3A67H

Crystal structure of hyhel-10 fv mutant ln31d complexed with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a67H00
2A38A 4HJ0D 5L9DH 4HKBA 1YJDL 4EN3A 2IGFL 3M17A 5I1LA 3NCJL 4G8GA 2CD0A 1U8NB 2ICWI 5IBLD 4Z6AT 3VXPA 1EDQA 4APQC 2O5YH 3BZEA 1K5NA 5I0DA 2E7HA 4LP5A 2OSLA 2NX5B 3BDYH 1MJUL 3W39B 3VD4A 1OTTC 1XF4B 1H3XA 2ZWLT 5J6GA 3O9WB 1BWMA 5C08A 5TQ2L 1CFTB 4ZNCD 4LAQL 4MD0B 4MB5A 2ZG2A 3RWFA 4KROB 4PRBB 5C0RL 2J6EA 3ULUH 5J1SC 1TJIL 4LLQB 5FHBH 2FLRT 1F45A 3SDAB 4U0QB 1KCKA 1U93A 2BSTA 5A2IH 4G80A 1YUHA 3KS0J 3UTPD 1OF2B 1DBJH 2BVOB 3EJJX 4P5MB 1KULA 4HUWB 4X5WB 5ISZE 3TCLA 2BVUA 4JO2H 4OKDA 4OZFG 5I19L 3S3SA 5E2UL 3C2AL 2X1WL 5E8EA 3KJ4C 1KLFA 5L2KA 2WANA 4QRRE 5HDBE 4XI5D 5DJ2A 4BZ1L 3QJFA 4HMEA 4WEMB 4N0YL 5KZCB 4LSPH 3EOAB 3T0VA 3EJZD 1DQJA 2VIRA 1LO2L 3HNSL 5IR1A 3WBDA 1JGDA 1A9EB 1UT9A 3D18B 2VDQL 4HWBH 5I18H 4FP8L 1U3HC 1R6VA 2NY1C 1KT2A 3MFFA 2QSQA 4ZFZA 2P5EE 5FGBA 3CVIH 4RQQA 1EGJH 4PLOB 4ZXBA 2HJLB 2A1WL 4RA0C 3VU2A 1IM9D 4PJGA 3SDCD 4JRYB 1JCKA 5KVFH 1M71B 4C4KT 5GS1B 1X6LA 4EJ1C 4D9QD 3S4SG 4W81A 2GAZA 4KUZH 3PJSA 5K33A 2NPLX 4YGVB 5FUZL 5I6XB 4UILH 4LNRA 3MV8B 4MJIA 2ZPKH 5FUCE 4GRWB 1CFQA 4KWUA 3FRUB 2CK0L 4UDTB 1KTRL 2QL1A 5C6TL 3E6FA 3QIBA 3RTQA 2IQAB 2P44B 5EDXA 4ZNEA 4S10A 1MSPA 1N8ZB 3MCKA 3WEXA 5BO1L 3PDDA 1MJ7H 4Y16A 4F7PA 2XZCL 4Y4HA 4XPGL 4YBLC 2VLKD 1KJ3L 1NAMB 3X14B 5JO5B 3EO0B 3JWDC 4HCRA 4G43A 2VITA 3GBNL 2OR7A 3FCTA 2OJEB 4JN2B 5FO8B 1WCQA 1UJTA 5I66A 1MRDL 1TITA 4LQFL 4HH9A 2Y07L 3MR9A 3WNLA 1FJ1B 3BKYH 1ZT4B 3EO1A 2VXTH 5T1MA 1U8KA 2HAZA 3O3EA 4GMTL 2BVPA 5F3BA 1P5UA 4HUMB 5JMOC 5AZ2L 1JFQL 2X9YA 3SE4C 3UJJL 3GSRA 3K8KA 1A7OL 2KZWA 1S7WA 5TFSL 5FYKL 5I2IB 4UDUA 4MCZB 5MEQA 2DQDH 1V3JA 4H0HB 1JPGB 2F58L 2HVJA 3S36X 4R97C 3VG0H 3M07A 3UMTA 1HDMB 5GS0C 2Z91A 4RSVA 1ZHKA 3L3KB 5I1HH 3K74B 3SPVB 4IM8A 1I9JL 4X99A 3SDDD 2BERA 4YX2L 5GQBA 4P4KA 4LCCA 1RJYB 5C70A 1DANT 3SQOL 1RJLA 3DO7A 3DBXA 3NFNA 4J1UB 5IVXF 5IKCB 4LKCA 4WI6A 4AM0A 4F37F 5E2VH 3OAZH 4RWYL 1ZLUH 3O81A 1VFBA 1KN4L 5GS2H 3CSPA 2DQFB 2I5YL 4POZC 3WIHL 3V9FA 1W0VA 3F6IA 3HFMH 1T03L 5TPWH 1RZJH 4H8WH 1S7VA 2BNQA 3UBXB 1IAKA 1G9ML 3MYJB 1MJ8L 4P9HH 2CXKA 5B4MD 3QYCA 4F33A 2FB4H 3U0WH 4KMQA 1P4BH 3KXFA 2FJFA 2V6HA 3FN9A 1DLFH 4JZNA 2HKHL 1UXSB 4OZ4B 4KJQD 1T21B 4C57C 4Z7VE 3GBMH 3CZFB 5BO1H 1EERB 1XZ0A 4I9WD 3ARPA 4HKZB 1D5XB 2A0LC 2F8XC 2VABA 3V6OE 4F37K 5IHBA 2JJTA 3KS0H 3BEVA 2IAMD 4HDIB 1BJMA 4J7RA 1FE8H 1SQ2N 3STLA 3KYAA 1FAIL 1IQDB 1BEYL 5H94B 4PJXF 4WUKL 2OTWB 2V2WB 4OB5H 1N0XH 5CCKL 2JJVA 4MCZA 3D69B 3O2WH 5DHXB 4JCLA 1JIBA 1RZ7L 4UUJB 3HR5A 3BRDA 4LVNC 4M02A 3QEGL 3QBTB 4XMPH 1YJDC 4HG4K 2AEPH 4PJIB 1FHGA 5KJRH 3MCG1 3O8XA 1NCTA 2C3GA 5CIPA 4I3SL 3H9ZA 2EIBA 3EOBA 4GFTB 2XV6B 4LEXL 1NSNH 2WBJD 3QHZH 4P2OB 1VADB 1YC8A 2AV1A 3P0YL 3TN0B 1LO4H 3L7EA 2AK4D 1VPOH 1G7MB 2PW1A 2NW3B 2K1MA 2DLTA 3NGBC 3IFPA 3INUH 3CFEB 4I5BB 3O3UN 4OCSH 3V52H 3FL7A 3MGTB 2WNGA 1I1AC 2QQNL 4NN7C 1KJ2L 2Y06H 2X9WA 2P7TB 4J4PD 4RBPH 3BN3B 3E1F1 3U9PL 1ZVSB 3B6SB 4JE4B 3FO2A 5I16A 1DQMH 4LGRB 3QEQB 4MQTB 3CNKA 4PJAA 1YNKL 3BHBA 2FGWL 1D9KA 4ORGA 3MA9H 4YFLF 3OAZK 4S1SH 4AJ0A 3CIQA 4PG9A 2KQMA 1OGAB 3NCEB 2BJMH 2O61A 5TQ2H 4J3SA 4UNUA 4HS6A 1W72B 3F5WB 2CMRH 4LPUA 5T1LD 4PJFF 1BAFH 3JUZA 1X5YA 4WWKA 4S1DD 2PW2A 4JFXA 3U2SA 1E4WL 2JELL 2R0LL 1XF5B 1QRNB 1FL3A 3BGMB 2DQHL 2HFEB 1FZMA 3FT3B 3WE6B 4K71B 1IL1B 1NAMA 3JTSB 1RZ8B 2PTTB 1S78D 1WAAE 4JQIL 5BVPL 4LVOB 5I17B 5TJWK 2PN5A 4NPYA 4NQCA 4PRHA 3SGKA 4OUUA 5C08E 5HHQB 5KS9B 3UJIL 5KTEL 3CXDL 5FFLA 1S7UB 4ZTPL 5T3ZH 3ESUF 5C07D 4WEBL 4X7DC 3CX2A 3PWUB 5JORB 4JG0L 4ONHB 1HHHB 2X4RB 3TBWA 3PUCA 1WAAF 3BVNB 4H1LB 3K1DA 2CUIA 4KI5D 5T5FL 4HXBL 1UH3A 2HT3C 4GLRI 3BJ91 1Q72H 3C60D 3FZUC 1XR9B 3L95A 4PV8B 4ZFGL 1RUAL 4K7FA 1I8LC 4PJFE 2KZ1B 1S9XA 4F58H 4M1DH 1S3KL 2EH7H 2L0DA 3OXRB 4XP1L 3RUGE 1K4CB 1NDGB 5T1KB 3VFPB 4BQ9A 5B3NA 3H9HB 3V4VL 5CEZH 5KSAD 4UV7L 2GK0B 4M1CD 3SGDH 2V5MA 1KN2H 1AGCA 2YD7A 2FL5B 1PDKA 2RCSL 4GW4A 2W38A 4JY4A 5TDNB 1FZKA 1WZ1L 3QAZB 1BF2A 2HTKC 1I9RL 1UCBH 4K8RL 3O4LA 1K8DB 1AKJD 5EA0L 1PGRB 4H0IA 3S3PA 1I1AA 3CGTA 1LO2H 4UU9A 3LKOB 2OS7A 3FB7A 12E8L 3HNVH 4LU5H 4EXPX 4BA8A 4ALAL 4TYUA 2C9AA 2HLAB 3BE1L 1J88A 1DUZB 3GUTA 4MD0A 2JTDA 3PGCA 3C2AH 3CH1B 3WS6A 3DOSA 3HE7D 4XVUC 1P4IH 1KG0A 3M1BA 4NQCB 5GS0L 2ZOLB 3K80A 2DTSA 4NWTH 2P5WD 4LKXB 1BQHG 3NCMA 4MNGE 4Z76A 1S9VA 2DKSA 4JM4H 2IF7A 1D5XA 5L6YH 5IMMB 4G7YH 1WBZB 1FCGA 5EN2B 3V8OA 5EC2A 1WIOA 4F9LA 4PJDE 1J8HD 3VWJC 3NAAL 1AGFA 4JPIA 4KKBC 3MLYH 3S34H 4IRSB 4JG1L 5F7DA 5CAYB 3F7VB 4UB0H 3RNKA 2FWOA 3ZE0F 4JDVA 1NMBH 4XNZB 4ZSOA 3OL2A 5CD3B 4RMQA 43C9A 3VI4E 1S9XB 1NLBH 5ICYA 4DUXA 4JFDE 3OQ3B 1IJ9A 3QQNA 1IKFL 4OCWH 1OP5H 1AP2B 4Y5YC 4JHAL 4APQD 5C71A 4KQ3L 2HMID 1AGCB 1RVFH 2NMSA 1A4JA 1D6VL 5JZ7C 1AJ7L 1VEPA 2JJUA 4DFHA 3UO1H 4RFOH 3VD9A 4JDTL 4L3EA 3MRPA 4WEBH 3VXUE 3D0VB 3ZTNH 2B7DT 2VLRA 2GCYA 2QV2A 5LCVH 5KTEH 4DGYH 4ZPTB 1S7XA 3PDOB 1RI8A 3IFPB 1MLBB 4LDOB 3GMOB 4M6AA 1LNUB 