1IC5H

Crystal structure of hyhel-10 fv mutant(hd99a)-hen lysozyme complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWAGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic5H00
2G60H 1A8JH 3HNTH 5F7FA 1MCDA 3VWKB 2YD1A 2P4AB 3RU8H 4FFVD 4ENED 1IAKB 3I75A 3KPRE 3WE6B 1EV2E 4ELKA 3TT1L 2WV3A 1PGRB 5MENE 2X89A 4P5TC 2QQKL 1H15A 3MUJA 4Q58C 5JPNA 4ZXBD 3G04B 1CL7H 1A7QL 4NO2B 2XYCA 3DXAE 4RFNB 1NGQH 4ONFL 1NBQA 4HFWA 5IW1B 5CGYD 1JF1A 2DLHA 2IQAA 3TV3L 2HT2D 3T4AA 4I2XB 2N56A 1FYHB 2AERT 5HVFB 1BIIA 2VQTA 1YN7A 5ADPL 1PAMA 1ZTXL 2DQDL 2BVPB 2YXMA 3PDGA 2VLRB 3D3VA 3QI9B 3OKOA 3B83A 4OJFH 5L9DH 2ICCA 4WW2C 5IFAL 3N50A 4TSAL 5JXAH 2Y23A 4YHOH 5F9WC 1H3VA 2CIIA 4V1DE 3MYZA 4OCSL 4OZIF 4PP1D 4MXQC 5TPWH 1YQVL 4JN1L 3FN0H 1A9BA 1BM3L 2GT9B 1RZ8A 1U36A 3S96B 3UTTA 4JCMA 2DKMA 4E0RB 4WW2B 3VFVB 4OFYA 25C8H 3AREC 1EHAA 3UAJC 1MI5D 3UPCA 1U91B 3HC0A 3GJEB 1A6ZA 3W39A 2QKIB 1IEAB 4W81A 1JNLL 3LPFA 3ZDYE 4GKSB 4NZTL 4PGJA 5J6HA 4JY6A 1MJJA 3S3SA 4C54A 3RWJB 2B5IC 4JFYA 4NKDB 3R06A 3T0AA 3MV9E 2XFXA 1XGTB 2IPKA 4R0LA 3TN0D 3MJ9L 4DGIH 5HVGB 3UBXB 4UB0L 3CVIL 4FMFA 4PJDE 2NXYD 1WEJH 3W11D 4EVNA 5DFVC 3BKCH 1VB9A 4XCCL 2FL5A 4OD1L 1TVBB 1JTTA 5EU4B 4BKLA 3RVUD 3WN5C 5CHNB 1JNHB 3CXDH 4WI4A 5INDA 4KI5F 2DM4A 5AZ2L 4LSTH 2HTKC 4QGTA 4U6VL 1MLCB 2AJSL 4IJ3C 5DJZB 4HT1L 4PRDA 3ULVE 2YWZA 3BP7B 1T5WB 1NCWH 2Q76B 1QFPA 5HI5C 1DP0A 1PDKA 3PHOB 3HNSH 3BKCL 1CICA 5J1AB 1WICA 3M17A 1CE6A 4ODBD 2L7UA 4ODSL 2P5WE 3OKEA 2FWOB 4IOFD 5E8EA 3GJFK 5BVJA 1LQSR 2NR6C 5HYSA 5JDJA 3RX7A 3TO2B 1T89A 5DVKA 1CZ8H 3GMRB 3O6KH 3MJ9A 5JZ7C 3O45B 1DLFH 1BX2B 4AM0B 2OZ4L 4PPTA 4R2GD 1KCUL 3OJDA 5DQDL 1UM6L 1MCBA 5B3JE 3ET9F 3HZKB 4JN2B 5CZXC 4Z18A 2ZOKB 3DX6B 3MMEB 5GXBB 1SBSL 2IQ9L 4IOSD 4PJAA 2R15A 2PETA 2EXWC 4LVHC 2LTQC 3RL2B 5KSAB 3N9GL 2F15A 2Z0BA 1ZA6B 4QXTB 5DZNA 4BK4A 3QI9C 4Q6IC 1I4FB 2ZKHH 4LLQB 3IRZA 4OLWL 5T3XH 4Z5RB 2R23A 4PJDA 4R96B 1X4YA 3O9WD 3RKDC 1DN0B 1MCIA 3IDIB 3RVVC 5D7KD 1EJOH 4TVPH 1YMMA 3QIBA 3EDDA 3GSUA 1JNJA 1DE4A 5H94B 2XQBH 5IV2B 1G7MA 4PLOB 4Y5YA 3LZFH 4ENEC 3SOBL 1A1MB 4Q6IB 3MRPB 2EYRB 1X3DA 1QSFE 4QXUH 4MQ7B 1BFOB 3I6LD 3K80A 1P7HL 5IK3B 4RAHA 4LL9A 5AWNH 3C9NB 4RISL 1XZ0A 3IVKA 1G7QA 5EIQA 4JR9H 4OF0A 1M7IA 2EDLA 1TVHA 4K3EH 2HRPH 2ZUQB 5IG7B 5IVXF 2Z31C 3ZTJH 1BVKB 1JGVH 2JJTA 3ARBD 4PGDB 2AXFA 3TP4A 4D3CH 2IANA 4BH7A 1A9BB 4LGPB 3PXJA 4PJHA 2N4IA 3ALXA 4J3TA 4R90L 3QUXB 1CDYA 5I15H 1A7BA 1XGYH 3QDJA 4X6DB 1KT2B 2AS5M 4GMSH 4JAMB 3EYQC 3HPLB 3OBAA 1HSAB 3VXUA 2W59A 2EH7L 3E8UH 4RAVB 2A1WL 2VLKB 1G7IA 2NX5A 5CINL 3IDUA 3QZWA 4I0PA 3C5JB 3P30L 3X17A 4Z7OF 5L7XH 4ZS7H 2J8UF 2NLJA 5JXED 4NRYA 4WWKC 1IFHL 5GJTH 2VRAA 3QQNA 5GGVY 3T4AB 2JJSA 1BWWA 5CILH 1FCCA 1QLFA 5EOQH 3LKOA 2CJUH 4J3OC 5GS0C 3MJ8B 3E6HB 4PJAE 4CVXA 4HEME 1IC7L 4RCAA 1TCMA 1F2QA 3MRFB 4QYOA 4Y19D 4RA0C 4GUPB 4H20L 1UWXH 1FFNA 5EU7C 5C0NC 5EORH 1RVFH 1I8IB 5F7EH 4P23A 2EYSB 5JW4R 3CCHA 3BZDA 2X70B 4AQOA 4H0HB 5D7LA 3S9DB 3CLFH 1FL3A 4OSUL 1XFPA 2VDML 4NO5A 5D9SB 4M7KL 3P77B 1MI5B 4CN1A 1KC5H 3T1FB 1QBAA 4HS6B 1Z0MA 3JV6B 1OP9A 3PGDB 4U1MA 3GBMH 3VXTB 3LS4L 3WHE0 3U9PH 2Q20A 1Q9LB 1C1EL 1K3ZA 3O3AA 2DTMH 4N0UA 3VWJA 4BK5A 4KPHH 5BS0A 4NNPL 5B39G 5FHBL 4O5LL 3WFHA 1CLZL 1I9IH 4ZO8A 2GK2A 5HVWA 1ZT1B 3F58H 3VXNA 5HVHB 4Y2DD 2R0ZL 4ZUVA 4V1DA 4BSWA 3TVMC 4BFGA 5DVNA 5AAWA 4YO0A 1NCUA 5HHVL 5CUSL 1JZ2A 1OSZB 3HI1A 1URLA 5FDYA 4XH2A 4WWKD 4KHXH 4WUUD 4ZUUB 4RMRA 4X7SH 1CYGA 2GITA 2YD2A 1AQKL 4NZJA 4L8DA 5D1XA 4DZBB 1DVFD 4H26A 2NY4D 3O2DL 1Z0NA 2AV1A 4KJPD 5IF0A 5GISL 3VRJA 3WJLA 3MA7A 5FGCE 3JTSB 5EWIL 5I16A 2JTDA 4NHCH 2DTSA 1TJGL 1X5YA 2Q3ZA 1LNUA 3EYVB 2VR4A 4WFFE 2ENYA 1SJHB 2OBGA 5CMAB 3EAKA 3EUUA 5CUSH 5DSCA 1LO0L 4Y89A 3RTQA 5J1AA 4PB9H 2BMKB 3MV9A 5DMKB 4LSUH 1G7IB 4N9OB 4K9EL 4P5KB 5BXFA 4OUOA 4NKQB 2J8UE 4BQCA 4YDIL 1RUQH 3BT2H 4NO0B 2Z93B 2RAMA 2WUCH 3RPIB 2GSIA 3GRWH 3S7GA 1F5WA 5K9OB 4WHDA 3UBXA 1HHGA 2ZPKL 2FJFB 1YEKL 3RWCB 2VIRB 2MCG1 4HUNB 1DLHB 3MGAA 4JRXA 3DRTB 1MPAH 3LKRB 2B1HH 3RWHB 3ZKNC 4XBGB 3SDCA 2F58H 5FA4B 4NZRH 3WUWB 4HEPG 4WUKL 4JRYA 3V4UH 4MA1B 5C0BD 4IRJA 4TUKH 1YEHL 4KRPC 3UZQA 3RZCD 2FGZA 1XGUA 3HE7C 4MGXA 4GW4A 1VENA 4RGNB 4F7PA 2ZCHL 4EI5D 4MXQD 3SE4A 4GUPA 4DEPC 2YD3A 4G43B 3TWCH 2ORBH 3GO1L 4ELME 1LO5B 4MB4A 4F2MB 3STZA 4GBXA 5GGUA 5GHWH 3D85A 4OZHA 4TVPD 2DD8L 1FPTH 4X8JA 5EBLA 1ADQH 4CU8A 3T08A 2DM2A 3MV7D 3PWLB 1U58A 1G9NC 4ORZC 2F5BL 3CMGA 5GS1B 4YE4L 1AE6H 1D9KC 3B9VA 2NLJB 4Z7UB 2Z91B 5ICYA 3VW3L 2G5BA 3T8XA 4NFCA 4KDTC 3RVWC 1UH3A 4AY0A 3PWNA 1DUZA 2XZAH 4ZFGL 4AIOA 1CF8L 1QG3A 4HMEA 4NCDA 5MERB 3D39E 4H1LG 4YHYC 1G6RB 5I1LA 5HI3C 1OLLA 3L6FB 4ODTH 1XAUA 1UKQA 1AY1L 3CJJA 5A2KH 3MODL 4I0KA 3MRIB 4FQJL 3ARBB 1YQVH 4JN1H 1JRHI 3U4BL 1DE4B 3MBXL 1T0NA 3PL6B 3WSQH 3B9KC 1DSFL 2OJEA 5L0QB 5K9OA 4G6FD 4ZODA 4TOYH 4JE4B 4P2OB 1SEBA 1P7KB 3F7VA 5IHUH 1NSNH 5JA9A 5DJCA 3TBSB 3TA3A 4JQIL 4RFOH 3IJHB 1J1PH 3CFBA 3LMJH 3OAUL 1XGPA 2HA1A 1MFDH 3HS0A 4D9LH 5T3ZL 1RULL 4PREB 1CDGA 1Q9OA 3IU3A 5B38G 