3A67H

Crystal structure of hyhel-10 fv mutant ln31d complexed with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a67H00
4XB7A 3JTTB 2WWKO 1I9EA 1UWXH 3QBTB 1DBBH 4XPFL 1MI5B 2IADA 2R1XB 5JIHA 5D2LE 3GKWH 3ZTJH 3MLTA 1N7ML 4LCWB 3LB6D 3TVMC 5IOPB 5F89B 3RKDC 4OCWH 2IG2H 2R29L 3MUGB 3HZKA 2EXWC 5HYJB 1KJVB 1SBSL 2X4TB 5GRJH 4LCUA 3HI5L 2NY7L 5DJXB 3MZGB 5J12C 3CXDL 1IARB 4FFWD 1TPXC 5GJTH 4C57C 1DSFH 1K9TA 4PBWD 4ERSH 2B4CC 5HD8D 4LLAA 5D9SA 2C1PA 5MEQA 3F58L 4JKMA 5F3HB 4XNMA 1UB6B 4KI5C 4U6VH 3SKMB 1BAFH 3LN5A 3KPNA 2XA8L 2YOCA 3BP5B 4OJFH 4I18B 2XQYG 4MNGA 1SHMA 1X4ZA 3UJTH 4FP8L 5KJRL 5HDBF 4EN3C 3HAEG 2BVQB 3DMMC 1L0QA 1WZKA 3MJGX 1CFVH 5D96C 3PV6A 4TUJA 4XMLL 1RIUH 2VDML 3I02A 4AIZA 2NZIA 1UGNA 3E2HC 4S1RL 4MQSB 4XGZA 3I6LE 1CDYA 3V6ZA 1HXYB 3QNXB 5IB4A 1IAKB 4LPUA 1TJGH 2PXYC 1AQDA 3S3JA 3VRLE 3B9EA 4XXCA 5C0GB 3FB7B 2Q76A 3H42H 4WEUD 4LKXB 4IRSA 1L7IL 2Q8AH 5C0AB 1KCUL 3SDCC 2GAZB 2EKJA 2ORBH 3AM8C 5ICYA 3GIZH 3WHXB 2J8UA 3QEGH 5DRNB 3EOYG 3CU1A 3GSOB 1RUPH 1XR9B 5ALCH 4MAUL 4RMVA 3VFOB 4X80L 1PSKL 1MWAA 2FD6H 3ARFB 5SV3A 5A3IC 1KUMA 2X4PA 2HN7A 4X7SH 4QLRA 3SOBL 3T4AB 4AENB 1NC4A 3X17A 1JTOA 1MRCL 5E2UH 3DVGB 2XY2A 4OLZH 4S11A 2LAAA 3RTQA 4OD2B 5CMAA 5DR5L 5J1AB 3VWKC 2QQNL 3X3GH 1II4E 5LCVH 2OZ4H 2W0FA 3LDBB 3MACL 4FTVB 3V7AG 5J13C 3AB0C 1J5OL 4B0MM 2FR4A 5GS1C 2EE6A 2FYYB 1A22B 3HE6A 1KF9B 5TF1L 5FECB 3QXAA 1JRHI 4JHWH 4QHUA 5D1ZC 4GMTH 1KJ2H 1K3IA 4NO0A 3SCMD 3S35X 3HUJE 2VXTL 4FQXD 5IVZA 5IEHB 2D4DA 4HD9A 1T3FA 2X4RA 3B5GA 1OAYL 4QHMB 4PRPA 3VWJA 1I9RH 3JWNC 4M7ZB 3ZE2F 2LQRA 4GAFB 3IJSA 4HW6A 4N5UA 4JDTH 3RWGB 4XP1H 3K8KA 3T0AA 5EN2A 1CFQB 2XN9D 1PX3A 5KVEH 2VDNH 2D0HA 2KH2B 1MFBH 3X3FL 2WWKT 4RGNC 1LK2B 1TNMA 5L2KE 5EIIA 3CZFB 5FCUL 4G8FB 3MV8E 4GOSA 4NPYB 2E27H 3SKJH 1OTSC 4PJGF 2VZSA 1UA6L 4I9WE 4LPYA 4PRAB 3NIFF 5IEKB 3GSWB 3MRCA 4D0CA 2VXUH 4XP4H 4RGMC 2ICWI 3DBXA 4PJ9A 4PY7A 3KLDA 2V2TA 1H3WM 4GBXC 4WHTA 4JFPB 3QRFM 4PREA 2ZWLT 1JMZA 4RX4D 15C8L 1QRNA 2IAMA 3QEUA 4JGMA 1EK3A 2EZ0C 4U1NA 3JVGA 1KIQA 2QV2A 3QWRA 4OM0L 5D1XA 3MLRH 5CLTA 3PL6C 3ARBB 1VGEH 3REWA 4LSUL 4PG2A 4DWHA 4WFHD 2YRZA 1QSFE 2DLEA 3OSKA 2YZ1A 5JLZB 2I24N 3ULUL 1J8HE 1QD0A 3WFDL 4ALAL 1UWEH 1FE8H 4YHMH 5IHBA 5DF0A 4Y8DC 3O9WD 3VXPB 1A14L 1YN6B 2VXQL 2WBJA 1R3HA 5FKAA 2I60H 2X5PA 2NY6C 5EUKA 3RNKB 2CXKA 1MJUL 2NY0C 3H9HA 3SDDA 5I1KL 1DBJH 4X6DB 2VE6B 3LOWA 3BP4B 1IQWH 2YD5A 1J7VR 4RFEA 5DA4A 4MAYC 1JGVH 4OFIA 3OGCA 1O0VA 4GSDL 3TN0D 3QJFA 1MUJB 4NCC2 1NPUA 4P2YA 5ELIA 1XGQB 4GH7B 4ORGB 5H37G 2CRMA 4A6YH 1WAAA 5C0CA 4F2MA 1ND0B 4FQXB 4HT1L 4Y4HB 4Q6IB 5IG7B 2NCMA 1K5NB 2NXZD 4GAYB 4HS6A 1DVFC 1H3VA 1GVIA 3MRMA 3T65A 5J8OA 4WI8A 3P4LA 4ZSOB 4JFHE 4N8VB 1EAJA 2FX9L 1H8NA 2VDPL 5TDNB 5ACZB 2HP4A 2CKBH 3U4BL 4P9MH 1M4KA 4HLZH 2O5ZH 6FABL 4ZUWA 1Q72L 1IGTB 2XN9B 4A2LA 3F6IA 1FSKB 4C56A 2Z8SA 1KXQE 3A0OA 3BRDA 4EUPA 2GUOB 2R23A 4FRWA 5BXFA 5DJZA 4P2QA 2EE2A 1MLCA 3MNZB 1IGCH 1MSPA 5F1KC 3RX8A 3MV7D 4G6KH 4TSAL 5KTEL 2H3NB 1N0XH 3CFDA 1QEWB 3EJYD 1F6AB 4ODTH 3D85A 5SWZD 3ARDA 4GMSL 2YUZA 3LKQB 2PNDA 4ZFOB 3VDCA 4LARL 3O8XB 1MF2L 5F7DA 3MRKA 1MREH 1CG9B 1NC2A 1INQA 4WUUA 2UUDK 2VWEE 3L3HA 3VMPA 5EO9B 1NAMH 4IJ3C 3X14B 5ADPL 4LP5A 2E8YA 1M05A 1TCMA 2E8ZA 4KWUA 5E2JA 2YMXL 4R90L 1XGRA 1FRGL 4PJAA 1BFSA 3GSNB 3TCLA 1MQKL 3VXME 5KW9L 4MYWB 2BDNH 1FIEA 3O9WB 3TIDA 5T3ZH 3PNWB 1MAJA 1INEL 4UT6L 1QBLH 2FO4B 2GW5A 5I9QB 3RL2B 5GZNC 5CJXC 2ADJB 4LVHB 2IALB 4HJ0C 3VH8A 3QQ4A 2BK8A 4PGDA 5C08D 4MX7B 3AVEA 1IGIH 1RUMH 3KYMA 5BZWA 1RUQL 1JWMB 5KS9B 2OL3H 3EYVB 5FUCC 1KCSL 5D7IF 4R96B 1E28B 4N0FA 1XGPB 3BAEH 3THML 4NM8L 1EMTL 1PJ9A 2DB8A 1AR1C 4OZ4A 5EBWA 3O6ML 2H8PB 4P3DA 2CDEA 2GT9B 3TN0B 4BQ9A 1H8OA 3FQNB 3VFUA 4V1DA 1EUUA 2BNRA 5T5NG 4KKLD 2CKNA 3GIVB 4NQDE 5IT2L 4E41E 5KSVB 2HLFD 2NXZB 4QTHB 5J6HA 3G08A 2D0GA 4Z7NE 2Q1EA 2DL9A 2PTTA 5AAMA 2X7LA 5BRZA 1A7OH 1JIBA 3VFVB 3VW3L 3DIFA 2DLHA 1TTGA 5CBAA 1S9WB 4R0LB 1B0RA 3UYRL 1MEXH 1MY7A 1OAZH 5I1JL 5DJ2B 3TNMB 4NN6C 3SDXA 4F7MB 1U3HC 4XBGB 2D9QB 2H32A 2DQUH 4O4YL 1PYWB 4PS4H 4UV4H 4MB5A 5F44A 1GPOH 3ARGD 5E6IA 5FM8A 4MJIA 4C4KO 3TT1H 1HHGA 1HHHB 4PRIE 4IDJL 3MV7B 3B9DA 2UWEA 4Y5XA 5C2BL 1QA9B 5SWZB 3VXNB 4DKEH 1AXTH 4OF6A 4TSCL 4OCYL 2JB6A 5DZLA 3RFZC 1BQHA 3GRWH 5MP6H 4GRWF 4YBLB 1MCKA 1E4WL 4NBYB 3U0PB 2Y07H 4JY5H 3S5LG 1YPZB 1YC8A 5EU6D 4DVBA 1JZ6A 2F5AL 4O9HH 1PKQB 3STZB 1MFAL 5GHWH 2YK1L 4DQOL 1J0HA 3PE9A 1G7LA 4G5ZL 2AXGA 3C2AL 3F5WB 3GMOB 1UEMA 4IIQA 1FNSH 1GZQA 3TH3T 3X13B 5EUOF 1RZKC 4BK5A 4PJDB 2PO6D 4Q6YA 4KMLB 1T7WA 4IMLA 4M8VA 3OKMB 4K7PH 4G8IA 4NJ9H 3OKYA 5E8DH 5HI5C 1FC1A 3FOLA 2P8PA 1VKXA 2QSTA 1Y0LB 4Z76A 3RWIA 4L5FL 1MWAL 5IROA 3WS6A 4C54A 4L4TE 1I7ZA 3HLAB 5ITFA 4NNPL 1MFEL 4AH2B 2DQCH 1EAPB 5GISL 4OUUB 3T2NH 4JKPL 5KG9A 1QRKA 4J4PA 3QCTH 1DBKH 3WIIL 4JB9L 2NXYC 4OCXL 4H26B 3LKNA 3TVMD 4J3XA 5HI4C 1V8HA 1A6TB 5KVDH 3K74B 1JHKH 3E3QE 1MCWM 2EXWD 3QDAA 4HLZG 1R5VA 3LEYL 2A6IA 3KYNB 3UTQA 3FT3B 2B1AL 3RY5A 3P4OA 3QHZL 1G7HB 4RMWA 4NYLB 1JF1A 