1IC5H

Crystal structure of hyhel-10 fv mutant(hd99a)-hen lysozyme complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWAGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic5H00
2E9BA 4WTZG 5TDNB 5IW3A 4Y2OA 3VXOB 1UB6B 5DRXB 1CVRA 1EZVX 1KN2L 3TNMB 2Z35B 2R4RH 1C08B 1LO4L 1OAZH 1RUAH 1FNHA 1FAKT 1ED3B 2J6EL 4QY8B 4MCZB 2I9LB 2AEPH 2A6KA 4RMUA 1AC6A 3B5HA 4N8CH 3E0GA 3GKWL 1PKQB 2L7UA 1P7KA 3U6RA 4LKCB 2VLRB 5ERWB 3UO1H 4PFEA 1M71B 3I6KA 5GRZA 2OR7A 3RFZC 2BXYA 1JL8A 2FWOA 1T1YB 3NCJL 3TPUA 3GSOA 3P0VH 1NBZB 4R2GD 1MNUL 1BZ9A 3QIBA 3QXWA 4G3YH 1EBPA 5KVGL 3CSGA 5D70L 3JWNC 2LTQC 4JGUA 3I50H 4KVCL 1I8KA 4AH2A 3VRIB 3RVXC 3UP1A 1FORH 5TGBB 1JYXA 2QQLH 4WFEE 3IKKA 3NPZB 4C58B 1A6ZB 2V6HA 3B5GA 4ONGL 5L7XH 5LBSL 4ZODA 4O5LL 4O2EA 1G7PB 3MLWH 1JV5A 3WDHA 3HUJE 2MQ3A 3Q1SL 2ITCB 5DVKA 4WUKL 3VCLA 2ED8A 4XCCL 1RJLB 2FHBA 5I71C 5MEND 2MMXA 4EKXA 1Z0MA 4IMLA 3WUWA 3ZKMC 4HUXA 1GOHA 4YWGL 4JFXB 3TGXA 3U4EA 1FL6B 4BZ1L 1FCGA 3GMMA 3KLDA 2NYYD 3STZA 2E7LA 4U31A 4LVHB 1YEDA 5DR5L 5CGTA 3VH8A 4GMSH 3JUYA 4LAQH 2YK1L 2HJKB 3MBXL 5E9DB 2HFTA 1T6VN 4GXVL 1RPQA 4NKIL 1WBXA 1SQ2N 3WHXA 5JA8B 1UWEH 1B2WL 2P1YA 1A6AA 1DVFD 2E7BA 4LIQL 4HKJA 4ZAKD 4ZTPH 1CXFA 4K94C 3T0EC 4Q9QL 4LRIC 4BK4A 3PJSB 4APQD 4ACPA 2JCCF 1DBKH 2R0LL 4M5YL 4DN3H 2H41A 5EA0L 1W72A 2XWTB 2IBGA 1AY1H 4ZTOL 3OF6A 5DURB 3DURB 3IAPA 1P4LB 3U4BL 4L8DB 4MXVF 2FL5A 1MI5A 2X4UA 2DDQL 4PJ7A 4Y5VB 4V1DA 1MCOL 2VLLA 1A2YA 1NKRA 5FYJU 1VGKA 3R4DA 2WP3T 3RVUD 5EORH 3UTPE 1CG9A 1S9YB 4L8SC 2AEQH 3EOTH 1KCRL 2C7UB 4IIQB 5JXEA 2BY1A 2VR9A 2AXGA 1UT9A 2YD9A 3ARWA 4P4KB 3VA2C 5HHNA 5FIEA 2WZPD 1XCQA 5IB3B 5HDOA 3CU1A 3DGGA 3H9SE 2NLJB 2UY7A 3CLFH 1J86A 2PN5A 2RAMA 4S1SH 5CZVH 5JPNA 2VIRB 2VLJB 2D7NA 4CU8A 5T1LA 4NQCA 3VFVA 3DHJA 4W6WB 4KI5E 1FP5A 5HYSB 2LU4A 8FABB 3ARYA 3LH2L 2Z92A 4D0BA 5J1AA 3WEXB 2VKXA 1UZ6F 4J6RL 2FX7H 1BX2B 1F6LL 4PJGF 4LF3A 4PGCB 2CMRH 3HAEH 1FVEA 1C5CL 3WLWC 5J89A 3D1MC 1C5BL 4Z95H 1A21A 1KXTB 1I9RH 1R3IL 1RAMA 5D1XB 4XAWL 1RZ7H 3PWNA 1KNOB 3O41B 3H9YA 3G04A 2OI9C 1LEKA 1HI6B 1LILA 5L2KB 4JHAL 3WS6A 4UZGA 3VFSA 2PO6A 4Z76A 3KS0H 1OSPH 5DQDH 2A0LD 1QFWI 2R15A 3WL9A 2YPKA 3CLEH 3CXHJ 4O4YL 3NMEA 4DGVH 1BWMA 3RWEB 4ODHH 4YXLL 5D7LA 2ZKHH 5D2NC 3FB8A 1YQVH 1X5FA 1XR8B 1ONQB 1WC7B 3P9LA 3EOBA 3G5ZB 3WDIA 3CPLB 5B39B 4LNVA 1GGBL 1MUJA 3LS4H 4NQDA 4XP6L 2P45B 1WAAF 4JM2C 2Q1EA 2DI9A 1TCRB 4CNIA 1QR4A 4H8WH 5DJCB 3QUZC 1Y18A 4R0LA 2DKMA 3LQAH 2VC2L 4M7JL 1CICD 2J1KA 3IFNL 3FFDA 3MLSL 4NFCA 3HC3H 4Y1AB 5F7EH 3OL2A 4UV4H 2V7HB 3ARVA 3SE9H 3UBXB 4KK9C 4FNLL 4NKIH 2VSDA 4L3ED 2FIKA 4XCYA 2J8UA 2HVJA 5SWQA 5A2JH 1FZKB 2VDKL 5T1KB 1CL7I 1RUQL 4URTB 5LAXA 1GH7A 1H15A 4MVBC 1F5WA 4MLSA 4X4YA 3WKNA 1UZ8A 3IXAA 4G42B 5FYLE 2N4IA 3GGWB 4RFEA 3MRPA 4LHUA 4PJXE 1KCSH 3GHBH 2AABL 2NR6D 4JY6A 2CO7B 3WCYA 2IPKA 2RFXB 3V5DA 2DQIL 4YHNB 2EH8L 1X5GA 4JFHE 3SOBH 5C0FA 5BV7B 1T7VA 2P8MB 5CZXC 2IANE 2EDNA 2PETA 1NGZB 4HHAB 3O6LH 3I9GH 3CFKA 2R2HA 4EI5A 2Y72A 3IXTB 3L9RB 4FXGA 2CKBL 4J3TA 5EZJB 2ZSVA 1D5ZB 1MHPL 1XGUA 3ARXA 5DUML 4UOW1 4FQ1H 5M94B 1PSKH 1NBVL 2MFNA 5J13C 1NSNH 1CTNA 4KMLB 3RKDD 2ID5A 1JPST 3WIIL 3VFTA 2JB6B 5GGUB 3L3IB 1PX4A 3U0TB 1K8DA 3VXPB 2EYTA 2YSSB 2NMSA 5J57B 5LGJA 4KZEH 1P4IL 1IFHH 1PZ5A 4OZHF 2EDWA 1CGWA 3HLAB 3DVIA 4E41E 4PJ8C 4JRXB 3E6FB 5EU5A 4JPKL 4OM0L 1EERB 2PW1B 1CD9B 4JFDD 1MH5B 3G5YB 3HAEA 4XVSL 5K9KB 2P5ED 1S7UB 4OCSL 4TULH 1ZMYA 4Z5RB 5FF6B 4NQXB 1TTUA 5AAWA 1LO0H 5EUOF 4UQ2B 4WNQB 1FNAA 3DPBA 3T65A 2HRPL 4Z7VA 1TQBB 1HN1A 2GJ6E 1C7TA 3KJ4C 3TA3A 3D0LA 3MODH 4HIJB 3TH2T 1TNMA 4LSQL 4OF5A 1UM5L 5D93B 1RZGB 4PGZA 1BVLB 2VXQL 4KTEH 3B2UD 4C4KO 2IG2H 4K7PH 3MJ8A 3VGBA 4YC2B 1IAOA 4S1DC 3UBXI 4BM7A 4Q6IC 3BP4B 4O58L 4HWEH 3EO1A 1DQMH 1KEML 4YGVA 4PGDA 1MOEA 4M43H 3OKKB 1PQZB 2VXSL 3PV7A 2PYEB 1TZHA 4M6NH 3QDGE 1FVDB 2MOVA 4NNXA 4CADA 4WFFD 4QHUB 3NZ8A 4X0KB 1HHIB 2AQ3A 2WBJC 3NCEB 2YD4A 4X83A 1KPUA 2IBZX 1KGCE 4X6BB 1NFDB 4YFEA 3H3PL 2F53B 4QTHA 3KLSA 2NTSP 1WT5A 5FGSA 4WI4A 4LSDA 1NDGA 3JTSB 4KJPC 4OD2A 1AO7A 4YPGA 4YHLL 5J8OA 2H26B 2OP4H 3IRZA 4KDTA 5HHQB 3QUXB 2VLKA 2OJZL 4TRPL 4PB0H 5DF0A 5E7BA 3KXFA 4X4XA 5D2LF 1UB5A 1D5IL 4UDTB 1ULVA 3MA7B 4PJBF 4DVRL 5DEGA 2F54E 4L3EB 2DI7A 5F8QC 1S9XA 1QO3A 2CUIA 3WO3B 4U6YB 3S5LB 4OFVA 4HUWA 1QSFD 3QIWC 3GSRB 1QA9A 3RWGA 1LP9E 2W1NA 5A43C 3VWKA 4RMRA 2YD1A 5D1QA 3UJTL 5D71L 1KLFA 4JPIB 2NW2B 3Q5YA 3K1KC 2Z93A 5IHZB 3SCMA 1JYWA 1BD2D 5I9QC 4K23L 4LLQB 1KACB 5ICYB 1HH9B 1I3RA 1RUKH 3OJMB 5GS0D 1WCBA 2X41A 3EJYD 4LSUL 3MRBB 3ARBB 5CEZD 5FUZL 3BGAA 4LHJB 5CJBA 4N5UA 4GBXA 4HQQH 4P0DA 4GXUN 3MMEA 1URLA 3MV8A 4QGTA 1AIFA 4AEHH 2DQCL 1JPFA 4K94H 5JR1L 3DMMC 3G6JE 4JM2F 1CI5A 2G9HA 5HGAB 2R56H 1F4YH 4PG9A 3QXDB 1J0IA 4H0GA 1AJ7H 3MR9A 4YDJA 4OZFG 4IEFB 4MQXC 5C07E 1WICA 2H2SD 3BVNB 3H9HB 3SE8H 4FA8A 4QRRE 4OGYH 1R0AL 1MAML 3HFMH 3SGKC 1LO3H 5KSBA 1F2XK 1QSEE 1HWHB 4FXKA 4W4OA 5I2IB 3VXMB 4TOYL 1F02I 3BXNA 5TPWH 2B1HH 5IT2H 4HK0B 5EU7E 5C6WH 4MXWH 3ZHDA 5F7NC 5JIPA 1BLNA 2H1PH 1N26A 