2MPAL

Bactericidal antibody against neisseria meningitidis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQTPLSLPVSLGDKASISCRSSQALVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVFFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MN12H2 IGG2A-KAPPA, light chain
publication title Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
pubmed doi rcsb
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1999-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaL01
4N90E 3AREA 3A6CH 4BK4A 2HT2C 3C60C 3VDBA 2XPGB 4MAYA 4M62L 1KIPB 2X4TA 4G43B 5CSBA 2DLFL 1KEGH 4HGWA 4QKXB 3FO9A 4ZUWB 2HVKA 1DDHB 4LSRH 3RBSA 4JQVC 4LCUB 3WFEH 3MYJB 4K3EL 1MRFL 6FABH 3CDYA 3HE6D 1TJHL 3MGTB 5GS0D 4FFWD 2ENYA 1CCZA 4L5FH 4LEXL 1AQDB 1YUHB 4WW1A 5D6DA 4FQLH 2F19L 5HGBA 2R0ZL 1W2KT 2OXHA 3QUZC 4ODHH 3G5YB 2CMRL 3O2WL 3RAJL 1ZLWK 1NMCC 4PBWD 3KG5A 5ITBL 3WV0A 1MI5B 1BWMA 1FFPB 5DQ9A 5B8CC 1YC8A 2DD8H 3V4UH 3RQ3A 4XB8A 4ENEC 4OZGB 1NFIB 1YY8B 1HYSC 3VXRA 3EAKA 4X80H 1CVRA 5D1ZC 5GQBA 1NBYB 4HUVA 1BBJB 5FB8A 3SQBA 1C5CL 4XNZC 3PHQA 3CSBA 2BOBB 2R69H 3VWKD 4QRRB 3FRUB 1VFAB 5MP6H 2I07A 3LVEA 2AQ1A 4Y19E 2NR6D 4ELKB 3O8XC 2P7TB 2Q7NA 4Z95L 2OQJA 3QDGD 2DS4A 1QBML 3RKPA 5L8KB 3VFWB 4MVBD 4HKBB 3OXSA 4PLNC 3ARUA 1MUJA 1FYTD 3DX6B 1G6RB 1NJ9B 3WYRA 4O9HL 1D6EA 1JGUL 4LLDA 4XNYH 5ILTH 1NMBH 2Q86A 1H3WM 5CGMA 4S1RL 3S8WA 1KJVB 4HJJL 4HLZH 5D1QC 5F9AC 3VD5A 2GK0B 1F2XK 3TIEA 1LO2H 1JWUB 2JIXA 3BI9X 5I1KH 1I1CA 5GSRA 2DQIL 5JO5A 3V52H 4BFIB 5IESH 2OMBA 3U83A 1U2HA 1MCIA 1I7ZB 4TSAH 1NAML 4QRSB 4MJID 5FGCB 5KOMC 2Y6SC 3SJVA 3OG6B 4FG6D 5KVEH 2B1AH 3VA6A 4JPVH 5IJVB 3MJ9L 3MLRL 2OYPA 4BK5A 4U6XB 4AM0B 5KSAC 3TNMB 2VQTA 5C0RL 5DJ6B 5F44A 4NWUH 3RVTC 1Z5LA 5FO8B 3T77B 4HKZA 1S3KL 1S9WA 4QO1A 1CFQA 4NKOA 5I66B 5HHVL 5DD0H 2YUZA 4NM4L 2PYEA 4IS6B 4ZXBB 2XWTB 1AGCA 3LQMA 4EDWL 1JPGB 1X3DA 5KTEH 3ROOB 2NY6B 3DHJA 3TIDA 3TBWA 2HKHH 1QLRA 1A1NA 3HNTL 3L3JA 3TVMC 3GSNB 5IVNA 1OM3H 3EJYC 4JE4B 5CJOL 4WHTB 1UVQA 1KB5H 4Y4KA 4EQ3A 3HN3A 4YQXH 4E0RB 4XPAL 1K5NA 4V2CB 3WEXA 1DZBA 2Z31A 2CIKB 4A6YH 2VLRD 1OAZL 1G9MC 4PJGF 1AJ7H 1P6FA 1G7IA 1GGBH 2IPKA 1AY1H 1Y18B 2YC1B 4JO2L 4LASL 4NO5B 2HKFL 3HR6A 3UTSE 4I18C 1OGAD 4LU5H 5T3XD 3UTQB 3ULUF 1TZIA 2XIDA 4P9MH 1YQ2A 1X5XA 3D6GA 1WUNT 5D7SL 1S7XB 1RJLA 5BW7C 3ES6B 4P2RD 4U0RC 1FO0A 4XAKD 4OLYL 4BSJA 3SOBL 4APQC 2RJMA 4DFIA 4NKIL 3TZVA 4HFWB 1NGWB 2BVQA 3GSVA 4QRQA 5MEPB 5IIEA 1NC4D 4PGDA 3DETC 4WUKL 3MA9H 4Z7VA 2X42A 2A9MH 4TTDC 5JIPA 2EIZA 1DE4B 5IVZB 1P4LB 2BK8A 4LLQB 1T66D 3B83A 3DTXA 3LS4L 3ZKMD 4PJAF 4HW6A 3FQRB 5FUZH 3JWOL 1FN4A 1OD9A 1S7RA 5J6HA 1W0VB 2P44B 5F7FA 4M8QB 4N5ED 5T1DL 1MFCH 2W1NA 3MRDA 3IGAB 2GSGB 4UU9A 3SDAD 3KWWA 1DVFA 3VGGA 1RK1A 2X7LA 1ZLSL 3KNBA 2F54A 4HS8H 3KJ6L 5FYJH 5EH1A 2EYRA 3GNML 2Y25A 4I3SH 1S7QA 5I1IH 4R97B 1XGRB 5DLML 2E9BA 1YEEL 1J1XH 4UB0L 3RGVB 3ROLB 2GJJA 5JOFB 5KANG 1MHPH 4DVRL 3F7PC 5F96H 4ZUTA 3G5VA 4GRWF 5C8JA 3TBYB 4PRHB 1VERA 1ZEAL 4Z0BH 1BFVH 3BEVB 3TBSA 1CWVA 1JCKA 1KIRA 1LP9B 4HG4J 5I17B 5ALCH 3F7YB 2ILLA 4Z7WF 1FZJB 3DXAA 2LU7A 1TTGA 3FMGL 1U8LB 2APBA 4JKPH 5C0CE 4KAQL 3MV7B 3D3VA 3WIHL 4NC1C 1HNFA 1MAKA 4U7SA 5EO0A 4YJZL 1MCJA 4JHAL 3X11B 3ULVF 2JK5A 1AXTL 1QSEA 3D0LB 3KJ4B 5F21B 3NCMA 5DJDB 2ID5A 4M7ZB 4YFDB 1ED3B 3DSFL 2JJUA 2RB8A 1WZKA 5SX5K 4X6EB 4LIQH 4LLMB 3GKWL 2VZ3A 1R3LA 3CIQA 3O3DB 1ZS8A 5ITFA 5IMKB 4L8SA 3MV11 3BSZL 5D2NA 2P49B 5K9QG 3SN6N 3OJ2C 5TDOB 4GAJH 5B4MC 1SVZA 3QUMH 3VXSA 3H7BB 1ZHLA 5CGYD 2CK0H 2R0WL 3BPCB 5E8NB 3SKNA 2FLBT 1JI1A 4QTHA 5C0JA 2J4WL 1GZPA 3NCFB 3SDCB 3DGGA 2FBOJ 4QRPE 5GGTH 1I8KB 3CFJB 2B7DT 3VXQA 4OF3A 3FQTB 5EIIA 2FJFA 4LL9A 5EU6E 4K71B 5ESAB 3O6FD 5C86A 4U05A 3O6LL 2DN7A 4PV8A 1Q72H 2LAGB 3T4AB 3UTPE 2NYYC 1G9MH 2EYSB 5INDB 3QQNA 3MOBL 5T5FH 1CDGA 5IB1B 2FBJH 3LQAC 4DN4H 3U0TB 4OQTA 3FQUA 1WZLA 4LPWA 3TV3L 5JW5A 1FL5B 5IV2A 3GI8L 2COQA 5GHWH 3AAZA 3BH9B 1YMMB 1V3KA 5JZ7D 2VABA 1WICA 4P4KD 5TE6L 4P57A 2WUBL 5HI5D 3T0WA 5J3HD 1T1YB 1BD2A 1BZ7A 3NCYS 3O2DL 1T89C 3CVIL 5GGRB 2MNUA 1RJZA 4XRCB 1DUZA 1QRNE 1XCQA 3GSUA 3MLTA 2HT4D 1CFNB 4KFZC 3MLVL 5DC0A 5EOTB 4NT6B 1MPAH 5DMKB 3EOAB 5L0QB 1B0RA 3QEHA 5FDWB 43C9B 4Q6IC 5HYSG 1BAFH 1WV7T 2ADJA 5E2WH 4P9HL 4Y4FB 4HGKC 5DFVD 3L3IA 4YXKH 4ZUSA 3MJ7B 1T20B 5DRWA 1YY9C 4J4PC 1JF6A 3O0RH 4K9EL 3S5LB 1QYGH 4NO3A 5D7LA 4Q2ZA 3HMWL 2VDRH 4QXUL 4N1HB 4KK6C 1KELL 1WZMA 3WSQH 4LBEA 2I27N 5FYJE 1KCRH 3FFCB 5CIPB 5E6IC 5DJAB 5C08B 4F37F 1MAMH 1A9EB 4YWGL 3UTTA 1WISA 4RMTA 3WD5H 4NYLB 3Q5TA 5DHVH 1FAIH 4XCEA 4IRJC 3BN9C 2QSTA 1PAMA 1KULA 5ACZB 4ONOA 5EO1A 2NY1D 1A7PH 5IHZB 4H20H 3QFJB 3V6FB 1C5DA 2CRMA 3BGFB 5HHPA 1Q9OA 2A6IA 1YJDC 4KJYA 1Z3GL 4YHKH 4X4YA 4KHXL 3Q5YA 1UB5A 2DI7A 3V5KA 1D5MA 4OGXH 4HPYH 4Z7VF 4NBXB 2Z93A 4JVUA 1GCFA 5DTFA 4K3JH 1IM9A 5D7JD 1TJGL 5B38B 5T3XL 5SWZA 2F74A 5E1AA 4ZFGL 4MD0A 3FOLA 5E2UL 4FQPA 3PG2A 3BZEB 1ZGLP 4M93C 1F4AA 1A6UL 4LIQE 5C0GA 3UJTL 4NGHL 3O45B 3SCMC 3GK8L 4D9LL 4DTGH 4KMTH 5J13B 1KCSL 3CFCH 3EKCA 1OPGL 1TCMA 4WU7A 5E2VL 3VD7A 1HYRC 3N1MC 4NOFA 5IW1A 