3A67H

Crystal structure of hyhel-10 fv mutant ln31d complexed with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a67H00
5GGUA 1PDKA 1MCPH 4OF8A 2Z4QA 3BO8A 1XR8B 2PYEB 5DO2C 3KYKH 3ZKXC 1VEMA 4MD4A 2H3NA 3DVNA 3LQAH 3OKOB 3WUWB 3UJJH 4G3YL 5D93B 1D5ZA 4ZUVB 5I18L 2W0LA 3QULA 1RMFH 3DVIA 3VD5A 3RKDD 1E6JH 3FT4B 3KDMB 5D2NA 1QLFA 4RAUA 1CWVA 3ILQC 5H8DA 5HHVH 4HUMB 1A6UH 4NQSB 4QRPA 5E0QA 4NZUL 1NGXA 3IJSA 2AEWA 4MAYC 2EC9U 4JO1L 1DUYA 1FNSL 2OLDA 1GCFA 1N2RB 4LCCA 5I1LB 1MCSA 3QEGH 2D0HA 2FCBA 2W65A 8FABA 3CVIH 4OFIA 4HXAL 5HHOE 3K81A 3LRSB 3MRDA 4KJPD 4ENED 3IFNH 1S5HA 3VG0H 4ZS6C 2VC2L 2ZSVB 5FGBC 2DD8H 1KIQA 3S88H 3ARBA 1NEZB 2OR7A 3CJJA 5IMLA 4F8TA 3IU4H 5BV7C 2WIIB 1R24B 2ADIB 2PR4L 5AUMA 4ODXB 4ZFGH 4UTAL 1HE7A 4NO0D 1MREL 3IB4A 3S37L 2XNAA 5GRXG 1YEGL 4NWUH 4WIQA 3WFZA 1R3JB 3QFDA 1EGJH 1N3NA 3VFGL 1B2WL 1I9RL 4KK8D 4XBGB 3GMRA 3MLSH 3U4BL 1ZHLA 4EOWL 4NO0B 2ICWA 4LCWB 5E9DD 2X40A 3ZL4H 3O4LE 6FABH 3OBAA 5T5NF 2HFFB 4MSWB 5JW4Q 3QI9A 1MHPH 1OD9A 4X7SL 5ADPL 1ZS8B 4MJ6B 1F8TL 5DQ9A 4GLRI 1G9MC 2NY6C 3O6LH 2VZ1A 3QXAA 4S10A 2HRPH 2VLLA 3NZHL 4QRRE 5J3HD 1K5NA 4MNQE 4WV1A 5KVGH 4Q0XL 2EYTB 3CDGA 4HCRL 4QF1B 5EN2A 3NIGF 1QR4A 2BNUA 3V0VB 1IAKB 4MLIA 4KHXH 5KVFH 4H1LA 5GRVK 5SWQB 5E6YA 3UTPD 1U3ZA 2GK2A 1ZVSA 1DBKH 1MCJA 5EOQH 3PWUB 4CVWA 1HHHA 1S78D 4LLUB 3OKYA 1QEWA 4MXVF 1AGBB 3LVEA 4XCNA 4HWZA 4AIZB 2FSEB 5IBUG 1UM4H 4DKFH 2WV3A 4ONFL 4LSRH 2VN7A 5D1XC 2HWZH 4KVNL 1H3WM 4OQ1A 4JVWA 4M61B 5ITBH 1CQYA 2ADJA 2WWMD 1FGVL 4GFTB 4GH7B 4K94C 5IM7B 5IK3A 5FCUH 3L7EB 1SHMA 3KPSB 5GS2H 3B3IB 3FN0L 1Q9LA 1PJ9A 2CKBA 3SQOL 1X4ZA 2LTQC 4N0YL 2PTVA 3VXSB 5K9QG 4EN3A 4RGMB 1KB9J 4YC2B 1M71A 2SEBB 5FYKE 1ONQA 1QLRB 1JYWA 3FO2A 2EEAA 5ID0A 4JHBA 4P3DA 3C6SB 4KZDH 1LO3H 5D6CA 4YHNB 2XPGB 5GIRB 1NFDB 3C2SA 3LPFA 3TBTB 4Q6YA 2BSED 5BZDB 1FYTE 4BQCA 3RY4A 5D5MB 4YXHH 1J05B 3BD4A 4JRWA 1E4JA 5HDQH 4GG6F 1RK1A 1LEKA 3B43A 3V0WH 2CXGA 2DBLL 1P5VA 5BZWA 2VQ1B 1TTUA 3DROB 3JVGA 1CLOH 5HGGS 3RGVC 3MODH 4PJXA 4GKZB 2Q20A 1V3MA 4JFYA 2YMXH 4BYHA 1AY1H 3HPLA 2X05A 1KIRA 1F58L 5T33H 4ERSH 2RHEA 1S7RA 4CN4A 1JNHA 1UVQA 4OGXH 5E00B 4MGXA 4Z76A 3EJYD 3F65A 3CVHH 1F02I 5E2JA 1Y6MR 5C7XL 4PRAB 2OL3L 4GRMB 3GJEB 2H45A 1A4KA 3ECBA 3M8OH 2D31A 2OQJB 2DQHH 3QQ9D 5EUOB 1SEQL 4JFED 2ZCLL 1FRGL 4MDJA 3AS3A 4U31A 3BZFB 3NPSC 4KTDH 2HKHH 4W4NA 5E70A 5EUKA 5CEZD 1HXMA 2QBWA 3SGDI 4R96B 1RJCA 5T3ZH 4S1DD 3HG1E 4L3EE 1KNOB 3TPUB 4JFDE 3ROOB 4MB3A 2FATL 2ZP0T 3HI6H 3HUJB 1QBLL 4FZ8H 4QWWD 2YPVH 1MCOL 2DKSA 2GK0A 3EZ8A 1FL6A 1ETZB 2P43B 5HVFB 5FHBL 4X6CB 1CG9B 1IGTA 2HJLA 3BKCH 1VKXB 4JG0L 4KQ3H 3SGEH 3QDME 5C0BE 3GSQA 4OZHF 3T2QA 5TQ2H 1X5AA 1C5DB 4TSBL 4XI5C 3DRQA 2MOVA 3UTSA 3LB6C 2I24N 3C5SB 1R0AL 3FCTB 1NCDL 4C58B 2J6EH 4Z7WF 1H3XA 1RJLB 3MV9D 3UMTA 2GYSA 4MVBC 3BJ91 1N59B 1B0RB 1IM9D 1D9KA 4MJIA 3HE6B 4HX1B 1I1AB 5INCA 4XVUD 3GK8H 1AQDA 4NT6B 4QXWA 2KKQA 4V1DE 4CJ0A 1FLRH 4Z77B 1XCTB 1KJ2B 3LQZB 4TQEL 5EDXA 2XG5A 4DZ8B 1I75A 5F7DA 3FB5B 4QRSB 2DQEH 5DTFB 4QO1A 2HP4A 4HKXA 