1IC5H

Crystal structure of hyhel-10 fv mutant(hd99a)-hen lysozyme complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWAGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic5H00
5TPWL 1ADQH 2AS5M 1WBXA 3O6KL 5TDOA 1A4JA 3AM8A 4PRAB 2WM0A 3LEVH 2Q8BH 1BIHA 3DNKA 1G0XA 4PJXA 3O2VH 2AEWA 5TE7L 3BYYA 5J06A 5L7XH 4J12A 1S7TB 4OKVA 3C5ZB 4KY1H 3VXRE 3IVKB 3IGAA 3IXAB 4G3YH 4YK4C 4GMSL 5IW6A 5TQ2L 3S96B 1D5XB 5JZ7C 3ZTNH 5JHDA 3ZO0A 4AL8H 3K4DA 1F13A 3VI3F 4F7TB 3VI4E 2BVPB 4R4FL 1F2XK 1FFPB 3KPSA 3DX6A 4H25A 4YHPA 5T1LD 1M7XA 3MGAA 1BWWA 3EO9H 1ND0A 1BM3H 2VOTA 2UZXB 3SGEI 1G7JA 1TJHL 4DKDC 3QBTB 4DOHB 4GKSB 3UPRA 1LWRA 4NQDD 5HHXH 5J9PA 2VB5A 1QBLL 4HJJL 5KTEH 4ESKA 4B53A 2I9LA 5EWIL 3VD7A 1T4KA 3NA4A 5IFJA 1DQQB 4U6XB 1VFBB 4HWZA 4S1SL 3KXFA 4QRPE 1LO3L 3P0VH 4PJFE 3ZTJH 3DYPA 4G8IB 1IEBB 4Q2ZB 4WJ5B 4QGYA 3TIEB 4KDTC 3S9DB 1S3KH 3BKJL 5D93B 1NC4D 4XPBH 4OZFG 1RHFA 3O4OB 3MGTA 5E56A 3ULVE 4R90L 2FEEI 3D18A 4G80A 3VMOA 1GZPA 4KJWD 1WSST 2Z31B 5K9QI 1M7DB 4TSCL 4JFXA 3DX6B 4MSWA 2YPLE 2MCPL 3E2HC 3VGGA 3BZEB 2PKDA 2FO4B 1MRDL 1FFOA 3UBXB 1IZKA 1EK3A 1QO3B 3T3PE 4WHTA 3W5NA 3EFFA 3S88L 5CGMA 3BD3A 3IFOB 2DN7A 1O0VA 3SQOL 2X7LB 2JIXA 4ZFZA 5IHZB 4PJ5E 1XGPA 2E5EA 5GS0H 3A67L 4AEIH 3VXOB 1S5HA 2VISA 4TVPD 4ONHB 1XCQB 4HWZB 3KXFB 2YPKA 1BQLL 1YJDL 1VFMA 3H42H 1N6VA 4LPXA 1KGCE 4NRXA 4NCDA 1ZA3A 1ZVYA 4YR6B 4G8FB 1NCNA 3MGTB 4PTTA 1X4XA 3SDXE 1WFTA 2V2XA 1NANI 3CFJB 1DZBA 2F19H 3J7HA 1GZPB 1YY8B 3B9AA 5DJ2A 4WY7H 1P7QA 5ICZA 2DM4A 3K2UH 4JFXB 4N9GB 2XXMB 1BX2B 5FYKL 2PW1A 4FMFA 2VL4A 2ZCKH 5CBAB 1NAMH 5B39A 3MV11 1I1RA 1YY9D 1DEDA 1J8HA 3QQ3B 5LGJA 4IOIA 1CFSB 3ALWA 1NKRA 4CVXA 1BJ8A 1V7NL 4Z7OE 3HPLA 2ZSWB 4NT6A 1K85A 4WO4A 2H2PD 2JIXB 1R5WA 2WLYA 3LKRA 5E70A 5IIEB 1S5HB 4M6NH 1JVKA 4HC1L 5CD3A 1GGUA 5DQJA 4Z7NE 4DVRL 4BK5A 1I8IA 5JOPD 4NRXB 4FFWC 1G1CA 4XPFL 1F90H 3QJFA 1WGOA 5C0FB 4ODXA 4RGMB 3C5ZC 5F6HJ 3CVHL 1ZHKB 3BVNB 2V2XB 3EGSB 2AK4E 4GW5B 2RFXB 4A2LA 3BSZH 3T8XA 3AS2A 5HI4D 3MRBB 3GSWA 4KUZL 3WLBB 1JN6B 5JXAH 1Q9KA 4IRSA 5C0RH 3UZQA 2VZ3A 1I7TB 4M02A 1JGLL 4UTAH 3NN8A 4JFQB 1JGVH 1XF4B 2OTPA 2Y07H 3WS6A 4KZEL 4NT6B 1RIVH 4U4BA 1FRGL 3GMRB 2AXGB 3PG2A 4JCLA 3LKRB 4V1DD 3S98A 3E6HA 1IARB 1S7WB 3NPZB 4QTIH 1BJMA 5C0AE 2V5SA 4PJAA 3AM8C 4E42A 2RJMA 3FB8B 4LU5L 3QDJA 4I18A 2OZ4L 1UKSA 3BD5A 2HT2C 2Z93A 2CKBH 2J6EL 2COQA 2KUTA 4P59H 2VRAA 5EOCH 3KVQA 3RIFK 2FHFA 2EO9A 5EUOA 3SGKA 4MA7L 2MKWA 5GSRA 4IRJB 1XF5A 3FOLB 1FL6A 2LV4A 4ODUA 4NZJA 5AZEH 5C6WH 5D93C 2DLFH 1QHPA 2FYYB 3O4OC 5DJAA 1T7XA 3HG1A 3TBSB 4XH2B 4GG8B 2XV6B 4J3TA 2Z31C 5EBLA 2CGRL 5DRNB 1HXYB 2EDEA 3STZB 5I30L 4LLWB 3NCYP 3TBWA 4D9RE 3HNSH 5GS3A 4C4KT 4PJBB 4PY8J 1KCUH 5FUCC 4M5ZL 5B4MD 2VE6B 1AGDA 1G7QB 3NIGF 4I18B 5CEYA 1FPTH 3BEVA 1WT5A 3L3GA 3FAWA 1KCVL 4POZC 3CLEH 5D7SL 5FKAB 4ZMAT 1HSBB 3VA2C 2DYPD 1B0WA 3T0XA 4RA0C 5IESL 3KS0H 4OQTL 1UB5A 4LMQI 1EVUA 1I1AB 4OZFB 3GI8H 3DRQB 4NO5B 1XF5B 4XWGL 2DQJH 5DK0A 1I8LA 3HMWL 4ODUB 1OQOA 5GS1A 1E27B 1MPAL 2IFFL 2AJZB 2YRLA 4AIZA 5DJAB 3BE1H 3O3UN 1FL3A 2HJLA 5I1KH 3ULUE 3RGVA 1IC5H 2J4WH 3QNXB 4F80A 5BO1L 1KTKE 4OCYL 4XXDB 5EBLB 3SE9L 3FQXA 4YXHH 4P5TA 2H3NB 4MWFB 3PL6D 1I1YB 1NCDH 3D25A 1NCWH 4JZJA 4NP4L 3VXRA 5DSCA 1BD2E 1I9JH 1MFNA 3WIIL 5EA0H 4NO3B 1YC8A 4C57C 4X6BA 1KV3A 2A9ML 1N6QH 3X3GL 1TZHA 3WJJA 3I6LE 5J6HA 4KHXH 3HNTH 2WP3O 4OFIA 3BP7B 4ISVA 4ODHH 3AVEA 4TUOA 1NANH 3TBVB 4OLVH 1I9RH 5KOVC 5BXFA 4F15B 3MZTA 2D7NA 4Y4HA 2P5ED 4RISH 2UY7A 4JQVC 2NY5L 1WAAA 3ZKNC 1EAJA 1WC7A 4RGMC 1R3LA 1QFWL 2P8LB 3BZ4B 2B4CL 3I3BA 2HJLB 4H1LH 1BVKB 5DQ9B 2NY1B 5KJRH 5ESVA 5CZKA 1GPOH 1IJ9A 1NJ9A 1A7RL 1DANT 2XZAH 4OCWL 1P4LA 4RX4A 5F7EL 3TNMA 3D25B 2AAVA 4NQSA 2FZ3B 1HYRC 1MWAA 3VXRB 4W4NA 4PJFA 3BISA 2Q6WA 3FO1A 5F89A 5E8NA 4U6YB 4F37F 4EXKA 5KBNC 4I4WB 4MLIA 1L6ZA 1RULH 3IFLH 4YE4H 3HE7B 4KTDH 3C6LA 2ZWLT 5C9JB 3SKUD 3WHE1 1QSFB 5KANI 4UNUA 2E9BA 3WL9A 1FVDA 3BXNB 3ARUA 5CJXA 1OPGL 4PJ8A 4Y4HB 2YPLA 1P69B 1LE5A 4JFYA 1GRWA 1JTOA 3MJ7A 2ADJB 3DSFL 4G7VL 4L3EA 2GY5A 5ITBL 1KN4L 1WC7B 3QCTH 4UV4L 4OLUL 2NY7L 5HYJE 1OTSD 5FYJE 4PJ5A 3ZYJA 5A16A 4RWYL 5ALCH 3FFCE 4WTZG 1P4LB 5DHVH 4QCIB 4ZO7A 4IRSC 4QRPB 1CG9A 1Q9WB 4IOSD 5CD5D 1ADQA 4JAMB 4HKBA 5F89B 4HMEA 5DEZA 3DJ9A 5JORA 3EJYC 1JBJA 4PJHF 3TT1H 3V6FA 3V52H 1S9XA 4POUB 2VXSL 3MRMA 4QOKE 5SWSD 3SDXA 1MHHB 3Q0HA 3MV8D 1PX4A 1UYWH 4HK3N 2IJ0C 1UGNA 1FVDB 3MLXH 4WI8A 5C07D 1WCQA 2DKSA 3T65A 3FT3A 4OZHE 4I18C 4PJ8B 5I0DA 2YPLB 1FNFA 4RMQA 1YUHB 1KB9J 2C3VA 1UZ6F 4PJEE 4HS6B 1XZ0A 3F8UB 1GHFH 5ESAB 2AJYH 4WUUD 2Q8AL 3PWVB 3SGKC 3WE6B 1A22B 4EIZC 4JRXE 4UUJA 3LPFA 4QY8B 3AY4A 4LCWE 2GJ6D 1CFTA 4FFYH 4OI7A 2NTFB 3LCYA 4YPGB 1CG9B 4P4KB 4D9QE 4G7YL 4PRHD 5FO7B 3FL7A 4LOUD 2BNQD 4NJAL 3V6FB 4XPAL 2CJUL 5J89A 4EBQL 3SDXB 5I16A 5JMRA 5HI5D 3VXME 4OFYA 2AK4A 3I6GB 3BOVA 2X5PA 4OB5H 2E8ZA 4Q0XH 1HINL 2F9BT 2AXFA 3FT3B 4Y2DA 5E9DB 1V7MH 5EOTB 5HGBA 1WT5C 5BS0A 1MHEA 1U3ZA 1TCMA 2C3VB 2ITDB 2CQVA 3CC5A 4NO0A 2XTJE 3C60D 3T2OA 2NW2B 5EIIB 3VD3A 