3AXLA 1DANU 5IB5B 4A2LA 3ULUL 5FO7A 3LPGA 4QRRA 1S7TB 1U6AL 4LDOB 4X6CE 3U4BH 4KKNA 4OF8A 4C57C 4X7TB 4G9FD 4WEBL 3G6AB 4NJ9H 1U93A 3LN4B 4L4VB 4UBDC 2DL2A 1I3VA 5F9JA 3G5XB 5A43C 1HHGB 2QLVB 1B0WA 1KF9B 3D3VE 1HHKA 5ISZA 1Q94B 1ZT7A 3HB3C 1JHLH 3TYFB 4PJFE 1QFWM 1Q72H 5E5RB 4HWUA 4EKXA 1D9KA 1RZIB 3HRZB 4NNXB 1UJ3C 1NBVL 1U8PA 1LDPH 5GRVL 5CJ8A 4JFPA 1E27B 3P73A 1XCTA 1QBMH 1WVZA 4WEBH 2NW2A 2Z8WC 4LPTA 1CBVL 3HE7B 2C1OA 1I3RA 1CTNA 4S1QH 4P2QE 3VI3E 3DWTA 4L3EE 1LEGA 1KJMB 1MRCH 5SWZA 3LRSB 1ZE3C 3C6LA 3WKNA 4H8WH 4S1SL 2CGRL 3O3BB 2ZZUT 3CDGB 1HH9B 3UEZA 2R8SH 2B2XL 2LE9A 4WFEE 4JZJC 2OR9H 1KTDA 1QRND 3V6BR 1G7PA 4KKLD 4Q9QH 1ZTXH 1IT9L 1ORSA 4ZTOH 2AJVH 3PWPD 1SEBB 3JWOH 5JHDB 1JHKL 2IGFL 1U8NB 2NY0C 4UIKH 1P9MC 5HHOE 5BOPA 1HN1A 3D0LA 1IJ9A 2X7LA 1TZHA 2YPLB 3DV6A 4GRLB 3MJ6A 5F89A 4WWKB 2C5DC 4M61B 4I4WA 5D1QA 1B2WL 3BIKA 1GIGL 3QFJA 2CDEA 3EOYG 3BPNB 3U83A 1N7MH 1JMXA 4JRXE 1TJIH 2XFXB 2QQLH 5MENA 2B8OT 1I7UB 3D2UA 5E08L 2YA0A 2BY3A 2XNAA 2FH8A 4HIJB 4CW1B 2BVQB 1JK8B 2X1XR 2BVPA 4NO5B 5I1LB 1SYVB 2OTPA 3L7FA 5DJCB 2YSSA 5FYLD 5F72S 4TSBH 3FB6B 4UIMA 4TN9A 4L4TB 1CGTA 2BERA 3NTCL 3G9VA 3C8KA 4JY5L 4LNRB 4RGOH 4XNZB 1M7DA 4JZOA 1QLEH 3LIZL 5BCAA 3HG1E 2DKUA 3TVMB 1GVIA 3S34L 1U8HB 4JFOB 3FQNA 3K2UH 1R3LA 3ARTA 3BKJL 3SN6N 1MNUH 1DBAL 3IS1X 2JCCE 3WS6A 1V7NL 2VL5A 5T1MB 4MNQB 5GJSH 3VGDA 4C4KO 4HAGA 1PYWA 3WHXB 5ACZA 1BQHB 4OZIE 3DPBA 3GSOA 4JREC 4BFIB 3LOWA 5CBAA 1U9KA 4U2ZA 1ZHBB 1C12B 1G6RL 2IAMA 1UQSA 2YZ8A 4TNWK 4X9FA 3LHPL 2V2XA 2IQAB 3P2TA 5JDSA 1EIBA 2AJSH 4PY7A 4QRPD 2J6EH 4KI5D 1KXQE 5MERA 3A6BL 3G5ZB 4EJ1C 3FFCB 4U6TA 1DBAH 1EO8L 1JGLL 2Z4QB 1FYTB 3DSFH 4FZ8H 4N8VG 1NGYB 4HCRH 3HE6B 5I76B 1S3KL 3MV7B 3QXDB 4Y4HD 1ES0A 4Y0GA 1TPXB 1KULA 1I1FA 2HVJB 3LH2L 5CEXA 4QT5B 3MRRA 5BXFB 1YEJL 1YEEL 4FQ1H 3UJJL 4DQOH 3V7MA 3C2SA 3SPVA 5ILTH 3NCJL 2BVQA 4X5WB 1YN6B 4FQXC 4GAGH 2EIZA 4S0TD 4X6CA 1EVUA 3PJSB 3TT3H 4I9WE 4TTGA 3UP1A 1AJ7H 3LRSA 3NCYS 3PIQA 4OM0H 3GMMA 3LSOA 1UM4L 4JFDA 1YEFH 3LEVH 1G7LB 1P2CA 2VZOA 1C5BL 1KXTB 4PJ8C 2DQTL 4Y16A 4YLQT 4OT1L 2DWEA 4M7ZB 5DD5H 1A1OB 1M6OA 1F00I 1X5LA 1MVFA 2GJ6D 1CICC 1FNEB 3PWUA 3IDYB 3S36X 5C07D 4GG6E 1PEZA 3FRUA 3ARWA 5E8OB 3MGOB 5EOCL 3JTTB 1RU9H 5F88B 1QYGL 4G8IA 4K7FA 5HYIA 1IM9B 1NCDH 2W0KA 1P4BL 4IIQC 1UM4H 4PJEA 2L7JA 1W0VA 1BJ8A 5ID1B 4JVWA 3HR5A 1ZLSL 5L7XL 4WI3A 1UJTA 5EU6E 1WWAX 1A9EB 1RZJC 5HYQB 1T21A 4KGLA 2IALB 1ZSDA 1MJUH 1I9IL 3LEXA 1I3RB 4XPFH 3EO9L 3MUHL 4HZLA 5JHDA 3U1SL 1WITA 5GGQL 2EXWD 5C1MB 5FCSH 2NXYB 3ES6A 1Z9MA 3MV8D 3PQYD 3WS3A 3T0EC 4I18C 5D7KE 5I76A 5DWUH 2F19L 4ZXBA 1P1ZB 1JV5A 1WT5A 1HH9A 5ELIA 4WY7L 4KJQC 4GMTH 5HI4C 2A6KB 3D39B 1D7FA 5HYFA 2BK8A 1UWEL 3HMWL 3RHWK 1CXHA 2E9WA 4ZFZA 1UT9A 4DKDC 2EZ0D 3WL9B 3G6JF 3VRIA 2VZVA 2H45A 3GNMH 4PJ9D 5CLWA 2F54E 4OZ4A 3UDWC 3DUHA 1ZLUH 1BD2A 3PGDA 4U1MB 4F58L 5KJRH 1MY5A 4XP5L 1RZKL 1YEGH 2F9BT 3D9AH 3IRPX 3CFBB 1FYTA 2X2YA 2AJYL 2OK0H 4JO3H 5D6CB 3O3UN 1A3RL 3QA3B 4GKOA 1IKNA 2Y6SC 1SBBA 5EU4A 1F3RB 1QRNB 1UYWH 1AGDB 5GSRA 3T2QA 1QVOB 3RWGB 4M48L 1BGXL 1CG9B 5CJXC 5ENWB 1FH5H 4HMCA 5KG9A 4PRPB 2EYRA 1FDLL 1JBJA 2X4QA 1UXSA 2H6PB 1ERNA 1I8KB 2EIZB 4S1RH 1T89C 3O3EB 1IZKA 3QIUB 3BEWB 3MRCA 1CTOA 1PSKH 1WZKA 5A2FA 3RQ3A 2VSCA 5BVPL 4IOIA 5GGSB 3K81A 2Y72A 4HMDA 1RJYB 1I9JL 4F33A 1HSBA 4JDZB 4MNGE 2AV7B 1RZ7L 5IB2A 1R3KB 1ZEAL 5DO2C 4OZGE 2FATH 4FQPA 4LCCC 5I1GL 5M7QA 4D0BB 3UTTE 3BEVB 4GKNA 1FGVH 2ICWA 3WEXA 3T0ED 4C83A 2CRIA 3T09A 4P2QA 5IHBA 2XTJC 3KWWB 4CJ1A 4PJCB 3P0YL 4CU7A 3BP5A 1N26A 3L7EA 4M61A 2M2DA 2OSLB 3DBXB 3MGTA 4G8FA 2XZZA 4GS7C 1I85A 1J0HA 2AVGA 4AQ1B 4E41A 1OB1B 5DEFA 5E7FA 3F5WA 4G8GA 1L7IL 4N0RA 4YBQC 3ZE2F 4NQCE 1J05A 3N06B 1TVHB 4LHUD 4NFBA 1KJ2A 3QG7H 2MWCA 3SDAB 5FYKU 5ESQA 2Q8AL 4XVTH 5HY9A 1ZOXA 2XWBA 4NUJA 1KJVA 2GI7A 2YRLA 3EJZD 5BRZA 4KTEH 1J0ZA 4OI7A 2VIRA 4MS8C 4YUEH 3IDNB 1OTSD 3EYVA 3QUXC 3KPRA 1JZ6A 2YPLA 3DV6B 1CFTB 2PTVA 3P4NA 1U3JA 4JPIB 4HH9A 3C5ZC 4L8BA 5GS2H 3I6GB 4P49A 3VH8A 4CN6A 4RMUA 1BMGA 3BRFA 4PJXF 4GW4B 5T1LD 2IFFH 5CP3A 4OLUH 4YGVA 4H1LA 1KIUA 2DQIL 3B8SA 1PG7W 4MJ5A 4BUGA 4NN7C 5I8KH 1VFMA 3PWJA 3OR6B 1BFOA 4HJ0D 3GO1H 3KPMA 4PGEB 4ODUB 3LEYH 5JHLL 1BQLH 2XN9D 5DR5H 2J1KA 1MHEB 4FP8L 3MXWH 4C59B 1TZGH 3S8WA 1JGEA 4LCCA 4LSUL 4LLVB 2VLKD 4JRXB 5D8JL 1FG2B 2JE8A 3OKKA 3WNOA 4PJ8D 5JORA 4ZSOE 4R8WH 2AXGA 2XT1B 2CDGA 1AXTL 2H41A 1OPGH 5E8DL 3OKDA 2C4XA 1J1XL 3HPJA 5D4QA 4KUCD 2CUMA 2XPGA 3QDGD 3SGKA 3ZHLA 3V2AR 1FN4A 3JWNC 3VI3F 3K1DA 1T3FB 3VFOB 3LN9A 1KPRA 4E9LA 5J6HB 5E00B 2Q87A 1OCWL 3BX7C 5E2UL 2P7TB 5CMAA 5GGVH 4XVSH 3QQ4B 4M1GL 4QY8B 4IHOB 3MUZ1 3T2NH 5KSBB 1UB5A 4NRXA 4MHHI 3OMZA 1GGIL 4CNIB 1TDQA 3O11B 2CLVB 4M62H 4X0KB 3TH4T 3JSSA 5DLMH 1GOFA 1X5IA 3EOBB 1J8HD 2FD6L 4Y5VB 5EUOF 3HZYA 3MRFA 3EO0A 3QUYB 3HAEA 2QADC 2J8UA 4R3SB 1IM9A 3OF6A 1DQLL 1IEAA 1QFWL 1XIWA 5JMRA 2G60L 1G84A 3P40A 5F7DB 4LARH 4PRIA 3V5HB 5EDXA 1X5FA 2PCPA 3BP4A 2IAND 2HKFL 4LCWA 5DTFA 4F37K 4U0QB 4K2UH 3VXQA 2O5ZH 2EDOA 3VCLB 3V0WH 2Q7NA 