5DVMA 3FB8B 1FRGL 4OD3H 2P45B 5AD0A 4M7LL 5I15L 1ZT4B 4AL8L 2E8ZA 3T0BA 4QGYA 2Q8AH 1FPTH 2HJFB 4XGZA 1DBKH 4PGEA 4M9PA 2X89A 2DM2A 3GJFH 3INUH 5FM5M 3ZL4H 4W70A 4ODSH 4Y1AE 5HHNA 5KSVA 5H35B 4QT5A 3QUXC 4WHYG 5KSBA 4K3GA 5D2LE 3RZCD 1KJ3L 1AKJD 3TO4B 2K9UA 1FL3B 3FONB 4OZIA 3N85H 3MV9E 4L1HA 5K9JH 2PR4L 1WK0A 3LDBC 4NPYA 4PRID 3JTTB 1A7OH 3QQ9C 1BJ1J 4F7PB 3EHBC 3X12A 3MXVH 1J5OL 3LN5B 1MELA 4Y19B 3G5ZB 5BRZD 9CGTA 2UWEF 4RIRA 2HFGL 1LVEA 4V1DB 1X9QA 2IH1A 4E41A 2J6EL 2XTJC 2ITCB 1I1YA 5JQ6L 1EEZB 3QZWA 2OMNA 1WCBB 4P5KA 5D1XD 5HD8C 3MXWH 4Y88A 4PJ5A 3NFNA 5A40E 3PL6A 5MENE 3HB3C 2DQEH 5AZ2H 2VN7A 2EYTA 3SE3C 1P7QB 4WFEE 4WY7H 2AQ2A 4Y5XC 1E27B 1MCFA 1NAMA 2QQQA 3AMKA 4XHQA 2P8MB 2WINB 2EH8L 3ARRA 2Y36H 3GO1H 4JY4A 1DQLL 4LSQH 4EOWL 2HN7A 2W91A 1LD9B 3C5SB 3HFMH 3QZWG 3MJ9A 3ARFA 1Z9LA 5IKCA 1FVDB 4WWKA 4YHIB 32C2A 3AUVA 1AXSA 3MRKB 4JRYA 5B21A 3RNQA 1MWAL 5L6YH 5TF1H 4KH2A 4QTIH 5ICYA 3DMMC 5A2IH 3G6DL 5C6TH 1R5VB 5D71H 4OD1H 3STZB 1LE9B 3UJIL 3LKNB 2PO6D 4G8IB 3PABB 5CBEB 3ARGA 4QOKE 3QPXL 2GK2A 1ZLVK 4S0SD 1TQCB 2WP3T 1F3DH 4KJPC 5GGSY 4IIQB 3P73B 5DJ8A 2YPLD 3B5TA 3HPLA 3QEUA 5JW4Q 3UYPA 3P2TA 2PXYA 3R4DA 4HMCA 5J89A 1AQKL 1IC7L 3P4NB 4Y4HD 1F4XH 3FO1B 3S4SG 4RFNB 3QCTL 4HUNB 4ZD3H 2VDLH 3ARWA 3Q6FA 4NC1E 2B4CC 4KXZH 3VFNB 1QFOA 3HI5H 2DQDH 4Y89A 5DJXA 2A73A 3KVQA 5EUKA 1AXIB 2VO5A 35C8H 4PRBB 4QHKJ 4F57H 2ZJSL 4ZS7H 3V8CA 2R2CA 3QQ3A 4U1KB 2YRPA 1GJIA 3HZYA 4I1NB 4KVNH 4LSUH 1NBZA 4ZOBA 3RWEA 4KI5C 1GGTA 4XX1G 1GOFA 5JMOC 4GAGH 1J05B 1ACYH 1B4RA 5IVXF 2VUOA 2YD3A 3UTSB 2KDGA 2C4XA 3IAGC 3TYGL 3CZJA 3KYOA 3IT8D 1S9KC 1PZ5B 1SJEB 1ZXQA 1JNHB 5D93C 3ZSSA 5C92A 4I48B 1WBYA 3AFLA 2WSKA 1UQSA 1RIVH 2O26U 4KRPC 5JIKA 5IG7A 1JZ4A 1N0LA 4FQXB 4P4RB 1TTUA 1DL7L 3CVHL 2L7UA 3KPLB 1LGVA 2AAVA 4M03A 4RZCA 2CD0A 2DBLH 4PJ7F 1VACA 2VZSA 3QEQD 4YO0A 1LO4L 4NKMB 1SJXA 1NAKL 1RULL 2C3VB 5GRVK 2G5BA 3V4VH 3VWJC 3VGAB 2MPAH 1BOGB 2P47B 2P48B 2VISB 5HGHA 1S9VB 1NCBL 4LRIC 2DKUA 1CG9B 3NIFF 2NY7L 3NFSL 2YWZA 1BECA 1QZ1A 1RMFL 2VKWA 3NFPB 4G8EA 3DECA 4UTAH 4TSCH 5DT1L 3VI3E 3FCTB 3FQNB 3NACH 1N59B 4U1IB 4JREC 2P5EE 3FZUC 1JGDB 1M1SA 5EU3A 2IAND 3N0PB 1RZKL 5DS8B 3JTSA 3KYKL 4WGVB 1LK3L 1VSCA 1HH6A 4U2YA 4BZ1L 1OAKH 1UB6A 1YN7B 1OY3B 3RTQD 2OZ4L 4XI5C 4CDHA 3QIUB 5IB2B 4HCRL 4Q0XL 2H8PB 3MRMA 3HE6A 1W0WB 3WIHA 5DZLA 5BZWB 1AO7B 4YBLC 1JNNL 3BYTA 5C0DB 1T21A 1Q94A 1GIGL 2BY0A 4WENB 2OR9L 3BKCH 3BZ4B 4JAMB 4S1SL 2UZIL 2VZUA 3PWLA 1CGXA 5E0QA 4P46D 1CFTA 4JFYA 2EEDA 5C0CB 1YEIH 1MRCH 3GRWL 3ARDC 5DZOA 4R26L 3T0DA 1EO7A 3DX9B 2DM4A 4GRLD 4KTDH 4OTXL 2V2XB 3IDNB 4HUWB 4QXTB 5I8CA 2XRAH 2AXFA 5HPMB 4KVCL 1D9KA 1MCEA 1RHHB 3OB0H 3QDJE 4XVJH 3SQOH 1U95A 4ODTL 3RPIA 1WF5A 3D39E 3PWPD 1T7YA 4X7TA 1UH3A 2CDFB 2B4CH 4WHDA 3SHSA 3HLAB 3VFSA 4ERSL 2VR9A 4KK8D 4X7EC 5F7MC 4QXGH 4PRNA 1GZQA 1KXQE 1WITA 3BIAX 2WP3O 4Z8FL 3RDTC 3C09C 1I3RB 2J1KA 1YNTA 3GMLA 5JORA 1KB5B 3UYRL 1AC6A 4QRPB 4X9GA 5IQ9B 2A83A 4LLAA 3QPQC 5DGQA 1A8JH 3N1FC 1F58L 1FGNL 2VL4A 5L8LB 2AJXL 4YHMH 2QADD 4ZAKC 1FYTA 1AHWB 2XN9D 2XQYG 2RFXB 4YHPB 4PJ9D 2AW2A 3ZT5A 4XTRD 5INCA 4R96B 1IT9L 1RURH 5LAXA 4HWBH 4U1JB 4Z78A 1U8PB 1IEAB 1MFDH 1TQBC 2EXWD 3NCEB 3O2DA 5DJYA 5ENWB 2AGJH 3FOMB 3QUYC 2RBLA 1QBLH 3EZ8A 5HVFB 4E42B 5DUMH 1XH3B 1V5JA 4FFZH 1MFBH 3MFFA 4P2QE 4JN1L 3GEWB 5DK0B 5IF0B 2Z0BA 3T2QA 1NMCB 3P0YL 5C2BL 4MJIA 4M4RA 1ZT1A 4LCIL 5BOZG 5EBMB 3BKYL 4ZFZA 1E0OB 3QJFA 2HT2D 4HH8A 1X7QA 4HWZB 1FNSL 4LSDA 1I1AC 1DN0A 1FORH 3TH2T 3ZYOA 3DUHA 1T5WB 4GFTB 4N0FA 1S9YA 4PRDA 2BCKA 3V79C 4JPKH 1OVZA 3GMMB 3BW9A 3HPJA 4PJAB 5C09E 5BXFA 1M7DB 3UO1L 1KPRA 4MS8C 1VFUA 2ZSVA 3GIZL 5DQJA 5JQHC 4X6DA 1EXUB 2C1PA 3PWVB 2RCSL 3LZFH 5I6XC 2NQCA 3MRIB 4JFEE 4DZ8B 2DJUA 4YNYA 4TNWK 3QUZD 1CDHA 1XF1A 3LKOA 4X6CE 3C5ZC 2D03L 4KK9D 4KV5E 4J3WA 5IFHL 5DO2C 4MDJB 4UV4H 3L7EB 5JOEA 5I1AA 2R2EA 1UJ3A 1EVUA 5DSCB 5IWLA 1ZAGA 1ZA3A 1CFBA 1MQ8A 5I9QB 5FYKD 3MLXL 1HHKA 1JGVH 1U8NB 3DRQB 1GH7A 3W0WA 1ORSA 5E4IA 3RWFA 4R0LB 1U9KA 4ZUUB 2Z4QA 1MJJB 5DA4A 2GEEA 2PTTB 3AB0B 1I8IA 1JL8A 2VC2L 2H32B 1IQDB 4JGUA 1YPZA 4DQOH 5EZOL 1VENA 3PQYA 1TZHB 3CFEB 2R1WB 1FG9C 4NQCD 3VCLB 5C6WH 1EAPB 4YH6A 5L88H 5ID0A 3QQ4B 1FFRA 1OAUH 1RZFL 1BPVA 3NZ8A 4Q9CA 3MV8E 5E5RB 1CF8H 2PTUA 2W0KA 3GMNA 3QB7C 4TVSa 1U3HD 2E8YA 4XMPL 2FIKA 4NZRH 3ECBB 4TQEH 4QYOA 1BFOB 2M8XA 4K2UL 1WT5A 4BA8A 2C7UB 3NVQA 3LEVH 1CFSA 3BUTA 3EYOB 3BD3A 1NGZA 1BVZA 3QUMB 3TVMB 1F90H 3JV5A 5T1LB 1I7RA 2EE9A 4RGMC 5KVFL 1BIIB 1KTDA 1S5HA 1L6XA 2SEBB 5FCUL 2QQKH 3UROR 4HUUB 1PSKL 2CPCA 1MCBA 1KPUA 1UKTA 4L4TE 4DGYL 1GYAA 1BGXL 1T4KA 3SDAA 4MNGA 1BQLH 4PFEA 4PJXF 3RNKB 4S10A 1GGYA 5EC2A 3TO2A 2A6DB 4UV7L 3WFCH 4YHYC 1Z6JT 4HUXB 4UT7L 5KVDL 2JLLA 2GITA 5C0ND 4G9FE 4P2OA 3MV9B 3MRQB 1KCVH 5CFHA 3DRTA 3MLWL 3RUGA 4GXVL 4KPHH 1ZT7A 4EI5A 2J6EA 4YK4C 1G7MB 1JNLH 2HRPH 3S7GA 4RISH 1UZ6F 4U0RB 3IFLH 5K9QI 4FZEL 1N6VA 4I13B 4R4FH 3O11A 1O7SA 1LEGA 1D6VL 2A9NH 1UACL 3OKLA 4NZTH 7FABH 4MQXC 1Q0YL 1N6QH 2WIIA 5L9DL 3D1MC 3P77B 1QBBA 3K1DA 1N0XL 3QJHB 3VFGH 2IPTH 1I9RL 5CJ5A 