1VEPA 1X6LA 3FZUD 2H45A 1DLHB 1RHHA 4F15C 4DKFH 5IT2H 1NCTA 1T5WB 1CFBA 3SCMD 3VA6A 2P42B 1INDH 4WGWB 1RUML 5JW4M 2VJXA 5GS1C 5F1SA 4LLAA 5I1CH 2BFVH 3JTSA 2AVGA 4UNVA 1UCBH 5HYQB 4PV9B 12E8H 1CXKA 2NY1C 4WCYH 5JQHC 4ODVL 4B41A 5HD8D 4S1QL 2B1HH 3L3HB 4Z7WF 4XZUA 2C26A 1OSPH 4OUUA 2AK4B 1LEKB 3QDMD 5LGKA 4P99A 3KYNB 3KR3H 3QFJE 1MJUL 4Y2DB 5HGBB 4CU8A 1RSFA 3EJZC 3MV9E 3D39D 3HE7C 4J4PC 3BT2H 1Q1JH 1T20B 1ODAA 2XYCA 1FNLA 4JO3H 3MBEB 5DD5H 1WFUA 2BHZA 1AGCA 1OF2B 4JY4B 1EXUA 3D0LA 3VXPA 2I60H 2R29H 1OAZH 4Y4HC 4HCRH 3NIDE 3EYSL 1UZ8B 2X4PA 4PJDF 4PLKD 5C0AB 4Y5XA 4K8RC 3WO4B 5IHLB 3PDDA 5LQBL 4WEUD 3BDYH 1P4IH 2B1AL 4WTZA 1J0KA 1U8IA 4M1GL 1NAMA 3QXTA 1FGVL 5JOFA 1IQWH 1IC4H 1SJXA 3IFNL 3RWJA 5TH2A 5DJZA 3O0RL 2NMSA 2VKXA 5L9DL 5F8RC 3QEHB 1YNLL 4TVSa 3BESR 4DW2H 5HGHB 2ORBH 1MAKA 3HRPA 4OCSH 1LNUA 4GXVL 3THML 2BSTB 3DTXB 3EOBA 3UJIL 2R2CA 1ES0A 3E8UL 1U8KA 3U30B 4NKMA 5EN2B 5TFSH 4WW1B 3FONB 3PHQB 1S9YB 1HDMA 1QD0A 2KL6A 1JGUL 2NY0D 3LEVL 2Q8BL 1Q8MA 4OZIE 4PJ8C 3VD4A 15C8H 3O2VL 1EFXA 4HHAB 1BD2A 5L7XL 3GO1L 4WU7B 5T5NG 3HPJB 1EEYA 1LP9E 3X11A 4Q7DA 5JR1L 3BGFB 1M71B 4G3YL 4GJTB 1NSNL 4HMCA 1SYSA 1HI6B 2NX5D 5FGBA 2PYED 3NAAL 5I1EH 2NR6D 3H7BB 5IFAH 2X89D 3OR7A 4DZ8A 1LNUB 1EJOH 4EVNA 1I4FB 4GRLA 1J0HA 1NCCL 5BQ7A 4S11A 1U8HA 4Z77B 4HWBL 3K8KA 2OR7A 4NKMB 1Q72H 1U3HB 2CKBA 1KLGB 1HDMB 1N0LA 1BM3L 1XR8A 2KZWA 1H8NA 4R3SA 1N64H 4PJCE 3RI5F 2LU7A 5INDA 3WNNA 1CLYL 5D1ZD 2VZVA 5KTEL 1FORH 3Q6FB 1XAUA 1EFXB 2D7MA 3SDYL 3RZCB 2ADGB 2DWDA 4L8DA 1EZVX 3OKLA 4ZXBB 1L9NA 5FHAH 2VUOA 4W70A 4JQIH 4NN5B 2E7HA 3P0VL 2J1KA 1KIPA 1C5BH 5CBEA 4ZS7L 2AK1H 2ZUXA 2PTVA 4I1NB 3F62A 3MRLA 2C3XA 5FO9B 2D4DA 2P5WD 3T0VA 4P3WA 2XPGB 3HMXL 4K9EC 3QWRD 4HGMA 3EJJX 2DRUA 3OR7B 2IQ9H 2QL1A 4ODSL 4P9HH 3ILPA 3JTTA 1T03H 4YDLB 2WSKA 4FQHA 4LCUB 2AQ3A 3QUYA 4Y5YB 5HYJA 2XWJB 5C0GA 1EFQA 5DT1L 1P7HL 4NSKB 4R3SB 4F7CA 4JG1H 1EGJH 3FFCA 1G6RL 4PRNA 4Y2DC 5DYOB 2UY6A 5IMOA 1FE8L 5T5FL 5BJTB 3L5HA 3MBEC 3HC0A 3IU3B 3MOQA 1S9WA 5IQ7H 2CLVA 2VZOA 4X5XA 3TVMA 4JKPH 3CXDH 1VKXA 4QOKA 4FQ1H 3OAUL 3V4UH 1NUGA 5ID0A 2NTSP 4N90D 3FOMB 3MRLB 3K81A 3FQNB 5D1XD 2P24A 3H9SE 4TNVF 1SY6H 3L5WB 4F2MA 3WO4C 4BQCA 3NPSB 1RURH 2VWEC 4OZHA 1JUFA 2F19L 1IGJB 4U1SB 2AXHA 4NQUA 3MJ9H 1UH3A 5IVZA 3HE6A 4PJEA 4WY7L 3WHE0 5E6IA 2QKIB 3V6ZA 1D3CA 2GSIA 4GAYB 1CDBA 1HWGB 1N26A 2IQAB 2P7TB 2QLVB 2ZCKL 5HYJB 3HFMH 5C0GB 4PD4K 5L8JB 4PGDA 3GKZA 4LCWA 1BAFL 1RFDH 2K3TA 3FFCB 4PRNB 3OG6B 5DC9B 2HMIC 5IMOB 3WUZA 2BOCA 3U30C 3QDAA 3O11B 2O5YH 3HC0B 4DAGL 1RIUH 1S9WB 4NPYA 4Z78B 3MOBL 3TVMB 4LLQA 3P2TA 5HY9A 3QG6A 1BIIB 4NOFA 1KCSH 4YO0B 3ARED 1IZJA 4H1LA 2H1PL 3CLFH 2N56A 2HFTA 2BVQA 2V2WA 2VIRB 4DVBA 1B6DA 5ECJE 5AZ2L 4BFEA 4OZHB 3V0VA 1CLOL 3GSQB 4P2RD 5J8OA 5J57B 3BGFC 2UWEA 1NCBL 3HE6B 3O6MH 4QF1A 3TZVD 1RZKH 1G7LB 1QQDB 1OTUD 3VFSA 3BHBB 4I3RH 2R0LL 5C0RL 4RWHA 4JRXB 4W4OC 1QBML 4RRPG 4LCWB 1CGTA 4ZFOA 1ULVA 1JGVL 3C9NB 4MQ7B 35C8H 2XY2A 1RIVL 2BOCB 2IBGA 5SX4I 5DFVD 4LLUA 1TETL 3LN5B 1IM9B 3ULUC 4QTIL 2LFGA 5F3BA 2R9HD 1KC5L 1Q94B 1ZWIB 4JQXA 4L4JA 1EHAA 5LXGL 3B6SA 4EI5A 4YDKH 3VXMB 3MOAH 3LKNB 1IL1A 4P59L 5E8EB 1GSMA 5EOCL 3VD9A 3RZCC 5J56B 4XC1L 4DVBB 4XBGB 4JKWA 1FZJB 3QFJA 4ZXBC 5A2IH 4NUJA 4JPIB 4PGBB 1F3RB 3MV9A 4NN5C 1H0DA 3MLSH 4PLOB 4QF1B 1T2XA 3EYUH 3MSPA 5GJTH 4LGPB 3VFSB 5IG7A 5EUKB 4K7FA 2V6HA 1W0VB 2GUOB 5CLWA 4HXAH 4HG4J 3L3IB 5TQ0L 2LU4A 4D9LH 1E4XI 1CWVA 2GK0B 4R96A 3C08H 3P4MA 1O5DT 5MERB 3WDJA 1S7VB 2VABB 1TQCB 1AHWA 1E4WH 3EDJA 3HNSL 1DBJL 4Y5YC 5F6IB 4I0PA 2OCFD 1QVOA 2V7HB 3IU4L 3L5JA 5M94B 4CW1A 2HJFB 4Q6IA 5DJCA 5J12B 3B6SB 5T1KA 4YJZL 3CLEL 4MD0B 1IL1B 3DMMD 2VLRB 4DTGL 3WFHB 3OGCB 4OV5B 5D2LF 1T80A 3QHZH 5E0QA 5IM7A 4RGOL 1FNAA 5C3LD 3NIFE 2F74B 1T83A 3CPLA 2ZPKH 4FQXB 3Q6GH 5D8JH 3U0PA 1W0WB 3KJ6L 4X6DF 2W65B 4P46D 4LASH 4UBDD 4UDTA 2YPVH 2DQJL 1N8ZB 4YXLH 1S7XA 4JB9H 4ZOEA 3VFMA 3W39A 1IEAA 2F5BH 4K7FB 5A3ID 4QHMB 5IR1A 2CLZA 1SJEA 2ED9A 3BE1L 3F5WA 1EV2E 3MRKA 3NPSC 3WFEH 1QFUH 5IWLC 2DJ4A 4DK3A 1IC5L 2B2XH 1S7SA 3TWCH 1IKNC 3BPCA 3GJFB 5AAMA 1NCWL 2A6KB 1LP9A 3GBNH 1J5OL 4I0PB 4HBCL 1KT2B 1I9JL 1QTYT 4Q6IB 3CK0H 5H37G 4DGIH 2BOBA 2R0WH 3CFEB 1N6QL 3GDBA 1A2YA 3QIBA 4OI9A 1Z3GH 1DQTA 5LAXA 2FB4H 4HIIA 3FHQA 3FN3A 4ODHL 2VDOH 4J8RA 4JPVH 1H5BA 1MVFA 4OLVL 3TVMC 4OFKA 3LH2H 3BD4A 2VLJA 2BHUA 5I66B 5D72H 3HI6H 1MJ8H 2GITB 4PRPD 3S5LA 4KRNA 1J1XH 5JW4Q 3LY6A 1IEAB 1LD9A 1NGWB 3TYFB 1I9IH 4PJCA 4QGTA 1HOCB 4OZIB 1BZ7A 3MRKB 2X9XA 3HHRB 4X6CF 4OCLC 3TNNA 5C7XH 1ZLWH 5D7IE 3HE6C 1S7SB 4PRBA 1UENA 3O9WD 3BPCB 1F4WL 5E8PA 1LEGA 1XGYL 4TULH 2YUWA 1M1SA 4HGKC 4F9PA 2YWYA 2IAMA 4OIAA 2O5ZH 3PXHA 3BN9C 1Z9LA 1JHKL 4D0BA 1IGIH 3EOYG 2HT3D 3IFLL 3MNWB 4YE4L 4KTDL 1F4XL 4HCRA 4K8RH 1CD1A 4HFWA 3MA9H 1HKFA 2VLKD 4J8RB 2AKRB 4YHMH 3WSQL 2V2TA 3V0WL 3BPNC 2WUCH 1U3YA 3MROA 1M7IA 3TLRA 3E1F1 1ZGLP 3GSXA 1KCRH 2DS4A 2W9EL 4PFEA 1ZVSB 2ZG1A 2C4FT 4UB0H 4AYFA 3KYKH 2E6JA 4PJCB 1OAKL 3QCTL 1JF6A 4JZOA 3SKJH 3BIKA 1A6WL 1BZ7B 5GGRB 