2MPAL

Bactericidal antibody against neisseria meningitidis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQTPLSLPVSLGDKASISCRSSQALVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVFFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MN12H2 IGG2A-KAPPA, light chain
publication title Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1999-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaL01
4JLRB 3UPAA 2Z8WC 3SKOB 1OL0A 5DJZA 2R29H 5GSRB 2DI9A 5IHZB 4YNYA 3EKCA 1IGJA 2DM7A 3QIWA 3WN5A 4P4KB 1DBKH 1WZ1L 1ZHNA 2X4UA 5GRXG 4DZBA 3QUMA 1N4XL 2VZ1A 5T1LD 5FA4B 3IETA 5ITFB 1J8HA 3C6SB 1OGAB 5I1HH 2X4TB 4R4FH 5SX5K 5IF0B 3VFWA 1JWUA 3DVGA 5DI8B 1V8HA 4E41B 3MRCB 1DN0A 1QBBA 5JNYA 3NOIA 1T83A 4Z7VE 3IDYC 5BXFB 3JXAA 5FCUL 5E1AA 4DAGH 2YD2A 4MXVF 1V7NH 2V7HA 3WHE1 3EYUL 3WYRA 3GMQA 3BPNC 4HZLA 2YOCA 3TA3C 3X3FL 2XZQL 5D5MA 3O2DA 3WFHB 4HUUA 2FO4B 2PW1A 3NPSB 1XGTA 3GGWB 4IMKC 3EZ8A 2E27H 4PTUB 3KDMA 1Y6NR 3B43A 4KDTA 4NKDA 4M6NL 1B4RA 4DVRH 4K8RL 4YDJA 5JQ6H 1BQHA 1DUZB 3C8DA 3PJSB 2PW2A 2NTFA 4DN3H 5IIEA 3QXWA 2ICEA 3EYFA 3QNXA 2X5PA 3CU7A 4UTAH 1HYSD 1J10A 3W39B 3IJHA 4HPOL 2H1PL 3MR9B 2GSGA 5C0CE 4Y2DB 1CIUA 1CQYA 2D0GA 4WUUD 4Z6AT 5KSAC 3VD3A 3GFUA 1JPST 2C4XA 3IT8D 3QUXC 2KZ1B 4KK8D 4FFYL 2R1XA 4NN6B 1DVFC 5KVDH 2NY7L 3LKPB 2JJTA 5FECB 3PWPB 4CN1A 3RWDB 5I0ZA 2D0HA 4XXCC 2J3SA 4MA7L 4NKIL 1EFXB 4XI5C 3DECA 2FYYB 1B0GB 3BP6B 4U1LB 3QNZB 3ZHDA 1MHEA 4Q6IA 4YEFA 4NO2A 4NKMA 2OP4L 3ZZ1A 2F58H 2Y9RT 4K2UH 3QDAA 4P2RB 1L7IL 5E8PB 5TPWL 2AK4E 3DIFB 4RFNC 5D70L 1KIRB 5C0RH 4P9HL 2AKRB 1CCZA 2CDFB 1JFQH 1VGEH 4N9GA 2A6KA 5IJVB 4RIRA 4UNTA 4ZUWA 1KT2A 4TNVK 5I9QB 4OZFH 4I77H 3QFDB 4K9EH 1A14H 1OD9A 1BVKB 2DQDH 5ICYB 3WJJA 2HA1A 1KXTB 4LBEB 2HFFB 4JZOA 3BGMB 1KC5L 3TCLB 3SO5A 5JW4R 5JR1H 2BY1A 5C70A 1QFUL 2R56L 5F1IA 2V2WB 1IAIM 5MERA 1P9MC 3ARPA 1VKXA 5C09E 4MS8C 3TVMC 2EC8A 2P8PA 2VXSL 4EXKA 1OY3B 1FFOB 1QSZA 1OARL 4JDTH 3MA9L 5HGHA 5L9DH 1SM3H 3P2TA 4OT1H 4PJXB 4JB9L 4X4XA 1XR8A 5DTFB 1HH6A 1N64L 4UBDC 5ANME 5FHBH 1OPGL 5DO2D 4WI4A 4QCIA 5FGSA 3TIDA 5HHXL 5HHOD 1ZA3B 3MRBB 2X41A 3S5LB 2NW3B 5C92A 3BE1L 5T1DH 4YO0A 1AI1L 2ZSVA 3ZSTA 4C58B 3GSNH 4Z7NE 5D7LE 1BZQK 2BVPA 5DD6A 5H2BA 3EJZD 5HPMB 3TWCH 1MJUL 4G6KL 3FQTB 1ZLVH 1JI2A 1JF1A 3MV9D 3U4BL 1FL3B 4U1MA 2NY5H 3ARFD 4LSRH 5HD8D 1X3DA 1NCDH 1T7ZA 2JIXD 1AO7D 3LRGA 4LLYA 4ELMF 3MACL 3H9SE 4J8RB 5C0IA 4POUB 5T5NF 4P5MA 3VRIB 3QIBC 2VYRE 3ULUC 5FK9A 4BFBD 2CGRH 1J9CT 1EH9A 2DJ4A 3GHEH 1U8JB 3CPLA 5J57B 4WHDA 5CEZD 2H2PD 3OKDA 4ZSOE 5I8CB 1CL7I 2IQ9L 4NZTL 4NO3B 1YMHB 1RHHA 4ZOCA 4PG2A 5IMMA 2AJ3A 4QRRA 4AT6A 4XNMB 3LQZB 3IAGC 1I7TB 5DHVH 1ZT7B 1FG2B 1IQDA 2HJKA 1NMCB 1FSKB 3LDBB 5IW3A 1WT5A 2WINA 3MLRL 1MCPL 1M7DB 4BELD 1KJMA 3MV11 1CN4A 4P3DA 5D1ZD 3WIHL 4PD4J 2YPLA 4S1DC 5F1KC 5HY9B 3T0DA 4OFYD 4HKZB 5HTSA 2J8OA 1IC5H 5DQJA 2OJEA 5JHDB 1RI8A 1JWSB 1FZJA 2OJZH 4ONHA 2QR0B 3FOMB 3UTTD 3EJYC 4KHTH 5EFIA 4IDJH 4QLRA 4GAJL 4LSVL 3HE6D 4YHMH 4UUJB 3TYFB 2C26A 1K2DA 5GPRA 3MBEB 1M4KA 3SDDB 4DQOL 5E6IA 3WDIA 1MHPH 3NA9L 2B2XH 3NABL 5SX4H 1F4WH 3KPMA 4XTRD 4ZOBA 1YC7A 5JOFB 3BMWA 3C09C 2BXZA 3SE3C 3MV8E 3PV6A 2JELL 2VLRE 3BT2H 2DL2A 5EH1A 1BZ9A 1KJVB 2OL3A 2Y23A 3U9UB 5CCKH 4EVNB 4Y19D 2X4NA 4NQXB 5D72L 2H2SC 3WFBH 3V8CA 4UU9B 3TIEB 3VFMB 5CHNB 4G43A 2A1WL 2YWYA 4PTTA 3DUSA 5CS7A 5FDWB 1BZ7B 4YFLI 1CDYA 4UTBH 1QFPA 1UWEH 2QSCH 3RY5A 5B8CA 4DW2L 2L7UA 3MV9A 1H15B 4NO0D 1LGVA 1WZ1H 3DURA 4YK4C 1BD2D 1VFUA 2NX5B 5EZLB 4UQ2A 2C3VB 3BD3A 1N4XH 2JIXA 5A1AA 4LQFL 2VXQL 4KJYA 1EEUA 3I75A 3VXPA 4L8SB 3C5ZC 4Y5VC 4P46D 3TV3H 1S9XB 3S88L 3NZ8B 4MNHA 3NACL 4HUKB 1QR1A 1S5HB 2R8SH 2Z91B 3DUUB 4YGAB 1P4LA 5FCUH 4LCUB 4Y4FD 3S34L 4Z0XA 3EYUH 2PTUA 1UFUA 2W65A 1UZ6F 2XZQH 2CRZA 2H3NB 3QUZA 2UVFA 3B9EA 1AGEA 4J6RL 2E7LC 4XNYL 3RWEB 3SDAB 4ELMA 4EUPH 1U95B 4K8RH 3WDHA 1KLGA 5LXGL 1H3XA 3HLAA 4GRLB 3R1GL 3VD5A 1S9WB 1OP5H 1F97A 1LP9F 2H1PH 5EU7C 3RP1A 1G84A 4H1LG 1RZIB 1MRDL 1EERB 5C0EA 4ZYKA 1H9VA 5JPNA 1MPAL 3HE6A 2VUYA 4P57A 4YZFE 3PABA 4FFYH 4TRPL 4CVWA 2NY7H 4R4ND 3G6JF 4JANA 4Z78A 4ERSL 4NKIH 4MA7H 5ALBL 5HHPA 3CDGA 3FOLB 3IJYA 1QTYT 3HNSL 2OP4H 1FL6A 1FZKB 3PWUA 3QFJB 4XP4L 1BF2A 4BUHA 1L7IH 5F7FA 4OTXL 3MRFB 2VLKB 1SVCP 1QFWH 1CICB 1RK1A 3AAZA 1X5ZA 1G7JB 2CLZA 4P9HH 2BSRA 3P73A 3UAJD 3HC3L 3VMPA 3UDWC 4ODVL 4ONFL 2RB8A 5T3XE 5EIIB 5FYKU 4U6VL 3W0WD 3EHBC 5LQBL 2EZ0D 1KC5H 2W9LA 2G9HB 2R56H 3BQUC 2NZ9C 5LGJB 3OR6A 4XVTL 2BMKB 1UEYA 5EORH 4PJAE 3IFOB 4FN0A 3N1FC 2VXSH 1HHJB 1CLCA 3VFGL 1OARH 3MA9H 1CD0A 4P46A 5GQBA 4AIXA 3QIUD 3ZHLA 4JB9H 2ZCHH 3IDUA 1TTUA 3T4AA 4NGHH 1N64H 5JOEA 5CJXA 1OPGH 1RMFL 1QSED 3L3IB 4BSWA 4Y16D 5DUPH 3FO0L 5FO9A 5E7BA 2XKNA 5HHXH 4Y4FA 3GB7A 3LPGA 3V0VB 5BS0E 2EDJA 3BE1H 1AI1H 3JUYA 5EOTB 1ODAA 4OFKA 1BLNB 3Q5TA 3RVXC 2GY7B 4X7FC 4NQED 4OBRA 1FJ1A 4U1NA 1WAAE 1Q94A 4CL7A 5EBMA 1NMBH 3RY6C 1MJUH 4QHUB 4XXDA 2P24B 4IHOA 4G6KH 1UB6A 1I7RA 4LKXB 2QADC 3CGTA 4D9LH 3BD4A 4HX1B 3CFJB 5B3JF 1T04A 1U8IB 5ITBL 4XPFL 1RSFA 3PP3H 4HUMB 3MACH 3RWCB 4QRSB 1RZGA 