4G8GE 3WFEH 4LVOB 2OJEB 2UYLA 5J6GB 4Y16C 1TTFA 3P4MA 1AI1H 2MWCA 5HJ3B 3O0RL 1SBBA 3FO9A 1EEZA 1RUML 3Q5TA 4N68A 3MJ8A 3PXJA 4B0MM 5HXMA 5CWSA 4I0PB 2R8SL 4BQBA 5LWYH 2FGWL 3HPJB 1NMCB 2BHYA 4PRPE 2M26A 4AEEA 1UZ8B 5JW4N 1I7TA 1BQHB 1V8HA 3O6MH 4X9GA 5FOBA 3QHFH 4NZDA 4FS0A 4IRSD 3NPZB 2BNQA 3VGDA 3CSPA 1B0WA 3DLQR 1G9EA 1CFQB 4CMMA 3D2UD 2BY3A 2F54A 4IRSB 1P9MA 1LQSR 5B8CA 2JJUA 4XNMB 4M1CD 1MHHA 1UQSB 1UCBL 5HHOD 3K2MC 3D2UB 1U58B 3UXFA 3MLZL 1KCLA 1JJUA 1LWRA 4HQQH 3MZGB 4R7NA 3MJGX 4H0GA 2R23A 4ZXBD 1H5BB 3KS0H 2AXJA 2YD7A 5HD8C 5EOTA 4WO4D 4OZ4B 1CD1B 4GXUM 4HKJA 5GSVA 2CK2A 5F1IA 2ESVE 3P30H 3WN5A 4F37K 4JPIA 5JW3L 4AY0A 5E94A 3MRRB 3L3KB 2IPUG 1IAOA 1MJ7L 1MI5A 5LCVH 4OKVB 3LZFL 1NDGA 2APTA 5JOFB 3QJHB 1AIFB 4GLRH 2NMSA 1W72B 1MFBL 3SGKA 2AW2A 1IGMH 4KI5F 3VXRA 1KN2L 2QSVA 5DJCB 2LAGB 3ORJA 2J88H 3KPNA 3ARYA 4LPYA 1KEMH 3VU2A 1MF2L 3GMLA 2EIBA 4M7ZB 1ZLSL 3O4LB 2FJGA 5CD3A 5HSFA 3BDBA 4NC0B 4XMPL 1KCVH 1U92B 4QRRD 3WFDH 4ONGL 4OQTL 3UYOD 3AGVA 4EXKA 4PG2A 3QP3A 1OHQA 3QA3B 1OCWL 1YEDA 3DYMA 2ZNWA 4QRRB 3W39A 5I19L 4MNQB 3WHXB 2V9TA 1A0QL 5EZLB 3B9KA 4XNZB 3IAPA 3LKOA 2A77L 1U0QA 5E95B 3RIFK 5GJSH 3WUWG 1B6UA 2J4WL 2EDBA 4WVRA 3MFGB 3ARDA 4KTEL 2HJKB 5JTWA 1GC1C 1WWBX 1S7SB 4JFPB 4APQC 4WTXA 5FV1L 4KKNA 4R4BB 5FB8B 1RI8A 4MQTB 4JFXA 5JPMA 3QXDB 1SYVB 1G7LA 1HHJA 2FO4B 4OV6F 4XXCA 4YXKL 2QR0B 4PV8B 2VAAA 4LRNL 4Y5YA 5I1GL 3WIFB 3WKNA 2PXYA 4P2OA 2GUOA 1QYGH 1FJ1B 4BFIB 4OCRL 4HC1H 5IGXH 2ADGA 2UZIH 4HXBH 5DVLA 4TSCL 3TNNB 1OAYL 4PV9B 4UINL 1BWMA 3PHQA 1BECA 3RL1B 2P7TB 3I6LE 3E6FB 3AREB 2C9AA 5C0NC 1XGRB 2ITCB 1QSEE 5I1CL 4IRJC 4I5BB 2Q6WA 4YNYA 2AJZB 5IT2H 2X9XA 4WTZG 3C87A 1X5LA 3O9WD 1IC1A 2ICWJ 2KL6A 4N8VB 4X7TB 3B8YA 2IAMA 3L3JB 4HJJL 3CFKB 1T80A 4M8QA 3KXFE 3HMWH 3M17A 3BGMA 4ZSOE 3CC5B 5FUCC 1FYTB 1Y18B 2NY7H 5JMOC 4I0KA 4L8CB 5C0GA 1CLZH 4HK0B 4KPHL 1ACYH 5GRYA 3L3OA 3SDAD 3ZHLA 2X5PA 2Z35B 3ULVE 4Z8FH 1PQZB 4DFHA 2KH2B 3BW9A 3WDIA 3ULUL 3TO4D 5IMOB 1D6VL 1ZLWH 3VXQA 1FZKA 5F3BB 3C8KB 2BVTA 4I18A 4XPTH 1JV5B 2H26A 1MNUL 5D7JB 2E9WA 2DLHA 3ALPA 2V5MA 3SGDH 3TO4B 4R0LA 4MA7H 4N0RA 1B4JL 1IVLA 5CJQH 4C56B 3X11B 2WUBL 2RJMA 4U1LA 5KVDH 2D4FA 5DK2A 2FRGP 4KKLC 2MPAH 4HV8B 2CUHA 3NCYP 4LDOB 2YD9A 2NXZD 1NLBH 3SBWA 3CU7A 4ZOBA 1X5IA 3E3QE 4YX2L 3V6BR 4L3ED 5K9JH 1G0XA 3MOAH 2F5AH 3RA7H 5HVWA 3CFCL 1AHWC 2XI9A 3O3UN 4KDTC 5DI8A 2JIXA 4P0DA 4I3GA 3KYNB 5TGBA 1X5YA 4RFEB 2E7BA 1U93B 3HG1B 4EXPX 4L3EB 4TVPL 1SY6H 4JFDB 1UM6L 1NPUA 2BY2A 3PJSA 3R8BB 1OTSD 5BV7H 1MHCA 1P4LB 5MENA 4IS6A 4X83A 1G9NC 4O4YH 3BH9A 3QDMD 5C0BD 1RUPH 1OM3L 4PGBB 4M5ZH 2AEQL 5HGHA 2YEZA 4GW5B 4FABL 1WCBA 3DIFA 3IGAA 3VXNB 4EDWL 4RFOL 4HEME 4GRWF 1L0XA 3VFRA 4G43B 2NLJA 3ARGD 4G8FA 4UILL 4PJGB 5L88L 5KSUA 1OSPH 4F57L 1AR2A 3LRGA 3C08L 3IDMA 4RQQA 4TUJB 1KJ2L 3BD3A 4V1DD 4YEFA 2QADD 4OCMC 3ARGB 3LS5L 3FN3A 1NJ9A 4U6VH 4HUUA 2Q86B 1EEYB 1S7VA 5FYKU 5HYFA 3QIWD 3I6KA 4O2CB 3DX6A 4G8GD 1YYLH 2X1XR 4P4RA 3TZVC 2FH8A 2V5YA 2VZSA 4K7PY 3HLAA 5LGHH 2AJSH 4YDKH 4WENB 1K2DA 