5BZWB 7FABH 5GGTA 1RU9L 4KJPD 2QQLH 3PP4H 1JE6A 1S78D 4APQD 3UTQA 4Z0XA 3KPPB 3NA9L 5CIPH 1PSKH 1SEQH 3NH7L 4WU5A 1OWRM 1CGSH 2HWZH 2BXZA 1W72L 2OM5A 4RNRA 1K5NB 4GRMB 5DVMA 3T2NH 4KKCC 4XCYB 3TT1L 1AKJA 4I3GA 4YDIL 3H9SA 4FQ2L 4NFBA 1TQCC 3PWPB 5F6IC 1S7QA 5I1AB 3O4LD 5I76B 2QQNH 3MLXL 3P77A 1PEZA 3GSXB 4JQXC 3DV4B 5J12C 4LCYA 4EI5C 4YX2H 2QADD 1GOFA 3O8XB 1J12A 1AQKH 4PJGE 5KZCB 3MUZ1 1GHFL 2AJYL 4Z5RA 1G7PB 1MCNA 2VAAB 3BIKB 5IHUL 4PB0H 1E4XH 2VDPL 1G9NH 1DFBH 1OGAE 3CMGA 1MHCB 3C8DA 4NRZB 4JANA 4FFYL 4MD5A 4N9OB 5F3HB 1CIUA 3HR5B 1FAKT 3PV6A 4BQBA 5IB2B 5EG6C 3LQZA 4L9DA 2I5YH 3H9SB 2NXYB 1MEXH 1A9EB 3ZE1F 4I0PC 1CFQA 3HZKA 3PQYD 5H35B 1RZIA 3T77A 4ZUWB 4OB5L 4MXQD 4Q6IC 3LKOA 2HN7A 3NABH 1O7VA 2YXMA 3JWDH 1SJHA 4ZTOL 1BZ9B 3UC0H 2ATPA 4TQEH 5IJVA 3N85L 3OKEA 4CU7A 3DXAE 4ZNCD 4JHAL 1INDL 1PYWA 1J1PL 2BFVL 2FGWH 1ZEAH 4GMTL 2ZUWA 1C16B 4XAKD 5IB5B 1CD9B 1UCBL 3KPMB 4R4BA 2UVEA 3BP4B 3DRTB 1JNNL 4KI1A 4NZRH 1G7HA 4WCYL 4G6KL 3VXTA 5ABDE 4L1HA 2EKSB 3MLRH 1RJLA 3ZSSA 3S4SG 1EGJA 4WFEE 3MO1A 4PJHE 2C1PA 3DVFA 5DRXA 3HZKB 5IEKA 3MRPA 2EDLA 5FYKD 3PIQB 2YHGA 3TO4A 3MRIA 2CH8A 5EO0B 4CNIA 4WI5A 4TRPL 3LKOB 1C7TA 2AGJL 4O58L 3ARXA 2UYLA 5DA4A 5DD5L 4OGZA 1A7QH 1SJHB 1TJGL 4OAWB 3JWOH 3JXAA 5CMAA 1SY6A 1A14L 1OAZL 2PR4H 2RHEA 1FNGA 1HQ4A 1A7PL 2O5XH 4HJGB 4LVOB 2FJHA 5B21A 4ZUTA 1RZJC 4PRID 3MJ9A 2WWMD 1BBJB 3TF7C 2WAHA 4BH7A 1PYWB 3RUGF 2BHYA 4K3DL 5HHOE 3BDYL 1YEFH 2V5YA 4Q9CA 1P4IL 4G9FA 4R4BB 2A74A 4CVZA 3VXNA 4XMPL 1RJLB 1IC4L 3WXVH 3C8HA 1DEEB 1WCBA 3L95B 3GB7A 4MNQD 3QUMH 2C1PB 1BBDL 3TYGH 5IEKB 5ICXA 3MRPB 4XPGH 2B5IB 3C5SA 2IEPA 2C4FU 3TO4B 3IDMA 3BGAA 4PP1C 4CNIB 4EDXA 1T66D 3ZT7A 1OQXA 4PG2A 2FEDD 3ZT6A 5IMLA 4XI5D 2UYLB 5GSVB 5JHDD 5KVGL 1JPST 4NQEB 4NRYB 1VADA 2CR3A 5ETUA 2GAZA 2VNCA 2VN7A 4WUKH 2C7UA 1ACYL 1HQ4B 1W8NA 4M3KB 2FJHB 4TVPH 5ADOL 2I07A 3O8XC 3SDDA 4BFBD 1K4CA 3H3BC 5CGTA 2XKSA 1JNJA 1H3XA 3HZYA 3MMEB 4Y4KA 1GIGH 4MB4A 2QR0B 4JFZH 2W0FB 5CSZA 5MEQB 2EDFA 2A74B 4CVZB 5LWYL 3DBXB 3LRSA 3VXNB 4JO4L 2WBWB 4CRPA 3F6LA 4IHOB 3GB7B 1UM6H 2FSEA 3S37H 2VDNL 5IFAL 1KYOK 5I8KL 3TT3H 1ZAGA 4C59B 2OJZL 1MUJB 2NY4D 2UUDH 3QFDA 5IMLB 2NXYC 1BJ1H 5FF6B 3IJYA 1A7NH 4LFHD 3AAZB 1VADB 4AG4L 4RAUB 5D7IA 1N64L 5FM8A 4NCC1 4XNMB 1F5WA 4AZ8A 2CRZA 4F9LA 1FNHA 2IWGA 4I0CC 3S34L 3PUCA 1FORL 5F96H 2BVOA 1DR9A 3SDDB 4HUVA 1CBVH 1ZLWK 1SEBA 3HZYB 5BZDB 4PJDE 4JQIL 4ZUVB 1CGYA 2OLDA 3QIUD 4GBXB 4JRYE 2OL3H 3FB6B 4L4TB 1C5BL 3LRSB 2X4UA 2AK1L 2EDNA 4NQDE 4U1KB 2PO6D 2IPUK 3BJ91 3AUVA 1OGTA 2YN3A 4BYHA 4JFFA 2FSEB 5E2TH 3OBAA 3IDGB 4J1UA 1D5MA 5I1IL 3S4SA 2R69H 2BVTA 1MCKA 2V9TA 1CK0H 2PXYB 2YD2A 2XN9D 3LQAH 5I1HL 4K3EH 4ZFFA 2CD0A 3OMZA 3QFDB 3ZL4H 2N4IA 2H2SC 1KELL 4TPRL 3VMPA 5DRZB 4IBLT 3SY0B 2Q7YB 5E1HB 3NZ8A 3ARDD 4E41A 5C09A 3RU8H 5I18H 3ZYIA 1YNTB 3KPRE 3FRUB 1IGCH 2X1XR 4EN3B 1XGQA 5EU7E 2EH7H 4GG6E 3MFFA 3RWHA 1DBKL 4F8TA 5IQ7L 3MRHA 4X4YB 4JKPL 4RIRB 1J7VR 1CDUA 3RNQA 2F54A 4LVOC 1KG0A 1E4JA 2G60H 4M7JL 4OT1L 1GVIA 4Z95L 1FZOA 4IRZL 4OLZH 3G08A 1P2CB 4J1UB 1U8QA 3QH3A 2FBJH 2IH1A 4TVPE 5FOBA 4LCCA 3S4SB 4KVCH 4WI2A 3B9VA 1C08A 4PJGA 4QYOA 4JM2A 1CDYA 4UIKL 2EIZA 4WI3A 4DUVA 5I8CB 2B5IC 1OGAA 2F58H 3TO4C 1U93B 1PG7H 4N0CD 3UYRL 2D7PA 3NFSL 1RFDL 4LRIC 4ZFGH 4YWGH 5ILTH 2Z91A 2EXYD 4UTBL 3B5TA 5E08H 1U6AH 4LVEA 4L1DA 5JDJA 4D3CH 2EDYA 1I3GH 4PBXA 4KAQL 1JNLH 3INUL 4GW4A 3ARFB 5HGDB 4I9WD 1KCSL 1HYSD 1C5DA 4L8SA 2NXZD 4HD9A 4W68A 1UVQB 4YEFA 4GAFB 3C87A 2IH1B 3SPVA 1JHTA 3ARVA 5JOPE 4KMTH 2HRLA 4NHUB 1RZKL 4PJGB 4POYA 4JM2B 1PVHA 1QFHA 3C2AL 4HV8A 2EIZB 1IRAY 1X7QB 1BLNB 4MJID 5ESQA 4CDGC 3R8BB 3DXAA 4NBYB 1YNKH 3M17B 3MUJA 4PPTA 1NFKA 5CEZE 1V3LA 2EYRB 1MLCA 1S7RB 1OAYH 2LU3A 4OTXL 3VFNB 4R97B 3FQWA 3HN3A 5DJXA 3A6BH 1TDQA 4X0KB 4JGMA 5T1DL 1E6JL 3SBWA 4CGTA 2YD1A 2O26U 5IMMA 4YDKL 1C5DB 5TDNA 4XP1H 1OD9A 2J8UF 3SDDC 3VFWA 4AEFA 1DSFL 4V1DE 1DDHA 1PQZA 2FWOB 1C12A 1CICA 5CIPA 1NH6A 3ECBB 3MUGB 1TCRB 3KNBB 4HDIB 4J3UA 1EEZA 1MFDH 2VDMH 1K2DA 1VCAA 2ZOKB 4GBXC 3MLSL 5C86A 4M7KH 3CMOH 4IDLA 4X9GA 5GRJL 3EYUL 5CGYC 1AQDB 1CDHA 1H15B 2HKFH 4LQFL 4OF8A 5GJTL 5KSVB 2A2QT 3UPAA 5AWNH 1PGRB 5M7QA 4Y19B 4ELKA 1JNHB 1X5KA 4NZTH 5ESQB 2X4RA 5E94A 5CP7B 4HKXA 4D9LL 2PXYC 5GRZA 3OJ2C 1ZLSH 4OD1H 1MCLA 5CJOH 5HHOA 4EI6B 2W60B 5I8EB 5DMJB 5MEND 1CR9H 3RGVD 2QHLA 1NPUA 2LVEA 4U1LA 4PJHB 4HFUL 1CQYA 4MHHG 4EN3C 3VFWB 3HCVA 3GSVB 2NQCA 1LE9A 3QHZL 3TBTB 2DQHH 3KPNB 1Y18B 1EAPA 1PLGH 5GRVL 5L8KB 5DK2A 1EEZB 5D8JL 4YZFF 3OGOE 4OD2A 5GIRB 2DWEA 4OLXH 3D0VA 4HUNB 3QO0A 1ZSDA 5DO2D 2YPVL 3V5HB 1J11A 3L7FA 2ZSVB 1D6VL 4HPOL 4D0DB 3B3IA 4M61A 2Y5TA 1FNEA 4YGVB 3MODL 3WFEL 1QFUL 2X4RB 1J9CT 3D2UA 3LPGA 4OV6F 4YHOH 1UWGH 3IAGC 2B2XL 2Y6SD 5HBBA 4Y16B 2Y36H 3EOAA 2DIJA 5B3JE 1XT5A 4S1DD 1XF2A 3EDDA 5HHOB 2BCKB 5HHNA 5MP6H 3NMEA 3BWAA 2H32B 1F02I 4U1GB 4LDOB 3BYTA 2OTWB 3ZHDA 2BSED 1C1EH 2D7TL 4X7TB 3RL2A 2CRYA 5FK9B 1W0YT 4CVWA 3IDYB 1FVEB 3WHXB 4Q58C 4MZ3A 1Y0LA 2FJFA 4JPVL 1EAPB 4U1JB 4LSTL 2D0HA 2ITCA 5FA4B 