1NCWH 3GMPB 2AJVL 3NN8A 3IJYB 1AHWB 4XBEL 1MHPH 4AQ1B 4CN4A 4TUOB 2P47B 5IW6A 5F72S 1FYTD 3WN5B 1CFQB 1FPTH 1F8TL 1ZAGA 3OSKA 1NMBL 5D6DC 4WHTB 1QPXA 2E6PA 4TNVF 2A6IA 4LU5L 5K9KB 4KK8D 1V7MH 4GKNB 2DL9A 4CNIA 5HHOD 3MREA 4QOKB 5DQ9A 1B4RA 3KG5A 1FO0A 3O3BB 2VDRL 3MV7D 3HG1A 4PJ8C 1ADQA 3MBEB 1EGJA 1CD9B 1AGFB 3LEXA 4JPIB 2VQ1B 3A0OA 1JYVA 4XNUL 5CWSA 1HINH 4WWKB 3MO1B 4JFXB 3U1SH 4Y89A 5DZNA 5EIVA 6FABL 5KSUA 4PJGF 4WI9A 4L8BA 1BZ9A 5AUMB 3E6HA 1D6EA 1BD2E 1NAKH 4KU1A 3UPRA 5HHQA 1MUJB 4NN5C 3PWVA 4X5XB 3QDGE 4XNMA 2X4PA 4OIIH 5I8CA 1PYWA 3QIUC 5B21A 3Q5OA 4NUJA 1MCOL 4RMUA 3BIKB 4JJ5B 3RDTB 1R3HB 2W65B 4MZ2A 2F19H 5DWUL 5IF0A 1H3WM 1YNLH 2FX9H 4AIXA 4KRLB 5SX5K 4OLYL 1NMCB 4Z7OE 2DJ4A 4JRWA 4U1JB 3L95B 1DQTA 1P7QD 3EDKA 1N2RA 3QUYC 4F8QA 4P9MH 2JLLA 4P3DA 4HUUB 1YN7B 1A6AB 1UQSB 1SEQL 4WGWB 4LOUC 2Q7YB 3BDXA 4LF3B 3BP7B 2BDNH 4S1QL 3F12A 4HSQA 3RKPA 3OKDA 5FECB 2FEEL 1NC2B 2F5AL 3C5JB 1VPOL 1PBYA 3LIZH 1TNMA 3H9SE 5BOPA 1FZOB 4QT5A 1F90L 5J6HA 4K9EL 1OLLA 2EYSA 5FO7A 3IKCB 2BHUA 2NZ9D 1QD0A 3KPRD 2JJSA 1R3KB 3NGBB 2YA2A 1SM3L 3GI8L 3NVQA 1QVOA 3MO1A 3I6GA 2YPLA 3PGDA 1T4KA 4CMMA 4U3CA 5E2TL 5DD1H 4DVBB 2YPLE 3EYOB 1OAUL 2CDFB 1J05B 4DW2H 2VE6B 1NKRA 5C0CD 3MOBH 3FONB 4I2XE 4NFBA 4CDHA 2ZOLA 2AXHA 4UQ2A 3OXSA 2EYTB 1CR9H 1RFDL 2IMNA 4XBGB 3BIAX 1AD9B 5FV1L 5IFJB 5J3HC 4HWZA 3ARXA 4TULL 1K3IA 4LPVA 1NBYB 1JPTH 3T04D 3ULUF 1GGBH 2W65A 4L3EE 1CK0L 1ND0A 4RX4A 3TA3D 4QTIL 4ZS7H 3EOBB 4JVUA 1Y0LA 1NCDH 5DVMA 3UPCA 1JPFB 1PG7X 1TCMA 4OZHE 3SKJL 2VLJA 2YRLA 2OJZL 1CE6B 2V2XB 4OCXH 5GRWA 5C0GA 3MOBL 2HN7A 1GGUA 3DV6A 5CGTA 3B2UC 4O2CB 3RUGB 4E5XA 4M7LL 5CGYC 1HH9B 3V6BR 3S36L 3ARFA 1U8PA 1IGYA 3OZ9L 3QNZA 3OAUL 2BNRA 5IESL 3VFGL 3HPJA 3HC3L 4LEXH 3B9KD 3V0WH 4F8TA 3J8F7 2VLLA 1YEDA 4X7TB 3ZHDA 1HH6B 2HVKB 2UV3A 3UC0H 1JK8A 4FNLL 3UYRL 2Z92A 3ROLB 3VH8G 1BD2D 3G5VA 4PG2A 1RIUL 4MNGA 1A1OA 3BGAA 5DLML 1J05A 4MA1C 3GMMB 4JPVL 4PP2B 5E70A 5J4MA 5A16A 4WUKH 3RWDA 1TQBB 3MJ7A 4NCC1 1QKZH 4HKXA 4KQ4H 4HGWB 1ZT1B 5ESQA 4KTDH 2LAGB 4CNIB 4LCYA 1SVCP 4M4PA 2OMNA 4GMTH 1YEHH 1KN4H 1FZMB 4MQ7A 4XP6H 2CK0H 2HT4C 1R5IA 1A6VL 3VFMB 4OM0L 3TZVB 2HT3D 4NQDA 2WAHA 3MV7E 1GZPA 5EBMA 5JDSB 3QXAA 5J12C 2DL2A 2AEWA 2XOTA 3O4LE 4MJIE 3RVWD 1GRWA 3KXFE 1U3HB 4A6YH 4I9WE 1AY1L 1P6AB 5C0EA 4HUKB 1A1MB 3U7WL 4JB9H 1JGLH 3C6LC 3TYFB 2P5ED 1LK2B 5BS0B 2AV7A 3V4UH 4MS8D 1FNEA 1LO0L 4TPRH 4DUVA 3MRBB 3RI5F 4RNRB 1CE6A 5C0GB 1V3KA 4ISVA 3DMMA 2R39A 2VZSA 1AR1D 4B0MM 5EU4A 1GVIA 1ETZA 1KEMH 4KI5E 4P2CG 3HFML 2MFNA 4J3VA 3V5DA 3R8QA 1CGXA 5BZDA 3QXVA 3QRGL 1U36A 1MJ8H 2VSDA 4P9HL 2HJKA 1YY9D 3DUSA 4K55A 3LRHA 2DLEA 3ELAT 4P2RA 5EU7C 4ZXBB 1IC4L 4FQJH 2DQCH 2JJTC 3S7GA 1UZ8A 4KKAD 2IQ9L 3CVHH 1LEGB 5CGYD 4EUPG 4D94A 5FAAA 3S36H 4U0RB 2IALB 4HIHA 3CLEL 1N4XH 4R7DA 1HSAB 1LO3H 4GW4B 4TVSa 1HKFA 2GAZB 3SDXA 3ROLA 3MJ9L 3WDHA 5ADPL 2VSCA 2AI0L 3GJFB 3V4UL 4C54A 3BUYA 1I9JH 2J4WH 2ED8A 2NLJA 4P59H 4PRHE 3RVTD 3U7WH 4DN4L 2J1KA 3DTXA 2VDRH 2X4TA 5A3IC 3O9WC 1H3PH 1GZQA 1A3LH 1N6VA 1U95B 3TF7C 2DYPA 4MJ5B 5ICXA 2RFXB 3L9RB 5D2LB 5GGTL 3BGFB 3QZWB 5DDHA 4U1KA 4PY7A 3B43A 1B0RA 2EYSB 4G5ZL 5SWQB 3QIUD 4G43B 1CVSC 2DQIL 3V6ZA 3OKYA 1BIIA 8CGTA 1CU4L 1MNUL 4HWEL 2EDFA 2BY1A 2QKIB 2RAMA 1QVOB 1BLNA 3HRZB 4OFVA 3QHFL 1H3VA 1GC1C 4X6BB 1T1ZB 3TYFA 5ADOL 4L5FH 3RL2B 2E7LC 3RTQD 4P49A 1IKFH 4BFIA 2V2TB 1MFBH 2XA3A 2Q86A 3H9SD 4YPJA 5KVEL 4NFDA 5DZOA 3WUWA 2VLKA 4JGMA 4FFVC 4Y2DB 4C83A 4U4BA 1TMCB 2Z4QB 4NRYB 2ICES 5JHLL 3HCVA 2NNAB 2DTML 4GRLD 2A9ML 5C0NC 4PJ8B 2BC4B 2FBJL 2F53B 2DI7A 1L0QA 1YEFL 4ZAKC 1WZMA 4OZFA 1NBVL 3KYNB 1FDLH 1QR1A 3LSOB 4O5LL 4KJYB 1KB5H 4L1HA 4C55A 2D2OA 3F8UB 2J8UE 3C5ZD 1Y0LB 1ZHLB 4PTTB 3T3PE 1MLCB 4QHLB 4GT7A 1P69B 1KLUB 3KPSB 4AZ8A 2D03L 1IVLA 5DFVC 3BUYB 2OTPA 4UI2A 3SGJC 4G6ML 3PDOA 4PG2C 2X4TB 2R23B 1J5OL 4PY8I 1UB5A 1KPRA 1OAXL 1S7QA 4Z7OF 2AXFA 1HOCA 3W39A 1ORSA 4B53A 3MC0A 4YO0A 1IGTA 3KXFB 3QUMA 4FS0A 3MOAH 3RWFB 4TUJA 3F62A 4TSAL 5BRZA 4Z8FH 3TLRA 2HRLA 4GMSL 4NSKB 4NGHH 2K3TA 3U4EB 1CFVL 4N8VG 1ZK9A 3SBWA 1A9BB 1NAMH 3LKPB 3RWCA 2X2YA 5JOFB 2QADB 1G9MC 1AXTH 4XAWH 5HYFA 4G8IA 3ARFC 5ESVB 4Z77B 4G80B 1NUFA 4ELMF 2VAJA 3P4NA 3RVUD 1J11A 1MEXH 1DVFA 5T3ZE 2ZCKH 5EUKB 4NZTH 1CXLA 3GJFK 5IVXB 5A3ID 1MHPL 5EIIB 3PV7A 1JZ2A 5BXFB 3S37X 3IXAB 3QRFM 2OTWA 1UM6H 4JLRA 5JXEC 1WTGT 1EO8L 5KSUB 3L5WB 4H88H 1DDHB 1LP9A 2LTQC 3DUUB 5ELIA 4OKVB 4RISH 4WCYL 4ELMB 4UINL 4HK0A 3E8UL 5GJTH 2BY0A 5HPMB 3TBTA 1TZIA 3S3JA 2FZ3A 4D0CA 4TUKL 4UNTA 1MFCH 1B9ZA 4WFGD 1YN6A 3CCHB 4CW1A 3FQTB 4L4VE 5CEZE 2E5EA 5ERWB 1MFDH 2I9TA 4YNYB 4I18A 2BY3A 5L9DL 3DHMA 4HW6A 5E99H 3FO9A 4PRDA 2JF1A 3T0EA 1BQLL 1IEBB 2XKNA 4URTB 4CL7A 3O6FA 3MRBA 4P9ML 1T7YA 3VFRB 4NZRL 3HNTH 5CSGA 2LU4A 4PIRF 4FXGA 2GITB 5INDA 1AR1C 3SHSA 3RGVC 1U8QB 4M6OL 2DI9A 2DQTH 2UUDK 4LCIL 3W0WB 3IDGA 2EDQA 4Q9BA 2OI9C 1OM3H 5DJ6A 5SX4H 5ANMA 4XNYH 1QQDB 1KCUH 4M9PA 3P9LA 3TO2B 1A2YA 3AY4C 1KC5H 4G7YL 4PJHE 1MCJA 5KOVC 4HMDA 4WI7A 1WZLA 2R2BB 4UBDD 4PS4L 2VXSL 4PB9H 