4W81A 4PIRF 3CFDB 1JGUL 2XY2A 4QXGL 2EDLA 4NN7C 3CLEL 3BVNB 4X9BA 4X7EC 2FBOJ 3FTGA 5EZOL 4YHKL 4OZFB 5I18L 1ETZB 2IQ9H 2GW5A 4NRYA 2RR3A 4NZTH 4HH9A 4NT6B 5HHVH 5SWQA 3V2AR 4F9LC 5GZND 2PKDA 1ADQL 4U1IA 1I8MB 5F3HB 3LKQB 4EN3B 2VITA 3KPOA 4PUBL 4P23D 4KQ4L 3TBVB 5I71C 1LP9A 3MLRH 4Y4KB 3DOSA 1MLBA 3WUWG 3FZUD 2AXGA 5DSCB 1NCWL 4HG4K 3WLBB 4HK0A 1PEZA 5AYQA 4DZ8B 4KJWD 3EOTL 2W0FA 1GJIA 4P2OB 3VI4F 4H5SA 4C83A 3OB8A 1IRAY 2QTEA 3G6JA 4OF8A 2YBRA 4H25B 4MA3A 5I2IB 2OR9H 3D69B 3WHXA 3W0WA 3D3VD 2NNAB 3WLWD 1J1OL 1E28A 3GSNB 1HXYA 1A5FL 3VXOA 5IHLB 5EUOF 1ZKAA 3BP5A 4DQOH 2GFBB 3SGJA 5DRNB 1MFBH 3NA9H 2R23A 1AFVL 1CLZL 3KPLA 1PGRB 1ZA6A 3NABH 2EXWD 4KTYA 4WHTA 1MIML 2FCBA 3V8OA 3FN0H 1A64A 1R3JB 3QIUA 3QEGL 3SGEI 4D94A 2JELH 3C5JB 1JGEA 3OL2A 5CBAA 1WEJL 1OGTB 1GHFL 2YN3A 2BVYA 3S3JA 1P7KA 2AQ3A 2C4FT 2UVEA 4LLQA 3QEUA 4YBHA 5I74C 1F8TL 3MXWL 4YDLC 3M45A 4CMHC 4X5WB 2IANE 3OKKA 1CFNB 2E3VA 4WFGE 3HAEH 1FVCB 5F3BB 1RUPL 4R26L 1WFNA 4TPRL 4DW2H 1WQVT 5DHVB 2Z8VC 2KQNA 1KCLA 3M17A 5T3ZD 2X4RB 5GGRA 5KSUA 2O93L 2VXQH 3FAXA 4HLJA 3BUYB 1U9KA 5D6DC 2XRAL 1DLHB 3S88H 1RVFL 3QP3A 4YR6B 4HV8A 4RDQF 3VG0L 4PV9B 5F88A 2GT9B 2MQ3A 4AEIH 3S34H 4M93B 3MV7D 4MCYA 2OXHA 1WCBB 1RJYB 4N8VB 5DJ6B 2YUWA 4WTZG 1FNFA 5FUOH 5C8JB 5CLWA 1FO0H 2C3WA 4P23A 3LV3A 3N9GL 3HZVB 4GQ9H 4F7PA 2R9HD 5HSFA 4J6RH 4XNYH 4XWOC 2F8OA 1PSKL 3LKNB 5LXGH 4DGIL 3H9ZA 4PJHF 4OM1H 2VDRH 1C08A 5TDPB 5IB2A 1CFSB 3OR7B 4PGCB 2IPTH 1W8OA 3MLZL 4M62H 1UB5B 4JKLA 3CIQA 3VWJB 3L6FB 5I1IL 3RNKA 1MRDH 3QDME 3VE0A 4KWUA 3D48R 2AERT 3D3VA 1MPAH 4RGND 2CIKB 1G9NH 4X99A 4P5TC 5DC4B 1OM3L 4HKJB 1D9KD 4TRPH 1NGWA 2ENYA 2IMMA 2FJHB 1BM3H 3OQ3B 4CNIA 3DBXA 4MYWB 5ALBH 3D0VA 3ULSA 5CZXD 3REVB 3NAAH 1X5IA 4JFFB 1JHKH 3FHQA 1I75A 1OSPL 2BZDA 2P7TB 2DICA 3RDTA 4KC3B 5JXAL 3SEPA 4GO6B 3BZEA 2CD0A 2C1PB 2XN9E 1XGUA 4J3OC 4DGVL 3MNWB 4UV4L 5BZDA 5EUOA 3U36B 3STLB 1G7PB 2DQCL 4ODVH 3U7WH 3PQYB 5EPMA 4QHNA 5IQ7L 4WY7H 1DQJB 2ORBL 4NOBA 4RGMC 1VGKB 5LQBH 3OAYH 2CIIB 5E8NA 2R0WH 1I8KA 5TH2B 5CSBA 4AENB 1TVBA 4XVTH 5HDBE 1FVDA 1F2QA 2FJFA 1PQZB 1N6UA 2ZG1A 1IGML 2IG2L 1F3JB 2VLLA 4HUXB 4EUPB 5LWYL 1PBYA 5ICXB 2IMNA 2WK2A 4XBPB 3U6RB 3SDCB 3EOAB 1CT8A 1JMXA 3BO8A 5IEHB 3HNVL 4U05A 4YHPB 3VFOA 1RMFH 2DMCA 4NQDA 2AJYL 1P4IH 3FO0H 4GS7C 4HWEL 1ORSB 3B9VA 3MV7A 4FTVE 2MCPL 5JOPD 2DD8L 3GBNH 5DJ2B 1KG0B 4E5XA 2X10A 4Y1AA 1AJ7H 2O5YL 3OKLB 5ACMA 4V2BA 4PJGA 3PGFL 5HJ3B 1YEFL 3PWLA 4YHYB 2AEQH 5C0JB 4L3EE 3TZVB 1FLRL 4JG1H 1U8OA 4JFQB 3LZFH 5GS0H 1KJ3L 2DQEL 3DGGB 2EECA 5F7DB 1YUHB 2O61A 5CBEB 1NC2A 4XPFH 3QR2A 5ISZA 3BXNA 1IEBA 1AQDB 4KXZI 5ID0A 1TENA 1YMMB 5EU4B 3MLUH 2OQJA 2ZZUT 2UYLA 1VADA 3MJ8A 3NVQA 4XP9L 1KTKE 3CLEH 3WO3B 5FYLD 5EZOH 1YPZF 4YHKH 1C7TA 4X98B 5I18H 5TE4L 2ESVD 1XCQB 3LMJH 4S1RH 3OAZH 5KN5B 2BNQD 3PUCA 1JGDB 5ACLA 4QOKA 4Y4HC 4PJHA 4DKFL 1DBBL 4M1CC 3QDJD 4K3GA 2H8PA 4KQ4H 1MRFL 1YY8A 2Y25A 5BQ7B 3GMLB 5KJRL 4NJ9H 1NCWH 5GSVB 1FYTE 4ZTPL 4MX7A 3HG1B 3IGAB 5L2KE 3C8KA 2DQJL 4HF5L 3TA3D 3QO0B 1CGUA 3EOTH 4S11A 4XC1L 1N3NA 3W9DA 1U8HB 3LKRB 2E9BA 3K3QA 2W0PA 5DJ0A 3JVGC 3VI3E 5CAYB 3RKPA 5DJAB 2P5WA 2GAZB 4HUWA 3S37L 5H35B 4Q9RL 2VISB 4R8WL 3QUYC 5T3XH 3SGDI 1J1OH 1A5FH 5HVWA 2VDPL 2A6JA 1URLA 4MJ6B 1CE1L 3C60B 4LCWE 1PLGL 4NQCB 1H0DB 4Z9KB 4ISVA 5I15H 5KS9E 3ZE2E 3FO2B 5INCA 2AXFB 5KSAD 1BQSA 4HJ0C 3IKCA 5K33A 1MIMH 4KI5C 4ZO6A 3QUXD 3QEGH 3JUZA 1A1NB 4G6FB 5HGDB 2Y4SA 1DVFD 1KCRL 2PXYB 2EDHA 1KGCD 1QLEL 2R1WA 3JTTA 4DGYL 4XI5D 1GHFH 5IESL 1J8KA 2QV2A 1F45A 5C0CB 1UKTA 4FQJL 1HHGA 2DLEA 4LGRB 1F8TH 1UH3A 1R5IA 2W60A 2DBJA 1DJSA 3ETBF 3FFCD 1QRNA 2KZWA 2X89A 4CBPA 4P2QA 1F6AA 5JORA 5D6CB 3SDXF 1RUPH 2Y06L 5IKCB 4R26H 25C8L 1ZXQA 1FVEA 4UDTB 3ZDZF 4UZGA 4OKDA 1EHXA 4B0MM 4IM8A 1HHKB 3MJ7B 4L9LB 1NCAL 1K8DA 1EV2E 3DMMB 3GSRB 1KPRA 3P30L 3W2DL 1OF2B 1NDGA 2MCG1 5ETUB 2BHZA 2XRAH 3G08A 1Q0XL 2VXTH 3LQAL 2L4OA 4JRYE 3IDGA 1IKNA 1OB1A 1QSFE 3VG0H 4F3FA 3K7UA 4MS8D 3TVMD 1DZBA 4MNQD 3UTSB 2BNQA 2PO6D 3FB7B 4QY8B 3FONB 2OTWB 2LQRA 3JV6B 4LL9A 4MQSB 1I3UA 3S98A 3QDJA 4HMCA 4UBDD 2VDQL 3EOBA 3Q0HA 4ZPTB 1J05A 2VN7A 5FF6B 2CR3A 1QZ1A 5E56A 5GHWL 5I8KL 5C08D 5I1DA 1F3DH 4PJDB 1SY6A 3MRGB 3ULUF 1T3FA 2LU4A 3TA3A 3OKMA 1NCCL 4C4KT 1YPZA 2AVGA 3KLSA 1ZV5A 1N2RB 2IALB 1JK8A 3MLZH 3S3SA 3RZCB 3RVTC 4E42A 2PUQT 1KYOJ 1I7ZB 4JDZB 4G7VL 3SE9L 1OM3H 5JPMB 3MA7B 3DVNA 4OSUL 4U7MA 1Q9WB 1U93A 5IB3B 4HDIB 4L9DA 3HAEB 4UIKH 2R69L 1LEGB 3QIBD 1QEWA 5D7LB 1NGQL 3ULUD 3PWNB 1RPQA 4LF3A 3SCMD 5GIRB 1JGVL 3CX2A 1RIHL 5M95B 1Z9MA 3DI2B 4M7JL 4PPTA 4KHXL 1DVFA 1OSPH 3DVIA 3QG6A 4G8FA 1FZMB 4G8IB 3MREA 4S1SL 4XXCA 3MRHA 5KAQG 5JXAH 4QWWC 4M7LT 3LEYL 3FMGL 3TBSA 4JEGB 1NFDE 3MRLA 3PL6C 3QUML 4U3XA 4UV4H 2A9NL 1A1MA 3TM6A 2DQCH 3QQ3B 4S1DD 4XAWH 2LVEA 2ORBH 4PRDB 3KPSB 3L3DB 1S7XB 1NUGA 1FO0B 3L7FB 4HIEB 3ZDYF 1OOAA 2RCSL 2N56A 1ZT1A 5ESAB 3EJYD 2B1AL 5KVFH 4U1GC 3PWJA 1DQLH 2GKIA 2F8XC 3Q2CA 4AZ8A 1U0QA 1B0RB 4OLUH 2RIKA 3HNVH 3D18B 2AJYH 2ZSWB 4PYHA 5FOBB 3SDXA 4JQIL 4HWEH 4OUOA 2DYPA 1R5WB 1F3DJ 1TNNA 