3V6OC 3WUZA 5JHLL 5DD1H 2F5BL 1KXVC 4U1SB 3MV9A 4Y19E 4NNYB 1FNLA 4P46A 2B5IC 4JAMA 4HUVB 1S9XB 1NGWB 5IHUH 5I66A 3KS0H 3AREC 5HHNB 1LO4H 4LAQL 3TJEL 2FHBA 5IKCB 1GOGA 3ARVA 4XXDA 2L7UA 1K8IA 2PF6A 5IB1B 1NKOA 4Q0XL 5I30L 1D6EA 4M43H 1Q1JH 1JGDA 4EN3D 3ARGB 3DMMD 5GGSB 5HHOE 1ADQA 3QDJD 4WW2C 3ULUC 3R06B 3N1MC 3AY4A 5GGVY 4GG6A 2AJYL 5B21A 1UZ6E 1VA9A 5JXED 5EO0B 1A3LH 5JTWA 1AO7B 2G2RB 3OR6B 1IJ9A 4LDOB 4YXKH 1F4YH 3DLQR 4GXVL 3WO4C 2ADGB 1RSFA 4RA0C 4PV9A 1VEOA 2IGFH 5F7LB 5EU6B 3TO4C 4PGJA 2EDHA 4XCYA 4WY7L 5ESQB 3WL9B 5KSBF 5INDB 3I6GB 3QXDB 4JFXA 1ZS8A 2EEDA 1A1OA 3MXVL 3SGJC 3WFHB 2NX5A 1G7IA 4HIXL 1FJ1B 5T33H 5A3ID 2CIKA 2PO6B 2GYSA 5C0BD 4WW1B 4OCLC 5J9PA 4C4KT 5BV7L 2V5RA 1AGEB 4X9FA 4PRDB 1WGOA 4PP1C 4JFDE 5DHXB 5I19H 3UX9B 1HK6A 3H6JA 5JDSA 3OAZH 1A5FH 4ONFH 4PJXA 4ZPVB 4JDZA 4ONOA 4HIIA 3X12A 3QDGA 2VZ3A 2FIKB 2J5LB 3OJ2C 3RWCB 1NCBL 3WFEH 5AZ2H 2FLRT 4XC1L 5E5MB 3KPRA 1FGNL 1XGTA 4W68A 2J2ZA 1S7SA 3FTGB 3HAEB 2HAZA 5GGRA 2LE9A 1YEHL 2DQIH 1HDMB 3T2QA 5C86A 5JO5B 5ETUA 2DJUA 8FABB 2HVKB 5LBSL 1G6VK 1NLDL 5DRZA 4JHAH 5MERB 1L0YA 1LMKA 3R8BB 4J6RH 4RAUA 1FDLH 1ZEAL 4FQ1L 4QRRE 1TTFA 4G42B 1CDCA 5EULV 3FO2B 3KPLA 4NC0B 4HFWA 1EHNA 5FYLL 1KIRB 4ZUVA 5J12B 3ZO0A 1IGYB 1S5IL 3PQYD 4TULH 4JY6B 4ODHL 1TPXB 3VXUD 3QULA 4RFNC 4XP9L 3QR2A 1D5BB 3VGAC 3FB8A 2OR9L 4O5LH 3MUJA 4FQQB 1Q9WB 5BJTB 2XRAH 4S2SA 1HINL 4HGWB 4UILL 4Z77A 4R7DA 4WEBL 1TTUA 1CLYH 1EO8L 1BZ9B 4RGND 5FKPA 2HFTA 5DFTA 2EDRA 1OPGH 2IPUG 3O2VL 4W4OA 2CK2A 2FBJL 1BZQK 4EN3B 4D0BB 1T20A 5DMGC 3QDJB 5DD5H 4LPWA 4UDTB 3MMEA 1A7BA 4MA1C 3QP3A 3U7WH 3C5JA 1RUKL 5CKAA 4AEIH 3MYJA 5EZLA 4FXKB 3RUGF 4PBXA 4JRXE 4DUWA 3GUTA 3MLUH 4MQXD 5IBTL 4DW2H 1ORQB 2A6JA 5ISZE 1YEFH 1DN0B 1OW0C 1WICA 2D9CA 4CADA 1LO3H 3ILQC 2NY3B 1SEBB 4O58L 3WN5A 2VISB 3ET9F 5D2LA 3GJFA 4NM4H 4NZDA 1ZLWH 3PL6D 3HC3L 1YEKL 4M5YH 3CLFL 3MRQB 1CXKA 3P11H 3P9MB 3F6LA 4ZS6C 1CBVH 2E7BA 1U41A 2Z35B 2BSRB 4K9EH 4NQED 1VACB 1KGCE 1YEEL 3MR9A 3QUMA 5C0BB 5CZVL 5DXWA 2BXYA 3ULVE 2XKUA 3GSVB 3MLSL 4M6OL 1W8NA 2ZG3A 5JR1L 3KLSA 3D39E 2NY6D 2CR6A 2X40A 2NY0D 5FV2A 2O26U 1LP9B 4FXGB 1U8MA 3G5VB 2HLAA 3AB0B 2OQJA 2ED8A 4P3CL 5E9DE 1RHHA 4X8JB 4OV5A 1T1WB 1YYLL 5GS1B 3O0RH 4HIEB 1QLRB 2AI0L 4D8PB 4NQCE 4MXVE 3WFCL 4Y4KA 5F97E 1BOGB 5DDHA 5KVFL 3BWAB 3G6DL 4LNRB 1WFUA 4KUZH 5BS0D 2LABA 3UJJL 1K8DA 4UNUA 3E6FB 1NL0H 1ZSDB 1DVFD 3E8UH 5D8JH 4XX1G 3MA9L 4OLUH 3PQYB 3MO1A 3VXUB 3CIQA 4AY0A 1N6QL 3QCVH 3CFEB 3S37L 5L88L 3JV6B 1J12A 3QFJB 4YGVA 2LFGA 5F7KC 5FB8A 1F3JB 3UTPD 1CFTB 4M9OA 1PBYA 4GW1A 5HY9B 1TZHA 5JIIA 5HVHC 1NUFA 5D7LE 4NUJA 3KPOB 3L5HA 5CEYB 3R1GH 2R69L 5JW5B 2CKBA 3BUYB 3JV4B 3KR3H 3WS3A 4MQ7A 3BJLA 4XXCC 1F4HA 5KSUB 1A7PL 1QPXA 4PJEE 4K7FA 4Q2ZA 2WWMC 1KG0A 5CGMA 5F9OL 5IFHH 4J3TA 1H3UA 1NFDA 2O61B 4FQLH 4N5EC 2MKLC 4O2CB 2C3VB 5FGCE 2FEEL 2LU7A 4JKKA 4U1IB 1QBML 2Y06H 3PWVB 2UVEA 2YSSB 4OLXH 1U2HA 1FN4B 5ENWB 5FA4B 2YD1A 3CFKA 1TNNA 2WV3A 5EU7E 3TBVA 1HCVA 1T1YB 5T1LA 3N9GH 4HPYL 4WDIA 4NNXB 4HKZB 2BC4A 3QUXA 4HG4K 3PL6B 5FEBA 4YHIA 2FATL 1VADA 4TNVF 4XNYH 3LIZL 4NQEB 3U0TB 4MA7L 4OCSH 4ETQA 4YC2B 2V7NB 1G7QB 2A73B 5C0FA 3RNQA 3KXFD 1U8IB 3MBXL 2XT1B 1B6DA 4QTIL 4D3CL 3B9KA 1A9EB 1I9JL 1P84J 1WLHA 3EYUL 3I85A 1UZ8A 5JIKA 1F45A 4XP6L 5GZND 4ZFZA 3RWFB 3HE6C 4UDUB 2NY6B 3C9NB 3QDME 4YQXL 2LTQC 3BO8B 1OTUC 5CZXC 1JHLH 3GSXB 1JNHA 1MRFH 2WQRA 4QOKD 1E6JL 4ZODA 1AR1D 1YQVL 4I2XA 5D72H 1HWGB 2XXMB 4GQPH 3LEXB 3A6CL 2F54E 3LN4A 2JCCB 5DRXB 4WFGE 4YDIL 5L2KA 4I77L 4HMEA 1CXIA 3PWPD 25C8L 3CSBA 3QAZC 3WE6B 5BS0B 1IRAY 2GKIA 5I71C 2OL3A 1LO0L 2RQ8A 3L7EB 3ZKSD 2BOCA 2W0KA 1MCOH 3IGAB 3QUZA 1P7QD 2Z0BA 4MSWA 1AQKL 1H8SA 1QFWL 3GO1L 1D5XA 1TZIB 3SGKA 2PYEB 1G9MH 1GIGL 2YKLL 3IJYB 2AGJL 1U92A 4P4RA 1J10A 1PY9A 4BKLA 3BH9B 5F1NB 3ULVH 3SY0B 4PJHB 4YJZL 5D7SH 4NIKB 3ME0A 3D2UB 3GKWL 2AEQH 3WV0A 1LO5A 3CCHB 3L7FB 1NFKA 4JVWA 4PJ9C 1Z9OA 2CR3A 2X41A 4NT6A 3V5KA 1UVQB 4FHBD 3AUVA 1QSFA 2R0ZL 4OCWL 4UT7L 1F58H 3MRBB 3LY6A 2AQ2A 1BX2A 1EJOH 1G6RH 2DQJL 5EU4B 3BKCH 2IAMC 4I3RH 1FVEA 1CE6B 4JANA 3JVGC 1WIOA 5BV7C 5J56B 1KJ2B 2APWA 2KZWA 2VZUA 1DSFL 4ERSL 3HZVB 2GEEA 3CFBB 3TWCH 3NIDF 5C9JB 1ZHLB 1NGPL 1QSEE 3T1FA 5JNYA 1HZHH 3RIAF 2EDBA 5JOFA 1DL7H 2XWBB 3BZ4B 4U6VL 3V7MA 4LF3B 1C08B 3HS0B 3EOBA 5I16B 4HKXA 3S96B 2VR9A 4IS6A 3QO1A 3ILPB 3EYOB 4G8GE 2JLLA 4BM7A 4OJFL 1RK1B 1MLBA 1ED3A 5KSAD 3L3KB 3NAAH 3G04B 2WBJC 3ESUF 4X6DF 1H15B 5GRZA 2BVPB 4ZNCD 5CD3B 5L2JB 3SDDC 4CU7A 4KV5E 3BSZH 1CFVL 3KXFB 1NGXA 2GJZA 3T04D 3UTTD 1CICA 1DTUA 3ZLQC 3MODH 5HI5D 1V3JA 1M7DA 2FGWH 3V4VH 5CJOH 2UY6A 1L4IA 3CAFA 1TJGL 4RA3A 4X9GA 1S8DA 1S7UB 4WTWA 4F15C 4QOKB 2ORBL 4WU5B 2O5XH 3GIZL 2N4IA 4WFFE 3EZJB 2F74B 5MI0B 5ALCL 1RUPL 3CDGB 1KULA 3VA2C 3G9VA 2FD6L 2NXYD 4O2FB 2DIBA 4TPRH 5HI4D 1ZT7B 4X7SL 3PJSB 4QCIA 2N7BA 1P6AB 2AEPH 3AS0A 1P7HL 4PR5B 1TCRA 1FLRL 3MV11 2YXMA 3NZ8A 3HG1A 5FM5M 4CNIB 1JYNA 5F3BA 1RJZB 2YS4A 2AK4D 3S5LB 3FT2B 3OXRA 5LCVL 4YGAB 4EBQH 1JCKA 4HUXA 4NSKB 1ORSA 1S9YB 2GTWA 