4RMRA 4Z0BH 5K59F 1I7UA 3IJSB 3ARTA 3U6RA 4S0TD 1OAXH 1JHKH 1P4IL 3H8NA 3FO1B 4EN3C 1NAML 1RZJC 3OWEA 4K94H 4L9LB 4LCWB 1WBXB 4Y7MA 4WO4C 1KFAL 3U2SB 4L4VD 4XB7A 1RZFL 1K4DA 2HFEA 2BFVH 2EXYD 3L5WA 3MV01 4WFHD 1DDHA 4R90L 5C09B 3K4AA 3C87A 4N0RA 4X83A 1R3IL 2OK0H 4YHKL 5FGRA 5SWQA 2X6MA 3IDIA 1DQDL 4QRPD 4M4RA 1BMGA 1L7IH 5HHPB 4C56E 4R0LA 3F7YA 1U92A 3X12B 2NX5E 3GJFH 2XY2A 1M4KA 4KKNA 4TNWK 3NZ8A 5IVNA 5IVZA 4NKQB 1U91B 1KEML 4M8QB 2VC2L 1DE4B 3QDJB 2HH0H 2X4RA 3EOTL 5F1OB 5CBAB 3TVMA 3O6FB 2H8PA 4BSVA 3C9NB 5DRXB 5IROA 5D7LD 5AYUL 3ARQA 4WWID 4Y4FD 2GJJA 4Y0GA 3P30H 1SBSH 5I1EH 1NSNL 3KPNB 2G2RB 4YR6A 4XPAH 1EEZA 5ECJE 3DGCR 3KPRE 3CX5J 4K8RH 3RWIA 1PY9A 1UB6B 4GAGL 3IDXH 4PJ8A 3DV6B 2IPTL 4ODTL 1A6VH 2DLFL 4J3UA 4OI8A 1H5BC 4E0RB 1YEHL 1NEZG 4JFHE 1KCRL 4FFYL 2WUBL 3QDGB 5F6HJ 1UC6A 3MXWH 1GC1L 3REWB 4LLMB 4E41E 1EEUA 1G6RH 4OD2A 2Y6SD 5IBTL 4U6TA 3GFUA 1HNFA 2XWTA 1BIHA 1U8LB 4K8RC 1C5DB 3RL1B 1MCPH 2ARJB 4UTAH 4J3OC 2ZJSH 3BESR 5B39B 1V5JA 5LWYH 3CLEH 3CFBA 2W59A 4Y5XA 1ZA6A 1WWCA 5LGJA 4KKLC 3VW3L 2N4IA 2YUXA 2EXWD 2WBJC 4WJ5B 3OKNB 4YXLH 3HC4H 2EE9A 3F58L 2XT1B 1E4XH 4XHQA 5E8OA 4XBPB 4P2QA 1IBGH 4NHCH 3QJHB 3X3GL 2YBRB 5DC4B 1WQVT 3D3VD 4Y2DC 5DTFB 5C9JA 4G8GE 1INEH 4X9FA 5KAQG 1YMHA 3G6JB 5F9WB 1VGEL 4DN3H 3O8XB 2CSPA 4X9IA 5D5MF 3TFKC 4JFPB 1LEIB 5D1ZB 4O2EA 5HGHA 5BS0A 1WZKA 2Q6WA 3T2NH 1JWUA 3TN0A 3TBTB 2F53E 3GMRA 3VFUB 2DD8L 5C7XH 3HPLA 3RAJH 1IKNA 2DLHA 2NZIA 2EC9U 2I9TB 2EDBA 2R4SL 1PQZB 4H20H 3SGEI 3UTOA 3RA7L 4UAOC 3WXVH 2M2DA 1OP5K 4EN3B 4PRIE 1U41A 5DD3L 1A02N 4DGIH 4L9LC 3TFKD 1R3JB 2EEAA 1FG2B 3HE6C 3HI6H 4YC2C 1ZXQA 5DWUH 5F1NA 5FCUL 1LNUA 3GMPA 4ZUSB 2GY5A 5DD6B 4FFZH 2ZSWB 1J8KA 3M45A 5DURB 4MAUH 2VUYA 1LD9A 3GBNH 4HS6B 3MJ9A 3F5WA 1LE9B 1BX2A 1HHIB 2F54B 4RRPG 5E5RB 5CSZB 5E0QA 3WO3B 3W2DH 3HG1E 4FZEL 5GGSA 4DKEH 4KJQC 4QRPB 4GKNA 2K7PA 1QRNA 2DYPB 3OG4B 3QZWG 1IEAB 4Y4KD 3BIBX 1MRFH 1KIUA 4WDIB 5TPWL 5E7BA 4G9FA 1KELH 5BOZG 1A47A 5HJ3A 3N85H 3IFLH 2AJUL 2W9DL 1EGJL 3RA7H 2CLZA 2EDDA 4GO6B 2YN3A 1NCDL 3TO4C 5JORA 5IHLB 3QJFB 1DLHA 3QUXA 4X6DB 1U3JA 2C4FU 4JDZB 4RZCB 5MHSE 2ZJSL 2D7TL 2H9GA 2E8ZA 3T3PF 3CSYA 2OX5A 3DWTA 1TENA 2VDOH 5C0IB 2IH1A 1MI5A 5FOBA 3RY5A 3DO3A 3RDTA 1R3HA 4YBLB 3RVWC 4YEEA 4POZD 3FO0L 2SEBA 5DD5H 4HLZH 4PP1C 1RZGA 3SQBA 4NN6B 1F02I 5C0FB 5B8CC 2R1YA 1REIA 3FOLB 2HJFB 1QFWH 3KPNA 3HC0B 5F9OH 3HE6A 4PJBA 2IG2L 1OAZH 1F4WH 3FQUA 3RY6A 3IRZA 4NKMB 3CZJA 4X6CF 2PO6B 3BP7A 2WZPD 3FB7B 3WNMA 1GXEA 1EAJA 2NY0B 1EHLL 5BQ7B 2CRMA 1D9KC 3AU1A 2WINB 4NZRH 3N50A 2YPKB 2MOVA 2CIIA 3ARZA 1RHHA 3OHXB 5CJ8A 1ED3B 4UT9H 1FLTX 4NBXB 1FLRL 4NO0B 4CVZB 1KYOK 3AS0A 4OUOA 4O4YL 2XZAL 2HFGH 3IGAB 1I1RA 3DPBA 3MLWH 4F7CB 4LSQH 2DIAA 3VCLA 4G8FB 3VDCA 3RP1A 4LARH 1FGVL 5C3LD 2H2PC 2J88L 4HH9B 4G6FB 1EXUB 3MOQA 3CAFA 4G8GD 5H37H 4MDIA 2F19L 2ZPKL 3MRJA 1J1OL 4HAGA 2EDTA 3WLWC 4ZOAA 1NC4D 4PJ5D 3GB7B 4HF5H 3KAAA 3B2UD 4Y8DC 1OGAE 1N5YH 4JDVB 5KSAB 3U4BL 5I8EA 4Y5VB 5JW4N 3MLXH 5J57B 5DD0L 3QQ4A 1A6PA 3H0TA 5DJ8B 2XTJB 5KSBF 2YD5A 4P2QB 5EWIH 5I9QC 1QTYT 1JHKL 5HPMA 2Z91B 5E1AB 3R1GL 4RRPA 2YD8A 3QEHA 4PLJD 4PJGE 1YEJL 2YPLD 5I1IL 2OP4L 4U1HA 5KVDH 3HUJA 3U36A 4OLXL 3OJDA 3M8OH 4YHKH 2VDNH 3LAFA 1OGTB 5CBEB 3BZ4B 2KKQA 5J3HD 3PABA 4QRTB 3TJEL 1DUYB 2B2XH 4PJ5B 3C8HA 3OGOE 2HN7B 3GHBH 1UZ6E 4Z5RB 5L2KD 4LLDA 3VXPB 1IT9L 4A2MA 1RZFH 5E03A 4EDXA 3EYFA 2PETA 4D3CH 1E4KA 1KTLA 4PUBH 5IW6B 3O9WA 1ED3A 1H5BA 3UTZA 4WFED 2NY3D 5EBLA 4K7PH 2CKBB 1CDHA 2YMXH 5F6IB 4MHHI 5FYKH 1BFSA 1A0QH 2VWEE 2D7QA 3HMWH 1NDMA 1Q9LA 4PYHA 4EEEA 2DRUA 2ED7A 1MJUH 4ZXBD 5I71B 5CILL 4K3DH 1RZKH 4EBQH 3RIFK 1NFDA 5ISZD 3PP3K 3HG1B 5TDPA 4A6YA 5DRZA 1TJHH 3MBXH 2F54A 4WTWA 5D9SA 1K2DA 4JVPA 3TEUA 5DEFB 1H3GA 5HYJB 3QULA 2OTUA 1F4YL 3HHRB 3QUKA 3OPZL 4FQPA 4OI9A 1GIGH 1D5IL 3B9KA 4QRPE 3ZL4H 4KI1A 3WSQH 4PJEA 1KB9K 2EH7L 4XP1H 4OBSA 4Q6YA 4O2FB 4PREA 1CGYA 1QSFB 3LZFH 2P8LA 4G6AD 3S5LB 4Q9CA 4KK5C 3NCYS 2YRPA 4GRMA 3ULSA 1IC1A 3UZVB 1CFVH 4J4PC 2EC9T 1QO3B 3ORJA 3BH9B 4RAVA 1GOHA 3GO1L 3FQNB 1DL7L 3DV4A 1XGQB 3L7EB 3PNWB 4MA7L 4X80L 1F11B 1OY3B 2RHEA 1IGIL 1QSEB 3ES6B 2WBJB 4I4WB 1A8JH 1T5WA 5HHVH 1M7DB 2IBZX 1UFUA 1BECA 3JV4A 1NL0H 3QDMD 3WKMH 5C0IA 4LNRB 1OAKH 4E9LA 1JGUL 4OFYA 1UB6A 1BD2B 1NGWB 1WIUA 4MAYB 1BFVL 1Y6MR 1IC5L 5HVGB 1J1PH 5FKPA 5F71A 1YECL 4ACPA 4KK9C 4P9HC 1ULVA 1TVHA 1NDMB 2ZOKA 1IAIH 4D0DA 4U6YB 3TGXA 3X13B 3I6KB 3P77A 2H45A 1WIPA 3SJVA 3SN6N 1ERNA 4HLJA 3G6JE 4QEGA 3LPFA 4PB0L 1CFSB 2FSEA 4KKCD 3MUHL 5FB8B 3M8OL 2YA0A 3LD8C 4J6RL 5D1XB 4AEHH 1OWRM 5AYQA 2P43B 3O2DL 5DJXB 1U95A 2DKMA 1U2HA 3BGMA 3P40A 5DRNA 1XGPA 2PO6C 3QP3A 5T1MB 3ZZ1A 1D5BB 5GRVK 1TVBB 1FNGA 3EGSB 5D5MB 1KTDB 3GMQB 3OKLA 1L0YA 2YHGA 5HY9B 1C16B 3MNWB 1A7RL 2GSIA 5HHMD 1KSRA 2P8LB 1WISA 3LDBB 3S5LA 2I26N 2Y06L 4TTGA 3RU8L 3GHBL 3TZVC 5MEOA 5ILTH 2NY6D 5CP3H 5E8OB 3VDAA 1BF8A 3HAEG 5C0CE 5ID0A 4YHIB 4E41B 4YK4C 1ES0B 4IRJA 2R2HB 3O45B 3TT3L 1F11A 1UACL 3EKCA 1CDUA 5E8EB 1OTSD 4QGTA 1BFOB 3ZT6A 3GGWA 