2MPAL

Bactericidal antibody against neisseria meningitidis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQTPLSLPVSLGDKASISCRSSQALVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVFFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
pubmed doi rcsb
molecule tags Immune system
molecule keywords MN12H2 IGG2A-KAPPA, light chain
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1999-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaL01
2CLRB 1LDPH 1W0WA 5BOZG 2M8XA 2P47B 4UBDD 2B5IC 3CLEH 5DD5H 4JFZL 4OSUH 1VFMA 5BMFL 2CIIB 3VDCA 1ES0B 1LEGB 2IALB 1MJ7L 3S88H 3GJFK 4JAMA 1DN0A 4LIQH 4P2RB 2QHLA 1MWAL 3QNZB 3UTPE 2ENYA 3H7LA 1B0GB 5DTFB 4XPHH 5T1LA 3T0BA 3SDAC 5IJKA 1ZHNB 4GMTL 1HQ4B 1MFDH 4WUUE 4UDTA 5MEPB 5IFJA 5I75C 1MPAL 1B4RA 5K59F 5DFVC 4UTAH 2X7LB 4XNMA 4JG0H 5ALBL 3L7EB 2IMMA 4GKNB 4OLWL 5LQBL 3WSQL 3ZKND 1JPGA 3BHBB 1OSZA 5KOMC 3IFLL 5C09A 2BSRB 1QSEE 5E6IA 4D9RD 4HLZH 1INQA 5JO5B 4D8PA 1T6VN 5LGJA 4FQXC 3LSOB 1I4FA 3MJGX 2Y06H 1BFOB 3O8XB 2J8UE 1CFQA 4IOFC 3OR7B 4JQIH 4OCRL 3EOTL 2HFTA 1VFAB 1HNGA 2PN5A 3LEVL 1AGDB 4KUCD 3ZT5A 1TLKA 4OLXL 4WO4D 3LS5H 4IIQA 43C9B 3CVHA 3FO9B 3QXAB 4G6JH 4WWKA 4RFOH 3Q6GH 3QRFM 1CTNA 4E0RB 2EDRA 1TQCC 5HD8C 5DZLA 5E94A 2VMFA 4MQTB 3C09B 4XNQB 4J3UA 4H0HB 4AG4L 4BK5A 1S7UA 4JFYA 1IC1A 2FR4A 1SY6H 4ODXB 4JDVA 5K59E 5E95B 1JBJA 1SBSL 4JO2H 1RUAL 2C3GA 3ZLQC 2WLYA 4KVCL 4AIZB 1B90A 4U3XA 4ODTL 3N1QC 3K0WA 1GVIA 3BWAA 1AXSA 5GGVL 4OCLC 5CP7A 2HG5B 4S2SA 1U41A 3EYSH 3DLQR 1NC4B 1I9RH 3MV8A 4BUGA 5J8OA 4NO5A 5F3BA 3IDUA 1ZT1A 4AEIL 2J8OA 5I75B 1T1XB 5EOCJ 2J4WH 1FZJB 2P48B 1UC6A 2VXSH 4M7JH 5DRNB 5AYQA 1JYNA 3GMOB 3S35L 1Z9OA 1NBYA 4PJXE 2NTFB 1J8HB 5CINL 3BPCA 5I2IB 4X8JA 3VFTA 4YLQT 1MREH 1X5XA 1YY8A 4H1LG 4W70A 3S37L 2EH8L 3ULVC 3AY4A 2ADJB 4AJ0A 5SWSE 1QNZL 2ZOKB 2OTWA 1YEKH 2EE6A 5MEPA 5IFJB 4FQQA 5C07D 4OGXH 32C2A 1INDH 2Y7QB 2DIBA 5BVPL 2A2QT 3T65A 2GK0A 2OP4L 4JVUA 4XB8A 4RBPH 3L3OA 4C57C 5L2JA 2IH3A 3FQTB 1MY7A 1HHHA 2WINB 4R4FL 2BRRH 3IAPA 2XWJB 5DMIL 3NFNA 4HS6B 5L6YL 3AREB 3SJVD 2CO6B 1ZMYA 4Y5XB 4NQED 3RIAF 3QBTB 1MJ7H 3S88L 3ZL4L 1VB9A 2KZWA 3DXAD 1ZSDA 5T1LD 3D39A 5E00B 1G7LB 2YA0A 4P57A 2BCKB 4L1HA 2X4QB 3O4LE 3FFCE 4Y2DB 1OP5K 1MUJA 4P46A 2O61B 2NY4B 4WIQA 2BDNH 1RK1A 2A1WL 2HFFA 3LKPA 4LBEA 2Q3AA 1Q9WB 2Q87A 4LLQA 4EZMA 1H5BC 1PZUB 4JFED 1FRGH 2RCSL 1LDSA 4Y4FD 4XBGB 2KBGA 3AU1A 4G42A 4MZ3A 4NZRH 1KCVL 1UEYA 3Q48A 5T3ZE 1AGFB 1Q1JH 2K7PA 3UO1L 5B3JE 3MV8E 1AD0A 3WUWA 1E28B 4BUHA 5BV7B 3QI9A 2WINA 4RFEB 4PTTB 1X5IA 4A6YH 4JO1L 1MFDL 3M17A 2YSSA 4QO1A 5A2FA 1YMHB 3BPOB 4MXQD 1DBAH 4XH2B 1RJLA 2BVOB 5I0DA 1LVEA 4TTDD 4DN4H 2MPAH 3ILPA 3C87A 3V4VH 1NGYA 1WBYA 4OLWH 5IROC 1A1MA 1P6AB 4X7SL 2H2PC 3GKWL 3AS1A 1QYGH 43CAA 1SYVB 1EV2E 4AZ8A 2FD6H 3SGKA 3LKQB 4IRJD 3DURB 5DK0A 1A6ZB 3WDIA 1CXHA 4HUNB 4JPKL 4S10A 5I73C 3U48A 2BFVH 3KPRB 3UYOD 1ZA6B 1F6FB 2UYLA 2HTKC 4JFHD 4LEOA 4QYOB 2ATKB 5E1AA 2J1KA 1ED3B 4ELMF 1G9NC 4HAGA 4IRSC 5C2BH 3PDOB 4NDMB 3BXNB 4FXLA 1J0YA 1L4IA 5H37H 4HEPG 4BZ2H 4Q9BA 5FHAL 3DRTB 2G60H 3PUCA 3MROA 4ZFOL 1B6UA 1BM3H 3FTGB 4OLZH 4GFTB 5TF0A 3U4AA 5I9QB 4RNRB 1FE8H 2W0FA 1OAXL 3C2AH 1G7PA 1RUPH 3E6HA 3EYQD 4FFVC 5TE7H 2Y5EA 3PXHA 3CSGA 1AXSB 4IRSD 2ADIA 4P49A 3ETBF 4ZUSB 2LVEA 5F7LB 4U1LA 3U6RA 3ZT6A 1XGUA 3V5DA 4KRPB 5IMLB 2EDBA 1IFHL 5E1HB 4Z7VF 3UTZB 1II4E 4Z7UF 2N4IA 2OR7A 5J1TC 2CD0A 4AEHL 4X6DB 4PJBF 3N1PC 1NFKA 3GBNL 1SYVA 2AJVH 5GGSA 3BYYA 4H88L 3OX8B 4P59H 2ESVB 2X42A 3D0LA 4AIOA 1IQDB 5T5FL 2HWZH 4XNYH 5I1EL 1QRNB 3MYJB 4EN3D 3H9ZA 3MRBA 5EU6A 1ZGLB 3TBWA 4FQJH 3WFHA 3QDMD 1NJ9A 4PV8A 3CD4A 4UIKH 4RFEA 3DXAA 5C07E 2A6JA 4PB0H 4I18C 2E7LA 4GW4B 1MHEA 1CD1A 5K9QI 1FG9C 1CDIA 4P46C 1IZKA 2PF6A 4RIRA 2YN5A 1HZHL 5IVXE 3O2VH 5D1QA 3CVIL 2ZUSA 2RBLA 5C3TA 4U1MA 1ACYL 1CWVA 2ZSWA 3DROA 1MCNA 1T2XA 5IB5A 1RK1B 4WRLA 1NCCH 4PJFB 4WU5A 3RJQB 2D7MA 4CU7A 5DVOA 5ITBL 2ZZUT 3QI9C 4FG6C 3UTSD 4NGHH 4Y4HA 3RVWD 1J18A 1PY4A 2LU4A 3GSNH 1GHFL 4P4KC 3QZWA 3FB6B 1KTLA 4N0UB 1HSAA 3EDKA 3BOVA 5CSGA 2YPLD 4KI5D 4MS8C 2A6IA 5HYJB 5GGVY 4G43B 4M1GL 4HHAA 4XNUH 2VDNL 1D5MA 2X4NB 3MUJA 4YC2C 5ABDE 2F9BT 4M9OA 4PJGB 3ULSB 4LHUG 4TUOA 3DWTA 1JNLH 3G5YB 1PLGL 2DM2A 3CFKB 1RMFL 2BZDA 4EQ2A 3B2UC 2FATL 5M95B 2H6PA 2ZCHH 2AXFA 1CDHA 3VXNB 5E4IA 2GSIA 3MJ8A 4JO1H 4XPFL 1XGPA 4P4RA 5EU3B 3ISWA 3T1FB 1XF4B 4XWOD 4XGZA 4PJHA 5KAQG 5HHQA 4H5SB 5J6HA 4PJ8C 1C5CH 5H8DA 3TYFA 3LOWA 1HIML 2BERA 5D7KD 1DBJL 1UB5A 4G8GE 1CR9H 3VXRD 2AK4B 4XMKL 2YA1A 4IM8A 1M05B 5FDWB 3PHQB 4TSBL 1FPTH 4MDIB 1F3JA 4J23A 4JDTH 3QO0B 3O4OB 2AW2A 5JZ7C 1L9MA 1HSBB 5LAXA 4MA1C 4G7VL 3GSWB 4LSDA 3JTSB 3EZ8A 4YDJB 4Q0XH 3I85A 1NCAL 2I07B 2X41A 1RZJC 3TO4C 1G0XA 3LV3B 5DO2C 2AK4E 4FZEL 1OCWL 5E8NA 4RDQG 3KAAA 5DXWA 5HD8D 1S9YB 5F7EH 2Y36H 4XPTL 1KIQB 1EPFA 4ZO8A 2A73A 2FCBA 2HAZA 5DEFA 1H3GA 3ARRA 2D7NA 3DX9A 5EU7C 2X4TA 1OM3L 4GRWE 1AD9A 2DKSA 5AZ2H 1G6RA 2DS4A 3FRUA 1F4WL 1PKOA 3X14B 1VFAA 3VFGL 4NO0D 2CDFB 1R5VB 1NFDF 1Q94B 1IM3B 2XG5A 1OAYL 3CAFA 3H9HB 4XCFH 1K4CB 4V2BA 4MCZB 3L3GB 