2MCPH 2O5XL 2PO6A 3TJEL 5ID1A 4Q9QL 2DD8H 2BNUB 3VWKC 1CWVA 4QRPD 3QEQD 3QXDA 3W11C 1XMWA 4F7EA 2O5YH 2FX8L 5AZEL 2YPVL 3PGFH 2H2SD 1HXMB 1YEFH 3VXRD 4X4MA 2VLJB 1FLRH 5LG1A 5CGMA 3MGOB 3ARDA 4PY8J 5EO0B 5GS2D 1KJ3H 2DQEH 5IWLC 2VZVA 2MQCA 1ITCA 1A8JH 2CDEB 2CLVA 3BP4B 3QQ9D 3DXAE 4GKZB 4ODUB 1YNTB 4XP9H 3RTQA 4GRWE 4QRUA 1N5AA 2NW2A 3QUKB 2VR5A 1CDJA 4Z7WA 3MCKB 1F13A 3SKOA 3RWJA 1A3LH 2IQAB 3C5ZD 5IHZA 4L3AA 4DKFH 3SCMA 1JNLL 4JRXE 3S36X 5D2LE 4IIQB 3QXAB 5CINH 5IK3B 1S7VB 2EKSA 3RBGA 5CSZB 2H6PA 2D7QA 3P4OB 5ITFA 2NYYC 4Y0GA 3R0MA 3KXFD 3BGFC 4HGWB 3SKUD 4HF5H 5IF0A 3MUZ1 1TCRA 1S7QB 3HI6H 5F1NA 5I1KL 5DI8A 4ZQKB 4E41A 3MRCA 3WDJA 2FL5B 1TVHB 4ODSH 4I0KA 3ZYZA 1S7WA 3S37H 1FFNB 1E4KC 3L95B 4HKXB 3RWGB 4BA8A 4R8WH 4IRJC 2ARJQ 1KXQE 4OF7A 5HHOE 2VDPH 1CE1H 2FO4A 2WP3O 1PLGH 3LIZH 4X4ZA 5E8OB 4DUVA 1DUZA 3PJSA 3U2SB 3V6OE 1EFQA 2I9LB 1MCIA 3BZ4A 4XCNB 4G8GD 4FQXC 3FRUB 1QLEH 5TFSL 2BVOB 4NKQB 4NKOB 3WL9B 4DGYH 5LGKA 5IESH 4BYHA 5FHAH 4Y2DA 2GJ6B 1B88A 4OF5A 4NQSB 3NZHL 1AO7E 3PGDA 4FQJH 1J1XL 1REIA 3MRMB 1C5CH 2XFXB 1VCAA 3QEQA 4HJGA 2UWEF 4KKLC 3DTXA 4LLUB 3CH8A 3VG9B 4YBLB 1U8QB 1NANH 1E4WL 1T1WB 1G9MH 3BIKB 4NC0B 2Y06H 4QTHB 4Q9BA 5DD3L 25C8H 5K9OB 1ZGLP 4QYOB 2D31A 2FYYA 1CGYA 2HFEB 2MNUA 3BP6A 4U1LA 5GXBB 3IDXH 5DXWA 3VXUB 2GSIA 1FH5H 4KRNA 3EDKA 1OP3H 1LE5B 4JO4L 3O3BB 1WBXB 4ZUUA 3DV4A 4IJ3B 3DRTB 3P30H 3EHBD 3W2DH 4JZJB 1YNKH 5E8PA 4Y7MA 1KIRA 3VJ6B 2CKBL 3VXQA 1MLCB 3BQUD 2NZ9D 5D1XB 1Q0XH 4F7MB 1H3TA 2AKRA 5HYFA 2ATKB 2FDBP 3QDGB 4G9FD 1JVKA 1PJ9A 1BVKA 5D7IB 3NFSL 3OHXA 1BGXH 1HK6A 2PYEE 3T0EE 3WIIL 5KSBF 4LBEA 1QD0A 3BGMA 2C1OA 3CXHJ 2VDQH 1FPTH 1N59A 3DETC 3LRHA 4M6OL 2I27N 3NPZB 3DX9A 4ZNCD 4ZODA 3BW9A 1P53A 3CUPB 5CIPH 5GHWH 4NC1E 1WTGT 5I8KH 4LOUC 1FFOA 3F12B 4PJCF 4L3CB 2XTJB 1QBML 3FB5B 5DQ9B 1NCCH 4H8WL 4NO5A 1E6OL 1CGVA 3RVXD 1GVIA 2FLBT 4CU6A 3FQRB 1ED3B 1SJHA 3JWDC 3LS4L 4ZNEE 1ZA3A 4Y19E 2MHAB 3S5LA 4G7VH 2X40A 2NW3A 3SE9H 1I9EA 2OL3L 2QADD 5BS0B 4OSUH 3L5XL 1MJJA 2R2EB 1MFEL 4L4VD 1M6OB 4ZG1A 1J88A 3PE9A 4N0FA 4WNQB 1R5VA 5D7JB 5KW9L 5DMGC 5HPMA 1NGQH 1FAIH 1JGVH 5DMIH 1RIHH 2B4CC 1DLFL 4M7JH 1TZHB 4G8GA 4KHXH 1ZLUH 3D39B 5EC2B 4S1SH 1BD2E 4P4KC 5DZLA 1D6EB 3VRIA 3ALPA 4AMKL 4ZO9A 4MD4B 1SMOA 3FKUS 3ARGB 4KKBC 3FMGH 1ZWIB 4ZXBB 2A9NH 3FAWA 1U8JA 3NIDF 5FGCE 1H8NA 3WS3B 1YMHA 3BHBA 4FABL 3GK8H 4LVOB 4MJ5B 4OFIA 1P7QD 5IBUG 4ORZC 2P1YA 1C5DB 2PTVA 4PG9A 5J6GB 1RZ7L 2B8OT 4XNMA 4GMTL 5CEZL 4FP8L 1I7TA 1ZT7A 1EDQA 2RCSH 2ZNWA 5EU6D 1M7IB 1DTUA 2B1AH 4NOFA 3HC4H 3UTQB 3ZYIA 5B38G 1DE4B 1HINL 2A74A 1H3UA 1NBQA 4HKZA 3BQUA 2UWEA 3DSFH 4JPKL 3U82B 5C9KA 5C0AD 2NTSP 5JHDA 3DPBA 4OJFH 2BVQA 5I8OL 4AY0A 4JQIH 3DWTA 4U6HB 3IAPA 2QR0A 2O5XH 3IDJB 4V1DB 3MSPA 3TYFA 5AZEH 2GTWB 2YPVH 4KY1L 3FQXA 1A2YB 3CFBA 3E2HB 3CDYA 3SDDA 1EEZB 5GRWA 4OLVH 2HLAB 1U92B 4F9PA 4P5KB 4HCRA 1ZS8B 1HSAB 1DQML 4WU7A 4H0GA 4CGTA 1KBGL 1W0VA 5F8RC 5JOFA 1N8ZB 1ND0B 5SWSE 1OW0A 4M8QA 1CFVL 4D9RE 3WO4B 4NPYA 4EVNA 2F8VA 2AP2A 1WZKA 5C0BD 3D1MC 1MHCB 4UU9A 4HWZA 3TIEA 3VFMA 2HRPH 5CD5D 2F74B 2A6IA 3L9RB 5JXEC 4WW2B 2RFXB 4XZUB 4YXLL 4L4VA 2DLFL 5B4MD 1T0MB 3E6HB 2CXGA 5FDWA 1X6NA 1BZ7A 1DQQA 3MROB 2NZIA 1MAML 2NMSA 4MWFA 1IGFL 1MY7A 3MO1B 4LLVA 3VFSB 3EFFB 1JNLH 1UEMA 1K9TA 1SMAA 2IWGA 2J8UE 4WWKB 1S7RA 1TDQA 2NX5A 5EZLA 2HAZA 2ED7A 2C3VA 1TETL 4G42A 3W9EB 1UXSB 3CJJA 5SWZD 1YDPA 5DLML 4KJPC 3T8XA 5F7HA 1QPPA 2G2RB 1S5HA 2Z91A 1AXSB 4LLDB 1Q9LB 4LSTH 4XWOD 1UJTA 3DUUA 4HXAL 3NTCH 4LCUA 5E2UL 3BEVB 1QSEE 1P7QA 3P4MA 3RIFF 3O8XB 1RZFH 4WU5B 5E9DB 3IJSA 3TH2T 1BJ8A 4BSVB 4EBQL 2GJZB 3MLWL 1BVLA 4W4OC 5J6HB 3V4VL 3SDAA 3X11B 5FV1L 3HCVB 4CN4A 4NQEE 3OGCB 2R15A 3D85D 1MCOL 4P5TD 2ADFL 3SBWC 4AH2B 1OAXL 2F53E 1IC4L 5C0ND 5EOQH 1Q72L 4BJLA 4OGXL 1AR2A 1AXIB 4WIQA 4X6EB 1CDIA 1I85A 4FXKB 2HN7A 2MKLC 3O6ML 4FQQA 4YAQA 4IRSB 3NZHH 1YYML 4YEEA 4Q74A 1J1XH 3TYGL 5I76A 3B4NA 4HBCL 4I2XB 2Q76B 5MI0C 1P5VA 2DMKA 4UINL 5CMAB 4PB9L 1R0AH 3KVQA 3UBXB 3A0OA 5DD3H 5KVMC 5FCSH 1KCSL 3L3KB 4BH7B 3LSOB 4WI3A 3LS5H 4ZAKC 3ARBA 1U41A 3JWOL 5DJCB 3B5TA 3JBG7 2FZ3A 4JO4H 3AVEA 2OK0L 5EZJB 3QFJA 1JF6A 3IS0X 5C0BA 5CD3B 2VLKA 2X05A 3CDCA 4JO1L 3ARXA 1FSKC 4I0PB 3QEHB 2D03H 2CKBH 4DTGL 1TJIH 1G7JA 5DF0A 3BKCL 2WZPD 1U3HC 5E00B 4CDHA 1T20B 2XZZA 2ICWA 1KPUB 3QG7L 1EPFA 1U8PA 5EIIA 4JO2L 3NFSH 4FZ8L 3WIIH 2ADJA 5IJKA 2I07B 5L7XH 3VW3L 5JIPA 3CXDL 1TTGA 4QKXB 2G9HA 3BH8B 4M6OH 4K7FB 2BMKA 4ETYA 1F11A 2EKJA 3CSGA 2VR4A 1UG9A 5BMFL 4JKPL 5IEKA 3MBEC 4C55A 3ZHKA 1MCLA 2EEBA 1ZGLB 3SKJL 1QBMH 3TH3T 3WEXB 1VFBA 4H8WH 4OZHF 1E6OH 3WV0A 3OGOE 1FORH 3QZWB 5E5MB 2LABA 4GFTB 3LS4H 2AS5M 3HZKB 4Z76A 4WW1A 5MEND 4FTVB 3BMVA 2OL3H 1EBPA 4FQHB 4LSDA 1R3KA 1JZ8A 3L5XH 3GI9L 1ZLSH 1T89C 1MFEH 1T1XB 1MOEA 1GGIL 4EDXA 1RUKH 2DJUA 2OS7A 1KB9J 5C0GB 4QHUA 2P24A 3BYTA 1YEKH 3PV7A 3DSNA 2IADA 3ECBB 3D85A 1BFOB 3BP7B 4WV1B 5I19L 5EG6C 2GY5A 1DLFH 5FXCH 3ZTNL 4LKXA 4F58L 5EU5A 5HDLA 3GJFH 3IU4L 4MAUL 3CFJA 3TO4B 4HIHB 5T3ZE 1CS6A 4J3XA 5IM7B 2R2CA 4QRSA 4Y4HD 1A47A 1MUJB 3CFDA 