5ENWA 5IVNA 4X4YA 2EDHA 3QIWB 4WUUE 1B6DA 4TPRL 5EC2A 4OKDA 4G8GB 3FAWA 1CL7L 3VXUA 4CMHB 5EO9B 3VFSB 1QHPA 4HWBA 4Y1AA 1QRNA 5E4EB 3LN4A 4H25B 1MIEL 3CAFA 5LQBL 4K3JH 2R2EA 3MRJA 5IMKA 1Y0LA 3SE3A 4K94H 1U9KA 4KUCF 1T1XB 3NFSH 1T03H 2A74B 3F7QA 3SDXA 3IDGB 4S11A 3DX8A 4WI4A 4PRPB 3OR6A 4NJ9L 1PKOA 4L5FH 3KLAA 4NNXA 3RDTB 1VHPA 5CP7A 4YHLH 5L8LB 1HI6B 4OZGF 4I48A 3VMPA 2C3VB 3GDBA 3PGDB 5IUSA 2WWKO 2FR4A 3H7BA 1X4YA 2AXGA 4XH2A 5DMGD 4JJ5A 2E7LC 4OLXH 4OD3L 1NCUA 2GTWB 3DGCR 5IMMA 2DQIL 4ZUUB 3F7RA 2DQJL 3V6ZB 3DO3A 5HYEA 1QO3B 2EDQA 4NKDB 5C2UB 4NPYB 2D03H 3EOYG 3GSNB 4P9HC 1INDL 4XWOD 4FQ2L 1NL0L 1FZJA 3HNTH 4A6YH 2F19L 3O41A 5CGYD 2NX5A 4GAYB 2A6JA 1UB5A 5IBTH 4KRPD 2ESVB 1W72L 4HIHB 3VFUA 3QEUA 2EIEA 1IILE 3BZEA 1MRDL 5I1AA 2VKXA 5TPWL 4KRPB 3P0YL 1U8MB 3ZE1F 1DVFA 2QQKH 4OJFH 5JMRA 1UG9A 1WSST 1C08A 3S96B 2J8UE 2VISB 1JFQL 3ARRA 4OZIE 1BHGA 4M6ML 4XXDA 5DMYA 3P4NB 1WBXB 3DXAA 3D69B 3V4UH 1CVRA 1YJDL 4FZEL 3V4VH 4HG4K 3TT1L 3WFHB 3U6RB 3MRLB 2GCYB 5BVPH 1FN4A 3WEXB 3H3KA 5ESVA 1JVKA 1QQDB 2VERN 1U3JA 3BEWA 3FMGL 3VJ6A 4PJ8C 2HJFB 4HIEB 2R0WH 4P4KB 3O6KL 1CDGA 3P0VL 4XPFH 2AK4D 1S7XB 3GBML 5T1KA 2IFGA 3QIBA 1CE6A 4JKPH 2JCCF 4KY1L 4Z7QE 1CI5A 3X12B 1I1YA 3MBXL 2LFGA 4ZAKD 3GNMH 3I75B 2N1KA 5EU6E 1ZA6A 3JTTB 1QFHA 3I9GL 1BQHG 5HDBE 1DQLH 2ORBH 5J12B 5BRZA 3CSYA 4O58H 1I3GH 4ZAKB 3W9EA 4PGDA 1SJHA 3QXUA 3KG5A 3VRJA 1DE4B 4YO0B 2B1AH 3L9RB 2MQ0A 1EDQA 4LGPB 4PRNB 3B8SA 3X13B 2VIRB 2V7HA 3OKEA 1M7DA 3WLWD 3FB7B 5CZKA 5CHNA 3D3VA 2R0LH 1UJ3C 3I6LD 4K07A 5GGSY 1OB1B 4QRPE 4XAWL 1DUZA 1ZAGA 5FYKL 1E4KA 1ZMYA 1QSED 4XNUL 5F71A 1JZ3A 3R0NA 5BXFB 3CCHA 1BQSA 2OR8A 4XC3L 4BKLB 2DN7A 5FKAB 1WICA 2M1KA 1YN6B 3LHPL 1GGYA 3RI5K 1QSEB 2DRUA 3GMNB 5I8EB 5C8JB 3U2SB 3KXFD 1MLBB 3H9YA 2P42B 4LCYB 1DLFH 5CUSL 1XF3A 4MNHB 4LAQL 3U7YL 1BBJB 4HLZG 4XP4H 1CXFA 3L5HA 3KXFB 3V5DA 4MXQD 1F5WA 4ZSOB 1T89C 1KGCE 3BRGC 1T1WB 5I8KL 1QR1A 5I0ZA 1A9EA 3HFML 4RZCA 4XNQA 1LNUA 3OSKA 5DLML 4K8RL 4NN7B 5JPNA 3ULVD 5C0FA 1YC8A 2VNCA 1BX2A 3GMQA 5C3LD 4G42A 3CLEH 2QSCL 4LSQH 2CMRL 2W60B 3OGCB 1P5UA 3ROLB 3OJ2C 4XGZB 5F1OB 5KSBA 1U3HA 4UV7H 1VACB 5BW7A 5F6IC 4JM4H 1KSRA 3KPRA 3GJFH 2WBJC 2XICA 5TE7L 3IDIB 1G7PA 3MRFB 3INUL 1DSFH 2HT3D 4LNRA 5JW5A 4OLZH 5FDWB 3CMOH 1GGIH 3TNMB 4YPGB 1MCCA 2AKRA 3SE8L 4TNVK 3MZTA 2DWDB 3VFPB 1MQ8A 5ID1A 3GGWB 4LLQA 3WNLA 4KAQH 3U0WH 1MVUB 3AMLA 4ACPA 3MNVA 1A1NA 1OF2A 5AYUH 3OKLB 5JHLL 4X80L 3IFOA 4NQDA 5D8JL 1ED3A 1TQBB 3PG2A 2NR6D 5LAXA 4H88L 5I16B 1FSKC 5JR1H 3AB0C 2YRLA 2IH1B 4JGMA 4WTWA 5CZXC 4NSKB 4PJIA 2BZDA 5GS1C 2YA0A 1YA5A 2G60H 3T2NH 1ZGLM 5FYJE 1WTLA 3STZB 1CFNA 15C8L 1FIGH 3O3AA 4N8VG 5I1IL 2F74A 3C60A 3V6FB 1JGVH 3UPAA 3S35X 3TO2A 3A6BL 2FB4L 4AEHH 3TA3C 2Z0BA 1ZSDA 5HYIA 1VFOA 3MCKA 2DYPB 3QUXA 1CXEA 3JTSB 1G7IB 4FFZL 5E2VL 4MLSA 4OBRA 2AJVH 1U8NB 2A73A 3Q5OA 3TF7C 4NN5B 4ZPTA 3ZKMD 4JHWH 1MFCH 3MRCB 3UTQA 5TDPA 1GC1H 4NO2B 4WUUB 3L95A 2HT4C 1E27A 4X6EB 2EKSA 4PJXE 4ZPVA 4YUEH 5FUOH 3BDYH 4K3DH 1IEBB 4O9HH 3V4PH 2C4FT 1L4IA 2DQDH 3IJYA 