1P7KA 3F7VB 1ZVYA 4ZAKC 1QPPA 2DQCH 2XKSA 3P9MA 3CVHL 4NM8H 1A47A 5FYJD 1K4DA 1JMZA 1F2XK 1JNNH 3DHMA 3V7AE 1OLZA 1J18A 2HTLD 3KLSA 1CFTA 3IF1B 4I0PD 4XP6H 4WUUB 1Q9OB 1NCBH 2IBZY 4PJ5D 4G7YH 3CLEH 1YDPB 2NY4B 2DQDH 2GSGB 1AD9A 3EO1B 4KKBD 4P57A 3M45A 3GBLA 4N0FA 1U3ZA 4WRLA 2IAMC 3DXAD 4LIQH 5MP6L 2BVOB 3OKLA 4Y8DC 3V95A 4JFED 1KB5L 2IC2A 4HUMB 1UWXK 2X4OB 2YC1A 5C0IA 1IQDB 1A22B 1IKFL 3RWFB 5K59F 5IW1A 3NFPA 4M9OA 1QVOA 2HLFC 4L8SA 5E8NB 2E7HA 5FCUL 3NABH 4HK0B 2EECA 2FECL 3ESUF 1BOYA 2X4QB 3BDBA 1XCQB 2OM5A 4KKCD 4KJYA 5J9PA 3A67H 4RBPK 5I9QB 1BFVL 2PO6C 4GSDH 4F7MB 4FQXA 4XBPA 1FZOB 2ARWA 1AFVL 1GGYA 1TENA 3KPSA 1SJHA 1TETH 2EYTB 2JLLA 5HJ3A 4P46D 3WUWA 2I25N 4HBCH 2X4RA 2IH1B 4LP5A 2DIAA 4PP2B 1UH4A 5F44A 1B0RA 4F37F 3S5LB 4HS3A 2H2PC 2AV7A 5EFIA 2CKBA 2F54A 2VH5H 4U0RB 5C0BB 2UY6A 2Z93A 1LP9E 1U3HB 3VFPB 2H26B 1BD2E 4LLDA 3RZCC 4Y2DA 3ILPA 1LEGB 4YJZL 4OD3L 4ELKB 4F15B 2YD7A 3ALPA 4JANA 1FVEB 5MHSE 4LQFL 3BRDA 1IC5H 4HUUA 5DMGD 4JFFB 1IQWL 3MC0A 5H2BA 1F3JA 5CLTA 1WUNT 4Q7DA 4XAWH 3DUUA 4QHLB 4OB5H 1NFIB 5GS0D 1AGDA 1F6FB 4XC1L 2Q8BH 5C8JB 1IC1A 5IGXH 5KOMC 3UPRA 4IMKA 4LASH 5EOTB 1DBBL 5EBMA 3RI5K 3QQ9D 4NBXB 3MRNB 3OR6A 3Q6FB 5SWQB 2CR3A 3MREA 3TO4A 3MUGA 3HPJB 4M6ML 3QEQB 5E6IB 2CSPA 3S4SG 4OZGA 1T7VA 3O6FC 4FQIL 5GJSL 1IC5L 4AYFA 1FZMA 4KJWD 5IQ9A 1T04A 2VB5A 4JVPA 5JORB 3RFZC 2HMIC 3I9GL 2QJDA 4HH9B 5B3NA 3BP6B 4QRRB 4IM8A 1IAII 5CZKA 4MA8H 5HHOD 5KSBA 4PJ7E 4JHWL 5DYOA 2EE2A 5FDWB 3OKNB 4M1DH 4I3RH 1NDMB 5FHAL 1E28B 1XGPB 1MCRA 2JB6A 1QSED 1OGTA 5I74C 1L6ZA 3O6KL 3DV4B 5DRWA 4EUPA 2CK0L 1I7ZA 4JRXD 3ZT7A 5DURB 4YR6B 4NGHH 4HC1L 1X5AA 1MQ8A 2NXZC 3ARDC 4XCEA 5FUZH 2OI9B 1RJLB 4I3SL 3IKCA 3LIZH 3H9YA 1N6QL 4MXVE 1WIUA 1OQXA 3NCMA 1KIQA 2X1WL 2AXGB 4E42B 2H26A 3AS1A 4JFPB 4LPYA 5C0GA 4ERSH 2LFGA 3QDGB 3WFBL 3WIFB 3S35L 5CGTA 4EI5A 1T80A 4EXKA 1JZ4A 1T20A 2LABA 4Z77A 3TESA 3A6OA 4YZFF 5F7WC 3EW3B 2EIDA 3P4OA 2FWOA 3MV7E 1YEFL 3LEVL 3BSZL 4JCLA 4NQVA 5CAYB 4ZTPL 1SY6A 3MV7A 3QXDA 1DFBL 4G6AD 4ZS7L 3ZYZA 5E2VL 3PDOB 3SGDI 5J3HC 5F3BB 2J5LB 4FFZL 1OAKH 1UACH 3L3GB 5DUMH 5ICXA 4NJAH 1EHNA 5JW5B 5ETUB 2IEPA 4Y2DC 3QRGL 4OAWA 1AGCB 1ZT7B 3U0PA 4PV9A 3IJYB 1KJ3L 1M1SA 4G5ZH 2JCCA 5FGBA 4S2SB 2ZJSL 3FZUC 4U1IB 2WQRA 5C0FA 4BZYA 1YNTB 3I85A 1EAPA 1U3HA 1AD9B 2KQNA 3G08A 3K4ZA 5H94A 4HJJL 1U3HC 4YAQB 2FX7L 3PWPB 3UO1H 1TXKA 4QOKE 3GIVA 1BF2A 2EH7H 3E8UL 3KPNA 2NY0D 3FFCA 5H37G 2R23B 2YSSB 5L2KA 4GMSL 4MZ3A 4EUPG 4GRLD 4OKVB 3GI9H 4LLMA 2Z35A 4HUVB 1U8QB 3E6FB 1F3DJ 3ZE2E 2MJWA 1FNGA 1B4JL 2OI9C 5HI5D 3QDMB 5T1DL 1FCGA 3B2UD 3QPXL 3CXDL 1J11A 4AEHL 3OWEA 2KZWA 4FXKB 1N5YH 3IDGB 1U8KB 3D69B 3VXQB 4DWHA 1AC0A 3QDHA 5C09B 3LVEA 3NIGE 4XMKL 3KPPA 2KBGA 4OFYD 3GKWH 4LFHD 4WEMB 5EBGA 3VDAA 1UCBH 2FSEA 4UINH 5EO9A 3W2DL 1ITBB 3HA0A 3ETBF 5EG6C 1D9KD 3JUYA 3OR7A 2HJFB 5JZ7D 1MFBL 4L3AA 5KZCD 3NN8A 4WCYL 1INQB 4NNYB 2DYPD 4OCMC 2J4WH 2ADIB 1RIUH 4NPYB 3BP4B 2DBLH 5HDQH 5FKPA 3ZKXC 3L5XH 1IAKA 5C0GB 1BQSA 3MRPA 1RZFH 4OAWB 3U7WH 3UTQA 3BEWA 1CGSH 4GBXB 3RL1B 3O2DA 4UTAH 3C6LD 3NGBB 1EH9A 5T33H 3O6MH 3RGVC 3DYPA 4QHKI 1K4DB 2DLFH 5E03A 2DQHH 2X9XA 4G3YH 5IQ9B 3FT4A 4UV7L 5FK9B 2P5WA 3L1OL 2IBBA 2WLYA 2XKNA 4ELMA 2PW1B 3Q6GH 3VRIB 1KGCE 1KN4L 5JPMA 3H8NA 3WE6A 1I8LC 4TVSa 1ONQB 2CLRA 5E9DB 1A14L 5HHQA 1B4RA 4Z77B 4PRNA 4HS6A 2SEBA 3LKRA 5D71H 5DR5L 2V9QA 4H88H 3SY0B 4EI6A 2WBJC 5CFHA 2VKWA 3C2AH 4R26L 2ZUSA 1WBZA 4NN7B 5E8PA 3G5VB 4X7EC 5BZWA 4M48H 4D0CA 4KQ4L 5IW6B 1S5HA 4KY1L 2BVEA 3IETB 5FKAA 4WGWB 3ILPB 5T5NG 3A6CH 1AGFB 1IGJB 4D0DB 5IHZB 1MAMH 1S9WB 5HYEA 4QWWD 2VXTL 5C7XL 5CZVH 4AG4L 1F13A 3ULVH 4RBPH 5DSCB 1ZGLA 3FOLB 1EFXB 5F6IC 4W6XB 3TBTA 4XRCB 3W39B 2FO4A 4U1JB 2K9UA 5I19H 4OLYL 2YMXH 1J5OL 5F7MC 2BXYA 5D6DC 3Q1SL 5LBSH 3GHBH 5BMFL 4NDMA 4BA8A 5BJTA 3PL6A 1A9EA 4MMZC 4HK3N 2QQNH 1NC2D 4WFFD 5F9JB 5AYQA 1I1CA 5A1AA 3A6CL 3QUKB 1IVLA 2A74A 5C07B 5DLML 1WWCA 4MB5A 1HZHL 4UQ3B 4GG8A 5IKCB 1OAZH 3MZTA 4J4PD 4KK5D 2OXGA 3PIQB 4Z0BL 3FJTA 3HZMB 4XBEH 1F4XL 2YKLH 1SJXA 4PTUB 4YXLL 4X4XA 2Z31D 2E6JA 3P30H 4NSKA 4MAYC 2R1WB 4LSPH 1ZANL 4WV1C 4QHLA 3H42L 4UV4H 3E2HC 5ADPH 3CC5A 1BVLB 3SDXB 2XACC 5KN5A 5FKPB 4FTVD 3L3IA 1UWGL 1MIEL 4MNGA 4U49A 1KJ2L 2MFNA 4DN4H 4RX4D 3H3PL 4HGWB 3PWLA 4Y1AE 4F3FB 3MZGB 2WIIA 4ZOBA 3QT2A 3MRLA 1REIA 2JB5L 3BAEL 1B6DA 2VDPH 2VL4A 4UAOC 3ARBA 4NZUH 2OP4H 1A3QA 4GJTB 5KG9B 2H8PB 4NQCA 1I8MB 4I2XE 3GMQB 1NLDH 5HHME 4E41E 2YOCA 3VXUD 5DVOA 4A6YB 4IMLA 5MEOA 2EE3A 1EZVY 1S7XA 5D6CA 2QQKH 3RKPA 2DLGA 4XP4L 3O8XA 4BZ2H 3RAJL 3GKZA 5DMIL 2P5EE 4HCRA 4Y16D 5D7JA 1LO2L 2CLZA 2Q86A 1EGJH 3MJ7B 5D5MF 2FCBA 4OFKA 4J8RA 5E0QA 3WSQL 2HJKB 4TNWF 2GJ6A 5IJVB 5EU5B 5J12C 1HKLH 3KPPB 4A6YL 2CXGA 4K94H 4UI2A 3TEUA 1NL0L 4S1QL 1NLDL 4O02L 1QO3A 3QBTB 1UCTA 4J23A 4BQ9A 5EZOL 4NM4L 3OGOE 4CN4A 3W0WD 1IILE 4NNXA 2PYEA 1U8HA 3T0WA 4KI5C 5IFJB 1RUPH 4OIAA 4F7CA 3NAAL 3K4AA 3MLWL 1P69B 5IV2A 3RBGA 1HK6A 4LPXA 4FFYL 5D6DA 3ARFB 3LB6D 2BFVH 2BSTA 1MCWM 4K3GA 1JWUA 4PJDB 5JO5B 5B8CB 5IR1A 1JHLL 