5DT1L 3O9WC 3EFDL 4M1CD 4XPHL 1HQRB 1I9IH 2HFGL 4OZGF 3ZL4L 3VGFA 3CVHA 4PB0L 4U6XA 1T0NB 3KLDA 4L8SC 3L3HB 4OZFA 3KYNB 4OI7A 2UZYB 3OZ9H 1QBAA 4GXUN 4ZO7A 4EI6B 3KHOA 4U33A 3B9AA 5C3LD 2R2HA 3RNQA 1A7PH 4PJ7E 4KRPB 1RZ7H 4GMTH 5CEZH 4FP8H 2HT2C 5EBLA 3IU3B 3QJFA 4HT1L 4Y4KA 5CIPB 4GKNA 1CGSL 4YWGL 5F9WB 4HS8H 1VACB 4HSQA 3HNTL 2H26B 1FYTB 1HINH 4FXGB 4ZS6D 4WFEE 4DZ8A 4JPKH 1HOCA 5CEXB 4I4WA 4APQB 5H37H 5I8OH 1GL4B 5C6PB 2K7QA 4PJ5E 4HJ0D 3T2PA 4K3EL 3UYPA 5I2IA 5CILL 3D69A 5C07E 2D2OA 1KFAL 3KPQA 3P4NB 3GSNA 5B3NA 2W91A 4KY1H 3P77B 2VWEC 1T5WB 4RGNE 4A6YA 4J3UA 2GFBA 2FGZA 5DRNA 1XR9B 1TNMA 2EXYC 1UCBL 4TNVF 1DQMH 2JCCE 1OLZA 5TJWK 1KBGH 4ZD3H 1WIPA 1WLHA 4O2FA 1R3JA 3F7PC 4W6WB 1UZ8A 4NM4H 1CFVH 4ZUSA 1MJ8L 4PS4H 4YNYB 5F1SA 1IGJB 4YBQC 3QIWB 3QHZL 4N1EA 3F8UB 3WN5B 1MY5A 4L29A 4C56E 3EBAA 1ZHNB 2X4UB 4H26A 4OIBA 5KAQF 4DZBB 1SYSA 3QUMB 1OQXA 5SX4I 1J12A 3IETB 1D5XA 1J8HB 5F89A 4YXLH 4X5WA 4N0CC 2DLFH 1AGBA 3GKZA 3MCLL 3VFWB 1A9EB 1T03H 1NC4D 4LVNB 1FVCA 3ARUA 4TUKL 1DN0B 5JNYB 1MCWM 4OCSL 2I60L 2NY1D 2APXA 5FKAB 3EDEA 2Z8RA 5DHVA 5E1AB 4UNVA 3GMQB 4RFEA 2YUXA 3D9AL 1MREL 4NRXA 1CXEA 3SKNB 5D5MB 3SY0B 3QRGH 1RJZB 5DFTA 5D2NE 3OXRA 5DLMH 3KDMB 3R0NA 4FHBD 4NKDB 2APFA 4YR6A 1NBYA 1RZJC 4YDJB 1BQHB 5EO1A 4AM0A 2P5EE 4PV9A 3QISA 4JAMA 1HI6B 2PW2B 2NTFB 4HXAH 2ICEB 3EYFB 3QNXB 5E2UH 3MXVL 1NEUA 3C5SB 2ERJC 3IJHB 4LSQL 1OAKL 2X4SA 5DJ6A 4AG4H 5BJTA 5C8JA 2GSGB 5JOPE 1AGCA 1QUNA 3RVTD 4BFGA 2D7MA 2FX9L 4QHKJ 5IB5A 1MI5D 4M1DL 4OZGA 1MCOH 3BPCB 2ADFH 3SDYL 4PRPD 3UMTA 2BNRE 1OAXH 5TDPA 2AI0L 2AV7A 4UILL 1MCFA 1CFSA 3OR7A 4PGCA 4J2XA 1MHEB 1UB5A 3O81A 1GXEA 4WHYG 4NO2B 4XPBH 4NKMB 1KELL 3UYRL 3MJGX 3TYGH 3HKFA 3MOBL 1P5UA 2CIKA 4HKJA 1QA9A 2E6JA 5FIEA 4JFED 2HVKA 1J0IA 3UXFA 4UINH 5LKNA 2FJHA 5BV7L 2CK2A 4GUPA 5JUEL 1F4HA 4Z7VF 4J3WA 4MZ3A 2YMXL 1ZANH 1YN7A 4N9GB 2ESVE 4RIRB 4ZUWB 1KT2B 3RX5A 2ZWLT 1KIPA 3PL6D 3REVA 3ROLA 3HMWL 5MHSD 3JWOH 2YD5A 4B7IA 1FE8L 4XMPL 4AIZA 4OCWH 4O5LL 1MVUA 2OK0H 3H7LA 1VPOL 2P7TA 3DV6A 1WJ3A 5DHYB 4JO1H 3R4DA 4JFDD 1NFIA 4M3JA 5T1LB 1NGYA 3S4SB 5EOCL 3BKCH 2HG5A 3U36A 5F9JA 2FGWL 3QG7H 1XR8B 1HH6B 1QFHA 3PQYA 4JO2H 5DD5H 4FZ8H 1DQJA 4WJ5A 4GQPH 1HWGB 2WBWB 3SJVA 2NY6C 5KSVA 3VW3H 3CXDH 4WWID 4OKVB 5GGVL 5TH2A 3TIDB 2FO1A 2L7JA 5DJXB 4JQXC 3IFPB 5CUSL 1I1FA 1NJ9A 3OX8A 1EZVX 2NLJB 2DBLL 4EUPA 2AJZA 4YO0B 2B0SL 5BMFH 1EUTA 2ZSVB 3O6FD 3VWKD 2A38A 3WXVH 4OV5A 1E4XL 3SKJH 4YXKH 3CCHA 3W11D 3SE4A 2ZUWA 3EOAA 1IJ9A 2BVPB 5IEHA 4L1DA 2DKSA 4ODTL 4YHPA 5DFVD 4EJ1C 1RD6A 3HE7D 1JF1B 5FO8A 4U1MB 4GW4A 5I6XC 4N8PA 4LLYB 1KG0A 5DJ2A 4NZDA 4DWHA 3P11L 5C0IB 1G0YR 3GI9H 5F7NC 1SQ2N 4P5MB 4WUUB 1GGIH 2G75B 2AEPL 5HJ3A 1AD0A 3TZVA 3OKYA 1MI5A 3AM8A 4JFQA 1A7RL 3P0YL 5I19H 3O4LD 3OKDB 5CGYC 2YSSB 1IM9D 3JV0A 3ZTNH 4F58H 1YUHA 1G7QB 1RHHB 4NFDA 5IMMB 2XYCA 3IU4H 4MAUH 5JIIA 4N68A 3WKML 1JUFB 3NIGE 1HHIA 4JJHA 2HJKB 4O2EA 5DT1H 2CKBB 3HA0A 1AQDA 4XPHH 2VERN 2WINB 2HFGH 4MA1C 5EU4A 3BKML 3ZL4H 2AK4D 2Q6WA 4YHZL 4PB0H 4P3DB 4JFEA 2CKNA 2GHWB 4YC2B 4MDIA 4X98A 4JQVC 2NYYD 3BN9C 4NQTA 2V5MA 1HQ4A 2XXMB 5KN5A 4GG8A 2OJEB 5FYLL 4MNQE 1FZJB 2KUTA 1ITBB 3ILQC 5BQ7A 1E27A 3GMLA 5EFIB 2W59A 4XBGA 2C3GA 2DM3A 1CGSH 1TZGL 4YWGH 2KDGA 4K71B 2XTLA 5GSVA 4Z7NF 4RA3A 4LRIA 3IGAA 1CVSC 4K3DL 4LEOB 4JHAH 5C08E 5ERWA 1QG3A 1U36A 3LKRA 4OD2A 4WEBL 3KPMB 2YUZA 5I16A 4ZUVA 1F00I 1NBZB 3MX0A 4K3EH 5DZOA 4Z7VA 4U1KA 5CILH 5H35A 5E2TL 1TLKA 5EUKB 1BZ9B 2OL3B 1KFAH 1CGTA 2Z31A 2X4NB 5IG7B 3WFDL 2APTA 2UY7A 4FQXD 3VWJC 4X9IA 1LEIB 4TUOA 3C60A 3KR3L 4LIQE 1H0DA 4G6ML 3QBTB 1U2HA 3QCTL 3MRRA 3O6FA 5E99L 2WUBL 4KKLD 4PTTB 5BO1H 4KU1A 1A1NA 5L88L 5HGDA 4LHUD 3ULUE 4YLQT 1XT5A 2BY3A 3HE7A 3P9MA 3MV9B 5IOPB 3GEWB 1JPTL 5T5FL 2Y7QA 3DURB 1T5XB 3H9SD 3H3KA 4XVUC 5BCAA 5C0CA 2FHBA 4U0RC 5CJQH 4UOW1 4N8VG 2JIXB 3VXPB 4FQLL 3UO1H 3MCLH 5MEQA 4ODWB 3EYVB 2GK2A 4MNHB 1QR1B 3NBNA 4HXBL 4OCSH 3J7HA 5IROA 3B3IA 3DARA 1GYAA 4UDTA 4R9HA 1IM9A 1T2QL 3U4EB 1EJOL 4LU5L 2QHRL 5L6YL 4Z0XB 5C3TA 5HBBA 3PIQA 4B7LA 2ARWA 2YPKA 2W65B 1G1YA 3MJ7A 4Y5XC 3D9AH 1MREH 5DDHB 3DMMA 1CLYL 3GSRA 2PNDA 3QUZB 4FQ1H 5KTEH 1J87A 3AFLA 2XNAA 5GJTL 5T3ZH 2YWZA 1AGEB 1GH7A 2AK4A 4DUWA 3DETD 5IHBA 1VHPA 1BBJA 3JV5A 4RMVA 1KLGB 4KH2A 2ID5A 1WK0A 3HLAB 3MLSL 4TSBL 4PRID 1F6FB 3SDCC 4LOUD 5DJDA 3MXVH 5J06A 4QY8A 1L7TL 3JV6A 1B6UA 4LSQH 2WIMA 1AP2A 4NNPL 1JHLH 1GAFL 3AY4C 1JNJA 4OLEA 3F7QA 4KJQC 3UTTB 4QRPE 5C0EB 4MMXC 3VRJA 3P9LB 5AG9A 3HE6B 4J4PC 4P57B 1E4KA 4WUKL 1JJUA 5C09A 3UC0L 4M1DH 4E0RB 3MRGA 3VXRE 1CXIA 3B83A 1ZHLA 4YHYC 2AI0H 4UILH 3QCVL 3D6GA 4WHCA 5TGBB 1KN2L 4Z78B 2KBGA 5HYEA 3WD5L 2VLRD 4L8CA 1N2RA 2IALA 5ANMA 5HHPB 2BHYA 3CDGB 5DMGD 3IJYB 5GGQL 1KCVL 4C59B 1KELH 1UJ3A 1FL6B 2XG4A 3AROA 5DURD 3UYRH 2DTML 3VGGA 1LO3L 2YXMA 3L5JA 1Q9WA 1IAOA 1N5YH 1A3RL 3HAEA 5JUEH 4P4KD 2CLZB 2BSRB 2I5YL 1ACYL 1H3GA 5B22A 2YMXH 1GC1C 5D7LA 3PWNA 4KKBD 5F7MC 3HMWH 2YXFA 4LHUA 3NH7L 1FE8H 4XMPH 3EO9H 4G8IA 2AXJA 3ULUL 1VPOH 3T77B 4NO0B 1VERA 4DVBA 2AABL 3D87B 3H9SA 1BD2B 2QKIB 