5AYUH 3ZYOA 3EDDA 1AKJA 4PP1D 4QOKE 3EOBA 3PWVB 3ME0A 4G8IB 1ZGLM 2UYLB 4LEOB 5E1AB 1MCJA 1JI1A 3D85B 5C0AB 2R0WH 3KYOA 1FN4A 3ZKNC 3VFSA 3EYVA 5JW5B 1BQHG 1JHTA 1TZHB 3JZ7A 4LVOC 5JHDA 4HKBA 1EO8L 1B2WH 4XVTL 2HN7A 1N7ML 3PQYE 3NZHH 3RU8H 2R0KL 3DYMA 3FO1B 4A6YL 4BKLA 2HT4C 2ZUWA 4U1JB 4GMSH 3D3VA 4ZS7H 2FNBA 3MA7A 3LV3A 4QYOA 4YK4B 5C08D 1EAJA 4YBLB 3SDAD 4OQTL 3FO0H 3GJEA 4LPWA 1YMME 3RIAK 3CIQA 1HHKB 4MQXC 4B5EA 1AO7A 3G5VA 1AQKH 1EBAA 2JIXB 2Y07H 4KJWC 3VGBA 3JV6B 2X05A 3JV0A 1JK8A 3LSOA 3MUHL 4AL8L 1JWUA 4BQ8A 3MJ7B 1LMKA 3BE1L 4EI5D 5C9JA 2KPNA 1AC6A 1I9RL 3SE9L 1EGJL 1JHLL 1UB6A 3VFOB 3FQXA 4GS7C 4P2OB 4LSQH 5DVMA 5IUSA 1BZ7A 5I1CH 4DVRL 3QEQD 2PYEB 4C55A 2NW2A 1Z2KA 5IMKA 2WBKA 1XGYL 4K7PL 1Y18A 2IBGA 4YHLL 1U3YA 4PJ5A 5ESAB 5FYKE 4CDGC 4DEPB 5KS9F 1PSKH 3S37H 5H94A 1KLGA 4P23C 3SKOB 4XMPH 5F1NA 1B0WA 4RA0C 1MCPL 3O3BB 2X1WL 3CXDH 4N8VA 1ZVHA 4NJAH 5AAMA 1KT2A 4Y5VB 5IB5B 3FQNA 4EDWL 4X5WB 3ARUA 2ZPKL 2P1YA 3G5YA 1G9NL 3ARQA 3D2UB 5IFAL 1ZLUK 3FFDA 1P4IL 2YZ8A 3QUKB 5EO0A 4M3KB 2CRMA 1K9TA 5E8EA 5INDB 2BP3A 3MRMA 2J6EA 1LILA 3R8BB 5KSAC 4HK0A 1ZANL 3WIFA 4K8RL 4NFDA 2AV7B 5FB8B 1WAAE 1NCNA 1QA9B 1M71B 1I1FB 2E27H 4ODSH 4BK4A 1G7JA 5DC9B 5HHOB 1ZK9A 1I3RA 1IGJB 5F7HA 1RK0B 5AD0A 3QP3A 5CJQH 3MNVA 2OS7A 5J56B 2CQVA 5FA4A 2W65B 2X4UB 4MQXD 3BPLC 2YPVL 1AXIB 5BRZB 4OCYL 5F89B 2VABA 4J8RB 3LIZH 4PGDA 2KUTA 4V1DD 4X8XA 2WW8A 3VRLF 4HJJH 4OUUA 5GS2D 4X80L 3VXMB 1CDUA 2ADJA 3N9GL 4PBVC 3CC5A 4OIIL 1MIEH 1RJYB 5IEHB 2NX5D 2VH5L 1X5JA 1WIUA 3DRQA 1JZ4A 4P3WA 3BP5B 3IXTB 2HJKB 4GRWB 4XPGL 2NXYC 5AYUL 4JO4H 3IJHA 2F54E 1WCBB 5DJYB 4YHPA 4BH7B 2O5YL 4OZ4B 5BO1H 4FRWA 5CUSL 2ZUQB 2ICWJ 5CSZB 1WWBX 3ZKMC 4L8SC 3IAQA 2C3VB 3BGFC 3QUZA 3X12A 1WAAF 3FJTA 1HXMB 4HGWB 1UA6L 2R56H 3W11D 1DQLH 1PY9A 3GSNB 1VKXB 1AHWA 5E2JA 1RU9L 1CLOL 5JIIA 4HAFA 2I9TB 35C8H 2Y06L 3O41B 1A6PA 2NQCA 3UPRA 2ZJSH 5F96H 25C8H 3TPKA 1KC5L 1UM4H 3X13A 4ZUSA 1R3JA 4HWZB 5ANME 4OCRH 5JPMB 1T20A 2YD1A 2W91A 4R0LA 4WCYH 5I15L 2WSKA 5TFSL 3CLFL 4OGYL 5ESVA 3L9RA 4OUOA 3CXHJ 3LS5L 4F7CA 4WWID 1LO4L 3CXHK 4L4TA 3SE9H 1QOKA 4NIKB 2OTUA 4Z5RB 2DQDL 5EZLB 4OZFB 2P4AB 2WIIA 3VH8A 1I1AA 1FL6B 2FWOA 4X5LA 4PRPD 3FCTB 4PV9A 3QUMB 2F15A 1J1OH 3QUXC 1ZHBA 5T1KD 1XGYH 3SO5A 3BD4A 1WJ3A 1YDPA 5GGUB 3IDXL 3DVFA 1EHNA 5DJYA 1NDGA 1S9VA 3QDGB 4JREC 1WQVT 4NRYA 3PV7A 5EBLB 5HHQB 4MJ4A 2UV3A 5FO8A 4Q7DA 2Y5TB 5MENA 4XWOC 2ZKHL 4YFDB 4NM8H 5E03A 5L0QC 1MI5B 5JHLH 4GSDH 2GJ6E 3TBVB 1JWMB 3EYOA 2VR9A 1C5DA 3U0PB 3UJIL 2NX5B 3E8UL 3V6OA 1MRDH 3QWOB 2DQTH 5LGHL 2XYCA 2ZUQC 2ADFL 3VXMD 2YHGA 1MCSA 4MD0A 3T0AA 1NCAH 5ALCL 1Q0XL 4OTXL 2VN4A 4U6HB 4PJ5D 5B39G 3FT3B 3V7AG 3DMMC 1Q38A 4M02A 3T2NL 3MCLH 1IBGH 1MREL 5E9DA 1IAKB 4OFDA 5F7EL 1IEAA 4P9MH 1CXLA 3BISA 5EUOA 4MS8D 2W9DL 2VL5A 1F58L 2FBJL 3N1GC 3OKOB 3C5SA 1ZXQA 5DJ8B 1ZT4A 4QT5B 1WTLA 2OP4H 1F4WH 3KDMA 5C0CE 3QI9D 3AB0C 3MLTB 32C2B 5C86A 1FNEA 5IGXH 4ZXBB 5BS0E 3U2SB 5EFIB 4LRIA 3PQYA 4ETYA 1SVZA 1WIOA 3BRFA 4LASH 2NY2B 2Y5TA 2NCMA 4JLRA 1BX2A 1N0XH 5DD0L 4F2MB 3H2WA 2IPTL 3ZE0F 1BD2A 3RNQB 1J0JA 1NBYB 2BVPA 2GCYB 4PJIB 3D5OF 3WFCL 4PJ7B 1DSFL 2EDTA 2CRYA 3ZKMD 3TNNB 3GHEL 5A2JH 3BKCL 3KHOA 1IAKA 1I7UB 3HMWL 3IDMB 5C0FA 3LB6C 4EIZC 1A47A 3FN0L 1S7WA 5MENE 1BLNA 1VACB 3MZGB 1I1RA 2M1KA 1W8NA 2OJZL 3MV9D 2GAZB 5CWSB 3UDWC 1OP5H 5A2IH 3Q6FB 2C4FT 5LVEA 4MLSA 1HYSD 5D7IA 4DCQA 4P2OD 4NPYA 4W6YB 5ETUB 1QFWL 2XZAH 2WMPA 1Q9OB 3OX8A 1K8DB 1N8ZA 3AFLA 2DKUA 2JELL 1ZLWH 4LSUH 2B20A 3KXFA 4OD3H 3VCLB 2UZIL 3VG9B 4Z7WA 1BJMA 1FVEA 3FKUS 4KI5F 4UT7H 3EJZD 3V4VL 3CDGB 1FVCA 4FFVD 1FCGA 4MCYA 1GOFA 3E6HB 3O2DH 3I02A 3IDYB 3U0TA 1FHGA 1BGXL 4OCSL 1ONQB 1P1ZB 1UZ8B 3K74B 1FJ1B 1T80A 3GMMA 5KW9H 1G7QB 2PXYC 5EZLA 4K55A 3X14A 3BZEB 2AJXL 3TWCH 1IJ9A 3UAJC 3P0YL 4FA8A 1INQB 4RFNB 3KPRE 2F5BH 1PG7W 1HHGB 4Z76B 1I7TB 4GXUN 5IEKB 4U1NA 2DDQL 2VDRH 3MLVL 3F58L 1QBMH 1T83C 5E99H 5D6CB 2AS5M 4Q9QH 1JUFB 4PJHE 4TULL 4NRXA 2UWEB 4KU1A 1VADA 4Z8FH 4JVPA 4FQXB 3GB7B 3NCJH 1CFNA 5TDPA 3O6FC 1CBVH 1MAKA 3L6FA 3QB7C 2HA1A 5CZVH 4Z7WB 3L1OL 3C2AL 2A6DA 1FYTB 1IGTA 1VADB 3LQMA 4XVUD 1T7WA 2PUQT 5C2BL 1UT9A 1FL5A 3DI3B 4GMTH 4LF3B 5E2UL 1A6VL 4Z0BH 3WUWG 4DAGH 3QIWC 1I7TA 1JMXA 4G80B 5DUBA 3SDXE 5I8OH 2IALA 3HG1D 3I6KB 1AXTH 3W0WE 1JYXA 5CJ5A 1BJ1H 3HAEB 1YEFH 3BO8A 1BVLB 1ZHKA 5D7LD 1YEDA 3BRGC 4JCMA 5A2LH 4F9LA 5ACMA 1U3HD 3CFBB 2GK2A 2BHYA 5LGHH 4S0TD 4HPOL 2IAMD 1MLCB 1QFWM 4MX7B 5D4QA 2AGJL 4YHOH 1UWEL 2UUDH 4YIQA 5EUKB 1V3KA 1T4KA 1TNNA 1NCBH 2VXUH 4A2MA 2VOTA 1KJVB 1FNEB 1XIWA 4WTZA 5EC1A 3P0GB 3V52L 4TSCH 2VZUA 4EXPX 3NACH 1N8ZB 4UIKL 1J88A 5KZCD 2Y07L 4K9EL 2QHRH 2YOCA 3U0WH 4MA8L 1WBYB 3QQ3A 5F9WC 3MV9E 3VA6A 1HK6A 4UIMA 4X6CF 4U0RC 4FQ1H 3LN4B 1S9XA 1KG0A 1LD9B 5BCAA 3WXVH 1BD2E 4LSQL 1OAUH 3V95A 2GJZB 5CIPA 3KJ6L 3O6LL 4F58H 3VRIA 4LCCC 1HINH 4O51B 4NZDA 4J3SA 4C56A 1KCSL 3C2SA 3E1F1 4G9DB 4PJEB 2FO1A 3WFDH 4HUMB 3VFOA 2GCYA 2DTSA 4D9LH 2B4CL 5HDBF 4HC1H 4RGMB 1G6VK 2R1XA 4I0CC 3KYAA 5HGDA 5IW1A 4JFOB 3SO3B 1V3MA 4LL9A 5D7JB 5MENB 4G8EA 4N90D 