5J1AA 4LHJB 5DK2B 4OZGE 4Z9KB 4DFHA 1A6TA 3ARFC 4OD2B 5CZXD 2DWEB 3QO0B 4OD3L 5I15L 1J1XL 2J5LB 3CZFA 3L7FB 1I9IL 2XXCB 4WI6A 4PBWD 2UUDK 1UXSB 3RDTB 2EICA 2RAMA 4P3CH 4OLWH 2FECI 2P5EE 1BQUA 5T1LA 4FP8H 4JM2C 4LLVA 1A7BA 1KPRA 3RWEB 1XF2B 3WUWA 3WDHA 2YC1B 3BWAB 5F70A 4P4RA 1IKFH 4FS0A 4N1EA 4NQDA 4KPHH 5KAQG 5IB3B 2WUBL 1FYHB 1ETZA 4RFNB 1NMCB 5C9KA 1K4DB 4K8RL 2NLJB 4Z7WB 1ZGLB 3KPOB 5ACZB 1Y0LB 3LMJH 2NYYD 2EDKA 3T4YB 3X14A 1R3HB 2ITCB 2WUCL 3T0DA 1QLEH 2Q1EA 3RBSA 5I17A 5EZIH 1KCRL 1Y6KR 1KEML 5LGHH 1NC4A 4B50A 1J10A 2V5TA 4UB0L 1EERB 5GGSA 5DR5H 4X4XB 3GSNA 1HSAB 3FQTA 4NDMA 1A47A 3SDCB 4G8GB 4WNQA 3DO7A 3QUMA 3OF6D 2HVKB 3OKOA 4LIQE 5IB4A 1F00I 4S1RH 3PP4L 3VXSD 1NKOA 4GG6A 2VN4A 1A3RL 5T1LB 5D7JB 4LLVB 3RWIA 3LD8B 3H3KA 4Y8DC 4PJDB 2M26A 3T1WA 1M6OB 1CGSL 2HWZL 4D94A 4ZSOA 4JRYB 1IGTA 3KHOA 4C83A 1JPSL 3KPQB 3T2NL 1EHLH 4XVUC 1RZ7L 3WIFA 2EH8H 3HR6A 5DMGD 4MAUH 1YEHL 5GZND 2AQ2A 1SVZA 4LPYA 4U3HA 1TFHA 2QQNL 1KPUB 3RKDD 1KJ3H 3RAJL 4P2CG 5IVXA 4UT7L 5I17B 3SBWC 4PJ9D 3WFDH 3U4AA 3M1BA 4YX2L 1NC4B 4NJ9L 2XQBL 4RAVB 4N8CH 3GSNB 1IEHA 3FQTB 4PB9H 5EDXA 4WNQB 3DO7B 5BVPH 3WLWC 2IADA 4MD4B 3KPRB 5C07E 3GBMH 3CDYA 1DFBL 4LKXB 2DQUL 3JSSA 2X1OA 3VH8A 1N59A 4HMDA 5GPRA 2H41A 3LSOA 2X42A 3I75B 1IGTB 4J3OC 3MRCB 1F8TH 2VZTA 3ULSB 4TTDD 4Y16C 4LNRB 3T0ED 2GJ6E 5IK3A 1NBVH 4PLJC 3S3SA 4EJ1C 4U1GC 4NKDA 4PJXF 4X98A 4C56A 3ZDZE 3LHPH 4X6EA 5E00A 1VGKB 2BNQE 3CFKA 4KWUA 4HLJA 5I1GH 2ZZUT 2OL3A 2APTA 1EBAA 3IDYC 1ZTXH 1PKQE 3JWDL 1PW3A 3UC0L 3LKQA 3VGHA 4U3CA 4Z7VE 5D71H 5E8OB 3OV6A 5DJ8B 3QXAA 3V95A 1LK3H 3MV7D 4I48B 5EU5A 5F7MC 2VDKH 4U31A 2ZUUA 2R2EA 1D6EA 3CJJA 4WEBH 1OM3H 2J5LC 1A0QL 1UB6A 2J88L 3QWOB 3RDTC 4IIQA 4GQPH 3ZDYE 4NZRL 3GK8L 1EHXA 2CDEB 5BW7A 4LP5A 3GIVB 2GTWB 4V1DA 2HKHH 4GS7B 5C0DA 2ZOLA 2XZQL 1HXMB 4X4MA 3QNZB 2F53D 5T3XE 4GRWF 2NZ9C 4L8CB 4NO2A 5E00B 1OHQA 4LSRH 2VLMD 1T5XA 4NFCA 5AEAA 1Z9OA 4JKKA 1INQA 4YHIA 4RFNC 1NMCC 1BVLA 3UTSE 1YEDB 4ZOCA 3GFUA 1DUZB 3JWOL 3LKQB 3QDME 5SWZB 4XNYL 5KSBE 2O5XL 5EFIB 3GMLA 4LSVL 2HH0H 4GFTB 4PYHA 3D39E 1EJ6A 2HJKA 4LQ1A 4TUKH 3KYMA 4WFHE 1JGEA 1FQ9C 3ROLA 5FUZH 3BO8B 4L3CA 3W2DH 4JFDE 4PR5B 2XA8H 4IEFB 4V1DB 5D7JC 2I9TA 5TF1H 2VC2H 3TV3H 5CJQL 3LD8C 3TYGL 2I25N 4XGZA 4N68A 2Y25A 1ED3B 5HHMB 3ZE1E 4BUGA 5F72S 5DJYA 3M45A 3MTRA 1X44A 2AEPL 1T5XB 2I24N 4FQLL 1INQB 1MNUL 4NYLA 3ZDXF 3QYCA 2DYPA 4LHUD 4ZO8A 2OJEB 3X3FH 5I2IA 3AS1A 5HVFB 4OM0H 3VFOA 3QULB 4PG9B 4WWKB 4WUKL 3OXSA 3VFVA 4Y4FD 1I1FA 1T22B 3MBXH 4NKOA 1WFOA 3GUTA 1F6LL 3KYMB 3DUUB 3ROLB 1RJYB 4J3SA 1GGYA 4MA8L 4FTVE 4KJWC 5K9JL 3BKMH 4UDUB 2WLZA 1QFPA 4HQQH 5EU7C 2X2YA 3NFPA 4WFFD 3PL6A 2R4SH 2C3WA 3ZKMD 2I9TB 2YBRA 2J8HA 4R6UA 3R8QA 1LDPH 4K3HA 3ULUL 1QNZH 4XGZB 4OZGA 3FRPG 1IM3B 3FQRA 3TT3L 4F33A 1MCEA 5DJYB 4FXKB 3C2SA 2GIYA 4PLNC 2DL9A 3FO2B 3TJHD 3DPBA 2XY1A 2DYPB 2XNAA 5T1MB 1AGFA 2PYEE 3T04D 1U8MA 3VFOB 2P5EA 5KS9E 1NCAH 3IKCA 3A0OA 1AD9A 4NBXB 3DUSA 1BFTA 4NKOB 3QUYD 2JJSA 3TA3B 2WANA 4QXTB 1KB5H 1DQDL 3EHBD 4EKXA 4LKCA 1BHGA 1E6OH 3RUGE 1FG2A 1K3IA 2MQCA 5EZJB 3PL6B 4RMUA 4PGCA 1YEIH 5IROA 3ARBD 2CRMA 3DECA 3PWJA 4RZCA 1AP2A 2R69L 4F33B 4ENED 4BSVA 3OTTA 5EOQH 4K3EL 5IUSA 2WMPA 1IC1A 2ARJB 3F7VA 4GS7C 3X13A 4PJAF 1KIRB 2XNAB 5DD1H 2P5WE 5GGRY 3RA7H 3S97C 5HDQL 3VWJD 4NZUH 2JJTA 1WZKA 3UTTD 3QEQD 3RY6C 3VJ6B 2FR4A 5MEOB 5E6ID 4RAHA 5I18L 2D9CA 4U6VL 1IGCL 1JFQL 1FSKB 3MRGA 5FV2A 3EYVB 1CS6A 2Z0BA 4AJ0A 2BJMH 1FFRA 1GYAA 1KNOB 4JR9L 4LKCB 1F11B 1FIGH 5TE6L 5C8JA 1L7TH 1U95A 2HTLD 4PTUA 1DVFD 3BW9A 4F3FA 3NGBB 5FYJL 5EZOH 1RUPH 5K93A 3SE4A 4AK1A 1X5JA 5L2KA 3MLVH 4RZCB 4IIQC 3QUXD 1IC7L 3FT4A 5BW7C 1RPQA 4MX7A 5E5RB 5SWSA 2JELH 1TVHB 4GLRI 3MV8A 4N90E 2E9IA 3CFDA 3X13B 1A6UH 1WEJH 3ZHKA 3OAZH 2VXVL 4LVHB 1K8DA 1CT8B 1WV7T 4M7ZB 3VU2A 2R8SH 3L6FA 1PG7L 5A43C 2FR4B 2HLAA 1ORQB 5DLMH 5C0CE 3T09A 2VDQL 2G9HA 4HPYH 1Q0XH 4JO2H 5E08L 4X6FB 5DC4B 1KTDA 2EYSA 2BK8A 3TH3T 3L3JB 3HAEB 4WUUA 2Q76A 4D3CL 4RMRA 3Q3GB 1GAFL 5F1NB 3RNKB 4NZDA 5FUOH 2ESVD 1JNLL 3GMOB 5C8JB 2GJ6A 5F1IA 2X4QA 3VXQA 3U82B 3L3KA 4M9OA 4OF3A 4UV7L 2F5AL 1T1WA 1MF2L 3BW9B 3NCCB 4AH2B 4WWID 3LEYH 3IDJA 4PRHA 3QP3A 2Q86B 2DICA 2XWBA 2BNQA 2Z8WC 3HZVB 2ZKHL 3CFBA 1G9MH 4U0RB 4I5BA 1F4AA 1KJ2B 1PKQA 3C8KA 3CFDB 2DQDH 1R3IH 2XKNA 4Z7VA 4H0HB 5C07B 4M7LH 2GJZB 2EIDA 4OM1L 4X6CB 1I85A 1ZHNB 1YNKL 1J18A 2G9HB 3B2VL 4PJIE 1B0GA 1FJ1A 1KTDB 2EYSB 4QNPF 1T89C 3FT2A 3MJ8A 4KGLA 1GGCH 1WBZB 3U9UB 2EZ0C 1CE6B 3RIFF 3OB0H 2GJ6B 1WAAF 3O41B 4I2XB 3SCMA 2X4QB 3O3DB 3OKNB 3SO5A 2YK1L 4XP1L 1BWMA 3IDNB 2HRPH 1X9QA 2ICWJ 4NQVA 1U9KA 3UDWC 3TA3C 1FL5A 3VXUD 1T04A 3QQ4A 4FZ8L 2XWBB 1ZV5A 3IETB 2BNQB 2FJGA 2R4RL 2VDML 5BRZD 1A8JH 1WTGT 3W9DA 3OKDB 3MNZB 3PL6C 1G7IA 2HKFL 4PJFF 1MFEL 3VFPA 1NGQH 3IB4A 1VENA 2JB6A 3QDMA 1FV1A 5MEPB 5KSBA 5F93C 1F6FB 3CDCA 2NCMA 3ULVF 4X7CC 3WKML 1HCFX 2GFBB 1KIQB 1B0GB 1JIBA 1OVZA 3C60B 2EC9U 2GSGA 1FLRL 3GKWL 1M05A 1VACA 1CR9L 5I8OH 5CILL 3G5XA 5TPWH 3VMNA 4HUUB 4AY0A 4JY6B 3SCMB 4XBPB 1I7ZB 2VR4A 