3AGVA 1WFTA 4G6KL 4Z5RB 1I3GH 4YXHL 1MJ8L 1A1OB 3TBTA 4J3SA 3HNSL 2BY2A 3PDOB 4XC3L 1G9NC 1U92A 1R3HB 4ISVA 3O9WB 3TWCH 5I73C 5ADOH 4XAWL 2MHAB 1MWAA 3G9AB 1F3RB 1VPOH 4GAFB 5AEAA 2BC4A 3PWUB 2YN5A 3CDGB 5CMAA 5JIIA 1CXLA 3MZGB 2A6KA 2FB4H 2Y7QB 3ZE0E 5BO1L 2IC2A 3G04A 5F71A 5GRVL 3KHQA 3OZ9L 1IZJA 1FLRH 2NLJA 3GB7A 2G5RA 1QR4A 4OM1L 1D5BB 2ZOLA 3SGDI 1L7TL 1XGYL 4JO4L 5DHVB 3U9UB 2AJSH 1P5VA 1OSZA 3O6FA 4EN3D 3D69A 4L9LA 2NXZB 4AK1A 3OX8B 5EA0H 4L8DB 1GGCH 4QOKB 3BRFA 2KZWA 3CMGA 3ULUC 4M00A 3MUHL 1OAQH 4LSVH 4U31A 1BZQK 3ELAT 4H1LH 3BX7C 5AWNL 3ZHLA 3RA7H 1BVLA 3MRLB 4N8VB 3JV4B 1T22A 2E7BA 2IBZY 2GT9A 4G6AC 4NRXA 4QCIA 2QHLA 4GG6A 2P8PB 5FHBH 4F9LC 5FA4A 4MA7H 2CXGA 3BJLA 1KSRA 1QQDA 1F4YH 4LRNH 1ZTXL 2Z35A 2HP4A 2OJZH 1RK0B 5LBSH 1N64L 4RMVA 2XZAL 1V8HA 3L3GB 3G6JE 3WFDH 4NDMA 3W9EB 3QXVA 4TUKL 3THML 4PV9B 5LWYL 4GMSH 4RFEA 5EU4B 4MYWB 3OJMB 5IB3B 2G2RA 2ICEB 2A1WL 4PLOB 3EYSH 3I3BA 3QWOA 1DBML 3MRFB 3TEUA 3FL7A 1B2WL 1CGSH 2GIYA 4UTBL 4MAYC 4WU5B 3B9KC 2XACC 3H42H 3QEGH 5I74C 1A4JB 2Z91B 1F11A 4D8PB 1KT2A 3NZHH 3AS3A 2W0FB 1IC4L 2VXVL 3DUSB 3TLRA 3PP3H 1DQTA 3Q2CA 1JPTH 1QBAA 3ALXA 1NLBL 3K8MA 3WUWB 3CVHA 4BKLB 1YEDB 2EIEA 1DP0A 2R1XB 4X4MA 1NUFA 3GJFB 1U91A 4HT1H 1KYOK 1DQQA 1KCLA 2FR4B 4LNRA 4X8JB 1BM3H 1MI5D 5ETUA 1VADA 2PYFA 4P3CL 3VGEA 4P5TB 4F7MB 1HXMA 1JV5A 3PV6A 5KS9E 3LB6D 5D6DC 1JF1B 4RNRA 4HBCH 2MFNA 3SGKA 3U7YH 1QFWL 2JCCE 4NNXB 4U1NB 4PJCA 4ACPA 4YDIH 1NC2A 2FECL 3WHE0 1R3IL 2J12B 2V2WA 4MXQC 3G6AB 4NKDB 5FYKL 3EYQD 4WW2A 4XWOC 4RBPH 1JGEB 2DYPA 4X8XA 1ZGLB 4K3DH 4D9QD 3BH8A 3DSNA 4I4WB 5GRYA 4HSQA 1OP5H 3CFBA 2V7HB 3K4DA 1CICA 1FFQA 3RWGA 5T3ZD 4JANB 5K9KB 2OZ4A 4YZFF 2IF7A 4JFZL 1FH5L 2P5EB 3WO4C 2GAZB 5E94B 1G9NH 3ARZA 4OF6A 4XCFH 4Y8AA 4HCRA 5EZLB 1QR1B 5F7KC 5I1HH 4QHLB 3KXFE 5C71A 2JB6B 5FKAA 1LO0H 1FVCA 1LDPH 5F9WC 5AG9A 1ZVYA 4JM2F 5I76B 2FL5A 2VITA 1VGEL 3ARQA 3PIQA 4JFXA 5IBUG 1YEKL 4WV1A 4AG4H 4KQ3H 4MD4B 3T2PA 1TVDA 4YE4L 5JLZB 2QEJA 5LGHH 4YX2H 3KPPA 5CP3A 3WS6A 1YYML 5GGVL 2Q1EA 3GRWA 1CIUA 4UOJA 5C0AE 3O6ML 4NN7B 1CD1B 3BP5B 5CEZH 1S7WB 3B3IA 2NY5H 4WVRA 4PRPD 4IMKA 3QO1A 3F7QA 4DCQB 1KIQB 2O61A 3S97C 1P4IH 1A2YA 1J87A 3FB5A 1UYWH 3RKDC 5DMYA 4YHLH 1SEQL 3RZCA 3QA3A 1AKJA 4JCMA 2J3SA 3P9LB 3TYFB 4PB0H 4ZXBD 5FAAA 1EMTH 2CIIB 1CBVL 3ZDZE 3IXAB 4HZAA 1A0QL 3MODL 2D7PA 1PKOA 3W2DH 2NY6D 3WS3B 3GHBL 2OX5A 2FIRT 4GKOA 5IEHA 2F5AL 4RAHA 4OLXL 2FATL 3MLUL 4UDUA 4XC1H 3R06B 4XXDA 3QNZB 4RMSA 5D7KD 3OKOB 5IK3A 3RVXC 3D39B 5I1CL 2AK1L 2MOVA 2BMKA 1ZVHA 5BRZA 3IFOA 2P43B 3IETB 5HJ3B 1E6JL 1RIUL 4HJGB 1T0PB 4NJ9H 2FSEB 1N3NA 2APXA 1F3JA 3FFDB 5D1XA 4OT1L 3UBXA 2D7QA 1J1OL 1CL7H 1MIML 3DVNA 4BZ2H 5IVXB 1HKLH 4ZOEA 1GC1L 4OJFH 1EEYA 3IDXH 2FJHB 3LHPH 1H3GA 1WBZB 3N1GC 1TJIL 2VERN 4OB5H 4YAQB 1FSKC 3MZTA 2Z31C 3CUPA 4YUEL 3K3QA 5DD6B 4JDZA 1KNOB 5KVGH 3BMVA 2PW1B 5E5MB 5TQ0L 1ZHBB 4KKAC 3TNNB 4JZJB 2BSED 3UBXG 2R9HD 2QQNH 3MGOA 5D6CA 4P2QB 3SE8L 5ALBH 1J18A 3OAUL 3J8F7 2AEPH 2NX5E 3TT3H 2E7LA 4HUKB 4DEPC 5IMOA 1Q9KA 2DI8A 1N5AB 5MEQB 4HXAH 3MACL 2PO6A 3R1GH 1AD9B 3BAEL 1NFDA 3VXTB 5CJXC 4WEMB 5FO9B 5J57B 5E8EB 1B90A 5C07D 1BQSA 1QKZH 4JY5H 4MXVE 4WGWB 3TF7C 3F5WB 4LQFL 4KHTH 4Y4HA 5HHOE 2F53B 2ZCHH 1QFUH 2EDXA 5T5NF 3U36B 4JFEB 2IQ9H 3B2VL 1GHFH 1S7VB 5BVPL 5I1JL 4WFGD 2I60H 2VE6A 4WI7A 1M05B 4OGAD 1OTSC 2Y72A 4X6CB 1JPFA 2X09A 4ZSOE 2OTUA 4XMLL 2GFBA 2MQCA 1G7JB 3U4EB 5FEBA 1F6LL 4P99A 1CD9B 2Q6WA 1T0MA 1RUPL 1HEZB 5HYJE 2BVEA 3E2HB 4JO1L 3QI9C 1YQVL 1P1ZA 3RGVD 1IGCH 5LXGH 5JDJA 3SKJL 4D0CB 4NNYB 1A7NL 2AXGA 3QYCA 4FQ2L 5FKPB 1OCWH 5JR1L 1EUUA 4PRHD 2E9WA 5FYJU 3BT2L 2V9TA 2VZ1A 4MA8L 2DICA 5T33H 5IR1A 1NH6A 1XEDA 1MCLA 2VLKD 4XBPB 2XZZA 4NHUB 1GAFH 2XTJD 3DMMB 5EZJA 4YDKH 2VRAA 5IEKB 4PJGE 4LVNB 1BQHA 1JWSB 2B20A 5HD8D 3H8NA 3UXFA 3U1SL 3MV7D 4HD9A 4P2CG 2AEIT 3HB3D 4X6BB 5AAMA 1FJ1A 2GJ6A 1QSFA 4ODXB 5DUPH 4EZMA 1AP2B 5DRZB 5F7HA 4GKNA 1TXKA 4PGZA 1DEEB 3MV8B 4Z7QE 1U3ZA 3WJJA 4UIKH 4FFVC 1IFHH 4TSBL 4AMKH 4D0BA 2F5BH 4OI8A 1XGTB 5EPMA 4KK5D 5F1SA 3PP4H 4GKSB 2GTZA 1NCWH 3QEQA 1JK8B 1Z2KA 2CDEA 1KXVC 1IBGL 1BQHG 5ANMA 3PGDB 4LSTH 3FB6B 3VE0A 3GMPA 1Q0XH 3SDCD 1CE1H 2A6JB 4X99A 5DHYA 3SBWC 5DVNA 4ZNCD 4EKXA 2YD1A 5D2NC 3OAYH 3SDYL 25C8L 1ETZA 3MOQA 2YD9A 4Q9BA 4IRSB 2FDBP 1A64A 4L4TB 4RAUA 3CMOH 1C5BH 2UVEA 3V7AG 4IRZL 3FO2A 4NM8L 5HHXH 3FT4B 3L6FA 4G5ZL 1S9XA 2EKSA 1OF2B 2IANA 4UAOC 4MCZA 2R23B 3ILQD 4HS6A 5TE4H 4MB4A 4XPFH 1IGMH 3DURB 1R3KB 4ODWB 3R8BB 4G80B 5T3ZL 1DLHA 3QHTC 4G9FB 3MRBB 1MCSA 2OR8A 3RTQA 1YMMD 2Z8RA 1JYXA 3ZE2E 3LQAL 4N9GB 4YFLF 1UH2A 4FABH 3HC3H 4HH9B 1RZ8A 5HDBE 4W6YB 5HVGB 2FEDD 3HS0A 4KDTA 4BH7B 3X14A 4EDXB 3MRNB 1U8OB 4Z9KB 1FO0H 3K2UL 3HNVL 4IJ3C 3GBNH 1X4YA 3WHE1 4PRAA 4P46A 4JFHD 5EC1B 1OARH 4PTTA 3VXRE 3WHXB 4Y4FD 1ZA6B 3IDIA 3MA7B 3QCVL 3TFKD 4U1SB 4GG8B 3QWQB 4ZTOH 1RU9L 1INEH 1NLDH 5HSFA 2WLZA 4F33A 1EZVY 1E28B 1KUMA 2HFFA 5TPWL 3ZE1E 2CR3A 4AENB 2GSIA 2XV6B 5FHAL 2YPVL 3CSPA 5FA3A 4NO2B 3WN5C 5J11C 1D5IH 3OKEA 4IHOA 1RJYA 2PW2B 4XBGB 3FFCD 1NSNL 4OCXL 3RL2B 2KH2B 