3LKPB 4LBEB 2XPGB 5SX5K 2JELH 5FUCE 1JPST 4UILL 2CR6A 5EUOE 1FIEA 2DIJA 2XTJE 1PBYA 1A1NA 3S35H 4GAGH 3Q3GA 4NN5C 2A6JB 3TO4D 2VDKL 4I2XE 3RX5A 1YPZE 4JPIB 1TITA 1CFTB 3FT4B 4JHBA 3LCYA 1OP3H 3MLWH 3RWJA 1ADQH 2Q20A 3FONA 1CLYL 4PJGF 4GAJL 5GGUA 3DV4A 3VFRB 5F9OL 5ISZA 4NQEE 3SDXA 3HNTL 3SJVE 5SX4I 1YN6A 2AEWA 3BQUD 3OG6B 2P24B 3ES6A 2BXYA 3VWJA 1U8MA 3MREA 4I2XB 4LCYA 4JDZB 1UZ6F 4M7LL 4OV5A 2Q7YB 4PJ8D 2ATPA 3OWEA 2Q1EA 5HJ3B 1QFHA 5I1HL 4O2EA 2OTWB 1INDL 2AEQL 5ALCH 5DVNA 1FL3B 3NABL 1VPOH 5HGBA 3WO4B 1O5DT 2AXGB 5SX4H 2ED8A 3LPGA 2R2EB 3C5JA 1Q9KB 1RZIA 4HUUB 3BQUA 3HG1B 1HXMA 4JFXB 1BFVL 4L5FL 1AJ7L 5MP6L 3OB8A 4EUPB 1FNSH 5HVFB 3F7VB 3FQUA 3B9AA 5AWNH 3HCVB 3LKOA 4LOUD 3VXPB 5F8QC 4HCRH 5HVHB 3RWEB 3C5ZB 5F93C 5CP7B 5GSRB 5LCVL 1UKTA 4FQXD 2VXQL 4TQEL 2GITA 4WW1A 4YXLL 1ZEAL 1QQDA 2G9HA 1I1CA 4W68A 4U3CA 5FUZL 2IAMA 3RX7A 4HUVB 3OR6B 3RVWC 4N0FB 1EJOH 1U8IA 2CLZA 1UH4A 3VD4A 4XPHL 3TYFB 5JQHC 3INUL 3O3DA 1RIUH 1A7PH 2J6EH 43CAB 3QXTA 1TQBC 1A9BA 4R3SB 1RZIB 1WZMA 4IIQB 4HIJA 5HGBB 5F7YC 2N1KA 5ENWA 2BNQA 3IETB 3TA3D 1YMHA 5ACZA 1YJDL 5TPWH 2E7MA 2WUBL 1M6OB 3HC3L 3DYOA 1U3HC 4PJFE 3T0DA 3ULUL 3EO1A 3WS3B 3NZHL 3RU8L 2XXMB 5JOFB 3RGVA 1RK0A 5AD0B 5DJAB 1HINL 2OR9H 5KVDH 1WZKA 3UTTA 1Z5LA 1IC5H 1EA9C 1U8JA 4ESKA 3HC4L 4C56B 2G5BB 4DUXA 2EIZA 1JRHI 2IPKA 2YPKA 1DR9A 2R23B 3DSNA 4O9HL 4X5WA 5CIPB 3VXSA 3JWDH 2Q76B 4UQ2B 4X99B 5D2NC 2BOBB 3CVHH 4KQ4L 4FXGA 5T1DL 3RGVD 1AQDB 1LP9E 4TNWK 1BZQK 1KJ2B 2R0KH 4ZO6A 4WFGD 1LO0L 5E00A 2KKQA 2R39A 3S7GA 5D2NE 1JRHH 3KDMB 3L5XH 4X99A 5DI8B 3QUYA 4JZOA 2ZUYA 4XAKE 4OI7A 2YXMA 4S0SD 4LCUA 3V6OE 4JJ5B 3LEVH 3ARGC 3STZB 5DEGA 1RZKL 5TDOA 1OARH 3HHRB 3BEWB 4RMRA 5E9DE 1OW0A 3TC9A 3S36L 1CBVL 3UAJD 1T04B 3T65B 2OBGA 3X3FL 2ZCKL 4CU6A 1HSAB 2W60B 1YEDB 3MV9A 3VGAC 5HGHB 5TDOB 3NBNA 2DTMH 1JZ6A 3BDYH 3K1DA 1JGEA 4NQEB 4HS6A 4OM0L 4FQJL 2VDLH 5EBWA 4HMEA 3QUKA 4KK5C 5DC0A 2X1PA 1NAMA 3RIFF 2IANB 4JZNB 4YO0A 2HTKD 1HKFA 1HEZA 4ZD3L 1SEBB 4JY4B 2JK5B 3DJ9A 4YXHH 2FX7H 5D70H 2F53E 5TE4L 5DRZB 2GUOB 5DRXB 5MI0B 1DANT 1NMAH 3VXUA 2J88L 2V7NB 3I6LD 4HUKB 1UKSA 2VDML 4PRDB 1MNUL 1QLRA 1ROWA 2COQA 3S8WA 3HG1E 2FWOB 1UWEH 2X4SB 4TTDC 2J8UA 2VDOH 4TRPH 4MCZA 3UCRA 1XCQB 1HWGB 1BOGA 1MHCA 4K8RH 3C5ZA 2ZNXA 3MLZH 3DX8B 4ODXA 5DT1L 4YXLH 3V52H 4XC3H 1XIWC 2OQJB 5CKAA 4XVSH 1DVFD 1J0IA 1NBVL 5D1XB 3OKDB 5F9DC 4HGKC 3PL6B 3L5WB 2FL5B 1C8PA 3IFNL 5L8KB 4LPXA 4FQ1L 3CVHB 1WBXB 4PJ9B 5D93B 2AXGA 1NGQL 1A3QA 1RZGA 3D3VB 4H25B 1S7TB 2UWEF 4EJ1C 2DI7A 4PY8I 1A9BB 1RZFH 1HI6B 4JM4L 3T3PF 3O3EA 4JFYB 1G9EA 1WSST 1ORSB 2VDNH 3MOAH 5DUPH 5IB1B 1OF2B 2ESVE 3DURA 4LEXH 4K3DH 5A16B 1NGWB 4E0RA 4Y4KD 2OQJA 5TQ0L 1DQQB 3ZE0E 3G08B 5ITFA 4F9PA 1JWSA 5ILTH 3HZKB 4PJBE 3ZDZE 3DUUA 3RWDB 5I66A 1FIGL 1Z0MA 4S1QH 5SWZB 1C7SA 4UV7L 3GSWA 1TCMA 2RIKA 3HZMB 3GJFA 4G6FD 5CILL 3QCTH 4OJFL 2WV3A 2YKLH 1NKRA 4ETQB 1LE5B 1ORQB 1K4CA 3QIUC 4ZNCD 5BXFA 3IDMA 4GG6F 3BSZL 1A1OB 2PW2A 5DK3A 2D9CA 1IKNA 2IPUK 3HI6H 4QTHA 2BSSA 2R29L 3REWB 2P8PB 4KJQD 5DEFB 3HMXH 5FUCC 2DQDH 4GAJH 2N7AA 1ZLVH 3WDJA 1KJ2L 1OSZB 4JANA 4U1KB 5D71H 3HG1A 1HEZB 4HIIA 4JZNA 4YO0B 1VFOA 3QULA 3L5HA 4R8WH 4J7RA 3QXDB 2CKBL 2DQGL 4U2ZA 5BV7C 4R2GB 3BP7B 1I3RB 1IGJA 5BV7H 2HFGL 2V17L 3ARGA 4XVJL 5EPMA 4OLVH 5SV4A 2EXWC 4GUPB 4AK1A 5C0DA 3TBTA 5ISZD 3VXUE 4R7NB 4O2EB 1NUGA 4G8GA 1NDMA 1YNTB 2H32H 1DDHB 1YYMH 5LAXB 5C7XL 1T5XA 4TSBH 1WITA 4RAVA 4TUOB 1A5FH 4Z7VB 3LZFL 3ZYJA 2DQEH 5DJ8A 4MAUL 5D8JH 2X4PB 4MDIA 4OI9A 5DR5H 1F13A 3BH9A 1N4XH 2R1YA 2VAAA 1S78D 4PBWD 4PRNB 5FO7B 5ICXB 4PY7B 2VZ3A 3RDTB 3VU2A 3WUWB 3OF6A 5MEOB 3W39B 4WVRA 4NN7C 2IBBA 3RWFA 2NY1C 5ERWA 1EHAA 1FH5L 3EFFA 2R8SH 4JFDB 2CKNA 5DS8B 3C6LD 4N9GA 4XPTH 4GS7B 1NAMB 2DQUL 4ODVH 2HJFB 4HKXB 5E6ID 1TVBB 3O2DA 3QHFL 3ZDXF 4YDKL 1KLGB 3BIBX 3KPSE 4JN2A 1E27A 3MRDB 2G75A 3X3FH 4QTIL 4NO2A 2BJMH 2QSVA 5KN5A 5KVFL 4G8EB 1I9EA 5M7QA 2QQKH 2ZSWB 3QIBC 2XG4A 4GQ9H 2YPKB 4NC2B 4WI2A 4JFZH 2Z31D 5HGDB 2OM5A 3C5SB 3QO1B 4M5ZL 2R0ZH 4EI6B 1BAFL 5IHUH 5DJ6B 5HI3D 2Z91B 2CH8A 1MFCL 3C8DA 4KJYA 4Y5VC 4JHWH 4KQ3H 1NGPL 2CDEB 4MJIA 4DTGL 2WBJB 5GGTA 3FQRA 1BBDH 4YXHL 4M61A 5B38A 5ESQB 2C1OA 3SKNB 2FZ3B 1C16A 3C8KB 3P73A 4G5ZH 1RULH 4Y0GA 1PG7X 2G2RB 4UIMB 4MHHG 1T1WB 5T5FH 3EDFA 3HS0B 4M8QB 3VFPB 2WWMD 2EE2A 4WEMB 5I1CL 4PJDB 2Y25A 3CZJA 3GKZA 3MLZL 4PJIF 3DVNB 5DVLA 1RZFL 4JM4H 4K71B 4K7PH 4UAOC 2BNQE 1DZBA 4JFEE 2GY7B 1U8IB 2CLZB 2V9RA 3PIQA 4K3DL 2VLME 3WIIL 1RJZA 2XN9A 4MLIA 4NJ9H 4WUUB 5FM5O 1GGIH 1WK0A 4MXWL 4GW1B 5FCUL 5GZOD 1YC8A 5C08B 3QJFA 4GRWF 1PQZB 4NFBA 1CICC 3LDBB 3G6DL 5D6DC 4NBXB 5DEZA 4MNHB 3BT2H 3QUZB 5T5NG 2BNQB 4G6JL 4L4TE 5EBMA 4FQLH 4ZFFB 2XIDA 4G6ML 2X2YA 2H1PL 4NP4H 4D2NA 1VPOL 3DUUB 4M62L 1AY1H 1HYRC 1RIHH 2FEDC 4QHLA 4RZCA 5CBAB 3NCYS 4CRPA 4YX2L 4BFIB 5J0BA 2EKJA 4NO3A 3VJ6A 2AABL 1P84K 1HKLH 3ARFC 3PP3K 5SV3A 1EMTH 1ZANH 4L8SB 4EI5A 2RAMA 3W0WA 5BVPH 4FABH 2V5TA 2B7DT 5DD3L 4MNQD 3G6JA 1Y0LB 2ZSVB 4YHKL 1YPZF 1WIPA 4UUJB 3V8CA 4IDJH 3MV8D 1EZVX 4RQQB 1CF8L 4ONFH 4GBXD 2A0LC 4RZCB 