4MXVF 3W0WB 4JZNB 3O6KH 3P9MB 4NQVB 1NGYA 2D31A 3HKFA 1FSKC 2JJSC 2V7NB 2XWTA 4O2CB 1FL5B 5D5ME 1QR1A 2CO6B 5HXMA 3QXUA 2VERN 4D0CA 4MCYB 4P5MA 4YHYB 4XCNB 3TFKC 4EQ2A 3NCMA 4XNUL 4CL7A 1G7IB 3UTSB 3STLA 1QFOA 3HB3C 1NC2D 5IROC 3E0GA 1FV1B 2H32H 3NGBC 4KI5F 3F7YA 1NEUA 3F7RA 1B2WH 4GMSH 5TQ2H 2F8OA 4X8JA 3B5HA 3ZE2E 1I7UB 3D39B 4XRCB 3SDXF 5J1TC 1NMBL 2X4NB 1NBYB 1MCWW 1YQVH 2GSGB 5EOCJ 4KK8C 4LVHC 4JFDB 4M7ZC 4OGYL 5E5UB 3TP4A 1N6UA 3G5XB 2V5RA 2DQGH 3OQ3B 2W0KA 5B38G 5I1DA 2Z35A 4ACPA 2W91A 4OCRL 3DVNA 4GUPB 2IAMD 2XWTB 2H6PB 1OTSC 3O3AA 1V3KA 1QBLH 4HJJH 3FTGA 4ETQA 4P5MB 3ARGD 3H9ZA 5FM4A 5EWIH 2E7LA 3ARSA 4Z7NF 4GLRH 1WBYA 2NX5A 3GHBH 2J3SA 2PYEA 3STLB 5JNYB 4KFZC 3DGGB 2X89A 5KS9A 1F6AB 3F7YB 4ZUSB 3LKSA 5DUMH 4YIQA 1QSEE 1QFWM 3D69B 3BKJH 3RVXD 4UOW1 4PRPE 4FTVB 1ONQA 4AQOA 1IKFL 5E2WL 5GGVY 1UWXH 3KS0J 4TSCH 32C2B 2QSTA 2Q7NA 4L9LA 1RZJL 3MNVA 3FQUA 5I1DB 1MRDH 4FFWD 5C08B 2OX5A 4CMMB 1UJTA 2KZ1B 4LARH 4BK4A 1FNSL 3DVNB 5L2JA 3S88H 4TYUA 1JV5A 1BQSA 1P7KA 3O2DA 5DD0H 2YA0A 3JV5A 1QLEL 3FKUS 2ENSA 3P4OA 4HH9B 2KPNA 4R7DA 3TGXA 1MLBA 3QIWB 5HTSA 3MUY1 4Y1AA 3WIHL 3MREB 1WBYB 4YZFE 1ZVHA 4M6OL 3QWRA 5DR5L 1BQLH 3OJVC 5DRWA 2FL5A 2VLKE 4JM4H 1BF8A 5JQ6H 3QA3B 3RWGA 4HZAA 1ZK9A 3HS0B 3MCKA 4XPHL 4XWOD 4RFOL 4N8VA 5D9SA 1DN0A 2A83A 3SKMB 1EO5A 3RUGB 4DQOL 3QPXL 4EOWL 4URTB 3Q2CA 1T0NA 5E2JA 3O3EA 1EHLL 1FO0H 3QNYA 1I85C 5D1ZB 3O6LL 3WNPA 4Z76B 5JLZB 5KVDH 3VFGL 1QFWI 3C60C 2R15A 5AG9A 1R5IB 5INCB 3KLAB 1CTNA 4N0RA 4ALAL 1V7NH 3SO3B 3WD5L 5JXEA 5GRXG 4H8WH 3CDGB 1BOGA 3QZWB 6FABH 3WFDL 3SCMC 5D1XA 2LQRA 1MLBB 3VGBA 4Y5VA 43C9A 3UTZB 2P5WB 4M00A 3JV0A 4N8CL 3KYOA 3CU1A 4Q6YA 4PB9L 4DVRH 3PABA 3O4LE 1HH6B 4HH8A 1YDPB 2FL5B 2IG2H 1Z6JT 4XPFH 3A6OA 3GBML 4YHYC 3OAZK 4JDVA 4QRSB 5GHWH 5BMFL 1DN0B 2A83B 3OJDB 1NGZA 5IBTL 4YXKL 3FAXA 4J3XA 1XF3B 4KUZH 4F57H 3QNYB 1F8TL 3FMGL 3V5KB 2G5BB 1YMHA 5DJ0A 1JWMA 1NBVL 3K1KC 5D1QB 4UQ3A 1TVBB 4TUJA 5IFHH 3D1MC 5B38A 4KZEH 4L4VD 1FRGH 3AREA 5D1XB 1A1OA 4K23L 3V9FA 1I8MA 5I1GL 4YDVB 1UM4H 3PWNB 5J6GA 4KTEL 3EYQD 5K59E 3PABB 4P2RA 3PQYE 4XTRD 1MH5B 2Y23A 5C0CB 4M1DH 2WWKT 4R7NB 4PJIA 1IMHC 5D71L 2J6EH 1DBBL 2VDKL 5J11B 2ZUTA 3EYFB 5F9WC 5DJ6A 4MNHA 4F37K 3D85A 4HIJA 5J7CC 4MA7H 3I9GL 1D5ZB 4U1HA 1NGZB 3QUKA 1XGTB 3MXWH 2W38A 2ZP0T 1VEOA 3BMVA 2PW2B 3HRZA 1NQBA 3FCTA 2GTZA 2H26B 4PD4J 3SJVB 1YMHB 2HFFB 3OB0K 5DJ0B 5E03A 3WXWH 2VAJA 4PJ7E 4XPTH 5DJDB 1PDKA 5JW5B 4G9FD 4QTHA 2CGRH 3DO3A 4XAKE 5I30H 2R0KL 4F7EB 3BRFA 1HHHA 5FA3A 3JUYA 1YYLL 3EZJB 1SMAA 1BEYL 3MRRA 3ZKND 2R1YA 5FYKE 3WEXB 1YN7A 1KCVH 2CO7B 3R06A 3TZVB 5D7SH 2FECL 8FABA 2HH0L 1I8KB 3QIWC 3ZYZA 4JFEB 3BPOB 4ETYA 2A6JA 3RVVD 4TUKL 3PJSB 5IESH 4N0UB 4OQTH 1T1YB 2NR6C 4U1HB 3DETC 3LVEA 3QUKB 3EKCA 4R26H 3RIAK 4G43B 3WO3B 5CJ8A 2ZUQB 4HS3A 3W2DL 4XWGH 5L0QB 4UU9B 5D2NE 2XA8L 1MPAH 2IFFH 4RMTA 5TF1L 2VC2L 3F12A 5D5MA 3TV3L 3V6BR 2FX7L 4R0LA 1L6XA 3ZLQC 4O00A 3CCHA 3HTLX 5BO1H 2BERA 4OCYH 4QTHB 2VITB 3SE9H 2R23A 3VRIA 4L9LC 5D1ZC 5FA3B 2BDNH 3DMMA 4FQQB 4NP4H 2L7UA 2IALB 3UTOA 4HKJB 5CHNB 2FNBA 1GZQA 5EBWA 2Z4QA 1HHIB 5C2BL 4OM0L 3SO3C 3X3GH 4P46A 4PREA 3KJ4B 1NBZB 1T3FA 4IRJD 8FABB 1GGIL 3VFRA 1ZT4B 4MNGE 4OZHF 1IILE 3H2WA 5JHDE 1EBPA 3EBAA 5HYEA 4KJQD 2XA3A 1CIDA 5DHYB 1OAXH 5FOJA 5IV2A 4PJEF 4YBQD 2X1PA 2NY5H 4L5FL 43CAB 1QSVA 4X7FC 3EJYD 1QFWH 2MHAA 2B4CH 3I85A 3OSKA 4R0LB 1YN6A 1HHGA 2W07A 5I1LA 3AU1B 1QNZL 3CNKA 4CADA 1MFCH 1BGXH 4OCWH 1A7RH 5F7EH 3VRIB 2FLBT 1KIUA 1EA9C 3DMMB 4PGEB 1NLBL 5E4IA 1U8NB 3B43A 4RBPH 3IRPX 4GKNA 3VGEA 5D1QC 4YFLI 4EUPG 3D3VB 5IQ9A 2QEJA 5JW3H 1U92A 1DN2A 4LRNH 3BH9A 4QT5A 3RX8A 1HN1A 4PREB 1NCAL 4PRPA 5GGVL 4UT9L 2X4OA 1T1ZB 1ZA6A 3X17A 5D1XC 2O61A 4A6YA 5F7WC 1I1AD 4LSQL 1NFDE 2UWEF 4AENB 1KB5L 3BGMB 1RMFH 1X5AA 3DSFH 3O9WA 1A1MB 1MCWM 3TBYB 1KN4H 5J11C 2Z92A 3JV6A 5FDYA 1YEIL 2J8UB 1UWXK 4YUEH 3P73A 1HHGB 2BSSB 4CADB 3ME0A 1MI5B 3CSGA 4P5KA 4RMVA 3EO1A 4O2EB 5EOQL 1UKTA 3FFDA 3DOSA 1BQHA 1JZ4A 4GKNB 3L5XL 5GGUA 4HSQA 1AO7B 1L0YA 3MCLH 5ISZA 3V6OA 2BRRL 1AXIB 1QSEB 3HNVH 3QAZB 4NZUL 1RI8A 4CMHB 5HDLA 3KLHD 1DTUA 5JOEA 2QHRL 4MAYB 4PRPB 4RCAA 1ZA6B 1OB1B 2DL2A 2VZ1A 2O61B 4A6YB 2GT9B 3HC4H 5EO1B 2BMKB 1WF5A 3EUUA 2BJML 4YHLH 2M1KA 4UOW0 2MNUA 3RVWD 1R24B 1HWHB 3TZVC 4APQA 5D7LD 1L7TL 5IOPB 4LLYA 4KJYA 1RK0B 3MLTA 3BPOC 1R0AL 2WINA 3MRFA 3B9DA 3VRJA 2WZPD 1HNFA 2Q8AH 3NIDF 5C0EA 4LEXL 5EZOL 2AV7B 2JB5L 2WIIA 2WQ8A 3I3DA 2ZUQC 2K9UA 4RQQA 5L0QC 2D0FA 2R0ZH 4Y7MA 1AFVH 3PF2A 1NFIA 3FFDB 2GCYB 3EJZD 5DFVC 3DX7A 3VE0B 3HAEH 3O4LA 3HE7D 3KWWA 4GKZB 4J4PD 2VLKB 5GGUB 2DTSA 4G7YH 1TZIB 2R9HC 1QSFD 2GJJA 1D5BB 1A6PA 5H2BA 4XPAH 1AGBA 5DURB 2CJUH 3MA7A 2FIKB 4EBQH 1P4BL 3BEWB 2OK0H 4HPYL 1Q0XL 4JO2L 5CP3H 4P57A 5JO5B 4DJMA 4JKLA 4PS4H 3U4EB 1HINH 4K8RD 5EC1A 5FUOL 2VXQL 1KFAH 4MMZC 3QISA 3KJ4C 3VG9C 4APQB 1G84A 5C6TH 4LLYB 3VFUA 1KJ2H 3PWLA 2WINB 4JFPA 1PY9A 2R1XB 5JIKA 4WVRA 4YDJA 5E1AB 2WIIB 4TSBL 4HUWB 3ZKSD 4KK5D 4ZD3H 1LP9F 1RUMH 4E5XA 1NFIB 4I9WE 5IGXL 4HIEB 3MJ6A 