4Q2ZB 1MCOL 4HPOL 3INUL 2PF6A 5IMKB 3TIEA 5KZCB 5EU7E 5HPOA 4I48A 2JK5B 3VWJD 1U8LA 1ZHLB 2DYPB 3SJVA 5BS0D 3L5IA 4QOKA 1WBZB 2BY2A 3DURB 2JIXD 5IGXL 4Y4KD 5DD6B 3KHQA 1JVKA 3GRWL 1Q9WA 3BVNA 3P4MA 2VDKL 1II4E 5HDLA 4XWGH 4M7JL 5DK0A 1KUMA 4GG8B 1ZXQA 4HKZA 4I18B 3IYLW 3VD9A 2X1QA 3QEHA 2A2QT 1RZGA 5D2NE 3BPNC 4WGVB 1JNNL 1R3JA 4PJ7B 3SE8L 1FGNL 3GIZH 4FQ2L 4PJCF 5JR1L 3I6KB 1JI2A 2OR9L 3LS5H 5INDB 2OZ4A 4LSSL 1UB5B 2EDTA 2R8SL 1QLRB 3MRKA 1YN6A 5FGRA 4LEOB 2JJUA 4IJ3B 5LGHH 3E3QC 3HB3D 5JOEA 1EXUB 5KVDL 4PJGE 1A02N 3HC4H 4RQQA 3UTQB 1H8SA 1Z9LA 3OB8A 3VXSD 3WFCL 2ENSA 1YEDA 2RGSA 3VXPB 3R0MA 3NGBC 3SCMB 5C0AD 3P0VH 3PP4L 2MKLC 3O3AB 4AT6A 4HC1H 4FQ2H 4XTRC 5DUPL 5TDPA 5AG8A 1YZZA 3MV9D 1VADB 4NWUH 2FRGP 4WU7B 5D5MB 2RQ8A 1PG7H 3DX7A 4MLIA 3P73B 3IFPB 4PJ8B 4ESKA 5IVZB 1FNEA 2OXHA 4X98B 5EFIB 3DIFA 5I8EA 3MJ8A 4K3HA 1FV1B 4I5BB 3LQZB 1G9EA 3LCYA 1X6NA 1UKTA 4PRNB 4ZFGH 2C3VA 1FVCA 1D5MB 5DT1H 3W9EA 1SYSA 1BZ7A 4Y1AB 5AWNL 3PWJB 4RGMC 3CU1A 2XICA 4NKOB 4KKLC 2HKHL 1LVEA 4LPVA 4JO1L 1LK2A 1FO0L 4WFED 4X9IA 4HIEA 4KHTL 4EEEA 1IAIL 4PJHF 3S36H 3VFTB 2ICEA 3V0VA 2AXFB 4JY5H 2F54B 4NJAL 5J13B 1UEMA 3ABZA 4Z7UE 1B9ZA 2H32H 3V6FB 4LLUB 5EBMB 1AXSA 5DJYA 1MJ8H 4PBXA 3RZWA 4L9LC 2Y06L 5HHNA 2G9HA 3P11L 3KPRD 3BPOB 4PGBB 3QZWB 3F7QA 2WUBH 2QHRL 4JO1H 3MV01 4HWEL 5IBUB 4EZMA 1G7MB 2BZDA 3LKSB 1DQJB 3LZFL 5E8NA 3RA7H 5IP4A 4RFEB 4XPTL 1ACYH 3ARFC 4Z7VA 4TSCH 4XPBL 1MIML 2CO7B 1AR1D 4I77L 4UT9L 4RAUA 1HXYA 5F7KC 2DIBA 3SDYH 1I7RA 5I16B 1CFVL 5D7LE 2AEPH 3KPQB 3HLAB 1NMAL 4YHPB 3KVQA 3BZEA 5IT2L 4MNQA 3QA3A 4HCRL 5D1XB 1H3PH 4Q0XL 5F3BA 3HG1D 2R69L 1F45A 1OAQH 5ENWA 4XCNA 4Y5XA 3B5TA 3K0WA 1FLTX 1DEEA 2YUVA 5DMGC 5C6TH 3V5HA 4NQDD 5DJ2A 5DRXA 4J4PC 1I7TB 5MENB 3QDGE 4LVEA 3ARVA 3WXVH 4M1CC 3VXOB 3OKYA 5GGQH 2VLMD 3TA3D 5GS0L 1X5ZA 1PZ5A 2OCFD 1UCBL 4UINL 1NMAH 1ZHKB 5HGDA 1RUKL 5IKCA 4Z8FL 3BPCA 3S88L 2OJZH 5JPNB 1ADQA 4HIEB 1U8JA 4APQB 1SJVA 1G7JA 2VN7A 5EPMB 3MSPA 5TDPB 1KB9K 3BN3B 1UVQB 2R2EB 2VDLL 2GSIB 4ZOCA 5GSRB 5CCKH 1NEZB 4JRYB 5ITFA 3FRUB 3AGVA 3KYOA 1MRFH 1P4LB 2V5SA 5CJXA 1FP5A 4XVJL 1IAOA 4MCYA 5E6YA 5ISZD 1A6WH 2BC4B 3ES6B 1E4XI 4NQXA 5B21A 2P8PA 2VAJA 1LE5B 4XI5C 1INDH 4ODWA 3NIFE 4WU7A 5D5MA 3SKOA 4HWBL 3SO3B 1IEBB 4DZBA 2VTFA 5KSBE 3PDOA 4PJBE 3VWJC 4QWWC 2KKQA 5F7EL 1ZLSH 3UTSE 4HKBA 1ETZB 5D1ZD 2DWDB 4OSUH 1MCNA 4N0YH 4U7MA 3PJSA 3TM6A 1MCCA 3FRPG 2V9RA 1HIMH 2J6EA 3MLZL 3JV6A 4ETQB 1XGRB 3I2CH 3NH7H 1KENH 2VDMH 1TPXC 4U1NB 4RGND 5DWUL 3JTTA 1NFDF 5SWZD 4ZFFB 1GHFL 4DCQA 3I84A 1P7QB 1N2RA 4YO0B 3W2DH 5FYLE 3FO9B 1K4CB 5CEYB 1ZA3B 3VWJB 4M8QB 3N85H 3VFRB 5EIIB 4EDWH 4GMTL 4GQ9L 4XAKD 3TYGH 2BCKA 4OQ1A 4PLKC 3FO2B 4N8PA 5D7IB 2DS4A 1U93B 3LN4A 4ZPVB 5DJZA 1D5XA 3ARFA 43C9B 2B0SL 4LOUD 5SWSB 1QKZL 4RFNC 1M05A 3DJ9A 3O2WH 4EDXB 5LJYH 2ARJB 5AZEH 1MJJB 2AQ3A 5D1QD 2VXQH 4N90D 3BGFC 3N85L 3QXTA 5BZDA 3W9DB 4CADB 3MNZB 4K8RL 1E4KA 5DJXB 3OX8B 3QG7L 1T0MA 3NN8B 1FL5B 2NZIA 3G6DH 3VGGA 5DQ9A 4HIIA 2A38A 3VXME 5HVHC 4W4NA 3ARXA 4ZUSA 3T8XB 1NGZB 3EHBD 1CXKA 4J6RL 1MFEH 4UDTB 5E6IC 3WO4C 1QSZA 5L2JB 2NY6B 2R0KH 4FFWD 2CKBL 1QSEB 1U8OB 4X8JB 2VSDA 5J6GA 1CQYA 3RWIA 5F93C 2PO6B 1ADQL 4DEPB 3HI5H 3MCLL 1UENA 1E4WH 4F9PC 2J2ZA 3HNTL 3ARDD 4QGYA 4GRLC 1M71A 4FNLH 5JNYB 3QAZC 1EA9C 3C08H 3MRQA 2B1AH 2MQ0A 3OHXB 1S7WB 3V6OC 3Q5OA 5L0QC 3GJEA 4JFZH 5D7JC 3TGXA 3PV6B 3H9HA 5GGRY 1CIDA 2Z35B 4YHLL 3PG2A 5KVEH 3S4SA 4Q9RH 4B7LA 2JB5H 4HBQA 2I07A 3OB0K 4JM2D 3X11A 5GS1C 5J11C 4YDKH 3GHBL 1KEMH 2W60A 4JG0H 1NCCL 4Z7VB 1GL4B 5I1JH 5DK3A 3KXFE 2G5BB 3H7BA 1BJ1H 1JK8A 4CKVX 3WEXB 4MHHG 3P9MB 3TO4D 3BJLA 5FYJU 3FB6A 1F6AA 4IRZH 4LCIH 4HWNA 1ZVHA 4DGYH 1RULH 1HEZB 4S11A 3HNVH 2QSCL 1DLHA 4X80H 4DAGH 5EBWA 3T4YB 4Y4HA 2YUWA 4HSQA 3Q0HA 4I4WB 4H0GA 4HG4J 4M1GH 3IDMB 3TVMA 4NO3A 3ZKSD 1XIWB 3N1FC 1JF1B 3ARZA 4YE4H 3NPZB 4RGMB 3UJTH 1SEQH 4LU5H 4ZPVA 1T5WA 2AEWA 4AG4H 3SKJH 4IDJH 1TZHB 4APQC 1ZVSA 3RVUC 5B4MD 5A2JH 4PGBA 4MDIA 4IS6A 1CR9H 3U9PL 4JO2H 4JKKA 4ONOA 3VFRA 4AENA 1FO0A 1BREA 1NGQL 1KPRB 1VACA 3BH8A 3HG1B 4MD5B 4HFUL 5BVJB 4PJBB 4KPHL 3WD5L 4L8CB 4MXWH 3MNZA 2H2SD 5KBNC 3EYFB 3TBYB 1CLZH 2D9QB 2PYFA 1S5HB 3LKNB 1NSNL 4PJAF 3QUXD 5IJKC 5D93B 1TIUA 4OCWH 4UU9A 1M05B 2DQCL 3C5ZD 1X7QB 1GC1L 4KK6C 2FJHA 4DN3L 4JO2L 4OF3A 3V4VL 4JO3L 3G5VA 3FO9A 3ARBC 1JN6B 3FN9A 4TPRL 4IRSB 3WLWC 1RQ5A 4WW1A 2LU7A 2A6IA 5I1KH 5IROA 1KEGL 2PR4H 4D9QD 1FLRL 4K71B 3TIDB 4R7NB 1S9WA 3QPQD 4R97C 4DUWA 5D72L 5DEGA 4Y19B 3TT1H 5C0CD 4U1LB 2R9HD 3MV8A 3FOLA 3PQYA 4NC2B 2YXFA 2UWEF 2A77L 2WINA 4AMKL 5L6YL 2FX9H 1RURH 2GTWA 3KXFA 1U0QA 3DOSA 5J8OA 2DMBA 1MHHB 3BPLB 3SGJA 5FK9A 3RX8A 3IDMA 4QRRE 3L9RA 1T7WA 4ZO9A 3CFCL 1MJ7L 5C0JB 4OI8A 4YPGB 3B43A 2NZ9D 2A9NL 2PXYA 2DQGH 3X13B 5D7LB 1JPSL 2FEEI 3UTTD 2QSQA 2CKNA 3FCTA 5E9DD 1QBBA 5IW3A 3BRGC 1G0DA 1A4JA 1AKJD 3FFCD 2ICES 2CH8A 1T04B 1FYTD 3GB7B 4PG2A 5T5NF 2ADFH 2H2SC 1CLYL 3OZ9L 4Y4HB 4Y16C 3FOMB 3OKKB 2LVEA 2QL1A 3UBXG 5ESAB 4PS4H 1Q9WB 5JIHA 2XKNB 2R0WH 1BLNA 2CMRH 5FDWA 2V17H 