5C08D 3MMEB 4WNQB 4QHNB 4HXBL 1LNUA 2VDPL 3B6SB 4XZUB 4F7EA 3B5HA 3GSNL 5D7IF 5DJ2A 3VXME 4NQUA 4ZFOL 3A0OA 4I5BB 4K7PY 4YHNB 2XN9A 4XP4H 4YR6A 3S96B 4PJ9A 4PTUB 3HAEA 3QFJD 4HJ0D 1RZ7H 4MJ5B 2R1YB 4OCNC 1WSST 2IBBA 1P84J 4PJHA 3BIBX 1I7UB 4O2EA 1OAYH 1NFDF 2DRUA 3BPLC 5AUMA 3V0VB 3SJVE 1YJDL 4JHWL 3IS1X 1XGQA 1I4FA 2Q8BL 3BKJH 3GSQA 3QH3A 3W9DB 5I1LB 2AP2A 3MRRB 5D5MA 4M7JL 3C60A 1AGEB 1H8OA 2AJYL 5E8OA 4N90D 2X4QB 3MJ8B 1FNLA 1L9MA 3WL9B 4DKFH 4JQVA 2PYEE 4JG1H 4ZQKB 1JZ5A 3LV3B 4XP6L 2YPKB 1MLBA 4CVXA 3V4PH 3TA3B 3MLYH 5IP4A 3QRGL 2DQJH 1PBYA 2AJZB 1L0YA 4JJHA 4OBSA 1FL6B 2QSCH 3C09B 1ORQA 4PLKD 3PHOB 4F3FA 1MHCB 1VEMA 1WEJL 3S37H 4BQBA 1JWMA 3QUZA 4HIXL 5H8DA 2VZTA 2NW2A 5I1DA 5I16A 2BNQB 4ZAKB 4URTB 3S36H 4LSSL 1MJUL 3ARDD 4OAWB 3CX5J 2FJGB 3TO4D 3ARXA 5HGAB 4X7SL 5KVMC 1OSPL 4CVZA 2BY1A 5D1ZA 2RR3A 5E70A 1C08A 2X4RA 1M7IA 4ZTPL 5CZVH 5F97E 2JCCB 3RWDA 1JP5A 3MRJB 2W65A 2IFFL 1S8DB 3O8XA 2I26N 3LKPB 4OQTH 3CZFB 2ATKA 4V1DD 2A77L 2YA2A 1NGPH 2VQ1B 4JM4H 2O5XL 5I2IB 4LCYA 4CVUA 4HIJA 1UADC 1H5BB 1T6VN 4OSUH 1XF5B 4LVHB 4ODUB 2MTPA 1YECH 3IJSA 3WNKA 1LDSA 4YGVB 4O2CB 1NCCH 3GMOB 3MGAA 1P7QD 2H6PA 4MAUH 4G7YL 4KKBD 4OLWL 5SWSD 5D1QA 1U3HA 4Z7VE 1RIHH 4BQ6A 3KXFB 3OR7A 2VDML 4Z6AT 1VFMA 3LN4A 1NDMB 4NNPH 3TBVB 3JV6B 5SV3A 3GGWA 4UBDC 1SBSL 3VA2C 2FLRT 2WBJC 3L5XL 2EDDA 3B2UC 5HI4D 3DVFA 4M43L 1WWWX 3KYNB 2KL6A 2XWBA 4MXWL 4TTGA 5IHUL 1FV1B 4JB9L 1CLYH 4L3EA 4AEIH 2BOCB 5KSAA 3ARFC 1YNKH 4XBEL 4WWKC 3IJHB 2LU4A 2F54E 4QY8B 3MO1B 4ETQB 1UA6L 2XICA 5EO9A 1JHKL 3BXNA 4ZUVB 4PJEF 2Z92A 3P9MA 4RAVA 1Q1JH 3M17A 5IOPA 1HIMH 4ZDHA 1FVEB 4GQPH 1VA9A 1QFHA 5FF6A 2XOTA 3CU1A 4I77L 4LARL 2V2TA 4M3JA 4Z0XA 2WBKA 3UAJC 5HVWA 1A5FL 3BPNC 5F9DC 1PVHA 4WWID 2ZNWA 3NPZB 2B2XL 4C54A 5FUOH 5DO2D 3T0EC 2XZCL 2PXYC 3LEYH 3MRGB 1XCTA 3N9GL 3NIGE 4HX1A 3OB8A 5DWUH 3DXAE 1P7KB 1BVKA 3IJYB 3H9SB 4JZNB 4M62H 4HC1L 5F9JA 2DLFH 1MCHA 3V8OA 2W60A 1QSEE 2BSTB 4OZHA 5CHNA 1ES0A 3QBTB 2KBGA 2VIRA 2AV1B 4LCWB 4K3EH 1MRFH 5CSZA 2D3VA 1HOCB 1IGIL 3KPSB 4J1UA 1N8ZA 3UTSD 1TJHH 4LEOB 3OKYA 5D2NE 4RWYL 4WHYH 1S7SA 3K74B 3LS5L 4LEXH 3VXSE 2F19H 3PWNA 2R0ZH 3WXWL 5CJQH 2P24A 2WIMA 2BDNL 3BQUB 4JVPA 3U46B 2CMRH 3O2WH 3RAJH 1F3DJ 4FQXD 3REVB 1T2XA 3TPUB 5ITBH 5HYQA 4QHMB 4XNUL 1JZ3A 4LLUA 3U30B 2EDQA 3F65A 3SDDC 3ZDXE 3U6RB 1U8IB 1L4IA 5IW3A 5KN5A 2G60L 4AEHL 2MQ0A 3HZMA 4DGIH 2OLDA 2O5YL 4M5ZL 4YPGA 4EN3A 1T1XA 2H3NA 1C5CH 3QNXA 2B5IC 1KJMB 5MHSE 1TITA 5FOBA 3C6LB 1ITBB 3SKMB 2NZIA 5KAQF 1OP3H 2X2YA 1WCQA 3AC0A 1IAOB 5JOPD 3OKMA 3U9PL 4Z95H 1ADQH 3JWOC 4IDJL 4JKLA 5CEXA 3DUUA 1QBMH 2H41A 1BD2E 1SM3L 4RA3A 4M7KL 1NEUA 2HMID 3TPKA 3QIWC 3S34L 4ZSOB 2D0FA 3CAFA 4O9HH 1JGUH 3U7WL 4M1CC 1TCRA 4JKKA 4YXLH 1KIPA 1FAKT 4G43A 4S1RH 4HJJH 2AKRB 1HHHA 3VD3A 4ZUWA 3ETBF 3VDCA 5MERA 1QHOA 5I71C 3OKNA 1ZLUK 4OFYD 4U6VL 4LCUA 3QIUD 1ZOXA 3MYJA 2DQIH 3D5OF 3H3PL 3DO7B 1KB9J 1NAMH 4DW2H 1MY5A 2EC9T 1PLGL 2NZ9D 4N68A 1RVFL 4PYGA 1AO7D 2UZXB 5D7LE 1YEGL 5D9SB 2VLJB 3MJ9H 2EDYA 3MLRH 2XY1A 2ZUQB 5C0RH 4JLRA 4Q9QL 5D96B 3HE6C 5F8RC 4JG0L 3EYVA 2C3GA 1MI5A 2ZCKH 2AJUL 4GW5A 5GS0C 3X3GL 3UTTE 1S3KH 5HHVH 1H3PL 4CU7A 4Q7DA 4NM4H 2MQ3A 4C83B 4LCCB 4EDWH 1NBYA 1BBJA 4YDLB 2VH5H 2V9RA 3E3QC 4OQ1A 5EOCH 5FK9B 4U3HA 3RWJA 2EDOA 5GRWA 5E08L 3T65B 4X4XB 3VFMA 1VFAA 4H8WC 5DDHB 3B9DA 5ELIA 4ELKA 3BN3B 3FKUS 3HNTH 2RGSA 5J7CC 5CJOH 3JBG7 3T3PE 5IB4B 4QRPD 4LFHD 3VWKC 2NR6C 5DJZB 4XPAH 1LEIB 5KBNC 4KKLD 4R4ND 4HDIB 1NJ9A 2L7JA 4BM7A 3AREB 1OAZH 5A3ID 5CEYA 3X17A 2FH6A 1W72B 2X4TB 4JO2H 4LASH 2HKFH 4MVBC 4RRPA 2Y1VA 2UY6A 2GK0A 3FO9B 2YMXL 4DWHA 4R7DA 1FNFA 1EDQA 5D7SH 2Y23A 1NMAL 3QAZB 3K80A 4A2MA 4PPTA 4QRSA 1TVHB 2ENSA 4OLYH 3SOBH 4P2YA 5CILL 5C9KA 2D2OA 43CAA 4NKIH 3EOYG 3NMEA 3OGCA 5IJVA 1FG2B 4YFLI 1RFDL 3RU8L 2D7TL 4RRPG 4PR5A 3RVUD 5ADPL 4JDVA 5DJ6A 4PRPA 5KSBE 3G5XA 3NABL 4MA3B 5FO8A 4IOSD 4WUKH 2R4RL 4FG6C 2ZOKB 4OZIE 1VCAA 1K8DA 4XNQA 3RJDA 4UINH 2XKNA 3EO9L 4MB5A 5F6IC 4ZXBA 4X98A 1J0HA 4J4PA 4HUVB 3LS4H 4PP2A 1NL0L 5FB8B 2GCYA 3ROOA 3JWOH 3W82A 3PHQB 4ZPVB 4K9EC 5DGRA 1N7ML 2YD2A 3VI4E 2ZG1A 5M7QA 2I07B 1BFTA 2LTQC 2HH0L 5T1DH 2E3VA 1G7PA 3GSNA 5EUOF 2AJ3A 4TRPH 4E41E 2D7OA 2UUDH 4KWUA 2WQ8A 3VFOA 4ZFOA 1ZLSH 5E6IA 4PG2C 5JXED 2W0PA 2VDOL 5F1IB 3SEPA 5F1NB 2ZPKL 4PJ5E 3GNMH 1U93A 1VEPA 4PS4L 3OXSB 2D0HA 4UB0H 1YEEH 5DLMH 1QRKA 5HXMA 1MUJB 5F9WB 4IRJA 1S7UA 5CKAA 2R2HB 2CIKA 4NFCA 5B3NA 3CC5B 3QFDA 3W39B 4DVRH 3VXMB 3V5DB 1D6EB 2ERJB 3HC4H 5IWLC 5GSVA 3VGHA 2Q86B 1ZEAH 4XWOD 1U58B 4HK0A 4FMFA 5HTSA 3TIEB 1V3LA 4AQOA 3SE4A 1BLNA 4FQIL 3C8HA 1S7XA 3KLDA 4Y0GA 3ULVD 4EUPA 3ES6A 4JRYE 2IFGA 5GS1C 1T1WA 3FMGH 4YPJA 3R8QA 1KTLA 4KAQH 3WIHH 3CCHA 3SJVB 2I9TB 1EO8L 2XI9A 4HKXA 4HLJA 4JHAH 2LVCA 4YC2B 15C8L 4HFWA 4N0YL 1AXTH 3PJSA 5H2BB 3TN0B 2D0GA 3DSFH 5I75B 1YNLL 5I8EA 5MEPA 3OQ3B 4PJBF 3IYLW 3U0WH 4PD4K 3GKWH 1B88A 4HKZB 1S9WB 1CFQB 3V4UL 5IVZA 4NKOB 4H0GA 1AH1A 3BSZH 4EUPG 4Y2DB 1RSFA 5C07A 1WZ1L 5T1LD 2OTWB 3VD4A 1ULVA 4OLVL 4OCMC 2PCPA 3FQRA 4XX1E 2J4WH 5E8PB 1IGJA 3TIDB 1WT5C 