3H9ZA 4LDEB 2NY5C 5C0EA 5I1EH 1XGQB 2BVPA 5FGCE 3ARFD 3ZDYE 4UINL 5EFIB 3TV3H 4Z7QE 3QEQD 2RIKA 4HPYL 1CD0A 1U8HA 1F4WL 2YR3A 5DC9B 5DFTA 1CIDA 2E6JA 3LEYL 5C0DA 1FG9C 4BELD 4MA1B 4HFWB 1J1OL 3H0TB 5CJOH 1G7MB 2MKWA 4X6CB 4JB9H 5I18L 1V3KA 2ZOLA 4MWFA 1IM3B 3Q6GH 5CZKA 5FYJD 4ISVB 4D8PB 4YR6B 3PWUA 4M62L 1S3KH 2M2DA 4P49A 3WFBL 3WHE0 4WW2A 1FV1B 2JJUA 5HGGS 5L9DH 1FL3B 4HBCH 2HT3D 5F8RC 2Q76B 5IBLC 1UKSA 5BMFL 1BIHA 1K8IB 2BHZA 2BOBB 1UCBL 2UZYB 3TN0D 5I1DB 4GG6F 1G9NL 1IBGL 3S4SG 3LS5H 3BZFB 1EEYA 3KHOA 4IJ3C 4MA3B 4N0RA 2BNRB 2GFBA 1LDPL 4KRLB 2V2XB 5HJ3B 3KPSA 5C9JA 1RZFH 4RRPA 4M9OA 4QOKA 1GAFL 1MPAH 4NNPH 4RISH 3CZJA 5A1AA 4QRQA 5F6HJ 3QCUH 3SDDA 2DQDL 1K3IA 4P5KB 1FZJB 3L5XL 3CH8A 1GZQB 3AFLA 2W65B 1OGAD 3KPPB 1QSFB 2PXYA 4NT6A 1EDQA 3FFCA 3QULA 1R3HA 4OZIA 1A7OH 2BVQB 4XPFL 1IEHA 4LVNC 4WRLA 3P4NB 3EYVB 4PD4K 3KYMB 4GT7A 1INDH 3A6BH 5D7JA 3N50A 4ONHA 4U1SA 1Z9MA 3GSQB 7CGTA 3ULVC 1PEWA 1QPPA 2DKSA 5FM5O 1EEUA 4Z7WE 4XNQA 5LQBH 3QQ3A 1IGJA 3LEVH 5IB2A 2Q86B 1OT2A 2EDRA 1YJDL 1HIML 1YNKH 5J0BA 2OK0L 2FO4B 2X4RA 2YPLE 5IROA 5EOCL 1MCWW 4EOWH 1OLZA 3FN3A 3PV6A 4L9LB 4N1CA 1F45A 1WVZA 4MCYA 4EBQL 4XTRC 3PP3H 5JLZA 2CJUH 3AREB 1VEMA 1N2RA 1RZKL 3MUGA 1R3LA 4MSWA 3KJ6L 5L0QB 4ALAH 5E8OA 1GC1L 2EO9A 5EOQH 4WU7B 4OLZL 4PJCF 1IILE 2XG4A 4OCYH 3VD9A 5L8KB 3AGVA 4XBPA 5FKPA 2V2WB 2E8YA 3QEUA 4HIHB 3GIVB 4NYLA 4MX7B 3DROB 3OQ3B 4NUGL 3OPZH 1GIGH 1AC0A 4HPOH 4JFDE 4OFIA 3ETBF 1I7RB 1FSKB 5IFAL 3FRUA 3P4OA 1CDJA 1CF8L 2A9ML 2BVOB 5K9OB 3B9KD 4U1MA 4CAGA 5E70A 3JV6A 4EUPG 1KB5L 3VMNA 5KVDH 4KV5F 5C0CA 3ARDB 3BP6A 5CHNA 3JVGA 5J3HD 4ETQB 4HUUB 1ZHBB 3ECBA 4P3DB 1S7QB 3VRJB 4MA8H 4U7MA 4AJ0A 2VXVH 4OZGE 1U3HD 3NIDE 4PJEE 1QPXA 4PTTB 1MJUL 3S34H 5FA4A 3FCTB 1VFAA 4KKAD 5I0ZA 1KTLB 1BREA 2CLVA 4LVOC 5E8EB 3U0WL 2X40A 5GS1C 1GXEA 5K9QG 2X44D 1E27A 3MGTA 3N0PB 4IRJA 4BFGA 4XT1C 2BCKB 3X3GL 5HGHB 1G6RL 3QFJD 3PHSA 1HXMA 2I60H 1CFQB 3STLB 2GT9B 1W8NA 4YDVA 1HDMA 3HRZB 4JM2A 5ACZA 4F7CB 4MB3A 3G9VA 3U30B 2NY0C 4XP9L 3MA9L 3TZVD 4CN4A 3JTTA 4PJ5E 4Y5YC 1WBYB 2OR9H 2AERT 2B0SL 4N5EC 1V3MA 3BD3A 1JYNA 4FABL 4XB7A 4XPAH 3BDBA 2WINB 2NXYC 4RA0C 5TDPB 2GSIB 2X4OA 3IDUA 4A6YH 1MY7A 1YC8A 4P2OD 3SDCD 2KH2B 4F37F 4CVWA 3FONB 3V9FA 4M7KL 2FEDD 4QXTB 1MLBA 5EU6B 4NO5B 3ZYIA 2VOTA 4I18C 1CGXA 1JWMB 2ZWLT 1LMKA 4LCWB 2CKBB 1MIML 4ZO6A 5CGYC 2D31B 1BD2E 2IF7A 4XAKD 5DZOA 1ZVSA 4OLYH 4UTAL 5HHXH 3UTSB 2NXZB 4UTBL 3WFDL 3RZCB 2VERN 1IGYA 3D39A 1TITA 4G6FD 1U8PB 2XT1B 1SMOA 2P8PB 4ZYKB 1KENH 1BOGA 1M7XA 3RAJL 4K3GA 1TVBA 5DD3L 2UUDH 4MNGE 4PJIE 3EDEA 2ZNWA 4AENB 4H1LG 4JHWL 1OL0A 5HI4D 2DQGH 4KUCD 5GISH 2UY6A 3SN6N 3DVNA 1JZ7A 1IM9A 1VFOA 5FO7B 4NO0A 2F15A 3DUSA 4U1KA 5D7KD 3KPTA 5T1MA 3F7VB 4PJ8A 3M07A 3VFWA 3F58L 3VFNA 1K9TA 1MF2L 3BIBX 4CKVX 1EAPB 2AK1L 3MACH 3QEHB 1AGFA 2PTVA 4WUUD 4OUOA 5A3ID 1NEZB 4U6TA 3HZVB 3ZDXF 1NMBL 4H26B 1YPZF 4LLDA 4LLVA 4Q0XH 3IU4L 4V2CB 4J3OC 2HTKC 4UDUA 3ULVF 3S88L 5JW5B 1XF4A 1SEBB 4X5WB 1T5WA 5DTFA 1J05B 1DR9A 4JFED 4GO6B 1JZ2A 3AXLB 3F12A 1N4XH 4NBZB 4X8JA 2YHGA 1YY8B 1LK2B 1P2CA 2KQNA 3EOAA 4BSWA 3R06A 2AXJA 2ERJC 4W81A 1NJ9A 1OB1A 1A1OB 3R0MA 2YWZA 4MHHI 2MKLC 3VXSE 1U95A 2K7PA 3QHZL 4YHZH 5FYJE 1HILA 1SYSB 1UVQA 1GGIL 3MJ9H 4XCNB 1H3WM 2EIEA 4OQTL 3H7BB 5DEFA 5C0JB 1QR1A 3WJJA 5JO5A 4ESKA 5F1IB 5L8JB 4PJFE 2EYRA 3G5VA 1J9CT 2P5WE 1FPTH 2PUQT 2ZJSH 5KVFH 5I16B 1SM3L 3W0WB 3M17A 4TSBL 1OTUD 4A6YA 3MLTB 1HEZA 4HUMB 4NWTL 1OF2B 3GJFK 2DLFL 2N7BA 3MV7B 4WWKC 5JW4Q 5DMKB 2R4SL 4U1IA 1HOCA 3V0WH 3QCTH 5JIIA 4GLRI 4R90L 4PRNA 2DBLL 4WV1C 2H32B 1ITCA 3IETB 1ZLVK 1MFEL 4FQIL 3PWPB 2G2RB 1AGBA 2YWYA 3SDCB 1C1EL 4KPHL 1ES0B 4L3CB 5I15H 4YHOH 1NC2D 1OGAE 2KL6A 3NGBB 5FUCE 4XWGH 3GSNL 3MV01 4UAOB 2HN7A 4JZJA 1A7RL 2G60L 5F7DB 3BN3B 2X4PB 4DOHB 3C8KB 3LDBC 4OQ1A 3RX7A 3SDAD 1MCRA 5GSVA 1VHPA 3BEVA 4JFFB 2X2YA 3TT3H 1V3LA 4G6FB 4FQLL 1ZA6A 4Z8FH 3B5TA 3X12A 1T03H 1IMHC 2DQJL 4I3SH 4KZDH 5FCUH 4OBRA 3O8XC 1J8HB 4KGLA 5FYKL 1VPOH 1MJJA 2EDKA 3O6KH 4WJ5A 3DMMA 4ETYA 5C09B 4NRZB 4WCYH 5GGVH 1UG9A 5DGQA 2ADFL 4JFQB 5E2UL 3V6FB 1KB5A 2FJFA 4MMXC 2FNBA 1T04A 4R8WH 4XCEA 3RWFB 3SDXB 2QL1A 4QHMA 1KEGH 5BQ7A 2UWEF 4YPJA 4U6VL 4DKFH 4Y88A 4MQ7B 3FRPG 4NKDB 4WTXA 3V6OA 3MOAH 3DO7B 1KTDB 3TO2B 5I19L 4NKOA 4G7VH 4RGNE 4N68A 4PRPD 4UIMB 3HE7C 5B8CB 3CXHK 2YMXH 4UT6H 1DEEA 1FIGH 4LLWA 3LN5A 4X5XA 3T04D 1BQSA 2IALB 3RWHB 3RGVA 4X6DF 4HIIB 4WO4D 2I24N 3GSXA 2ESVA 4I0CC 4P23D 4WI6A 4R7DA 3V6ZA 4I0PC 5GZND 3DARA 1IC4H 3MJ9A 3LKOA 4GG8B 2VABA 5I1JL 3QNYB 3OB0H 2FGWL 4P99A 1LGVA 4XB8A 3SKJH 2IADB 4PJHB 1ZK9A 4FTVE 4ZO9A 2BJML 4EVNA 3VG9B 1SJVA 4P59L 3MLXL 2XV6B 5EPMB 4NC2B 4GKSA 5D8JL 3AU1B 1GYAA 2OMBA 3L6FA 4GW4A 1DBBL 3UYRL 3EGSA 5LGKA 2HFGH 3QO1A 1SM3H 2CQVA 2YRLA 4QXGL 2UUDK 2VLMD 2DLFH 3D85A 4ODSL 4R3SB 1D6EB 5ISZE 4MDIA 2CRZA 5DMJB 5MI0C 4R26H 5CJ5A 1Q38A 1PX3A 3REVA 2VZVA 3TH4T 1OTTC 2VB5A 2BNUB 5DQ9A 5SV4A 5I76A 4G9FA 2H9GB 3O3EB 2XN9A 1NMAH 4KQ3L 2IH1B 3I6GA 4KI5C 4LNRA 4IRSC 1YUHA 2Q6WA 4K9EL 2HLFD 4QF1A 