5ELIA 5EOCH 1IQWH 3KXFE 3HMXA 4P46B 2GK0B 2PN5A 1MSPA 1PFCA 2LTQB 3T4AB 4ZSOA 5FGCB 4PJ8D 1SJEA 2EDKA 3DRQB 4BSWB 1S7XA 4G5ZH 1FO0A 4Z5RA 2XKNB 1IAIL 4Y4FB 3GB7B 4YZFF 1JPFB 3H3PL 5CUSH 5F6HJ 1UGNA 2BDNL 1DP0A 5ESAA 5EU7E 3VXSD 4HJJH 3SQOH 1NFKA 4XX1G 5IP4A 1E4XH 1FJ1B 4R2GC 1B0RA 4ZOAA 3AREC 5EBMB 4YPJA 5MEOA 4URTB 2Z9TA 3D18A 4IHOB 3G5XA 4FXLA 5EO9A 3FQUB 1I7RB 1YJDC 1R5WA 4BQ9A 4MXQC 3PHOA 3HFML 4PRAA 1T04B 2BNUA 5DA4A 5IB4A 2E9JA 4WCYL 4EDWH 3P11H 1RZGB 4JHBA 2AEPH 4X4YB 4GG6F 3GO1L 3V5HA 2Q7YB 3GUTA 2M2DA 4LSSL 1NEZG 3UTZA 4QRRE 1BJMA 3FTGB 4ZFZB 5LJYH 3AXLB 5EO0A 1A7RH 4LRNH 1YYLL 3AB0B 4X80L 5SWQB 1AGDA 2Z93B 4DKDC 3BH9A 3MV8A 4WEUD 2GJJA 2VLRA 4U1IB 4NCC1 2VOTA 1UT9A 1UCTA 2CDEA 2CH8A 2VITB 3BP4A 1VFAA 3OTTA 4PJAF 4CKVX 4F15C 1OT1A 4I5BB 1LP9B 3V95A 3LPFA 3BKMH 1MLBB 1LK3H 4YHZH 3BZFA 2AXGB 1K4CB 3M07A 4L9LC 3QUKA 2V5RA 5J13C 1JZ7A 4HK0B 1I4FA 5F21B 3MCKA 4FG6C 4M61B 5JO5A 2YKLL 3CH1A 4W4NA 2X4QB 2W0FB 5LBSL 1IZKA 1MH5A 5T3XD 4KJPD 4H5SB 4G9FE 5FYLH 4PY7B 4YE4L 2B39A 3G6JB 5EOCJ 5AD0B 4FFZL 2YBRB 1YQVL 3G5YB 1S7VA 4GT7A 2J8UB 3C2SA 3W0WB 3WHXB 1TZGH 3P4OA 4RNRA 1E28B 4X6DE 1WAAF 1XGYL 4I3RL 3BP5B 4HGWA 1DQTA 2DQHL 1GZPA 2R23B 4TQEL 3T0EC 1ZA6B 2ZUVA 1I1RA 2UUDK 2YZ1A 4OGYL 5KOVC 1IGYA 1P2CA 2FL5A 4WHTB 3S36L 4HUVB 3MRIA 2BSED 3QIUB 4N0UE 3GJEA 1NLBL 4Z7OE 4P0DA 1LILA 1FFNA 5E4EB 4ELKA 2Y5TB 1YEJL 4PJ8A 3RWGA 4HKXA 4QXUL 4BZ1L 2Y5EA 4NC1C 1QSEB 3WFDH 4Y16B 3RZCC 5CBAB 3I6LD 2QEJA 2FX7H 5KSBE 3KR3H 5LCVH 5IB1A 1P7KB 4G6MH 4R7DB 3QCTH 5CJBA 3IRPX 4KVNL 1VEMA 3GI8L 1VA9A 3VCLB 2JB6B 2XT1B 1L0QA 3U2SA 4NQEB 1CK0L 1MCNA 2WUBH 3GDBA 4PJCE 5L88H 2I9LA 1I7UB 4XCNA 4LPUA 1AKJA 4PBVC 1LDPL 4MJIE 3FRUA 5E8EA 4L1HA 4NKOA 3TT3L 3K4AA 5T5FH 3GBLA 3T65B 1CLOL 3BISA 4ZAKD 4RX4D 3VXME 2BC4A 5GGRB 5KSUB 4HPYL 2XFXA 1YEGH 5HVHC 4FQLH 1KV3A 3QYCA 1U8QA 4MD5B 1HILA 3EO0A 2CK0L 4HV8B 4AEFA 1CBVL 4HXBH 5K9OA 4M43L 5T1KD 3TBTB 4LMQI 2X6MA 5CSGA 1U3HD 1T2QH 4R7NB 1EJOH 4LU5H 2QHRH 3NCJH 1JTPA 3J8F7 4H0IA 1JP5A 1TJGH 4KZEH 3H42L 3O3BA 4TVPL 1WBXA 2XWJB 1CLYH 2VDML 4P23B 4Y88A 1SVZA 4JZJA 4NWTL 5EU6E 2YC1A 32C2B 3ZLQC 4F7PB 3CMOL 1U3ZA 3VJ6A 5B21A 5D1XA 5D1QC 4HD9A 2ATKA 1TQCC 2XZCL 1BFVL 3MLSH 4TSBH 3HPJA 3RL2B 8FABA 3MLVL 5D4QA 5HHQA 4UIMA 3H9YA 1L7TH 3RZWA 3AS3A 3ZE0E 5E2WL 3K8LA 4NNPH 1GAFH 2AJXL 5F7YC 3NCCB 2CUHA 3D3VB 4X99B 4PJAA 4WUKH 4PJFE 2X4PA 1F2XK 3UC0H 4L3CA 1NGWB 4B53A 5JQHC 1KEGL 3AC0A 3MLYL 4XNZB 4X5LA 3FB5A 5DQ9A 4IOSD 3QCVH 4D3CH 1KN2H 2XOTA 4X7TA 3WD5H 2CLRA 4NNXB 3VFTB 1PZ5B 5GGQH 1KCVH 2N7AA 2MHAA 3SBWA 3AS2A 4FQCL 2DTMH 2YRPA 5HYSB 1IARB 5BS0A 3RDTB 2R2EA 3ZTJG 4QTIL 1A3RH 1M6OA 3BZEB 4WNQA 3S9DB 2IAND 2I5YH 5D7JA 1XGUB 4LIQH 4IRZL 4WFGD 3O9WD 3WFEL 1WAAA 5EUOB 2HH0H 4JJ5A 3SPVA 1YN6A 1TVDA 1ZT4A 1I8LA 3QDHA 4PY8I 4QHNB 5DJYB 5EPMB 3VDCA 4XCEB 2GITA 1O0VA 5JW4N 5EC2A 5E8NB 3ULUH 1OD7A 4PGDB 1X5JA 2LVCA 2AABH 1JHTB 1KLUA 1TVBB 1T7XA 1FVDB 2FJFB 4W70A 4PRBB 4ZAKA 5I17A 4OZIF 3ARGA 4MJ2A 3BEWA 3GMPA 3RPKA 2VLLB 1ZWIA 2HT2D 3VD4A 2K1MA 5SWZE 4B41A 2RHEA 3PHSA 2DB8A 3BO8B 4PJ9C 1IAMA 3UCRA 4MJ5A 4PLKC 4NQDB 4JFZL 3T1FA 1G7LA 1C5DA 5J6GA 4JZNA 4H20L 1IAIH 4PJ7B 3OG4B 1FQ9C 1X5KA 3MV7B 3RHWK 4JKWA 5TF1L 1H3PL 4E5XB 5DRWA 3SGKC 4NZRH 1I1AA 3UTQA 3T2OA 1DE4A 3KPRD 2V2XA 4PJIF 5I8EA 1FGNH 4WI5A 1AHWB 1U8OB 1DFBH 2MSPA 4U6HA 2O61B 1NUFA 3HFMH 3U7AA 3QDMD 4RCAA 4M5YH 5ISZB 1S9VA 4OLWH 3VA2C 1C7SA 1F4AA 5BV7B 3BXNB 4YBQD 5ID0B 3GO1H 1EEZA 3MJ8B 2UYLB 1VADB 4GW1B 4OIIL 3ZE1F 1U92A 4P5KA 5EB9A 1SHMA 1D9KB 4HLZG 4NHCL 3WNLA 1YYLH 1IILE 1AE6L 1ND0A 1T89A 2R29L 4N0CD 1FDLL 4QOKB 4POZC 5HDBF 4LCIL 4L4TD 1CD1A 5KG9A 3ARWA 2H8PB 4U6YA 1YY8B 5INDB 5J11B 2Q8BH 1PD6A 4AQOA 5I0DA 2F74A 2P43B 4NM8H 1U8KB 4IJ3C 4G6AD 2RFXA 1KULA 2XN9D 4XZUA 5HPOA 3WSQL 4R4FL 3C8KB 2CDGB 3G6DL 4H1LH 3E6HA 1N3NB 3MROA 5IR1B 3P3YA 3F65A 1HNGA 3WFZA 1K85A 2KQMA 3ALWA 4DEPC 4DAGL 3U0WL 4FFZH 4NN5B 1J5OL 1U8LB 1QO3A 4YHNA 1KF9B 1NPUA 4XMKH 2V5YA 2NXYC 2W0KA 2J1KA 3W9EA 3O4OB 3TPUA 2A6JB 3WNKA 1FBIL 2M1KA 2VAAA 3FL7A 3HZYA 3N1QC 3OB0H 3QXVA 2DQHH 1XF2B 5ACZA 4O51A 4ISVB 5F9OH 1TQBC 3CX5K 5D2NB 3UBXI 1WV7T 2P8LA 5GS1B 1AXSA 3OKOA 4I18B 1Q9LA 4LLDA 2XPGA 4OGYH 5TDOB 3S36H 5JQ6L 2XTJC 2VABB 4LGSB 4J3TA 3BPLC 1YEJH 1KLFA 4R0LB 2R1WB 2YRLA 3JTTB 4PJBF 4WU5A 1L6ZA 5E9DA 5MENE 1XIWC 1FC1A 1MCSA 3U4AA 4BSVA 3ISWA 4BK5A 4I1NB 2NY2C 4U2ZA 1HHGB 5J6HA 4GRMA 4JN1L 1HN1A 2PYFA 1HH9A 3NCBB 2DAVA 2W60B 3QQNA 4K7PX 4KVNH 5FA3A 4GMSL 4LPWA 1CK0H 4AH2A 5JORB 2ARJA 4U2YA 2FEEL 1LDPH 4X6EA 1CGXA 4OZHE 2XV6B 1BWMA 4FXKA 2E9IA 2WUCL 3EYQC 1G0XA 3TT3H 2D9QB 4LSUL 4BQBA 2OYPA 4RBPK 1CLOH 1JRHL 4TSCL 1MJ7L 6FABH 1IGIH 3QDMA 1I1YA 2FLRT 4HPYH 4U49A 3C9NA 1K8DB 2MWCA 2YK1L 4GSDL 4JPVL 2Q76A 1FNLA 3G08B 4ZXBC 5C0RL 1BIHA 1QLFB 3UBXA 5J89A 2CK0H 3MFFA 3VI3F 3CC5A 3CVHL 1JFQL 2VR9A 2ESVB 3QHFL 4I77L 4NBXB 2GTZB 4K9EL 2DQDL 2BNQB 5IT2H 4MMZC 3DX8A 4MHHG 1LO4H 3QDJB 5EZJA 3WS6C 2VDMH 2ZCLL 3EOBB 4YIQA 5FM5M 5KS9F 1NANI 4NWTH 1DCLA 4GOSA 2NY6D 3ZE2F 3IDYB 3QEHA 4TNWK 4ETQA 1J05B 2NXZC 