2A9NH 1H0DB 3VXUE 4F7CB 1ZT4A 5FYJE 3S3PA 1OGAD 1C08B 3GSNB 4M4RA 3UBXI 3DUSA 3CK0H 3CFDB 3VMNA 4RWYL 4HHAB 2HFFA 1CFSB 3EDFA 4JDVA 2VDQL 4QRTA 1DQDL 2A73A 4WI9A 3SBWC 1I3GL 3VWKC 3X3FL 2BSRA 1A5FH 2CXKA 5C2BH 2ZUUA 3KPSB 3BKML 4RNRA 1VFBA 3IFNH 2QR0A 1MEXL 2OTWA 4KXZH 3EYUH 4NSKB 5FGCB 1A0QH 2FLBT 2P46B 3MUY1 2R4SH 4LASL 5F6HJ 6FABH 3BDXA 1CD8A 4KAQH 1CFQB 4BZ1L 4P2QD 1KBGH 1RUAL 4YNYB 3U7YL 2ADGA 2X4TB 1RUMH 5CIPA 4DVBB 1IM3B 1FL6B 1XF4B 3KJ4C 4JHAL 4Q97A 4M3KB 1CICD 1UM6H 2VKXA 4E5XA 1EEZB 5HJ3B 2AJZB 3MRHA 5J1TC 4Z5RA 2H1PH 4P2CG 1WZMA 4AH2B 2ZUVA 1CDIA 1DBJH 1S78C 1FIGH 4IRJB 3GSQB 2Z31B 5CD5C 1Z5LB 3G6JB 3S97C 1XH3A 4QRSA 1HHIA 1S9YA 5DS8A 5AEAA 4NUGL 4PRIB 5IJVA 2DN7A 5IBTH 4TOYL 4P57B 4MX7B 2HTKD 3BMVA 4UDTA 3H6JA 2BNRA 2XRAH 3BO8B 1UA6H 2BRRH 2AGJL 1IAMA 4HGWA 4P4RA 4X9HA 3GB7A 4YXKH 1H15B 4OCYH 5DVLA 1E6JH 1YC7A 5CBAB 4W6YB 3LV3B 4JM2B 5IB2B 4XH2B 4ZFZB 2DQTH 3QQ3B 3CDCA 4Y4HC 1MCFA 1P84J 3OX8A 5CSGA 4V2BA 3MPCA 4XNQA 1N64H 3EKCA 1Y0LA 4EI5B 1R3IL 3CFDA 1MCLA 5D2LB 3U0TA 3TJHC 2VLJB 3G04A 5JQ6L 3IAGC 1QYGH 1L7TH 2B4CH 5F9DC 1RUKH 4MLSA 3MV11 4O2CA 5JHDE 4H0IA 1TTGA 1LDSA 4OLZL 5FFLA 4WU5A 3UYRL 1K8IB 3P4LA 5JIIA 2WW8A 4PJ8A 5BV7B 1YMMD 1S7RB 3QIBD 5CP7A 1TZIA 4YDVB 3WO4B 3FQUA 1X5KA 3AFLA 5C71A 4UB0H 5FECA 2FX8L 3MRBB 5KVGH 4P48A 2ICWJ 3QH3B 1H9VA 3WN5B 1BJMA 1BZ7B 2V5TA 3QCTL 2XTLA 4KZDL 3QI9D 3HC3L 5CWSB 5C08D 3QNXB 3QO0A 5IB4A 3BDYH 1Q1JH 5DEZA 4KJPC 4XCFH 2XWJB 1BBJB 5TQ2H 4R4FH 5GS3A 4F9LC 2DWEB 4NNYA 2P1YA 2JF1A 3NCCB 1EDQA 1FNFA 4L8DB 5EOTA 1N6QH 1I9RH 1U3YA 1XR8B 3MRMB 4JGUA 4OGAC 2XOTA 4YHZH 4QRQB 3DO7B 1JFQL 2AK4B 3T65A 1S5IL 3TBYA 3BWUC 4LCWE 5HI3D 1IC7H 4G42A 3GMLB 4ODXB 5KJRL 3SE4C 1N59A 5F7NC 3QP3A 2BNUB 2HMID 1HWHB 5DK2B 1UZ8B 3MLUL 1FO0B 3DLQR 1ND0A 3MFFB 4DZ8B 3S88H 1WSST 1KB5H 4JG1L 5ECJE 3KYKL 5EZIH 2ZUYA 1HWGB 5EPMA 4CGTA 1E4XH 1JN6A 4OZFA 4LQ1A 2HJFA 5BS0B 4ZYKB 3I6GA 4XPFL 1D5ZB 4M7LH 4KDTA 3DETC 3TN0B 3KPOB 4PLJD 1QEWA 3C87A 1RK0A 1FIEA 3F7YA 3GJFA 4NQXB 2YD6A 3BO8A 3QJHB 1L0YA 1SM3H 5CKGA 2P24B 5DHVH 4JM2F 4IS6B 4KRPD 5T1KD 2QKIA 1H3PL 3KR3L 1MHEA 1T6VN 2I27N 2R29L 4I1NB 4P23D 4RMTA 1S9YB 2HFEA 5FEBA 3QJFB 2JK5A 5AZ2H 5C3LD 2ZJSH 1C16B 5D7LD 1FGVL 1X5GA 4P9MH 5FB8A 1S9XB 2EDEA 2VDRH 5H37H 5HGBB 3TA3C 3GGWB 3U2SB 3LKPA 3MACH 4HPYL 2R2HA 4JPVH 5C0BE 3O6ML 3WJLC 5IOPB 2QBWA 5MI0B 1NCNA 1Z6JT 4NWTL 2VZUA 4RIRB 1A3LL 4NBYB 3ZZ1A 1NMCC 1XGUB 4WFGE 5JQHC 3MLXH 2W38A 4XC1H 3SDXE 3U4EA 1A21A 5IMMB 4Z7WE 2XWBB 3V4PH 5EZLA 4XHJC 4WO4C 2NW3B 2C3HA 1ZT4B 3LN5B 2A9ML 2ZCKL 1WTGT 1QA9B 1NAKL 4NHCL 3RIFF 4NCC1 4QCIA 2C7UB 2W0LA 3KPSD 4FQIH 5C2UB 2VN4A 4QTIH 4PTUA 2NZ9C 1E4JA 2WBJB 3MGTB 4G8FB 4WWKA 3U82B 2PYEE 4R96A 3WNNA 4R97B 2E7CA 3O41A 1DVFA 4JHBA 1NCCH 4PLJC 2JIXA 2ARJQ 2BNQA 2F54D 4Z76B 5DZLA 1KV3A 4KMTL 5LWYL 2EKJA 3X13A 4FXLA 4XXDA 3VG0L 1CFSA 5FM5M 2R0KL 5A40E 5T5FH 4G9FE 2VDNL 3VD3A 3HAEB 1BVZA 1VEOA 2B1HL 5CJBA 5BQ7B 3RY5A 2DQFB 3GEWB 2A1WH 2J5LC 4U1KB 3RTQD 3SJVE 3HZMA 1OTSC 4OF7A 1KB5B 2C1PB 4MMXC 2W9LA 5DVMA 3MBEC 2JKXA 3Q5YA 5CJOH 5C9KA 1D5XB 2FHFA 2NW2B 4NRXB 2E7MA 1YNTA 4Z95H 5E99L 5SWZE 2DWDA 1H8NA 5D2NB 2EDQA 1CK0H 3EOAA 3JVGA 4KWUA 4XX1G 1OAZL 1ZLWH 1ND0B 3MFFA 5K9KA 4YIQB 2ZUXA 2GY7B 4Z0BH 4D8PA 4WTZA 1LO4H 1R24B 2DD8H 4FZEH 4PJFB 4Q6YA 5K9QI 2FB4L 3ZDZE 5HHOA 4Y4FD 3Q2CA 4QRPB 4DVRL 5GZND 1QEWB 1Z3GL 2DQUH 3H9SD 5ITFB 3ZYOA 1MLBA 4RMQA 1FNSH 43C9A 2NY3B 3TNNB 3EO0B 2D0GA 3AC0A 4WHTA 3V5DB 3QG6A 2GJZA 3PXHA 4LVOC 5A16B 1OWWA 5I0ZA 1EPFA 4PR5A 5D8JH 2IH1A 5T3ZD 3C60D 3KPLA 4QT5A 1TZIB 2GKIA 1KEGH 2WWMD 4G42B 2XPGB 4ZUVB 2MKWA 2YK1L 4JKPH 4LAQH 5C08B 4H1LB 4PRAA 1TQCC 4UMGA 1XGRA 3AAZA 3G5XA 3JV4B 1OL0A 1T3FA 4H20H 4IRSC 4O2CB 2XXCB 4WI2A 1P53A 5ID1A 3KJ6L 2Y36L 4HS8L 3BPCB 1INEH 3IU4H 3E0GA 5IW6A 2F5BH 3OXSA 4M8QA 2WWKO 2AEQL 2P5WB 4MNHA 1AE6L 2DI7A 3MYJB 5HBBA 4HZLB 1KN2H 1VFOA 4DW2H 3BI9X 5C8JA 3QH3A 5I1EH 4C4KT 4P5TB 4NQCB 2K7QA 1B0GB 3FMGH 1G9MH 2OTUB 3K3QA 4PJIE 4ZG1A 5HGAA 1IGTB 1YY9C 5B8CC 1OM3L 3DI2B 1MF2H 4WU5B 4YHNA 3O41B 1HHJB 3BESR 4ONFH 1IEBA 1KB5A 1RZ7H 3FO1A 1Q8MA 4DGIL 3VFNB 5J13C 3FONB 3SGJC 4PBVC 3TPKA 2E9IA 4NZUL 5I30L 1IGFL 3E6HA 2R0ZH 3VDCA 3QXUA 2ZPKH 3BUYA 4NN6B 3ZKQD 1TITA 2PTTB 3CH1A 2VDQH 1F8TH 3KYAA 3C8DA 5T1KB 4XBGA 3SDCB 4G9DB 4XCYA 1ZV5A 3SGEH 1I8IA 4M5YH 4KTDL 4O9HH 1MF2L 2Y1VA 4XP4H 5B39A 5IMLA 1N6UA 4J8RB 5EN2A 1KCRH 3THMH 4PRPA 3N9GH 2EDXA 4KUCF 3MRJA 8FABB 1KGCD 5JW5A 5CD3B 3V52H 5C0DB 3LKOB 4MA7H 2HRLA 4GRWE 1JWMB 1JGUH 4OLWH 2C7UA 1SYVA 2NY6D 3L7FB 3MBEB 5TFSH 4NRZB 2E7LA 2ITDA 3C9NA 1FZOA 1H5BC 2BJMH 4PV9B 4ZUTA 1XF2B 3C5JA 4TPRH 5E24E 3RWDA 5JR1H 4EQ3A 3MOAH 3BQUA 2NTSP 1G7QB 3SO3C 4D0BA 3KPTA 4HK0A 3FHQA 5D70L 2VUOA 4UUJA 4JY4B 3NAAH 2CQVA 4KQ3L 4JFHD 1Y18B 5E5MA 3KPNB 4PV8B 1CF8H 2NTFB 4F7EB 4F7PB 4WHTB 1RURL 1VEMA 3TZVC 5GRXG 3WIHA 5HPMA 2WBJD 4HF5H 4H8WL 4S1SH 4KUZL 4F15C 2P5ED 3D39A 3QHFL 1NBZA 4GRWB 2OQJB 1PG7L 4ONGL 3TV3H 5GRVK 3OV6A 4M1CD 4WJ5B 4FABL 2VDOH 3RZCB 1NDMA 3L3KB 3FCTB 5I18L 3AM8A 1N0XH 