 5HTSA 5AAMA 2LTQB 3APFA 1RFDL 3DMMD 1W16A 5H35B 1EK3A 5IB5A 3ASOB 1FPTH 1P5VB 4P2YA 3TCLB 2Z65C 1WG3A 3FCSB 2JB6B 2VDQB 4P8QA 3CDFA 1H5BA 3FRUB 3GTVA 2JJVA 4XMZA 2X3CA 1UT9A 2CDEA 1GHFH 2DLGA 2X9ZA 3UP1A 4GP4B 3D69A 3RJOA 1J9QA 3NSXA 4TNFA 3FT4A 2A9NH 2H6PB 3ARBC 4S0SD 4WCYH 1CDHA 5GGVL 3ZPDA 3WN5C 1NCCL 1FFQA 3K5RA 5D5MB 4LHQB 4WUUE 4DGUA 4F7EB 4FFYH 4P46D 3NQIA 4FJZA 2XWZA 4V1DA 1OP4A 4URKA 3ESNA 3C6LA 4FTVE 3JWOL 2F8IA 2ZOLB 1DL7L 5F7BA 1CICC 3R0MA 4NQDB 1EXGA 4OI7A 2Y06H 4JB9L 2NY6C 2CU9A 2ED8A 3KEDA 2XFXA 4ENED 4U1LA 1Y6MR 2BSDA 5CD3A 4KK9C 4FMFA 5F7DB 1CR9H 3TWYA 2WLNA 1IM9D 4ZO8A 2Z7WA 1CXHA 3C2SA 4W93A 4J3OC 5JO5A 4KJQC 1NEUA 4G6MH 3W56A 3L48A 3QUXB 1CTMA 3MRJB 1IEBA 4MS8C 3VFPB 3G5XA 3VRLE 2AZAA 4R3SB 1XSIA 3EH5B 1TZGL 1LMKA 1J1OH 3PP3K 3NFSL 4QRRB 5A3IC 2NY2C 3VFVB 3GNMH 3DETD 1FZOB 3EDFA 3MCKB 1BG9A 2AKRA 2ENJA 3BDYH 3TYFA 1C5DA 4ODUB 5CGMA 2GW5A 3MBXL 2N7BA 3QIUB 5F0PB 3FB6B 3IAQA 3QPQC 3P77A 1M7DA 5E9DB 2QQKH 2M1KA 1E3FA 5AW5B 4KX7A 2DTML 4FFVD 3ULVD 1J5OL 3MGOB 1BQHA 1UKTA 5C0AE 1IL1B 4BJLA 1YZZA 4G5ZH 5I6XB 4KQ4L 4QRUA 3UIZA 4PUBH 4AKPA 4G5AA 2QDWA 3VD2A 4M7JH 1K4DB 3QXAA 4MJ2A 1IC7H 1D5BB 3CUPB 2HTKC 4WFHD 3WY1A 2XHNA 1HSBB 1FHNA 1P84J 4KZEH 3DXAD 4U6YB 5AOMA 4JFZH 3OF6A 1RZIA 3MNMA 2XWDA 5L8KB 1ED3B 2HT2C 2Z8VC 1JRHL 1O6SA 2ZICA 2XRAL 3GINA 1EFXD 4KZ0A 1C16B 4NM4H 4ABQA 1OHQA 3DX7A 3NP4A 4JDZA 2GJ6B 1S46A 5FX3A 1T7ZA 2H3NA 4M6OL 4TQEH 3I2CL 1JE6A 4R5XA 5EZJA 1AS8A 1P6AB 1O0VA 4XNQA 5KYWB 1RVFH 1MUJB 2FZ3B 4L4JA 3UG3A 3FN3A 2GY5A 1UM6L 1AI1H 2OS7A 2UZYA 5IBUB 2ZCKH 1GJUA 1X9QA 3BZEA 2R56H 4A2FA 2NY3D 3SOBH 4CBZA 4ALAH 4QGTA 3D85B 3GZKA 3K6SA 5B7EA 5J1AA 4DERA 1D6EB 3B2MA 2GCYA 3KPLA 3WFCL 4JPWH 4JLRB 1J0ZA 2Z4QA 4NUGH 3D3VA 3T0EC 3RNQA 3VH8B 3KPRB 5E7FA 3SQBB 4TPRL 2PXYA 3T3ME 3NCFB 2FR4B 