5L2KD 3V5KA 5FUCC 5E8DL 2VIRA 1BFVH 3V4PH 4B5EA 1SM3L 1T20A 1T3FB 3BPNB 5L9DL 4JFXA 1ZMYA 1F90L 3TA3B 1YPZB 3BSZH 1FNSH 5FHBL 2D7NA 3V0WH 5E2WH 4OQ1A 4E42B 2AJXH 4KI5E 4I9WE 4RQQA 4LCWD 1HSBA 3U30C 4XHJC 3U0TA 1UA6L 4JDVA 1WISA 3E2HC 3MLYH 1KEGH 2WLZA 3WEXA 4A6YL 1CL7H 1WBZB 1QEWB 1I9RH 5KSAB 1CZ8L 3QZWA 3HI1B 3QUXB 3DX7B 1ES0B 1KXVC 3RX7A 1DVFB 3WO4C 3QG6B 5CGYD 4FQCH 4G8FB 4FTVA 1R24A 1B3JA 3QQ4A 1M05B 5I1AA 3MRHB 4JN2A 4WI7A 1T1XA 3MRNB 1EIBA 5A2JH 3TLRA 4LKCA 4Q2ZA 4L5FL 4IRZH 3MRLB 5C0GA 5AEAA 2YD7A 3GHEL 1WUNT 4L3EA 3FFCB 4AQ1B 4MAYC 3QWRD 1Z0NA 1JZ4A 1WSST 3M8OH 4RFNB 1Q8MA 3BN9D 3S8WA 4FMFA 3VGHA 3S96A 1XGQA 1AGFA 2ZUUA 4WWKC 5I1LA 3MRKB 5EU3A 1T0NA 4N5EC 4U3HA 1FG9C 1RZ8B 1QSFD 4Q97A 4EI6A 1IC5L 5HHMD 1JNNL 2DRUA 1FZOB 4Y1AE 3ZO0A 4JVWA 2QHLA 3DLQR 2OTUA 5FGRA 3SDXB 4H20H 2OJZL 3SN6N 2DYPB 4PJGE 1ZVSA 1BFTA 2PO6B 4KHTL 5TF1H 3O8XC 5FEBA 1EO7A 3PF2A 3ABZA 3I02B 4M4RA 1FYTA 4HUNB 1DBAL 5L2KA 2DF3A 4PGBA 1TFHA 1MHPL 1KTLA 5CEXA 5C08B 1V3KA 1JBJA 4APQA 1ZLWH 4ZMAT 4CJ1A 4I3GA 5CCKL 1BOGA 3WFCH 1B4JL 2SEBA 3P4LA 4IBLT 4QXTA 1UENA 3SOBL 3WFBL 3HHRB 4IRSC 4X6CE 4S1QL 2PF6A 1NFDF 4X5XB 4LCWA 4HWBA 3RTQB 4QRUB 5JDSB 1XR9A 1X4YA 4XVUD 1N5AB 5KS9A 1OVZA 3DROB 5JW5A 2FBJH 3UZVB 4JGUA 1MCEA 2DIAA 1AE6H 2Y07L 1CDUA 5TDNB 1NMAL 3RWJB 4GKOA 2NY0D 1CQKA 4UTBL 1FDLH 1UWEL 2QSCL 5DS8B 4LCIH 3SCMB 5MHSE 5EN2B 2VKXA 4KKCC 3H3BC 1G6RH 2EKSB 3HPLB 2H6PB 1U3JA 2IAMC 1KENL 4Y8AA 1RJCA 2DWEA 3CFCL 3V7MA 1UXWA 3WSQH 4JFDE 2F15A 3OKEA 3G6DH 1A9EA 3TV3L 1TCRB 1K3IA 5F1NB 3TH4T 2R8SL 5GRVK 5FKAA 2F5AL 3U0WH 4M9OA 3MNZA 1J5OH 1S7WB 2WBJC 3E8UL 1J0YA 3A6OA 3GMNA 3SDCD 3QNYA 4ODXB 4F8QA 3SKNA 3SY0A 1FBIH 1RJZA 3WNMA 1KCUH 3ESVF 3NFNA 3GMRB 5F72S 5ENWB 2VAJA 2JJSC 3DO7B 5CGTA 3QCUL 3MRQA 4JRYA 1HI6A 1ZEAH 1QSFA 4J4PD 1LNUA 4UQ3A 3QHTC 5BZWB 3BZ4B 2D9CA 2HRLA 5DK3A 4JVUA 1I3GL 3ZKXC 3C5SA 4QO1A 3F6LA 4WI2A 1QACA 2RGSA 4GRWF 4GJTB 3PGDB 3C09B 4HHAA 4QRPB 4JN1H 3QEQB 4HJGB 1OHQA 1XEDA 3DTXB 1OCWL 4GMSH 1KJ2H 2EDQA 1CR9H 3BPCA 4I13B 3VXRB 2BOCA 2LAGB 4LP4A 4OLXL 2A2QT 1YMMD 1HNFA 5D2LF 3O4LE 2D31B 2VE6A 5JMRA 1C16A 2WUCH 3DO3A 3VFVA 2GSIB 4LSUH 1NH6A 3GIVB 1JRHH 4TSCH 1MJ7H 2X09A 3DXAD 2X2YA 4TOYH 5BRZE 3TO4C 4ZUUB 3DV4B 3L3JA 2YK1H 4K94C 3GM0A 4QGYA 5EC1B 3PWVB 4GSDH 3LQMA 4JPVH 2LU7A 1QFWL 1S7SA 3RUGE 4PRHE 4H1LB 5FYJE 3VXQB 4OAWA 3LQAC 1KN4L 1P84K 4LSPL 5C0DB 3CVHH 1BPVA 4CU8A 3QHFH 3L5WB 3RQ3A 4JREB 4ZTOL 3C5ZB 4JRXD 2W9DH 3OHXB 2GQHA 3K2MC 5HYJD 1FV1A 2C1OB 5HDOA 1GPOL 2ZCLH 1YC8A 5FGBA 1N59B 5DHYA 2V9QA 3DX9B 5EORL 2VSCA 5B39G 3BW9B 5T1LA 2FIKB 3S4SA 5E8DH 2ICWJ 2YA0A 1NFDA 2QBWA 3KXFB 4Y5XA 3P0VL 1F90H 2ZCHL 5CJ8A 4NO5B 3NN8A 1DL7L 4NGHL 3U9PH 3DX6A 4R2GD 1EUUA 3HC0A 1SEBA 5DUPL 3F5WB 1W72L 3ARED 4OKVA 1SJHB 4NCDA 5DJXA 4ORGA 3IFPA 4NP4L 1TIUA 1P4BL 4CRPA 2CUMA 2NLJA 4MXQD 3V7AG 3CDFA 1MJJB 4KPHH 1NL0L 1UA6H 2YN5A 1IT9H 4YX2L 3HRZA 4M02A 4N0FB 3ZDXE 1R5VB 4A6YH 1YEHH 1LO2H 1K4DB 1NMBL 1J11A 1CZ8H 2ZUYA 3IFNH 1FC2D 1QFOA 4N0YH 3B2UC 5DK0B 4G8GB 4D9LL 1DSFL 2DQUH 1S9YB 3WN5C 4WUUA 2G75A 1HEZB 4HS3B 4L5FH 5I30L 5DQDH 2B20A 3U46B 2BXYA 2JJVA 2YSSA 1T7VA 1UKQA 3I6GA 5DK2A 5HHVL 1G7QA 3BHBB 4FG6D 4PG9B 1JUFA 1A7QL 2CKBA 1D5ZA 1DR9A 3DXAA 3UTSD 3RAJH 5E94B 5IMOA 5C86A 4I3SL 5D71H 2V9TA 3V79C 3LB6C 2FWOA 1MCJA 2A74B 4PJEF 3FO9B 3BWAA 3BQUB 2MQ0A 2UWEB 4KDTC 2BHUA 5SX5H 1JNNH 4PRIE 1NEZA 1YEDB 5I66B 2BVQB 2PYED 2XKUA 3T0ED 4G9FB 4JRXA 2OR9L 3F58L 5D2LA 4JPWL 5IVXE 9CGTA 5F7WC 3JTSB 3FQXB 3CFBB 3RZCD 3LN4B 4G8EA 5K9KB 1DBAH 4LEOA 1BQLL 3VFPA 3OF6D 1MFBL 4R4BB 4WU7B 4F2MA 3WUWB 4NDMB 1W0VB 1H5BC 3FN0L 4XPGH 2NY3C 3FN3A 1NBZA 4M8QB 4N0UB 5MEPB 3CAFA 5EUKA 3T0VA 4NPYB 1B4JH 4UOW0 5IG7A 1ORQB 3TO2B 5JW3L 4Q6IC 4TN9A 4Z7WE 4YDIL 3SOBH 4S1QH 3QI9D 1LEIA 1RK0B 4HWZB 5HHOA 5KSBB 2IGFL 4FNLL 4NC2B 2A6IB 2DLGA 2QADB 2Q7NA 5F8QC 5GGUA 4HKBB 1EX0A 2BSSB 2Y07H 4L4VB 3QPXH 1NMAH 3GJFA 1DQQB 3V6OA 4PJCB 4MWFB 3RBSA 4XCFL 4Z95L 4LLVB 3LPWA 1OGAE 4NN7B 4O02L 5IOPA 1NGPL 2ZOLB 1T5XA 1S7RB 3ARFA 3WJJC 4BKLA 1GZQA 1N7ML 4E41E 1AO7A 1KENH 4G42B 2Z8SA 5E24E 3CFCH 5AAWA 4AL8L 3ZKND 3DHJA 4HIIB 1YDPB 3IXTA 3M1BB 4ODWA 3EYVA 3T8XB 1GCFA 1TMCB 5HI3D 5DRXB 3IRZA 1A7NH 3HMXL 2F5AH 3MLTB 4UAOC 5D1QD 3L3OB 3U4EA 5K59E 4AEIL 4KTEH 3E8UH 1P7QB 3P4MB 4JY6A 1ONQA 5FUOL 3IJSB 5DDHA 1FO0L 4GQ9L 5EU6B 1BVLB 2Q86A 4HS6A 3U48A 3VXSE 5D1ZA 3QCUH 3RI5K 4JM2C 1XZ0B 1A02N 3V4UH 3RWHA 4OM1L 2VDRL 4OFYA 5KOMC 1I3GH 5C0AB 2IPTL 2GI7A 3BI9X 1Q9KA 2HN7B 2PYEA 4FQQB 4M62L 3T0EA 2VQUA 4YAQB 2ADIA 3UTTA 2ZG3A 3PWPE 3P9LA 5I76B 4OM0L 1G9NL 3QA3B 1OCWH 3R8BB 4E0RA 2DQTH 4HK3J 4PLOB 3OF6A 1BM3L 3UTPD 1PDKA 3O45B 5EDXA 4XHQA 5SWSD 1A6VL 4OLXH 5TGBA 1X4XA 3VU2A 2HLFC 4D9RD 5I74B 2J8UF 4P2RE 1G7HA 3ARBB 1BX2B 3NAAL 4PBWD 4CMHB 4GW5B 4PG2C 3U79A 1JHKL 3WJLC 2XICA 5DA0B 1QBLL 2FZ3B 5AUMA 4Y19A 2Y6SC 5C0BB 3QI9A 2CJUH 1WT5C 4YFDB 5HGAA 4IEFB 2B4CL 3GBMH 1EGJL 1KN4H 3NGBC 3MV01 4LSPH 4MD0A 4GG6E 2J7LA 3K81A 2ICWB 4ZTOH 1U8PB 3U7WL 3T04D 4WY7L 1MHHB 2ADJB 4OCLC 3T3PE 3KPNB 2R0WL 1JTTA 4PJ9D 2Q8AL 