1DBJH 4F7EA 4Q6IB 25C8H 2C1OB 1EO5A 3UTTA 1B0GB 32C2B 2R56L 4M4RA 4QHLB 2BJMH 1RUQH 3MFFB 2NY5L 3GSUB 4E42B 4I77H 3ARSA 4EUPH 1HHIB 4WEBL 3MJ7B 4HF5H 3GSNL 3PHOA 2WM0A 2R29L 3X14B 3QO0B 4CAGA 4XCYB 3R1GL 1A6TB 4HBCL 1KG0B 2BCKA 3A6OA 4FQHA 4PJDF 1VSCA 2FWOB 2Z31D 5C6TL 4U0RC 3DV4B 2IANA 4Y4FC 3TVMC 4TSAL 1U3YA 3K7UA 2Z31B 2NY0C 3EFDL 3EDEA 1WAAA 3OXSB 3D25A 4IDJL 1QBBA 1H15B 1Q94A 3QUMB 4OSUL 1UADC 2B8OT 3RY5A 2F58H 2Y6SC 3PNWA 2OZ4H 5JOPE 1QFWL 4NHUB 4PJBE 2VDLL 1IC5L 3K2UH 1W2KT 3UTSE 2V2TA 5IVXF 1MJJB 1CD9B 2J8UB 1ZT4B 5D70H 1TZGH 4BSVA 3HMXH 2YBRA 3GSVB 2VR4A 4MJIE 4HS3A 2XOTA 1GHFH 1MCEA 3F6IA 4NHCL 2FX8H 1E4WH 2DWEA 1IQDA 1T3FA 2Z92B 3BKYH 4WHYG 5IVZB 2IH3A 5DDHA 1LD9B 3TEUA 3RY6C 1M6OB 1KELH 4PTUB 1FQ9C 3BP4B 5I75B 4RGNE 4OBSA 1RIUL 1XZ0A 1BFSA 5EU6D 1TETH 5GRUL 3OTTA 2A1WH 1NMBH 3BFOA 2V9RA 1FBIL 4NYLB 1KB5B 1BFVH 1JYVA 1ZT7B 3HR6A 3RWJA 3ZLQC 1U8HB 4LHUA 5DQDL 1KYOK 4OTXL 2NY2B 5EU6B 4HUXB 3O2DA 5AD0A 2ADFH 4MQ7B 2IBZY 5GGUB 4E9LA 1G9NH 2Z4QB 3BO8B 3OXRA 3ZT6A 4XVTL 1I8LA 4LBEA 4MD4B 4IOSD 2H3NB 3DVNB 2FEEI 1D5ZB 2CDFA 4QRPD 3U36A 1QSVA 1HIML 3QULB 4LMQE 1GGCH 2O5ZL 4MB5A 2EYSA 3K0WA 5D2NB 4OIAA 1QLFB 2BNQE 4RAUB 1HSAA 2DTMH 1K6QH 4PD4K 3K4ZA 2F54E 1UXSA 3LMJL 4QRPB 3RIAK 1NGXB 2R39A 3IJSB 4NN6C 1N26A 4NKMA 2HH0L 1A1MA 4ODWA 1DUYB 1G7JA 1UYWH 3RHWF 4P23C 1IE5A 1AQKH 1AGEA 4KQ4H 4R8WH 2R4RL 4LCCB 1LE9A 4L9LA 2JJTC 3AU1A 2W65B 1MFAL 3TJHD 8FABB 1T2XA 3EO9H 4YWGL 3S8WA 2NXYC 1KGCD 5KW9L 3ARBD 3EYUH 1JZ5A 2CKNA 3WXWL 3TCXA 3BE1L 3MRDB 1FC1A 5L2JA 1S5HB 1UJTA 3MPCA 4F15C 1V3JA 2VDRH 4LIQE 1GGBH 1KIQB 3ARBB 1MI5E 3IDYB 5IMLB 1UZ6F 4ONHA 3WIHH 5AUMB 2VL4A 5C2BH 2X10A 3EZJB 4L3AA 5M7QA 2XNAB 1CXLA 5D71H 3QFDB 1RUAH 3LKNA 4PGZA 2HG5A 3VXRE 1N3NB 2NY4D 1I1FA 3GMRB 4WY7H 4DGIH 1ZHLB 1N4XL 1ZANL 2ICWB 1LDPH 2VJXA 3LY6A 2VLRA 4O5LH 5IV2A 4XPHH 3ARFC 4OI8A 3QI9B 2NY4B 4N9OB 4GOSA 5CZVL 3SCMC 1CR9L 4ZTPH 3NOIA 3WCYA 5DQ9B 3LEVL 4OF5A 2FJHA 3PGFL 3QXAB 2VLLB 1NC2D 4U1KA 1K5NB 2VH5H 3AM8A 4FXGA 2IMMA 4WV1B 3G6DH 3CDGB 5EN2B 4N0CC 2ATKA 1UA6H 2D7QA 2WQ8A 5D93C 5JW4R 2BNUB 1TVBA 5FDYA 3K1KC 5C6WH 2ZWLT 4H1LB 3VGEA 4P9HH 3MJ9L 3UJIL 1ZVSB 4JLRA 5KSAA 1HHHB 4QOKA 3RFZC 1QBML 4OGYH 4Q97A 1QEWB 2H9GA 4LSUL 4Z7OE 5SX5K 2C3GA 4MD5A 5K33A 3RKDC 4XCNB 4B53A 1NCAL 4HWZB 4X4XA 5IHUH 4EI5A 4JY5H 1IMHC 4MXWH 4FXLA 4YFLI 1K3IA 2G9HA 3MC0A 1BAFL 5FYJD 3NTCL 2ADJB 2B20A 5IK3B 1A2YA 4W70A 2H2PD 1Q9LB 3ZZ1A 1S9WA 2CKBB 4N90D 1QTYT 1DEDA 3WNNA 1P1ZA 5FO7A 4JN1L 1B3JA 2F8VA 3IDXL 4OCLC 4EN3B 2GHWB 3PP4H 2FYYA 1M71B 1ONQB 2N4IA 3FO2B 1S5IL 2VQTA 1JBJA 5ID0B 4NGHL 1J10A 4L9DA 4P3DB 3TC9A 5JXEA 2FDBP 4B7IA 3O6FA 5D6CB 1Q0XL 3WFBL 2PO6D 4UV4H 2ATPA 4XPBL 5DK3A 5EOCJ 2X4PA 1HILA 4CN6A 4G6AD 1TJHL 2Q3AA 1KCSH 3O2VH 3MRHA 1Z5LA 4KK8C 4GAGL 1CFVL 1RK1B 1LEKB 3NN8A 5DFTA 2FD6L 3TM6A 4XHJD 4J3UA 4G6ML 2V5TA 1FC2D 5BZWB 4J3OC 5K59F 1BM3H 4PRHA 4PJXB 2H41A 4JFYB 4R97B 3HPLB 1ADQA 4J12A 1KIRB 4KGJA 5FGCE 1T1ZA 3H9HA 5FCSH 1S7RB 1T7YA 3MLTA 4MX7A 4ELMF 1JNHB 1UVQB 4HWUA 1T20A 4MMXC 