1N7ML 4LEOA 3QRGH 2F5BL 2XZAH 4KKBC 4NZRL 1FO0L 1CXIA 1Q0XH 4WY7L 1DQDH 5E6IB 4JG1L 1MAKA 1VADB 4G5ZH 2OZ4H 2O26U 5J6GA 1JI1A 3PWJB 1NCCL 1OCWH 3BT2L 3UJIL 3I85A 3OKYA 1HSBB 1D5MA 2CRMA 4M5ZL 1B4RA 3C8DA 4XNZB 2VISA 2ZPKH 5TFSL 3KVQA 5I30H 4U05A 3DGCR 3MGOB 4ZS6C 4PV8B 1LNUB 3AVEA 2HKHH 2O5XL 2WM0A 3OAYH 4J3VA 4Y4FA 4F37K 1HYRC 1TXKA 3P11H 4JVPA 4MJ6A 3DX6A 1IC7H 1U58A 1ZLSH 3VXUB 4WEBH 2FJHA 2IGFH 3BQUC 4XP4L 2FD6H 3MJ7A 3NA4A 3DRQA 1U8MB 1YEFH 3REWB 1CFNB 4ELMF 1BQLH 4G6MH 4MNHA 3ULUF 2OTPA 5D1ZB 4RDQG 5EC2B 1OM3L 4X7TA 5C0BB 5IR1A 2EH7H 5AWNL 3EDDA 5D7KE 1JGEA 2F9BT 4U1GC 3C5SA 2EZ0D 4G6JL 5GRWA 3MRMB 1UXWB 1OD7A 3TIDA 2IAMB 1KLGB 1KB9K 1FAIH 3NCYP 4M61B 1QLRA 1NCBL 3EYFA 3LRGA 4KK6D 1HSAB 5ESVB 1YMMA 2QBWA 1UACH 5KN5B 1FBIH 3BH9A 1U8OA 1JGDB 2X70B 4OQTA 5ALCH 1UJ3C 3OAUH 3NTCL 5BVJA 2YEZA 2HJLB 3D9AH 3O2DL 1U8QA 3MBEA 5DD5L 5ABDE 4EUPH 4HJ0C 3ZTNL 4OLUH 4GRWB 5D8JH 1OWWA 3I2CH 5TDOB 1F6AA 3ZKXB 3VD3A 3E8UH 4QXGH 5JOFB 3M8OL 3QIBD 3CMOH 3MOBH 3W9EA 4OI8A 2YC1A 3TBYB 5I8CB 2DQUL 4MNQD 3BUYB 1AKJB 3OX8B 4I5BA 1JNHB 1M7IA 3DV4A 2R23B 3V8CA 4AG4H 5SWSB 5LWYH 1IC5L 4Q9RH 3MV9B 4QWWC 2YZ1A 4I9WD 1T83C 3EO0B 5ICXB 4H88H 3Q6FB 3MNWA 1Y6NR 2HKFL 2VDNH 1MFDL 2DB8A 4KQ3H 2I27N 2RBLA 4F8TA 3RBGA 1ETZB 2B5IB 3F7YA 3ROOB 5HVFB 3RUGE 5F96L 1J1PL 3QISA 5LCVL 2FX8H 1NGPH 3UZVB 5FECA 5HVHB 1I7UA 4WGWB 15C8L 4UOJA 4RQQB 1P1ZA 5E2VH 3CX5K 2WUCL 1QFWM 1F6FB 2I9TB 5IMMB 4KVNL 4HJGB 5E8PA 3UYOD 3BPLB 4OTXH 4PREB 2G75B 2DLIA 3GMLB 1AXSA 4JZOB 1KCUH 4PJDB 1DCLA 5MEPB 4F15B 1X5XA 5D5MF 5EIVA 3TVMC 1Q1JL 1BBJB 1HE7A 3BAEH 2OMNA 1BQHA 5BS0B 4I18A 4RAUA 5A2IH 1T0NB 3BEWA 3RWDB 1ZLWH 1X3DA 2HVKA 2BY3A 1AHWC 4G8FB 3O6FA 2Q3ZA 5C0AE 2RGSA 2AXFB 3DNKA 1T0MB 1H5BB 4L29B 1KOAA 3SKOA 3OJ2C 3IAGC 4R2GC 4XPGL 3L7EB 2QADB 1J1XL 1KJ3H 1FE8L 4XXCA 1KIPA 5E4EB 1ZA3A 3OF6D 3P73A 5CJXC 3OV6A 1MI5D 2Q7YB 4V1DD 5JHDD 1T1XA 4ZSOA 3DX8B 4RNRA 3RDTB 3SO3C 2VQ1B 5IBTH 4AK1A 4GJTB 4G8EA 3HI1A 2HFFA 1DN0A 2O5YH 4U33A 4PJAF 5JXED 5AZEL 4PRBB 1K85A 3FOMA 1WZMA 5JPMB 1DBJH 4FMKA 1CFTA 4KI5F 2HRLA 3UJJH 4MJIB 2W9DL 2K9UA 3HZMB 3T0BA 3BDXA 1UQSA 1A4KA 3WKML 1MAJA 2BVUA 2NYYC 1S5IH 2AW2A 1AQDA 5F9JA 4NQCD 5T1LD 1PKQE 5JZ7D 3QIUA 1WEJH 1KF9B 3CSYA 1JWUA 3X13B 4PRPE 4KUZL 1K4DA 3NFSH 2ZSWB 2VDQH 2XWJB 2PCPB 2O61A 1UH2A 3GM8A 1EZVY 4UV7L 2YA2A 3VXNB 2DQEH 3QXAB 2YOCA 1DVFC 1P7KB 1OAXH 1T2QH 3S5LG 4YEFA 3VGHA 2I5YH 4CMMA 2UV3A 4MD4A 2MQ0A 3MRJB 1C5DA 1NGQH 1I1AD 3RTQB 5KSAA 4APQC 3CAFA 4U1HA 2FWOB 4DN4L 4NPYA 5HHVL 3VFUB 2IH3B 2A6IA 1BZ9B 5DDHB 1CDHA 1T1ZB 1DLHB 2PO6D 4MLIA 3EIFA 6FABL 1BAFL 1I8KB 2YRPA 2AJYH 4NJ9L 1CR9L 5GZOD 3JWOC 4M7LL 4BH7A 4NP4H 3EYUH 4NHUA 3RVUC 1FYTA 5DJ0B 5F88A 3TIEB 2VLME 4J1UB 4K2UH 5IWLC 3GMNA 2E3VA 3TNNB 5IHBA 1KIQB 5CJQL 4Y2DB 2ZUTA 4OCWH 1P84K 1WJ3A 1JV5B 4ZPTA 2F8XC 3O3AB 5I8OL 2VL5A 1HYSD 4JO3H 3HNVL 4MJ5B 3BE1H 4CMHB 2CXGA 2GSGA 3O6MH 1MLCA 3WUWB 4ZUTB 1TFHA 1XF3A 4ELKA 5EU7C 5KS9F 2CIKB 5IHUH 1FFNA 3PHQA 1XF2B 5GGRA 5JW3H 5T3ZL 5HYJB 4OD1L 3STZB 1CZ8H 1RJZA 4PV9B 2EEAA 1BECA 3AM8C 3C2AL 1YEDB 4S1RH 4WEUD 4MGXA 1FN4B 4YE4L 2A1WL 4YX2L 5MP6L 2VDPL 3EFDL 5DUPH 4HT1L 4OGZA 4XX1E 4LHUD 4DK3A 1WBXB 5DUBA 3ZT7A 1RMFL 2EKSA 4IDJL 4U1LB 3T8XA 4ODWB 4JFOB 3QG6A 4QKXB 5F71A 2Z8SA 1N64H 5CD5D 3MRQB 3OAZK 3O45A 4XXDA 3EO9L 1FNSH 3WXVH 4JVWA 4L8BB 3TWCH 4JJ5A 4PUBH 4ZUWA 5GJTL 2VDRL 5HYQA 1G7IA 1T1WA 2FATH 3WIHL 4EI5D 2VDOH 5MEOB 1KT2B 2A0LC 4XC3L 3CZFA 4DKDC 3O8XA 5C0RL 2EYSA 3D3VB 4HXBL 4WFHD 5EWIL 4PJ7B 2DWDA 4XMKL 4XPBL 3BMVA 4MB4A 3HPLA 1I9JH 1VGKB 5ENWB 4DCQA 2FX9H 5EIIA 1ZE3C 5D72L 2AJZA 3HUJA 3H42L 4KAQH 3FO1A 4NM8H 1CDGA 1A6TA 1GPOH 1FVCB 2AXGB 4UOW0 3BGMA 3L5WA 5HHNB 5I75C 1XCQB 3P77A 1NC4B 4MJ4A 9CGTA 4HKZB 1CICC 1G0DA 5FOBA 5JPNB 3S96A 4NQCB 1QACA 5DD6A 3EW3B 1A4JA 5DWUH 2AJVH 1WSST 4YBLC 35C8L 2Z92B 4NBXB 3TA3D 3VXTA 3U82B 2ADIA 4DGYL 4WTWA 4YBQD 4ZPVB 1KV3A 4XNMA 1GCFA 1AD9B 3SKMB 5L2KE 4I0PA 2NR6C 5IM7B 2ZCLL 4D9QE 1XGYH 4HG4J 4QNPF 4OKVB 4FQPA 2FEEL 2LABA 3UTTB 1YEEH 1YNTB 2DYPB 5DSCA 1ZSDA 1DL7L 5FYLH 4R7NA 1QLEH 4OZ4B 5C0IA 1OARH 5D7SH 5JORA 3VXRB 3MLZL 1FGNL 5FA3B 3O4LA 2FJGA 3VFSB 2PO6B 4RDQF 4MAYC 4G7YH 5GRJH 3VFMA 3B2VL 3WL9B 4JZNA 2YPKB 3U0PB 1KPVA 4MNQE 3QNXA 4JO2L 5D7LB 1ZVHA 4U1NB 4JDZA 3RKDC 2H6PA 2FBJL 2VKWA 4IOIA 5DHXB 1H8NA 3MC0A 2YD6A 1D9KB 4HKBA 1EFXB 5HGBA 3OJVC 4NQDB 3C6SA 3CDGA 3SBWC 2YUVA 4Y1AE 1U92A 4Y16A 3GO1H 3H9SA 2F19H 3MGAA 2R39A 4D9RD 3IJSB 3MLVH 4JG0L 2CDGA 2VLKD 2N56A 2Z91A 2ENYA 2EDEA 5BW7C 5IEHA 3KXFD 3RU8L 3MLRH 1LP9F 5IIEA 2Y5TA 4YQXL 1CDCA 3GDBA 4WI8A 3O3DB 2C3VA 3UAJD 1A6PA 2HVJB 3MRGB 5IFJB 5EOTA 5LAXB 3WNOA 4PRAA 1JIBA 1R5VA 3S35X 3VWKD 5D1QD 3IXAB 2PYFA 3EYOB 2HAZA 1MCFA 4HEPG 5EZOH 4OLXL 3MRKA 3ZL4L 4K71C 3ZKSD 3B2UC 4UBDD 3FQUB 3K2MC 5DJ8B 5FDWA 2X4QA 2QHRH 4QHNA 4I2XE 5BRZD 3X11B 3NPSB 2AGJL 3HMXH 5MERB 1L9MA 5DJ2A 3GSVB 4X7SH 3JZ7A 5GXBB 3GJEB 5AD0A 3L3OA 3ARPA 3O3BA 4GBXD 3MV8D 3DVGA 1B4JL 4X4MA 1CLZL 5F1NA 2R1YB 3FB6A 1XGUB 1XEDA 5DHVH 4LQ1A 2EEBA 1M6OA 2YN3A 