3T77A 1GPOH 4BFEA 4NO0A 3T08A 4PJXE 5AZ2L 1BD2A 1F11B 2QKIA 3D5OF 2P8MA 3UPRA 2A9ML 5IEKB 2R0KL 2DI7A 2GK0A 3P0VH 4KROC 1QKZL 1RZKC 5SWZB 1VFBB 5ECJE 5E6IC 1MVFA 4CVXA 1DL7H 3U83A 2EE9A 3MGTA 3DRQA 1W72H 5D1QA 1P4IL 2IBZY 1PEWA 3KYMA 1JPFA 4Z76B 4WW1B 4NP4H 3LKOB 1P4BH 3DUHA 3GBNL 3I6LE 5DO2C 1F4XL 1NCNA 1R3KB 1AJ7L 4WO4C 1HCVA 4TTDC 1NL0H 1BAFH 4YX2H 2G60H 4EDXB 1FRGL 2AEQL 2F53D 4LCCA 1HDMB 1Y0LA 4JG1L 2IADB 3D85B 3LZFL 4Z77A 1KTRL 1WBYA 5GS0L 1RUQL 4P5TB 3HUJE 3FQUA 4W6YB 5KBNC 5EU5B 5B8CC 1DSFH 4RMRA 3PP4H 4P2CG 3PXJA 1LWRA 1UH4A 4X4YA 3K4ZA 3MLUL 2Q7YA 1S78C 3CVHB 4U6XB 1VSCA 5I30H 1MCBA 4C4KO 4ZFZA 3VGAB 3GHBL 3AXLA 4LPVA 2J6EL 1KCKA 4QRTB 4S1RL 3LMJL 3NCFB 4EI5C 2Z93A 1OT2A 2AGJH 1YEEH 1T2XA 1AC0A 4M03A 2R2HB 3ULVE 5K9QI 3RNQB 2HFTA 3TT1H 1A7QH 5EBLB 3QJFB 4I5BA 4KVCL 4UT6L 3IDMA 4GKNB 2BRRL 2P48B 3B5HA 5IBTH 1GGCL 5C9JB 1K4CA 5C0FA 4NJ9L 4RGMB 4I3SH 3QUZC 4CW1A 5GGRY 1UM6L 2NXYD 4QT5A 4M61A 5E5UB 1BECA 4UNUA 1HOCB 2X4QA 4U3CA 5FYJH 4I4WB 4MNGB 5J3HD 4PY7A 5AD0A 5JA9A 1PVHA 3EDFA 5K9JH 3F58H 3G5YA 2XTJD 2BOBA 4JPWH 1G7IA 2J8UA 5L0QC 1FFPB 5T3XL 3KPQB 4Z7UE 3DI3B 2WMPA 3UJIL 4X7CC 1PYWA 1YEIH 4A6YB 1BQLH 3G5ZA 5I15L 5E6ZA 3H9HB 3S6CA 1XIWD 4O4YL 5FM4A 4XPTL 2NY2D 3IB4A 4HUVA 4O2FB 1UZ8B 4ZUSB 2Y5TA 4LCYA 4PRNA 3NCYS 4PGJA 1QSEA 2DQFB 4Y16A 5JW3H 4YDIH 3EGSA 2P44B 2AEIT 4RGOH 4YXHL 1UH2A 4L29B 3EYQD 2IGFH 4FNLH 5MENB 2MTPA 4H26B 1QSVA 1SYSB 4R7DA 1M71A 1D5XB 4KK5C 5F89B 3VCLA 2JB6A 4NQEA 1AGBB 5TQ2H 2J88L 3FT3A 3T2QA 4KUCF 1I7UA 2BX5A 4PJ7F 5I75C 2F53A 4OZ4B 4XCFH 4Z95H 43CAA 4Q9CA 1JYVA 1NAML 5T33L 4O02H 4OZHB 1NGPH 1E0OB 2HKHH 3T65A 3O3AA 5I1EL 1N7MH 2AQ1A 4HC1L 1HIML 4RFEB 4NRXB 2N4IA 4PREB 4Y4HB 4AL8H 1K8IA 4MD5A 3OXRB 5EIVA 3BJLA 1NBYB 2VXTL 3IKKA 3QWOB 5EO1B 4AM0B 2NXZD 3HMXH 4P46C 4JAMB 3TBTA 2ILLA 4KUCD 3MYJA 4R7NA 3T3ME 2X4SB 1ZHBB 5BJTB 2XWJA 3PNWB 5LVEA 5F7LB 1HKLL 1AGCB 32C2A 1LO0H 2COQA 1RU9L 2JCCF 4JVPA 4WFED 3BFOA 5IB5B 4OZIE 1NSNH 4RAUB 4AEHL 4OZGB 3KPRE 4V1DD 1T6VN 3RL2A 4XHJD 2VWEE 3C6LC 4P49A 4I0CC 2AV7B 4PJ5D 1HYRC 2BFVL 2W0LA 5C07D 4CJ0A 2XWTA 3O11A 4LASL 1FCGA 4RMUA 4IOFC 1N26A 3CLFL 5D93B 2H45A 4JR9L 1NGZA 2X1OA 4I48A 4OM0H 3RWIA 5E5RB 1XAUA 5DMYA 1QA9B 5F6HI 2HVKB 3TESA 4GUPB 2OR8A 3BAEL 4UIKL 1XIWA 1A6VH 3JWDH 1YN7B 4FQPA 3QFJE 4NNXA 5DVKA 1IEHA 4PJIE 5JLZB 1KIPB 3ROLB 3VFTA 1PZ5A 4OLZL 4X7SL 2ZUQC 4M48L 2WWMC 3UROR 4MAYD 4AIZB 4L4TE 1MVUB 1QBLH 4C56D 5HYSA 3BX7C 2EO9A 1MQKH 3SO3C 3DV6B 4HEME 4QNPE 3RGVC 3ZKSD 3X17A 5J9PA 2MPAL 1NFIB 2QSTA 1NGYB 2B4CH 1EGJH 5M7QA 4WWKD 4Z7QE 2HG5B 3ZE1E 5F9JB 1YQ2A 4ONOA 1NC4B 4N5ED 1CFTA 5DJYA 2PETA 4F80A 4XAWL 4XCEA 4WJ5B 3SJVB 3REWA 1XH3A 3G9AB 5F6IB 2NY1B 3ME0A 5KSVB 2Q8AH 4PGDA 3TP4A 1JHTA 2VB5A 5AZ2H 4M7KH 4TVSa 1AR1C 4PRBA 3EDJA 1I1FB 1NJ9B 3BESR 3OX8B 3MYZA 2AJZB 2A9MH 5KVFL 1DQLL 2Q3ZA 2R0KH 4OV5B 1QKZH 2P5ED 1INEL 3CCHB 3ARZA 4ZDHB 4OLUL 2VRAA 2DMBA 4DK3A 4PJ7A 3DVFA 1Z5LB 5E4EC 5FO8B 1DUYB 5GGVY 4GW4B 1VDGA 1MCRA 2B5IC 1EAPB 1WICA 1SBBA 1F4XH 4K23L 3GSXA 4BUGA 4UDUA 1AXTL 5IQ9B 5IFHL 1AD0B 1FRGH 2BNRD 1N0XL 1MI5B 3TC9A 1AHWA 1EAJA 1U91A 1TPXB 1RUQH 4PRPB 1FP5A 4WRLA 4GH7B 4LARL 4K3HA 4YJZL 2VN4A 4HAFA 5C07A 5IGXL 4ZFGL 3TN0C 4RMQA 1HHIB 4Z0BH 1E4XI 4O2EB 4PJBE 1DANU 1O5DT 4LVHC 4D8PB 3LD8B 4GW1A 2Q6WB 1JWMB 2VZOA 2MMXA 4N90D 1BVZA 1D9KA 3F62A 4JFEB 1IGCH 1T66C 2GEEA 3GHBH 4L8BA 2J6EH 2IAMD 4MDIB 2JCCA 5CP3A 1ZOXA 1WIOA 1A3LL 1HQ4B 4GG8B 1NGXA 4Y5YA 2WIIA 2CO6B 3EO1B 3OJVC 4XWGL 3PL6B 2OSLB 5CINL 5GGSA 5INDA 4KVCH 2ITDA 1E27B 4UT6H 2EDWA 4JRWA 4XBGB 2BRRH 1GGCH 4C56A 1WF5A 2WBJD 1U8KA 3DHMA 1M1SA 1UM6H 3CU1A 3MCG1 2CDGA 4JFDB 3HI6L 3MZGB 3FZUC 5ERWB 5IR1A 3QXUA 1G6VK 4OCXL 4OD2B 1W72B 2JJWA 4ODSL 2LV4A 5I16B 3I84A 4Z7VB 4KAQL 4U1GB 4ZUVB 1U8LA 4U0QB 4U1KB 3GSVB 3E3QC 4ONGL 1PG7X 2F5BL 1HZHL 2Z31B 2B1HL 3MQIA 4HG4J 4DKAA 3KLAA 1IC7L 4J1UA 5JIKA 1RZJL 4LNRA 3UJIH 4TUOB 2AJUH 5CKGA 3QO1A 1XF2A 3LIZL 5D2NA 1OAZH 4O4YH 2DJSA 5GS1A 4XPTH 3MRRB 3O6FB 4I18A 1UM5L 5TDOA 3VWKB 3TPKA 1T1ZA 1CDBA 2P5EA 2VABA 2FB4L 3ARSA 1EXUB 1FYHB 2Y36L 4R0LA 3NIGF 3HE7B 3P9MB 2DLTA 4FZEH 2LAAA 5FHAL 2Y7QB 4YXHH 4HGKC 4LEXH 2G5BA 1S8DB 3HS0A 1C5CL 1CI5A 2A6DB 4Q7DA 3RDTC 4YHIA 5KANI 3TF7C 1T0PB 3FJTA 2OBGA 5MEQB 1YECH 2J88H 3CK0L 2XQYK 3RPIB 1G9ML 4WFHD 3X13B 4OB5L 4ZO8A 3H6JA 3O6KH 1NAMH 3B3IB 5T33H 2E6PA 2QQLL 3IDXL 3O4LB 4LNVA 1IM9B 1FH5L 4FQIH 1DBJL 2ZUTA 3Q3GB 4ALAL 3PIQB 2YPKB 5I1EH 4K7PL 4HC1H 1HIMH 3OJ2C 4OUUA 4YGVA 3IDIA 5HYQB 3RJDA 1YNKL 2XNAB 4JFPA 2AK4B 1QLFA 1BBJB 1IM3A 2NY4C 4D9QE 3N1MC 2IAMA 5EBWA 5K93A 2ESVA 4OD3L 5HHME 2GTZA 5DJDB 1T2JA 4GBXC 2OI9C 4RRPG 1BGXL 3LHPL 3SQBA 2F54D 4OF6A 3FQWB 4RWHA 1AP2B 4HIJB 1S7TB 4EIGB 1FPTL 3B9KC 1HKLH 1RU9H 3VRJB 2X1PA 3FB6B 2WBJA 5C09B 3H7BA 5C2UB 1A7OL 1NCTA 4AEHH 5DEZA 1ZHLB 1GIGL 5I1CH 4IMKA 5IMKA 2BFVH 4L8CB 2JJSA 5ANMB 4LASH 2UZXB 1HHHA 3CLFH 1XF5A 3EUUA 4JR9H 4U1HB 1UJ3B 3ILPA 5KZCD 4FQXB 1MCWW 3MTRA 5BV7C 1IAOB 3Q5YA 2CR6A 4JFFE 1JCKA 1L0XA 1QR4A 3BAEH 2VQ1B 1WBZA 2VDKH 4HWBL 4NUGL 2EDOA 5T1MA 5KSAA 2RJMA 