3TBWB 4F37K 2R69L 1A7BA 3IB4A 1WIUA 1A1NB 4X9FA 4YEFA 4M8QA 3F58L 1A47A 4Q74A 3VG9B 1T66C 3KAAA 4BFBD 1XGPB 3O6LH 2MCPL 3RKDD 1SY6L 4CMHC 5DRXA 1K9TA 3K4ZA 2LE9A 4GAYB 4Y4KB 3MOBH 4FFYH 1HSBB 5I18L 4Q6YA 4N5EC 1K5NB 1XGRA 4JFQA 3CX5K 1UM4L 1FSKB 3ROLA 3SDAC 3TV3H 3GI8H 3V2AR 2DIJA 1CFVL 4OZFA 5ILTL 1F97A 1G7IB 4PRHA 3IFNL 5TE6H 1EIBA 5J4MA 3BEVA 4DFHA 2WUBH 2ZP0T 3LSOB 4Z7NF 1LP9A 5I17A 5IGXL 2VLKA 4FN0A 1N26A 3CFKB 4OZGF 1TZIB 3O2DH 1T04B 2C4FT 3CVIH 5D70L 4B0MM 2BHUA 3O81A 2GTWB 1RJLB 2H26A 2H9GA 1FO0B 3MLVH 3HUJA 3MV7A 3ZKXB 2Y5TA 1CLZL 4JPVL 3SE3A 1BREA 3TZVB 4OZFG 3D0LA 2DDQL 4XVUD 1ZLWH 5DJDA 4MJ4A 4P9HH 2MMXA 4WFED 2CLRB 1NCNA 5JDSB 3O9WD 5IIEB 3DWTA 4LLMA 4U1LB 4F8TA 2CLZA 1HWGB 3UC0L 2EIZB 5IMKA 2BX5A 4PGJA 3P4OA 3PXHA 4UUJA 3ARBD 1R3JA 3HMWH 5F3HA 4QXUH 3OL2A 3H7BA 3DTXB 1KELH 2W38A 3BPCA 4N1CA 5BV7B 1PKQA 1U3JA 3VDAA 3SDCA 1PG7W 2ED8A 1I8KA 1FN4B 3CFJA 1KACB 3P11L 1S7RB 4NN5C 4DUWA 1OQXA 5IM7B 4YWGH 2AXJA 1FZOB 5IBTL 4DK6A 3ILPA 5J12B 4X6FA 1DJSA 4UU9B 5ESAA 1DVFB 5CGYC 1FFNA 2KQNA 5F7EL 1RK1B 2NXZD 2X7LB 4PJIB 5TE7L 3KNBB 3T4AA 2F54B 4QOKD 1KB5L 2EYSA 4F15B 5INDA 2EYRB 1S7QB 1C1EL 3U0TA 1SHMA 3BRGC 3O6FC 1FL5A 4ELMA 1KCKA 1Z3GH 4QWWD 4KHXH 4GT7A 1ZVSB 4ZS6D 4ZUTB 1YMMA 3G5VB 4JR9L 1AJ7L 5C8JB 4LKXA 1TLKA 3GUTA 2BVPA 4HC1A 3TBSB 1KC5H 1KIRB 1TJGH 1RI8A 3I6GA 2NW3A 1T1YA 1DSFH 5T3XH 3ZT7A 5K93A 1GSMA 5GGRA 4ZFGH 5I19L 5E2UH 4XRCA 1JGLL 3MOAL 1R5IA 4U6YB 5JZ7C 3DXAB 5HPOA 4PBVC 1A6UH 4P4KC 3NBNA 5GZND 4JRWA 4LHJB 3UJTH 2YD8A 1JMXA 3GK8H 5EOTA 5IROA 4D9LH 3UZQA 4NT6A 5HI5C 2DIBA 3EOAA 4LDEB 1KCSH 5J3HC 2FGWL 2JK5B 1OPGH 1A3RL 1QSEB 2P5WA 3KPRA 5E2VH 5LGJB 4Y4FA 2HT4C 2NY2B 4DJMA 2H2PD 3ZO0A 1QOKA 1FRGH 3VRLE 4KROB 2AK4A 4M7LH 5ITFB 1NUNB 4D3CL 4L8SB 2YHGA 4AL8H 3S5LA 3BUYA 3EGSA 2ZUSA 1P9MA 1A3QA 3FO0L 3VXSB 3CK0L 5DFVC 2C26A 1ZHLB 3SKNB 1QTYT 1XGUA 4GS7C 5C0JB 4QTHB 1XF2A 1GZPB 4BUGA 2EXYD 3DGGB 1X5JA 4P5TD 2BXYA 2Q3AA 3A6BL 3FFCA 4R2GB 3VXQB 1KJ3H 5DJAA 4I0PB 4NYLA 2CUMA 1FYTE 2O5ZL 2PR4H 2WK2A 4ZO8A 4PV8B 4XVSL 1MVUB 5CD5D 5ACZA 1INQB 1KGCE 2RHEA 3VWJA 1B0GB 3QFJA 4MHHI 5I1IL 5FGBC 1J5OH 4LPXA 3FQUB 2XXMB 1HHJA 2HFGH 1Q9WB 1JNJA 4MZ2A 1Z9SA 1X44A 5HYSB 2J6EH 2VABB 3ORJA 5JQ6H 3OPZL 1WFOA 4P57B 3W5MA 4TPRH 3GSXA 3VJ6A 1I1FB 4WW2C 4JFDE 2EIBA 4RFOL 5J1SC 4ZPTB 1CGVA 5FYLL 2EE2A 1RJZB 1NBVL 2HWZL 4EQ2A 3BZEA 3GSUB 3ULVL 1KJ2H 4P59L 3MV01 5D7JC 2GKIA 4M6NL 2EH8H 2APWA 3IU3B 1JUFA 1U8QA 1DBAL 1DQLH 1N2RB 4DN3L 4EOWH 2NY4C 2YK1L 2VDKL 3L3IB 4KMQA 4X6DE 5J11B 4G6FD 3FB8A 1EHAA 4DVBA 1QFWI 3WLBB 3LH2L 1MWAH 2K3TA 2FECI 3MRPA 2C1OA 4NZUL 1KB9K 2KZ1B 3GDBA 5D7LB 3M8OL 4Q2ZB 3UJIH 4WV1C 1MCQA 5I1EL 1UEMA 4O51B 3QPXH 5H35A 3ARDA 3WS6C 3UJJL 2UV3A 1L0QA 3JWNC 1K85A 1LP9F 3TO4A 1FL3A 3UTTB 3W0WE 1KXTB 4NUGL 1EHNA 2DQCL 1AQKH 1IC7H 4IMKC 1KLFA 1RZGA 1CI5A 3NGBB 2P42B 3IDMA 4QEGA 3H9YA 4F58L 3G9VA 1A7QL 3WJLA 3QCTH 4J3OC 1YPZE 3D39D 1EV2E 2FBJL 4DN4L 5T3XE 2FWOB 3PQYE 3SGEI 3G5ZA 2IEPA 1WAAA 5HHPB 4PGBA 2MWCA 3RDTA 1KEML 5FV1L 4X4YB 2YD4A 1H3UA 4V1DA 3RJQB 3V5KB 1D5MB 1YDPA 3VRIB 4NCC1 2ZJSH 2ITCA 3CH8A 1EEZA 4DAGL 2Z93B 2GY5A 3RY6C 1FDLL 4GBXD 3U48A 4OFPA 1IM9B 1DBJL 4ZO9A 3GJEB 5HVHC 2FO4B 4M6AA 4NCC2 2F74B 5BZDA 2F8VA 3B5GA 2YEZB 1P7QA 3HG1B 4CNIB 3MCLL 5C0GB 5L2KB 3OKDA 5SWSA 5D1XC 1IM3A 5A2LH 3TYGH 3VFVA 1BAFL 1K2DA 4NO0A 3NH7L 4WU7B 1LD9A 3C5SA 5SX5H 3ZDYF 3DYPA 5GZOD 2VAJA 1DQML 4U1HA 2VL5A 2G9HA 1ONQA 1T5XB 1E4WL 2HTKC 2HLAB 2YRZA 4P2QD 4F80A 5AD0B 1DL7H 3I02A 3CVHH 4PJ8B 1BF8A 3STZA 2NY0B 1LE9A 4MNGE 4XGZB 1BZ9A 3LKNA 3D25A 4PGEB 3PABA 5CBEA 2NXYB 4QT5B 4CJ0A 5KSBB 5TJWK 4HIHB 1MAML 1R5WB 4J23A 1LO4H 2E7LC 4OZIB 1NAKH 1RULH 3RUGE 5F70A 2PO6C 5FIEA 1NCBH 5B39G 4NPYB 3FO1A 2F53D 4EI6A 2JE8A 2NY7H 3NFSH 2YBRB 1RMFH 3X12B 1SQ2N 1AGFA 3NCCB 1PGRB 3Q0HA 2CSPA 5MI0B 4NQDA 2BFVL 1WIPA 4RIRB 5SV4A 2IH1B 4Y4HC 3WNLA 2IBGA 4BSVB 3NAAL 1PEZA 3F12B 1BQUA 2I24N 4MLSA 3QZWB 1FP5A 1RZKH 3KYKH 4LPUA 1LK3H 4BZ1H 4MD5B 4PJ5B 5E9DA 3PL6B 3V6ZA 2C5DC 2OZ4H 3NPSB 4IMLA 5FM8A 3S37X 2EYTB 1CE6A 3IDGA 4AJ0A 4HCRH 4Q0XH 4HS3B 1OP9A 4JY4B 1JNNH 4BZYA 1GIGH 1JPST 4NIKB 4I48A 3ULSB 2OR9H 5J1AA 5IKCB 4XVTL 1T3FB 4S1SH 5J1TC 2UZIH 4FOMA 5C0BA 32C2B 4JRXA 4FQXA 4P4RA 5CP3H 1TETL 3GRWH 3S4SB 1VESA 4R26H 3MV8D 3KPLA 1C7SA 3LN9A 2LQRA 2HFTA 5JW4N 4NCDA 1TPXB 1NBQA 3ARGB 4ODSL 4KVCH 1J9CT 3BPNB 4ODTH 5DEZA 4NKMA 3HPLB 5DJ8B 3NIDE 3LIZL 3L5HA 2C3VA 4HV8B 3WJJC 2WBJD 1QSVA 4ERSH 2CGRL 2L4OA 4GG6E 1CG9A 4Z8FH 4TOYL 1SY6A 1G7LB 2X9YA 3UYRH 4LQ1A 1FLTX 3RZWA 1YYLL 4FMKA 2LAAA 4IRSD 1F58H 1FGNH 3P4MA 4L4TD 5DJXB 4YBQC 2A73B 1IRAY 1N59A 4U1IA 2ZUWA 2WM0A 3HI6L 2YUVA 5IB5A 4UQ2A 3CLFL 3QQ3B 3VW3L 1IT9H 5DS8A 3HZYB 2ADGA 2V7NB 1YN7A 1BX2A 1NBZB 4G9FD 3BVNA 4OFYA 3WIIL 1QFWM 3QIUA 4WI3A 4M6OL 4H26A 4OCYL 1MCOH 5IB2A 4WEBL 1Y0LB 4JN1H 4KI1A 5C2BH 3RI5F 3C87A 5LCVL 2NY3B 4LCIH 3BKYH 5BZWA 4W6WB 1AO7A 3PNWB 3RTQC 3VD9A 4UT6L 5C0DA 5JXAL 4YDJA 4X4ME 1FNHA 4L4VD 1FNSH 3O6KL 1IAKA 1UQSB 5FUCE 1HHGB 2J8HA 4HEPG 2PN5A 1IC5L 2B5IB 4K94L 3RWIB 4L8CA 3KDMA 3WDIA 1U8KB 