3ZE0E 4Z76B 5A2IH 4AZ8A 2CO6B 5DHVH 5DUML 4K7PH 1V3LA 3QWQB 5EORH 4X6BA 1AH1A 1A4KB 2BRRH 3ECBB 5IQ7H 5DMKA 3BN9D 4FQJL 1J11A 2AGJH 2D31B 3G5ZA 4K7PX 5F70A 4LFHG 2FJFA 3QUYA 3K46A 4MDJB 3RWEA 2AK1H 1KIPA 3EDJA 2VDKH 4JQVC 5EUKB 1QA9A 1HXMB 5I74B 4G80A 3MOBL 4WW1A 3HZYA 2BXYA 3EJJX 4XBPA 2RCSH 5C08A 1JWUA 4U33A 3GBNL 3QUML 2WWMC 1Q38A 3VWKD 4L8SA 1WZ1H 2KPNA 3NACH 5MENE 4RGMC 3S6CA 2GK0B 4Y4KA 4YBQD 2PUQT 1OTUD 4BZYA 5E1AA 4YC2C 2OTWA 4M7JH 1FL6B 5JOPD 2YKLH 4NKIL 2Q7YA 1IGTB 2HJLB 5DMIH 4X6DF 3MRIA 4Z9KB 1F4WH 3ZDYE 3GSQB 4F8QA 4GXVL 4YFLF 5L2KD 1D9KD 2R9HC 4MJID 3DRQB 2OP4L 3UTSB 5CLWA 1SMAA 3CK0L 3W0WD 4YE4H 1NMAL 1B90A 1D9KB 5D72L 4MJIB 1MCIA 5DRNA 5INCB 5HTSA 4LPVA 4RGND 1AQDB 1Q9WA 1KEGL 3H6JA 1KB5L 1U8IA 2D7PA 1EAJA 3IDNA 4POUB 4MWFA 4DWHA 3QUZD 5E6ID 1FNGA 4K7FA 4XVJL 3HKFA 1BJ1H 3VXMA 5F7DB 1IGFL 1SJVA 1A47A 3LKPA 4HKXB 4U0QB 4YHZL 3VXUE 3ULUC 5I18H 4JN2A 2UYLB 4Y1AE 4JZNA 3IDJA 3P4MB 5CIPH 2GW5A 5BS0A 4FQ1L 1T0NA 2X44D 4OFPA 3HAEA 3FO9B 3EJYC 1EEZB 3MJ8B 3BZDA 5CWSB 4NZUH 3SDDA 4FQXD 3LKQA 5LKNA 2LQRA 1FORL 2VABA 4JO1H 4KK9C 1WZKA 1FNSH 2BNQD 4FFWC 4PJEF 1I7TB 3ZYOA 5AG8A 4HUWA 5FOBB 4OZFA 4J2XA 2F54D 1AR1C 3TP4A 2VOTA 4OI9A 4WNQA 3CFJA 4P46D 2BNQB 4HXAH 4B7LA 5HPOA 3UAJD 1C8PA 1LK3L 1IL1A 1CICD 4CMMB 1FNHA 4OI7A 2F54B 1QFOA 5B8CB 1DBAL 2VC2H 1MHHB 4NZJA 2JKXA 5IBLD 4PG9A 1W0WA 3V0AC 4LSPL 4Y5XC 4Q58C 2PR4H 1W0YT 2IEPA 1PAMA 4U2ZA 5JUEL 3MV01 2NYYD 3QPQC 3S37H 4UTAH 1KTRL 4R7NB 4IRZL 2R23B 4X7EC 2HAZA 1YEGH 4WRLA 2NX5E 5EOTB 4S1SL 5M95B 3OPZL 4HKJB 5GSVB 1OW0A 5KTEL 3BSZL 3OF6A 3F8UB 3VFGH 1B2WH 1I9RH 5F1IB 3WN5B 4JPIB 3U4BH 5T3XE 3Q3GA 4EOWH 5E94B 3HE6C 2YN5A 5GZOC 1I1AC 1IAOB 4XT1C 4HHAA 1CCZA 1R3IL 4JFQA 1MI5B 3H8NA 3TYGL 4MNGA 1NDGB 3T0ED 5ADPH 1F8TH 4X6DA 4O2EA 1Y6NR 4XVUC 2W91A 4F80A 4I9WE 1L0YA 1IKFL 3VXRB 3DXAE 1S8DA 3NZHH 3KPNB 1FNAA 1F90L 3GMLB 4Q0XH 4HCRH 2FJGB 4LVOC 5C1MB 5CD3B 4M43L 3VRIA 1H9VA 4X7CC 1KN4H 5L0QB 3Q1SL 3ET9F 3TCLA 1FFRA 2F53D 4WI2A 3I3BA 4GRLA 4I0PC 1YEDB 4J4PC 4Y8DC 1NMCC 3W39B 2P8MA 1AGDA 3DX7A 3B9KB 4ONFH 3REWA 3WKMH 3LKOB 3D5OF 3BN3B 4KVNH 3MUGA 1BJMA 5MEQA 4J23A 1V7NL 3VDCA 1T7VA 1FGVH 5T1LA 3ARDB 3FQNA 2ZG3A 2V5RA 3FN0H 1ZA3A 3FT3A 5DJ8A 3K4AA 3SQOH 2X4SA 4IRSC 1NGWA 3EUUA 4N0YH 5D6DC 4CDGC 4JFXB 2CKBL 3CFEA 5JPMB 5HYSA 1G7LB 1HHJB 4HIJA 1IZJA 3RTQA 4DK6A 1BVLA 4D0BA 4HBQA 2DQFA 2VAAB 4Y5YB 3D3VE 3BIBX 2PXYB 4JKLA 4P2OB 2GUOB 1PX4A 4OF0A 2E3VA 4YXLL 2ADGB 3QIUA 1Z9LA 2YD6A 5D7IF 3PHQB 1FVEA 1MJUL 2DI8A 4OLWL 1KBGL 5E7BA 4AMKL 4JDVA 1FVCB 3H9SA 2IAMD 2Q6WB 4YNYB 1XAUA 4YDIL 2D9CA 2MHAA 3T1WA 3WDJA 4ODHL 3QDJA 2DBLH 4Y2DD 4R2GB 2IAMB 3DMMA 5DQJA 4GJTB 4M8QB 4PY7A 3I50H 4U1JA 3M17B 3BGMB 4LSSL 4NNYA 5B3JE 5DWUL 1N0LA 4M7ZC 3JUZA 4P2QD 3B4NA 1F58H 4P59L 2DQTL 5C0GB 1VA9A 4HMEA 4OB5L 3DHJA 1KCKA 3F7YA 3C5ZA 1YJDC 3MV11 4FTVA 4PY8J 3L3OB 5C7XH 5I73B 1MEXL 2OL3H 3QDHA 3AS2A 4IDLA 5KSBE 3BW9B 4OCXL 5JZ7C 1CLYL 2AJXH 3VXQB 5IOPA 1FZKB 3JV5A 4XNZC 4I18B 5DGQA 1SEQH 2H26B 3KPRE 2ZCLH 5F7MC 1FRGH 1UWEL 4KHTL 