1FAIL 5ADOH 4XGZB 3HI1A 5DMIL 4F33A 3QUXA 5DFWH 3DX7A 4OLZH 4X7SH 1ES0A 1BJ1H 3OBAA 4LHUB 4M48H 1M05A 4DVBB 5J11C 3H9SB 3MRNA 2MPAH 4PD4K 4KDWA 1CXLA 5ICZA 5E1HB 3FFCA 4TUJB 4MXWH 4FFWC 1RAMA 1J0JA 4ZSOB 3GK8L 1SJEB 3LB6D 4EOWL 4N0RA 1IVLA 3F7VB 1L9NA 5IHUL 4Z5RB 4HWNA 1XF4B 1X44A 5FO7A 2DLIA 1FN4A 1QLRB 3MRKA 4F8TA 1HKFA 3HC4L 1RZ8A 4LPYA 3GSUA 1INEH 2OM5A 3GMMA 4YHLH 1BWWA 3DSFL 5MEOB 2OXGA 4R96A 1P9MA 1FZOA 3G5XB 4OJFL 1D5MB 3BRDA 5EO9B 3TVMA 4PRIB 5DVNA 4MNQA 1JE6A 3PHOB 4PRAB 3T0BA 2NY3D 3RIAF 5IB4B 3TGXA 4K23H 1ZLVK 3ZYJA 5IVXB 5DEFA 1AXTH 5IBUB 2QSVA 3I02A 3V5HB 5EWIH 5L8LB 5IFHH 3U7YL 1MIEL 1MQ8A 3GUTB 4OLVL 3UTZB 1N0XH 5C08A 1CU4H 1IBGL 3T0WA 2R2BA 1IAII 4XX1E 2R0ZL 4LARH 3B5GA 1X4ZA 1AGDB 1YMME 3BH9B 3MV8B 2H32H 1HCFX 2VLRB 3SE8H 5IGXH 2Z4QB 4ZFGH 1VFAB 3KYAA 5DC9B 4XB8A 1XCTA 3GRWL 4X5XA 1SYVA 2E8ZA 2HRPL 5DURB 3V6ZB 3QAZC 2A77L 3BZFB 5JDSA 2FSEB 1BJ1J 5FAAA 3DROA 3FN9A 4XBEH 4RMSA 1I4FB 2FH8A 5F7UA 5JO5B 3CSBA 5TDNA 3O0RH 3CH1B 2FATH 3QIBA 4JM2F 1MH5B 1IKNC 3WHE0 3G6AB 5DS8A 4XWGH 4JFOA 3HG1E 5EN2A 4AYFA 3Q1SH 3V6BR 2OX5A 5HYJE 1UQSA 1BHGA 1KIUA 2VDOL 3HPLA 3O41B 5L2JB 4RNRB 1ERNA 4XP6L 3UTOA 5FKPB 1ZVYA 3AUVA 4XCYA 4WHYH 3NFPB 1GZPB 4IS6A 4OCXH 4DK6A 1IGYB 1P2CB 1W0YT 4LSTL 4D0CA 3MRIB 1Y6KR 4XVSH 3GJEB 4KAQH 5I1GH 4KGJA 2BK8A 4NQCE 3NTCL 4ELKB 4JM2D 4D2NA 4ONGH 4PJ8B 2F5BH 2DTSA 1HZHH 2ADGA 2B1HH 1O7VA 4ODXA 3QJHA 1RZFL 1IC7H 1RZJH 3MRPA 5IB1B 3GMRA 4GAFB 3KJ4B 5ENWA 1JNHA 3NCMA 4R3SA 1FFQA 3P0GB 3DO7A 2B7DT 2Y1VA 4PGEB 3VXSB 1UM5H 4MDJA 1QOKA 1A4KB 2IH3A 5KVEL 3UJJH 1JZ3A 2FB4H 5BZWA 3R06B 2AEWA 1IL1B 4RZCA 2Y36H 5EOQL 3DGCR 1AKJB 3EJJX 5E8EB 2HLFD 2WLYA 5BVJB 1H5BA 2BC4B 3SE3A 2EE3A 2FD6L 1AH1A 4QRPA 4N8CL 2EYTA 2X9WA 4QRRD 3OPZH 2RBLA 1HILB 3CK0H 3EO0B 4YFEA 1R0AL 2Y6SD 3VXRA 4NZUH 4OB5H 3V9FA 5DJ8B 1IGTA 4PR5A 5KANG 2QQLH 5DVLA 3RHWF 3LS5L 4XNQB 3JWNC 4K3JL 1DBJH 1RUML 3GIVA 4MQ7A 3S35H 3VH8G 2YPLD 3FFDB 1MFAH 2BSTA 2EDTA 1U6AL 4ALAH 4K7PH 4X6DF 2R1YB 4LDOB 3WUZA 1DQDH 3FT4A 5EC1A 3PWVA 4MB3A 4MB4A 1GC1L 5C1MB 2YC1B 4H1LA 2AV1A 3UTSE 2D03L 5AWNL 4ZPVA 1TJIL 3OJMB 5D96C 5LAXB 1U8NA 5HHNA 5C0DA 1PX3A 3BDYL 4Z7OF 2X70A 4MCZA 4GG6B 1X5XA 3HPJB 4OD3H 1PKQE 3L5WA 8FABB 4ZFFA 3C5ZA 4Y5VA 5HHQB 4HMEA 4UIMB 4KROD 3C8HA 5DYOA 1RJLB 3LHPH 1E6JL 5E6ID 3ELAT 4PP2B 1CGWA 4PJDE 5L7XL 3ZKMC 3KPPA 4JM4H 5FB8B 1OP5K 1VESA 2PO6C 3EYSL 3SHSA 3GSOB 2DQGL 3AU1B 4L8DB 3HR6A 2FIKA 2E9WA 4PJAB 1DBML 2X4PB 4FS0A 2F19L 4OQTL 1A7OH 1T4KA 2EE2A 3KXFA 3H8NA 1FNGA 4LGPB 5J0BA 4WO4D 4TTDD 2M26A 3W5MA 1GIGH 4X7TB 4PJEE 3FB8B 2IH1A 3ARDC 2CLRB 2E7LA 1FORL 2EEDA 4HW6A 3F5WA 4J7RA 3DNKA 4P4RA 4JM2A 4KKNA 3WXWL 4R97C 2X44D 1RQ5A 1ZLSL 3RA7L 5A2IH 2YD3A 5E7FA 1QHOA 1EVTC 4KQ3H 1RUKL 3LAFA 4QF1B 3RTQC 4HWBH 4NUGH 1K4DA 1NAMB 1YJDL 2XQBL 1YEKL 4JJ5B 7CGTA 1S78D 2FHCA 4MJID 2HTLC 5DD0L 3SPVB 1YN6B 3NA4A 1ZT4B 1TCMA 3HUJB 3LN5B 5DK0A 5MI0B 2GUOA 2GITB 5DMKA 4EI5D 3SCMC 1S9YA 3VXMD 3X14A 4EXPX 4YFLF 4ZFOA 5GGTA 1FIGL 1KLUB 3N85L 1HEZA 4ZAKB 4O00A 5I17B 3RU8L 1I9IL 3BEWB 3GMPB 4HS3A 4BQ6A 4B50A 2YUVA 3KPSE 3WJLA 3D25B 4C54A 5FV2A 3C2AL 3U46A 1A1OA 3OZ9L 1KNOA 3QUZD 3ZE0F 2A83B 3QRFM 3HR5A 3IFLL 4EOWH 5T1KB 1A7PL 3T1FB 5IHUH 1G7LB 4JZNB 1U3HB 4WI9A 4LFHG 5GRZA 4PJFF 1IMHC 3UDWA 4TTGA 5DRWB 4HS8L 35C8L 5E94A 1I1AB 3NPSC 4X0KB 3I2CH 3RFZC 3FO9A 4PFEA 2V2XB 5I8EB 1ZE3C 4HGMA 4U7SA 2VDNL 2JJUA 1YEDA 5I66A 4G9FA 1NAKH 3RKDC 1YA5A 2VLJE 4XPAL 3VFUA 4P48A 4Q58C 4U1JA 1S9VB 3MNVA 3QT2A 3OV6A 4Y2DC 3JTSA 4Z7UB 3MFGB 3K1KC 4X6DA 3LN4A 4KMTL 5K9KA 2EDYA 3U7YH 1MIEH 4R4BA 3PP3K 5CZKA 4MGXA 4RAHA 1B9ZA 4H0HB 3WUWA 4NDMA 1IBGH 1EVUA 4ZD3L 4NN6C 4JFHE 3UTPE 2R0ZH 3BRGC 4IMLA 4KK5D 4WO4A 4N0UA 4NM4L 5L8JB 5MEPA 2ZKHH 3EYOB 3OWEA 4NRZB 4PS4L 1ORQA 3TO2A 1CD1B 1T22B 2EDEA 5KG9B 3RY6A 4TNWF 4U6YB 2J2ZA 3N50A 3GRWH 5HDQL 1RK0A 5KSBA 5BW7C 2APBA 4X8JB 2A77H 3F7RA 1JV5A 3NCYP 3QQ9C 1I3VA 4KTDL 3AMKA 2GIYA 4HKBA 4RMWA 2BSSA 2XWBB 4XNUL 5BOZG 2IANB 1T03L 2EH8L 3O9WB 4PJCA 2JKXA 3VGDA 4ZOEA 1MWAL 3LKSA 4MJIA 5I9QC 2ZOLA 4JREC 5F70A 1QO3B 1FL5A 4LDLB 4YHNB 2VDOH 4GLRH 4EI5A 2Q20A 3VXMA 4F9LA 3TPUB 4XP6H 3QRGL 2VAAB 3HZYB 1BIIB 4HIIA 3CZFB 5ACZB 4O51B 3M1BA 3FQNB 2P8LB 5DRXA 3OKOB 4JG0L 2AAVA 2XPGB 3VA6A 5ESQA 3EOYG 3MLTA 3QSKB 3X3FH 3IDNB 3L3OA 3G04A 1FLTX 3C6LD 1EJ6A 2C7UA 4AG4L 4CU7A 1XGPA 4M6NH 4NJAL 2V2TA 2CRYA 3TNMB 5EU6A 4IOFD 4CN6A 4GRMB 2ATPA 2PYFB 1HH9B 5FA3B 3ARRA 4HPOH 2WWKO 1JMZA 1XZ0A 5KVEH 4OZIB 2IEPA 2GJ6E 2ICWI 2ARJB 3KPRB 2VH5L 2H32B 5DUML 4F37K 4CVZB 5C0AA 5L8KB 4JY5L 1R3HA 2VNCA 2V7NB 2PTTB 2KPNA 2R0LL 4XPBL 4WDIB 3QDMB 4ODBD 1I1YB 2FD6H 1I8IB 4IOIA 4N8CH 2WWMD 3QA3A 3C9NB 3VFRB 3VXUE 4PJFA 4NBYB 4WTZA 1FNEA 2XZAL 5DUBB 2DWDA 3RGVD 1XF1A 3MFFB 3O45A 3BGAA 1T21A 3CC5B 1ZANL 2KKQA 4IDLA 1BX2A 4BFIA 3TCXA 4K3JH 4PJIB 2A0LC 2IBZX 3B6SA 1G6RA 1RUMH 4GW5A 5TPWH 5D70H 1U6AH 3D2UD 3ROOB 3DX8B 4OCWL 4PV8A 4L4TB 1QQDA 5DRZA 4JPIA 4YIQB 3ZKQD 1GC1H 3QDGE 2VL5B 1EEYB 3F7YA 1NMCC 3LDBC 3ESUF 4ETQB 3S5LG 5AWNH 5D7IE 1X9QA 2FEEI 3V5KB 4BH8A 3L5HA 3ULVC