1W80A 4LCIH 3HNSH 4LLDA 4XWGL 5HHOA 3AQZA 4XAKD 3TPKA 2AXGB 1D9KD 2B08A 3GSRB 5EO1B 3Q8EA 3ARYA 4JRXD 4RGNE 4H1LB 1KY7A 4K3DH 4PJFB 1H0DA 3H9SB 3ELQA 1R47A 4FE9A 4GRWH 4NNPL 2BM3A 1E90A 3HC0A 2VDMH 1OF2B 1WAPA 1CFSA 4LVNC 4QKTA 1NCNA 2APSA 5CSZB 5FO2A 5C08E 3RZWA 5K69A 1I3VA 1KIPA 2AJUH 2F53D 3IDXL 3RGVD 4GT0A 2DMGA 5JMRA 1J9SA 1BOGB 2EDDA 2K78A 3M7OA 4XMKL 1VEOA 4WV1C 5JHLH 2CDFB 4L2YA 2VUOA 5CR8A 4PG2A 2BSBA 5AL0A 4HULB 1UWXK 1OSZA 1NLBL 4DTGL 2BSTA 3POCA 1WA2X 3EYFB 5HPMB 5BZZA 1CYXA 3L8QA 5L8LB 2GBTA 4L3EA 5A1AA 1MNNA 1ZVYA 2Y07L 2QV2A 4JG1H 3MLSL 3NDZE 1A4JA 2W65A 4RBPH 2J88L 5FA4B 3ZXAC 1VHPA 1J8HB 5DUMH 1TQUA 2G3ZA 3CAFA 3CHSA 4E41E 1N26A 2PUQT 2C5DC 2X88A 5DEFA 3ZTNH 4WFGD 1FAKT 4JRWA 1SQMA 4LSVL 1IAIL 4OBSA 1A1OB 4KX9A 3VDAA 1KTCA 1HVXA 4TL4A 4QXUH 1RJLA 4I2XB 4TL5A 4Y2LA 4BH8A 2BNQA 2V3EA 1DBJH 1KPVB 2VDLB 3QQDA 4FHBD 4MJ5B 4P3CH 2IALA 3PQYD 3LKPA 1I3UA 4IOFD 3CFCL 3O0RH 5I28A 1YAZA 3PAUA 5I76A 3KLHD 4TULL 1SMAA 4LF3A 3CPLB 4G83A 1ZLEA 5ID0A 4QWWD 1EAPA 1S7XB 1T7WA 1N70A 1PLCA 2JJSA 2E27L 3PHOA 5DTFA 3SCMC 3DGGA 5EUKA 2YUWA 1EO8L 4BK5C 4CSZA 3PJNA 4NSKA 1OGPA 4HPOL 2OR7A 4Z7UA 3BH9A 2CO7A 5E1IA 2NX5B 4R83A 1IBYA 5GZNC 3GXMA 1SEQL 1JTOA 1A5FH 2ZX6A 3VX0A 1A7PL 1QKZL 3B2UD 1BOYA 1PLGL 1H3XA 1RZFH 1OOAA 3I9GL 3GSXB 4XN7A 5FV2A 3SYCA 1HSAA 1IGJA 5DJCB 2B7DT 3BI9X 2GJJA 5AAPA 5JHMA 2DJ4A 1QUPA 3FU7B 3MGAA 2Q8AH 1R5WB 3PWPE 4PB0L 3H6JA 3E80A 4UDUB 1ITCA 1EJ8A 3QXWA 1X5AA 5JPMC 4A7SA 4Z7OB 4BHUI 3GK8L 5IBLC 1H3GA 4F2MB 1OL0A 4NKIH 3ZGIA 2EXYC 4ZW5A 1TFPA 1QX1A 3DYMA 3KH4A 2C1OB 5D1XE 3KXFA 3RVXC 3F8UB 1OF0A 1JP5A 2JV6A 1E43A 1XIWB 2IPUG 2XNAB 1A8JH 4NN6C 3LZOA 3QEHB 4E0RA 2H0PA 4F3FB 2FB4L 4DFHA 3QYCA 4BKSC 2DEYX 1GS6X 1UWYA 3WNPA 5A6LA 5AG8A 2IAMC 4W70A 5BQDA 5ILTL 5FXCH 4G8EB 4OGYH 3CN3A 3DX4A 5TF1H 3KJ6L