5CBAA 3SOBH 5IT2L 3T0WA 3QFJD 1CGUA 3I9GL 2E27L 3HE6A 5KSBB 3V4UL 1F00I 2R4SL 3VXOB 4NZUH 5BVJA 4Y1AD 4HLZG 5DMIH 5IROA 2VITA 3HNVL 5KS9A 3N85L 4G8FB 8FABA 5IIEB 1A7QH 3OV6A 5C8JB 1KB5A 4KPHH 2BC4B 4QEGA 1N6VA 3VXUD 5EOQL 2BNUA 1ED3A 3LS4L 2F19L 3HZYA 1EX0A 4XTRD 1N3NB 5EU7E 3VXNA 1FO0B 5CZXC 1K8IB 3BKML 2BDNL 4KDTC 3WLBA 4JRYB 1KCVH 2Y72A 3GSUB 5E24E 4WENB 5F1IA 1TVHA 4PJDA 5J6GA 3PGDA 4MMZC 1AGCA 4ZO9A 1D5ZA 2EICA 5B39A 1KJ2A 2H2SD 3LQAH 4UINH 3QYCA 4DFIA 1DEEB 4K94L 2ZJSL 3GM0A 4DKEH 4ZQKA 2KQMA 1RHHA 4QRPD 1IQWL 2X4PA 3KXFE 2J8HA 2V2WA 4PP1C 4J2XA 4PGEA 4NQVB 4QTIH 3TV3L 5I18H 3GMNB 3VGGA 4EVNB 1MCBA 1J87A 3QPXH 5F96L 1XCTB 4QCIB 5T3ZD 3UTTB 3RAJH 3RTQB 3NGBC 3NPSB 4LIQL 5HBBA 4NQUA 2AGJH 2PO6B 2DLEA 4JN1H 1MI5A 4H0GA 1B2WL 1I1AD 3PJSB 4I9WD 2VRAA 5AUMA 5HYJD 2HH0H 3ORJA 4LMQE 2QSTA 1W72L 4LIQE 4POZD 5I16A 4X6CB 4QHUA 4OZHA 3WO3B 4DOHB 3EZJB 1A22B 3L3DB 4Z7UE 3O3BA 4O58L 1W8OA 1AQDA 1J0HA 1T89A 2B4CH 3CFDB 3UTTE 2FX9L 3UTSB 4NQVA 4PJ5E 3WL9A 4HJ0C 3DXAE 5C07A 1XGRB 5DHYA 3RI5K 1FG2A 1BEYH 1TTGA 3OJVC 1H3VA 3VRLE 1DQDL 3GIVA 5KSVB 5EO1A 1NLDL 1NC2D 1FC2D 1RQ5A 3BRDA 1P4BH 2G5BA 1EEZA 1R3LB 4JM2D 3RUGF 2MSPA 2NY2C 1MH5B 2R1YB 1IAII 4X0KB 4RA3A 1GXEA 4HIHA 4TTGA 1U92A 2P43B 1DQQA 4MB4A 1F4AA 1Q0YL 1JK8B 5GGSB 5D1QC 4M62H 3S3SA 5EBGA 5FFLA 1JHKH 5CP3H 1Q72L 3ARFA 4KMTH 2E9IA 4JDVB 3L6FB 3PGFH 3BP6B 3HZYB 3VXPA 3VG0L 4M43L 1PZ5B 3UPCA 4OFVA 4JJHA 1I8MA 2ZPKH 4NZJA 3DX9B 1UCTA 5DZNA 2WIMA 3MO1A 1NBZA 2F58L 5BZWB 5JHDE 1GC1L 4PP2A 2B0SL 4ZYKA 4HDIB 1C12A 4FNLH 5D1XA 3B2UD 1FFOA 1D5IH 4P5TA 1P5UA 1YUHA 4WHYG 2AEQH 3HE6C 3MRQB 4LHUA 2A74B 4O2FA 4U6XA 1G7QA 3SN6N 4I13B 1XF2B 1DL7H 3QNXB 1IAOB 5JXED 2GJ6A 2JLLA 4BSWB 4Z78B 5IGXL 1E4WL 2X40A 5KJRH 1G7HA 4KRPD 4KI5C 4IOSD 4Y16B 5CEZH 3CFJA 1QFUH 5KVFH 1C08A 4CVXB 1CLZL 3EIFA 4GOSA 1JL8A 4WU7B 1IAOA 2HT3D 3OKMA 3QNXA 5F7DB 4QXGH 3TJEH 3GBLA 4L4JA 4OLYH 4ODWA 1CFNB 5C09B 3FN9A 3W9DB 1UH3A 1GZQB 2ZUTA 5IB2B 3KPNA 2GSGA 4MXVF 1OTTD 3EJYC 3R06B 2Q7NA 1TMCB 5HY9A 1AGEA 3N0PB 4LPYA 5HHXL 4DW2H 1TJIH 5JMOC 1EEYA 5T3XE 4DUWA 1BFVH 4LVHC 3B2VL 3NFPB 4PRBB 2FHFA 2OL3B 2AQ1A 3QQ4A 5T1KA 4F37F 1FGNH 3HAEH 2ITDB 4K2UH 5C09E 4Z6AT 3U4BH 4RX4D 3RVUC 2VC2H 4FFYH 5F7KC 1NSNL 1WFUA 4MD4A 5E2TL 4KROD 2MWCA 4OCYH 1MCCA 5HGAB 4HK0B 1RUML 5IK3A 2I5YH 2Q6WA 5CEYA 5EOCL 5ITBH 2BY0A 1RUQH 4Y4KA 4HFWB 5AAWA 4XP6H 4PJCF 1SJEB 3HNSL 3HI6L 3OSKA 1YN7B 4NKDB 3B9KA 3KXFB 4UT7L 3DVIA 1OWWA 2DI8A 5JDSB 1BP3B 4LCIL 1EJOL 4K23H 5J6HB 2HMIC 4H5SA 2VWEC 4CMHC 4DQOL 4PLOB 3RWCA 3LY6A 2VQ1A 3O4LB 3FFCB 1BD2D 2WLZA 2ZNWA 2XACC 3OPZL 4N8VB 1FZKA 2VLJA 3LRSA 5IR1A 2XY2A 4ENEC 4EUPG 3VDBA 3RWIA 5I1GL 3VFUA 4RMTA 5D72H 4JRWA 2DWDA 3PF2A 4KAQH 1TPXB 3OZ9H 5F9AC 2NZIA 4L3CB 4QRPB 5DJZA 3WIHH 3T3PE 1P9MA 2XZCL 3KGRA 1Z3GH 4XI5D 4ZTPL 4C56E 1UQSB 4WCYL 4R90H 1LQSR 4NQXA 2AERT 5FO9B 2ZCHL 2CK2A 4NN6C 2R1WB 3NFNB 2V2TB 1C1EH 2OI9B 1EO5A 4I8DA 1QPPA 3ZDZF 1P7QD 3F12A 3TM6A 3FZUC 2VR5A 4OIBA 1PD6A 1RU9H 4OBRA 4G7VH 1FDLL 2OR8A 4U6HA 5IHZA 4YPJA 1OTSC 4PGEB 1WT5A 1A3RH 1ND0B 1HH9A 2FJHB 2JIXA 2AI0L 2YA2A 5D5MA 4MDJB 4NWTL 2YBRA 1H5BA 4WHDA 5DJZB 1CI5A 2DQUH 1JHKL 2APTA 1CR9L 3OGCB 5FYKD 1KGCD 4NO0A 5H37G 3SJVB 1LHZA 2OTPA 4FHBD 4ZAKC 1FZKB 5HVGB 5KVMC 4PRHA 4V1DE 4E42A 5FYJU 1FAIH 1ZT4B 4LF3A 4QT5A 3QUYB 5F21B 1S5IH 1ZKAA 1N0LA 2DQFB 1KB9J 1CXFA 3KWWA 5I1AB 4IRJC 2Q86A 2BX5A 3HE7D 3O9WA 2CUMA 5B8CA 1N64H 3F65A 2CK0H 3S96A 5I30H 5C0EB 5C0AA 3T0EC 2ARJQ 3MV8B 3DTXA 5FIEA 2HKHL 1VERA 2QTEA 3RY6C 3IDJA 4OD1L 5GJSH 5IMKB 5IHBA 4JRXE 4U6YB 4YHOL 4URTB 4KKAC 4FQHB 4KVNL 4WUKH 3ZZ1A 1CFVH 5TE4H 2OMBA 2MOVA 1YEGH 1ZA3A 3I50H 5HI3C 3RWEA 5I0ZA 2W9DH 4ZFZA 4APQB 1AD9B 5IK3B 1JWUB 2VE6B 3MRHA 2EYTA 3GNMH 5IOPA 5DJCB 2OMNA 4ERSL 2OXGA 4R4BA 1AO7B 3G5VB 2ESVA 1X4XA 5JHDD 4PGBA 1FO0H 5AZ2L 1GYAA 3GK8L 4HUUA 1IL1B 4UZGA 3RP1A 3NACL 3VXTA 4ZD3H 2XTJD 5KS9E 4GO6B 1PZ5A 3R0NA 1YDPB 4LRNL 1DBKH 1S3KH 1A9EB 4XC3L 1MHPH 4EDXB 3C6LC 1YEHH 3QEHA 3MQIA 4MXWH 1UXSA 2HTLD 4PGBB 3GB7A 3OXRA 3VJ6B 3R06A 5JW5A 4TUJA 2GHWB 3WO4C 4OLYL 5D2LE 5I73B 1IGFH 1WEJH 2EDFA 3VD9A 1EXUA 4JR9L 3HFMH 4HFUL 3BGMA 2B4CC 3VFRA 3PHOB 4F3FB 4NYLB 1A6WL 4CW1A 2M2DA 2XNAB 1MFBL 3LQZB 4TPRL 1M7DA 4PUBH 4HT1L 1ADQL 1JV5B 1XGRA 1HI6A 2XA8L 7CGTA 2ARJB 4JFQB 5SWSB 4UNTA 1S9WA 1ZVYA 3IFNH 4RFOL 1DUYB 2ATKA 3RL1B 1IGIH 1QKZL 5F3HB 4OLXH 4M6OH 5H35A 1YEJL 5I1IL 3LAFA 5DTFA 3U7YL 4XZUA 3ROLB 2C4XA 3ULVD 4PRHB 5FA4B 4DN3L 1IKFL 1AGBB 3K7UA 1CF8H 4YGVB 4I18A 2E7LC 4WI3A 1CLYH 1XF3A 5L2KA 1XEDA 3LRHA 2DN7A 4G43A 4UTBL 1I3GH 1F11A 3ALPA 4K7PX 4HS8L 1TCRB 4O51A 4EEEA 4QOKD 4YEEA 4O2CB 3V4PH 1TFHA 5TQ2L 1OSPH 3L3KA 1S9XB 1I7ZA 3RQ3A 3U1SH 4EBQL 2EDOA 2IBZX 1CDYA 5F8RC 3TNNA 2B0SH 1L0XA 3GMPA 5BS0A 5FOBB 4XCEB 4ZAKA 3RWHB 1R3KA 1BBJB 3QCVL 4S1SL 1QG3A 1TZIB 1NCWL 4LLVA 2EDHA 5EC2B 2QLVB 1DP0A 2PYEE 4CADB 3V79C 3CDCA 1HH6B 4GXUM 4XNZB 3N9GH 3BZFA 3JWNC 2XTJC 2QKIA 4J1UA 4I0KA 2BRRL 5KJRL 4R8WL 3T0EA 5FGBA 3MRFA 1LP9B 2H26B 2GJ6D 3INUH 5GS1C 3D39E 1C5BH 4OM1L 4Z18A 2PXYB 2EEAA 5FO8B 5LCVH 