3BQUA 4V1DE 5JHDE 3CXDL 3WN5C 4JRXE 4QRUA 5TE7H 2Y07H 1I8MB 1KCVH 3SE4C 2GTZB 1N0XH 4QTIL 4M7ZB 1YNLH 3VG0L 2JIXB 2NY1B 3DX9B 3GZKA 1Z6JT 5LG1A 3DX7A 4LSVL 4TQEH 3TM6A 4EN3B 5C0GB 3TCLA 4M6ML 3BW9A 4LCIL 4LVEA 3GMOA 4KROB 4XHJD 3IFOA 4CUCA 1PG7H 3GHEH 3LD8B 3BDYH 5ANMA 2OJEB 4ZOCA 4PJXA 3TA3B 5L88H 1RU9L 5I66A 5LXGL 1JUFB 4WFGE 4WI9A 3BZEB 2L0DA 4OLWL 4UUJB 2WNGA 2D7OA 4NZUH 3QI9B 4RA3A 2AQ1A 4KHXH 1X7QB 5CEYA 5CP7B 5B21A 4XBGA 3BWUC 3MJ8B 2VJXA 2IANA 2F58L 1XGPA 3EJYC 2VZTA 2BXZA 1VFBA 2YKLL 4YGVB 1EXUA 1KYOJ 1XIWB 3WSQH 4JAMA 3MRHA 3QDJD 3CJJA 4YBHA 3PHOB 4LPTA 5ELIA 2F53E 1OHQA 5DLMH 3FB7A 2D7PA 4WHCA 3GSUB 2JCCB 1I3VA 4WHYG 3MREB 3GFUA 3L3JA 1XF5A 5F97E 1J12A 2WUBH 1H8SA 4JO4L 2OTWA 2ZCHH 4W6XB 1KPUB 3QWOA 1E4XL 5HDQH 3W5MA 3IU3B 2GAZB 3D25A 5F7FA 1ACZA 5CILH 5KJRL 4QTHB 1EEZA 3PNWA 1DDHB 3G08A 3LV3B 4E41A 4KKNA 1AO7B 2H2SC 2IBZY 4G43A 1V5JA 1CGSH 2Q8AL 5D7IF 3JWOH 4LKXB 4EJ1C 2J7LA 5SWZE 4L4VA 3N1FC 4G8IB 3QB7C 4PJ9B 1CVSC 3KPOA 1ZHNA 3KPSD 4QOKD 4UNUA 3O81A 3V4PL 4YHMH 3PWLA 5GIRA 4YGAB 5EG6C 3L1OL 3QWQB 5GSRB 4NN6C 4R96B 2GJ6A 1WFUA 2Y7QB 3SDDD 1QO3B 3SKNA 4E42A 3AS0A 1RD6A 1EJOH 2PXYD 3RWGB 1QA9B 1DQTA 2C1OB 3FFCD 4H20L 4HLZH 3TVMA 1FNFA 3ZHLA 3KYKH 1BGXL 1H0DA 2Z8WC 5D7JD 3ZKQD 4KQ4L 1AHWA 4RIRA 3SCMB 4PJGB 1FFRA 1AFVH 2P24B 3S36L 4OKDA 4W4NA 4Z7OF 5IJKA 5DMIH 3QDGA 4OF8A 1MCDA 4IS6A 4JLRA 1T4KB 3T4YA 5FO8B 4HH9A 4X6FB 5F9OH 4DKEH 4CL7A 1H3XA 4QRPA 4YHYC 3GB7A 3IRPX 2HT3C 5IMLB 3MXVH 1DBMH 1JPFB 1MJ8L 4WFHE 1X5KA 5HYIA 3IDIB 4YXHL 3BJ91 2IMNA 3K1DA 2G9HB 1LE5B 1G9EA 3A6OA 3FO9A 4XWOD 3MLYH 3TN0C 3HI6L 4PY7A 3VXME 1OAUH 4ZNCD 2J8HA 4DZBA 1A1NA 1R6VA 5J1TC 4YDJB 2XNAB 5CSZA 4YIQA 3UTZA 2AJ3B 1P53A 5KSBB 3QCVH 3HNSL 4ZUVB 2F54A 5IG7A 1XR9A 4QYOB 2EDJA 2A83B 1Z9SA 1YEKH 3HZYB 1LP9A 1A6UL 1ZT1B 3QQ4A 3SJVB 2BVPB 4JJHA 1MRFL 1QRNB 1YQ2A 5CWSA 5E5MA 2CO6B 4IMKC 4OZGF 2QSTA 4X6CE 5DRZA 4PJEF 3NIDF 5DK3A 1TMCB 4N8VA 4YAQB 5C0CD 1YECH 3O4OC 4M8QA 1IARB 1P4BL 3GI8L 2HLAB 1X4YA 3RA7H 4N0YL 2NY5L 3JUZA 4FQJL 3WMSA 3HB3D 4MDJB 5EUKA 4AM0A 1IEBB 3E3QC 3VFOB 4LSPH 1RJYA 3OKDA 3CVIH 3V5KA 3CGTA 1U2HA 2J4WL 2GY5A 4NRYA 1PLGH 4GSDL 1L0XA 2LTQB 2CUHA 1S7WA 4YK4C 3G6JA 3TJEL 4HJJH 4RAVA 3S37L 4JFYA 4IRJD 2VE6B 1T89C 1IAMA 5D9SB 2BSTA 3QPQD 2CDEA 3TBSB 5IWLA 4HWZA 4NWUH 1TJHL 4QRTA 2JELH 1ZT7A 4HFUL 5C07A 1NCDL 4QRRA 1MRCL 1AI1H 1T7WA 4WI3A 3VI4E 1QSEA 3ESUF 4AIOA 4PRDB 3HE6A 3ALPA 5F7WC 2ZUVA 4LIQE 5I71B 1EUTA 4GKNA 1AQKH 5IESH 4OZHB 5ITFA 2VLKE 1ZGLP 2X09A 5IMOB 1FDLL 25C8H 3KXFE 1PYWB 1XGRA 4M1GL 4ONOA 1L4IA 4JREC 1NAML 1X5HA 1FGVL 3B9KC 3EYSL 3JXAA 4P3CH 3AM8A 3BWAB 2VXTH 3VU2A 4I1NB 3FFCB 1G7JB 1R3HB 4KH2A 4POYA 5ID1B 1V3JA 3V52L 3MCLH 4I13B 1QRKA 5JDSB 4XNUL 4Y19B 5J3HC 4M4RA 5TE4H 2QEJA 4U1SB 3EFFB 2E9WA 5MEQB 3CK0H 2X42A 4F9PA 2NY2B 1U3HC 4C56B 4FZEH 3GIZL 4I3RL 3T0EB 3QQ3B 4V2BA 3L95A 5BRZE 4DAGH 4NQUA 5IB2B 3D39D 4KKAC 4X99B 3RIAF 1IE5A 1EH9A 2G5BA 3L7FA 3ULVL 4GRLD 1EVUA 2R0ZL 4HXAH 5DQJB 4RBPH 2ZZUT 1EPFA 3NACL 1PY4A 3KLAB 4QRSB 4H0HB 1D6VH 1HHGB 4L8SB 5E2TH 4XBEH 4LEXL 3HS0B 3TO4A 4ODUA 4CVUA 2X4TA 3TZVC 1W0WA 1IM9D 4HGMA 4NO0D 5AYUH 2XZQL 3QPXH 5D6CA 2YXFA 4IRZL 1INQB 1WGOA 4PJ8D 4GW5B 5FKPB 1F90L 4F7TA 1VKXB 3QFDA 4JQXA 3T77A 1JJUA 1KPRB 5SX4H 4ZOAA 1MCLA 1JWSA 2BSRB 3WE6B 1G7QA 4YUEL 2B1AH 1T2XA 1PY9A 3V4VH 3P4OB 5D2LB 1T66D 4P2OC 4OCXL 1B0RB 1QUNA 5KSVA 5BOZG 1FCCA 2EEDA 4PJBB 1A7QH 3T09A 4OUUA 5DD1H 1F3RB 4BH8A 4YJZL 1ZANH 2FEDC 1G9ML 3ZTJG 5IB4A 3JV6B 4Z7WA 1HZHH 3P9MB 5CD3A 3RGHA 4H5SA 5I1CL 1KJVA 4NOFA 2N1KA 5F1KC 3HTLX 4PYGA 2OI9B 3ZYZA 4RGOH 2YPLA 4X7EC 4GQ9L 5TE6L 2KKQA 3D2UB 1WWBX 2MPAL 3QDJE 2GITB 4ERSH 4MAYA 2QKIA 5C6TH 3OKOB 4G6KH 1IEAA 4KJQD 2VN4A 3N85L 1NCDH 3MUHL 3C60C 2VQUA 2APFA 2E27L 3ILQD 1HINH 3FO0L 4JFZH 5D2NB 3BKCH 4F33B 1E27B 4N9GA 5T3XL 5HI4C 1A0QL 4ZUUA 5CINL 5E56A 4YDVB 1HDMB 4MD0B 4JM2B 4K8RC 1SVZA 1Q9OA 4B41A 3QNZA 5DJXA 1FNLA 3QUZB 5E08H 1MQKH 3JTTB 2NY4D 2P8LA 1OGTB 2GUOA 3GM0A 3QUML 4JFDA 1VENA 1E4WL 1BF2A 1J0JA 2A73A 1FH5L 1JCKA 2AJXL 2EE6A 4U6HA 2FZ3A 4QOKE 5A3IC 2EDOA 5ID0A 2BNQD 2FH8A 5L6YL 1LO2L 2OYPA 1Y6KR 4DZ8A 4OIIL 1MFCL 1INEH 2CK0H 4JN1H 5INDA 3UTSE 3VWJA 1BIIA 2BFVH 4M6OH 2DLEA 4PJEA 5BVPH 3PGCB 2PTTB 3OJDB 3MOQA 1A5FL 2D4FA 4H25B 5C08B 5F93C 2FEEI 4OCNC 2HJFA 2GK0A 5DK2A 1RZIA 4P9HL 3T2PA 3IFLH 3LQZB 1PG7W 4PRIB 1AGDB 3GJFB 2VH5H 4ORZC 4ZO7A 3U9UA 2IFFH 2VSCA 3AROA 5IQ7L 1KJ2L 1TJIL 2CLZA 3SHSA 2FSEA 4O00A 2ED7A 2WBWB 1KFAH 5FYJH 3ILPA 1IAIL 4BSVA 2KQMA 3MTRA 5F9WB 1YEHL 2K1MA 5EZIL 3C08H 4IHOB 4ZXBA 4PJ5A 3LB6D 3GUTA 1IM9B 1XGTA 2VAAB 4F9LC 1U8KB 3WFEH 4WDIA 2EE9A 4F58H 3RWCB 1N5AA 4J3XA 4OIAA 4GG6B 1ORQA 3DTXA 1MCPL 1E6OL 1YDPA 3S3PA 3OGCB 3VFNB 1P9MC 3JV5A 1ZS8B 1X6NA 4UI2A 2W59A 4LCYB 5HI5C 3B9DA 3CVHL 3FTGA 3VGAB 2CGRL 2VDML 1G0XA 3L3KA 3HZKA 1DLFH 5IFHH 3HR5B 1GJIA 2X7LA 3KJ4B 4FFYL 3X3FH 1TJGL 4WGVB 2AKRA 5H37H 3RGVD 2ESVD 2CIIA 1QQDB 4XVTL 5B22A 6CGTA 2I25N 3O9WD 1CFVL 3F12B 2IQ9L 4OD3L 4Q6IB 1YEGL 4JKPH 3SDAC 1B0GA 2PKDA 3I3EA 