4PJCE 3UO1H 2V2XA 3IDNA 4MA1B 4HUWA 4WO4B 5CJBA 3GIZH 5HPMA 4P46C 3I50L 3MBED 1A6WL 1SJVA 2RCSH 1C8PA 1QNZL 4YO0B 1MFNA 1A6TA 2CDFA 2D03H 2HG5B 4GRLC 3HLAA 5IFHH 1A02N 5HGHB 1HQRA 4M1GL 5EB9A 2P8LB 1HI6B 1KB5A 5CZXD 5IQ9A 4G8EB 3H7LA 4LLWA 3IF1B 4NP4L 3MLXH 4JFPB 3DGCR 5IVOA 2D9CA 1PYWA 4KK8C 4O4YL 5JNYA 1Z9OA 2DF3A 3D85B 3P0VL 2WQRA 4YHPA 1KBGL 5EU3B 2Q76A 4LGPB 2VC2H 3JTSB 4G9DB 3MRCB 1TTFA 4GW1A 4JY6B 3RIFK 4FQCL 3REWB 4U1JA 5EBLA 1E4XL 1MRDL 1IEAA 5EZOH 3KPOB 2QADC 2XNAB 4JKWA 1MY7A 4LFHG 4F9LA 4P23B 1OD7A 4XTRC 3QXAB 4E42A 2DI9A 2N7BA 3DROA 3MRMB 3IDYC 1P69B 4EJ1C 5TDNA 3I2CL 2EXWC 4PJBB 2FNBA 4M1CD 1T21B 1DQDL 3FTGB 5SWQA 1REIA 2CDGA 4XMPH 1NDGB 3F7VB 5CP7B 1CFTB 1T5WA 3MLPA 1VFOA 4K7FB 3PGCB 4PJAA 1M7DA 5EG6C 2XT1B 3B9KA 1ZLVH 1VB9A 2FX8L 3IKCA 1SEBA 1CTNA 4LHUA 5KVFH 5HGGS 2AXFB 3ZTNL 2VSDA 1D9KB 1UC6A 4O02L 2R8SL 3OAZK 1IC1A 1U95B 2QQLL 3MRIA 5I8KL 2J5LB 5CAYB 4LSPH 4NHCL 1PSKH 4X7TB 5CINL 3LY6A 1FCCA 5BRZE 3MQIA 1J0JA 1NGQL 1T7XA 4DGYH 2BNQD 4MDJA 1RPQA 4PRNB 1A21A 3L7EA 4FNLL 3LEXA 5DSCA 3GMLB 5JORB 5JXEA 2ZCLL 1JN6B 4MDIA 5EWIL 2A83B 2DTML 4UV7H 2EO9A 4UT7H 4LHUG 5KVDH 4KK9C 1SJHA 1U8NA 2X6MA 4LAQL 4LNVA 4DKEL 5E5UB 4BQ8A 3QWRD 4K55A 3MLWH 1X5IA 4R0LA 5J8OA 4ZUUA 4GXVH 3F62A 5IW6A 2W9LA 2PTTA 5INCB 4W4NA 3QO0A 2H32A 2HA1A 1KF9B 3QDMB 5BVJA 5LAXB 4Z7WA 5E00B 4FZEH 4Z78B 1D6VH 5DJYB 1UACH 4LKCB 2R1WA 4TVPL 4Z7OE 4FTVD 1Q0YH 3VCLA 4RGOL 5L9DH 1N0XH 1ZHKB 1T0NA 3I75A 3LKRB 3MFFB 3MX0A 2ZG3A 3QQ4A 1I9RH 5E24E 4UILL 3DV4B 1MFEL 5K33A 4G6KH 4YXHH 3QJFB 1MJ8H 4JFDB 2X1OA 3HCVA 3EJZD 4XC3H 3BDYH 3GHEL 1NFDE 1DN0B 2WW8A 4PRDB 3H2WA 3KXFD 4EBQL 2BCKB 4XAWH 5DR5L 3CFDA 4F7TB 3L3DA 1HQ4A 3EZJB 3HPJB 2ZUVA 2IPUK 1MH5A 1NCUA 5BXFB 3EYOA 1P2CA 3R0NA 1KPRB 4RGNB 1U3HC 3C5JB 2DQTL 3MNVB 5T1LA 3SDXE 4N8PA 2ZSVB 4JFFA 4X6DB 3DARA 3B43A 5BO1H 3SQOL 2IALB 1JFQL 4I9WD 3OZ9H 1IAIL 2V5YA 5TF0A 2W07A 5L2JA 5TGBB 4P49A 4NQEB 4OM1H 1L7TH 1XGYH 4JO4H 5K9OB 3QSKB 4XP5L 3BYYA 2R2EB 1UJ3B 2R0KL 2DM3A 4Y5VB 3KLHD 2EDTA 1ZA3B 2V5SA 4G8GB 4KRNA 3DLQR 1HHKB 2CXKA 2Z8SA 2NCMA 1R24A 3W0WB 4H25A 5AWNH 3RWFB 1Y6NR 2Z4QB 3S3JA 4CADA 3F7RA 3HAEH 1I8IB 1G7MA 1RURL 5IQ7L 4UDTA 4NN6B 5DQDL 5BS0B 1YPZB 4WUUD 1ZTXH 2R4SH 3UPRB 5C0NC 4MSWA 3PQYB 4U1GB 5DI8A 5C7XL 3FQWA 1IL1A 4ORGA 1RV6X 1N64H 1QBLL 3H9SD 2XZAH 1LEKA 4NBZB 2OXGA 4TUKH 4ZNEA 2GJ6E 1QSFE 3THMH 1MNUL 3I6KB 3QIBB 5LWYH 1ERNA 2GW5A 4Z5RA 2A1WH 5GJTL 1GC1C 1DBMH 2R0LL 4LCWD 1B2WH 4PIRF 2Y9RT 5D8JL 1R3HA 3CPLA 2R29H 1FORL 2BJML 1H15B 3KPSD 5GRUL 2IAMD 4QYOB 3V7AE 3QEQE 3U7AA 4AEEA 1IC4H 2VXVH 3OGOE 4JPKL 5ANME 4PLJD 1NLBH 4JPIA 5TFSL 1NGZB 3RBGA 2EDLA 5JPMB 3ARSA 3ARBA 3L5WA 3S35X 3DBXA 2Y7QA 1KTDB 4GSDL 3C8KA 2VXTL 1ZV5A 1JHLL 1EFQA 2AJVL 4P3CH 5ESVB 4Z7UE 4GQ9L 1UWXK 3HE7B 2HTLD 2VR5A 4LVOB 4Y5YB 3AS0A 1D5BA 4X0KA 1NQBA 1CU4L 3VU2A 1QFWH 4MX7A 2XG4A 3SDAB 2Y07L 2OM5A 2X05A 5CJXA 1R3IH 1YEFL 4L8DA 1K8IB 1HCVA 3MCG1 3TO2B 3RIAF 5FYKH 2ZUTA 5GRJL 1JGVL 1BFSA 2VXUL 4NRYB 4P2OB 5JW4M 3DRTB 4PREB 4EN3C 3RUGB 1J10A 5F7LB 1F6AA 1ZT7B 4EI5B 2GI7A 3QISA 5F9OL 3BMWA 1EBPA 4JGMA 2YN3A 1RHFA 4FQQA 4P5MB 4DQOL 1MEXH 3ARVA 4MQSB 3OKLB 4LAJH 1RK0A 2CKBL 2JJWA 3LRSB 1NKOA 2WIIB 4JFZH 1A3LL 1FH5H 3DX7A 1F4HA 5IMLB 5IFJA 4MNHB 4JM2D 5L88L 3W9EA 3SGEH 4L8BA 3QI9A 1KJ2B 2VKXA 5ABDE 3I3EA 4XMKL 1YEJH 2HJLA 3MNZB 4MQ7B 3WKML 3TBTB 1G0DA 3BWUC 2VR4A 1JIBA 1CF8L 1VGEH 4X7FC 4GLRH 1U92B 1YEKH 4PGCA 5E6ZA 1A4JA 1NGXB 5F7DB 2Z91A 1L6ZA 4YE4H 3DUSA 3VMPA 4D94A 1MWAB 1YMHB 2VZVA 1YYMH 1S78D 1J8HB 5GGVH 3WUWA 2BC4B 2VLJD 4G6MH 2X4PA 3O6MH 1OWWA 3QULA 1IGFL 1YEDA 4PJDE 3P30L 1EPFA 3GSOA 1SMAA 3UZEA 4X8JA 3O4LD 3G04B 4E5XB 1SEQH 1RZIA 3SE9L 1DLFL 2VDNL 5CLWA 2ZOLB 4RDQF 1CBVH 1ZWIA 1AFVL 3VRJB 5DJCA 1KLGA 1A0QH 1OSZB 4N9OB 5GS0L 3MODH 3D69B 3OKKA 4L9LB 3GHBH 1ZSDA 3E1F1 1MHHA 4LPYA 2F5AH 2UWEA 4U33A 4OLXH 2FATH 3MLUH 3LB6C 4HQQH 4NKDA 4AIZA 5I1CH 3L3KB 2AK1H 1QP1A 4PJHE 1S5IL 2F15A 1JGEA 4TULL 3SBWA 1ZGLA 4GG6B 1E6JH 4H8WL 4I4WA 5FA4B 4AYFA 3BKML 4RISL 1QQDB 1X5GA 3EYQC 5D5ME 4OT1H 4OF7A 2FGZA 1J1OH 1MIMH 1GC1H 3ARED 4XNXL 4P3WA 3EYFA 1E6OL 3WNPA 1SYSA 5E94A 4NDMB 4BYHA 1NUGA 4QHLA 3S3PA 2EC9U 4RFEB 5GJSL 1KN2L 5F1OB 1MCWM 4YUEH 3IAQA 5I0ZA 2DKMA 4EEEA 4K23L 4Z18A 4WFHE 5TQ0H 2YKLL 3LOWA 4MD4A 1P5UA 3TWCL 4NSKA 3H9ZA 1KT2B 1OB1B 4Y2OA 4KUZL 5D2LF 2JJSA 1VPOL 3OAUH 3CVHB 3HMXL 3JWDC 4HWEL 3BP5A 1S7WA 2EDWA 1G6VK 5EOCJ 1U91B 3MACH 4X7DC 3E8UL 4LNRB 3SY0A 3BAEH 2B1HL 3P40A 4HHAA 3IVKB 1KIQA 1JV5B 1JHTA 3PV6B 5E2JA 1MREH 3EDKA 1CTOA 2DIAA 1UM5L 4U7MA 1I7TB 2CIIA 3HZKA 3M45A 4PJCB 1NC2B 5ACLA 4LQFH 5MEOA 5EA0L 2X44D 1CK0L 4XCNA 4MCYB 1ZHNA 2A0LD 2V2WB 2E27L 3MNWA 1FIEA 3R06A 4FP8H 1I3UA 2NY1B 3B2VH 3OKOA 5E4EB 5BVPH 4OV6F 5I1JH 3WN5A 4ZXBC 1VGKB 4N0CD 5CUSL 3O3AA 2EH7L 5GGSA 1EGJL 3I6LD 4XMLH 4KKNA 3GIVA 2DYPB 2NY6C 5IJKA 3IETA 3BH8B 4HJGA 4XNMB 3X3FL 1RUPH 4ONFL 5IBUB 1BJ1H 4JO1H 4LHQB 1CICB 4GBXA 5DRNA 3PWJB 2OJZL 3SKJH 2UZYB 3DPBA 5IVXA 1A7NH 4FQ2H 3VXMD 5A1AA 5JR1H 3WE6B 2FJHA 4UZGA 1F2QA 1WBZA 3BT2H 1HHIA 2ITDA 4MA8H 4RMUA 