5FGCB 1PZUB 1FNLA 4AQ1B 5FYLE 2MKLC 4PJCA 4R0LB 4U4BA 4LVEA 4QXGL 4H1LG 4YHYB 4IOFC 1VPOL 5JA9A 2HTLD 4U1LB 2V9QA 2JIXD 5DK2B 2XTJC 2FATH 3STBA 4JRXA 1WWWX 43CAA 2VAJA 1MCOH 4GBXA 1BQUA 4U3HA 3T0VA 4QRQA 2ZG2A 5DI8B 2JIXB 5FHBH 1QPPA 5JDJA 1XIWA 3VD3A 5TGBB 1XGTA 1BD2A 3J8F7 4JG0H 5JNYA 5CEXA 3TV3L 1NFIA 3FZUD 3HE7A 3VXTA 3B9AA 4NQDE 1A7PL 3PJSB 3AREC 4I2XE 4KJQC 3BUTA 4TSBH 2WK2A 3L5XL 1TVHA 1MHCB 5MENB 2VXUL 4IS6B 1QFWM 5E8DL 5A3IC 1NCDH 1R0AH 3BH9B 4MAUL 4EIZC 2VXSL 4PJIE 3UZVB 1LO2L 5HGHB 2YEZB 4MS8C 4U1IA 3TT3L 1WCBB 3DIFB 1G0DA 3IGAB 1X7QA 3VFRB 3GM0A 2L7UA 2I26N 4PJ9D 2NLJB 4HT1L 1RZGA 2JB6A 4G8FB 5CEYA 3RWHA 4TQEH 5KSUB 1JPFA 5D7IA 3IDMB 4RQQB 5DF0A 5FKPA 3MA7A 4OFDA 1NJ9B 4HUUB 5F9WB 1NFDF 1S7VB 1L9MA 4K8RC 3O0RH 1HHGA 3I6KB 5IFJA 1YNTA 5EH1A 2ARJA 3DX6B 5FAAA 5C0CE 1RUMH 5B39A 4P4RB 5F89A 2ZUTA 1WZLA 5FM5O 5D7JC 4LRIA 4XRCA 2R8SH 4Y1AD 3HLAB 2FGWH 1K2DB 3J7HA 5ENWB 1F4XL 3BD5A 3OAYH 2MCG1 4X4YB 5J13B 3TO4C 2XZZA 5EC2B 3TH4T 4WHCA 4L4VD 1OSZA 2UUDH 1CL7I 4HZAA 3VXUB 3T09A 4Y1AB 1YY9D 1QRNB 1XH3A 3BMWA 3DX9A 5T5NG 3LN4B 5DJ6A 3S5LA 5IMKB 2R2EB 3MRJB 2DQUL 1Y0LB 4NOBA 4IBLT 1TJIL 3OKNA 1FL3A 35C8H 1QLEL 1ZK9A 4QYOA 1P7QD 3SDXB 3DX8B 3OR6B 3UTTE 2VLJA 3VRLE 1UCBH 1X4XA 3JZ7A 3KLAB 4NNXB 4PBVC 4AENA 3ULUF 5CP7B 4YPJA 4Z7NF 1DBBL 4DVRL 2E7MA 2NCMA 3MLZH 3R4DA 4I48B 5E9DA 1A3LL 2FR4B 3H7BB 2AXGB 4XH2B 4JJ5B 3FHQA 2EE2A 1PG7L 5GHWL 4HG4J 5JW3H 5IMMB 12E8H 2IBZX 1MJ7H 4OGAD 3LD8B 2IANE 4HFWA 2HLFD 1QZ1A 3CSBA 1AGFA 2ZSWA 3LZFH 4UTBL 4NQTA 5T3XD 4OLUH 1FZJB 3HUJF 4GAJL 3G08A 3O41B 5F8QC 1MFBH 2NX5B 3UC0L 2VDML 3AS0A 4DUXA 2A6JB 1UB5B 3LKSA 4R4ND 1KN2H 4N9GA 1WAAE 3VFUB 3BHBA 3QEUB 1FH5L 5JLZA 1MF2H 3ARGC 3S36L 3BZEB 4X6CF 1ZLSH 1U6AL 2E27H 5I1AB 1IGCL 4I9WD 3NH7L 4XMPH 3DXAD 1DVFB 4ONGH 2X4NA 4OQTH 1UB6A 4M9PA 2FHCA 5DD0L 1C08B 1NGYA 3VFNA 2Z91A 1JZ8A 2BDNL 1OCWH 4J7RA 4XXDB 3RVTC 2ZZUT 3DXAB 3IETA 5I19H 3ES6A 3QIWC 4KROD 1A0QH 3MUJA 2FO1A 4CMHC 1FN4B 2A77H 3DGGA 5ESVB 5L8KB 3MROA 2VYRE 5E4EC 3S3PA 2J4WH 5ESAA 3UYRH 3BEWB 2BNRD 4JY4A 4KROB 3VJ6B 4KTEH 3VA6A 4FNLL 1EIBA 2YD2A 1CS6A 5T1KB 4BSWA 3QIBB 3FO1A 4KV5E 1CE6B 5FO8A 1I1YB 1QSFA 1MY7A 4W4OA 5ISZA 1KOAA 4YZFF 3RDTC 1ZA6B 4YXKH 3NGBB 1JI1A 3PHSA 4LRNH 5I1GH 3QRGL 3S3SA 1GH7A 1PY4A 5BRZB 4NCC1 4OCRH 3CSYB 4DTGL 1DTUA 3G6AA 3W9EB 4TSCH 3T3PE 1OAYH 4PGDB 4UINH 1SJHB 3D3VD 3VRJB 2QKIA 5BJTA 3AAZA 2ZPKL 5DMGC 5EWIL 4JY6A 3W82A 5GRJH 5I1CH 3FOMA 2RAMA 2NY5C 2V7HB 3OKEB 1M7DB 1ZOXA 4ZNEA 4UOW1 3GKWL 1EEQA 5CHNB 1T5WA 3D3VB 1NLDL 4EEEA 1DUZB 3EHBD 4NQEA 5I66A 3QCTH 4Z5RA 4HJJH 1RZ7L 3CCHB 2HVJA 1D5BA 2W0KA 4XWOC 1A3QA 1CFSA 3PGCA 5ANMA 4KRPC 2EO9A 3MRNA 5C0EA 2X4QA 5K9OA 4KPHH 1QACA 5EZOL 2FBJL 4JFEA 5HPMA 1XF3B 1P7HL 1BQLL 4WCYL 1KLGA 3V5DB 5F7NC 3ULUH 1D6VH 1QR1B 1A9EB 4OFVA 4XNQB 4RZCB 1LNUB 2AXHA 1NH6A 1MNUH 2CRMA 5JPNB 5C0FB 1IM3A 3OG6B 5IJKC 5D7SL 3MCG1 1BX2B 1I7RA 3GMQB 5I6XC 4G42B 4P4KC 1B4JH 1Q9OA 3JWDL 3QR2A 2WUBH 3ZHDA 3RVUC 5KSBB 5FYLD 1U3HB 3CPLA 3T4YA 4Y7MA 4YX2H 2HLAA 2VXVL 3KPRB 2A2QT 