1VGEL 4Z7UF 5HI3D 2LFGA 1OB1B 2V5MA 1TIUA 3PG2A 3LKRA 5E99L 4OT1L 3W5NA 4MNGA 4PJIA 5K9JL 1HILB 3A67H 1FNGB 2YUZA 4CU6A 4GUPA 2CRIA 1NAMA 5FV1L 5C3TA 3UPRA 2WBJB 2AJUH 3W0WE 4RBPK 3LKSB 3DHMA 3NCCB 3G5XB 4O51A 4NQVA 3D85D 3UZQA 2HG5B 4WIQA 1Q9WA 1WITA 2EYRB 4XNYL 4LBEA 4CVXB 5EO0B 2BERA 3WD5H 3QEGL 3NCYS 5KSUA 3KPRB 4A6YB 5K33A 1QVOA 5A2KH 1TVHB 2E9IA 2GJZB 1CDUA 4FP8H 4K7PX 1MCCA 3EAKA 4PJCB 1NDMB 3PWPE 1SBSL 3PDOB 3NAAL 5IUSA 4XCFL 4G9FD 2XN9D 4NJAL 1QYGH 2QV2A 1QBLL 2AK4E 3UX9B 4PRNB 1IQWH 4NQEA 4XH2B 5K93A 7FABL 3B43A 5D6DA 1CGTA 5DEZA 5I1KL 1A6VH 1AGBB 4LSRL 1OP3H 3ULUL 4XVJL 4EDXB 3QIWB 3TYFA 4WO4C 2WQRA 3QG7L 4P23C 1R5IA 4JFFE 5GZNC 1O0VA 1YEJL 2IBBA 4HCRH 2EC9T 3KYOB 3MXWH 2XQBH 3C2SA 2W9EL 3NVQA 2EDFA 4JRYA 4TUKL 5I9QB 1LO5A 2B4CL 3ARUA 4L4TD 1J8HE 3VXSA 3BFOA 4NZTL 1NMCC 1PAMA 4LASH 5JW4M 3HC4H 3G6AA 2C3XA 1MIEH 1CLOL 4YDLC 3FQRA 3HG1B 3D39E 4Y4FD 2O5ZL 3O2VL 1QBAA 3OGOE 5B38A 5FUOH 4XP5H 1JN6B 2LVCA 4U7SA 3ZZ1A 4PJFA 4WJ5B 2P5WA 3DMMB 4AQ1B 2P43B 3MRCA 2YUWA 3I75B 4JFPA 5CBEB 3BZ4A 2WLYA 1E4XI 5CKGA 2DM2A 1A7NL 2QJDA 4P46A 4NNYA 2OX5A 1BEYL 4NKMA 1RK1B 3G9AB 2VDMH 1RUPH 2Z8RA 3WFHA 3RIAK 1RZJC 2OL3H 5FCSH 3MRRA 1U6AL 1S7TA 1A3LH 3VD5A 5I74C 1EO8L 4YHPB 4F3FA 2HLFC 5GHWL 4FQHA 4G80B 4HULB 3LIZL 3WUWG 1VESA 3J8F7 4K3JH 1L7IL 1MCQA 4LPUA 5IW1B 3VFGH 4IMKA 4PJHE 4QHKI 1UWGH 1LVEA 1IGML 3MBED 1MEXH 5TQ2L 4BKLB 2QQQA 1IGCH 3DECA 3VH8G 3L3GB 3NIGE 3EDKA 1WFNA 5E6YA 1J0KA 4OI7A 5SX5K 1A7PH 4EVNB 1A3QA 3T0VA 4O02H 4IIQC 3ROLA 4GW4B 4Q9BA 1JGLH 8CGTA 1QEWA 3K8LA 3RNQA 5CSBA 3RUGF 1CXKA 1LK3L 3OXSB 1CK0L 1J88A 3HCVB 2BY2A 4YDIL 3IDNB 4OFKA 3IVKB 2ZCKH 5T5FH 5AZ2L 1XH3A 4M4PA 1J18A 1DSFH 3AS2A 3VFRA 4UT9H 4Y4KD 3REVB 1A9BB 2MTPA 4IJ3B 2EZ0C 3DI2B 3UC0H 3BKYH 4Q7DA 1JZ6A 1C7SA 4HCRA 2APVA 2OXHA 4KK6C 4LNRB 4K8RH 3LCYA 1JK8B 4XMLL 4XPTL 5BO1H 5F3HA 2BNQE 1ODAA 4TUJA 1P7QA 1RZ8A 4LVNB 1YPZB 2XPGB 1SY6L 4R4ND 3IFPA 3BPNC 2C3GA 3O6FD 4E0RB 4FTVA 4OJFL 3GRWL 4J23A 1CDBA 4PR5B 1X4ZA 1CLCA 3CUPB 1OP9A 4PB9L 4YDKL 2RCSL 5DVOA 3ULSB 1SEQL 1U8NA 1Y0LA 3QIBC 2HWZH 4ODTH 3TFKD 1IGFH 1ADQL 1N6QH 3C5ZB 1LD9A 4F7MA 5C8JB 3S9DB 2R1WB 3KPMB 2D4DA 1JNJA 3T0AA 3CVHA 2Z4QB 2QSCL 3BJLA 4MJ6B 5ISZA 5KW9H 4OZFB 5DK0A 1I9IH 5IQ9B 5JHLH 1FG2A 1BQUA 2F8OA 2OL3A 5C0BE 3IDJA 2NY7H 1MVUB 3MJ7B 2IQAA 3TBVA 4K07A 1FZMA 4LSTL 2CSPA 4IBLT 4RWYH 4D2NA 3TH3T 2X1XR 1IT9H 1NANI 2XOTA 2Z31B 1F58H 2C3WA 1ZT4A 4A2MA 4OCRH 1OP5K 5KVEH 1FJ1B 2FB4L 3TBWA 1Z3GH 3CU7A 1JPTL 1HH6B 1BBDL 1HQRB 5AEAA 3T1FB 3VJ6B 1XMWA 2E7LC 3EYFB 3QIUD 5DJYA 4P2OA 1YMMB 2XRAH 1MHCA 1NFIA 4OFYA 1NCNA 3KR3L 2OTUB 1SBBA 5GRVK 2YEZB 5H94B 1U42A 4HS8H 5TH2A 3D0VB 2D03L 2ESVE 1IGTA 1S7XA 1S8DB 5E4IA 5KSAD 5A16B 1IJ9A 3MV9E 4LHUG 4NGHL 4J8RA 1QNZH 1Q72L 4TVPL 2HH0L 4YHIA 5IJVA 3P40A 4LVOB 3C60A 4OI9A 5LGHH 4RMVA 3FQTA 1F11A 3DV4B 1M7IB 4JM4L 5GS1B 3LKNB 4ZFOA 2NW3A 4P2RB 3S4SB 1HXYA 4HZLA 1PDKA 3T3MF 3QUMB 1RIVH 4YFLF 1FYTD 4JKWA 2EC9U 3X14B 3OKNA 3MNWB 1Q9KA 4I77H 3VRLE 3BIKA 5FKAB 2AJSL 3CC5A 4GMTH 2NY0B 5H8DA 2WIIA 4HUVA 2DMKA 5FECB 3MLUL 1FFOB 4Y5YB 4AT6A 5IF0A 2NY6B 1SJHA 2D0HA 2UWEB 3NIFF 1ZEAH 1OAYH 2EDLA 1JZ4A 3KPLB 5JZ7C 2NXYB 5FV2A 4F57H 4C57C 5E8PB 3X17A 5BS0E 4CU7A 2H3NB 4YC2C 2PR4L 3OKEA 4BK5A 3SY0B 1MCJA 2YRZA 1E28B 3SQOL 1JPSH 3MNVA 1MHHA 5KG9A 3HAEG 5EBLA 1JFQH 2VDLH 3DYMA 3T4AA 3NBNA 2ATKB 2I07B 1K2DB 4RAUB 4OCLC 3R1GL 2HVKB 2BHUA 3BKMH 4QO1A 5I73B 3JWDH 1I1AC 3WS3B 2RHEA 1KJ2B 1F4XL 3L3DA 4I48A 1JMXA 3SKOB 2J5LB 1U41A 4L4TE 3ISWA 3NN8B 4DGIH 3IJHB 3WS6C 1UH4A 3C6LD 1ZLUH 4EI6B 3P73B 4Y5XC 4XC1H 4M1DL 5E8NB 5GZOC 4WFED 4BQCA 5IGXH 1VEPA 4CW1A 3QDHA 5EBMB 3FQNB 2CLRB 4KY1L 4Z0BH 2P7TA 5EZLB 5GGSA 5CIPA 2J88H 4RNRB 1A1MB 1KBGH 2PF6A 3AAZA 2DQTL 4G8EB 3Q3GA 3F6LA 1DN0B 1BBDH 2X05A 3PQYA 2A6DA 4UIKH 4M9PA 4ODVL 4HX1A 4R0LC 5CGMA 2Y25A 1F4AA 2A74A 4OV6F 5F9AC 5HDBE 4GAGH 2NZ9D 3Q5OA 4FFVD 1D3CA 1NAKL 1I3GL 1P9MA 5BZDA 2IPUG 3OHXA 4NO3B 5I1AB 5H35A 3T3PF 4EUPB 1KC5L 2ZUSA 3CCHA 5DS8A 5DYOA 1JWUB 1JGUL 4Q2ZA 4KJYB 1JPGA 4Z0XA 2FR4A 3GNML 4KK8C 4JPWL 4NDMA 1RZJH 4JGMA 4WHTB 3ARBC 3SGEI 1UA6L 4FQXB 2OR8A 2C1PB 5C0AA 3OKMA 4Z77B 3KPQA 5IMKB 1G7HB 1D5XB 1NBQA 1HNFA 2QQNH 3V7MA 3QZWA 3ALXA 5CD5C 3GSWA 4O2CB 5ADOL 4LLMB 2R69L 3ARGA 4LLUA 5DD0L 2BSSA 2ERJB 3U36A 4JPVH 4EI5C 4D3CL 3RL1B 3NA9H 3QAZC 3O4LD 1UYWL 3ZE0F 3DXAA 4NQSA 5I0DA 3MFGB 5BV7L 1PFCA 1UKTA 1M4KA 1V7ML 3P0YL 1RULL 1FRGL 5FHAL 3F62A 1UB6A 1P5UA 4ZFGH 3TNMA 1CL7H 1TTFA 1SY6A 4XGZB 4Y16D 3ZE1E 2W92A 1C08A 1IAII 3CFCH 4UILH 1S78D 1ED3A 4QY8A 2DWEA 4ELMB 4MCZA 1DBAH 1OAKH 1OTTD 2I9LA 4XNXH 3THMH 1ZKAA 4WWKB 1TNNA 3B3IB 1YEIL 4FQCL 4LFHD 1PKQA 3WFZA 4ELKB 4LKCA 4WV1B 1R5WB 4OSUH 4PRPA 2YPVL 1M71A 1A6WL 1A14L 4TSCL 2B2XL 4E9LA 1EGJH 2XFXB 1T1YA 2Y4SA 3HPJB 4KMTH 5FYKE 1FLRH 2VWEE 4P9MH 1NBZA 4UNTA 4LLYA 4RCAA 4P23A 3NCBB 1UM6H 2E7MA 4RFOL 1MCBA 5JUEH 4LSSL 3VRIA 4U3HA 1E6JL 3VDAA 5F7UA 3V4UH 5TGBA 5DO2D 3MRLB 3D3VE 1A6ZA 4ZS6D 3P2TA 3F6IA 2Y1VA 4H1LB 5HYQB 1T1WB 4PJ7F 4YZFF 5EO9B 1CBVH 4UQ3B 