2PO6A 4W4OA 5FAAA 4C4KT 4R2GD 4Q58C 1U6AH 1P6FA 1WBZB 5HYJE 2EIBA 1I3VA 1I3UA 4LCWA 2PYFB 5DFTA 1CK0L 4XB7A 3D2UA 5FV1L 2JJSC 1A4JA 4P4KB 1CQYA 4PJGE 3NCYP 5BO1L 3AXLA 1I9JL 3SQOH 1DQLL 2Z35A 2ZG1A 1NEZB 1RIUL 2D0HA 4MQ7A 1BQHA 4XPGH 3MLPA 3DHMA 1NANI 5FK9B 4HUXA 1T83A 2LV4A 1R0AL 3O2WL 5ESVB 3VMOA 5BZDA 3FO1A 4NT6B 4BKLB 1G0YR 4R3SA 4OZGA 4BFBD 1QVOB 1JZ2A 4H1LA 2PYEA 3THMH 1J0ZA 1YEHL 3LN9A 3MNWB 3WFBL 3QIWB 2C26A 3WKML 1JUFA 2ZG3A 2YMXL 5K9OA 3B9KB 1YJDH 3L3HB 3CU7A 1NANH 3W9DA 4P2OA 3D3VE 3ULUH 3VI4F 4Y4KB 1S8DB 2HFEA 1U42A 2XWBB 4B53A 1CD1B 2A9NL 4Z7NF 3TO4A 1OTSD 5CLWA 5MI0C 1NC4A 1JGUH 3ABZA 3I2CH 4JY5H 4PJDE 2EECA 3IGAA 3T2OA 2APBA 2B8OT 4NZTH 1XGTA 5ANMA 3CFEB 1GGCH 3DBXB 5DC4B 3QH3B 4PRID 2MHAB 5LGJB 1VCAA 4G3YL 4DVBB 3I6KA 4BZ2L 1TVDA 4CVZA 3FQWB 3SKUD 2F54B 4PJBA 1DQTA 3MV11 2BSRA 4QRSB 2QQLL 5D1XD 4DKFH 2FECI 3BZDA 4L29A 3W2DL 1MCFA 4L8BA 1JPFA 4LLDB 4QRRB 5DJ0B 4F7PB 3TVMD 4ONGL 3RGHA 4PPTA 4KHTH 4NHCH 3QXAA 4FQLL 2OCFD 5HHMB 3B6SA 1EEUA 5F70A 4NQCB 5JLZA 2EE3A 3UTQB 1J1OL 3U36B 2BXZA 1MRFL 1X5YA 5D93C 3A67H 2O5XH 2AK1H 3GO1H 3ARSA 3P73B 5I1DB 2YSSB 3O8XC 2JJTC 1FZMB 4U1NB 1U92B 4JQVA 3KPTA 5F72S 1BVKA 3HRZA 4U1GC 3PV6A 1MPAH 5GJTH 1E28A 4H1LH 3U9PH 2AEIT 4P99A 2X4TB 4H20L 1EVUA 1WBZA 4XP5L 2VDLL 4PR5B 1C12B 5GQBA 3PIQB 3RVUD 1VGKB 1FORH 4P48A 2IAND 4JFPB 2QJDA 3BP5A 1BX2B 2DD8H 4Y19B 3K4AA 3BW9A 5E5UB 2EC8A 2VLKA 4FN0A 3FOLB 4OQ1A 5D9SA 2VXTH 2P7TA 3I9GH 3FB8B 3NTCL 5INDA 1E27B 2YD7A 3MRDA 2YUWA 3RPIB 3DNKA 2H6PB 1ODAA 1RFDL 4OV5B 4YHIA 3T2QA 5GS1A 1LO2L 1YMMB 1A7OL 4HWNA 2F74A 2NY3D 1NL0H 2EYRA 5LBSL 2OSLB 3RL2B 3MXWH 2JJUA 4K8RD 2YD2A 3BESR 4ZSOA 4PJCA 2CPCA 1PX4A 5CP3A 5FF6B 3RUGE 2D7OA 5KVEH 1N5YL 3HI1A 1EH9A 3Q2CA 3AUVA 2NX5E 1J12A 2X9XA 1I8IB 3BH9B 5J3HC 4XH2A 2HKFL 3K1KC 1M1SA 3MGOB 1I8KA 4IMKC 3DO3A 1FYHB 2GKIA 4L3CA 4QRPA 3NA9L 4LOUC 4P5MB 2XQYK 4YHZH 5FM4A 5HHOE 3EBAA 2YPLA 3MLYH 3GMLB 3CVIH 5GGSY 4Q9RL 1AGFA 1XF3B 5CFHA 4LSPH 3VWKB 1RJCA 5ADOH 1IM9B 1CXEA 2LTQB 4KZEH 4PJAB 4MA3B 1VFBA 4XZUB 1UM6H 5F1OB 3HB3C 5DLML 2NTFA 3CFCH 2R2CA 5J1AA 2BSED 5CZKA 1TTFA 3R4DA 2JJVA 5JXEA 3L3IB 4R97B 1CU4H 3SKMA 4P57B 3GSNL 3RKDD 3O0RH 3MLTA 2GTWB 5D1QD 5KG9B 2VLLA 5JW4N 4U1IB 1X5ZA 2V2WB 5EO9A 3LKRA 3OKNB 5B38G 1RMFH 1NJ9B 4Y5XC 2XXCB 4RAVB 4B41A 2OLDA 3OHXB 4J12A 1F3RB 1GHFH 4QHMB 4OLVL 3MRBB 4PJCB 2E9BA 3P4MA 3UZEA 5E99L 5IW6A 4G80A 4U1HB 1JNLL 2FGWL 2J4WL 3DSFH 4M7JL 2IH3B 4XNUL 4HGMA 3PWVA 3L3OB 1QSFB 3G04B 2CSPA 4HJ0D 4BJLA 1N6QL 3QULB 3DX6A 4GJTB 4GRLD 1K85A 5C09D 1HE7A 2AP2A 4JRYA 2WBJC 1CGWA 1GH7A 4NCDA 4NOBA 3BZ4A 4WTZG 3QDJE 5GRJL 3TVMA 1I3GL 1YYML 4R7NA 5C7XH 1N5AA 1GIGL 5L2KD 3BPLB 4MAYA 4XBPA 1FH5H 4PRIE 1IEBA 3MLVH 4TUKL 3U82B 5KW9L 1XR9B 4G7YL 1KB5B 3MACL 4OD1H 2A73B 4N5EC 5GJSL 1ACZA 2X4OB 1O0VA 4LNRB 1QR1B 4HULB 3O8XA 3EOAB 2H3NA 1X44A 1ADQA 3QHFH 1J5OH 3BPOC 1DQJB 4EOWL 1A6VH 4XBEH 3I50L 1H0DA 4NNYA 5E5RB 5JORB 4TYUA 2A1WH 1NAKH 3D85A 3NIDE 1SJXA 1B0RA 4LVNB 1AHWC 2ZWLT 3FCTA 5EOTA 3G08A 3I02B 3U0TB 1YEIL 5DA4A 2F58H 4Q0XL 4TVPD 5JDJA 4WTWA 3K2UH 4F37K 3TPUB 3TGXA 2VXUL 4LPTA 5JW4R 1OLZA 4OFKA 4PJXA 4WDIA 3RI5F 1CGSH 4PJ8B 4NC1E 4M93B 1URLA 4UDTB 4YDKH 1MCQA 2R0ZL 2Q86B 1CFSA 1JPFB 5IQ9B 2EIDA 2VZVA 1P84J 4M9PA 1JZ7A 3Q1SL 4HH9B 4PJHB 4E42B 2MPAL 2WNGA 3JUZA 4JM2B 3WNLA 4H25A 4M1DH 3R0MA 1UYWH 1RVFL 2CGRH 3OAYH 4P2YA 5GGQL 1IILE 1N5AB 3UO1H 1MCIA 5I9QC 1LEIB 4TRPL 3ARFB 2R4RH 4YXKH 4HT1H 5DRWB 1KLFA 1X4ZA 5KBNC 1UH2A 3GBML 4PJGA 4XNXH 2NZ9D 4PRDA 1FNLA 5J12C 4KWUA 2CIKA 4XVSL 5DEGB 2YMXH 5MEND 5CEZL 1NEZG 1QFUL 1VEOA 5GRYA 5CKGA 1QKZH 4LSPL 3P9LA 5DJXA 4BQ6A 2PO6D 1F5WA 3OL2A 1CFTA 1UQSA 3QHTC 1CS6A 3QUXB 1U8PB 1SEBA 2FD6L 4JY4A 3ULUF 3MOBH 1GSMA 4GKZB 5J06A 5D7LA 2I5YL 4JPVH 1BZ9B 4NQSB 4YWGL 1W72B 5DLMH 1DBBL 2BFVL 4OQTA 4ZUVB 4LVNC 5DRXA 5DUML 3S37X 3NA9H 5E0QA 2CJUL 3QHZL 3X3GL 4PGCA 5CHNA 5E8DL 4Y5XA 2DQJL 1SHMA 3KR3H 4KZDL 2VSCA 3NMEA 4Q6YA 3S6CA 4I0PD 3S35X 4PJ7E 2HVJB 4HFWA 1KYOK 1S7VA 2X70A 4D94A 4X6DF 3QO1A 1OAKH 1ZVSB 4UQ3B 4NM4L 4I4WB 2X1QA 1MCWM 5CLTA 1QA9A 4HD9A 5A3ID 3C6SB 4C58B 4ZUTA 4C54A 5FEBA 5K33A 3MLSL 3ULVF 1AP2B 1KJMB 4LSTH 1QBBA 2ZP0T 5JW4M 3BMWA 3U0PA 3QEGH 3FB8A 5CBEA 5FGRA 3H9YA 5CINH 1ZHLB 5D7LB 2DWEA 3D0VB 3VFWB 5D7SL 3REVB 1TZIA 3AB0B 1QSVA 4CGTA 2R4SH 4IJ3B 1BJ8A 4P59L 3BH8A 4U1MB 1YZZA 4XAWL 1U8JB 4O00A 1D9KB 1N6QH 4N0FA 3IDIB 3GDBA 2YUXA 4NC0B 3VXSB 2NZ9C 2V5RA 1DANU 3MRIA 1I1YA 3BW9B 3F7YB 5I71B 1J8KA 1T5XB 4X9HA 4KKBD 1EGJA 3JUYA 4L4TB 5I1KL 4NQCA 3QQ9C 5ACZB 1WC7A 4LHQB 4R0LC 1DLFL 1BECA 1IARB 5JW3H 1ZWIB 2Z31C 4F7EB 1MFEL 3O6KH 1CGSL 4NO3B 1DUZA 3OAUH 1MIEL 4LP4A 3LIZL 4OV6F 4X98B 4LAJH 3UPRB 1IKNC 4XCYB 2AQ2A 3WLWD 5B3NA 5I8CA 4ORGA 5E8NB 3MGAA 1FNGB 5IFHL 1ZT1B 3VGFA 4HUVA 1FYTE 3WFEH 2ICCA 3TBSB 2VXQH 4TQEH 3QR2A 4IMKA 5HJ3A 4NCC1 5K9KA 4KUZH 2NY1D 5CJOH 2YD8A 3QPXL 4ODHL 1I85A 5KVDL 1VGEL 5AEAA 1F45A 3GSVB 4Z78A 1KIUA 35C8L 1HHGA 1NKOA 1S8DA 2HFEB 2XWBA 3NVQA 1MCLA 3B8YA 3DMMD 2FR4B 1WC7B 3K2MC 3W9EA 3QFDA 5B4MD 4YNYA 1CXKA 3FAWA 3FT4A 2XRAL 