2X1WL 2ICWJ 4E0RA 1ZA3A 1S7TB 3AXLA 2B1HH 1Q9LA 4AK1A 3H2WA 1SBBA 4C58B 3ARED 1ZANH 2ZCLH 4MCZA 1DDHB 3SGDH 4EJ1C 5TDOB 5H35B 4JHWL 1AKJB 4RQQA 5HDBE 1NUNB 2NY4C 3EO0B 2YPKA 5BVJB 4HGKC 3ARDC 1MJ8L 3KVQA 1KENL 5H2BB 4XC3H 4JFFB 1QVOA 1A1NB 3QH3B 3TBSB 3IXAB 4KROC 3MLZH 4LASH 4XCNB 1YA5A 4BSVB 2FEDC 4L3EE 2LV4A 1OGAE 1J88A 2A74A 5GXBB 3INUH 4I13B 3G5ZA 4I48A 1BFTA 4HWUA 4OAWB 3MX0A 1HH9B 1I9RL 5HYSG 3WXWH 4N0UB 3PDOB 4QY8A 3HHRB 4ODVH 1ZLVH 1I4FA 1QACA 3DV6B 5IHLB 2E7HA 2VJXA 4NRXA 5KVEL 2VDNL 5SWSD 1U8OA 1GH7A 4EUPG 1A2YB 5JMRA 3TO4D 2CDFB 1CLOL 3RZCB 1T6WA 4NDMA 5KSAB 1BZ7A 1CIDA 5C07E 4KDTA 2E27L 5KS9F 2HKHH 1GZPA 2UZXB 3FQTB 4RIRB 4NQDA 3KDMA 1A21A 5LXGH 4DGVH 1T7VA 5FYJU 1MY5A 1PAMA 3FRPG 1AP2B 1CCZA 3FQUA 1CS6A 3K7UA 4J12A 1ROWA 3L95A 4MDIB 1V5JA 4XVUD 4MNQB 3UBXA 43CAA 3V8CA 1C12B 3QUML 2UUDH 2YD7A 1L7TL 2VQUA 5DI8B 2ZOLB 2HFGH 1BJMA 4U1KA 2XPGA 5TGBA 3BD3A 4Y88A 5E95B 2Z8VC 5DD6A 1XMWA 3DVNB 4XTRD 1N5YH 1ODAA 3IRZA 5KANI 3L5XH 4Z7UB 1UWEL 2NY2D 3TYFA 2B2XH 4PRIA 1IMHC 5HGBA 5DHVA 1K6QL 5GRYA 5IQ9A 5I1AA 5A16B 3F7YA 3FO9B 2I60L 2DI8A 5F72S 3EDFA 2AK4B 4XBPB 3V5DB 2XZCH 1DBJL 1UB5A 3L9RA 3EJZC 5DTFA 2V2XB 4JZNB 5DJCA 4HULB 2Y36H 5AUMA 5EC2B 1IQWL 5MENE 4AEEA 1JGVL 1DFBH 4PRHA 2IPTH 4Y5XC 4ZQKB 4KTEL 1AD9B 2DWEA 4A6YL 5DMGD 3EGSA 3GMNA 1FG2A 1CXLA 1WC7A 2VLJD 3NIFE 1I7UA 5F6HI 1GOFA 1YPZF 3K46A 1FNEA 4L1HA 4LCCB 3VE0B 3T0BA 3FCTB 1N2RB 2ITCB 1YECH 3KLHC 2C7UB 4OFYA 1E27B 2P42B 1VFAA 5C92A 2CKBL 4P9ML 4L4TA 4IIQC 4PJDF 1TMCB 2O5ZL 3WHE1 4XP5H 4PV8A 2VDRH 4U6XB 3S35H 1A6ZB 2IH1B 5SWSB 4ZXBB 3ILQD 1T0NB 5ICZB 1LGVA 3M1BA 4KRMB 1MJ7H 2NQCA 5EU3A 4LMQE 3C8KB 5C0RH 1KB5A 1NFIA 5IROC 3WS6C 4PJBE 3MGOA 2W60A 2YC1B 5DEFA 1NCDH 2Y5TB 3BKJH 1T1ZB 1MHHB 3LKOA 1LE9B 1IGCL 4OLWH 1IGJA 4J4PC 3MJ9A 1CI5A 1N0XL 1BQHG 4ODTL 1BQLH 3DUSB 1TJIH 4WNQA 3JTSB 3QQ3B 4PLKC 4CVXB 2AV1A 3KWWA 1FORL 3P4NB 3ALXA 1UG9A 2L0DA 1VERA 4KK9D 4IOSD 4X6BA 2HJKA 4NP4H 4U1MA 2J7LA 4RAVA 3MRJB 2IPKB 4Y5YB 5IMKA 4NZUH 5FO8B 5HHOA 1ITBB 5CEZD 2BDNL 4P46C 1DZBA 2NY2B 1LDSA 3ZSTA 5GGTA 1HI6A 4N0CC 1CLZL 2Z4QB 2GITB 4EI6A 1TVDA 5ID0B 3VGAB 4JFYA 3CFJA 1IGIL 1RUML 2FJFB 1YMHA 2DBJA 4TVPE 2OL3L 4TYUA 5F7EH 2BVUA 2OJZH 5INCB 3BAEL 4GAJH 4L8DB 4DUVA 3AY4C 3ZHKA 5BZDA 1LEIA 2HT2D 4MJ5A 3GGWA 4K3DL 2AJUH 1JPFA 3QWOA 3D3VE 3HMXH 4M48H 1PEZA 2VLJB 3SO3B 1JYXA 1WT5A 3VD3A 2D7TH 3N06B 4IRSD 2WWMD 3PGCA 2YEZB 3DTXA 1YY8B 3UTZB 3EHBC 1ZK9A 1WVZA 3IKCB 4N5ED 4JFDA 5GRVL 2QR0A 3W9EA 2ZUSA 5EZOH 3U36B 4CGTA 1A7OL 3B5TA 1BD2D 3EOTL 1QFWM 3C6LB 4TTGA 3NCMA 5JIPA 3MOBH 4X7EC 4QRPB 1OAZL 1T89C 3PGFH 1JF5A 3K4DA 1FO0B 1NC4D 1U8QB 2DQUL 2VO5A 3ISWA 4PJCE 5L6YH 4LSTH 2IFFL 3RTQD 4YPJA 2Y23A 4P2RB 1GPOL 3HCVB 4QXTB 4Z78B 1KB9J 4GRMB 2GIYA 3F12A 3TT1L 2F8OA 1JZ5A 2AEWA 1AC0A 3B3IA 3VGBA 1NBZA 1ZE3C 2BHUA 4YFDB 2IADB 4DTGH 2B7DT 2IWGA 3ZDYF 1U8HB 2PYFB 3HE6D 1EFQA 1B3JA 1I1RA 3MLTB 5F1IB 4DKEL 1AXTL 4S1DC 2EICA 5CZXD 5D7IE 4NO0D 1T5XA 5MP6L 2YPLA 5FHAH 5HHME 4JY5L 3W81A 4LCUB 3GMMA 4PRPD 3VWJD 5B8CC 5GHWL 2VMFA 3LVEA 1EHAA 4LRNH 3TGXA 1FNSL 3CH1A 3NACH 4ZDHB 3G6JA 4HPOH 1MIEH 1EEQA 2W07A 5DEGB 1IFHL 4YXLH 1ZTXH 4FQ2H 3KPNB 4BH8A 5CLWA 5IV2A 3MNWB 2CK0L 1MH5B 3SKNB 4NJ9L 5E8DL 3TFKC 2P24A 2VLRA 3MLXH 5DVNA 1S9VA 5CJ5A 3U48A 4JCLA 4MNGB 3OJMB 4LDLB 2UZIL 5L8KB 1HQ4A 2O5YH 4DFHA 2H6PA 3QRGH 4W4OC 2AJ3A 5IBUG 4GRLB 4F33A 1PG7X 4UT9L 2QSCL 1ACZA 1XIWA 2YUXA 2DQCL 5ISZA 3V0WH 3BDXA 4M8QB 1CN4A 3T2NL 4TUJB 1RZFH 3I02B 4AIZB 2VLLA 3O6FA 4QRTA 1DBKL 2ZUQC 2W9DH 4PD4J 2R8SH 4M61A 3QHFL 4G6AC 5IB4B 2Z92A 3MRPB 4RSVA 4PJ9D 3JWDH 3T4YA 5KAQG 1FFRA 4AEHH 1Q0YH 5CWSA 5KVDL 2VC2H 2Q76B 1JHKL 3BGMA 4IRSB 4P59H 5F71A 2NW3A 1QRND 2R4RL 5JHDA 1BF8A 4XMPH 1I3RB 1A9BA 3QWRD 3WN5C 2J8UB 5KVMC 2X1PA 5D1XD 1FNGB 4RNRB 1BD2B 1PGRB 3IFOA 2IQ9L 2L4OA 4OI9A 2X4PB 4GRWE 4OF0A 2HN7B 5EB9A 1FNAA 4C83A 5E9DA 1JRHH 5IHUL 4NN7C 3D0LB 4RRPA 1LO4L 4RMUA 3RTQB 1UXWA 3P0VH 3QNYA 4NQCA 2WBJD 4EDXB 1RZIA 5IJKA 3CX2A 1LP9F 3ZDZF 1N8ZB 4M43L 5CSGA 5EUOE 1Q1JL 2JB5H 4LSDA 5MHSE 3TO2B 1CT8B 4TVPH 3SDDD 2AQ1A 1CLCA 4CVZA 4QRUB 4XH2A 1SVZA 2BFVL 4YK4C 2FR4B 5DMIH 4Y1AA 4L29B 5FYLD 3OKDB 3MCLH 2MWCA 5FO7A 5F7NC 1A3LL 3VFRA 3NFPA 4Y4KC 2LTQB 1OF2A 5DHYB 1ETZA 4N8CH 4NO0B 5DWUL 5DQ9B 3MUHL 1T5WA 1B0WA 3NH7L 5IVZB 3BD5A 4YEEA 4UB0H 3QG6B 1T3FB 2X4RB 2HTKC 4PRPB 3VWJB 5F9JB 5D7LA 3B2VH 3WNMA 1RULH 2EIBA 3PWJB 4P23A 3GMPA 4LLYA 2EYTA 2X9XA 4CDHA 2C3WA 5EN2B 4PJEA 1S7XB 3L6FA 2AJZA 3OKEB 4C56D 5GRUH 4WFEE 3OHXA 5I19L 5EIIB 3T3PE 2WQ8A 1AC6A 1WBZB 3FB5B 4R8WH 1AXIB 1KLUA 4JG0H 3P77A 2BNQB 4WV1A 3QHTC 4YR6A 1VFUA 3WFEL 4P2QD 4R4NC 5FYKE 2HT3C 4D0CB 3BH8B 2R0LH 1T2QH 2DQIL 2PR4H 3DBXB 4PJ9B 4PY7B 3D85D 4UIKH 1DEEA 1UKTA 4JHAL 3HE7A 4PREB 4J6RL 5C09E 4KROD 4L3AA 1FDLL 1G1CA 4CU6A 1NC2D 3HA0A 1J0YA 1R3KA 3U2SB 4U1NB 4WUUD 1KIQB 4QWWC 1FBIH 5D1XB 4TULL 3QUXC 2A6DA 3S34H 5GPRA 5K9JH 3QDMA 3LSOA 1ZOXA 3U30C 3REWB 1FZOA 1JE6A 4O5LL 3E6HA 1A4JA 1M6OA 1NDGA 2XRAL 5E2WH 1EXUA 1NQBA 3RZWA 1U93B 1XF3B 5B4MC 5KSBE 