1PD6A 4JANA 5ID1B 1DVFC 4QRUA 5F9JB 2MCPL 2BSRB 2KH2B 4K3GA 5A2JH 2Z4QA 5DJYA 2OZ4L 1G7PA 5D4QA 3UJIH 2A6JB 4JAMA 2DLGA 4K3JL 1A6TB 3CLFH 2G75B 2YUWA 3WJJC 5KSBE 3QEHB 5F6IC 3DVNA 2C4FT 3CMOH 4PRAA 3WDJA 3H9HA 2XXCB 3WYRA 3KPRB 1N4XL 3H42H 1UJ3C 5CEXA 5H35A 2BP3A 1QFWL 4N1CA 3GJEB 3AVEA 5ITFA 3HPJB 3BMWA 2EXYC 5CJXA 3ARGB 1IM3A 1RZKC 1ZWIB 5GGRB 5IOPB 2BZDA 1HHKB 4R8WL 3QDJE 1M71A 4M7LH 5C09E 5AZEH 4JQIH 1UKQA 1H0DB 2QADC 3I50H 2HFGL 3A67H 3KYOA 1F6LL 5GIRB 4C56B 4F7EA 4YO0B 3S98A 4NBZB 4XWGL 4I0PD 3EGSA 3CH1A 4TUJB 5D5MA 5BRZB 3AAZB 4LCWE 1OAQH 5A2LH 1RK0B 4M9OA 3GSXA 1JF1B 4L4TE 2EKJA 4S1RL 5E4IA 2AI0H 3WV0A 1CK0H 4XPHL 2E7CA 1VSCA 2ZKHH 3GIZL 4J4PA 1AI1H 1MHHB 1LO3L 1JPTL 3PWNB 4NHUB 2D7TH 3OKKA 3DGGA 1J0ZA 1PLGL 2A74A 4U7KA 4L4JA 1ZSDA 1EK3A 3WHE0 4IRSA 1WITA 1C7TA 1ITCA 3GRWL 1AO7E 2OTUB 1MCHA 4NNYA 1FJ1A 1S9KC 4FFWC 4MA3B 1SYSB 1F2XK 5J13B 3Q2CA 3MJ8B 4FQLL 4PJHB 4X4YB 3O0RH 3DSFH 4WWKD 5DS8A 5T5FH 4Y19A 5FYKU 4F3FB 1QFWM 1MWAA 4Z95H 4N90D 4GAYA 4DK3A 3PWPD 3G08A 1S8DB 2XRAH 3W0WE 1J1OH 1A1NA 2P7TA 2VWEC 4O00A 4HIEB 4PRHD 2AK1H 2H1PH 3PNWA 1L6XA 4Z7WA 3GSVA 4XRCA 3QEQA 5ALCL 5F96L 1YEGL 3VFOB 1FCCA 4NJ9H 1NGYB 3TH3T 4AT6B 5KS9F 1L9MA 3HC0A 3V8CA 4L4VB 3DBXB 4KQ4L 4PJBB 5C08B 4F7EB 3JTTB 1W72A 3QQ9D 4G6JL 1CICB 1DLFL 1W0VB 1BBDH 4ELME 2A6IB 3DX6B 3PIQA 3NA9L 1FL3B 4Q2ZB 1MJJB 3LN5A 1G9MH 1GGBL 3LEYH 2Q76A 3UTTB 2DIBA 3X3FH 5EFIB 1WT5C 4FFZL 3UTSA 1OD7A 2AJSH 3GIVB 4JO4L 4X5WA 1VENA 3MGOB 5IVXE 5C3TA 1KCSL 2FSEB 2X42A 3O4OB 1AQDB 1DSFL 5CWSB 5DA0B 2Q8BL 2XN9D 3U9PH 1GGIL 3IDMA 5CJOL 3ZYOA 2F74B 2NXYB 1ZHNB 5GS2D 3DVIA 3O4LD 3PWUA 1OTTD 1AKJA 1IFHL 2VLMD 3WFHA 1RZJL 2W0KA 3E3QE 1WTLA 1KENL 4TSCH 2G5BB 1JWMB 2V7NA 4DEPB 1HI6A 3CDYA 4HX1B 4F9PC 5HHNA 3RZWA 3UPRB 1MWAB 5D8JL 2XXMB 3L3JA 3Q1SL 1YA5A 2J8UB 5E94B 5TH2B 1P4LA 3EDJA 2BC4A 5ID0B 1FV1B 5EU5B 2AGJL 3JWNC 4G7VH 4HFUH 2N7AA 1EAPA 3UYOD 1KIPB 4QRUB 5F9JA 3OJDB 1ACYH 1ODAA 1CGSH 1KGCE 2G2RA 5TDNA 2IANE 4R4NC 3KPSA 1RZIB 1WWWX 1MCRA 3LH2L 4IOIB 2BVTA 4PJIE 3REVA 3GSOB 3MRNA 1JHLH 1BFVH 2I25N 4NO0D 3MLUH 2I60L 1FE8L 3NPSB 4M7JH 5ICZB 4APQB 4PRAB 4WUUD 4JPWH 1OAUH 2XA8H 4GKZB 4OGYH 2W0PA 3H7LA 4JGJA 4Y2OA 2Q87A 4RMSA 2MCPH 2A83B 3ZKNC 2OYPA 3GUTB 2VDPL 1DTUA 2GKIA 4HXAL 3GHEH 2G9HB 1QSFE 3FO2B 3BDBA 4GW5A 1U58A 4KVCL 5DQJB 3GSNL 4NQVA 5HSFA 2R15A 5JOFA 1CDJA 2ZG1A 5I15H 2EKSB 4JREB 4KDVA 3BPOC 1KJ3H 2GHWB 1N59B 1T1YB 5LJYH 3MLZH 4G6AC 4NQUA 5D2LE 3BWAA 4OFKA 5CINL 5BZWA 1BOGB 3RGVA 1TPXB 5HYJE 1NEZB 3MRKB 1QBAA 1K3ZA 2I5YH 4LLAA 3WJJA 4PBVC 1OARL 3NCFB 5EU7E 5F89A 3VFTB 3WIFA 1T7ZA 5E2VL 3MRRB 3W11D 5JDJA 4L8DA 1S5IH 4YHMH 4LFHG 5A40E 1MHHA 5GPRA 1IL1A 2HVJB 4R90H 5L88H 3GSNB 2J6EL 4DAGL 1WCBA 2H3NB 5F1IB 5DK2B 1U8IA 2EDXA 3IT8D 1RZKL 4EBQL 4L29B 2XZQL 3CCHA 4UIMA 1QFUH 2VDML 1KIPA 2IANB 4R9HA 3BYYA 2H32H 3BW9A 3MLSH 3SDXF 4ZFFA 2F58H 1QFWI 4MNQB 5MENE 2EYRA 3N06B 4AIZB 1X5HA 3BZDA 5HI4D 4ONHA 3U7YL 2BVEA 1T6VN 4ZOCA 4CN1A 1OQOA 5DS8B 3ES6A 2H6PB 4XVSH 4X4MA 3O3AB 4Y4KB 5F7HA 1UM4H 2DBLH 5INCB 4FQHB 1H9VA 3NFSH 1SHMA 1OP3K 3O11B 4TUOA 4F33B 3WN5A 3OGCB 1ZA3A 3WJLC 5F3HB 1Q94A 4G6KL 1EHXA 2BMKB 1A7PL 3G04A 4RAUB 1KFAH 1JYWA 2A6DA 1L7TL 3KLDA 1CVRA 5IT2L 5D96B 1PZ5B 4WW1A 1NLDL 2NXZD 2B5IB 3L3OA 1QRKA 2HLFC 3F65A 4X7SL 5ENWA 3HA0A 3CK0L 1MVUB 3O3BA 3O4LB 4IJ3C 1GC1H 1XGYH 3T2OA 5I1DA 4QKXB 3C6LD 3DNKA 1BX2B 2EEBA 3PXJA 3E8UH 5T3XL 4Q9QH 1P7QA 3CVHA 3ZTNL 5SV3A 5DRNB 4Y88A 3PGFL 3ET9F 5E4EB 3IU4H 4LMQE 4RGNC 5CJBA 3QCVL 1XGUB 4YE4H 5LBSH 1KTDA 3GMQA 2WP3T 1YQ2A 3MNZA 2ADJA 1V3MA 4AH2B 5IMKA 2EDYA 3IDIB 1T0MB 4KQ3H 4P46D 4F9PA 2X10A 3VXRA 3SDCC 1EMTH 1INQA 4JRXB 5J13C 1D6VH 4P5TD 5SWSD 1VEOA 1NLBL 4S0SD 1KF9B 1UWEH 1MH5A 5TE4H 3O8XC 1I85C 4JHWL 3I2CL 4WTZA 4RZCA 4LVOC 4OZHF 2QQQA 1VFOA 5I8OH 2H6PA 4XMLH 4Y4KA 1INDH 2X7LA 5JNYA 1YNTA 2E7LA 5F7LB 2P5EB 3GZKA 5I2IA 3LS5H 5DHYB 4Z18A 2HJKB 2A6JA 4M1GH 3ZDZE 5CFHA 4H88L 3PP4H 1GSMA 5JHDE 2ADFL 1PEWA 1FFQA 4OFPA 3DVNB 1PSKL 2R4RH 4Z7NF 4JO2L 2MKLC 3RZCC 4EQ3A 3BOVA 5SV4A 4PP1D 5EO1A 4YXKH 5K9OA 3W5MA 2YSSA 4OLXH 4QRRB 4J1UA 3HE6B 4L9DA 1YEJH 1FC1A 4YC2B 3B9EA 4HC1L 5DQDL 2D03H 3RBSA 5J1AA 3ZE1E 2VTFA 4IOSD 3EYQC 2UY6A 5JPMA 3D85B 4POYA 2OL3H 1VERA 2WSKA 3I2CH 2OBGA 4XAKE 1HZHL 1PG7H 1X3DA 1XF5A 4CMMB 1I3RB 3WKNA 1MI5D 1I8MB 3MLRL 1S9WB 2VLJD 3L7FB 1T04A 4PY8J 2XZQH 4L4TB 3EYSL 1ZLWH 4XNYL 5SX4I 3UROR 4LBEB 4I2XB 3QHZL 3GSXB 4JFFA 1T22A 1UADC 4JHZA 2NY2C 3CFJB 4AENA 4W4OC 4ZODA 1S7UA 1C1EL 4DEPC 3BWAB 1OL0A 2MTPA 3CMGA 2B8OT 1RZ7H 4R0LC 1CL7H 1KB5B 1JNLH 5DTFA 4HWEH 4B5EA 5TE6L 2OLDA 3VWJA 3G6JA 3OF6A 1JMZA 5IBUB 4EIZC 2YZ1A 5AG8A 3WIFB 3CK0H 3GSWA 1PKQA 4U6HA 3DRTA 3RNQB 4LARL 3S4SA 5DFVD 2GTWB 5LGHH 5CSBA 3E2HB 3TJHD 4AK1A 3EBAA 3ARDB 1K4CA 3KR3H 3GMRB 3VFPA 3BP6A 1AE6L 4PRIB 1NJ9A 2CIKA 4M7KH 4U1MA 4Z7WF 3QNYB 3D9AH 2CXGA 4X5LA 4X5XA 4FTVD 1MLCA 2AQ2A 4JY4B 4ODBD 4BQ6A 1ZMYA 4JZOA 5AD0A 4P46B 1DUYA 3QUYD 4PJ5A 3MGAA 3AS2A 4PGZA 4XRCB 1C5BH 1G7HB 5C0CB 3SO3C 2JJWA 1HH6A 2HVKA 2LE9A 