3IXTB 5F97E 5L88L 3O4LB 4R0LC 1R3IL 4UZGA 1CICD 4U1MA 4LFHG 4M7LL 3MCG1 4PJAE 2C5DC 4S1QH 1S9VA 1AGBB 3MA7B 3LAFA 3GSUB 3PNWB 5HPMA 3DMMC 5BOPA 4P57B 4QRQB 2E7CA 2A6DB 1JWUA 2DLGA 2W0PA 4M6ML 5EUOE 1A64A 1PZ5A 1U8PA 4P46C 3T0WA 1KXQE 5MHSD 4UBDC 1C5CL 2ATKA 4CJ0A 2VR5A 4PJCF 2GQHA 4DKEL 2HRPL 4GXUM 4PJ7A 4M5YH 4JFPB 4KROB 2C3HA 1AXSA 4MCZA 4N0YH 3TIDB 4P4KD 5DS8B 1FIEA 1QRNB 4O4YL 1KGCD 3H0TB 5BV7H 4FRWA 3OG4B 4XAWH 4P23B 1NGQL 4HUXA 3L9RA 2PF6A 3PQYB 3FN0H 5LQBH 4Z8FL 2EDHA 3GMNA 2YD3A 1FZMB 3E3QE 3O2WL 1ZHLA 4R2GD 4M1GH 1FGVH 2Q20A 1B4JH 2O93L 2D03H 2Y7QA 1ZS8A 1A4KA 5E9DD 4JDZB 2EC8A 4HXBH 4EUPB 4EZMA 1YNLH 3U83A 5FDWA 1YECL 4H26A 4N5ED 4MZ2A 4GXVH 3THMH 4HC1A 3QAZC 3D2UD 5D2NA 3UJIH 4CMHC 5I8OL 3E8UH 1PZ5B 2G75A 3HUJE 2CLRA 4MAYC 4PRIA 3RX5A 1RJZA 1NDGB 5CUSH 1MRCH 4KDVA 4PJ7B 5JA8B 1C8PA 3PWUB 1JGUH 3MRJB 3REVB 3CVHA 3PXJA 2A0LD 1CGWA 3FB7A 3ESUF 4BSWA 5MENE 4NM8H 4DK6A 3WNOA 4ODWB 3IF1A 4MNQA 2MKLC 3GO1H 4X99A 1KPVA 3UEZA 4P2YA 5JR1H 2MJWA 2BY3A 1B2WL 5K9OA 1NSNH 4NNXA 3SKOB 2Y7QB 3T4AB 4DCQB 2HT3C 5E5MA 4X5WA 4MNGA 2DLTA 5F7LB 2JCCE 4JFHD 3NAAH 4HLZH 3G5YB 3TO2A 4A2MA 1YQVL 1GC1C 4G6AD 4LK4A 1D9KD 4QNPE 2Q87A 3C6SB 3CVIH 3SDAD 2G75B 1NCCH 1R3KA 2DLEA 2DQGL 4HWBH 1LMKA 4M48L 4UQ2A 2OZ4A 3B9KD 1WBXB 2J6EA 4LLMA 5JA9A 4PUBH 1IGMH 4ZAKD 5TDOB 1WAAE 2W9DL 1A4JB 1NMAL 4ORGA 5C0AD 3CVHB 4HKZA 3GRWL 4MJ2A 4KJPC 1CLYH 4PJXB 1S78C 1MIEL 4APQC 3SDYH 1SYVA 3IF1B 1FZKA 2YA2A 4OKVB 3GHBL 4GAGH 5LKNA 1D5IL 1GOGA 3IGAB 2OBGA 4U7KA 4KGJA 5DUML 3K8LA 4P2QD 4ZS7H 4RBPK 5IW6B 4MNGB 1FLTX 1CLZL 1NFDA 5JHDB 1VFAA 4KKAD 3HMXH 5FB8A 3ARTA 3W82A 4FXGA 4MDIA 1H9VA 4ODSH 3WNMA 3KPSB 1R3KB 5IJKC 4H25B 4YHPB 2A73A 5I19H 5DT1H 4L3EE 1ND0B 4LARL 3VRLF 4IOFC 4MXVE 4NUGL 2A77L 2F8XC 1G7JB 3EFDH 3R4DA 1KLFA 4ORGB 1G6RH 5CZVH 3UPRB 4HKZB 3QIUA 5FM5M 4GRWB 5DD0L 4OQTA 1FE8H 5T5FH 5J9PB 2F15A 1ZANL 2PO6A 2I9LB 3E6FA 1LILA 1T4KB 4KKBC 5IFJB 1QUNA 2NNAA 3DSNA 1KACB 4KROC 1CXHA 3V4PH 2VDLH 3OAUH 4JM4L 4AQ1B 5JQ6L 4KI5E 2XN9A 5F88A 4LLDA 1MFAL 4O51A 3QXDA 1NFDB 3RY4A 4P23C 4JG0H 1KSRA 4AEHH 1DE4A 1KYOJ 3D18B 3O6FD 3PHOA 4G80B 4PV8A 4MXQC 4OGAC 4MDIB 3ARDA 5IVOA 1U3HD 3IDXL 4WHCA 2APBA 1GL4B 1FO0L 2PN5A 3Q1SL 4MSWB 1BECA 3RWDA 4DZBA 3VXSE 1YEJH 1FFOB 5KVDL 3ZSTA 1QEWA 5JHLH 1J0YA 4WHTB 3EFFB 2DM3A 3RZCD 1BAFH 1RIHL 2LABA 1OW0A 4ZXBD 4UIMA 4H8WL 1YJDC 4Z7UA 4ZFZB 1XGPB 6FABL 2PO6B 1HILA 3E6FB 4DAGH 2WQRA 4AEEA 4LCIL 2VISB 3QUZA 3MOBH 1P84K 3UYPA 4XHJD 1NAKL 2YPKB 4OFDA 3VGAB 1NGXA 4FG6C 4C56D 4HIHA 2IG2L 1ZA3B 4I77L 2H1PH 2NZIA 2IPTL 2BNRD 4LLDB 3NIFF 3ESVF 5AZ2H 2DQCH 1VERA 4PTTB 5GHWL 1FH5H 3DROA 1CLOH 5F44A 1DE4B 4PV8B 3ARDB 3LEXA 1JWSA 1NCBH 5DJ2B 1JCKA 1BF2A 1P7QB 2D4FA 3OZ9L 5ICZB 4WHYH 4BZ2H 4F57L 5BS0E 3RWDB 1WTLA 4MDJA 2PW1B 4IMKA 2R0LH 3L3OA 1QEWB 1JPFA 5B39B 3J8F7 1QBMH 1J8HB 1NEZA 5LGJB 4IOIB 5IFHL 4CVXB 3HPLB 4WO4B 2X70A 1R5WB 1TETH 1HILB 2R2BA 4DEPC 5FYLH 2YD6A 1PZUB 3T0EE 4C54A 1UM4L 5CD3B 1T7WA 5DQJB 1FC2D 3MXVL 1KC5H 2X05A 1I8IB 4HF5H 1X4ZA 1P5VA 2P43B 5LXGH 4M1DL 3MRQA 3QJFB 1RY7B 4MYWB 4OGXL 4P3DA 4ODXB 4XC1H 4D2NA 2WP3T 3U7WL 4MJIA 1H8SA 4HS8H 4NC0B 2VH5L 4QRUA 4X7EC 4XP9L 1JWSB 3T8XB 2NW3A 5FYJD 3CGTA 4IS6A 3MXWL 1KTRL 1RUQH 3U9PL 3GSWB 5FKPA 5ANME 2YXFA 3MV7E 1Q9KB 3EDKA 4IRSB 4XI5C 5FECA 1Y6MR 5D7IF 1K8IA 4YHNA 3SGEH 3WXWL 5TQ0H 1SVCP 4KDWA 4XPTL 5T3ZL 3NN8B 4YLQT 1Y6NR 4U0QB 2X70B 5CEZL 1DBJH 3E6HB 3VFTA 4O5LL 4JEGB 3IU4H 5B8CA 3AS3A 1NL0L 4JJ5A 4I3SL 4PJAB 4E42B 3QDJB 2F53E 5CINL 2PUQT 2Z93B 3K46A 4DTGH 2VLME 1DL7H 4RGOH 5F9JA 5F7UA 1U36A 5DGQA 5EUOB 1OAUH 3V5DA 3HUJA 5GSRB 4QRUB 3KJ6H 4R26L 1R5VA 4R8WH 4JRXD 5FIEA 1FL6B 4G6MH 5BCAA 5FKPB 3BN9D 4FQJH 1S8DA 3I6KA 3VWKD 3UROR 2P4AB 2P8MA 5CS7A 3I2CH 1N4XH 3CSYA 4F58L 1BP3B 2R1WA 5MENA 1H3PH 3HG1B 5CP3A 1HE7A 4TN9A 1IM9D 4D9QD 5SV4A 3TBWB 4NQTA 2BDNL 2DQFA 1J5OH 3GNML 2AXJA 3VFTB 4HBCH 4XP6L 3REWA 5GZOD 5B8CB 3VXMD 1AGDB 3RFZC 5CEYB 3CUPA 2ARWA 3BEVB 3L3GB 5KVMC 3BN3B 3RVUC 2CDGA 2JCCA 4ONGH 2PO6C 4NBZB 4WFGE 4XVSH 4Y2OA 2OYPA 3ZTJG 4OF7A 1VFUA 1UB5B 1OAXL 3VGAC 1MOEA 1R5VB 4E0RA 4PJGF 2ENYA 4JM2F 5DK0B 3T3ME 3I6KB 5GS1B 4AIZB 1RZFL 3T0BA 1JMZA 2R1WB 2YD4A 5MENB 1XEDA 1FL3B 1F4YL 3RGVB 1ITCA 3ARDC 1MFCL 2Y06H 3F58H 2YD9A 1JGDA 1F4WH 1BGXL 3FQXB 1XGYH 4P5TB 5GISL 3KPLA 4JZJB 3UMTA 5DSCB 1QBAA 4OIIL 2UZYB 3QXWA 2VLRD 4PGZA 5IW1A 1JHKH 3DWTA 3DIFA 4X6BB 5JW3L 1XH3A 4LRNL 1XR9A 1WZ1L 3FO9A 1TZHB 3TM6A 4WO4C 3STBA 5J6HB 1F4XH 1JMXA 1WISA 4FQXD 1U8LA 5EPMA 4RSVA 4ZYKA 4CN4A 1XIWD 4ISVB 4TUOB 3WSQH 2D7OA 3V0WH 5C71A 5BXFB 3PHSA 7CGTA 1RMFL 2W9EH 3U36A 4E0RB 5DMIL 2BNUA 5AYUL 2XACC 4NC1C 2VXTL 5IW3A 4KQ4L 1OAKH 1R3LB 5F71A 1A6WH 4YUEL 1UG9A 1MCOL 2FHBA 5ESVB 1RU9H 4N0CC 2IBZY 3PGDA 1JGDB 3MFGB 1NJ9B 3NA9H 3TNMB 3CZJA 4NQSB 1MWAB 3NH7H 2XKUA 4PJFB 1W72H 3FO1B 2Q6WB 4XB7A 5CEXA 5E8NB 3MCLL 3WS3A 5L2KD 3HNVL 3DIFB 4NNYA 4YDIH 3WS6C 3OKKA 3H9HA 3GEWB 4FQ2H 3C6LB 3GMMA 4K2UH 2NXZC 1HKLH 2NPLX 3HC4L 2R56H 4U7SA 5ICYA 3WL9B 3OF6A 4OLEA 4YHLL 1LE5B 1I3RA 3BKYH 