1G7PA 4H8WC 4K7FB 5JW4N 4UB0H 2FYYB 3N9GH 2D7TL 2ITCA 2WBKA 5J1SC 3O8XB 3NH7H 1RJLA 5DZNA 1EHXA 2DD8H 3VA6A 3QUKA 3NFNB 3HPLB 4JFXA 1FL6A 5EU4B 5K9QI 5HGDB 3TYGL 5IK3B 4D9LL 1KC5H 4KDTC 1NCWH 2ZUUA 3L5WB 1RK0A 4K3HA 4LCUB 5CUSH 2HFEB 4MA7H 3IJYB 1CLYL 1OPGL 5E9DA 1JTTA 5HY9B 2OLDA 2GEEA 2XKNB 4NHCL 2V9QA 1U93B 3FKUS 3S96B 5C9KA 1NGXA 1CT8B 5JTWA 2R0WL 3CIQA 1XFPA 3HE7B 4LPCA 3UAJC 5F7HA 4XPHH 2EIBA 1TZGH 5FHBH 5FYLD 1DQQA 3PJSA 4FQQB 3G6DH 4DKAA 4RRPG 5B3JF 4FRWA 3VWKC 4TPRH 5D1QC 3VW3H 2XWTA 1J0ZA 3F5WB 1UENA 4OM1H 4I0PB 4JFHD 3DURA 4UBDC 1AE6H 1F2QA 5D5MB 3QDMB 4XMPH 4L8DA 3DYOA 3W2DH 5C1MB 4L9LC 4UT7L 1JVKA 4Y5VA 2IAND 4PRHB 4BQ6A 1WV7T 2W0PA 3NFPA 3HC0B 2C7UA 4KDWA 4IIQA 2FJGB 4HUNB 4HWBL 4P4KA 3W39A 5T3ZD 5IB3A 4FHBD 4M48L 3VFPB 5ADPH 1U36A 5E03A 1N5YL 1N59B 2NLJA 1H3PH 3OG4B 1YMHB 1IZKA 1AGEA 2H6PB 5I1HL 4IOIB 1BZQK 2XZCL 3ARSA 4MD5A 1FYTE 3BSZL 3S6CA 5I8KL 4EDWH 4R6UA 1NLBH 3PGFH 3C6SB 1OAQH 4O9HH 1CD1B 5MI0B 4E41D 1NL0L 1BFVH 3H9SB 1EGJA 2FHFA 4FQ2H 3IKCB 4OGXL 4ZS7L 1TPXC 1DEDA 1MFBL 4R4FH 5K59F 1L6ZA 3WEXA 2VUYA 4L4VD 4W4OC 1GHFL 2ORBH 1BX2A 4HGWB 4RMSA 4PGCA 5DA4A 2J8UF 3UROR 4EEEA 2WANA 2ZG1A 3ARDC 4ONFL 2AI0L 2Y5TB 4IRSB 5F72S 2GJ6D 4XHJC 2X10A 4BFBD 1KNOA 1A9EB 1A3RL 5LJYH 2HT2D 4LGRB 1HI6A 1A7BA 5L2KA 3QJHB 4PS4H 3TVMD 5DC0A 5IEKB 1K6QL 3EZ8A 3E6HB 5E8DH 4Y8DC 1HKLH 3BP5B 2VXUH 2CUMA 4DUWA 4HIXH 4ZO8A 3RWEA 5IW6A 2M8XA 2L7JA 2X4QB 1XR8A 1ONQA 1WC7A 3G5ZA 3OZ9H 3V5HB 3QDGD 1OOAA 4Z18A 5B39A 1JGVL 1KIRB 1I1CA 1B90A 2ICEB 5JIHA 4XP1H 2A9NH 5AD0B 4MNQA 1BFSA 2F5AL 1ITBB 5DJCA 3O3BB 1KGCD 3DVGB 4QRPD 4WW2C 2DQHL 2G5RA 3WV0A 2IC2A 3U46B 5CCKL 1M6OB 2Y36L 1FC1A 3BQUB 3DBXB 3MRIB 1GGCH 4Y1AA 3ABZA 3OXRA 3PWVB 3P3YA 2MQCA 3IF1B 2V7HA 1KG0B 1XAUA 3UBXA 3GMPB 5T1DL 2IWGA 3GBML 1H3UA 2XTJD 1FZKA 5T1KA 3LZFL 2EDYA 3RY4A 3LMJH 3UTQB 2H2PD 1ZTXL 4X7CC 5D4QA 1IGIH 4S1QL 1MJ7H 1HHHA 4G42A 3DX7B 4U1GB 4K3DL 4G6AD 1U3ZA 2HT4D 1RURL 2F54D 4DTGH 3GGWA 5GGQH 3QO0B 4Z7VF 4AEIL 2RFXA 4JDTH 3SDDC 4YHNA 2W60B 5KS9B 3PDGA 3DYPA 3R0NA 1OSZB 2PXYC 1MRDL 1UJ3B 4JY5H 5KTEH 4JE4B 3SDYL 1NGZA 3T2NH 4HHAA 5I66B 3VD7A 5EO1B 2BC4A 5D7JC 3L9RA 4ZD3L 5EZJA 4I2XA 4BFIB 4J4PA 3CFEB 1D5ZA 5TF1H 1RFDL 2XA8L 4XBGB 1Z9OA 5J9PB 1QBML 2A77H 1U91A 1T5XB 1UM4H 1VFBB 2JB5L 3K46A 5GGTH 2B20A 4WVRA 2JB6A 4P2CG 3MRHB 4MXVE 1QTYT 5IROC 1IKFH 3FB7B 2VITB 2YSSA 3O2WH 1JP5A 3O4LE 5GQBA 5JHDA 5GS0L 4JRXA 2OTWB 1Z0NA 4AL8H 3K81A 3QWOB 2ARJQ 3CFJB 2PW1A 5CEZL 4NSKA 3G5YA 4XWOC 4HC1L 1AP2B 5K9KA 3PNWB 1S7UA 5C07D 4Z5RA 4D0DB 4NQXA 1KN2H 4QRRD 3MRNB 1CDIA 3G08B 3NABL 5J12C 3LY6A 4UQ2A 3MO1B 4G43B 1QSED 4KHTL 3HE6D 1LO4H 1GRWA 2J6EH 4G8GD 4X80L 4UMGA 3B4NA 4HIJA 3IGAA 3KPOB 3GKWH 2JJWA 1BM3L 3KDMB 1BVLA 2GJ6B 3BP4A 1A22B 3KPNB 2ICWB 5DVLA 1UZ6E 4JRWA 4PJGE 3BO8B 3OKKA 5H2BB 3CFBB 3NCJH 2PYEA 1FFQA 2UZIL 1FVDA 1MNUH 4NRXB 1WWCA 4QHUA 3JVGC 5KVGH 1XZ0A 2FHCA 2ARJA 5D70H 1JHKL 3IDXL 1AHWB 4X0KA 1HHIA 4KVCH 5DHVB 1F3JB 5T33L 1I1AA 3HB3C 4X6BA 1VACB 3RL2A 2F53A 1KXVC 4R2GB 4IS6B 1OLLA 4JLRB 1QZ1A 4MXQD 4HH9B 4ONGH 5CSGA 2EKJA 3JTSA 4HSQA 5LBSH 4X7FC 4O5LH 4Y5XA 5DJZB 1WTGT 1U8JB 2H26A 3Q1SH 5I17B 4WUKH 5HHQA 3QUXA 4IRJC 4LDOB 4X4ME 4XCCH 1BVKB 3QPQC 3SO3B 3VXQB 4YWGH 1A02N 4I3GA 4UDTA 3O0RL 3MA7A 4BZ1H 4PY7B 5AG8A 5DT1L 3TO4D 5KSBF 4F7PB 5SWZA 4U6YA 5HHOD 5EOCJ 43CAB 5MENB 3WFCL 5DR5H 3GSRA 2OCFD 3CX2A 5EN2B 2F74B 2YK1H 3F7RA 3SJVE 3MBXH 2GIYA 2NW2A 1QRNE 5IG7B 4GXVH 5IHZA 1B2WH 3LSOA 5E2WL 1JHLL 3ZDZF 4HWBA 4LIQH 4LLQA 2QSQA 1LP9B 1HH9A 5ICYA 3UMTA 3BN9D 2EDQA 1T3FB 5GGTA 4KRPD 2OM5A 2NY3D 4Q9QH 3ARBA 5ANME 4Y0GA 3W11C 2R0LH 4M5YH 5CEXA 3V7AE 5EA0H 1OWRM 1DVFB 4ZTOH 1JF1B 4OB5L 4ZAKB 3U4BH 2NPLX 3RVTD 4H0IA 1U0QA 1FQ9C 2R0KL 2DDQH 1EJ6A 1WTLA 1R3JA 3EKCA 1MCOH 3HNTL 5HPMB 4HK3J 4APQB 2EXWD 2ICWI 2YPLD 5CAYB 1RJYB 3MCKB 5HGAA 4WW2F 2Y06L 3V5KB 4N0FB 3QXDA 1KCRH 5IV2A 4MAYD 3K4AA 4GRLC 2QQKL 3QJFB 5DXWA 1KELL 3H9HA 2BRRL 5T3ZE 2J6EA 5M7QA 1MCSA 5I2IA 2LE9A 3VXMA 5EB9A 5GRUL 4HK0A 4OZHE 2OS7A 1LE9A 4M02A 2PTUA 2P48B 1YYLL 4XRCB 4JY4A 5EFIA 3LH2H 4AIZA 4KKCD 1GGYA 4DW2L 4J6RH 4L4VE 4M3JA 4OFPA 5EUOE 5C0ND 1C5CH 4HFWA 3ARRA 3H0TA 5FGCB 1T66C 1C5BH 4L5FL 4OZIF 1JHTB 1JNLL 1R3IH 5E1HB 4XAWH 4GKZB 4FZ8L 5GJSL 4X6CA 2FIRT 4C56E 4JHAH 4D8PA 2ADJA 1BZ7B 3P4MB 4YR6A 4Z6AT 1CE6B 3K8MA 2I26N 2FECI 3VWJD 3DWTA 1S7VA 3KG5A 1G9NC 1FV1A 4HBQA 1FL3A 3VGDA 1QFUL 3EHBD 4O4YH 3P4LA 3D18B 4YXLH 4DEPB 3KLHD 1F97A 4TSAL 4PY8I 5FO9B 1VFMA 1I4FA 1K8IA 5DRWB 2BOBA 3VGEA 1GGBH 1T21B 3WXWL 2VZUA 4XP6H 4KJQC 2R1XA 5I1LB 4PBXA 2ITDA 4HD9A 1RIUL 3ILQC 5ALBL 4PLNC 1EX0A 3BZFA 4QRPE 4MA3A 1NCTA 4AEFA 2BNRA 2VC2H 4M7JH 2V2XA 1KN4L 3L3HB 5HJ3A 1RHHA 3WJJC 1SJEA 3IFNH 3MLSH 4TYUA 2ZUYA 4WI5A 4ZXBD 2M26A 4Y4HD 4PJ5D 4FNLH 2X4TB 1FZJA 4K3EL 3OTTA 1GZQA 2W65A 2VDKH 5FK9B 2NY4C 1RUQH 2XTJE 3KPPA 3HI5L 5JNYB 1CICB 2BVQA 1L0YA 2KDGA 4HLJA 3EYVA 1YJDC 3HHRB 3UEZA 5D7IB 2E7HA 1DQLL 3TJHD 1AGCB 3GSQA 2AABH 3NZHL 4P2YA 1DE4B 2DQIH 1R3KA 4L1DA 2EH8H 4I4WB 4YBLB 4DJMA 2VZ3A 2Q86A 