3N1PC 4YAQA 3UTZA 2IGFL 1FVCB 4C56A 1X6LA 3QXTA 2UYLB 2VITB 3CX2A 4UIMB 1KNOA 2PW1A 4JFXB 2ESVD 4WV1B 5D4QA 3BDXA 3EFFB 1AI1H 2EZ0D 2ICWA 3SJVD 1MCCA 2DWDA 3KPPB 3QG7L 4L3EE 3RWHB 5EBGA 5BJTA 2FX9L 3UMTA 3SE4C 1RUKL 4PJ7A 3TN0D 1OOAA 5DMGD 3B3IB 3D9AL 1FGVL 4TSBH 1MQKL 3QO1B 1AC0A 1KENL 1AD9A 2R9HC 1BM3L 2NY4D 2O61B 3FB5B 5FO9A 1JE6A 4XH2B 5DFWH 5E8EA 3RZCB 3QA3B 4NQTA 3QDHA 1MIEL 1CDBA 1IBGH 4Y2DD 4HMDA 3F5WA 2BRRL 1U8JB 2CQVA 1IVLA 2F53A 3U82B 3M1BA 5DC9B 4XXDB 5IK3B 3U36A 25C8H 5JHLL 1WTGT 5DFTA 5EULV 1UZ8A 1M05A 8FABB 5HVHB 5BRZB 2DOCA 3T8XB 1T03L 3IFOB 2J8UE 3ZYZA 3MRHA 1A6AB 4IRZH 4ONGH 4PJFE 4NM8H 3U4EA 3HHRB 5CBAB 4Y4KD 4G5ZH 4L3AA 1HEZA 1QVOB 4M61A 3T08A 4OZHE 1B4JL 3TH4T 3UBXB 4OGAC 4D0CA 3NA9L 5T3ZH 4NNYA 5FKPA 1UXSB 5H37H 4U4BA 2BZDA 3OR6A 3N06B 1XR8A 1EEYB 4MLIA 1IKFL 3NN8B 3RL1B 3LQAH 4O00A 5IT2L 4JJ5A 4R97C 3LKSA 3O2VL 3RGVC 1LO0L 2I5YL 5F1KC 5F89A 3RVWD 4JDZB 1Q8MA 4NHUA 3CH1A 5IEKA 1I9IL 1QLEL 1B0WA 5I8OL 2IH3A 4UQ3A 5JUEH 4KQ3L 3K2UH 3MGOB 5D6CB 5F8QC 4X6BA 1NANH 3EO0A 4YX2L 4OFVA 4ODXA 3E6FB 1AP2A 5DRZA 3TZVD 5ISZA 2QLVB 1AD0A 5HBBA 2DQFA 1DEEA 5E8DL 3FAXA 5IMOB 1Q9KB 1WC7A 3QCVH 5ACMA 2PO6B 3MBXL 1RU9H 1XGTA 4OD2A 1EAJA 1XIWB 3W11D 5JPNB 1FHGA 2C3XA 3KJ4C 5TPWH 2WBWB 5FHAH 3QCUL 1DFBL 4M7ZC 3VI3F 3FB6A 2HTKD 2WBJA 3MFGB 2AV7B 3GSWB 4CU6A 3V0WL 1BJMA 4CL7A 1JBJA 3SDXB 4KK5C 2OL3B 1BP3B 2I9LB 1NSNH 4OCXH 4HXBH 2Q87A 2VDPH 2VE6B 4NWTL 1EO5A 3GSNH 1JPFB 2CUHA 3GSRB 2F54D 3SDCC 3U79A 3H9HA 3KHOA 3UP1A 2R23A 1R0AL 3C08L 1P1ZB 4K71C 4G80A 2Q7YB 4HZLA 1Q38A 4N0UA 2C4FU 4U3CA 4FQHA 3LHPL 1W72L 3T0EA 4L29A 5IR1B 3ILQC 1YJDH 5DD3H 4JHWH 2Q8BH 5A43C 5KVGL 4M7JH 3VXUE 1QHPA 4AT6A 2R56L 2AJYH 3DXAD 4AIOA 1BQHB 4EUPH 4L4VA 3TESA 4EDXA 1LK2B 2NTFB 2QQNL 4BH8A 4XHJD 2GJ6B 1QSFB 5EC1A 5C9JB 2ZSWA 4KZEL 2Y06H 2FEDC 2APFA 1AGBA 3WHXA 4XP6H 4U1SA 2NY2D 3LD8B 3QRGH 5IROC 5C0IA 5EPMB 5L0QC 4KROD 1U8MA 1CR9L 4R90L 1KLUA 1HXYB 5F72S 3MBEA 2XWJB 4JPWL 4OV5B 3GM0A 4KJQC 3QP3A 4XWGL 2BERA 4AENA 1UCTA 1WEJH 2YOCA 5ANMB 4HIXH 3TP4A 4Y4FC 3TFKC 1QKZL 3CSGA 3VE0B 1Q9LA 3L3OA 3Q3GA 1B3JA 4G7VL 4KHTL 1T6WA 4D9QE 4EIGB 2PW2A 4X99B 2QHRL 2XA8L 1CLCA 1TVBA 5DHYB 3WFHA 5BMFL 5F88A 3MMEA 3SDDA 4Q97A 4Z7UB 1CGTA 2IQ9L 4QHNA 4X7SH 1GHFL 1OSPH 3FRPA 4I0PD 1P9MC 1ETZB 3BWAB 5T3ZE 1RQ5A 1LQSR 4HKJB 3IXTA 1CZ8L 4RAUB 2DL9A 1ND0A 3VH8B 3WFBL 4ZTPH 3MJGX 4R3SA 1FCGA 4I5BA 3FO2B 1TMCB 5JTWA 3L6FB 3S96A 1S9XB 2D4DA 3L5IA 4PTUA 2X4UA 3V6OA 1JMZA 2IFFH 4WDIA 4G6JL 4HS6B 2R1YA 1QA9A 2A77H 1JZ7A 3ZKSD 4NQSA 2FZ3A 2CKBA 3HTLX 3HC0A 4OZFH 3FRPG 2O5XH 5FGCE 5HDLA 3V0VA 2OSLA 4YBQD 3BGFC 4HJ0C 3QIWA 4H5SB 3MRRA 1RZ8B 2CO7B 1AGEA 4H88L 3HRZB 5ID1A 3X14B 3MJ8A 4PRPE 4G7YH 4OLWH 3BO8B 1I1RA 2WMPA 1U8HA 1WWAX 4X6CF 2CUIA 4ZQKA 4KV5F 2YD7A 5ECJE 3IDIB 3LKQB 5TQ2L 4F9PA 4UIKL 1SBSH 1DUYB 1JYNA 5J13C 3L5XH 5HY9B 3JV0A 4M43H 1AR1D 3K46A 5D7KE 5IHUH 3PHOA 4JB9H 2OI9B 4F33B 1MHCA 2HFFB 1OGTA 2KPNA 4RSVA 2GSIB 4PJXA 4M3KB 1K3IA 3ZYIA 4XBEH 2BNQA 2BVTA 4OGZA 2X9XA 4PJDB 3OHXB 4ONHB 1JHKH 2FJGA 4PLKC 2IQAA 3BD4A 4HG4K 3LPFA 5AZEL 5AAWA 3KYMA 3JXAA 1J0IA 3D18B 4N1EA 2OBGA 2DWEB 3GBML 4NQVB 2AI0L 2HLFC 4LARH 4PUBL 4YLQT 1OAXL 1A5FH 4PJ9B 4TUOA 3TO4C 2B2XH 3BPOB 4ALAL 1KFAL 4Z77A 4LVEA 3IDUA 1UG9A 1KCUL 2XZCH 3VFRA 4CW1A 1AE6L 4FQJL 1X4ZA 2FD6L 3CZFA 3N9GH 3BGAA 4QRUA 1FNGA 3NCYP 3VWKA 4FTVA 4O2EB 3CU7A 3WJLC 5DK2B 5AUMB 4HC1H 1H5BA 3EBAA 1XF5A 1EEQA 1XGQB 3GSQB 1I4FB 3HC3L 5D5MB 5DD5L 4YGVA 5C0FA 3C60B 3QDGA 3HG1D 5E8OB 1D5XB 5L2KD 4ZFFB 5FO7B 5E6YA 5EU6B 2D31A 4DZBB 5HYFA 4A6YB 1JPSL 1NEZB 1O0VA 4RWYH 1X5AA 5C07E 1NDMA 3LS5H 3HMXA 3TBVA 3WXWH 4G8FB 5DJ0B 4KKBC 3ET9F 2BDNH 1YEHL 5AYUL 4HUMB 1ORQB 3MUZ1 1INEL 4XPTL 2N7AA 1DBBL 4XNUH 2HJKB 2X1WL 4PJ8D 1JWMB 3QUZB 4WFGE 1LE5A 2NY0D 4I2XE 2NW2B 5I1DB 2G60H 3SKOB 4AEHH 3D48R 2P1YA 3TCXA 5BV7L 1EJOL 2IMMA 2K7QA 3MO1A 2NXYD 2O5YH 4M5ZH 5HI4C 5B8CB 5TDPB 2XTLA 1MCPL 4ZUVA 2BNRE 2X9WA 3BD5A 4HAGA 2X1QA 1QRNB 5D1ZB 2Q20A 1C08B 1EGJA 2X4RB 4IM8A 4XNZB 4IDLA 3KPQB 4MJ2A 3RWDB 3U9PH 1OTUC 5JW3H 1TQCC 4IDJH 3BE1L 2W65B 3RX8A 3O8XB 2VLKE 1G1CA 1SM3H 4M7KH 4XCYB 3WO3B 4WUUA 2XTJE 3FQXA 4PG2A 3S34H 4RFNC 3IJYA 3U7WH 3MREA 2IG2L 3H9SA 2MSPA 2VQUA 3HUJE 3MV7E 4K7PL 3QHFL 4OUOA 4PJ5D 2VXSL 3VXPB 5C70A 1NCDL 5HDQL 3IJSB 1UM6H 2J88L 5C0EA 4IOIB 3GMRB 4LCWA 3H3PH 4Y16D 1QG3A 5D1QB 5J6GA 3ZE0F 1HOCA 1BEYL 3KPSA 1PLGH 2BNUB 2IAMA 1RVFH 3OR7B 1L7IL 4QNPE 1AIFB 2VLRA 3H3BC 3LN4B 2E7HA 1YEGH 5JHDD 5GS1A 2CJUL 1PKQE 2DQJL 1OGAA 3FN9A 1VFBB 4Q9QH 3RHWK 4JG0H 3TPUA 2XWBB 2AJUH 3X3GH 3MUGB 4CMMA 2EDKA 4L3EB 1T7ZA 2W9DL 3CLEH 1H3PH 5KSAB 4P2RA 3WNOA 2WNGA 4OCRH 2IPUG 3ARGD 2JB5L 4PP1D 4OKDA 5E99L 4FQXC 5FXCH 3LRGA 4M1DL 4XXCC 3BXNB 1KJMA 2Z92B 5E08H 3P9MB 1NCAL 4RAVB 1PQZB 4ZMAT 3M17B 3SKMA 4ZDHB 4CBPA 4ELME 5A2FA 4J8RA 5FF6B 1NC4A 3AY4A 1YMME 1IAOA 4QF1B 1YC7A 4U6HB 5CZVL 4Z0XB 1BOYA 3G6JF 5CWSB 3EJJX 1PFCA 2GJZB 3BGMA 3VGAC 1OL0A 4DKAA 2J8UB 1JYVA 5HI3D 4N5UA 4PJFB 5F6HJ 1H0DA 4JM2A 4KI5E 2CRZA 2AKRA 2XFXB 2YMXH 2P5WE 4OZHB 2ICCA 2HMIC 3TH3T 