4HC1H 5DK0A 1LWRA 5CSZA 5F9AC 1T66C 2WBJB 1OPGL 5FKAB 2FL5A 1NCWL 2R15A 3BGFC 4U4BA 5TE4H 4EOWH 3H9HB 5DD5L 1KTDA 4OFVA 1WWWX 2VAAA 4Y7MA 2QHRH 1I8IA 3ES6A 2JCCF 2Q8BH 1AGCA 3U7WL 2VZTA 1NAKH 1YNTB 4A2MA 3SKOB 5IGXL 2R2BA 3OGCB 4AEIL 1DLHA 4KKCC 3QJFB 3N85H 1ZGLM 3MLUL 4V1DD 2BNRD 3H9ZA 4DW2L 3NCJH 3OJDA 4F2MB 1WBYA 3WDIA 1LO3L 5FUZH 3QUZC 3W11C 3HPJB 1A6PA 4BFGA 1DUZB 4X6FB 2HMIC 5ANME 4NO3A 5F7YC 1K85A 4NM4L 4DVRH 4M5YL 1F3DJ 1CBVL 4YDKH 3P11L 2ZSVA 3C60B 4LVNC 3BZFA 1U91A 3D25A 4K9EL 4QRSB 3SGKC 4UBDC 4ZUWB 1CFNB 4GRWH 4AL8H 5HYSB 1CGSH 2AJVH 2ZNWA 3C2SA 5AYUH 3RWDA 1XCTA 1DE4B 1NSNH 4PJFB 4EUPB 5CIPH 3L3GA 3BPLB 5FA3A 5MEOA 3U0WL 2R23B 5E6ID 4PIRF 5BXFB 5TE7H 4MJID 5IP4A 4OKDA 3ZKMD 3EYQC 3JWOH 3BVNA 3VXSD 3QFDA 1XT5A 4ZS7H 1OAQL 4U7SA 3IJHB 5BOZG 3PHQA 2X89A 4KUZL 5EC1B 5F7DB 3MRKB 2AW2A 2ATPB 2YUWA 2JJWA 1NC2B 1NL0L 2VDQH 4BK4A 1ULVA 4WUUB 1UM4H 5E8EA 5EBLA 5D8JL 3LRSB 3NBNA 4OLUL 1M1SA 3CMOL 1F00I 1JJUA 3QCVL 3RUGE 1M05B 2DWDA 3VXOA 1SMOA 4WHCA 2NTSP 4NJAH 1CDIA 4J8RB 4NRZA 3TCLB 2GSGB 1HH6B 2V9QA 2VNCA 1AY1L 4ODBD 1UXSB 1P5UA 2Q6WB 1CICC 1F4XH 2E5EA 2Y9RT 3BWUC 4G8EB 3VH8B 1QNZH 1RK0A 4PGDB 3T0VA 3R1GL 3OG4B 3KR3L 4JO4L 1CK0H 3G5XA 4KK5C 1W72A 2H2PD 1G7MB 1U95A 5GJSH 3WNNA 1VFBB 3AGVA 5C9KA 5GGQH 5T3XD 4CL7A 5IFHL 4R4BB 3MRGA 4LAJH 1YYMH 4J4PD 3O4OB 4P3DB 4FQLL 2CDEB 4OM1H 1OM3H 4LCWE 4ZD3H 4FZEL 1G6RB 5C0IA 4JR9H 4PLKD 2Y06L 3VFUB 4ODXA 4V1DB 2BNRB 2K7PA 5DD3H 2XQYK 4OLXL 3ULSA 5HYJE 1MCNA 3IAQA 4HJJL 1GGBH 4OCRL 3R0NA 3MZTA 4GQ9H 4PGEA 5I8KH 3N9GL 4OZIB 5IB3A 5E2VH 3G08B 1OARH 4OQTH 3MROA 4XVSH 5DUPH 3MUZ1 4XNYL 2X7LB 1KPUB 4WTZA 3DIFB 1B4RA 4OCSL 1JMXA 4NWUH 3MV9D 4XVTH 2AKRB 3HTLX 4P46D 1B0RB 5BO1L 4BSWA 2HG5A 1YEGH 2CLVB 4L3EA 3IDNA 3CC5A 4N0CD 3PABA 4Y16A 2VWEC 3WIHA 2V2TB 4YFEA 2ZUUA 4ZO8A 1J1OH 3RPIB 5C0EA 1CD0A 5J3HC 3IDJA 3TM6A 1JHLL 4M4PA 3DUUA 3CVHH 5E6IB 3GZKA 3VD9A 5A2IH 3CVIH 4MJIB 4M7LH 5ITBL 1MRFL 2VXVH 3ZT7A 4NGHH 1IGML 2Q20A 5D72L 3VXSB 2K3TA 4K94H 2UWEB 4Y5XB 5HPMA 3BQUC 5C07A 3GHBH 4M6MH 3NCFB 2JB6B 3EBAA 3UPRB 2FECL 5FYJH 5DT1H 1BQHB 1NBVH 1MCOL 4JN2A 5CS7A 1A1MA 2VXSL 4L4JA 4LSPH 4NN5B 4UU9A 1BFOA 3EHBD 4TVSa 2MNUA 1EHLH 4K8RD 5CD5D 5C0NC 4KDTC 1G9ML 3ZSSA 2NX5D 1WZLA 3GSQA 3HMXA 1U8KB 1ZHKA 4FABH 2KQNA 4P4KC 5E8NA 5DFVC 1C1EH 2WZPD 3IDYC 4IMLB 4MJ6A 3ULVL 1I75A 5D7SL 1HHKA 5EH1A 4F7CB 2AEQL 3P73B 2P8PB 1VKXB 4MS8C 4Z76B 1CL7H 3SQOH 4MD0A 1I7ZB 3RVUD 1UQSA 2X10A 3QDGD 5C2UB 3Q6FA 1F58L 1EJOL 1KCVH 3LQMA 4I3RL 4Z7VB 1BGXH 1GGCH 7CGTA 4X0KA 2OP4H 1C5CH 4ODWB 5E00B 4QF1A 3O4LE 4U1HA 5K9QI 4EI5A 1Y18A 2DYPA 1JI1A 4S1QL 1KFAH 4S1DD 3WSQH 4XVJH 1EX0A 3HI1B 2R56L 1HZHL 4J3WA 5EOTA 1DL7L 1JZ2A 3VFMB 4JO3H 1R5VB 4H1LA 3S6CA 3P4OB 1FC2D 5MENA 4H25B 4JM4H 1JF1B 4DN3H 3NAAL 1A4KA 2FJGA 1JZ8A 2V7HB 3I9GH 5JXAH 1T1XA 2DF3A 3BPOB 3MV9B 2QL1A 4P46B 3BSZL 4JLRA 1S7WA 2DTSA 2FX7H 5AWNH 1NGYA 1MPAH 4B7LA 2J88H 3MODL 2JIXA 5I66B 4YAQA 2FGWL 3AAZB 4XXDB 4M7LT 1K8IB 4Y0GA 1QSZA 2BY0A 3UMTA 1JGDB 4P57B 1BIIA 4P5TB 3BN9C 3I75A 3VI4F 1SEQH 4JPWH 4Y2DC 3T0WA 5D6DA 1I9IH 3OL2A 2O5XL 2X70B 4GG6B 1RURH 4X4ZA 1K3ZA 4I8DA 5T1DL 2VH5H 3DX9A 4G6AD 1MHPH 1KACB 1MFDH 4UTBH 1MFCL 4TPRL 1NEZA 4PJBA 4PJIE 4OGYH 1FNHA 2AEPL 3MLVH 3PWLA 1UACH 3QSKB 5FDWA 1JTPA 4XCYB 2WLYA 1ZS8B 3B4NA 1A1OB 5SX4I 4F58H 3GSRB 4LLWB 5D1QA 3NIDE 4EBQL 1G7IB 4UUJA 2CIKB 4UOW0 1GCFA 2K1MA 3IDIB 2EKSA 2B1HL 3E3QC 2QHLA 5I73B 1YN7A 2R2CA 5J9PB 5DUMH 4ZAKD 1ZANL 2ZCLL 4H8WH 3WFBH 2VLKE 2FSEB 2G5RA 5GGUA 4CJ1A 1Z2KA 4MLIA 1KEGH 5FOBA 3KPPB 5JDSB 4X6DE 5IB2B 4JDZB 3OAUH 4HIIB 3X12B 3QDGB 1F5WA 4XC3L 2J8OA 4K9EC 3MPCA 3MLZL 4LASL 1AE6H 4D9RE 1QZ1A 3GI9H 3H9SA 1XGTB 4HS8L 3T8XA 3INUL 1S7SB 3O2WH 1IBGH 1U3ZA 5GGRB 2DMCA 3WXWL 3QO0A 4Y4KD 3DGGA 2A9NH 5DRZB 1WFOA 4WUKH 4L4VB 5E1AA 4RAUB 2E7LA 4OBRA 5DS8A 4MNHA 4P48A 4ZSOE 1JWUB 4HFWB 3DVFA 2HTKD 3TT3H 4WEMB 3LPWA 1JZ3A 4ZO7A 3I6LD 1FFOB 3QULB 5EZJA 4XRCB 4N90D 4K7PY 3FB8B 2AAVA 2XN9E 2HKHL 3D3VA 4E5XA 1T22B 2FZ3B 1HILA 5LXGL 4S2SB 4XPAH 4WCYL 4Z77B 4R7DB 3K1DA 1W0YT 2AXHA 5DQJA 5FKPB 4NC2B 4Q58C 1ZT1A 1RAMA 1DQDH 2J6EA 5CGTA 5HXMA 5F6HJ 3BHBB 3BPCA 4J1UA 4G9FA 1T20B 3A6BL 1BVLA 1C7TA 4EIGB 3O3DA 1I1YA 1N26A 3W5NA 4Q9BA 1WT5C 3MMEB 4R4ND 2HFGL 3LEVL 4XNUH 4Y8AA 2QTEA 2Q7YA 2WINA 2HT3D 4XWOC 2ZUQB 4PJCA 4K71B 1PFCA 4UAOB 1U8JA 2HRLA 5I1EH 2EDEA 4JZOA 3GUTB 1N5YL 5D7JA 2HFEA 3L5XL 3LD8C 4LGRB 3ARZA 4LOUC 2GJ6E 4OV6F 4QWWD 5T1LD 3AU1A 3P9LB 3GJFB 4WFHE 3QUXD 3SDCA 1B90A 5HYEA 3RAJL 4Z0XB 3E1F1 1IKNC 3MR9B 3QUMB 1J1XH 2EXYC 4JQVA 2A77H 1Y6KR 4NN7B 3ORJA 4ZAKB 3OR7B 1CD1B 1F4AA 5B4MD 3B9KD 5DJDA 4DK6A 2IPTL 4LCYB 5E8OA 3VI3E 5KS9E 1IZJA 5E0QA 1EGJA 2HLAB 3VWKA 1OAUH 2OQJB 5D5MB 1RHHB 5M7QA 1G9NH 1WBXA 1OQXA 2R2EA 2Z93A 3DX7A 1FL3A 3HFMH 5DJAA 4KKNA 3FQRB 2K7QA 5E8PA 2ZPKH 5L2KD 4Y4KB 5DDHB 4D94A 5JPNB 4XP5L 2OCFD 5I8CA 5IIEB 1W72L 2VDRL 3S35L 3ZKXB 1K8DB 2HH0H 5D1ZA 4I9WD 2MCPH 5JW3L 3W11D 1MJ7L 4L3CB 2JJVA 5L9DH 5C0RL 4K7PX 4AM0A 3KNBB 2CLRA 4IOIA 4UBDD 3VG0H 4OB5H 3DOSA 