5EU6D 3W9EB 5J3HD 4JFXA 1R6VA 5DT1L 1JJUA 5KTEH 4DGVL 1S8DA 2APVA 4WVRA 5MEPA 2UYLB 3PNWA 5IESH 1CVRA 1U95B 5JW4N 5HHXL 1JPTH 3WFZA 3QG6B 5FUZL 3CMOL 3OPZH 5TDOA 5EA0L 1MWAA 1KIQB 4ZAKA 3TCLA 3NA9H 1ZLVK 2A6IB 4ZS6C 2LV4A 3FB8B 1MLBB 5CILL 4K3JH 1EHLH 3MRNA 5TJWK 2EO9A 1Q0YH 2J6EL 1D6EA 5T3XE 2J8OA 3MCKB 2X9YA 3T1FA 2FJGA 3REWA 3M8OL 5I75C 3IJHA 2VC2L 2W9EL 3CFJB 3X14B 3HRZA 1RZIA 3O6LH 1NBYB 1R5WB 3BKMH 5HYJB 4JFFA 2BVUA 5TQ2L 5KSAC 1LEKA 1JGVL 3RIAF 1YEJH 1YEEH 1OGAE 5BO1H 4KK8D 5CJ5A 4MA8L 1ZSDB 1A0QL 4XT1C 4U3XA 1NMBH 3ARDA 1DVFB 3GSNL 5I71C 3PL6D 4MD4A 3CVIH 4MJ2A 1PVHA 4L9LA 5E5MB 2O5ZL 3QEHB 1JL8A 4LSQL 3BKJH 4NQUA 2XA8H 4X4ZA 4M93B 2EIBA 2DM7A 5I17B 1QQDB 1EMTH 3BWAA 4HH8A 4PP1C 5FHAH 5J57B 3MUGB 4KDWA 4U1SA 2FGWH 3C5ZB 5DXWA 4GG6B 1R24A 4PGEA 1IGCL 5DF0A 3NZHH 1T1XA 1DVFC 5FYKL 5ANMA 2C3WA 2Y07H 2Z31A 5I8OL 1YNKL 5DFTA 3ROOB 2OMNA 1BM3H 3ULUF 3OB0H 4GLRI 2NYYC 4MAUH 2ZUTA 3SBWA 4YGAB 4ALAH 4G9FB 4R4BA 4HJ0C 4JY4A 5DK0B 3A6BH 1PZ5B 1T7XA 2ERJC 4YNYA 4U1HB 3DGGB 5TE6H 1JNLH 5E4IA 1T1ZA 4I13B 4XPGL 5L8KB 3ESVF 2NX5D 1RY7B 4XP9L 4DKFH 3PDDA 4ZOEA 5I8OH 5FYJH 2X05A 2F74B 1HCFX 5ALCL 1HSBB 4JDZA 5FYLL 3O2DH 1TJIL 1RUPL 4HULB 2AI0L 4F8QA 5IWLC 4Z7WF 1MJUL 4NQCD 1U8MB 4MAYB 2C3XA 5CIPB 4DVBA 3S96A 3UTTB 5CD5D 3I3EA 4JLRB 3KPQA 1FG9C 5EO9B 2OL3L 3LS4H 4GSDL 2BFVL 3PWPE 2BHYA 2MNUA 2Q6WA 2VYRE 5BV7H 3DRQB 4HXAL 3L95A 5TGBA 3Q48A 4U6YA 3ULSA 5F7YC 2A83B 1YMHA 2WBWB 3GMOA 4UT6H 4GKSA 1RK1B 1ZS8B 3CFEA 4RNRB 4ZYKA 3N0PB 4HIIB 4NNPH 3CC5B 4ACPA 2W07A 2G5RA 2OL3B 4YQXH 1HIML 2CDFB 2D03L 5JHDD 4BM7A 1W2KT 3LD8B 4LLQA 4HIJA 4CW1A 2D7MA 5HHNB 3MBEA 4MQ7A 2KQMA 1NDGA 5T1MA 4WW2F 4XPAL 2VXUH 5IVOA 3MNWA 4EN3D 3STZB 2ATKA 3I02A 4HIHB 1FAIH 43CAB 4XZUB 4RA3A 2A6JA 1AO7B 3T0BA 35C8H 4PJ5B 1FFOB 4FQHB 4PUBL 1LEKB 4JN2A 1YEHH 4OZFB 1T1YB 2Q8BL 3I50H 4MQXD 4OM1L 3BZ4B 1S9XA 4D9RE 3FT3B 2Q7YB 3IXTB 3LQAL 3EYQD 3QHTC 4QXUL 2AABL 4P5TA 3GKWL 3J8F7 4YBLC 3VFMB 5DK2A 1ZLUK 1CQKA 1FFPB 4GG6F 5IB3B 1BQUA 2DIJA 4K3DH 5BVPH 4EI6B 1RI8A 1FE8H 1WWWX 1EFXA 4M3JA 3M17B 1GCFA 4G6MH 2J8UB 1IGML 3BIKB 3JV0A 3QIWC 4OQTL 5L8JB 3ARRA 1G7HB 1VGEL 2HFGL 4MD4B 1A7PH 5IIEA 1MSPA 3V5KA 1KELH 3SHSA 5BJTB 3GNML 2R4RH 5JPMB 2WIMA 1I9EA 4I3RL 5IB4B 5C7XH 4D2NA 1N2RB 4KFZC 2RFXA 4FTVB 4OM0L 4KMQA 1CN4A 2X4SB 3O81A 1IC4L 2AW2A 4R2GC 1MELA 4P5MB 1A3RH 1OSPH 5GGTH 4OLYH 4OQTH 3F7PC 1HQ4A 3HZKA 4LLWA 2ZSVA 1AXTH 3IS0X 4TUOA 3CZJA 1KTDB 1KCLA 2P8LB 3ZTJG 2GCYB 4BYHA 5LGJB 3NIGF 1A6VH 1AHWB 1D5ZA 1OGAA 2GFBA 4KRNA 4P4KA 5I1HL 1MHCA 2YN5A 5L9DL 1GRWA 4M7ZC 4RFOL 5KAQF 1EK3A 2E9JA 2I5YL 3DMMD 4C56E 3DSFL 2OYPA 2P8PB 2FYYB 3X3GH 3IFOA 1H3TA 3O9WB 3PUCA 5D1ZC 1HQRA 1BECA 1YYMH 4FQCL 3UPAA 1QSEE 2H3NB 3MRRB 4G8GD 3BJ91 4QHMB 5E8EB 4X7DC 1FFRA 1ZHBA 1NUGA 3QQ3A 2ESVB 4MCZA 3CXHJ 1NFIA 4O00A 2Y5TA 5D9SA 4LHUG 3BOVA 1K6QL 2R1YA 5LXGL 4M7KH 4LAQL 5ITBL 3QEQD 3GBNL 3SDYL 5IB3A 3ZHKA 4P59H 2HT3D 2VXTH 5E6ZA 4LSRL 1HOCA 2YPLD 5AD0A 5HPMB 3WKML 3ZSTA 2DQJH 1G0XA 3MLYL 4HGKC 4AIZA 1N0LA 1ZHNB 5HHOB 1MRDH 1JZ3A 1F90H 3QEUA 2G2RA 4HS3B 2YPKB 3HTLX 2APXA 1S7VA 3W0WE 1GGBL 5GSVA 3BMWA 4F58H 2BNRD 3GBNH 4QTHA 1UXWB 4A6YA 5MEOB 2YN3A 3NCFB 2W65A 4JQIH 3GMPB 2YEZB 4NO2A 4PIRF 4M6NH 2GTZA 2VLKA 1JF6A 2ZNXA 3X11B 4OTXL 5I1AB 4LFHG 2AJUL 2DQEH 1MRDL 4IBLT 4G7VH 3QO1A 1OP3H 3WFDL 1ZLVH 3RGVA 1IMHC 5D93C 2RHEA 2BDNH 3TJHD 2R0LL 1FFPA 4W6WB 1NFDE 1FSKB 1HEZA 3DX9A 3K8LA 1HCVA 1T1XB 3O8XC 4MNQD 3FQTA 3V6ZB 5JUEH 1GGUA 4JM4L 5SX4H 1DL7L 1R0AL 1NBVH 5ICYB 2AXHA 2R1WA 3CSPA 2XWTA 3B4NA 2W60B 2FEDC 4G9FA 4NQDA 4R4BB 1CD1B 2FJFA 5DRNB 2FH6A 1YPZB 4PJ9B 1YEKH 3F58L 3QI9A 4LU5L 4P4KC 2R2HB 5C08A 1J8HA 1FVDB 2A77H 1YA5A 4HKJB 1G9ML 5L6YH 3EJJX 4RGNE 5B38B 4Y1AA 4FHBD 4FOMA 3UZVB 1S9VB 2M1KA 4HPOH 3DVNA 4LEXL 1HQRB 1KYOK 2IPUG 4WEUD 5C0JA 3J7HA 3QEUB 3V4UL 4NN5B 3VRJB 4LCWD 4M9PA 4Y5YC 5MHSD 3EYSL 5A2LH 3DVGA 2F5AH 1J8KA 3ZT6A 3E2HB 2NY0B 2HN7B 1DTUA 1X7QA 2EH8L 4GRWH 5EUOE 3N1QC 5EWIH 2R2CA 2UVEA 3I3BA 4U2YA 1NKOA 3TH3T 4W4OC 3T0EE 5T3ZE 4JDTH 1S7QB 1WJ3A 3D6GA 4HJGA 1VGKA 4P5KA 4O9HL 3C2AL 3O4OC 3SQOL 1EJOL 4NC1E 1QRNA 4FABH 1QFUH 4LLWB 1JZ5A 1A7RL 3AVEA 2VERN 2QQLL 5FOJA 1GH7A 4RQQB 2ICWI 3ULVC 2EE6A 3L5WA 1A7NH 4MDIB 4YX2H 3TBSA 15C8H 1UH2A 2VWEC 4ZQKB 3X3FH 1FZMB 4U6XA 4U05A 5D1QC 4JFEA 3HR5B 2CGRH 1VADA 4XAKE 1GPOL 4X99A 1T21B 2YUXA 4JPIA 5EC1A 4POYA 1TJHH 5IF0B 5BW7C 3FB5B 4K9EC 5CHNA 5DYOB 1TNMA 2J8HA 5IFJA 3O2VL 4ZTOL 2EO1A 1V7MH 3VI4F 1KYOJ 4HKZB 3UYOD 3VFMA 5BRZB 4XGZB 4YGVB 2SEBB 4LVHB 3MGOA 4FQXD 2PW2A 2BSTB 3GSRB 4J3VA 2VQUA 4P46A 5CBEA 4L3CA 2ATKB 3I02B 4HIHA 43CAA 4E41B 1HI6A 2FEEL 4TULL 1G7JB 3FQUB 4XTRD 1MCQA 1VESA 1OVZA 4XAWL 1KEML 1BBDH 3HI6H 3TIDA 1RFDL 3TF7C 1YPZF 4JRWA 2XWTB 1UM5L 2PYFB 2Y25A 2J7LA 4O4YL 5C09A 1EFQA 1OAUH 5I66B 5IVNA 1TCRA 5DI8B 4NUJB 5EOCH 2XRAL 4S1DD 2J88H 2KUTA 4BFEA 4OCRL 1RIVL 2BC4A 3E6FA 4L5FH 1DQDH 3GMPA 3EOTL 3SGEI 4L3EB 3F5WB 4G8GB 3MROB 3GMNA 2F8XC 3MLRH 4JGJA 2Z9TA 5EA0H 1Y6NR 4APQD 4DQOL 5FO8B 3RNKB 2HRPL 2CPCA 5FUOL 