4HV8A 4NO2A 3TIDA 4NP4L 3LRSA 1MRCL 2Y5TB 3KPMA 2AJSL 4JO4H 4P3DB 2BJML 4GJTB 3VXRE 3I84A 5J8OA 1IGTB 1LD9B 1UJ3A 5DSCB 3S88H 4KZEH 2W1NA 4IOFC 3BD5A 1T5XB 2CRZA 3JZ7A 4OI7A 1N8ZA 3MCKB 1I8LA 5IQ7L 1K6QH 4X98A 3VFSB 1SY6L 4N9GA 1S7TA 5ACZA 5I75C 4LCYB 5IGXL 1RUKH 3UTTA 4U1GC 4NQEA 1A21A 1CT8B 3EO0A 4XNZC 5KSVA 5DUPH 5IB2A 3Q5TA 1BGXH 2GTZA 5T5NG 5TFSH 2Z93B 4BH8B 5BXFA 3BPLB 3VI3F 3HS0B 3K4ZA 1I3GH 1BEYH 4QTHB 3I3EA 4YPGB 2AVGA 1MAJA 2V7HB 1ZLVH 2EXWC 4H25A 2JB5L 3BX7C 2DQCL 1NGQH 3LS4H 2CDFA 3ARUA 4LSVH 4OGXL 5I15L 3ETBF 4RNRA 4NCC2 3OAYK 5K59E 3Q3GB 2WIIA 1VA9A 1CYGA 3LB6C 3VXUB 2XZAH 3X3FL 4JREC 3CSYB 3FQTA 5H8DA 3GBLA 1F5WA 4BSWA 1SEBB 4MD4A 1RV6X 43CAB 3K7UA 4XPBL 5I1CL 2BOBA 5GGSY 1RIUH 3WDIA 2VR9A 2VLRB 3MLXL 2CO6B 2V17L 1M7IA 1AC0A 1E6JL 1Y18A 1IAIM 3C5SB 5BJTA 5EULV 1M7DA 4XX1E 4BUHA 4OFDA 5ESAB 3IDGB 3SEPA 3HC3H 5IMLB 4P5KA 4OLUH 3MRNB 5JZ7D 4MAYA 4NM8H 3VFGH 1AI1L 4GAGH 5FM5O 3MSPA 4X9BA 4TQEL 3LD8B 1X7QB 2GK0A 1XIWC 1NGZA 3ULUE 3OKMA 4QHKI 5GSVB 1Z3GL 5IB3A 1CG9B 5AG9A 1AO7A 3FQRA 4WW2C 3LKSB 1BM3H 2ADIA 3QFJD 2D4FA 2HT4D 5GZOD 2X4QB 1BFTA 1CGVA 1T2XA 3LEXB 4L9LA 2Z93A 4BH8A 5J11B 1EJ6A 2UUDH 4FQXA 2AP2A 3HZVA 2W0FA 3F58H 4OFYD 3QQ3B 4I0CC 2UY7A 4I48A 1PLGH 4LPTA 2VN4A 4PD4K 5I1KH 5I6XC 3THML 4LSPL 3LQAH 4YHNB 4XVTL 4NN5B 4OLUL 3Q3GA 4YHYB 4MGXA 5CHNB 1MAKA 3QIWC 5HHPA 2M26A 4PJ9D 1OAQL 4C83B 3IF1A 4EI6A 3X11A 3ZE2F 1FFNA 5IJKA 4R96A 1G6RA 3VXSA 3ULVE 3OX8B 5TDOA 3NA9H 1RAMA 2W9LA 4NUJB 5E9DA 1Z3GH 2NY0D 4XPGH 5D7IF 4PJ5E 3IFOA 2BSSB 2MHAA 3BD4A 3TNNB 5CIPB 4HULB 1F90H 3N0PB 4ODWB 5DJAA 4KROC 1DVFD 2F5BL 1P5VA 3MZTA 5CBEA 1JTTA 4MSWB 1B3JA 2I9LB 5F7UA 5IMLA 4HUUA 2ESVB 4BSJA 1XGRB 2E7MA 2DBJA 5FK9B 3NZHH 1GAFH 3NACH 4EVNB 3IDYC 3MXVL 4FMFA 1H15A 3OKDB 4Y5XC 5EU6A 1HYRC 3CC5B 1MFAH 4X6DF 3O6ML 2KPNA 3P30L 3NBNA 3TCXA 1EFQA 4LHUB 2VZ1A 1S78C 5B22A 1ZA3B 4LHQB 1T2JA 4JRXE 2OZ4H 4Y1AD 2X4QA 2EIZB 3D2UB 1PKOA 1F00I 4GXVL 3EOTH 1A6UL 1AIFA 2YRZA 4ZUVB 5K9JH 1H0DA 5ESVA 4LCCC 5I1GH 3EAKA 3K0WA 3T0ED 4R3SA 4YJZL 1FNHA 1FNLA 2IBZY 2NY1B 4XPFL 3C2SA 5D2NE 4F15C 3FONA 4N8PA 3L1OH 4DCQB 3QG7H 2XQYG 5JUEL 1C08B 1RPQA 1M1SA 1KJ2B 1R3LB 5DT1H 3B83A 4WJ5A 3KDMB 3RWEB 2BSTB 1WEJL 1G0YR 5HD8C 1JV5A 4HWZB 3B9KB 1A64A 1QYGL 1XF2B 4NQEB 4OKVA 3OKKB 4ELMA 3CDFA 5DR5H 3GK8H 4Y5YA 5CEZD 3V6ZB 1OCWL 4GW1A 1QSFA 3HZKA 5DHVA 1AGBA 2Z31D 1QUNA 4AMKL 3HS0A 4JFDD 1EO5A 5C0BA 4YPGA 4GRMB 3BPNB 4ZS6C 4Z78A 3NABL 3U4AA 2J3SA 3HUJF 4O2EB 2WW8A 3W11C 1JNHB 3QIUB 4XP5L 4PGDB 2A9NL 1FZJA 1AC6A 3G9VA 5BV7H 1I9EA 4X6FA 4P48A 1BZ9B 1P6FA 3P73B 3QIWA 4QXUH 4HFWA 5I1IH 3DYMA 1XIWB 2NCMA 3KPSE 5CJQL 3VWKD 4MNQE 4PV8A 4OCLC 1A1NB 4Z9KB 4NM4H 2VZ3A 2E9WA 3KPOB 2EDNA 4QRQA 4RMTA 4WO4A 3S35L 3U4BH 3KPQB 4P3CL 4Z7WB 4FQXC 5GS1A 4X6DE 1NFIA 1UVQB 5EO1B 5K9OB 4MWFA 1FNSH 4ZYKB 3U0PA 4KK6D 2IAMC 1FH5H 1KLUA 2CDEA 5EZLB 3MLVL 3TVMD 3MV8A 1MFCL 5JOPD 1F6AB 4ZAKD 5D71L 3OB8A 3CFCH 1GCFA 4ONOA 4GRLC 3GMMA 3ULVD 3I02B 3PWPA 3FAWA 1GYAA 1CBVH 2GJ6A 2GT9A 3HAEB 1N6UA 1UB5B 2YC1A 1FP5A 4PRID 4KK5D 5D6CB 2BVQA 4XGZB 3BDYL 3CDGB 3RPIB 4UV4L 2B20A 1UXWB 1H8NA 5D7IE 1PG7W 2O5YL 4X6CB 2BX5A 1NEUA 5IFAL 3TH2T 3QEQD 4JG1H 4Z7VB 4Z7UE 1HXYB 3LKQA 2VL4A 1SYVB 5I73B 1U6AL 1J12A 5E95B 5FO8A 5GISH 4HBQA 1UYWL 4HS8H 1EVUA 1KIRB 4NFCA 1FNSL 1NUDA 1A7PH 1Q0XL 5D70L 4I18C 2XNAB 2EIDA 1T66C 3TESA 3T0BA 1IAOA 1HK6A 4Q9RL 4OJFH 2H8PB 1J18A 5E08L 1T3FA 3U30C 1I8KB 3KYKH 1VACB 1T0NB 3TBSA 4LLUA 4XHJD 5FYKD 5DFTA 3GSWB 3SE3A 4YHYC 1Z0NA 4NDMB 4J3XA 3PE9A 1NCCL 4XNXL 1CDIA 4OAWB 1CL7I 4CKVX 3RVTC 2GEEA 1XCQA 1FV1A 3ARDA 3BT2H 3MLTB 2JJSC 5DXWA 3GK8L 1FFOA 4DAGH 4WU5A 1VFUA 4JPKL 2V5TA 2E9JA 4XX1G 4K23H 3GI9L 3TNNA 4PUBL 4GH7B 1JPST 3D85D 4JM2F 2NW2B 1UCTA 3NAAH 2A77H 4LCCB 1EFXB 1OP9A 1RJLB 3KPTA 5JLZB 3BFOA 3GJFA 3NPZB 4N5ED 5ITBL 3MRMA 4M1GL 2BFVL 4JHBA 2P48B 1IC4H 5TF1L 4FXGB 1VFBB 3IU4L 2B2XL 4M61B 5CP7A 4E41D 2W9EH 3WIHA 1RUQH 1GZQB 3STZB 5I0ZA 3KYOB 2Y5TA 1TZHB 3U7YH 4PJEF 5GGUB 4M1DL 1KBGL 3BKJH 4AIOA 3P9LB 1ZLSH 3GM0A 4GW5B 4UNVA 4WHTA 1CGWA 1BIIB 1Z9SA 1JF1A 5ACLA 1LILA 4PS4H 2DTMH 4KJPC 5EORH 3TN0C 2QBWA 2Z9TA 3UTTE 2ITDA 4ZTPH 5T3ZL 3S97C 2Z92B 1HHGA 1Z9LA 2XA8L 4LVHC 2LU7A 2ZG3A 1UCBL 1N64L 1OSZB 5HDLA 3DHJA 1OD9A 2V9RA 5AAWA 2DAVA 3EO9L 1YY8A 3RWDB 4FQ2L 5JIKA 4PLJC 2NY4C 4YDIH 4DCQA 4LLUB 3AREA 4Y2DA 4GRWE 4JFPA 3MV8E 2BCKB 1CZ8H 1GGCH 1QNZL 4LP4A 3I75B 5DUBB 2UWEE 2X05A 2J8OA 4MQ7B 3MMEA 1JHLL 3QDGD 4GQPH 5CEYA 4QXGL 2XPGA 5HDQL 1Q72L 4GOSA 1FFOB 1A14L 4ZFOB 1NBZB 1W72H 1S8DA 2COQA 3Q1SH 4QHLA 5GHWL 1PQZA 4MNQA 3NFPA 3GKWL 3DLQR 2VH5H 4UT6L 3HMWL 2E7BA 4ZUWA 1QLFA 2C3VB 4XVJH 3V5HA 3EFFB 1KENH 1X44A 5E6IA 3QIWB 2V5YA 4PD4J 3T08A 3CFEA 4I5BA 1KPRB 2BOCA 2ZNWA 5MHSD 3ARYA 1RURH 2B5IC 3WXWH 2ZCLH 2FIKA 4Q0XL 5DD5L 3OGCA 1TETL 5EBLB 3SCMD 5EOTA 5F97E 4Q6IA 5HYSG 3QFJB 2D0GA 12E8H 3HNVL 5ISZB 3V6FB 3CFIC 4QCIB 4HJGB 3ZE1F 2ATKA 4HFUL 4NOBA 3BAEH 4WW1B 1WWAX 5GSVA 3WFCH 1JF6A 3LEVH 5IB3B 2BRRH 4Q6IC 2J6EH 4ZOEA 1XH3B 1MCBA 3P9WB 3RDTD 1XCTB 