4YGVB 1NCDL 4U3CA 1XIWC 3GMLA 3ZKNC 4KK8C 3SE8L 4LSRH 3O6FC 3H3PH 1QKZH 1IM3B 3QEQA 3ECBB 1BQLL 4NUJB 1TJIL 4M7JH 3WS3B 1G9MC 4MQ7B 1QSFD 5HDQH 1KEMH 2VITA 3FZUC 4K7FB 3MV7E 3CPLA 4Q2ZB 1Z9SA 3EYQD 1KG0B 2J8UF 4IEFB 5ESAA 4XPTH 3ULVC 1GOHA 4NP4L 1NFDB 1PDKA 4OZFA 1AGBA 3IDMA 1U8PB 4FQIH 1IQDB 1Z5LA 2H2SC 3UYOD 4HWBA 1AHWB 1YPZE 2BOBB 2LU4A 4GBXA 3CFKB 3OQ3B 5CGYD 1PKQE 5T1LB 2CRZA 1JWSA 3V9FA 3BEVA 1CF8L 4WDIB 3CX5K 2BC4B 1WWBX 3QUXB 4TUKH 1I1FA 2NY1B 3QQ9C 5IJKC 1I8KA 2P1YA 3MREA 5KVGL 1KCLA 5EOQH 5F7EL 1IL1A 4ETQB 2OJZL 4ZFFB 1DQJA 1PZUB 5TE6H 3RNQB 1LEKA 4GAJL 3UPAA 5EA0H 1P4LB 4P2OA 1CICD 3B9KB 1UZ8B 5E2TH 3GI8H 4Y5VB 1V3MA 4ZFZB 4HWZA 1L9MA 4JFHD 4HG4J 5AD0A 2AJUL 5GS0C 2CIIB 3HMXL 1K4CA 4M48L 2XNAA 4N9GA 1FZKA 4M1DH 4KK5D 4X98A 4ETYA 4OZGE 4X5WB 4LNVA 1TLKA 3O45A 4JRWA 5EOCJ 3DWTA 4I2XB 2ZP0T 1PLGH 2NMSA 3LN4B 1KTRL 4MZ3A 4U1LA 4BZ1H 3KPMA 2DKUA 1G84A 9CGTA 2P4AB 4KZDH 3H0TA 4MAYA 4P23C 4RRPG 3STLB 3MOBL 4BFIA 4MXQC 3D18A 4OI7A 3FN0H 2VDLH 4NKIH 1A7RH 4LBEB 1FFNA 3O41A 4WJ5A 5L6YL 4P5KA 4LSTL 3Q5OA 3HG1D 3ROOA 1D5XB 1U8LA 4LVNB 1HHIA 4U6HA 3GSNH 3VFTA 5JUEL 3GSUB 1U92B 4PGCA 5C09A 4O2EB 1SM3H 4BKLB 1FVDA 1YEDB 3FRUA 4O02H 3DARA 3FKUS 3O6KH 1ZKAA 4MCYB 2Z9TA 3VCLA 1WZ1H 3V5KB 4NT6B 5J3HD 4E42A 2HT4C 3FFCB 2CO7B 3HE7C 2AVGA 1ZAGA 4YDJA 5FHAL 3O2DH 3WUWA 1U58A 5KSBA 2IQAA 1AO7E 3DRQB 2Z31C 3TPUA 2R1WA 4LRNL 4GG8A 3KPSE 3PXJA 3NACL 5DJYB 3T1FB 3D9AL 5JNYB 4HPOL 5JOFB 1MIEL 3G9AB 1KPVA 1XAUA 2JELH 3EOBB 4HKXB 4FQ2L 4IS6B 5ID1A 3W5MA 3QA3A 4K23H 4U7KA 3MLXL 4U3XA 1YDPB 1T2JA 4Z0BL 1MLBB 1G9EA 1ED3B 1OD7A 1GJIA 3V8OA 5I0ZA 2O5YL 4ZUUA 5C0ND 3QRGL 2ICWB 5L8JB 4MA3A 3MTRA 1RZJL 5E99H 1V7MH 3V0WL 2GJZB 1FG9C 4CBPA 5DFVD 1TVHA 4PYGA 2OTUA 3CK0H 5ANMA 1M7DB 1AIFA 4YHNA 2W9DL 3B6SA 3FMGH 4Z7WB 3PHOB 2VERN 1WAAF 4FMKA 1Q0YL 5HYQA 5EFIB 3M17A 3QIWA 2VC2L 2MCG1 4P59L 1HHJA 3EFFA 1JYWA 5J6GB 3SE3A 3FN3A 4AT6A 1ITCA 3RWHA 1R5IB 3ZDYE 1WCBA 3LS5H 1Y6NR 1UM6H 4R2GB 5MEPB 5DMYA 1FFPA 1J05B 2GY5A 1R3JA 1YUHA 2EC9U 4YWGL 1P53A 2ZUVA 2FEEI 4Y4FC 1I1AA 3S8WA 2IPUK 1SJEA 1MHCA 3FO0L 1TCRB 1VGKA 2GTZA 3JV0A 3NZ8B 3HG1B 3P0VL 1BVKA 4JN1H 4FZ8H 5C71A 3FONA 2FX8H 2VL4A 1KNOA 3TJHC 4PLOB 4HUXB 4JPKH 4TVPL 5D6CA 4F37F 1ORSB 2GTWB 3N1GC 1MRDH 4E0RB 4KZEL 3AXLB 1BJ1H 1Q9LB 1N3NB 3QI9A 4XNXH 4LHQB 5CAYB 4MCZB 4U0QB 1CZ8L 4Q97A 4KY1H 4X8XA 1F4WH 4PRHD 1U3HA 3UTSE 3ZE0F 3RUGA 5FV1L 3QDJE 2YPKB 4N8CL 4HKBA 3SGEI 2AK1L 4HCRH 3GMQA 5HVWA 4UB0L 3V7AE 3IS1X 4U33A 1BLNB 3G5ZB 3GM0A 4I48B 2DLGA 2J6EL 5C0DB 4OFYD 2N1KA 1U3YA 4PJAF 4L4TD 3RGHA 1T0MB 1I4FB 3DYMA 2V6HA 3JTTA 1W0VA 2DQTL 3RQ3A 3VMNA 3BIAX 4NRXB 3NPSC 1T7XA 2NTFA 1U8OB 3CDCA 4HDIB 5GRUL 1RUAL 2OR7A 5JQ6L 4NDMB 4HAFA 4LCWA 5F89A 4WIQA 1QFWI 5HYFA 2AABH 3V4UH 2A1WL 5C0BE 3MUGA 1JUFA 5IFAH 5HYJA 1FCCA 1KJVA 1OSZA 3HC0B 3KDMB 4KHTL 3GEWB 5CIPB 5E6ZA 4URTB 1T2QL 5LGHH 2PR4L 3BN3B 4FNLH 1OAKH 2P8MB 3L95B 4UIKL 3DROB 1UB6A 43CAB 2RB8A 1PG7H 2P48B 3RX7A 3L1OH 5DC0A 4AZ8A 4ZYKB 1VCAA 3HB3C 4JHBA 1PQZB 1N5AA 1GC1L 4OZIF 4ACPA 3TZVA 1FBIL 2XPGB 4IM8A 4WO4A 3WNKA 2D0FA 1OLZA 4CRPA 5DD6B 2EO9A 2BVQA 4XAWH 1XF2A 3F7PC 1NDMA 5IK3B 3BX7C 5HHOD 4U0RB 4U1GC 4UI2A 5E2WL 2HJLB 4P9HH 2VN7A 4LVOC 3TYFB 4FQCH 3PQYE 3VXUE 2B0SH 5HGBB 4XMKL 4HC1L 5DHVB 1HXYA 3QNXA 1IAKA 4Y16C 3CZJA 1F8TH 1FL5B 3F7YB 4POUB 4DUXA 1XGYL 3QFJE 3GBNL 2QQKH 4HUWB 2QSQA 3FB7A 4EOWL 1R24A 1TITA 2FHFA 2XZQL 4LKXA 4G43A 3V6OA 4TQEH 3L9RB 3ZMRA 2GAZA 3ROLB 3VFWB 4JZJA 3WHXA 5AUMB 2OXHA 2RFXA 1UKQA 5F9WB 2Q8BL 1XR9A 2UWEF 4M1GH 1JPSH 3TF7C 2CLZA 4PRHB 4LRIA 1NBQA 5CJQH 2BVOB 4OKVB 2VDKH 1R3LA 2NNAA 3NCJL 4HIHA 4KQ3H 3EOAB 3EGSB 5B3JF 3GMNB 1ZLUH 1FG2B 1WC7B 4RGOL 1I7UB 5FUZL 3HAEH 4YFLF 1IAIH 3RIFF 2A6KA 3ZE1F 3DVGA 3P30L 4OD2A 4XWOD 1EVUA 3NFSH 5J1AA 4G7YH 2CJUH 4JFDD 2ZKHH 1VFAB 4YDKL 5HGHB 5IVOA 4OZHE 2F58H 1HKLH 4AL8L 4JFZH 5I6XC 3WDJA 1BFVL 1GYAA 1I3VA 2CSPA 2NR6D 3TBYB 4I4WA 4LOUD 5AYUL 1NSNL 2SEBB 5EU3B 2B4CH 3O4LA 4NQEE 1OP5K 2OLDA 1KB5B 4LSQL 2UYLB 4WVRA 3L5WA 3MGOB 3RU8L 5IEHA 4NQUA 4O51A 3ZL4H 2EYSA 2W60B 5DEFB 5TE7L 4Z7VF 3U82B 5IVNA 2C4FU 5DGRA 1IGJB 2D2OA 4ZS7L 4LSVL 4YO0A 4NC1E 2CRIA 5ALBH 1D5ZA 3K80A 4EI5C 4WNQB 2VABB 2GI7A 2AV1B 1SYVB 3D69A 3WDHA 3BESR 4KXZI 5EIVA 1P9MA 2JCCE 2YPLD 1UM4L 2LAGB 3CZFA 4G8FA 2YR3A 4NBZB 2GK0A 4X6BB 3LV3A 2HJKB 4U1MB 3BI9X 2NLJA 4ZPTA 4J7RA 5BS0E 5FUOL 2DQFA 5IMKB 4NJAL 4FQJH 2GFBA 4PRAA 5HHOB 5IEKA 2EH7L 3GSWA 3GHEH 1N64H 4GKZB 3KYAA 2APFA 1HI6B 4HIJA 5C7XL 1F4XL 3AS3A 2VLRD 3HZYB 4PGBB 4EIZC 1QBAA 2PYEE 4JFPA 4JFYB 4OIIL 3BGAA 4X9IA 3TYGL 1CK0L 1RY7B 3CFJB 4HBCH 2WMPA 1YMHB 4PJIA 1J1PL 3MGTA 1JPST 1XIWD 4PJHE 5ISZD 3ZKND 5GJSL 4X5LA 2ZOKA 5DYOA 2H45A 4GG6F 5FYKL 4BFBD 5GGQL 1LEIB 5D6DC 4CN1A 3BZEB 2VR5A 1YYML 1A7NH 3ARBA 3O6FD 1OM3L 2OM5A 1A0QH 4RMQA 2X4OA 4MJ5B 1CU4H 2ADFH 3GGWB 5JLZA 1JPFB 4BQ6A 2DRUA 5DD3L 4H1LG 5F96H 1RZJC 3BD4A 5GGVL 3OKOB 4GQ9L 3PGCB 35C8H 1OP9A 5JHDD 5I8KL 2QQQA 2HFFB 2VLKA 5E2VL 3LQAH 1P4IH 1N59B 1TJHH 3RNKA 2QR0B 2FWOA 3W9EB 4XVSL 