4JFYB 3UTTE 3QEGL 3QEQE 3VXSA 3MJ7B 1V8HA 1DBML 4L3EB 1ITBB 3AXLA 3QQ9C 4XVJL 2APVA 3U1SL 2FDBP 4LVNC 5IHUH 1BJ1J 2VDPH 2KKQA 4K94C 3ZKXB 2H9GA 4PJ5B 5E6ZA 5A16B 3PGDB 4ZPTA 2HT4D 2R0ZL 1AFVL 3D9AH 2DKMA 4HWBA 3VW3H 1QG3A 5CEXB 4HKBB 3MX0A 4NKIL 5JORB 3WS3B 4M6AA 4PJ9A 5HJ3A 1S9XB 3MRMB 2OK0L 1MJJA 3CH1A 3GIZL 3UBXI 3E3QC 1X5IA 5B8CC 2PTUA 5ICYB 1QLRA 4PS4L 4NM4L 3QCVH 3T65B 4KUCF 3BZFA 1KFAL 4C55A 3VXSB 2UWEE 5C6TL 1XZ0B 4KK6C 1WZLA 1KJ2L 4ZTOH 5EU6D 3N85H 3HMXA 4UUJB 1CFVH 3TH4T 1II4E 5HHPA 1Z0MA 1CFTB 4JHAH 4ZD3L 5A40E 2VDRH 4PP1D 1I8LC 3T0EA 3DX9A 1E4KA 5DEGA 4U05A 2C9AA 1FFNA 1J1PH 4XMKH 2QSCL 1KTLA 4GMTH 2KH2B 3IJSA 3PWPD 5CCKL 1JNNH 3RGVC 4MQSB 4G6KH 3B8SA 3U0TA 1G6RA 4P5TC 2EYTA 5I74B 1QA9A 4JZJC 5I16B 3LV3A 4HJ0C 3NACL 1ZHBA 1VA9A 3O8XD 2FD6L 4M8QA 4TRPH 5KZCD 2AXFB 5ANMA 2AJ3A 5BS0B 3MV7A 3O45A 2AGJH 1MHEB 1AC6A 4O58H 3WJJC 3AFLA 5DO2C 8CGTA 4LBEA 3CC5B 1MCRA 4NO0B 3P11L 1TJGH 4M5YL 3QJHA 5K9QG 1A14H 2HYMA 3JVGA 1RHHB 3RPIA 1A7PH 4N0YL 2OI9B 5HHPB 2A9NH 5BV7L 3DV6A 4XAWL 2ICWA 3JTSB 4K3DH 3FN0L 2NXYD 2F53A 5GRUL 4QHNA 1DBAL 3VXUE 4XMPH 1B4JL 4AIXA 3N1GC 5FO8A 2D03L 2EYTB 1FGNL 1QA9B 1NBQA 1BBDH 4XZUB 4OUUB 1CCZA 4HXBL 5T3XL 2CMRH 1ZT7A 3FHAA 2AJSL 2YEZA 2IH3A 4UILL 4WV1A 1FYTD 2AJ3B 4KV5F 5CWSA 5CZXC 2QBWA 2AERT 4AIOA 1QHOA 3K4ZA 5CUSL 3C6LC 5KVGH 3ULVC 1MRCL 1AGCB 4NWTL 4HUKB 1EXUB 3D0LB 3VXPB 1LO5A 2VSDA 1G7MA 1JK8A 5CJXC 1ACYH 2OQJA 4NM8L 4GG6F 5ADOH 1JZ3A 2VQUA 1BPVA 5E2VL 2X4PB 4QXUL 4LMQE 4Y5XB 4H1LG 5FV1L 4HUMB 1AD0A 2AI0L 1WZMA 4XCEA 4F7MA 1YEGL 2NY3D 4GQ9L 3W81A 1U8IB 3ZKXC 4FA8A 1INEH 1NAMB 1YC7A 3Q48A 5LWYH 5J4MA 4QWWC 2CUMA 4JO4H 5JOFB 2X41A 5FO8B 1CDGA 5EC2A 1T21A 2A38A 3RWJB 5TH2B 5DJZB 4DN3L 1HQRA 2VKWA 2VDNH 4LHUA 4WGVB 1RQ5A 4WW2A 1RUKL 1IBGH 2ED7A 1GJIA 2GY7B 4DGVH 5IVXF 5I8KH 4PP2A 3LRHA 4KI5C 3VD5A 4WV1B 1LQSR 4WIQA 3EOBB 2CDFA 4Y4FA 3CVIL 2OJZH 1ES0B 1U8KB 2ADFH 4XNQA 2VLJE 1Q9LA 2VLLA 4LAQL 3CAFA 4G5ZL 5KW9H 4AG4H 4PUBL 1IGML 3BQUD 1LO5B 1OL0A 4HWNA 4ZS6C 3WYRA 4FOMA 2OQJB 1EEUA 3L7EA 3S34H 1EO7A 3LS5L 4U1NA 1BD2B 1YZZA 5SX5H 3MLYH 2AJUH 1ZKAA 4GAGL 1EEYB 3X11B 1J87A 1E28A 3WN5A 1AR1C 3R0MA 3AY4C 3H9YA 1SYSB 4Y1AD 5IHBA 4M1CC 4MQXC 5F7KC 5GZNC 2MPAH 1PJ9A 5I1IH 1U58A 4JE4B 2EDTA 3DURA 3RKDC 1JPTH 4DZ8B 2DQTL 1WLHA 4NQED 2QV2A 1N3NA 4GRWH 4EVNB 3GZKA 2CDFB 4GRLB 2E7MA 5I1HH 5BQ7B 4XNQB 2YD8A 1U8HB 5E4EC 1KELH 5I74C 2VLLB 2VL5A 3GSRA 2X1WL 4TPRH 5I19L 2CKBB 3TN0D 5CKAA 1XR8B 5FHBL 1T7ZA 3EFDL 4HX1A 1O7SA 1F97A 5INDB 5CZVL 3WKNA 3L3DA 4DKAA 4U1NB 5EZLA 4GW1A 3HI5H 1DBKH 2DWDB 4L8DB 5I75C 3OKLB 3ARBA 2XG4A 3V4PL 1PG7W 1E28B 2CXGA 3JWNC 2VDLL 5JXED 4X5LA 3IT8D 5DQDL 1KIPB 2OI9C 5CBEB 3OHXA 4DN4L 4M7JH 4OT1H 4TTDC 5B22A 4Z95H 1VSCA 3SKNA 4IRZH 4NQXA 1E4KC 5KAQF 4JG0L 3P9LA 1XGUA 4AEHL 3VWJA 5JPNA 3UTTA 3QEQA 4U7MA 5HVGB 5TGBA 2D2OA 4K3JL 3ILPB 1IAOA 3JTTB 4Z7QE 2BVYA 4UIKH 4FQHB 2VL5B 2CXKA 2UZIL 3QUYB 1U42A 1YEJL 2HAZA 1K9TA 5GS0C 5JHLL 4F7CB 3UYRH 3NFSH 1GOHA 5ERWA 4UTBH 4X9FA 5IVNA 2IAND 2IMMA 4WI9A 4GSDL 3RZWA 3LZFL 4GBXD 1DVFA 4GW1B 4L4TD 2IC2A 5EU3A 4DOHE 5IBLD 4QHUA 2CLVB 2DMKA 2WV3A 4X5XB 4PRDA 4KAQH 2B8OT 3INUH 3JVGC 2VQTA 5IF0A 4G42A 4UAOB 5FEBA 1VKXB 4QOKB 3QUXA 4X7DC 4JFOA 2JK5A 3AMKA 4GH7B 5ID0B 4G6FB 2PXYD 4HK0A 2P24B 4Y5XC 4Q9QH 4F2MB 1QP1A 2DQCL 3S5LG 3U0WL 4BZYA 4LSUH 1FH5L 4GOSA 3ELAT 1LEIA 1JUFB 1KJVA 5HYSA 3RWCA 5IVZB 4PJEB 3K0WA 5MI0B 5E6IB 3V6ZB 4BZ2L 2DBLL 1IAOB 3LIZH 2GSIB 4YPJA 3C2AH 2XI9A 1N0XH 1RUAL 5EH1A 2XFXA 2GEEA 3D85D 3V0AC 4KZDH 3MYJA 5E2UL 4ZTPL 3MRDA 4PGDB 4EN3D 3QI9D 2IGFH 5B3JF 2ESVA 4WV1C 3VRLE 4YHZH 5DFWH 3CXHJ 4JVPA 5FYLL 4TNWF 2AJVL 1LHZA 1BFVL 4NPYB 4OTXH 2P49B 3BPNB 4LLQB 5D7KD 3TEUA 5HY9B 2GKIA 3QG6B 5T1DH 1E6JH 4OFVA 4HF5L 5IF0B 2DAVA 4G42B 2FH6A 3QUXB 5HSFA 4H1LB 4MA1B 4L4VE 1J0IA 4BKLA 4S2SA 2SEBA 2BVQB 1DSFH 2V2WB 3TJEL 4OZGF 4WDIA 4UNTA 5DHVA 1OY3B 3V0VB 1LEIB 4HS8L 2CK0L 1KJVB 2UWEB 2YD5A 1W72A 4O2FA 4IMLA 5GRJH 4X4ZA 3S35X 4KKLC 1RUQL 1JPGA 4LQFH 4G6JH 3MZGB 2XTJB 3VDCA 3OXRA 2PYFA 2AV1A 2DI8A 5FGBC 3MR9A 3HI1A 3UXFA 4QEGA 4E9LA 2LTQB 4ZFOB 1CDJA 4MJ5A 1N5AA 2FRGP 4GRLC 1KEGL 2A6IA 1Z2KA 3OR6A 1U8OA 4LLUB 3ARFD 4ZO6A 5F3BB 3VXUA 4YFEA 5DWUL 4HIXL 5TDPA 4OZFH 2G5RA 2Y4SA 2OR9L 5F9AC 5BRZA 4NN7B 4EI5B 4G9FE 3B8YA 4HFUH 4AT6A 3ARYA 4XCCL 1UQSA 1DL7L 4KK9C 2X9WA 1VB9A 3QFJB 5DHVB 4NUJB 3MV9B 4JN1H 1OAUL 5ENWA 1ZLVH 4G9DA 1H0DB 4R8WL 5D70L 1CGUA 4G6ML 5HGGS 5IG7B 4FQJL 5GQBA 4XP4L 4HPOH 1D6VH 4L29A 2APWA 5IB1A 4EQ3A 3OL2A 3I2CL 1N4XL 1A1NA 3MODH 5DI8A 2HVJA 3HLAA 5JUEH 1H3PL 3BP6A 4R96B 3P4MB 4MJ5B 1UJ3A 3FO0L 2GYSA 5KN5A 2LVCA 5EU4A 1AHWB 1U8OB 2ICEA 3QUYC 1QVOB 5DUBA 5IKCA 4CW1B 5F9OH 1CZ8L 3MGOA 3VXUB 1FBIL 5DJCB 3JV4A 3KLSA 1T7VA 3F7QA 2VQ1A 2D7TH 5T1KB 4YAQA 1A9BA 4ONGL 1IT9H 1NC2A 4XVSL 5IM7B 2E9WA 1TZGH 4LSTH 3CPLB 5DVLA 3P30H 3U0PB 2A1WL 4UAOC 4Y19D 2P48B 3VCLA 4OD3H 4UDTB 5I15H 2ED8A 1NGPL 1S7XB 4XVUD 3VFMB 4JHWH 3W39B 3DX8A 4L29B 4KU1A 3KDMA 5K9KA 4JPKH 2CLZB 1SJEB 3LS4L 5IR1B 3F5WB 1A1NB 5DI8B 2DOCA 