3IFPB 1QHOA 3OXRB 3G9AB 3L7FA 4OZGB 4JQXC 1BAFH 2WUCH 4RFNC 3TT3L 5IHUL 2X5PA 3OJDA 2MMXA 3SE4A 1IE5A 2D7QA 1T3FB 4QGTA 1T1WA 4NKMB 4JKPL 2QR0A 2WUBH 3KPRA 5T1DH 4Z7WE 2OZ4H 1IAIM 1I8LA 2CLVB 4U31A 4TSCL 2D03L 3BEVA 1X9QA 2CMRH 1JTPA 5B21A 3VFWA 4O9HH 2H8PB 2WBJD 4I3GA 3CPLA 5DMGC 1JYWA 4LGSB 4DAGL 2EDJA 3VFMA 1QTYT 4HIHB 4HKZB 3IJHB 3MNZA 5FOJA 5FECA 4EI6A 4LRIC 5GS2H 1LO3H 3HZVA 1SMOA 1JRHL 1R3LA 1E0OB 3IJSB 3RIFK 3Q5YA 4WW2C 1WAAA 4PJDF 2Z92B 5D5ME 4WJ5A 1K3IA 1WFNA 2ID5A 3UPAA 2DD8L 2P24A 1KFAH 3FAXA 5HYIA 4NM8L 2EE9A 4YHNA 1KTDA 4Z7OE 4HIXH 4NQDD 3ZKXB 2H1PH 4NP4L 1I8IA 1T6WA 5C0EA 3BZFB 1U95B 4MGXA 1IBGL 1FNAA 5F7FA 3TH4T 3T3ME 3SE3A 4QXUL 4UTBH 3FT2A 4P9ML 5C0BB 2HRPL 5TE6H 4UI2A 5IJVB 1JFQL 4YDVA 5H2BB 3RDTD 3T2NH 4F8QA 4X4MA 3SJVA 5D70L 1UWGL 4OD2A 4KK6D 1VESA 2NY5H 2W1NA 3MJ8B 3PWPE 4R9HA 5F97E 4PJ5B 5ESAA 5LQBH 4RWHA 1MLCA 4LCWE 4JB9L 1A02N 3J8F7 3MJ9H 1DL7L 1U8OB 3A0OA 1DVFC 2IFFH 3JVGC 4S1DD 5C0BE 3BDYL 1UJ3C 4JREB 1XIWD 6FABH 4BM7A 2X6MA 4N1EA 5DK2B 2AEPH 2V5SA 4U7SA 5D7IF 1U8NA 2X4RA 2LVCA 2Q6WB 2YUZA 1CLZH 1T1XA 3GGWA 4LAQH 1EHXA 3N85H 5CJXC 2DQIH 2P5WB 1CTOA 4XCNB 2CUIA 3D0LB 4D0BB 2QSCL 4S1RL 5C1MB 2YD6A 5C0CA 4Z7NE 1LD9A 5CEZD 2P8MA 2X09A 4GG6E 5GZND 3T4AA 2R0LL 5LGKA 2DLFH 2ORBH 5ICZB 5CZXD 4WU5B 3T3MF 2B1HL 1Y6KR 2VYRE 1EEYB 4P5KB 1BFSA 1R6VA 5D7JC 1H3UA 4ETQA 3EFDL 3GSXB 1QBLL 1JF6A 1D6VH 4I5BA 3WKNA 3PWLA 3O6FA 4ZO7A 4OAWB 5HDLA 2JCCF 4QTHB 1MWAB 5F9OH 5HGAA 3GSVA 1IQWH 4OCXH 3NN8A 4NO5B 4GXVL 5F3BB 2X4OA 3H0TA 3O3EB 5HPMA 3PDOA 4ZS6C 3S98A 1A7RL 1CE6A 1T21B 2AVGA 3ARGD 4PJ9D 2OK0H 3KYMB 4HIJB 1L6ZA 1KYOJ 5GGTL 4UINL 1DN2A 3KLAB 1T0PB 4KVCH 4ODHH 3GIZH 2DICA 3T4YA 4LSUL 1IC4H 3ZE1E 5DHVB 1XFPA 3ZYIA 2A9MH 1DVFB 5GGVH 1FLRL 1A6ZA 3SY0B 5GS0D 2EH8H 3GFUA 4QF1B 3KNBB 3KJ4C 4DK6A 3QXVA 3WD5H 3S4SB 4BQBA 5I8EA 3L7EA 2UUDK 3CUPB 1DBMH 2FEDD 2CKBH 2DQGH 3BD5A 4XPBL 4LSTL 4JG1H 1TXKA 1WBXA 2O93L 2VDRL 3OKKA 2WUCL 1AI1H 3UBXB 2CRIA 1KCUL 3QO0A 3ARBC 1B0GA 4N1HB 1F8TH 1Q94A 1JGUL 2VLLB 2R29H 1DE4B 5FA3B 5IBTL 3MRQA 4YQXL 2HLAB 1VFUA 5D71L 3SE3C 5BRZD 5DJ6A 5EO1B 4LNRA 2DQFA 4FOMA 1XCQA 1TZGL 2ICWA 3CX5J 2VIRA 5ELIA 2XICA 4XC1L 4MAYB 4XBPB 1DTUA 3PQYB 1QLRB 1U3HA 4Y5YB 3I6LE 4ZDHB 1KB9K 4PRIA 1U91A 4E41A 1E4KA 1GL4B 4ODVL 2EEDA 3RA7L 2WWMC 1MFAH 3EO9L 5I16B 3L5XL 2RQ8A 2NY4C 3MRCA 1FPTL 3MRJA 4G6KL 3U4EB 5C6WH 2IADA 5HDQH 3BUTA 1NEZA 1Q0YH 3EOYG 4LLYB 3GK8H 4POUB 5IHLB 5KANI 1XZ0B 1A1MB 1NH6A 2UVFA 4XRCB 3RY5A 1T5WB 4G9DA 4L4VA 2PYFA 4DZBB 1AH1A 3CX5K 3M1BB 3QZWG 3SDAA 3V0VA 5IJKC 4G5ZL 5FO9A 1S7WB 5I8OL 5HGHA 3VRIB 3VI3E 4ZPVB 5GPRA 3BD3A 3NIFE 1LDPL 1ZLWK 4YEFA 4AT6A 2VLRB 3HR5B 1S7QB 2LAAA 2DM7A 4OF3A 1BQLL 2PR4H 4HKZA 1MIML 3UZQA 3PGDB 3MXVL 4XBGA 2BVYA 1YY8B 4YDIL 3DROB 5D7JA 1E6JH 5E6IC 5JOEA 4PJHF 2E9JA 5EC1B 4LLVB 2DKMA 5JUEH 4NCC2 4JM2F 2D4DA 1U36A 3CDYA 5JNYA 2ED9A 1KT2B 3MA9H 3MV7D 4NRYB 3U2SA 4F80A 5IVXA 3QDGA 1S9VB 3ESUF 3IF1B 2BSSB 4IDLA 1D5MB 3NCMA 2BVTA 3U4BL 5FM8A 1N7MH 3PV6B 4YFLF 5DRWA 3VXRE 2VLKB 3HR5A 5IM7A 5JZ7D 4QWWC 4XNZC 3BQUC 3MGOA 4TVPH 4DN3H 3FT3A 2NY6B 4C83B 5EORL 3SDCD 3B6SB 4RGOL 4LLUB 4ZFOB 3AS2A 3QEGL 3VFMB 3MLYL 3RL2A 1KPVA 4HWBA 15C8H 3JV6A 4UUJA 5DURB 4ALAH 4YHMH 3VGAB 3D85D 1FLRH 2NW3B 4U49A 3GMRB 4WWKB 3DO7B 1T4KB 4MJ5A 1T2QL 3MMEA 3GSNA 5EDXA 2A77L 1VKXA 5I6XC 1MRDL 3Q0HA 1R3HB 2K3TA 4L4TD 3VXME 1D6EB 1J10A 3MPCA 4QRRA 3MLUL 4RCAA 5C8JA 1TJHL 4XCCL 4XCYA 2R15A 4UOW0 1KCLA 4MYWB 1HXYB 3LKNB 1JHTB 1TZHA 1DUZB 3QIUD 3GJFB 4YR6A 4F3FA 5JOPE 1A14H 1D9KD 4XP4L 2EDXA 4DKDC 4LASL 4OJFH 2XN9D 4XP1L 4CMHB 3AY4C 5J4MA 4LSRH 5D96B 4Y4KC 2YZ1A 3F7YA 3CZFA 2X10A 4LSVL 4JZJA 5IB1A 4TOYL 1I8MB 3UYPA 3H9HA 4NKIL 1WZ1L 5JA9A 1CGVA 1DSFH 3HTLX 3MUGB 3MRNB 3QQNA 4UT6H 4PY8J 2NW3A 1UG9A 4IOIA 3KNBA 4OLEA 2SEBA 5L8JB 4QOKA 5FYLL 3V4UH 3UJJH 2NY6C 4N8PA 4NPYB 5GISH 3EO0B 2NMSA 3IDYC 1P9MC 4X0KA 5T33L 3AMKA 4RNRA 2HKHH 1A2YA 1JTOA 5CJXA 2W59A 4UOJA 4YH6A 4BELD 2HJLB 2YD9A 1CIDA 2HT2D 2I60L 3LQAC 5GRZA 2YD3A 3QEQA 4F7MA 1N26A 4OF0A 3P30L 1F02I 4PTTA 3OJMB 3WL9B 1INEH 3T0XA 1KXQE 1UGNA 1T66C 5TPWL 2AV1A 2CXGA 3L3DA 5CUSH 5E8EB 3DIFA 3O6FB 1YNLH 2OJZH 5CMAA 3T0ED 1Z6JT 4ZOEA 1OW0C 4X80H 5F6IB 5K9OB 3G9VA 4MSWB 3HE7C 1V3JA 4PJAA 2P5EA 3IXAB 3AVEA 4NZTL 1G9MC 4WV1B 5DDHB 1GOHA 1IC5L 1KPVB 3LQAL 4PGCB 5DI8A 3TV3H 5KSUA 4E9LA 3T0EB 3O6FD 4MB3A 5DQ9B 1HCFX 2GYSA 3WNKA 1CL7H 4FFWD 4EVNA 2BCKA 4OFYD 2NPLX 1UM4L 1DQML 3EYQC 4MNQA 1UXWB 1ETZB 3NH7H 5GS0H 1ITCA 2A9NH 4TSAL 3RZWA 2RCSH 4JRYE 5J13B 4O5LL 5ERWB 5DMYA 3E2HB 2C1OB 3SKNA 4WEBH 4G9FB 4NKDA 1A4KB 1MFCH 4H26B 4M61B 5B38B 2FB4H 3CVHL 4APQC 4L4VB 4GRMB 1UA6H 1LO4H 3GRWH 3SGKC 3IF1A 5ISZE 2GW5A 2FECL 4U6VL 1MFNA 1OGTB 3M45A 3SDCB 4XT1C 4NSKA 4Z7UA 4LKXB 4YHYC 2CJUH 1DBAL 3QNYA 3OGOE 4JO2L 5JXAL 1X6LA 5ID0B 4ORZC 2JF1A 3RPIA 3H7BB 5GJTL 3RWGA 1YQVH 5EPMB 1U3HB 3OG4B 1JWMA 1P2CA 4FMKA 3GKWH 2IH1B 1AIFB 1UKQA 1E6OL 4YQXH 2H2PD 3T8XA 5IJVA 5INCA 5H35B 3BN3B 3RWFB 2HMID 2BRQA 4JPWH 3U7WH 3QG7L 4ZFGL 2AK1L 3RL1A 3GO1L 3NTCH 3ZHKA 1SJEA 4DOHE 1D5XA 5KVGH 