4U1NA 1G7PB 3CFCH 5J12C 4LNRB 3CSGA 4HJ0D 5JW5B 1EX0A 4P5MA 3UDWC 2DM4A 4ZAKC 3NFNA 4TVPH 3MV9A 1AC6A 1SVZA 2AKRB 2L4OA 1UM6H 1IM9A 5FV2A 3VFOA 2NW3A 5ID1B 4LLQB 3FFCA 1GPOL 4KUZL 1WIPA 5D7LA 1ODAA 1OM3H 3EFFA 3WO4B 3KVQA 2ZUYA 4P2CG 2AEQH 1JPSL 3PV6A 1FHGA 1V05A 2OXGA 5ADOH 1NKRA 3MNVB 1A1NB 3NAAL 1OF2B 4FABH 2HMID 3QFJA 4EDWH 1K85A 4RFOH 3DV6A 4BK5A 4TUOA 4OF6A 3IFOB 4NQDB 4FQQA 5GZNC 3SKUD 1FFPA 1ED3B 3TN0D 4UILH 5L88H 4LDLB 4F57H 3LKRA 5LAXB 1RURL 1UT9A 2I07A 4ZOCA 3BIKA 4YAQA 5JQ6H 3C08H 3GI8H 4G6JL 4NP4L 3BKJL 2W0FA 4QEGA 3U9UA 4JFOA 4PJIB 3C60D 1CGVA 1JMZA 3LS5H 5A40E 1DQQA 1WFOA 2R15A 4OD2A 3KYAA 3KHOA 3N1QC 3VI4F 1CFNB 2NY3B 3F12A 4XCEA 1SM3L 3CU1A 3O3AB 5I9QB 5MEPA 4XTRD 2F74B 3C60B 5D1ZD 1VFAA 4NUJA 3NFPA 2JTDA 4NN7C 4NQXA 3TO2B 3BP6A 5IFHL 1ZSDB 4MXQC 4ZO9A 3MCKB 4TPRH 5A2FA 4PJHA 5C0CD 1CXIA 5I76A 1I8MA 1CL7H 3QUXB 1G7MA 4F9LC 3I02A 4NZTL 3IRPX 2ZUQB 5TFSH 4HWBL 2A73B 5GGRY 3VH8A 5LQBH 3CLFL 5HHOA 4ZPTB 4IM8A 2BFVL 2ITDA 1DQDL 4AH2A 3UTQB 5TDPB 1TNNA 4ZXBA 4NJ9H 4WO4A 1M7XA 3L95B 3OGOE 1E27B 4PRHE 2EKSB 1X9QA 1KFAL 3T65A 4ZPVB 5T3ZE 4G7VH 2H6PA 1EH9A 1QHOA 4WW2A 1WFUA 3E3QC 3IJYB 4F7EB 4JGUA 3M1BA 2QHLA 3EOAA 4OD3H 4DAGL 4NZRL 1G1CA 4D8PA 5EU7E 2DQIH 5LJYH 3UTTB 2IPUK 5I15L 5K93A 4TVSa 1OP9A 2DQJH 5DC4B 43C9A 1DLHA 3C6LD 7FABL 4IMKA 3C8HA 1INDH 4FQ2H 1NL0H 1TQBC 2F19H 5E99H 1KTLA 4OFYA 1T7WA 4HLZH 3PHOB 4YHIA 2IAND 3BT2L 2W9EL 1W72H 2IJ0C 3I2CL 1F4HA 2BCKB 4FQHB 4DFIA 1MRDH 2MSPA 1TTGA 3DYOA 3HMXA 5C08E 5T3XL 5TPWH 4AM0A 1Y6KR 2IANB 1TCRA 1WFTA 1MOEA 1KENL 1T66D 4M6MH 3LEYL 4CDHA 1SVCP 4FZEH 1YJDH 3D25B 2YD3A 3TT1H 1MCQA 2WAHA 4ZQKA 5GGQL 1Q94B 1RIVL 4C4KT 3CUPA 4MJ2A 1MRCL 3D0VA 3PNWB 1I7ZA 1A6WL 1QFWI 3ARZA 2V2TB 3FMGH 1QP1A 1DZBA 2NZIA 3MUZ1 4PJGF 4NN5C 3O6KH 5CP3H 1C1EL 3P0VH 1JNNL 5DA4A 4BSVB 3GBMH 2YBRB 4LPCA 5GRVL 3SHSA 4HS3B 1EO8L 4KY1H 2X1QA 2YWZA 3D1MC 1YZZA 3MBXH 4XCCL 3UEZA 3BZ4A 4YHPA 4U7KA 1T3FB 1KT2A 2UUDK 2IH3B 5DDHB 2VL5A 3I9GH 1F13A 1T2QL 4PD4J 4PLJC 4LNVA 1R3KA 4Q2ZA 3VXME 1CTOA 4TNWF 1XZ0B 3WS6C 4QXUL 4Q6IC 1IGJA 4LEOA 1EK3A 4I0CC 2B5IC 2E5EA 3O9WA 1NBZA 2ILLA 5C0DA 4M5YL 3RWJB 4LHUB 4UMGA 5BS0E 4WGWB 3MJ6A 4RWHA 5AD0B 4EVNA 3OB0H 3UP1A 5DD3H 3H7LA 5E1HB 5ICXA 5KG9A 2YC1A 4OAWA 4XAWH 4JO3H 1OARL 2XA8L 5FYKH 3OXRB 4NNPL 4XNUH 4QCIA 2Y36L 3R06A 4LBEB 3RX5A 2PYFA 4KU1A 4XC3H 4RDQF 3ARQA 3NIDE 4ZS7L 4D3CL 5DT1L 3U0PA 2CDFB 4FHBD 3U36B 3LHPH 3SDAA 3LPWA 2EYSB 3QNXA 4LKXA 1HSAB 4Y88A 1UH2A 1NKOA 1UXSB 5CUSH 5IROA 2Z31C 4LAQH 3U7YH 1INEL 4NKMB 1I3UA 3B6SA 1A1MB 2ED8A 4ODWB 4GSDL 3LQMA 1G7JB 4JANA 3ZT7A 1XR9A 4M9OA 5I8KH 1AGEB 3HFMH 2HYMA 1LE9B 5DLMH 4FMKA 4L9LB 4K8RH 3AU1B 3GMMA 2ICCA 4YLQT 3STLA 5EU5A 2QSCH 3QHZL 1FG9C 2CMRH 4ODTL 3BKML 3ZDZE 5L2JB 4TUKL 2EDKA 5JA8B 4WEMB 5FECA 1WJ3A 4XP5L 4PYGA 3QJFA 5BQ7A 4ONHB 3QO1A 4MNGE 2BOCA 5TE7H 2E9JA 5JQHC 3T0AA 1ZGLP 3INUH 1DR9A 4OZHE 1DQJA 1LO0H 5H37G 1QRKA 5I75C 3V7MA 4J1UA 3LKNB 2CPCA 2HG5B 3RU8L 5EOCL 4FQLL 1I1FB 3QDMA 5C0BA 3MUY1 4W81A 2DBJA 2DIAA 1I9IH 4WWID 4WWKA 