2HVJB 2XRAH 2YWZA 1N2RA 5DF0A 2Y06L 3F58L 1T6WA 1UJ3B 4K55A 5MI0C 5E6IC 2BC4A 5KN5B 3U6RA 4F8QA 1LP9B 5DD6A 3P3YA 3MACL 3QDGD 5FYKU 5JDSA 4P2OD 1DQML 1WWBX 5SX5K 1LO4H 3R1GH 2WUBH 3U7AA 5ELIA 2BOBB 3ARGA 1A2YB 3QIBB 3GGWA 5LAXB 4HIIB 4NWUL 3UCRA 1CLCA 3ZDZF 1AY1L 4JFFE 4ZDHA 1H5BB 5ISZD 1AXTL 4RGND 2VLJB 3QUXC 1KEMH 2YR3A 2JJWA 5ACLA 4MA1C 3S5LB 4FFVC 2C1OA 3VGDA 3IFPA 1LD9B 2K1MA 4Z7VF 4R4NC 2YMXH 4Y16D 5K9KB 4KVNH 1T0MA 4DWHA 4LHQB 3TNNB 1RZGA 3EW3B 1KBGH 4PRAA 4PRBB 4E41E 1A3RH 2BC4B 5E8PB 5SX4H 1LEGB 1T6VN 5C09E 2XTJC 1OAQL 5KVFH 3ZDYF 1KJMA 4HK3J 2IAMB 1YEKH 1S7TA 2LTQC 1JPSH 4OJFL 2ZNWA 4D0BB 1RZ7H 3BRDA 3IVKA 3ARGB 3IXAA 4HEPG 2F54E 5AG8A 4LDLB 1QPXA 1FG9C 4K2UL 1K6QH 1HKLL 3S96A 1YEHH 1CD1B 2XQYK 1D5XA 4HFWB 2R56L 3N9GH 3C5JA 3RAJH 4OSUL 3RPKA 2V2TB 4GT7A 4OLYH 3MROB 4UT7H 1M7IB 3QR2A 4F7TA 4NN7C 3BKYL 4NJ9H 3RDTD 1HZHL 2XQBH 4MS8C 3WCYA 1UM5H 4RMWA 3QT2A 1MQKH 5KSBF 4JZOB 1GC1L 5J3HD 1T0MB 3R0NA 4ZPVA 1RZGB 1UH2A 5HI3C 3UTQB 2NZ9D 2DQUH 4GKSA 4Z0XB 3D9AL 5D7LE 4WU5B 1KJMB 1RK1A 3RTQD 3S6CA 3VW3L 4RNRB 1DQQA 4U6XA 2ZCLL 1VFBA 4ELME 1AKJB 3WDIA 4G8IA 1IEBA 4Q2ZA 1MCFA 1AHWC 4WJ5A 3TIEA 4J6RL 1S7QB 3B2UC 2IBBA 4R9HA 1Q0YL 3C5JB 3QCVL 5C0BD 1TIUA 3P77B 1QSFE 1WIOA 3GM0A 4G8GD 3EO0A 4OIBA 3SDCD 1JF5A 4LCYB 2PETA 4X80H 3T08A 4QHKI 2Z31A 1I9EA 1M7DA 4MB5A 1I1CA 1OCWL 5HVHB 5TF0A 4K9EH 4Z5RB 1IFHL 2HG5A 5H8DA 3BZEA 5D7JD 2FO4A 1S5IL 1T83C 3UBXA 1HNGA 1QO3A 4ZPVB 1RAMA 1CFVL 4JRYD 1MIMH 3IFOA 5D4QA 2YRPA 4JANB 2VDRL 4QRTA 2X7LA 2Y9RT 4MD5B 5IHZA 1PFCA 4XMKL 1A0QH 5JTWA 3PV6B 1RK1B 4ZNEE 2J88H 3VXOA 5E95B 4ONHA 4H20H 1XCQA 3GK8H 3LDBC 4L4VA 3LQZB 1UJ3C 4M9PA 2EEBA 1TQBB 2XZQH 3DVIA 1CFNA 3SOBL 1F42A 1CFQB 1GGBH 1RZIB 3T77B 3IRZA 1X5HA 4YR6A 4G8FA 2EDXA 3GHEL 4O02H 3CFJA 2HN7B 3EO0B 2HTKC 1YY8A 1IAIL 3QIBC 1IAMA 3KPRD 1AH1A 5KS9F 4N9GA 1BX2A 2HG5B 1CD0A 2ATPB 1H5BC 3OX8A 5CBAA 5IJVB 3ISWA 4XNYH 3OKEB 4L8BA 3QQ3A 4H88H 3T2PA 1CFSA 4LSVH 2A9NL 3RHWK 4QRTB 2DJUA 2ZSWA 5MHSE 1CL7L 4CU6A 3LB6D 5IIEA 4B0MM 3VXTB 1G7HB 4L4VB 5F7DA 1UT9A 4FABL 1KXTB 5F7YC 4TTGA 1WWWX 2YRZA 2X4TA 5CJQH 3MO1B 1HEZA 4JQVA 4W6WB 1CFNB 4F9PC 3D6GA 5DRXB 2CMRL 2IAMC 5C0FA 3IS1X 3MRIB 2FX8L 1ZHKA 4JPWH 3BVNA 3WFCL 3EGSA 2AEPH 1AI1L 1GH7A 4AMKH 2BY0A 3ARGC 4FQLH 2RFXA 4GW5A 1MNUH 5GRVK 4JY5H 1ZLVK 3OJMB 1LDSA 3MRBA 5E9DE 3WLBA 1JN6A 1DQLL 5GJSL 2ZUSA 3RJQB 1T7YA 3ZE0E 3OX8B 5CMAB 1I7TA 4L8BB 1FNGB 3WV0A 4ZUTB 4JFQA 3RVXC 2NY2B 1XF4A 2DM2A 4KTYA 1OARH 4BH7B 3GMRA 2AXGA 4WTXA 3GMPA 4MA8H 5K9JH 1J0ZA 1X5FA 1S7WA 4G9FB 4FFZL 1DUYA 1INEL 5F7DB 1NUDA 2FH8A 4IDJL 1NCUA 3FB8A 2V5MA 3BUYA 1TTUA 1WCBB 2X4TB 2IBZX 2V17L 1HEZB 1YYML 2FBOJ 3U7YH 2IPUG 3ULUH 1F3JA 5ICXB 1JZ6A 3C5SB 5KSUA 1IBGL 3IDMB 5IMKA 3WJLA 4DGVL 4YEEA 4EDXB 5T3ZD 2ADFL 4IRJA 1LVEA 5SWZD 3FOLA 1Q38A 5CEZD 5KW9L 4JFHE 4Z0BH 5ETUB 2FYYA 2GAZB 1L0XA 2C7UB 3TBSA 4XH2A 4GG8A 1MRFL 2B0SH 2I07B 3WMSA 5DRNA 1HXYA 4XWOC 3STZA 1K4CB 3MLYL 4LLWA 5HVHC 2AJUL 3MC0A 1XMWA 4IM8A 1DQDH 2DBJA 3GMPB 5HYFA 4PJBA 4Y4KB 4AM0A 5CSZB 2VE6A 2DM7A 1DUYB 1G7QA 5L6YL 3ARRA 1MY7A 2MMXA 5EBMA 3BUYB 3BZDA 2VWEE 5HHMD 1YEEL 1AE6H 1NLDL 1F3JB 5FKAA 2MPAL 3BAEL 1HSBA 4FNLH 5KSUB 4GKOA 5IMKB 1FVCA 1JPTL 3DVGA 4J3VA 4P2QE 4MLSA 4WWKD 2VXUH 5HHVH 1I1AA 4OZFA 1TQBC 2EE3A 4HT1H 4QO1A 3DRQA 4NO5A 3IJYB 4KV5E 2W9LA 2FGZA 4NGHL 5HDQH 3ZHLA 2EXWC 5D7IB 1E27A 1OP3H 2AJZA 4PJIF 1FCCA 3UX9B 4U6VH 5KVEL 3QNXA 3BP5A 2BVOB 4XXDA 1JFQH 2P47B 4HUVB 1SEBB 3HI5L 2H3NA 4MWFA 1I1YA 4JR9H 5DGRA 4AM0B 3I84A 3BIAX 1JYXA 5TE6H 4ZSOE 4NO3A 2XOTA 2X4UB 5C70A 5EBMB 1OGTB 4P9HC 5DMKA 4JFFB 2X1QA 3QUZD 5FYJH 1ROWA 1D5MB 3U79A 1MQ8A 3BP7A 2RCSH 5A1AA 1FVCB 5LBSL 1HHKA 1IC7H 3TBVA 3DVGB 1ZE3C 2X44D 1OD7A 3QSKB 5IVXE 1W2KT 2NY6B 4XB8A 4ZFFB 2EZ0D 2VXVH 2GI7A 3EYQC 3LQMA 4Q9RL 3NZ8B 4XTRC 4E41B 2P8LA 3BZ4A 4DGYL 3TA3D 5C09B 2VDQH 5D7LA 2VUYA 1BVKA 4FQIH 5DQ9A 3BP5B 2B20A 3KHQA 1XGQB 3WNLA 3MFFB 3RWHB 1GAFH 2FZ3A 3MRHB 4ELMA 2HLFD 3H3PL 3RNQB 2F54B 4U6YA 1KG0B 5DK3A 5D5MF 4BM7A 4UV7H 2NY2C 4I4WA 2F5AH 3QG7H 1FZOB 1MF2H 5DMKB 1QZ1A 3B4NA 3HE7A 4J4PA 4Q9QL 3G08B 3MLUL 4LSUL 1U8QB 2QQKH 3RL1A 3QH3B 5C9JA 1CU4H 1QSFA 5FOBB 4LCCB 4KXZI 5DEFA 1HHKB 1S7UA 2ZKHH 3BXNA 1C08B 4C56E 4QYOB 3LIZL 3OAYH 3DYMA 2EDBA 1N0XL 2BNRE 3LOWA 2ADJA 4KZDL 3ZE2F 3WUWG 1OGAB 4OM1H 2IGFL 4YHZL 5D7LB 2Z91B 3B2VH 2P45B 4PG2C 4ZNEA 3RVVC 4C4KO 3TFKD 2HP4A 4QCIA 4CDHA 4WI7A 4ELMB 4QRPA 1S9KC 3HB3D 1Q9WA 5I1JH 4CN6A 4GW4B 4XXCA 4JAMA 3P9WB 2YK1H 4OKDA 4L8SB 3B83A 4X7SH 4EXPX 2X9YA 2OP4H 3QCUH 4BUHA 1RZKC 1B9ZA 4QXGH 3RL1B 1MHHA 4FZ8H 4Y4KC 4X4ME 3SPVB 5AD0A 5DEFB 2R4RH 1JHTB 1S7UB 4KK8D 3WBDA 3AB0B 4G6JL 1LGVA 1MFEH 4HV8B 3G5VA 5C6PB 1YUHA 4HS6A 1Z9MA 5DC0A 2ZG2A 5ESAA 3WJLC 2V9RA 4LSDA 2JKXA 3DXAB 3H8NA 3PWVA 3WE6A 3WKMH 4IRJC 5EORL 1Z9SA 4QY8A 1FLRH 4BELD 3GKWH 3EDFA 1MLCB 4NQCD 4B5EA 3ILQD 4KJQC 2NTFA 3OB8A 4BFGA 1QPPA 3FQWB 4YPGA 5DJXB 1AGEA 5CILH 4K94L 4YBQC 1Q9OA 3V2AR 4P4KA 3ARWA 5IMMB 5FO7A 3N1PC 4F9LC 3WFZA 5TDNB 2Z8VC 3RIAF 1DDHB 1PQZB 4FXLA 1C12B