1UB6B 3IU4L 4MXQC 2LU3A 3O3AB 2P46B 2C5DC 4GSDL 5F6IC 3JWOL 3TNMA 1XH3A 1A7OH 4ODUB 4RGMC 1KXVC 4RMWA 3MRCB 3U4EA 4QXGL 3TJEL 4WNQB 1H3PH 2ADFH 5BMFH 4XX1G 4NUJB 5L2KB 3JWOC 3T1WA 1KEGL 3TA3C 1F42A 2DF3A 4PJCE 3RUGA 3UYRL 4JVWA 3QCVH 4S1SH 2B1HH 4LPCA 5EIVA 1IL1A 3VXTB 5IB4A 3QIUA 5E70A 1PFCA 4JO3L 2C7UA 3MRLB 1XR9A 5SWQB 1CICA 1NL0L 5D7SH 5HHME 4I77H 3U0WL 3MFFA 1ZHBB 3OR6A 2NY0D 4A6YB 2EZ0C 5KVEL 4O02H 1KEML 1N5YH 2HT3C 4MAYD 1JF5A 3F6IA 3EOBB 1BMGA 3HMXA 1ZLVK 4RX4A 4KRPC 1RZJH 1EGJH 1JHLH 2NXZB 2EYTB 4NQDA 5HI4C 5KTEL 3K8LA 3ZYZA 4H0IA 4YHPB 4BH7A 4U33A 4MJ2A 1KCSH 1D5XB 4DGIL 2KL6A 3C08H 5TQ0H 3AAZA 3FQUB 3JSSA 3FL7A 3FTGA 3FONB 3HE6D 4P9HH 1A7QL 3MOAL 3RVVD 4YX2H 2VB5A 5K9KB 4RAHA 4EIGB 3OAUL 1QLFB 1KLUA 4ODTH 4ZOBA 1GRWA 3UTSA 2IQAB 4BFGA 2MKWA 5T3ZH 3G5XA 4DJMA 5FK9A 1EK3A 5DGQA 3TYGH 2JB5L 3MBEB 2BNRB 4R96B 2GSIB 3RWGB 4FABL 1CK0H 4Y7MA 3GI8L 3P9MB 3LEXA 4AG4H 1HCVA 4J6RL 5L7XL 2E8YA 1KSRA 3NH7L 2H45A 4ELKA 1BFTA 3ULSA 5IWLC 1JGDB 4APQA 4K7PY 3SOBL 5IT2H 4U1HA 1EIBA 2YWZA 3RTQA 4ZFOA 3GRWA 4OB5H 2I07A 3R1GH 1UB5B 3NIGE 4JGJA 4NJAL 4H26A 1JPGB 2NY2D 3HI5L 2A6IB 4JFDE 5JIHA 1X5LA 1QNZH 4M48H 4F8TA 5I8KH 1QRKA 1YMMD 3P4OB 4K3EL 4UT9L 4GKNA 3TNMB 1FVDA 4AM0B 2FIKA 4IMLA 2DLHA 4OUUB 5ICZA 2YUVA 1S7RA 2XFXB 2DAVA 2AK4A 3STZA 2DQEL 3QI9B 3S96B 1KELL 2V2TA 4PLNC 1MCOL 1V7MH 3QPQC 3BGAA 5JPNA 3KPSD 3M8OL 1PLGH 4X6CA 1HQRA 5J6GB 4YAQA 3P0YH 2DQHL 3O6ML 1GAFH 4L9DA 3EW3B 1GPOL 1NMBL 1MCWW 1KACB 3HMXL 2HFGH 2V17H 4HZLA 4JFFB 4XVJH 4BFEA 2C3WA 3HKFA 3ZKSD 3T1FA 3BUYB 2ITCB 4QY8A 1IEAB 4YC2B 3DIFB 5BJTA 2BY2A 5DYOB 1MUJB 4KVNH 4WUKL 1XCTA 3L3KB 4IOFD 2VQ1B 3O4LA 5JXAH 3IDNA 3WS6C 1DLHA 5D9SB 1WZ1H 1IAMA 2J6EL 4N8VG 1KN4L 5EIIB 2AJSL 4GKSB 1YQVL 12E8H 4OKVB 3WDHA 3FO2B 1MQKL 4U7KA 1U8QA 1DBJH 1AXTL 5I18L 1PKQA 3QQ4B 1MI5D 3TESA 4MHHI 3TF7C 1S5IL 4PY7A 5HXMA 5E2UH 4Z0BL 4LCUB 5GRXG 3PWPB 1MIMH 1KB5H 5HYJA 2H2SC 4MJID 5I1LA 1J8HD 1FZMA 1EFXA 1K6QL 4HH9A 2DI9A 2X1OA 4CN6A 5EBLA 1UM5H 2CLVA 3LHPH 3GMQB 4YUEH 2ZCLH 2UY6A 1HHIB 4MWFB 1CFSB 5T1KB 4KV5E 3NPSC 3ARGB 3O4OC 1CXIA 1NC2A 5HYSB 4FFZL 1ZT7B 4HBCL 4YBQD 1M7DB 2Y4SA 1G7HB 5E2VH 5HYEA 4L8BB 1YNKL 4AIXA 1NCBL 3ECBA 1NGZA 4QHKJ 5F1KC 4BSWA 2R56L 1G1CA 5J11C 2XKUA 2JB6A 4PYHA 3VFNB 5TGBB 2EO9A 3OJ2C 3WN5B 4RGOH 4X4YB 1KN2H 1JGDA 3MJ7A 4MNGB 5C9JB 1FO0L 3E3QE 4NQDB 3B9DA 5DJ2A 5IESH 4IJ3C 1NGPH 2CDGB 3B9KD 1M6OA 1JYVA 2QADC 5F7NC 4M1CC 2A0LD 4PV8B 3VI3F 2Q8AH 3GI9H 3ARWA 1KEMH 5IVZA 5C3LD 3D6GA 2LE9A 3QDHA 1QBAA 4PRBA 2C1PA 1HDMA 1T7VA 1L0QA 1KLUB 3PWLB 5AG8A 4R0LB 5FGBC 1K2DA 1KJ3H 3ZHLA 4OLUL 4JEGB 4HG4J 4LK4A 1RD6A 2JJWA 2DQTL 2BNRD 5TE7L 5A2KH 1LEKB 1P7QA 2BNRE 4G6MH 1Q0XH 4CVXA 3TJHD 1IGIL 2KH2B 5M94B 3V4PL 3KYMA 2Q7YA 1AGDA 3QH3A 3RRQA 1UCBH 1HHJB 1SM3H 5TJWK 2PXYD 2X4SA 4ODUA 2P49B 3VMNA 5IVXF 1FG2B 1NMAL 5A1AA 5DSCB 3MR9B 5JHLL 5GSVB 4KKLC 4CNIA 1H0DB 3ZTNL 3DMMB 3H3PH 2ENSA 1XGQA 5GZOC 3E6FB 2AJ3B 3U1SL 4UT6L 2H3NB 3EJZC 1V05A 3LKNA 4LCIH 1BOGB 1NBZB 4K3HA 5C0BD 3O81A 1ZHLA 1QO3B 4BA8A 4FQCH 4UU9A 1TJIL 2XZZA 4JKWA 3PGCB 5DWUH 3WD5L 4P2OC 4M7LH 1HYSC 2A38A 2IBZY 3GMRA 3ILPB 1OD7A 3I84A 3WS6A 4RAUA 1MCKA 1S7XA 5T1MB 3HLAB 3U46A 3LKQA 3SE8L 3V9FA 1OAZL 1OTUC 5EA0H 5C0CB 3STBA 2Z35B 3T08A 5EN2B 1U0QA 5FKAB 4ZPVA 3MLRL 1F3JB 1FNFA 1KTRL 4LVHB 3LB6D 3EHBD 3FN3A 3K81A 2YRZA 3TZVD 4UMGA 3ULUC 5MEOA 4NRZA 3KPSA 1AJ7H 2DQHH 1T89C 3O6MH 4QHMA 3I6GB 3DX7B 1YJDC 5EH1A 1NEUA 1FGVL 5AG9A 4MQSB 1KB5L 3MACH 3UTPD 1E4XL 1MOEA 2FRGP 4GAFB 1A8JH 1DDHA 3HUJA 4DQOH 4ELMA 2BVEA 5C0GB 4WW2B 1N3NA 4ODBD 1G0DA 12E8L 1CL7L 4OD2B 4M1GH 5IMMB 5C0IB 3B4NA 1CZ8L 1GOGA 1U2CA 4OZHE 1EVTC 4ZUWB 5H2BA 3QT2A 4Y19A 1QHPA 3LN5A 5DUPL 3WHE1 1MHHB 4UNUA 4FQ2H 2DMCA 3ZSTA 1OQOA 3SBWC 3GMOA 2VTFA 5CEYB 1C1EL 5JOFA 2XWJA 1S7SA 4P5MA 4I3RL 2PW1A 3MXVH 5C6TH 1U3ZA 1G9MH 1NGXB 5E9DB 1GGCL 3HC3H 1CT8B 1HNFA 4Z7VA 5EN2A 2NY1B 2Z92A 1JF1A 3FO0L 4P5TC 1ZGLA 2APVA 4FQQB 5KSBA 1DQDH 5JR1H 2A6KB 1UJ3B 3KYKH 5GGQH 2ADGA 2FYYB 3CSYA 3V6ZB 1V3LA 5BQ7A 2OR9L 3BKYL 2EDKA 2OZ4L 3Q6GL 4QF1A 3MRJB 4Y8AA 3WLBB 1KJ2H 1CE1H 1GZQA 5IB2A 1F6LL 4LKCA 3SDDC 3TN0C 3DECA 3QAZC 5CCKH 4PGZA 3HUJF 1RZGB 2J7LA 4DVBA 1Q72H 4KMTL 4NNPH 1RZ8B 3BGFB 3QUMA 5I17A 1AR2A 3ULVH 4IRSA 4D9QE 4K7FA 1WUNT 3VXSD 1X6NA 1LO0H 3CXDL 3C60D 3DARA 4Z76A 5IEKA 4HWEL 4YE4H 2XNAA 3ARYA 3LQZA 4DZ8A 1RZ7H 3NCFB 5A40E 3MJ9A 1FORL 3C60C 4Q2ZB 4XP9H 5I1JL 4YWGH 3B8SA 1FV1B 1OM3H 4X6DE 3AGVA 3HN3A 4QXWA 1DEDA 4PG9A 4J3OC 1A6AA 2NY5L 6FABL 3CGTA 3QUYD 3UTQA 1AO7E 1R3HA 1ORSA 1J05B 1U8LA 2YN3A 5FKPB 4P5KA 1OCWH 3W0WB 2WZPD 1KN4H 3D25A 4G6AC 4PJXB 3U30C 1FQ9C 4HIEB 2G5RA 2R69L 1MRCL 4P2QB 3W11C 1UWXK 3RKPA 5BQ7B 3DVGB 3MJ9L 3MRKB 2GQHA 3ARVA 5CJQL 1B0RB 3QWRD 5EOTB 2L7UA 5D2LB 5E4EB 4MA7L 2YK1L 5CGMA 2WP3T 2ORBL 4HJGA 2VDMH 3HPLB 5GGRA 1BJ1J 1EEZB 1WCBA 2WQRA 3VFNA 4DZ8B 3DX8A 4J3VA 4X7CC 5HPMB 3WNNA 2F53A 3HRPA 3EKCA 2NXYD 1CFQB 2CLRA 4U0RB 1N6UA 1LNUB 3F62A 2GTWA 4RISH 4U6YA 1H3TA 5HHVL 2V6HA 4UQ3A 4GW1A 3DETD 3IDNB 4BH8B 2WBJA 2D4FA 4RMUA 1P69B 1MEXH 5J1AB 1S7VB 