1BZQK 3PF2A 1WZ1H 2IPKB 4HH8A 2WMPA 1F3JA 1NCBL 2VITB 1YY8B 5HGGS 4LPWA 4NO5A 5IBTH 3TO4D 3HZVB 4NYLB 3P0VL 2P4AB 3FHQA 2XWTB 3TBVB 3MUZ1 2AABH 2CR6A 4MJ5A 2HA1A 4NUGL 5ICXB 5D2LA 1NCAH 3AMLA 1URLA 4JDZA 5JXAH 3TNMB 1B0RB 2ITCA 2X89D 5KANG 2V7NB 2WUBH 3BPNC 1O5DT 2MPAH 3ULUC 5E24E 5IW1B 4PREB 1CIDA 2ZUVA 3EJYC 4OUUB 4UQ2B 1ZE3C 3GSNH 4ERSL 5ALCH 3U9UA 1P1ZA 4R96B 4XPTL 3SDYL 3C6LA 3MACH 3UZQA 3FOMB 3NFPB 2H1PL 1FYHB 3MBED 3W0WD 2R2EA 2XKNB 4I13B 4KJWD 5IFHL 1G7QB 1LE5B 4CDGC 1YEIL 2BRRL 3MRDB 5DJ0A 4DGVL 3SDCA 1Z5LB 2EO9A 3MUGA 1CD1B 5D8JH 4OD1L 4P4KB 3IAGC 1LEIA 1DN2A 2FYYA 5MERB 5IJVB 2HKHH 4MSWA 3X17A 3D39E 4DGIL 3FFCA 3UJTL 1NC4A 3MRFB 4EQ2A 3NCBB 3MNVB 4I0PB 1HIMH 2RGSA 4P5TA 3T3ME 5HYQB 2JELH 1L7IL 2ZUTA 4LHUG 4WUUB 15C8H 1TVHB 4IRZL 5IGXH 1QFPA 2CMRL 4GRLB 4Y16C 3V7AG 4FZ8H 3T8XA 4MXWH 2YEZB 3SE8L 2X40A 3V95A 2J8UF 5A2FA 5CZXC 1T21A 3RTQC 2X44D 1W72L 3T0AA 4OIIL 3KPPA 5FDYA 3T2NL 4FOMA 5HBBA 2D7PA 4NYLA 4YHLH 3FT4A 4L1DA 3T0EC 4DJMA 5DEZA 1TFHA 1TZHA 4XC3L 4L4TA 2XWBB 1JN6B 4OCNC 4D9QE 3TNMA 1CLZH 3PWLA 4MJ6A 1KG0B 4YEFA 1JBJA 4JQVA 4U2ZA 4KZEL 1MHEB 1NFDE 6FABH 1R3LA 1RURL 1ZT1A 4HGWA 3CU1A 2KBGA 1EEYB 1FGNL 4BQ8A 4KV5E 4ONFH 1OW0C 3H0TB 5LXGH 2LTQB 2YXMA 3ZKXB 4UUJA 2A2QT 3SQOH 4I77L 3TZVA 4KRNA 1LMKA 1PZUB 4LCIH 5DK2A 1HCFX 1I4FA 3IETB 1JTOA 4YX2H 4U1HB 4HPOH 2VB5A 2XRAL 3MRGA 4MAUL 1E6OH 1MREL 5DLMH 1WV7T 1AD0A 1KIQB 3AREB 1ZS8A 4F7TB 3WUZA 4Z78B 1VADA 5H2BB 5IJVA 2AJXH 3LV3A 4ERSH 4P4KD 2PYEE 4R7NB 4W6WB 1JGVL 5DEGA 1IQWH 3SGDI 2PNDA 1FIGL 2Y23A 5KSBA 3SBWC 5F9WC 5FOJA 4K9EH 1J1XL 3IJHB 4OV6F 4U1MB 5J89A 4XT1C 4Y8AA 4B41A 4LEOA 2XACC 3U83A 5DJDA 4PYGA 4I18B 3DUSB 3RU8H 2V5RA 1R3IH 4K8RD 1FNFA 2Z8RA 3ECBB 1IMHC 4MS8C 1IM3B 1ZWIA 5HHME 4NNXA 2IALA 1CXFA 4K3HA 4YDJA 1DBAH 3TC9A 5JXAL 2IFFL 3L3HA 4N90E 5D7JB 4JEGB 4X8XA 3CFDB 2HH0L 3KPMB 1A6WL 3QO0B 3NH7L 5CUSL 1H3TA 3HI1B 5E8PA 1MIMH 4TOYL 1R5VB 1YNLL 2FX9L 1WFUA 4LLVA 1ZLSL 5FKAB 3I02A 1QFOA 2VC2H 5HYJA 1RIVH 2Q8AL 1MHCB 4O58H 4PJDB 4ZUUB 4RGND 1TXKA 4PJIF 4UBDC 2HKFL 3QUYA 3G6DH 4GBXD 2XQBL 2ZSVA 4NP4H 3RJDA 4XBPA 3T77A 3C09C 1A6ZA 4N0UE 3VW3H 4EOWL 1M7XA 1NFDF 3GNMH 1T20A 3OAUH 4NPYB 4PRHB 5ITBH 4RGMB 1A7RH 3SJVE 4HQQL 3RZCD 4OQTH 1INQB 3VFWB 4YBQC 4G6MH 2EZ0D 1ZOXA 1S7SA 4XH2B 5DJ2B 2VZOA 4V2BA 2AJZA 3QISA 3MV9A 2FEEI 1IGFL 2PYFA 2YPVL 4KDTA 2O93L 1QACA 1NCCH 5C09A 2PR4H 3MJ8A 4EUPA 4FXKA 1NMAH 1HE7A 1A9EA 2AK4A 3V6OC 1VACA 2I27N 4K3EH 5JQ6H 3B2VL 3VXQB 1U3ZA 5FXCH 5JIHA 1MUJA 4CGTA 3G08B 5LWYL 4ZFZB 5F7NC 4OGZA 4LVHB 1U91A 1NANI 3IB4A 5CMAB 3QXTA 3HLAA 1UYWH 5EZJB 4PJGB 1EO8H 2HRPL 2JIXD 3KYNA 5FKPB 1RFDH 3K8MA 4KC3B 5BS0E 3ZL4L 1F8TH 5FYJD 1GOGA 2XTJE 1T1XB 4M1CC 1RVFL 2HP4A 1D9KD 3O4OC 5FYJH 4MJIB 2DQGH 4IRJD 4WW2B 2DWDB 1CF8L 1UA6L 1DZBA 3EYUH 4D9LH 1T89C 2OXGA 4LLVB 3VI3E 1HHIA 3VMOA 5JPNB 2Q7YA 3VWKB 1VKXB 1E28B 1XIWD 5T1LA 5DMGC 3ZHKA 3C5JA 1KEGL 1I3RA 3LQZA 4NKDB 4X4ZA 5IT2H 3VGEA 5JIIA 1TVBA 4N8VB 5BMFH 5KS9E 5JO5A 2VR4A 3PGCB 4LCUA 4UMGA 3JV6A 1A4KA 2BNUB 4U1LA 2ICWJ 4UILL 4K3DL 3ILQD 3ZTJG 4G6KH 4AYFA 1E0OB 2FH6A 2GSIB 1T22B 3UTSE 1AQDA 1L4IA 5I8KH 3W9DB 5JXED 2QSCL 2ZUWA 3FT4B 5GRUH 7FABH 5J12B 4KRPC 1HHGB 1C5DA 1QRNE 4DVBA 1TLKA 5EUKA 1UM4L 1D5ZB 2FLBT 2OR9L 1ZA6B 3BKCL 1WVZA 4JM2A 2XI9A 5D9SB 1UM5H 4OLYH 4OBRA 4NM4L 3VMNA 1GGTA 1U8HA 2MQ0A 3GSRB 3OXSB 3VJ6B 4XNXH 2R0LH 5F8RC 2EIEA 3C60A 3BSZL 4KGJA 2R9HC 4XP9H 5CLTA 5D2NC 4Z7VF 4MQXC 5HI4C 5KVGH 4LHUD 1LO5A 3QEQE 2ATPA 3G6DL 1ZHKB 3L3KA 4F57H 5D7KE 5HXMA 5IJKC 5L88L 3IFOB 4OZHB 2QSVA 3QNYA 1OM3L 1QBLL 4MA1B 1RJYA 4Y5VC 4M6NL 4TVPE 3HUJE 5HGHB 3FQNA 3BPOB 1CF8H 1UA6H 2DWDA 2ILLA 1ITBB 1OAKL 4L3EB 2V2XA 3KLAA 4J8RB 4HUNB 4DQOL 3W81A 4HKJA 3ARRA 4A6YL 1K5NB 5MEPA 1H15B 3WS6C 5DVOA 5B38G 1PSKH 1UENA 3LRSB 2DQIH 4OCSL 3PGFH 2CKNA 5E9DD 1YPZB 2Y36H 5IQ9B 1G1CA 5DO2D 5BMFL 2BK8A 3TO2A 5D1QA 1F42A 5B8CA 2VO5A 4Y19D 2DKUA 5DMIL 3RVXD 4NNXB 5KVDL 3SDAA 4OTXH 5FA4A 2ZOKB 3BUTA 4HKZA 5I74B 1N59A 1T1YA 4I3GA 3QO0A 1EXUA 4WHDA 5KJRL 4L5FL 2D0FA 1AGEA 3LKRB 4JHWH 1FPTL 1YYML 3OG6B 2VQUA 1CLOL 3D3VE 1CLYL 4OZIA 1MAMH 5DJZA 1J8HA 1OSPL 4LCWA 2F54E 2VQ1A 1F4WL 2XTJC 3STLB 1HHJA 3EYUL 4D9LL 3Q48A 3VGDA 5F89B 1MHCA 3G6JF 4KRMB 3MLVH 1CFNA 1E4WH 3D69A 3QUXC 1V3LA 5EIQA 1A6ZB 2A6KA 5F1IA 5IWLC 1DBML 1GHFH 4L3CB 5HYIA 5JQ6L 4XC3H 1A0QL 3LH2H 4YHZL 2ZNXA 1FVEA 4Q58C 3QCTH 4JCMA 4NQXB 1CGUA 3C6LB 5C0AB 3UBXG 1JI2A 1DQLL 3SE9H 3DI3B 3PHQB 2GYSA 2ADGB 2WWKO 3QDAA 2YD1A 3ZDXE 1WBYA 1ZLUK 5JOEA 4X6FB 1TZGH 5DJ0B 1GPOH 3T0EE 4IJ3B 2NY2D 1ETZB 4UB0L 3MOAL 1PY4A 4FZ8L 4JFHD 1I9RH 4S2SB 4HF5L 4OF3A 3RWJA 5MENA 1YPZA 3K46A 3TV3H 3ZKXC 4M48H 1QSFD 1FYTA 1OARH 4JFDA 2GI7A 3H2WA 3QWOB 2IQAA 3G04B 1NGXB 2CKBH 4YXHL 1YMMD 1NGZB 2H41A 3BHBB 1HSAA 2X1XR 2OP4H 3FQXA 1D9KB 4XVSL 5JHLH 4YDLB 4ZSOE 4P57B 5CIPH 4QXTA 2W92A 4DOHB 4WI2A 5ITFB 5CUSH 5DT1L 5C0JB 4MA8H 1IKNC 1IQWL 2Z8VC 4PR5B 2ID5A 1HHKA 2IH3A 1EJOL 3HG1D 5I76A 5JPNA 3LN9A 3VWKA 4BJLA 1VKXA 3MRIA 1YC7A 2W0FB 5F7EL 3VXUD 5DMGD 4YZFE 