1HE7A 4H25A 3T77A 3E1F1 1S7VB 3UJIL 3QULB 3UTPE 4ZNCD 4PRHE 1D5BA 4OCXH 4MA3B 1EBAA 3WXWL 6FABL 3JWDC 4WV1A 4C83B 2RR3A 3M07A 2JCCF 1T2QH 1RIVH 1DR9A 4YC2C 1QSVA 4I8DA 1Z2KA 4D9LL 1BAFL 1AQDA 5DJDB 3ULUH 2ICEB 2B2XH 3QFDA 5IMOB 3WIHH 3BKYL 5GQBA 1MY7A 3BEVA 5I1DB 4P2OD 3LPWA 1T2XA 3GSUB 2PCPB 4XWOC 3V6OE 1NANI 1Z9SA 2CIKB 3SDAC 5IEHA 5DRNA 1QSEA 1Y18A 3BUYB 2AXJA 1DCLA 1F4WH 1G9NL 1IM3A 1FL6A 3GZKA 5HHVH 1ZLWK 3HLAA 4YHPA 12E8L 1LO5A 3O3DB 3PP3H 1P7QD 3QCUL 1VFBB 4UIMB 4NP4L 1LDPL 4LPUA 2DDQH 5ICZB 1UACL 5DD3H 3GSQA 5KSUA 1KTRL 3O4LD 1EVTC 3GK8L 4LMQE 4Z7UA 2ESVA 4I77H 4UT9H 4TSCL 4WNQB 4XPBH 4L9LB 4S0SD 3CVHH 4LLUA 4EDXA 2EIEA 3QRFM 4DUXA 4XPAH 2R2BB 4HHAA 4WY7H 3O6LL 2VAAA 4OBRA 2V7HB 4XCCH 2YBRB 5J6GB 2ZOKA 3MMEA 1I9JH 3T0VA 5FYJL 1NGWA 1AC6A 1KLGB 2ED8A 2X42A 5DD5L 5I1CH 2CLVA 4UOJA 3HZVB 1NGPH 1SMOA 3O6FD 2I9TA 1TTFA 4HT1H 1T66D 4DTGL 2R9HC 2IGFH 1T03H 3P0YH 3VD7A 4HLZH 3NACL 3C5ZA 4QKXB 5E2WL 1R3HA 2P24A 4R3SA 3P9LB 2FJGB 1JGEB 3ZTNL 3FQRA 3PHQB 4LGRB 3VFOA 4ELMF 3OG6B 4OGXL 3BD5A 1DUYB 3BN9D 5F7DA 1FYTE 1A2YA 2PO6D 3UYPA 1TQBB 2Y4SA 4PJEF 1BZ9A 1KG0A 5FA3A 1AI1H 2L0DA 4JJ5B 4QRQA 3DO7A 3WIIL 2DM3A 2C1OB 4O2EB 2A74B 3MRGA 4HKXB 5GISH 5TH2B 4Z0XB 2BOBA 3AU1A 4YDLC 5BS0E 4X6CB 3WV0A 4HXBL 1KPUB 5KSVA 1MH5A 3MLUH 1JGLH 4PGZA 5JW3L 2ZCLL 3BGMA 1V3JA 3RY6A 1S8DB 3KYKH 3RRQA 3FT2A 4L1DA 5HD8C 1A4KB 4K9EH 5DUPH 3TPUB 1GGTA 3ALWA 3OKEB 4HUXB 1EO5A 1XF5B 3DUUB 4OIIH 3S5LG 1ZEAH 1U41A 2Q7YA 4P9HL 2PW1A 2YS4A 2PXYD 1H3GA 4D0DA 5F96H 4BH8A 3UO1L 5E9DA 5F7LB 3FFCE 3LKQA 2JJTC 5HDOA 5DJAB 2NY2B 1MFCH 2W9DL 2AK1H 3TO4B 4PJ7A 2ESVE 3UX9B 3ARUA 5AUMB 4OGAD 2VXVL 2IAMB 3SY0A 4LRNH 1V3KA 3VGHA 1UFUA 2UVFA 3TIEB 2RCSL 1GOGA 3PGFH 3D18B 1T66C 1YNLL 5C0AE 3QWRD 1T1YA 3T0EA 5IHUL 4GRWF 4OLVH 1OARH 3HFML 1DDHA 1P4IH 1OP5K 5FM8A 3EOAB 4K71C 3ZL4H 2RJMA 2E3VA 4Q9RL 1MCKA 4JPVL 1A1NA 2ERJB 4ZTPH 4E41D 3ULUD 5D7JB 5HGGS 5IQ7L 4PUBH 3GSOB 4KC3B 5E2VH 3EYFA 4EUPH 3PGFL 4JQXA 1L6XA 3O9WC 4NHUA 4XNXL 2EICA 3DTXB 5IUSA 1SMAA 2YA2A 4DOHE 2D31B 4HV8A 4ISVB 5J56B 3MRQB 4GAYB 2FZ3B 4KJYB 5J9PB 4K55A 1QO3B 3DXAB 5TGBB 5CZVL 3B6SA 3JWDL 1NUNB 4KTYA 3LEYL 4I3SH 2X4NB 3QCVL 5JHLH 5IOPA 2NY5H 3O3DA 5DURD 4HGMA 3RDTB 4K23L 4OT1H 3NFPB 2HFTA 1HHHA 2A0LD 3HI5L 3MCLH 3FL7A 4LRIA 4AL8H 4KKBC 4OZ4B 4X4YB 3F12B 5DMJB 4MAYA 3W81A 1OAXH 1MRCL 3ZE1E 2BSRB 3CSYA 2XN9A 3JWDH 1HINH 4YXHH 3QIUA 3BXNA 4Z78A 2F53E 4R0LC 2X4UA 3QIBC 1YMHB 1RJYA 3IDXH 5C0EA 1OAKL 4EIGB 2KH2B 3L3GA 4XMPH 3LQZA 1H3XA 5I6XB 1MVUB 3PV7A 2F8OA 1T22B 4JLRA 2CUIA 4YAQA 4M62L 3B9KA 4G43A 3DSNA 3VMOA 2VQ1A 1UEYA 5HGBA 2EEDA 3RWCA 3FO0H 5M94B 4I3GA 4J4PA 1VERA 3KPSE 2PUQT 3TNMA 3GDBA 4J3SA 4MJIB 4JDVB 4QRTB 5F1NA 5TE4L 4JQXC 1VFAB 1JE6A 4LEXH 4HWBH 3BPOC 1PY9A 4JFFD 4HUXA 4YFEA 2QSCH 4DAGL 3CPLB 4NOFA 3BE1H 1JNHA 3PWVA 4CMMA 1T1WB 4E42A 2FATL 3NCEB 3O4LB 3MRDA 4W70A 4URTB 1AGBB 4HJJH 3D18A 3CU7A 3C5SB 2O5YL 3GI8H 4YPGA 3UTSD 2G2RB 4Y8AA 4UT7L 5JMOC 4KXZI 1HYRC 5FF6B 1F6LL 1W72B 1VFUA 3MTRA 2RFXB 4FTVA 4RZCA 1XEDA 3QNYA 1NPUA 5DGRA 4Z7WB 5EU3A 3DV4A 3KNBB 4M8VA 1OM3H 4X6FA 4KK6D 4L8CA 3QB7C 2OX5A 2IPKB 2CDGB 2GK0B 1N5YL 1E27A 3TO2A 3QQ9C 1XF5A 2P45B 3K2UL 3AMKA 1FH5L 4UIKL 4MQSB 4PD4J 3BD4A 4M02A 5I1IH 3U0WH 3QPQC 4BSWB 5B38A 4ODHL 2ZUQC 5TDNB 1MWAH 2WINB 5HD8D 1NQBA 1VPOH 1CICB 1LE9B 1D3CA 2ITDB 3SCMA 4OQTA 5ESVA 5ALBH 3VH8B 2V6HA 4HKBB 1EEQA 2GITB 4PJ5A 4J2XA 3IETA 4XNUL 5CSZA 2WBKA 2NNAA 4KROD 5EO1B 5J06A 1DJSA 3NCBB 4WFHD 2XY2A 3EFFA 1LP9F 5DZOA 5BV7C 1K5NA 5I1IL 1T6WA 4ZOAA 3FQRB 3PHQA 1J0JA 4NT6A 1IAOB 2NXZD 4FP8H 3LV3A 3DROB 4YBHA 4ZO7A 4AMKH 5T1KA 1R3JB 3MRIA 5KVMC 1CI5A 3MOAL 5DQDH 4XP1L 3C6SB 4XC3H 2CK2A 5KSBF 3W0WA 2ZNWA 3CAFA 1FNHA 5EZJB 1YJDL 5A2IH 1DEDA 4RMSA 1IGFH 1B88A 4LCYB 4G80B 4OLXL 5IIEB 1HXMA 1OP3K 4F7EA 2VLJA 1DUZB 4L29A 5DFVD 1IZJA 4NQTA 4LPCA 2J88L 3F7RA 1TVBA 1C8PA 3ZKXB 4L4TA 4HF5L 4N1CA 4JPWL 5L88L 5HGAB 1NH6A 4YDJA 3K46A 3N1GC 1PQZA 4RMVA 3V6ZA 2ZOLA 4M5YL 5FA4A 1NC4B 3QHZH 4NBZB 3SDXF 1LK3L 1DEEB 1V8HA 4HFWB 5F3HA 2R0WL 4D9RD 2HLAA 1RJZB 2D0FA 1QSFB 4JG0L 2XZQL 4Y4KA 5I2IA 1RZJH 3QWQB 5I6XC 3W82A 4X9GA 1UB6A 2IH3B 3ARGD 1MFAL 3EDJA 3BP5B 1ZHKA 3V6OA 1HOCB 4NQDE 3KLHD 1IGTA 1PYWB 3WHXA 2X4NA 1EFXD 3CSYB 4JQVA 4K3EL 1IQDA 4NWUL 4OGYH 4MSWA 3UTOA 1WISA 4YHMH 2IBZX 4RFEA 3VXRE 4JZNA 5DJ8A 1U92B 4X4YA 3HMXL 5L2KE 5CP3H 4PGCB 1JYXA 2W92A 5A3IC 1B3JA 3LMJL 5C0DA 4U1HA 1MNUL 4Z7UF 1ROWA 3VXSA 5I15L 3DUSB 4NM8L 1F4WL 5DJAA 3QWOA 4YHOL 3O3BA 1RZKC 5C0AA 3B6SB 4TSAH 3RDTD 1DBJL 1Z5LA 3G6JA 4LSPL 5D7IE 3PGCA 3ARDB 4L3CB 5HXMA 5GGVL 2QR0B 4PBWD 1MOEA 3NOIA 3TLRA 1BVLA 1GZPB 1WT5C 1XCTB 4G6KL 4JKPL 1KOAA 4WI6A 5H35B 4NJ9L 2EEAA 2AAVA 1NCWL 3T3PF 1KJ2H 2V2WA 3DMMA 4PJIF 3QUYA 4OF6A 3DETD 2QHRH 1QRKA 4U1JA 3REVA 2HVKA 3C6LB 1T1ZB 1DFBH 5DHVB 2H2PD 1HI6B 5GGRB 4RDQG 3BSZH 2XZCL 5D7SL 5IVXE 3VRLF 3VFGL 3B5HA 4Y4FA 3P0GB 4OD2B 3DO3A 4NKIL 1JGDA 3STLB 1T0MB 3V8CA 1T83A 1KN2L 3FAXA 4U7KA 5FGSA 3QEQE 4X7TA 2VJXA 4FFYH 1WBYA 4X0KA 3QEQA 4G8IB 2B4CL 3L3JB 