1WFOA 5L8LB 4AL8H 4AY0A 4GXVH 2QL1A 1K4DA 2WP3O 4K94C 3CJJA 3QDMA 3L5JA 5JW4Q 3I3BA 4JFEA 1QSED 5DJDA 3KXFD 3PP3H 3RZCD 5GS3A 2O26U 2DYPA 4I0PA 1GZPB 2NY7H 3JBG7 1QBLH 1MLBA 3VFPA 3P4MB 3WFEL 4Y4HC 5FCSH 2YPLB 4W81A 3IB4A 4KK5D 4YHLH 5H94B 4LSSH 3ARDB 4KFZC 1WZLA 4L9LA 4YHZL 3D39D 4R26L 1OPGL 2W0LA 4Q6IA 4DK3A 4NN5B 2DMBA 4U7MA 3A6CH 4P4KA 1QSFD 4OZIF 4UT9H 3GGWB 3ULUD 3HI1B 2XQBH 5B8CC 2R1XB 3TZVC 5KSAD 4KJYB 4EBQH 3U30B 3MOQA 4JJ5A 4MJIE 3EO1B 4ELKB 3NOIA 2XZCH 2P8LB 3T0VA 2RR3A 1VEPA 4JZOB 3ROLA 1P7KA 3SGEI 4KKCC 3QSKB 4N0UE 1DLHB 1W0YT 5D1ZB 4MJ6B 4IS6B 1R0AH 4NZUL 3OPZH 4P23D 3MV7B 4Y16D 3BSZH 2FIKB 4MD5A 5EZOL 3SGEH 5BXFB 4YAQB 4TUKH 2NNAB 1EZVY 3NA4A 1DFBL 1RUKH 3ULVL 4EN3B 3V5HA 1X5KA 1ZLUH 7FABH 1U6AL 4XRCA 3BIAX 3LEYL 3JV4B 2IPUG 4PTUA 3MGTB 2DL2A 4U6VH 2XTLA 2CMRL 3TIDB 5BRZE 2A6DB 2QQNL 1BVLA 1ZHKB 2F53B 3NFSL 4Z0XB 4R7DA 4ZFGH 4KPHL 2CDFA 2CKBB 3L9RB 4F7CB 5C0DB 1SY6A 4OZIA 1AC0A 2MQ0A 5JTWA 3MX0A 1J05A 3NAAL 2D0FA 5DUBB 1NGWA 5LXGH 2DJUA 3DGCR 4TULH 4D0CB 1QSFE 1H3WM 4HDIA 4WTXA 3AC0A 4ZG1A 1JN6B 3PABA 5IQ7L 1RVFH 2CGRL 3KLDA 5L6YH 3NZ8B 3IFLH 5HI5D 1T3FA 3B3IA 2HLAA 2P42B 1L0YA 3D25B 4TVSa 1FP5A 3PQYD 2Y9RT 4LARH 1KN2L 3BZ4B 4Z0XA 1XR8B 4JRXA 4X7TB 4K94H 3A6BL 1KCRH 3MLXH 4CAGA 5HDOA 4HUWA 4U2YA 1MCRA 3QCUH 3QXUA 3MCKA 4IRJB 3BI9X 4X9FA 3VGEA 1YUHB 2CR3A 5IBLD 3BZEA 3ECBB 3WMSA 4XNQA 4LLDA 5DJ0A 1JPSH 1KNOB 4ZTOL 4GQ9L 4LPVA 4YXKL 3FMGL 4UV4H 1MAMH 4CJ1A 5EORH 2HVKA 1GC1C 4PG2A 4RGND 1T0NA 4NOFA 4N0CD 2WK2A 1NUFA 2DIAA 3BP6A 4HFUH 4JKKA 2Z8SA 3B9VA 3C08L 5DO2D 3UEZA 4MJ6A 3CCHA 4NUJA 1DBKL 1S3KL 3VCLA 4PUBL 5BW7A 3B9EA 4W4NA 4ZUTB 4U3HA 1F4YH 3A67L 4I2XA 1I7UA 2NYYC 2QSCH 3TFKC 4QRTA 5JO5A 1GGIL 5EBWB 4OF7A 3BKJH 1P4BL 1UJ3A 1MCEA 2Z8VC 3D87B 5EZIH 5FYKL 4LP5A 2NY5C 2A83B 4TNVF 5LWYH 3S5LA 3QZWB 4JRYD 5HHNA 1BIIA 3FHAA 5I19L 4U1GB 1MJ8H 2OL3L 3QFJA 5IVOA 4I9WE 3MYZA 1J1XL 5KAQF 3F6LA 1D9KA 2ITCA 3L3IA 4HC1L 4KTDH 4M6OL 2O5ZL 1T1ZB 3LMJH 1BGXH 4OCSH 4L3EE 2G60L 3VXUB 3AM8C 3KWWB 2ZKHH 4ZNEE 2J2ZA 3RWCB 5ID0A 1CGTA 4Y19D 3T8XB 2C4FU 4LCWD 4LCCB 4XAWH 4PD4K 4CN4A 5AUMB 3G6DH 3CFKA 4Y1AB 1F58H 2FBJH 1NFIA 4WO4C 5EZJB 1EHLH 5TH2B 3OGCA 3MODL 1IKFH 2MQ3A 4ELMB 1AI1L 3SO3C 3NCJL 1FSKB 4OB5L 1G7LA 4O2CA 3WFZA 5FYLE 2A9ML 4GQPH 1I7RA 1I9IH 2ICEB 2P5WD 4G8GB 2J88H 4NQCD 2X70B 3WXWH 3V0VB 5J13C 4FG6D 3TFKD 3KLHC 3PWNA 3RHWK 5DF0A 5TF1H 1V7NH 3KJ4B 5KSUB 4HX1B 4HF5L 2VXVL 2GK0B 4KDWA 5LXGL 3V7AE 1MQKH 1IGTB 4Y2OA 1QD0A 1SEQL 1S7XB 5T1MA 5IQ7H 4RGNC 4R6UA 3CLEL 3GHBL 5DD5L 5DT1H 3PDGA 4D0DA 2HVKB 4PRIB 5HDQL 3FFCA 4P46D 3ILQD 4ZOCA 1U8LB 1N0XL 3RVVC 5D7LE 2IAMC 3IFPA 3DGGB 5ILTL 5HGGS 1CDBA 1OT2A 3QISA 3LD8C 1BZ7B 4YUEL 3W5MA 4GRWH 3VFSB 3PHOA 1OGAE 1T0MA 3MLXL 3BWUC 3VRJB 1HOCA 2FEEL 5D72L 2YC1B 3ZSSA 4OD3L 2PNDA 1YEEH 4Q97A 3IRPX 1KPUA 3VXQA 3KYKL 2GITB 3SKJH 1CG9A 1B88A 4AEFA 4K7FB 4MAYC 2XZQL 2MNUA 3QIWD 3EYUL 4QOKB 2EZ0D 4OCMC 4WO4B 4JQVC 4YFEA 1X5AA 4M7LT 4PG2C 5HI5C 1UVQA 1MVUA 3D48R 3KS0H 1GGYA 3LH2L 5SWZE 4L9LC 1LEKA 3MUY1 1IC7H 4JRXD 1J1PH 3BAEH 1A0QH 4Q6IC 4LFHD 3G6JF 4NQDE 4M6NL 1H8SA 1UJTA 1NLBL 1T20B 2HH0L 4JFXA 1Z9LA 4UTAL 1R24A 3OXSA 1TTUA 1W0VB 5E7BA 4DGYH 2R0WL 2E7HA 5CSZA 1DVFA 3JVGA 1KPUB 3NCEB 4JN1L 2ADGB 2FYYA 3ARTA 3T2PA 3OF6D 4OZFG 4ONHA 3BKJL 5SWSD 1JZ3A 4M3JA 3BHBA 1UACL 3KHQA 5ID1B 3QDJD 1NLDH 1JPTH 1HXYA 1E6JL 5HVWA 2GJ6B 4OI8A 1D6EA 5D7IE 4Z95L 5EZOH 2Q8AL 2QQLH 4HIXL 4O58H 2DQCH 1ZTXL 3KS0J 5E6IB 1J1XH 1IT9L 4K07A 1LK3H 2RB8A 4WI4A 3UP1A 4QXUH 4NN7B 3LZFH 1BEYL 5IB4B 4XGZB 4OZFH 2DWEB 2AJVL 1KCKA 1RV6X 3MRHB 1RJYA 5IOPB 3EYSL 2NLJA 1VSCA 4HBQA 2WWKO 3ZT7A 1ZWIA 3UXFA 4HLJA 4P4RB 4OIAA 2BVUA 4ZXBA 5BZDB 4P46B 2O61A 3GSOB 1A3LL 3MRPA 4XP5H 2IJ0C 2QV2A 4XAKD 1J8HE 4NWUL 2OYPA 3PGFL 5EIIA 4JFFE 1H15B 4LDEB 4OF5A 2IFFL 3DOSA 1T2JA 4L4VE 1FBIL 2W65A 3N06B 1YC7A 3S97C 5IBUB 4H20H 9CGTA 4APQD 5FOBA 5BS0B 5LBSH 3DV4B 1MHPL 5EO0B 4L5FH 5MP6H 3QQ3B 2ARWA 1QSEA 2RHEA 5B39B 4FNLL 4YZFF 4PRHD 2MKLC 4NBZB 3GSUA 4Y4FC 4G8GD 4ZUWA 4TN9A 3I75B 3HLAA 3U46B 3MRPB 4Y4HD 2APXA 2FBOJ 5DMKB 1FO0A 2I26N 2XFXA 3L3JA 4DGIH 2IEPA 3PNWA 3HUJE 3EFDH 4P2RE 2EXYD 1ZEAH 3BUYA 3ZE1F 4WI6A 4XHJD 3H6JA 3QG6B 4WV1A 2AEPL 3B5HA 3UJTL 1YEKL 1PJ9A 4S1RH 2ICWB 4OIIH 1RFDH 5F7WC 2Z9TA 4ONOA 3OKOA 3B2VH 1G6RL 3AREC 1NDGB 3DETC 5DJAA 2JB5H 1EO8H 4GRLA 3SKOA 4DW2L 5AZEH 1NCDL 5MERB 3QXWA 4ZS7L 3ALWA 5HTSA 2ICES 2P5EE 5I1KH 2HKFH 4HJJL 1QR4A 3S36X 1NQBA 4LNVA 1CQKA 2E7BA 3IDGA 3QEUA 4PRAA 1MVFA 3D3VD 5ADOL 5I66B 1IZJA 1WICA 2NX5A 3PGCA 2XTJB 3PP4H 2ZUVA 4I0PB 4I3RH 4WHYH 1IAIL 4Q9RH 3TCLB 3DVGA 5JHDB 2C9AA 4NRXB 5E56A 2J3SA 4YHIB 2AXJA 5GS1B 1FCCA 5F7MC 3HNTH 5C9KA 1NLBH 5SX5H 1IGYB 3P9MA 2YEZA 1DFBH 1RUKL 3CDFA 4NC1C 2IFGA 3OKMB 1YY9C 3UTZA 1MVUB 4LLWB 3PG2A 1AKJB 4OGYH 4PLKC 1F97A 1KENH 1X7QA 2BC4A 3ARPA 3QUXD 4ONFL 1PSKL 4KQ4H 4MNHA 3IVKA 5GRVK 1VHPA 1XGTB 5ANMB 3VXSE 1P5VA 3H9SE 2V2XB 5FHBH 4D9QD 2B1AH 4M48L 3S3JA 4M7ZB 1D9KC 1CD8A 1R5IA 4NNYB 5JORA 2XN9E 5TQ2H 1OWRM 3AM8A 4HKJB 4LQFL 4KY1L 3F7VA 4R4NC 5I1GH 3HE7B 3HZKA