5DUPL 4OGXL 5D1QC 2BXZA 5TQ2H 4JE4B 4JJ5A 4QYOA 2H2SD 4NWUL 4XVTL 4JG1H 4S0SD 2AV7A 1UKSA 1YEGL 1IM9A 4NHCH 5E9DD 5LQBH 3TBWA 1P69B 4X4YA 5C8JB 1OW0A 1XGQA 3MRDB 4ORGA 4PJXF 4NQCD 3MRLB 1J1OL 4UTAH 2APTA 2F15A 3U4AA 4X7DC 5KANG 3CVHL 1MNUH 4Y4HA 4Q6IA 3CVIL 2OI9B 4M7LL 3SE9H 3SHSA 4GAYA 5BMFL 3GMRA 4NGHL 3B3IB 6CGTA 4Y1AD 1A6VH 4N8VA 4ZSOA 2YPVH 1X5IA 5E08H 1JGLH 5TDNA 5ACZA 1BOYA 4OLEA 4IBLT 3GM8A 5AZEH 1DQLH 2IFGA 3GHBL 4UMGA 5GS0D 4M6ML 1XF5B 4FG6C 2XN9A 2NW2B 5J4MA 5I74C 4QOKE 5AAWA 5DT1L 1NBVL 1QSVA 1T5XB 1I1CA 4D0DA 4Z9KB 5KAQF 2YPLB 5I15H 1CVRA 2E7LC 2F53B 4LSPL 2GCYA 4LKCA 3GMMB 1OGTB 1EHLL 5D7LD 5M94B 3LKRA 1KC5H 3W0WE 4P23D 4OTXH 4MXQD 3G6JB 1QHOA 5H37H 1FPTH 5I1IL 4XHJD 5F7HA 5TH2A 4BH8B 2YRPA 3RVVC 2H3NA 3NCCB 1CIUA 2VLRB 5C0JA 3ESVF 2FDBP 5KBNC 1HQ4B 3LKQA 4N9OB 5FHBH 1CL7L 4ZFOA 3O8XA 1Q38A 4GS7B 4F33B 2ENSA 4XBEL 5CFHA 4JQIH 5T5FH 1KCVL 3HC4H 1WCQA 3T0EB 4KDVA 1BGXL 1GGCL 2AQ3A 2GJ6A 2VLLB 2OP4L 1C5CL 3O6FB 4AEFA 4M61B 1GSMA 3WSQL 1E4XH 1KFAL 4JFFE 2XTJE 3OMZA 4XVJL 1F6LL 3T4YB 2HT4D 5E56A 1Z6JT 1FYTD 5CWSB 4RCAA 3HE7D 5D7JC 1U8NA 4F37K 1RVFH 3PNWA 3BGMB 3TBTB 1DQTA 2NW3B 5JHDB 2DQHH 2ADJA 5LJYH 5IM7A 1A9BB 4JM4L 3VGFA 4DN3L 1X6NA 4WGVB 1JWMA 3QDMD 4Z5RB 5KS9A 4DGIH 3W2DH 4R96A 4NRYA 4GKNB 2X4QB 3MCG1 4QT5A 2K9UA 5F8QC 2FGZA 5JDJA 2FX7L 4C83B 5AWNL 4JQVC 4IHOA 4FFVC 1AJ7H 1GRWA 4OGZA 1GC1C 1PZ5A 3FQNA 4PRBA 4NQCB 4OLYH 2XKNA 3QNYB 4WFGD 1PD6A 1NMCC 1FFQA 3ZDXF 1RZIB 5TFSH 5DK2A 1S78C 4KMTH 4HK0A 3CH8A 4MB3A 4X6EA 2F8XC 4HWEH 5D5MF 4CVZB 1J0ZA 3B83A 1T21B 1BEYH 2QKIB 1SEQL 4XH2B 1S7VA 3OXSA 1I9IL 3BRGC 4Q9RH 4Y1AB 1B4JH 5I1LB 1RURL 1FV1A 3ZT6A 4YBQC 3GFUA 3NZHH 2VQTA 2VH5L 4MNQE 3VFRB 3VFVA 1MFDL 1OF2B 4UTBL 4MDJB 1JPGA 3PHSA 1ETZB 4R0LA 4U6TA 5DJ2A 4OGYL 4KHXH 2V17L 4F7MA 3MRHA 4XBGA 2DQDH 3LN9A 3QISA 4AYFA 3MLVL 2IANE 2ADIA 4U6YB 1UACL 2H1PH 1PYWA 4KAQH 4JFQA 2OS7A 3QJHB 5D7LB 3P40A 4F58L 4Z7QF 5K33A 5I2IA 4Z95H 4POZC 5ADOH 3GMPB 4Z7UE 4LLYB 1PG7W 1HHHA 3D48R 5J06A 1CR9H 1DR9A 5J1TC 3WFBL 1X5LA 1QA9A 3OHXB 2AK4E 3DSFL 1Z0MA 4ELKA 5JPMA 1KEGL 5FGCB 5T3ZE 3HNSH 1OT1A 3OAUL 5IR1A 1KLUB 3TJHD 2R29H 3P77B 1ZV5A 4WV1B 1EIBA 3SE4A 4HXAH 5E94B 3S36X 1XZ0B 3U0PA 2V5MA 3UZEA 1AE6L 1YPZA 4HEPG 4HX1B 3GI9L 3ARXA 4KUCD 3HI5H 1NFDF 2NY7H 3V6FA 3RDTA 1IBGL 2HTLC 1JPTH 3CXDH 3SKUD 1QBBA 4L9LC 3F5WA 3GMOA 4PJ8A 2EE3A 4JVUA 4TUOB 4YE4L 2X89D 1FYTB 2W0LA 3VI4E 4WUKL 4LLVB 3FOMA 1IC7L 1LO2H 4YX2H 1OL0A 2VQ1A 3F7VA 1KIPA 1Y0LA 3TT3L 4DOHE 5D93C 5HHQA 5KJRH 3TNNB 3BP6B 4XPBH 4RDQF 2A6DB 3HLAA 1RJYA 3LSOB 4EZMA 4DCQA 4X6CE 3E6HB 4ZO6A 1NDGB 4OZGA 2VDMH 4XPAL 1EXUB 2B8OT 4XNQB 5ECJE 4S1RH 4P2OC 4YDLB 3RIFK 2DDQL 5DK0B 3HPLB 2D03H 1XEDA 1ZVYA 5CSZB 4H26A 3WNOA 2FL5B 1IEBB 1T4KA 4ENED 1A6TA 4LDEB 3HNTH 5LAXA 1L7IH 3VG9B 1KTDB 3F7QA 3JV5A 5FFLA 3AMKA 2VAAB 3IF1A 4OZFG 4XNUL 1G7HA 4LP4A 3ES6B 5EBMB 1AGCB 2KUTA 1L6XA 4MAUH 1YMME 3L3OA 4X80H 3CUPA 2R2BB 2QSVA 1DLHB 4W70A 3NCYP 4NNYA 4EQ3A 2ICCA 1S9XA 4YLQT 1BJ8A 3OJDB 1WBYB 2LVEA 3DRTA 3DXAA 5IKCA 3U9PH 5FGBA 3SCMB 1AR2A 4NO3B 4NO5A 3ALPA 5IB1A 2X4NA 2QQNH 1IC5L 2APVA 1G0DA 2ZSVB 3EYFA 1X5YA 3BZFB 1U91B 3GNMH 4OGAC 3R06A 3C8HA 3BT2L 1J5OH 1VFOA 2R0WL 1J1XL 3B43A 2A77L 5TF0A 3VDAA 3UEZA 2DJ4A 4L3ED 1XCTB 1AO7A 4Y16D 1ZLVK 3OR6A 5K9KA 2QEJA 1RZKH 1P1ZB 3KPSA 2FNBA 3L3GB 3CSPA 1HOCB 2W91A 5MEOB 3QNZA 3PWNB 1Q9KB 1G9NL 1N6VA 2OMBA 2R9HC 5ESQA 4OCMC 3BVNB 2VKWA 3HFML 3QXDA 5INDA 2DS4A 32C2A 1YNKH 3QFDB 2ZPKL 1FJ1A 3MLYH 5C07D 1A6UH 2VLJE 5FM4A 1BIHA 3T1WA 3LKSA 3SO5A 4D9QD 3MFFA 3KGRA 4XNZC 3DURB 2HH0L 1AGEA 2MCPL 2VTFA 3BPNC 5E8EB 2APBA 5EBLB 1WIUA 1UJ3A 5L9DL 4KKAC 3UJIH 4QRPE 2DWDB 3RWCA 3VG0L 3VXOB 2A0LC 3NPSB 3UBXI 1QO3A 3IDGB 1WIPA 5B22A 1QPPA 1XCQA 4UNVA 2X6MA 4G9DA 3H3PL 4Z7WF 1QKZL 4P2RE 5JO5A 3FT4A 1UCBH 4JRYE 5A40E 1RK0B 2D7NA 3WUWG 1A7QH 4C59B 1EZVX 4P3WA 2BMKA 3QIWC 15C8H 5HDQL 5J11B 5DD0L 3FO2A 4OFDA 1YEIH 2RHEA 1U95B 3VU2A 4ODSH 1KIRA 1HXMB 4ONGH 4XPTL 2VSDA 3SE3C 1IGYA 3MRGB 4M3JA 4HS3A 2Y6SD 4EI5D 2DYPD 5HVGB 2AJXH 5C0IB 1Q9WA 4FQIL 3ULSB 4K3JH 1I7RB 5IJVB 4MVBD 3VRIB 1I1AC 4FFYH 1IGFH 1BZ9A 1A14H 4PGEB 3RJDA 2XACC 5I0DA 4TUKL 4HHAA 4M6NH 3T3MF 1HYSD 1TVBB 5I1DA 4D0BA 3UTSA 5CEZE 3QDJA 3T09A 1RZGA 4HFUH 4PJ7A 4U1GB 3C5ZC 1KTLA 3OB8A 5TE6L 4LVOB 3PIQB 1YQ2A 2L7JA 5EA0L 1KCKA 4MNGE 4QRQA 1PKOA 2BRRH 2JIXD 3QI9C 3GI8L 1NCCH 4XI5C 3CLEL 4FXLA 3SN6N 3SPVA 1ORQA 1S7QA 3IDJB 4HT1H 1CXEA 4M1DL 3DUUB 4YHZL 2AXFB 1SEBA 2VISA 1PLGL 5IVXB 4YEFA 1LE5A 4BZ1L 1FGVH 2FX9H 4ZFOL 5HPMB 2Z35A 2BSRA 5C07B 3QEHA 2BCKA 5BVPH 1AGDB 1G7PB 3AS2A 1VACA 6FABH 4KZDL 1X5XA 5DJ0A 4FQHB 1FIGH 2I5YH 3VGEA 4F7EA 3GKZA 1M71A 3FN0L 2VDLL 2J8UE 4JN2B 4NKIL 2P8LA 4UU9B 1BFOB 1NGZB 1BD2E 3GSNL 3LPFA 5D1QD 3GSQB 1ZHKB 2BX5A 3OAYH 5CSBA 4G6FD 1IKFL 4NO2A 5E8NB 1NLBL 3NABL 1RMFL 4D8PA 4PJ5D 4TSAH 2MQ0A 2V5SA 4O02L 4N1CA 3GJFK 1BOGA 5SWQB 5I17A 2EIEA 3O6KL 2Q87A 2BSSA 3KJ4B 3VXRA 1WZ1L 3WFZA 3Q5YA 4MD0B 4G80B 5CEXB 4JGUA 3RKPA 1ZSDA 1QFUL 3LRGA 5C08B 1ZHNA 1EPFA 3H9SD 