4ZAKB 2NXZC 2AQ1A 5KG9A 2E6QA 5GXBB 4QF1B 1YY9C 4GXUM 4KVNH 4NO0A 1JN6A 4I0KA 4LFHD 4WFHE 1RUMH 4FMKA 5E2WL 3IF1B 4XCFH 4LSUH 3T3MF 2UYLB 3DGGB 1TJGH 4FG6D 2WBWB 2V17H 4HUWA 1TCRA 5E8NB 5EC1B 1WBYB 4KRPB 4OM1L 4X99B 2VISB 2AW2A 5T1DH 2YK1L 3VGGA 3ALWA 1M05A 3P3YA 3KGRA 1WJ3A 5D1ZA 3T1WA 4MXQC 3LV3B 3DO7B 1A7NH 1MFEL 3GHEL 4K7FB 2N7BA 3C09B 3UBXI 1J0JA 3QDHA 1JGDB 3WIIH 1CGTA 4JFDB 2IC2A 3ZYJA 4W4OA 1AFVH 1HILB 3ZYIA 1NGQL 1NAKL 3BXNA 4OGAD 4K94C 4PJ7A 2ZCLL 2CRIA 3OB0H 1NUGA 1FSKC 2EDOA 2EO1A 5HGDB 5LQBH 2VLKE 3HZMB 3WL9B 4HIEA 4LSSH 2C1PB 5C8JB 3RUGF 4FQJL 4WFFE 2XFXA 3EOYG 3STZA 3U46B 2NY4D 3ARDD 4QF1A 4MNGB 4XTRD 1BOGA 2IPUK 4NQCE 1LDPH 1IGJB 3MA7A 4EIGB 4S1SL 1CICA 3SDYH 1WAAA 4M03A 3VMPA 5GGSB 5HGBA 4OCYH 3WEXB 4MCYB 1IILE 3GDBA 3V4PH 4PRPE 1NQBA 4GUPB 4LSUL 3X3GH 3RHWF 1DVFB 3JWOL 3Q6GL 4Y5YB 3T77B 3T09A 1KB5A 3O2VH 2VXUL 1P7HL 5JW4Q 4E41A 5EBGA 4OZIB 4AY0A 1G9EA 2XN9B 4WVRA 4R2GB 1Q9WB 3ME0A 3SDXE 1CQKA 2FWOB 4NCDA 3KYMA 4JFOB 5SX5H 1UG9A 4Z0XB 2VUOA 3MMEB 3DYOA 1SM3H 3GI8H 2BVPB 4MNHB 4QRRD 1U8OB 1NCUA 4HK0B 1BJ1J 3B9DA 4N5EC 4WI5A 4YH6A 2D7MA 1F13A 1CLOH 3N1FC 2OXHA 4S1QH 4ZFOA 4LGPB 4I3RH 3HMXA 1TQCC 3QUZC 1OTSC 4PLNC 5I30H 5IESH 3DURB 3U0WL 5ERWA 1ROWA 1R5WB 2XZCH 3ARFD 1A4JB 4M5YH 3UTPE 5GZNC 3UC0L 3FO9B 2CLVB 4PJCA 1C1EH 4QHUB 4UOJA 4B7IA 5CGMA 5F3HA 4WO4B 3HLAB 4P46A 3VFRA 4MJID 3SPVA 2X4OB 4PGCA 1MWAL 4U1GB 2GCYB 4HIHB 1U8NA 3VGHA 1M6OA 5KW9L 1OWWA 4I4WA 3BZEB 4NZDA 3MLYL 3S34L 2HJFA 1Q9OA 2HTLC 5DMKA 1IM9A 1LEKB 3DX9B 3AGVA 1BD2A 4QTIH 3E3QC 5F7YC 3ZSTA 1NH6A 3GKWH 4C4KO 5L6YL 1A2YB 1NCBH 5IHUH 3PWPB 2DQFA 3QIBC 3FB6A 3FTGA 2EICA 4N0FA 5DQDH 5KVMC 3O6FC 1PG7L 3IJSA 3MREB 3O0RL 3CDGA 3RPIA 3OHXA 5DDHB 1FO0B 2DM3A 4I8DA 4ZS7L 3B5GA 5I17A 1YQVL 3MXWL 4GRWF 4DKFL 1QHPA 4PBWD 4KK9D 1KCRH 4FFYH 3DRQB 3GRWH 5DURD 4M62H 1JJUA 2P45B 5B3JE 4RGOH 1HSBB 3RDTC 3KYMB 4JQXA 4D0BB 1RJCA 5F7KC 4D8PB 1K4DB 1FNGB 1NEZA 1MCPL 1DQJB 2VIRB 4YK4B 5DC0A 3RWHB 4JFQA 4MQXD 2P5WB 3MODH 1MY5A 3PQYA 3GB7A 5ANME 1MCFA 2VH5L 4UT6H 5T5NF 1YYMH 1SBSL 2M1KA 2O5ZL 4KTEL 4XCYB 2OL3B 5DHYA 3SDDA 2EDLA 3IU3A 1V7ML 3FOMA 2G60L 4OAWA 3OR7A 4NKIL 2AKRA 1W2KT 4DFIA 1T6WA 3ULUL 4P2RD 1G9NL 1QNZH 4MA7H 4WI8A 5FF6A 5DRXA 4OD3L 4OZHA 4LDLB 2AEQH 1MI5E 2LVEA 1TQBC 4JFED 4QHMB 1TTGA 4P2RE 3C5SA 3RKDD 1CBVL 4PTTA 1RD6A 3S96B 2FO4A 3DXAB 4NJAL 1FZKB 4YDKL 5DJYB 2X89A 3AB0B 4AIZA 3ARSA 1AJ7H 2BNQD 3R0MA 3RWIB 3VWJD 3JTTA 4P5KB 3ZO0A 2CUMA 2XWJB 5LBSL 3RTQB 2AJYL 1S9YA 3EYQD 5CP3A 1F4XH 3QPQD 2W0LA 2HG5A 1X7QA 3MGTA 1GIGL 3V0AC 1I8MA 3GJEA 3MCLL 3MRQB 4UOW0 1OP3H 4ZPVA 2YEZA 1X9QA 5D7LE 3A6CH 3B6SA 4HKBB 3TWCL 4LLMA 3U4EA 2A6DB 1IGFH 2YPVH 4OGAC 5HD8D 3DRQA 1CIUA 1RK1B 1RY7B 3BN9D 1BBJB 3L3OB 1KPUA 5EC2B 3AMKA 3B2VH 3CH8A 4KH2A 2PTUA 4HIJA 5F9AC 2MSPA 3SCMC 4LNVA 3RWHA 1VFAB 2PKDA 3SO5A 4JFQB 2RCSH 1F58L 5E2UH 4JFEE 2Y9RT 1IC5H 3AFLA 5HGBB 4JZJA 3QUKB 1U93B 4MCYA 1JGUH 1EVTC 5E7FA 4K94L 2OL3A 3SDDB 3IDYB 4TRPL 4M62L 1YUHB 3DRTB 3RNQA 3FT3A 3EFDH 4ESKA 4KUCF 4FTVB 4NRXB 3MNZB 5GGVL 5E9DB 2XG5A 1DFBH 1P2CB 2FEDD 4X9HA 1H8SA 4R2GD 1BJ1H 4I3RL 3U79A 1DANU 4YBQD 2GY7B 3VG9C 4U6VH 1QFHA 1KCUL 3NFNB 4X9GA 5IKCA 2FIRT 1A6UH 5K9JL 4IDJL 5D71H 5E08H 4X4YA 2EC8A 5I8OL 4EVNA 5FUOH 2WBJA 4QYOB 2L7JA 4HV8B 3TIDB 4F15B 1FL6B 1J1PL 1JPSH 3FAXA 3T4YB 1L0XA 3BKCH 5D1QC 5IM7B 2YUVA 2PCPA 2K9UA 2ICWB 1EA9C 4I0PC 4LSQL 5DVKA 1NGWA 4D9RD 3HRPA 5DJCA 2NTSP 3PP3H 1OLZA 2OMBA 4JZNB 3JWOC 4WU7B 3MV7B 1ADQL 1FG2A 1UGNA 2Q1EA 1I7UB 1K9TA 5CZKA 3I85A 5D7JA 3LPWA 4HBCL 5HTSA 1B6DA 1H8OA 1FH5L 2QHLA 3LCYA 3RX7A 4PP2A 1AGDB 2VXQL 3BPCB 4P59L 5IG7B 4NNPH 5KVEH 3FKUS 3FTGB 3VFTA 1KJ2A 2BXZA 1QSED 4LSSL 2F15A 3BN9C 1J0IA 4JM4L 1R5IB 2DBLL 2IJ0C 5LKNA 7CGTA 1X6NA 2I60H 2R0ZL 1ACYL 3D1MC 1SMOA 1OB1A 1SJHB 1U8MA 1YMMB 3B3IA 1G7LA 1IC7H 5I9QB 2ZP0T 1RULL 5GRJH 5I66B 5C0BB 5MEOB 2VDOL 3QG7L 2CK2A 1FN4B 5F7WC 4ZUTA 3WFEL 2PYED 4JN1L 4N5UA 3K81A 5F70A 1YEFH 2EDWA 3WFHB 3QG6A 3DMMB 4FQXD 3VRJA 3H3PL 1M7IB 2NW3A 3SDCB 1S7RB 3LN4A 1TNNA 3KLHC 2R56L 1S7WB 3L5JA 3MUY1 3T4YA 4GXVH 5L2JB 4YIQA 1KPVB 1NCNA 3SY0B 5KW9H 2AKRB 4GKOA 4K07A 1ZTXL 5M95B 4FRWA 1A6WH 4OM0H 4F80A 5FDWB 3OJ2C 2CJUH 1KXVC 5H35B 3KHOA 1JYNA 35C8H 2DICA 3S8WA 2FNBA 4ODXB 4XVTH 5EO0A 5JW5A 1GAFL 2CPCA 4X6EB 2NY5C 1QEWA 1BQHA 4FZEH 4ORZC 4DKEL 4IOIA 4LRIC 4WFFD 3AB0C 4NRZA 4ZPTA 1BBDL 4YFEA 4AEEA 1RIVL 2NX5D 2Q8AH 2HG5B 3RZCB 2YPLB 4OSUL 1Q1JL 5IK3A 3AY4A 3UBXA 4C56D 3U46A 1FL5B 2C3XA 2WINA 4U6XB 1LO0H 1RUAH 4XWOD 3TYGH 5FGBC 1XGTA 3WE6A 4O51B 5HVHB 1XGUA 3L5XH 3UDWA 1GJIA 4OZ4A 1U58B 1RK0A 2O5XH 1G9NC 3N1GC 4IBLT 5K9KA 4JFZH 4M93C 1G7LB 1RK1A 4EI5D 3IDNA 3TPUA 4EI6B 3H9SB 4GUPA 3P0VH 1IAII 3HE7A 5FCUH 1ORQA 1L6ZA 4Y1AA 3CUPA 4KJWC 4PRNA 2Y1VA 2I07B 5JIPA 5E00B 3ZDYE 1VFAA 1F4HA 2CDGA 2MHAB 3TBSB 5FHAL 2VQTA 3DSFL 1RIHL 2NY2B 4H20L 2AABL 2C1OB 3C60B 2A1WH 1T7XA 3HCVB 1YNKH 4L8SB 2H26A 1H3UA 4TPRL 1Q1JH 4O2CA 3RUGA 4PJ8D 1JGLL 2Y72A 3U82B 2VLJE 4E5XB 3SGKC 1TTFA 3SGEH 4LSRH 3U36B 1YEEH 4LEOB 