3RVVD 3KPRE 4Y1AB 1ES0B 4JQIL 1UWGL 3MTRA 5CSZB 5D2LB 1NMAH 4I18B 1KN4L 4RMRA 3DO7A 4XP1L 4AIXA 2AK4E 1EJ6A 1N8ZB 4R9HA 5CILH 5KS9F 4FZ8L 2IADA 1S7SB 4O5LL 1IKNC 3QIUC 2VLJA 3IDJA 1RFDH 4EIZC 5F3BB 3RU8H 2D7TH 2JCCF 2P24B 3FHQA 4APQB 3FFCE 3RIFF 3NABH 1BJ8A 5HYQB 2NZ9C 4OLEA 2R4RH 3O4LA 3FT2B 3RWCA 4LLUB 4XT1C 4OIIL 3HZVA 3G08B 5KN5B 4J7RA 3FJTA 4LCCA 4WO4D 2ARJA 3C9NA 4W81A 4RMQA 4EN3B 1NL0H 1T1XB 2VLLB 5FK9A 5DZNA 2EDEA 5MENB 1N7MH 3T65A 3OTTA 5FOBB 1PG7H 3VFUA 4CRPA 1MCKA 3BHBB 3MR9A 2HH0H 3Q6GL 4I3GA 4BSWB 3K4AA 3HRPA 3MLZL 3OKMB 4MNQE 1G7HA 3PF2A 5IB4A 5CEXB 3DUUB 3F6IA 2VDOH 2ZPKH 3EW3B 4GH7B 4ZYKA 3GMQB 4PS4H 1LEIA 2NMSA 4JGJA 4X5XA 3BISA 3D85D 2HFEA 4FS0A 4LF3A 4LK4A 3CJJA 1TCRB 1W72A 2J7LA 4M5YL 3FN0H 2QV2A 4XP9L 1HHHB 4S1QL 3D2UB 1MCDA 1B6UA 5MERB 4KKLC 3W81A 3OKNB 4R4NC 1AHWC 3ISWA 2BVUA 4P23D 1U6AL 4N8CL 4FQIH 12E8L 5A3IC 4XPGL 1OTTC 1X5LA 4YDVA 1TVHA 5IFAH 5I1GL 3EOBA 1EO8H 2FYYA 5B3JE 1A4KB 15C8H 3UDWA 2V9QA 4N0YH 1FG2A 4P4KA 1IAMA 3VXUB 1QEWB 3ZDZF 3O41A 5CJQL 2DQUL 1YNLH 1IGYB 4JLRB 1XZ0A 3ZKND 4K8RD 4MA3A 3EYVB 3MLSL 4GW5B 4DGVL 2ZOKA 2A2QT 4M9OA 1WZ1H 5GGUB 1M71B 4JFOB 3RVUC 3FB7B 4DGIL 4KXZI 4OLVH 1D9KD 3RWJB 4ZPVA 4JN2B 3BIKB 1A9BA 4BQCA 3VFMB 1CXEA 1WAAE 3F58H 3C2AH 4V1DE 2Z9TA 4KJWD 3I9GL 2MCPH 1ADQL 2X4NA 1SY6H 1E4XI 3H3KA 2VSCA 5F1IA 4OF5A 5EOQL 4Q9RL 5F1NA 1URLA 1P7HL 5I18H 5KSUB 5T5NG 2A38A 1QSZA 1UM4H 3QUKA 4LOUD 2R2HA 5E2TL 3CC5A 3W39A 1T1ZB 4PB9L 3V5DA 1CFVH 3VXMA 5JXEC 5SWSE 5CEYB 3HI1B 4QHUA 5I9QC 4YXLL 3GBLA 5FGBA 3QDMD 3IFNH 1KGCD 4OUUB 1U58A 3X13A 2YRLA 5IGXH 4R7DB 3O3EA 2ICWI 2M1KA 3DIFA 3OXRB 4R0LC 4QRRD 5D70H 3AB0C 1CQKA 4P0DA 2ESVA 4DW2L 3CSYB 2I9TA 1FZMB 5SX4I 4KZDL 1CLZH 4JFDD 5GRXG 43CAB 3OGCB 4JZOB 5D72L 5F7NC 2DDQH 5H2BA 3TN0A 4MXVF 4PR5B 3ULVC 5HYIA 5D7JA 4JDVB 5HGDA 4PRPB 3AU1B 3KPMB 3G5XB 4KRMB 2ZCKL 4Q6IB 4KKCD 1EHXA 2QKIA 3UC0H 4PBXA 1K8DB 4XNQB 1UH4A 2XKNB 5JW4R 2WUCL 4Y2DA 3HR5A 2H2SD 4GUPB 4RGND 2OTWA 3ME0A 4X98B 1J7VR 3U0PB 4O58L 2VH5L 4PP2B 5EOCL 2GCYB 5E8PA 1GGIL 2BSRB 4JCLA 3P11H 4NQDE 4NQED 5IBTH 5M95B 1G7PB 3TC9A 2AJ3B 3VFOB 5F7EH 1XGPA 4ZFOB 5TE7H 5E6IB 1HILB 4GAYA 4G8GD 5J56B 2NPLX 1HSBA 1U93B 5E9DE 5DHXB 1C1EH 5C1MB 3T09A 3W0WD 4MZ3A 4R6UA 4IRJB 1S7UB 1JRHL 5EN2B 1CDUA 3QFDB 2M26A 3T4YA 4JR9H 3TJHD 1IGTB 5GSVB 3ULUH 5IHBA 2CH8A 1I9JL 3L9RB 5CSGA 5BS0D 1ZLUH 3LSOA 4MMXC 4HK0B 3PQYD 2DBJA 3CFKA 1N4XL 4PRIA 1T04A 2APTA 4D2NA 1BLNB 4Z7QF 3QDJB 5I19H 2GTWA 1JGLH 3MOAH 5C0BE 3RY6A 4EUPB 4ORZC 3BP4B 4JRXE 1T1WB 3A67L 5E7BA 1KTLB 3QIBD 3CCHB 3OJDB 2FGWH 4HKXB 4OIAA 1A3RH 3PJSB 1I8MB 4M93B 4KUCF 1IAII 1DEDA 3SCMB 2CLRA 5JDSA 5I8EB 1ZGLM 4HEME 1WGOA 2EE3A 2WWKT 4U1LA 2BVOA 4L4JA 5IBLD 3OF6D 3UCRA 4ZOAA 1A6ZB 4D3CH 1N6UA 4UINL 1FQ9C 4JO3L 1FE8L 2ATPA 2QTEA 1HDMB 4XVUC 5C07B 3FO0H 3CK0H 3FN3A 5JOPE 3O9WC 1HKFA 2PCPB 4FQ1L 1FBIL 1IGJB 4P3DB 3EFDL 3A6BH 4YIQA 5D7IA 3HE7D 5IM7A 4KRLB 4NUJA 1MF2L 1FZOA 1VDGA 3ARBC 3BZFB 3NCJL 4I2XB 2O5ZH 3EO1B 2X4SB 4TRPL 2FEEL 3CNKA 7CGTA 3QUXB 4XVSH 4PJIA 4NJAL 5DRXB 3ZE2F 2BNRB 1NFKA 4GRWH 4P2OD 3S35L 4JFQB 3BEWA 3LDBB 5HDBF 3V0AC 3ZTJH 2NXZC 3KS0H 5BCAA 1ZVSA 3HC4L 4EI5D 3DV6A 4OZFB 3L5JA 4MGXA 2YPLA 5CKGA 5I30L 2H32H 1U3YA 3OPZH 5C09B 2OJEB 5DMIL 5FYKU 4OCLC 2ZKHL 1G7QA 1AO7E 4PG9A 4CKVX 4OCSL 2VLKB 4RFOH 1CT8B 4QWWC 5FYLH 2XTJB 5KW9L 3CXDL 4MJ6B 5EFIB 4ZS6C 4M8VA 3TM6A 1NBVH 4I0CC 2HWZH 4U6YA 3STLB 4CUCA 5A16A 3ULVH 2DKSA 2H26B 2H9GB 1ZANL 1GPOL 3HUJB 4P59H 4YHOL 4M6NH 3QXDA 2Y5TB 1DBAH 3ZE1F 2RIKA 4DN3H 4D9RE 4Y5XB 5LGJA 2YK1H 2VDKH 1RAMA 1UWEL 5GZNC 5ESQA 1NGYA 3U0WL 4K8RL 3UPAA 2CLZB 3LH2H 3TCLA 1J8HD 3P4OB 4NZUH 5T1KB 4UUJB 1D5ZB 1ZK9A 1R3JB 3M8OH 4B7IA 5F3HB 4CAGA 4J3XA 2H2PC 5I1EH 5KJRL 1PKQB 4GKZB 5FCSH 5J0BA 4MWFA 4AY0A 5CEZE 3UJJH 2IJ0C 1ACZA 3ILPB 4I0PA 3WIFB 4NUGH 4X6FB 1RUQL 2DQCH 1FFNB 3B9EA 1MVUA 5LQBL 3ULUE 2EXYC 3L95A 4P5TC 4F58H 1A7QH 1INQA 4FFYL 3T0AA 1B0GA 4HBQA 4ELMB 3T1WA 1KEMH 1Q9WA 4WI2A 5AG8A 5HYSA 5CD5C 4NQXA 4LKXB 4WFFD 3U4BL 3GUTB 4DAGH 2BVPB 3IFPA 4U1MA 1FDLH 3H0TA 1I1FA 1DBJH 1S7TB 4XPBL 2NW3B 3I6GB 4KY1L 4X5WA 5B22A 4ZPTA 1HH9A 1G1YA 2JTDA 2FX7L 3T1FB 1R5IB 2WAHA 3MCLH 4FXKB 3W5NA 3IU3A 1FFOB 2B0SH 4PJAE 1XF4A 1N2RA 3PE9A 2P5WB 3NH7H 4NRZA 3KPRB 1DQMH 4WJ5B 3CDCA 1E4WH 1G6RL 4GW4A 2VAAB 3WLBA 2AK4B 1EEUA 5D93B 1WIOA 1CGWA 3BUYB 3EGSB 1EHLL 1LO5B 1LO3L 4PJEA 4KRPB 1FZKA 2WWKO 1XGUB 2VDQL 1XF2B 4O51A 4BFEA 4HPOL 1CD8A 2JJSC 3JWDL 4ZO6A 2R2BA 2ZUYA 4K94C 4GRWE 5EDXA 4NN7C 1RZJL 1Z9MA 4OFIA 1F4WL 3C6SA 1JZ8A 1NC2D 3T0VA 3MROA 4POUB 4KJQD 1HINL 3SGJC 2AS5M 5GIRA 1MLCA 1K6QL 2ADFL 1FNEA 4Z7WE 4ZG1A 4F2MB 4GRLA 3VWJB 5ICXA 1CLOH 2FWOA 4LLYA 2EKJA 2BFVH 3U2SB 5FYLE 1HHJB 2DYPD 3DX8B 2VXQL 1INDH 3VRIA 3ULVE 1KG0A 3PWPA 4MNQB 3NAAH 5GS2H 3K7UA 1UCBL 2H1PL 3L3HA 1KC5L 1CICD 1K3ZA 3GSXB 4G42B 1IAIM 3VJ6B 3GJEA 4XPHL 1DSFL 2FO4A 4JREB 3RFZC 4R7NB 2OP4L 4OGYH 4LLVB 5IJKC 1MFAL 2YEZA 2N4IA 3HG1A 3EYUL 5E1HB 4CNIA 5L2KA 2EO1A 3RI5K 4GBXC 3TGXA 4XCCL 1JUFB 1U8QB 3IU4L 3TT1L 1AGDB 1J1PL 2J2ZA 4JFFE 4PJIF 4XVTH 4M6ML 5GXBB