5J56B 1IKNC 2DMBA 5IB4B 1HHJA 4HC1A 1OT1A 2CKBH 4JZJC 4L9LA 1VEOA 1MHPH 5BRZA 3A6CL 3UDWA 4H5SB 5DUMH 1ZWIB 5HPOA 3AREA 1NBVH 2GTWB 3OR6B 3DV6B 5D2NE 4N9OB 3WIIH 1RV6X 3ALWA 1N6UA 4N0UE 4WU7A 3EYQD 1NGYB 5BJTB 1K4CB 1DZBA 5ILTL 4OLVL 5JXAL 4OAWA 1WZ1L 1P4IH 1UKQA 1YA5A 2UZXB 1YN7B 2NTFA 2V2WA 4HIHA 3GIVA 5AUMB 4GW1B 4GLRH 4JPKH 2XWBB 4MX7A 3DROA 4OM0H 1OY3B 5HHPB 4XVSH 1UC6A 1EMTL 1AR2A 3LB6C 4OCSH 3RVVD 2BVOA 5K9OA 3Q5TA 1VSCA 3QNZB 3V79C 4GRMA 2HRPH 1T20B 3V6OC 4JFDB 1JF6A 4G8GE 1RUML 3BYTA 5EIQA 4BZ2L 1Q94B 4LSQH 1UM5H 2P5EB 3ARDA 4ETQA 1MWAL 2VXQH 1O7SA 4HUUA 1ZHBA 2NNAB 4NQED 1S7QA 4P3DA 2IPUK 4O58H 3RGVC 1KEMH 1NCAL 3FCTA 2P42B 2V17L 2VXSH 5C08E 2C4FT 2EIZB 5HHMD 3DRTA 5INDB 1KTLA 4K71B 5E8EA 1LEGB 3GK8L 3O9WC 3U7YL 4OZGB 5D96C 2ADGB 4PJEB 4JRYD 4PRIE 4G9DB 2BVEA 2BCKA 3MV11 4HZAA 5CMAB 5HGHA 3VXSD 3FT2B 1O7VA 3DUUB 5TQ0L 5HI3C 3QDJA 3H3PH 1CFQA 3STLA 2GT9A 4JANA 3HRZA 5DK2B 4TN9A 1RZIB 2WLZA 1N8ZB 4KDVA 4F2MB 5BOPA 4YHLH 3U9UB 2BRQA 5ITBL 1CFSA 1WBYA 2R8SL 3WNMA 3IDYC 3I84A 2P5WD 2X4NB 2OJZH 4TRPH 5INCA 3WN5B 5E00A 4JO1L 1OTSD 1HWGB 2WINA 4P2QD 5TDPA 2Q8BL 1D5IH 1LEIB 1K3ZA 1DUZA 4P46D 4P5TD 4DVRH 1BFOA 2AV7B 2HTLD 4JR9L 1IZJA 2OQJA 3FONA 5HHOE 3BRDA 3ARQA 4FFZL 1OQXA 1PW3A 4QXTA 1ORQB 5EU6A 4NO5A 5SV3A 3UJTH 5D71H 5C70A 1JWMA 3RI5F 4LCWA 2CKBA 5HD8D 5I1GL 4RZCA 2H32H 3FN9A 3FTGB 3IDMB 3WJLA 3HZKB 4W70A 1DP0A 2D31A 4K23H 1ORSA 1H5BC 4RFNC 1JBJA 3INUL 3UTSA 3FHAA 2X7LB 2FRGP 2IMMA 4NM4L 5JDJA 5T3XD 5IB1B 3BD4A 4LSUH 1U8PA 2P8PA 5DRNB 4GAJL 2BMKB 4KRMB 5FUZH 4ZYKA 3LOWA 4HDIB 4OFDA 1D5BB 1BD2B 1FNEB 3JV4A 4AENA 3MUZ1 1I1YB 2DQCH 5JR1H 1BQHG 5L2JA 3WIFB 5C71A 2LV4A 3O3UN 1F8TL 3M1BB 4UU9B 4EXPX 5I1IL 3HMWL 1OVZA 3LKRB 4Y4FC 4PP1D 3PL6D 3I02B 5FO7A 2WIMA 4U6XA 3F7VA 3H8NA 2MHAB 1R0AH 3KPRE 1MAMH 2LAAA 2H45A 4MYWB 1PG7X 4C83B 1I7TB 2JK5A 4PJCE 4TOYH 1EAPA 2X89A 3CH1B 3QEHA 3QUYC 1G0YR 3HZVA 4Q97A 4YH6A 4PTUB 5KSUB 2VYRE 3NCMA 2MCG1 4H26A 3VI3E 4NUJB 3MRFB 3MYJA 3GBNL 4UINH 3BKJL 5JW5A 4RGND 4HPYH 1EBAA 2WWMD 2WQ8A 1SEBA 3AMLA 5CLTA 4X5WA 1F4WH 2B8OT 4LARL 1J05A 5C6PB 4NN6B 3AXLA 3LEYH 4K7PY 1J1OH 4YLQT 1YY8A 4LRNL 1LK2A 3ARFB 3NCFB 4AIXA 3QEQB 5J6HB 4QXUL 4B5EA 5I18H 1A1OA 1P7QD 3MBEC 1RIHL 2V7NA 1DQJB 5FM5M 1SYSA 4HS6B 4M62H 1CXLA 3RY6A 4NN7C 4XCNA 3HG1E 4QCIB 3WFBH 4FTVD 4OV5A 5C0JA 3MUY1 1Q9LB 4JHZA 1J0YA 5F1IA 2BOCB 1QFHA 5BMFH 4FFWD 4ZDHB 3SPVB 3TT1L 3B6SB 3DSNA 3W0WA 1UCBH 1SVCP 3MLTA 1G9NH 1I8IB 1M1SA 3S35L 1DFBL 1IBGH 2FLRT 5ISZD 2ZUQC 4PJFB 3U1SL 3ZMRA 1VDGA 1LDPH 1X5YA 5IVXE 3LKQB 1TDQA 3BZ4B 3RJDA 1GAFH 3LN4B 2DJUA 3TN0B 2H32A 3IETA 4KU1A 3VMPA 1BJ1J 5DFVD 2IJ0C 4NNYB 3B8SA 5C2UB 4QEGA 1WISA 3LRHA 3PWPA 2G2RA 2DQDH 1U8IB 4Y4KC 3P30L 3MCG1 3M45A 3L5XH 3S7GA 2AK4A 5JQ6L 1ES0A 4L3CA 5F3BB 3RPKA 3B8YA 1ZHKB 1ND0A 4P4RA 4XPFH 1AXTL 4ZFFB 2H8PA 4JDVB 4R9HA 1YYML 5BZWA 1X44A 1MCKA 3MNZA 5F7DA 2QR0B 2X4PA 4NC0B 1JTPA 5E0QA 3C8KA 2VWEC 1OGAB 1TETL 4JFFA 3ES6B 4OFYD 4ZFZB 3U48A 2X4SB 1FLTX 5FXCH 4AMKL 1YJDH 1HIMH 2OK0H 3MFFB 2ICES 4R4NC 3O4OB 1KXQE 4FOMA 4BQ8A 1JRHL 5ESAB 5EOCH 3O6FC 3LHPL 1J8HA 2CDFA 3LPGA 3FMGL 4EBQH 1A47A 4NRZA 4HF5L 2DTSA 2DTML 1RZKH 5FOJA 3PGDB 4XXCC 3TFKC 3KJ6H 1A64A 1GC1H 4RMQA 4GRLA 3RWFA 3C60D 5GPRA 4OLZH 3WLBB 4RGMC 1HKFA 4YK4B 2C4FU 4AQOA 2BDNL 4MQ7A 4NKDA 4X9GA 3BD5A 3DO7A 4KTDL 1KTDA 5IBUB 1CE1L 4NUGH 12E8L 1J5OL 4K8RD 4J3WA 4UIMA 5B8CA 1YN6A 5IFAH 3VDCA 1XT5A 1XH3B 1V7NL 1RVFL 1CF8H 2A9MH 4WHDA 3PABB 4HIIA 2IPTL 3FN0L 1NH6A 1KB5H 2Y23A 5DJDB 1AR1D 4GG8A 3GI9L 3QIUC 1YPZE 5CKAA 3QNYA 4JREB 2KPNA 3H2WA 3DUHA 1ACYL 2JJSA 3B9KB 2E9JA 4NQEE 5B4MD 3ULVE 4PJHA 2LVEA 3S3JA 1CN4A 1MJUH 4Z7NF 3U7WL 5EPMA 5I8EB 1MFAL 3AU1A 4PLJD 5HHME 5BXFB 3U2SA 1PJ9A 3U0WH 1WQVT 4DQOL 1U3HB 5KSAC 4JRYE 3DSFL 4R3SA 1D6EA 1E4JA 3X3GH 1FL5B 5E94B 4L9DA 4NIKB 1G6RH 1U8NB 1Y0LB 1NGWB 5KOVC 1GZPB 4PBVC 1IL1A 5EC1B 4Z7UB 2MCPL 3QHFL 4XP9H 4K9EC 3MA9H 3QR2A 4YHKL 4YFDB 3R8QA 4MZ3A 2BNUA 3RX8A 3PP3K 5C2BL 1CU4L 3GBLA 2DKUA 2H9GA 3QFJB 2B0SH 3BH8B 3S36X 2IH1A 1C12B 1WIUA 2IQAB 5HDBF 4FABH 5F7LB 32C2A 4FG6D 2K3TA 5DVMA 4P2QE 5IB5B 3PQYD 3TZVB 1QKZL 1L7TL 3K8KA 3DLQR 4M7KH 1MREL 1SYVA 5E6IA 3ZYJA 1FFPB 1G1CA 1T7XA 3PWJA 5HI5D 2BNQA 3U9PL 1HSBA 4P2OB 1MIMH 1W2KT 1EHLL 4AY0A 1T22B 3UTOA 4UTAH 3MGOA 4J3UA 4UTBH 3WFDH 4PV8A 3D48R 1IKNA 1LNUA 1KLUB 5C0AD 5E1AB 3EDFA 5T3XE 2APBA 4NO2B 2ATPB 4MS8C 3FT4A 2R29L 3RAJH 5DD3H 4X5LA 3K2UL 3PP4L 3KNBB 3RI5K 3ARGD 3ZSSA 4HV8B 4JHWH 4JQIL 1NBYB 1U8MA 3C6LC 1W0VA 2JJVA 4PD4J 4KFZC 5D1ZA 3DXAD 2W07A 5FB8B 1P6FA 3UPAA 3C60B 5EC2A 4LAJH 1T0PB 5C0BA 1Q0YL 5F1SA 1DANT 4ZFOB 3RPIB 3F58H 3C5JB 1UXWA 3MZGB 1H8OA 3FAWA 2IAMA 4LMQI 1KLGA 1MF2H 1W72L 4M61A 2UWEE 1C16B 2AK1H 1HSAA 1MWAB 5ESVA 2R9HD 4HIEA 2WIIB 1JGDA 1JNNL 2X70A 1NMBH 2NZ9C 4FFVC 3IU4H 2HJLA 3FL7A 2Q7NA 3S88H 2VLRD 4WUUB 2XYCA 2R4RL 5DJAA 2NX5E 1OAZL 1RUAL 1HCVA 2AEPL 5TDOA 4X6DE 2W0FB 4N8CL 5FGBC 2ZUXA 1MHHB 5JOFA 1G6RA 3UO1L 3T4AB 1WF5A 5EU3B 3BP7B 3O9WA 3TBYA 4JFEB 3BUYA 1D7FA 3QHZH 4KGJA 5F21B 