5E5MA 4PV9A 1JZ4A 1JGEA 5C07E 1EBAA 4JKWA 1GH7A 2CLVA 4PJCB 4QHUA 1ONQA 4JN1H 5SWZE 3WLWD 5GRZA 3U48A 4JRYA 1KTKE 4IIQA 3UJTH 1K8IA 3SKOA 3QR2A 1LP9E 3NIDF 4P2YA 5I1KL 4EDWL 5I1HL 4ZUSA 1ZGLP 1HOCB 1FL5A 4U6XA 4R3SB 2ICWA 3WO4C 8FABA 4OF7A 4LAJH 5D1QB 5CSZA 4NSKA 1CD8A 2CKBA 2X4UB 1XR8B 5HI3D 3MV7A 3FFDA 5BW7C 2X70A 4G9FE 1O0VA 4Y1AE 3N1MC 3T2PA 3IDNB 3TPUB 1PZ5A 4MVBD 3SGJA 4EXKA 1JRHI 2CQVA 1L9NA 2GQHA 4F7PB 4ETQA 4QOKE 4DGVH 4PG9B 3DETD 1MVUA 5EN2A 1DBBH 4KHXL 5I1DB 1P7KB 1NUNB 3ARGC 5TE6H 5E00A 2GIYA 4G3YL 4NZUH 3SDDC 3HZKB 2OJEA 5DHVB 1W8OA 5T3XD 3CX5K 35C8L 1R0AH 5C0EB 1DP0A 1N6QH 4BH7B 5I1EL 1XMWA 3NCJH 4XH2A 2C1OA 2D0HA 3H7BB 5EORL 1W0WB 2D31B 1DQQA 3DUUA 4DKAA 2NY7L 5AYUH 5F3BB 3TYGL 5IIEA 4ISVB 1OTUD 1UKTA 3SDAD 2ADJB 4AH2A 2IPTH 2A6KB 4ODTH 1KBGH 3BKJL 4OD1H 3QI9C 1AE6H 3BP6B 4PRIA 3V5DB 3AXLB 2FJHA 2JIXB 2YS4A 3MLRH 2FB4L 2BNRE 5IFJA 4PJXB 3VH8A 2PXYA 2AQ3A 5IEHA 4PJAF 2J8UA 5E94A 1J0YA 1MOEA 1T80A 2EDJA 4HCRL 4PRDB 3MYZA 4ZDHA 3QDMB 1BVLB 3HZYA 5SWZB 4DTGL 3OZ9H 4RWYH 3QXWA 4XI5C 4PJFA 1T1XA 1F3DJ 3RWJB 1I7ZA 4KMTH 4UT7H 3TBYA 2ENSA 3T1FA 4AM0B 5DJ6B 1I3GL 5I75B 3REVB 2WIMA 2VN7A 2RJMA 3UDWC 4DW2L 3QWOA 2VRAA 1G7JA 4UZGA 4FP8H 2VDKH 2X70B 3VG0L 3H3PH 4KFZC 5IV2B 1IAKB 2BVQB 4XGZA 2RFXA 3L9RA 32C2A 3FMGL 2R56H 1FVDB 1IAMA 4EN3D 5L2KE 4ODHL 2VYRE 4LCUB 4U6VL 5EUOF 3JUYA 2G9HA 3ROOB 1K8DA 1CQYA 1E4KC 3CZFA 4RFNB 5JPMB 4NQVB 4MHHG 4IMLB 3D85A 5MEND 3W9DA 4NO5B 2BHZA 1KIRA 2DN7A 3IS1X 3SE9L 4Q97A 4V1DB 3BRGC 5C08D 1NCWL 4JKLA 1EMTL 3BO8A 1IC7L 4O51A 1JNLL 1CS6A 4P4KC 5JA9A 1XF1A 1MCWW 4J3WA 1G7IB 1JPSL 1D6EB 4HKXB 1N64H 4CADA 3KDMA 3RWEA 4AENB 2IEPA 3JXAA 4XVJL 4RX4D 3DMMC 5HI5D 3TA3A 2V9TA 4MD4B 3VDBA 2V9QA 2VL5A 4LQFH 4P23B 2HT2C 3ZE0E 4OLZL 5C0RH 1WCBB 3CPLB 3QXAB 1P2CA 4BZ2H 2R2HA 2YD2A 3O45A 2MNUA 5SWZA 2WQ8A 3T4AA 2V5SA 5GGQL 3CXHJ 2Y36L 4PJFB 3B8SA 4OF8A 5HDQH 2EYRB 3C5ZC 3B9AA 2FX7L 3LZFL 3PABB 5F7MC 1CE1H 2H26B 3ZLQC 1KLGA 5KVFL 2Z35B 3PHOB 4D9RE 1NC4B 3MRFA 2UZIH 4HPYL 4KKCC 2AAVA 4NT6B 5CJQH 3GNML 1VGKA 4HIXH 2PCPB 3VXNA 3QDGA 3L3DA 3IDXL 1XT5A 2QHRL 3FB8A 4HUVA 2AK4E 3SKMA 4D2NA 4NQDE 4K7PY 5BCAA 5D1ZD 5E6ZA 3KPPB 1S7XB 2OL3L 5E6IC 1KGCD 4RIRB 3FMGH 4HUXB 3EDFA 3V7MA 5FM5M 4Z77A 4GG6B 1JP5A 5DRWA 1JE6A 1HWGB 3JSSA 1E27B 3NH7H 1X4ZA 2XTJD 5EU3B 4NN7B 2MCG1 4K7PL 2ESVD 4WTZG 4OCRL 5DYOA 5D1ZC 3NPSC 2APBA 3Q0HA 4U31A 4WHYH 1MHEA 1Z9MA 2X1QA 3WHE1 4CADB 4OLWL 4GKSA 3EFDL 3MFGB 3KPLA 3C08L 4YHOL 3I9GL 1MY7A 4HS8L 5J9PB 2R0WL 2P8MA 3DECA 2FD6L 1EFXD 3QJHA 2XPGB 1SMAA 4Z7VA 1KXTB 4YDKH 4N9OB 3BKML 5T33H 4PGEB 3VFNA 3B5TA 1BLNB 3MLZL 4YNYA 4CRPA 1QO3A 5DVLA 3P0GB 4IHOA 2WWKT 4KHTH 4NQDD 3OB0K 1S3KH 1G9NH 3P9MA 1IAOB 2I9LA 3MRHA 2QSCH 1CE1L 3JWDH 5BVJB 2K7QA 4AL8L 1JTPA 2ERJC 3TO4A 4X8JA 1I8IB 2FBJH 5INDB 1F4XL 4MJ4A 1KYOJ 3IJHA 5C0DB 4OT1L 2P5EA 4HPOL 4GAYB 2ZUUA 4LHJB 3PWVB 4KVCH 1VGKB 4PBXA 4OZFH 3O6LH 43CAA 1MQ8A 2QSTA 3OJVC 1FYTB 1XCQB 2AJYH 4G5ZH 3ECBA 4MLSA 2EE6A 1OVZA 3MLWL 2ENYA 4X7TA 3OR6A 4OD3H 1Y6NR 2R9HD 1MQKH 1CLZL 3I6KA 2YSSB 4QRRA 5DD6A 1XH3A 3OPZH 1JYXA 1PW3A 2DYPD 3VRIA 1QLRA 3CJJA 1QLEL 1AXIB 2VJXA 1CXHA 2R69L 3BQUB 2F54D 3WD5L 4KHXH 4UOW1 4TUKH 5EOQL 4PRPA 3JV5A 3KPLB 3OKMB 3A6BL 4JRXD 4RBPK 2Q76B 3O6KH 2ZSVB 1DUZA 3LKSA 2NTFB 5KAQF 4JFEB 2ITCB 4XXDA 2IBBA 1OCWH 3QAZC 2EZ0C 1J9CT 2DQEL 2DDQH 3A6OA 2CLZB 3CFJA 2C4XA 3H9SA 1QYGH 2AXJA 2VDKL 1F3DH 3ARBA 2NXYC 4K2UL 2VDNL 1HSBA 1C5CL 1T1WA 2X1PA 5DZLA 4FQIH 3QIUA 1JNHA 3EO1B 4PJAE 1U8KB 3OKEA 1QG3A 4LMQI 2QJDA 4YHIA 3TVMB 4R2GC 2B0SL 3WLBB 1KJ2H 1BM3L 2E9IA 3HE7C 4TOYH 4G42A 3P73A 1Z5LA 4QXUL 1HKLH 4GS7C 3IXTA 1SJEB 4HK3N 5C0DA 3QA3A 3K2UH 5JUEH 4NGHL 1ZANH 1YEEL 1N5YL 1D5MA 5ALBH 3CU7A 5I71C 4L8SA 4QRQB 1HDMA 1JF5A 1ZLVK 1YEKL 2E27L 3BH8B 3O8XD 5FF6B 1WC7B 2BSSA 1NJ9B 2CIKB 2VXVH 2IWGA 5T1DL 4QHMA 4PJ7B 4MVBC 4R7DB 5JTWA 1KNOA 3DXAE 1ZVHA 1FO0H 4GRLA 4BK4A 3QHFH 3GSQB 1IGCL 4K71C 1AY1H 5JW3H 1QKZL 2MKWA 5FHAH 1XF3A 2AJ3B 3PQYD 3CFKB 4RCAA 3GSOA 3ZDXF 2B39A 5CLWA 5FK9A 2FECI 3GM8A 1FRGH 5F1KC 2NR6C 1K8IB 3SKOB 3PV6B 5BRZD 1MCNA 1CCZA 5D6DA 4BFEA 3DIFB 3RL1A 1D3CA 3DETC 2ARJA 5I30L 3VGFA 3LKNA 2WWMC 1I1YB 4JY5L 4JFEA 4KI5C 5EOTB 3PWLB 4HJGA 4KV5F 1FBIH 4XPTH 4M7JL 1JGVH 3D39D 3H3BC 3U6RB 1JK8B 1TJGL 2NY6C 1YDPB 5IB5A 2XZZA 5GGTA 2MPAL 4HIJB 1E27A 5IB2B 4XXCA 5A16B 1RMFL 3BI9X 3FN0L 3MJ7B 3ARGD 4OF6A 1CD0A 1CU4H 1MNUH 2IADB 3TBVA 2R0KL 4G7VL 2ZKHL 3GIZH 5IROC 5H2BA 1W0WA 2BNQE 3DSNA 1LO4L 4OZGB 5DMJB 4PJBF 2R1WA 4JRYE 1EZVY 1GZPB 4JY6A 5EBMB 2D7OA 3S37L 1U8IB 3ZKMD 2WQRA 3VFNB 3ZDYF 1ZANL 1B0GA 2L4OA 5C07A 1T7VA 4GBXA 3WFCL 3QXDB 4PGBA 3U9UB 4DZBA 5IMOB 5IVZB 4U3HA 2IBGA 3I50L 1OGTA 2AV1B 3UJJH 2H2SC 4QRTA 4HT1H 5JR1H 4R8WH 5AAMA 3MRMB 4KMTL 4UT7L 3RVUC 4YXLL 3DX7A 4E42A 2EE2A 1Y18B 1HYSD 4TULH 5MEPB 4NIKB 3VFOA 1RIHH 2R23A 1MCSA 1A22B 5HVFB 5E2WH 2AERT 3O6FD 4GG8A 5IM7A 3H42L 3HI1A 4U3XA 2LV4A 5F44A 1YN7A 2MQ3A 1ZKAA 4LIQE 3E6FB 2AXGB 2ZUXA 4I0PA 4U1SA 1QSVA 2J12B 1EIBA 1IE5A 1KCLA 4G9DA 2W07A 4E0RA 4PJDA