4R4FL 3SJVA 2HWZH 2APXA 4X0KB 3TZVC 3CFCL 3CFEA 3OF6A 5ADPH 3QIUA 2DM7A 4WO4C 4BA8A 3JV6A 1Z3GH 3QFJA 5IBLC 2YMXH 4X4ME 5L7XL 4IRJA 4FG6D 4GW5A 3EYSH 1CFTA 3CNKA 1CGWA 2JELL 1AI1H 1HQRB 5BQ7B 4NKDB 4CMHC 4K23L 4PRPE 4H1LB 5IWLA 3FHQA 3RKDD 1NANH 2PW2A 2X4SB 3KPOA 5CEYA 3JV4A 1RZ8B 2FJGB 3MXWH 3D3VD 2R0KH 3THMH 4JLRB 1OAXH 4NM8H 1FO0H 1EMTH 4P5MA 4HGMA 2BSTB 1GAFL 3RVVD 3O6MH 4JZJC 2O61A 3L3DA 2CUMA 1MAML 2JIXB 2VIRB 3CK0L 4YAQB 4KI5D 4OIBA 3FMGL 2MPAH 2VKXA 4I0CC 2BNQE 3ARFC 3PWVA 4LRIC 4TRPH 3UO1H 1FN4A 1RIHL 4G9FD 4OZHA 5IMLA 1BIIB 1JTTA 1P84K 3I75B 1ZA6A 4F7PA 5DVOA 2XOTA 3FB6A 4NKOB 2MJWA 3LS5L 3BMWA 5B38G 2A38A 1UM6L 3TIEA 4NQEA 2D7QA 3U0TA 2Y7QA 1SJHB 1S7RB 1DBAL 3LDBC 1G7QA 3K2UH 4PJBB 1QQDA 2CQVA 5IMOB 2H41A 5D7JD 2HJFB 1KBGH 1A9EA 1UM5H 1WWAX 2PXYD 3LMJH 4G6JL 2DBLH 3N0PB 1TENA 3ZHDA 1KIUA 1N0LA 4JN1L 5DMKA 4FZ8L 3SDCD 3EAKA 3EFDH 4QHLB 5D1QB 5CEZH 2DMBA 2FX8L 4JPKL 3DX6B 4DZ8B 3D0VA 1MRDL 3QT2A 3LEXA 2C1OB 1YN7B 4PJ5B 5DRXA 4FFVD 4WHYG 5HHMD 1X7QB 4X7CC 5GGUB 1T89A 5C2BH 4M7ZC 3EDEA 4I0KA 1H5BA 5FOBB 3WE6A 1LD9B 1PW3A 2BHYA 2GY7B 3IGAA 3NTCH 4HCRL 1CYGA 1YEJL 1E4WH 5DMJB 3VWKD 1HSBA 3IKKA 3H9SB 4NCC1 1P9MC 3T8XB 5CUSH 1TZIA 3F7RA 2P5EE 2PYEA 4XZUB 4ZTPH 1OY3B 3IJYA 1WAAE 2R1YB 3HKFA 5I74B 3LQZA 2OR8A 3P0GB 3KPQB 3BH9A 5F1NA 3SY0A 2LU3A 2NY5H 4NQXA 4PJHA 4UQ3A 1NMAH 3A67H 5D1ZD 5DS8B 3TVMB 3QDHA 2FECI 3D2UA 2XFXB 1UZ6F 2OZ4A 1OP5H 4KKBC 1MCWW 1MWAH 1IEHA 5EZJB 1UVQA 1RQ5A 2AABL 4POZD 3V4UL 3B8SA 3MRBA 2GQHA 3O6LH 1DEDA 1S5HB 2P7TB 4DZBA 5GISH 2C26A 5EZIL 5B8CA 2ICES 2FHCA 5LGJA 1CE6A 3VMOA 1RV6X 3QZWG 4PJFE 1KJ2A 5DQJB 1SY6H 3QUYA 4FNLL 1OAKL 3ARBC 3HMWH 4APQA 1DBML 3QEQD 5C9JA 1ZHLA 2CMRL 2ZSWA 3BYYA 2XWBA 3BZ4A 4G9FB 4LF3A 1C08A 1PG7L 5I16A 3S96A 3B9VA 3L1OL 4WWKA 5BCAA 1FH5H 1A6AB 1OTSD 3DVIA 3SBWA 2WINB 1JGUH 3HZMA 2EH8L 1KTKE 3DMMB 2HTLD 1ZHBA 1IILE 2C3GA 4TOYH 3G04A 4PJCB 5D96B 2C4FT 2F5BH 2HRPH 1U8JB 3LPGA 2OK0L 2BVPA 3MNVB 5CD3A 12E8H 4XAWL 3E2HB 4JZOB 3QIBA 5GSRA 1WFNA 3BEWA 3I50L 2OTWB 4WUUE 2HFEB 3G6AB 4P9HL 2PXYB 4GBXD 5IW6B 4FQCL 2XWJA 4LAQH 2B0SL 1NJ9B 5K9QG 3TESA 2W9EH 4X7FC 2DI9A 3SDCB 5I30H 1S7UA 2EZ0D 5TPWH 1EERB 4TQEL 4Y4HC 4QOKA 3DO7A 4Q6IC 3LCYA 2XWTB 3PDGA 4P2OD 4EEEA 1JPSL 5DJDB 4XCCL 5CJQL 5E8OB 3NFNB 1ZT7A 2D31A 3W0WA 2VUYA 4KQ3L 2G75B 1ZLSH 3WYRA 4GLRH 3VWKB 1FSKC 1IAIL 2J1KA 1R3IH 3D6GA 3OB0H 1JVKA 1BBJB 2X2YA 5GIRA 2R2EB 3DX7B 4CNIA 1FL3B 3RWJB 5J13B 1RJZA 2CJUL 5E8PB 3S5LA 2BNRE 2ZKHL 3L3JB 4HIXH 3T77A 3I6KB 2GJJA 1JHTA 4NSKA 3G6JF 1ZT4A 2F58L 3QXUA 4MAYD 3ARQA 1AGFB 1HKLL 3IU3A 3KLAB 4WI9A 5I8CB 5CJ8A 4JFZL 5D1ZB 4YZFE 3RI5F 1P7KB 4OZIE 3PP4H 5LWYH 5FYKD 5H35A 2ARJB 1AKJA 4ZNEE 4W81A 3EO0A 5BVJA 4AM0B 4LSSL 1NEUA 5H2BA 3LKPB 1T04B 4JFFA 3O8XC 4IOIB 1A1NA 3RP1A 3TBSA 1NCBH 1C5DB 3HNVH 4BSVA 2EO1A 5JW4Q 4KTDL 5C09D 1GGUA 3ELAT 2GSIB 1EJ6A 4OAWA 4OF3A 3BE1L 4A6YA 4YDVA 4N0YL 5EO1B 4HQQH 3WD5L 3PDOA 3QEQB 5LBSH 3SGDI 1UWGH 1JNNL 2D7MA 4RGNB 1ZGLA 5EU5A 1D5MB 1A2YA 3TCXA 2X09A 3VXSE 5FYLH 3CPLB 3RZCA 4IMKC 2DM2A 3ARTA 5KSAA 1S5IH 3M8OH 4LVHC 4YHPB 1EA9C 4XP9H 4OZFB 3VXQA 5D7KE 3FQTA 1AGBB 4RGMB 1Z5LB 1HEZA 4PTUB 2EEBA 2YA2A 1N64L 4LGSB 4GBXB 1I7TB 3ZE1E 2BY1A 4M3KB 1JWSB 3BEVB 4U1JB 2EYRA 4UQ2A 1CGTA 1I1FB 4JPVH 4MDIA 4KKAD 4MNQA 3B8YA 1C12A 4HBCL 3U7YH 4KVNH 1I8KB 3MJ8B 2A0LD 4GUPB 1K4DB 1IL1B 4JY4A 1DQJB 2R4SH 2ZOLA 1LEKB 2NXZC 3I3DA 2IANA 4P2OB 1B0GB 4XPHH 4BZ2L 1A7NL 4EUPH 3HUJA 1A0QL 4HWZB 1G0XA 3CX5J 2ADFL 5AD0B 1VENA 3I3BA 3FQWA 5F96L 5IBTH 1K4CB 5HGAA 2XNAB 4R0LC 4Z7UA 4N9GB 1FZKB 3QIWD 4Z7VE 1NAMA 2IH3A 1D7FA 3FAWA 1KCRH 4HJ0D 3BUTA 1UEYA 4O58H 3O45B 4PP2B 2NY0B 5A16A 4HUMB 2YD4A 3LQAL 1P4IL 1MCHA 3HC3H 1TJHL 1YEKH 3CLFH 4U1LB 3KPMB 4XBPA 5IESH 4MQTB 4X83A 4HJGB 5IHZB 1YEEH 2V2XA 3H0TB 4MAYB 5D71H 4BFIB 5CZVH 1I1AD 3MV8A 1JFQL 1ZMYA 5LQBL 1QLFB 1FFNB 4M6OH 1IEAA 4P5KB 5JR1H 3NN8B 4ZQKA 5CBEB 4KJWC 3ROOB 3LS4H 1MCRA 3MV9E 2KQMA 3I84A 1DVFB 3VFTB 1QR1A 1DLFH 5CKGA 1X5AA 2P47B 3SE4C 4YBLC 4PGCB 1ERNA 4LCCA 1YYLH 3VE0A 1N2RA 1DUYA 2ITCA 5E70A 4I0PA 2FJHB 1FVDB 2C7UA 1A6VL 4LPVA 2YPVL 3FRUB 3QI9D 3RL1A 3SEPA 3RDTC 3WFCH 5E08L 1JGLL 2FBOJ 4MMXC 3OZ9H 5AZEL 4PJ8C 1DQLL 2HVJA 3G6DH 1OWWA 1DBBL 1U3HD 1X5JA 2VAJA 3VCLB 3WJLA 1MCEA 3HRZB 5EWIH 4ZXBA 4X6CA 3WIFB 1T0NA 1XGUB 1CGVA 5F88B 4GG6E 4YDJB 2IMMA 3WUWB 1T6VN 2MMXA 3VFNB 3V79C 2IG2L 3C8KA 2IQAB 1J8HA 3S37H 3C08H 2BHZA 3TPUB 1MVUA 2M26A 2R1WB 4OSUH 4KPHH 1KC5L 5GRJL 2DKMA 1HNFA 2Y5TA 1T1ZA 1LNUB 1FPTL 1LE9A 5GJTL 4H5SB 3BDYH 2MOVA 5ERWA 3EJJX 5I1GH 3IFPA 3C09C 1J86A 3DUSA 3OPZH 1YMMA 3GB7A 1BAFL 3RVWC 3ARWA 2R69H 5FHBL 1H0DB 3BW9B 4LCWD 4ZUUB 3SDYH 2HLFC 4MA3B 1A7PH 2G9HA 2ZCHH 2ZUTA 4IJ3B 4JQIL 5T5FL 4PTTA 3UJTL 5HYJD 3HC4L 2H32H 1YZZA 5F9OH 2JE8A 1OOAA 1BWMA 4JREC 3DX8B 1AIFB 3C5SB 5CCKH 3GRWA 3B6SB 4Y5YA 3QDGE 1CQKA 4PUBH 2I27N 1QBMH 1RIUL 3KHQA 4LLQA 5IQ7H 3QIWB 3TA3A 5ILTH 1RVFL 1A47A 4QXWA 5ICXA 3EFFB 4WU7B 4EXKA 1WTLA 4QXGH 5DJ6A 3RWHB 3TZVD 1WCBB 3H42L 5FGBC 3DI3B 2FATH 4WO4D 2Q8AL 3DJ9A 