1AKJA 3OX8A 4JKMA 1JNHA 1GGIH 5DZLA 5JMRA 3MV9A 4CJ0A 3HN3A 1O5DT 4OQTH 5DA0B 5ETUB 2LU3A 3P0VL 1MHEA 3IAQA 5DI8A 3MJGX 4R4BB 4G3YL 2ICCA 2V2TB 1ETZA 3ROOA 1RY7B 1FORL 4TSBH 1X5JA 2QQLL 4NWTH 4RQQA 4CN1A 5L7XL 2NZIA 2R4SH 4EXKA 4U1JB 4HJGA 3AAZB 3MLWL 3RUGB 4PIRF 4R90H 2DBLH 4GAYB 2YA1A 4PREA 2G75A 2Q20A 4Y16C 3BPOB 1S78C 1JI2A 4JZOA 1MFEH 4FQIH 4PJDA 4U0QB 5MEPA 1C1EH 3FOLA 1Z9LA 4KPHH 5E9DD 5BS0A 5BZDB 4S2SB 1I85C 3RWDA 4CDGC 3GSNH 2WK2A 4LPWA 3OR7B 2AXFA 4GMSL 1A7RH 1T0MA 2G60H 4LAQL 1H5BA 4L29A 4Q2ZB 2ILLA 4ZQKB 5CBAB 3L7EA 1NC2B 4NDMB 5DHYB 1UWEL 2FH6A 4FQLH 1WWWX 5DURD 2DQJH 4ZTPL 2Q7YA 4QT5B 4L4TA 5FYKH 5DO2C 3DX8A 3SDAB 1DBKL 3VE0B 3MQIA 4DN3L 1S9WB 2BSSB 1AY1L 1U9KA 5FGRA 2ADFH 5E2UH 4QHLB 3P9WB 4XHQA 1NLDL 4P4KD 4PRBA 4NQSB 2EDXA 1M05B 5J06A 1CTOA 4U6VH 4ELME 2AEQL 3EOTL 3HZMA 3BHBB 2DS4A 4GOSA 3ULUE 2VLJD 4HS3B 5IKCB 1CGYA 1EO5A 1P5VA 3QUYA 5I19H 3CDFA 3X13A 3C87A 4ZUSB 5F89A 2ZSWA 2DWEB 2XWJA 3CLFL 3F65A 4S1SL 2PCPA 5CZVL 3EDJA 4PGEB 3IDGB 2DM7A 3VXNA 3QXAA 1OD9A 4PRPB 4EIGB 1N0LA 2E7CA 5D1XD 5I1JH 3MRJA 2FGWH 1S9VB 5DJ6B 3RTQA 3ET9F 2FX7L 5L2KD 4WO4B 4Z78B 3RVWD 2BJMH 1G7LB 3VFUA 2IH3A 2CMRL 3KWWB 4D9QD 3QA3B 4LLYB 1WK0A 4P23B 4P59H 3MLXH 5DDHA 1T1ZA 1DLHA 4Z95L 4ODXB 1I9RL 4BUHA 1RZ7L 4TNVF 1DBBH 3UYRH 2Z0BA 4F7EB 4TUOB 3VDBA 3OKLB 1UWXH 3FO2B 5DJ0A 3TIEA 5E6ZA 4N8VG 1X4XA 1NMCB 4J1UA 4ODSH 4HMCA 3TNNA 1KIQA 1OSPL 4Y2DA 5DQDL 3SEPA 4YDLB 5E5RB 3CLEL 1ZHLB 4DGVL 4ODHL 3O3AA 2ZKHL 5GRXG 1QSZA 1YQVL 2BVYA 3HUJF 4MJ5A 2AS5M 3QUKB 1HCFX 1QLFB 4ZUTA 3LS4L 2CIKA 4Y1AD 1XF2A 3GSNA 4H8WL 5HYJA 1J7VR 3DO3A 4PGBB 4PV9A 1NPUA 3LQAL 3RWJA 4HKXA 4Y4KA 5T1KD 4K9EH 3PQYE 1N7MH 3O11A 1RK0B 1FN4A 3HC3L 2F5BH 2M1KA 43C9B 4AYFA 5F7EL 4UV4L 3D5OF 4NZRH 1QHPA 1FO0H 5EBWB 3SE9L 3MSPA 4WY7H 1WUNT 4JG1H 1DANU 4U1LA 5I74B 1BWWA 4ODWA 3DETD 4E5XB 1TZIB 4JFOA 4OF3A 1NGXB 1NCCH 1DN2A 3BT2H 4HLZG 3UJIH 3MRQA 2NY2C 3QDME 5D5ME 2BVTA 2HT2C 1DUYB 4M5ZH 4L8BA 1DQQB 1IAKB 4PRHE 5HBBA 1HQ4B 5TFSH 3ME0A 1KCSL 3GHBL 1EVTC 2DMCA 1BJ1H 5MEOA 1KT2A 2DQFB 2O5XH 3TBTB 4J4PD 3SOBL 1NLDH 3D3VA 1K5NA 3OB0K 1BPVA 4S10A 5IJKC 2PW2B 5ENWA 3O6LL 3I9GL 3NFPB 4XP4H 5GGVY 4U2YA 1B6DA 1ERNA 2W9LA 5HYFA 1FVCA 4FQ1L 1PSKL 1IQDB 3W39B 1NSNL 4BJLA 3DXAE 2XXMB 1Z5LB 4JRXD 1OM3H 1NC4A 2XY1A 3TLRA 4HKZA 3E2HC 5AWNH 4K55A 4TNWF 3WO4C 1AGEB 4PJAE 4X6EB 3DIFB 4MD5B 4G6JH 2GQHA 2DF3A 3QRFM 4P5MB 4KZEL 1IFHL 1NCBH 2XTJC 5EDXA 2A6JB 2ZOKB 2H2PC 4X98A 4P57B 4XI5D 4YO0A 3NTCH 2W0LA 4G6AC 2XIDA 2HT4C 4ZPVA 1AD9A 3I6LE 3SKMA 4TULL 5IM7A 3O2DH 5DD5H 1LO0L 5KZCD 4OKVA 2VLRE 3ZTNH 3CSPA 2DLTA 1YNTA 3UTTA 4YFLI 2DYPA 4LP4A 3MODL 2A6KB 2AV1A 4KK5D 4WFGD 2JF1A 4OZ4A 4XZUA 4DVBA 3VXRA 2PYED 3M8OH 5FA3A 3KYNA 4KTEL 3U6RB 1S7RA 2IG2L 4K7PL 2XA3A 3I6KB 5F44A 3U0PA 2DQUH 1SMAA 3BPNB 4HWEL 5IW6B 1DQML 4M43L 4U1NA 1JRHI 1IC5H 3TPUB 2F53D 3GSOB 1D9KA 4QHKJ 4M6NL 1EFXA 3D69A 3QIBB 2HKFH 1MFDH 2VO5A 3OAYK 4MNQB 4AH2B 4QLRA 5F96H 3TESA 3IJSA 1J1PH 5LCVH 3QUXD 4LGSB 3RHWF 15C8H 4R97C 1F00I 2AVGA 4Q6YA 1FO0A 2WUCH 5A2FA 2JKXA 2EIDA 3OXRB 4KVNH 4LOUD 4O2EB 3O3DA 2OP4L 2HMIC 3VCLB 5SWZD 4LQFL 3FT3A 3HE6C 3MRGA 5IFJA 4PB0L 5KS9E 4IMLB 4ZOEA 3WDJA 4HUXB 1HHHB 3EYOA 1Q1JH 3U4EB 5E9DE 3GMMB 4GS7C 3FQUA 5DJ8A 4PJXF 2CRYA 4TVPE 3X11A 2LQRA 3VH8B 5MERA 4NOBA 4KK8D 3GSVA 2X1OA 3ARBD 1CS6A 3GJEA 4XPGH 2DJ4A 1J1XH 1FE8H 3WHXB 2P4AB 2BC4B 1A6AB 4CVZA 4I2XB 3RIFF 4HKJB 2LU7A 3BZDA 2R1YA 4PG2A 4F9PC 1RUKL 2BHYA 5GRYA 1U3JA 3K74B 2SEBA 2HP4A 1OQOA 1U91B 1UWXK 1AXIB 4MXQC 1I1FA 3C6LA 4HQQL 1W72B 1I8MA 5F9WC 4AEHL 2FL5B 1MI5B 2GTZA 2X4UB 5AZEH 4K94L 4V1DB 2VLLB 5JHDB 3QQ9D 1A2YB 2JIXA 3DX9A 3NOIA 4KXZI 3VXMD 3CD4A 4NSKB 4EN3A 2XKSA 1CG9B 2R56L 2W9DH 1F4YL 5C0GA 3O2DA 1GOGA 1AJ7L 3WKMH 3TO4C 2VLJE 3VGAC 1S9KC 3SE8L 4OGYL 2J8OA 3HFML 2DOCA 1LO3L 3DGGB 1ZVYA 4KUZH 2OJEA 4JQXC 1RSFA 1JUFA 2D7MA 3IGAB 5TPWL 2B1HL 1N6VA 3AUVA 5IT2L 3BZEA 4UUJA 4TVSa 3ZLQC 4UV7H 4MXWL 3QI9A 4X7DC 5T1LB 1X7QA 3VFVB 5CP7A 2H1PL 5I1EL 5KZCB 3EJZD 5C86A 3BN9C 5GS2H 4POUB 3TV3L 5FGBA 4D0BB 4KRPC 2NY3C 1T2JA 4RSVA 5J1AB 1WZKA 1XIWA 4BQ9A 4DN4H 4JHBA 4WWID 4QNPE 3PHOA 4LF3B 5HHVH 4CN6A 1KB9J 3UXFA 1FVEB 3H7LA 3GSUA 2JCCA 4KMQA 1ZLWK 3MREA 3Q0HA 5CJOL 1XZ0B 2ARJB 3RVTC 6FABH 3AS1A 1YZZA 1J87A 1BAFH 1UCTA 3PWNB 4NJ9H 1WIOA 1CR9H 4JB9L 3G04B 1I1AB 1YY9C 4RMWA 1LEKB 3IU3A 4M7LH 2EXWC 2GAZA 3Q6GL 5F6IC 3GKZA 3RL2B 2OXGA 5AAMA 1S3KL 1FIEA 4Z76B 1DDHA 5CJQH 3LV3A 5L9DL 4HBCL 4Y5XB 5I8OH 1E0OB 4LKXA 4DK6A 3FB8B 4LQFH 3HNVH 4G8IA 2BNRD 4PJ9A 3P9LB 3EOBB 5MENE 4TNVK 1MUJB 5GSRA 3SGDH 4R96A 4CNIB 2Y7QA 5T3ZH 4OD1H 3LS5L 5SWZB 1Y18B 4R0LB 3C2AH 4KKCC 2C1OA 1RZFL 3FFDB 1MPAL 2A1WH 4YE4H 4YX2H 4NNPL 4RISL 5C0NC 1I85A 4GFTB 2VDPH 5MP6H 3EFDH 3QCUL 4HT1H 1JYVA 5LKNA 2FIKB 1RMFH 5GGRY 3LSOB 4IDJH 4PJGA 1F13A 2P24A 4XCYB 2J8UB 5SWQB 3T2QA 4IM8A 1H15B 1A7OL 3ESVF 3EO9H 4KRNA 1IVLA 3CX5J 1T4KA 4X4YB 5FO8A 1UZ8B 1INDL 1II4E 1XF1A 3A6BL 4X6FA 5GJTH 3UYPA 2VDRH 4RFEB 3MRPB 4LHUB 5ESQA 3WIHH 1CXHA 3VWJC 5CEXB 4AZ8A 4JY6B 1PEZ