2M26A 4LCUB 3ECBB 4ZFFA 1CWVA 2F19H 3TYFA 4GG6A 3QQ4A 4GAJH 5EUKB 4U31A 5EC1B 1G7LA 5IBUG 1FO0H 5SX5H 3R0NA 5HYQA 3NFNB 3B2VL 1KJ3H 3UAJD 5J7CC 5CEZL 2HJLA 4N8CH 1IT9H 1MWAB 1IFHH 4Y16B 5GJTL 5T3XD 3QUMH 3RPKA 2BOCA 3EYOB 5SX5K 4ZUWB 3B9KB 1HILB 2HN7A 1O0VA 2JB6B 4U3CA 3C09B 3CX5K 4M43L 1U8IA 1CE1L 4JPKL 2EDBA 3D87B 1BAFH 3VU2A 3H3BC 1QNZL 4KHXL 2YWYA 4J1UA 4LSSH 4QNPF 2X4RB 1NBZB 1JRHL 2EDYA 1DQQB 1FZJB 4YHZL 2GK0A 1WAAA 1GZPA 2XQBL 1HKFA 4HZAA 1OQOA 5T1DH 2X70A 3FB5A 1K2DA 4KROC 5LGHL 5IWLA 2FBJL 1WAAE 3VFSA 3RVTD 3KDMB 2MPAH 1MVUA 1W72H 1JFQH 3GM8A 1T03L 2VWEE 3WJJA 1FFNB 4LDEB 4UILL 5TFSL 4PRHA 1JUFA 3MLTB 4PG9B 4OD1H 4FQLL 4OV6F 1QZ1A 3UXFA 2CO6B 2COQA 3ZMRA 3VGBA 1DQMH 3SQBA 1WC7B 3DURA 3EYUL 4BSVA 1UQSB 3PWVB 3U30B 1QFOA 2PYEB 5EZLB 4KZEL 1A6UH 4BFBD 2R4SL 4NQED 2X9WA 1G1CA 1QD0A 2JIXB 4PRPE 3WFEH 1C16A 3QDJB 4X6DA 3B9DA 4N0YL 4PJIB 4ETYA 1AGCA 3FRPA 3IFLL 3MA9L 4HDIA 5ERWA 3RX5A 5JW3H 3VJ6A 4QYOB 3D85B 2V7HA 4OZHB 1AQDB 1TZGL 3KR3H 5DJDA 3QNZA 4Q9BA 3FN3A 3O4LE 1K9TA 3MNWB 1FRGL 3RWFA 2A6DA 3IXAA 3PP3K 3VFTA 4N1HB 3AB0C 5C0FB 2IG2L 2I07B 4POZC 3KG5A 3RJDA 3VDBA 3RIAK 3CDYA 5DJ8B 3U4EB 3OKMA 2RB8A 1J1XH 2GY5A 1GJIA 4XXDB 1GC1C 4P2RD 1KIRA 2MCPH 3WFCH 1I1RA 3TWCL 3LN5A 4N0FB 5JIPA 5GZOC 1DLFL 3NVQA 4JAMA 1PW3A 2VXQL 4L3EA 4LLMB 2VABB 3QJHA 1WFTA 3HE6D 2HG5A 3RWIB 1NC4D 1Q9KA 1EEYA 3BQUD 1S3KH 4X4ME 3DX7B 5FIEA 3RI5F 5CGYC 1QFWI 5C0IB 5KW9L 2YPVL 5DA4A 7FABH 3DYMA 3RU8L 5F9AC 3RA7L 4AL8L 3KS0H 3GSWA 4LCYA 1CD9B 4WIQA 3KDMA 3CLFL 4PJ9C 3C60B 1YY8A 1FORH 4ZD3H 1UXWA 3DVFA 2IFFL 5DJ6A 5JW4Q 4GAGL 1M4KA 2EKSA 4KKAC 4RMWA 1T20B 5D2NC 2JELH 4GW5B 3G5YB 4GW1A 3B2UC 4K8RD 3P4OB 4QHMA 3CZFB 4GQ9H 3RHWF 1QFHA 2VLJE 1F4YH 1WQVT 4TUKL 4U6HB 3IAQA 2PXYC 2WK2A 3D5OF 4FG6C 3QULA 1BD2B 3T3MF 4NZDA 5GRZA 5DRZA 4ZPTA 1FJ1A 3SKJL 3QEGL 1MHCB 4LOUC 2UWEE 2J3SA 3N1MC 1C5CL 3KXFB 5E1HB 5TF0A 4WHCA 3EJYD 2X40A 4MQXC 1A2YB 1I7ZB 2HAZA 5C0RH 1A4KA 4QOKB 4AEFA 1GAFL 4ZAKD 1X5XA 1T5XB 3DIFB 2E8YA 5CCKL 3MA7B 1YY9D 1A6VL 4WO4D 1C7SA 1FDLH 1NC2A 3MRKB 1P4LA 4L8SC 2P44B 3KLHC 5E70A 1UADC 3U6RA 2AJXL 3KGRA 1RPQA 1CGUA 4JZJA 3BGMB 5MEQB 4MJ5B 1CK0L 3WNLA 3HRPA 3MV8B 3KLAB 3PQYB 4FXGB 3SEPA 3WNMA 3ZL4L 4CDGC 2NY7H 4JEGB 3AXLB 4GBXC 4FQCH 5IQ7H 1OTTC 1I1YB 1VACB 5MI0C 3LQAC 4U7SA 1FG2A 4WW1B 1CDCA 5C0CE 1KG0B 2FX7H 3B9AA 4GO6B 4PJGF 2K3TA 1WK0A 3R1GH 1RZKH 3JTSA 1KJVB 1FBIH 2OL3H 3TA3B 1KPUA 5KSVB 2DJ4A 2FX9L 1QBLH 3H3KA 1S7QA 2MHAB 3FT4B 1RMFL 5C0AB 3IGAA 5JUEL 3GFUA 2BCKB 2R2EA 2CIIB 2QQQA 5KS9E 4GS7B 3PGCB 5I74B 1S7TA 2YZ1A 4D0CB 1NAMH 2APTA 2ZG2A 1CD1A 5DHYB 4Q9CA 1GZQB 5HHPA 1JI1A 2EDWA 4YFDB 2GJJA 4QO1A 1J12A 3H0TA 5E1AB 4Y7MA 4AJ0A 2V9TA 2XQYG 4XMKH 1B6UA 4M7LT 3SGDH 3QXAA 4TQEH 1E6OH 2WLZA 4DJMA 3MRHB 5MP6H 3IVKB 1S9VA 3OXRA 2XKUA 3OR7B 4NZTH 3NMEA 4QXGH 4BSJA 1XF2A 1R3KA 1INEL 2AJ3B 35C8L 4XMPL 4L4VE 1ZGLM 3FQNB 3MLXL 1XGTA 4OKDA 1UZ6E 2AK4D 3H9SE 1WGOA 5DJ0A 1NGXB 3V6FA 4WFGD 3C6LC 2BDNL 4N0CC 4Y5YB 4DW2L 4PLKD 1KCSH 1Y0LB 5EU6B 4NYLA 2F53D 1I8KA 3QR2A 1S78D 1I7RB 2R56L 5E4EB 3QDAA 4ZSOA 2DLFL 1A7QH 5C92A 3IDNA 2YC1B 1A6AB 3UC0L 4NZRL 4NKOA 5IVXB 1MCHA 3ROOA 1V05A 3RVVD 4Z78B 2G75A 2QTEA 5I19L 3MJGX 3FKUS 1XF1A 2PYED 3IDGA 4WI5A 4X4XB 4AEIH 1WCBA 1EGJL 1I7UA 3D2UB 4MXWL 1QLEL 4MNHB 4OUUB 3CGTA 4LBEA 1LGVA 4JHWH 4U6VH 4PGDA 4OGZA 2DMKA 1LO3L 3WDHA 2X4TA 1X4XA 1ED3B 2DQGL 4P3DA 1NGZA 3LKPB 4KMLB 1NL0H 2FSEB 2D4DA 3QISA 3L3OB 1RK0B 2R56H 3EOBA 3A0OA 2CK0H 4DN3H 2UZXB 5BZDB 4PB9L 4N5EC 2UZIH 5HDBF 4XCNB 3GSRA 4Y5XB 4L4JA 2K1MA 3SJVD 5DQ9B 2EC8A 1I1AC 4DK3A 1KFAL 5HYSB 4XGZA 5E1AA 1KT2A 1LILA 2XNAB 1FQ9C 4U1GC 3HC4L 5F89B 1N59B 4U1GB 1AKJA 4G6JL 1IBGL 4JDTL 3DGGA 1S7SA 4AM0A 4OV5B 2UWEA 1CT8A 3HAEH 3TCLB 1E4WL 3U46A 1A6TB 1I1AB 1R5IA 3MODH 2M8XA 2ID5A 3C6SA 3SQOH 4HX1B 3HI6L 4R90H 4R8WL 2R1XB 2VZTA 5TE7L 3CVHA 4D3CL 4P9HC 4HUKB 1R3IH 1M7XA 2W1NA 3B9EA 4C58B 1QPXA 4UZGA 1V7NH 4GXVH 4GT7A 5ISZB 5CEZE 4N8VA 3OGCB 5IMKA 3SKUD 4G5ZL 4ZMAT 4JO4H 5EZJA 3T2NL 1J88A 1IKNC 4XVSL 3MNVA 1NC2B 5FKAB 3CLEL 3IB4A 3LKNA 3TN0A 3HMXH 1T22A 4U6HA 3S37X 3H42H 2X44D 3OKDB 3IKKA 4RRPA 2WANA 2DBJA 5EO0A 4DCQB 4UNUA 3S35H 3OSKA 4V1DB 3Q3GA 2MMXA 3X12B 1R5VA 3WNPA 5EIIA 1AHWC 3S35X 4MJID 5D2LF 4X4MA 1O7VA 1UKSA 2DI8A 3NA9L 1T1WA 1QLRA 3OQ3B 3FHAA 2VNCA 5DD1H 1I1FB 5J1SC 4XPTH 2FR4A 2DQEL 2BNQB 1KACB 4WO4B 4Z76A 3RKDD 3ZYJA 4K3JL 1EHLL 2D3VA 3T65B 3MCG1 3VFWA 3HUJB 5DHXB 4U33A 5C86A 3IDJA 4XXCC 1OAUL 3Q6FA 4JFHE 3BZ4A 3QSKB 5SWQA 1WAAF 2QEJA 3EO9H 3TZVA 4LLDB 4EOWH 2MQ3A 1KC5L 1RUML 4FS0A 2D7TH 1WEJL 4TSBL 4JPKH 1J10A 1OGTB 1ACZA 2FEDD 1KCUH 1CLOL 2C1PA 4D8PB 5I9QC 4MNQE 1AP2A 2XXMB 1K8DA 2DDQL 5EUOB 5DD1L 3CPLA 3C8HA 1JRHH 1AO7D 4JFDE 3CFEB 3RWEB 1KLUA 4EN3C 1A1OA 3EFDH 4TYUA 3EJYC 2Y7QA 4G7YL 3P9WB 2HH0L 1LD9B 1S7UB 3MR9B 4LLAA 4P3CH 1RZGB 4MYWB 4EOWL 1YYLL 1AR1C 4R7DB 3RJQB 1GC1H 2LQRA 4CVXB 3NIDE 2VAAB 3LSOB 4X6DF 3OGCA 1EGJA 2A83A 1Q72L 2O61A 2YD8A 2NMSA 4H8WC 4Y5XC 3BH8B 3HG1A 4MD5A 5J11B 4I48B 2G75B 3ZLQC 1TQBC 1B0RB 4LP4A </