5IBLD 4XT1C 1J18A 3ARGC 1FFPB 1OWRM 4L4VE 3W2DL 5IF0A 3QEGL 4GW4B 3B9AA 1R3JB 1YUHB 4HMCA 1I1AB 4QTIH 4D3CH 1M7IB 2N7AA 1U2CA 3PWPB 1MHCB 2CDGA 5DRWA 3BIKA 1AJ7L 1VGKB 2GTZB 3QXVA 1I85C 4YHOH 3PGDA 5BW7A 1P7QB 1BVKB 1LVEA 5JA8B 5TFSL 4KMTL 5E2UL 1KNOB 1BMGA 3VJ6A 2CO6B 4OLZL 4HWEL 2YEZA 5J0BA 2XI9A 4YXHH 1YY8A 1HSAA 3X3GL 1YQVH 5JOPE 4Q9RL 3A6CH 4WI2A 2OZ4L 4JFED 3JUZA 3QI9B 4YDIH 3UZVB 3U36A 4F3FB 4NN6B 1U3HB 1UYWH 3DV4B 3C6LA 1X5KA 1KB9K 4QRPA 1MAKA 1LO0H 4HKBB 2OJEA 4M5ZH 3GMQB 4QEGA 3O81A 5T3XH 2DQDL 1U8QA 3S88H 4Y2OA 1AQKH 1W0WB 2H1PL 4GMTL 1KJ2L 3GO1H 1Q9OB 5GS3A 4KAQL 2DLIA 3VXMA 3ULUD 2ZG2A 4P2RA 1UJ3C 4JRYA 5ADOL 4QXTA 2VB5A 2J5LC 4L1DA 4QO1A 4PPTA 4GRMA 4QHNA 2KZ1B 2DD8H 3F62A 4YIQA 1W0VB 4OQ1A 3BQUA 1CR9L 2NTFB 2AJSH 5HHPB 1U8HA 2PYFA 4JDTL 3HR5B 4XP1L 3VGGA 5F6IC 5F1IA 5K59F 3W9DB 3O4LD 4ZFGH 1MFBL 1FYHB 1EO7A 3HNSL 3IDXH 5F9DC 1KPRB 2R0ZH 4UT7H 3TC9A 4MA8H 1JUFB 4HXAL 1OSZB 4JM2A 2DQJH 4OLVH 3SKJL 5IW1A 3ARSA 1JPTL 4P4KA 4E41A 4KU1A 4Z7OF 5F7WC 3UTTB 3ZDXE 2PUQT 1NGPH 4ZDHA 3VFGH 1ADQH 2VXUL 4XP4L 4DGYH 3EO1A 5D5ME 1E4KA 4PP1D 5DEGA 3MNWA 1LO2L 1MH5A 2PETA 4YX2L 3SKNA 2I07B 4NQVB 4PD4K 1N5AB 3TZVB 4ZOEA 2DLFH 2Q86A 4WO4B 2EDJA 4XPBL 4GRLA 1QOKA 4F8QA 1XF2B 4M8QA 1NDMB 5B38B 3MLRL 4M62H 4R7NA 1VGEL 3KS0J 2NXYB 4CMHB 5HYIA 5JXEC 4K8RH 2Y72A 2D03L 4KKBD 4N90E 3MRPA 1E6OH 4YHML 1FE8L 4Z7QE 3MBEA 4NUGH 3VH8G 3O3AA 4LMQI 1R24B 3HNTL 1DCLA 4G43B 3TPKA 1P2CB 1U6AH 2VL5A 4X9HA 4I5BA 3ZE2E 1I3RA 1O7VA 2NY3C 4JZJB 2RFXB 4JFEB 1RJLA 5IVXF 3RI5K 1F42A 2B5IB 1JV5B 1FNGA 4RNRA 2CLZB 3ARBD 1IAIM 1BD2A 4EVNB 3AREB 4LLUA 4MD5A 5HVFB 1R3LB 2NNAB 4HIHB 1KYOJ 4JFOB 4LLMB 3D0LA 1K2DA 1FLRH 2DAVA 3BDBA 4PJGE 1NFDE 2P46B 2A6KB 1F90H 3QCUH 1KSRA 3U9PL 4BQCA 4F57H 4WW2B 1SY6A 2VLKD 5E6YA 4EDXA 4Y2DA 1N8ZA 4ONHA 2ICEB 3TO2A 1CT8A 2Y5EA 3P4MB 1XR8A 3C6SA 3GNML 4QRUA 3TEUA 1MCJA 2YD3A 4L29A 1IM9D 3OKDA 4D9RD 4I4WB 3WO4B 2X05A 5FCSH 1DP0A 5I18H 2YN3A 4XHQA 3O4LB 3U6RA 5DHYA 3LQAC 1RZKL 1MJ8H 3TO4B 4KXZH 4X4MA 1KENH 3L5WB 5DQ9A 4PLJC 2VLME 4O51B 3IFLH 2EYSB 4LLDA 4Y4HD 3QG6A 2I9LB 3VGHA 4ZS6D 3QUKB 2F19H 5F9JA 1Z0NA 2ZG1A 1YNKL 3R4DA 3FHAA 3CSYB 4YO0B 4EDWH 3QIUC 3PWJA 4RBPH 3MLYL 1D5ZB 1OVZA 3V0VA 1MCSA 2EIZA 3GDBA 3QZWB 1A6UL 4IRJC 4G6KL 4MZ2A 1S7XA 3D69B 4JHZA 3S36H 1QR4A 4I2XE 3OKEA 5IB5B 1CLOH 4TNVK 5CILH 4EXPX 5IWLC 4Y19A 2GK0B 1MREL 3LV3B 1WBZA 3FB5A 2DOCA 1Q94B 2NLJB 3NCBB 4WI6A 4ZPTB 1JZ4A 2HYMA 4HSQA 2BNQA 3UJIL 2DQFB 4ELMB 1NAML 2GFBB 1ZWIB 3PV7A 4R97C 4JO1H 5I8EA 1KT2B 3BH8A 4NHUA 3GJFH 2Z91B 4HIJB 3ZTNH 1X4YA 1UCBL 4HKJA 4DN4H 4K55A 4MJ2A 5T3ZL 2JTDA 4MQXC 3O8XD 1QBLL 1A7QL 3QUMH 1KXTB 4PJIB 3MGTB 1L7TH 2P49B 4RFNB 3U2SA 1YEIL 3D1MC 4ODSL 2ZOKB 5GGSY 5DYOB 4ONGL 3BP7B 1NCAH 2CXGA 4LHUA 4HK3N 2EIDA 4PB9H 2GJ6D 5M95B 5JORA 1I8MA 5IFJA 3BJ91 2X1OA 2X4OB 4KRPC 2MHAA 3FFCE 4PJBF 2AJXL 2B20A 4YC2C 2DL2A 4K3JL 4FFYL 1U93A 1IGFL 4HV8B 1MCCA 1XF3A 2A2QT 1K6QH 2V2WA 2VLKB 3RX5A 5FF6A 4M6NL 5DVKA 3W39A 3GBMH 2XG4A 1QLEH 2M2DA 3ZTJG 4NC1C 2FWOB 4MA1B 2UZYB 4JJ5B 1DQQB 2WBKA 4QYOB 4HFUL 1H3GA 3JUYA 2AV7B 3R0MA 3IS0X 4PYHA 1IM9B 2YRLA 1YNTA 3TBWB 4HZLA 4JO2H 2BRRL 3SKOA 3FFDA 4X4YB 4J3UA 1NCCL 1MEXL 2P5EA 1NCNA 4KTEH 4J3VA 1H5BC 1XH3B 4NQSA 1MJJB 1OB1A 4RWHA 5E24E 2H26B 1IT9H 4PS4L 3VXTB 4MJ4A 4UV4L 3K8LA 3HPJA 4KJYA 4UZGA 1DUZA 4X6FA 3GMRB 4FFZH 1IKNA 1YNLH 4RISH 4Z7WE 1FGVL 3RIAK 3C60A 1N6UA 4QRSA 3U1SH 5BVPL 1B9ZA 1TDQA 3M45A 3W82A 2ILLA 2Y1VA 4QRRA 5GRWA 4RFOH 1CFNA 5HYSA 1FIGL 3OKNA 2I5YL 1ZVHA 4M00A 1T80A 3KYOA 4ISVA 2MQCA 4NKQB 4UOJA 4W6WB 4D0DB 1LDPH 1DE4A 1CGXA 4PJFA 1OTUD 5CINH 3NIGF 2GCYB 3EDDA 4LKCB 3GRWL 1L0XA 3HZKB 5HJ3A 1KN2H 2Y07L 3LKRB 3O3EA 1FLTX 1DJSA 5J89A 4O9HL 2QQLH 1INDH 2P5WE 2A83A 5TH2B 4KI5F 3HG1E 5D9SB 2C1PB 5MEQB 4MB4A 5C0JB 3IJHA 4XNMB 3QUYC 3T3ME 4KJWD 3FRPA 2ARWA 4APQC 3LN5B 4K7PL 5EC1A 4G3YH 1FORH 2ATPA 4UIMA 2DLTA 3OKKA 4WWKC 5J1SC 2RJMA 3LRSA 2HWZL 4QHKI 3SBWC 4JRXA 4PJCF 3E0GA 2GJ6B 1AH1A 3RDTD 1CD8A 1D3CA 5F1OB 1Z3GL 4PJ8D 3PV6B 3V6BR 5I75C 4J8RA 3FJTA 2GSGA 4ZG1A 1HH6A 2ZUWA 3JZ7A 5HVHB 3QCTL 3EYSL 3QIBC 4XGZB 2DIAA 2H9GA 4KRNA 1AI1L 1U8NB 1UXSA 1CTNA 3V6ZB 5DQDH 3M07A 3PP3K 4P49A 2Q6WA 1CLZH 1AQDB 5IM7B 4G8EA 1BM3H 2IAMD 5KOVC 3T08A 3MXWL 5ICYB 3KG5A 4NRYB 1G7MA 2P43B 2R0KL 1VFBA 4QT5B 1OAXL 1FO0L 2ZUXA 5DD1L 5GQBA 4NZTH 3D39A 4R4BA 1MWAB 4OF8A 4IHOB 2FLBT 5MI0C 4ZOCA 1PZ5B 1G6RA 4PRBB 4K3DH 2MPAL 1HIMH 2XKNB 3RVWD 4TRPL 3UO1L 1TETH 4NBXB 1NC4B 5DK2B 5C6TH 4DAGH 4HK0B 5HI3C 4X6EB 3EUUA 1P5VA 4H0HB 5CMAB 3IRPX 1S7VB 5TDPA 3OXSB 4OZIA 2W0FB 3WMSA 1FV1B 4ZNEA 1KPUA 3EOTH 3WKNA 3IAGC 1JPGB 3K2UL 2AKRA 3HE6B 4O00A 2CLVA 3QXAB 1KBGL 1UM5L 3MRHB 4QHUB 3LMJL 2ADIB 2DBLL 4YXKL 1F4YL 3DXAD 1ZVSA 2IFFH 1EFXA 5C0CD 4JFQB 3RPIA 2IGFL 3EFDL 4LQFH 5CEZL 5I2IB 2XTJC 2DJSA 1C16A 2YBRA 4M9PA 1I3GH 3VXSA 4LPTA 3QAZB 3IJSB 4ZOBA 5T33L 4KQ4H 3MSPA 1J0JA 5I71B 1D5IH 3MOAH 3DSNA 1AO7D 4ELKB 3BYTA 5JPMB 4RAHA 2LVCA 3UPRA 3KPSD 5IR1B 5JMOC 3NTCL 1MVFA 3K2MC 3PWUA 2WUCH 4ORZC 1A5FL