1HZHL 5DS8A 3RQ3A 3SE8H 2VLRB 5IV2B 1QFUL 3ESUF 2NY2C 3DO7A 1AFVL 5GS2D 1II4E 2FJHB 1VESA 1NGZA 2GAZA 3MCLL 3SKJL 2EIDA 4U1KB 5CCKH 5JHLH 3EYOA 4FXGB 2HT2C 4V1DA 4X80H 3CX2A 5FK9A 5D8JH 3GBLA 4LPTA 1BJ8A 2ATKB 1TVBB 1VFUA 4H88H 4Q9CA 5D2NC 4JLRB 5KSAB 4TYUA 4QOKB 4FXKA 2H9GB 1JMXA 4MD5B 5J1AA 4X4XB 1BOGA 2AEPL 4EI5B 15C8H 4IJ3B 5IF0A 1V7ML 1DL7L 5BO1H 2G9HB 1RZKL 4LCCC 1CD0A 3A6BH 2FB4H 5T1DL 2OMBA 4ZO7A 1E4XL 5EO0A 1U8LA 1A2YB 3QG6A 3KPLA 1AKJA 2A0LC 1HYSD 2XXCB 1S7UA 4WHYH 1S9WB 3BPCA 4FFZH 1P1ZB 3TJHC 5E2VH 5IW1A 3KLHC 4I3RL 4U2YA 4Z7UA 1DEEA 3A6CL 5JXED 3ARBC 2FYYB 3IDYC 4G8EA 3QCVL 5TE4L 3QDJE 3A67L 2A6KA 3W2DL 2X7LA 3D9AL 4MA8L 1IFHL 3O6FB 5IW3A 4FP8L 4L4TA 2AP2A 4JQXA 5DFVD 1ZWIA 2ATPB 4RISL 4YBLB 1ZE3C 3ZE2E 2X4PB 1HILB 1P6AB 3F6LA 1HQRA 3EDDA 4DCQA 3H3PL 3QI9C 1CFBA 2NY4C 3MRHB 1Z5LB 1YNKL 2AJUL 1X6NA 3NN8B 4LEXL 5T3ZD 4NIKB 4FTVE 1WF5A 1GJIA 4MD0A 5TE6L 2R56H 4PRHB 4GT7A 4JRYA 4WV1C 4NQCD 4J6RL 5DXWA 3CFDA 4UT9L 4RX4A 3ZTJG 1VADA 2NY5H 4F7TA 2Z8WC 1T1ZB 3H9HB 4JB9L 4WEBH 2DTSA 1N64L 3MLTB 3GSNH 4MX7B 2R29H 4PJCE 3VGAB 1T20B 2AI0H 3CIQA 4DKEL 4GMTL 4WFFE 3R1GH 1K3ZA 4S1RH 4RMUA 4F2MA 2CH8A 3MOQA 4X6BB 5C6TH 2H2SC 4BH7A 5C9JA 5DMKB 5AZ2L 4JRXE 2X9YA 3VGGA 3G5ZB 4TSAH 3LEXA 1JF5A 2FJFB 3QUYB 4PIRF 1T0MA 3RWEB 5EBWA 1KIPB 4IMLA 5C08D 4QHMA 1QA9B 3EFDH 4G80B 1WWCA 4IDJH 2VKWA 1BD2E 3HS0A 3HZYB 4WW1B 1KACB 4OSUH 4XBPB 2VWEC 2R2HB 2AK4A 4QXTA 5C08B 1JWUB 1QFWH 3NIFE 2VDLH 1IC5H 4L8SB 5GS0L 4BZ1L 4EN3C 2H2PC 4Y4KB 1CK0L 5E1AB 1CXHA 4WHTA 2OTWB 3U48A 4WFEE 1JHTA 2D7NA 3BQUD 2P48B 2Q7YB 4NHCH 3MRIB 2UVFA 4YQXL 2I27N 4FQPA 1JTPA 2HFTA 1AP2A 4XNYL 4LLDA 4Y8AA 7CGTA 4JKWA 1RIUH 4IEFB 1OP3K 2FX7L 1OGAA 3B2UD 5GRUH 2WBWB 1FBIH 4G8IA 5DRNB 1RJYA 4G6AC 3QEQE 1Q9WB 1FLTX 2FGZA 5HGDA 5DQDH 2R2CA 3KWWA 3JVGC 2N7AA 1U8IB 3IDNB 2P5WD 4MWFB 4R97C 4XHJC 3RKPA 3PP3H 1TIUA 3O2DL 3V5HA 2VUOA 1FNGB 1RPQA 4K7FB 3VXMB 4W6XB 1T21A 4BSJA 4XVTH 3DUHA 4HUNB 3LKPB 1OOAA 5F7LB 4KVCH 4D9QD 4JN2B 1HIMH 2X1WL 5KOVC 4JZNB 3VD9A 3IDJB 3RVXD 2O5ZH 2ZUSA 2Y5EA 2P24A 5BS0B 1T0NB 1YNLL 3HAEB 3NZ8A 4KKAC 4PLOB 3OAZK 4YHKL 1U95A 3LMJH 2R1XA 4UBDC 3SDDB 4AIXA 2EH7L 3S88L 1J0KA 1MAMH 2J3SA 3LKQB 5I74C 1J5OL 2VABB 3BN9C 3BRDA 4RBPK 2VLJE 3PABA 1C16A 2EDDA 4HUWB 4OZFB 2R4RH 5GGSA 4YDVA 3HC4L 1IT9L 4WNQB 3CFJB 1IAIL 3ZSSA 3P3YA 4X4ZA 1EHLL 5KW9H 1IL1B 5C0JA 4NFCA 5J1TC 4K2UL 3WXWH 3BE1H 1XGUA 5EBGA 5FFLA 1JPST 3P2TA 3SOBL 1H3PL 1XGYL 4QHKJ 4QT5A 1NEUA 4YBQC 1OTUC 4PG9B 2B4CH 3SGJA 1W0WB 3O4OB 3O6LL 2W0PA 1SBSL 1U8QA 5TDNA 1NAKL 2HRPL 3OJDA 2YN3A 2BP3A 5HHPA 1DP0A 4U6HA 3BPNB 2OMNA 4RMSA 1MAKA 2EO1A 1WV7T 4EDXA 2EXWD 3Q3GB 1D9KC 3U1SL 4HHAB 4JFQB 1DBKL 1IKNA 2ICWI 5DRXA 5JW4M 1O7SA 5IQ9A 4MNGB 5CZVH 1K9TA 2EE3A 1CR9H 1MCFA 4JDTL 1YEJL 3LEVH 4X6DB 4O2EB 1F3DJ 1NGQL 3MRMA 2J8UF 1BGXL 3PGFH 1S8DB 2ENSA 3EKCA 4DN3L 4OZIF 2APBA 2GSIA 1CU4L 1HWGB 3VWJD 4NC2B 1JPGA 2Y5TA 4GRLD 3BPLB 5F72S 4M8VA 2ZUVA 5HYJD 3VRIB 4LLWA 2NZ9D 3HCVA 3UJIH 3L3DA 4K9EL 4LHUG 3TCLB 4LHQB 5C6PB 1IC7L 1QBMH 4GRLB 4LSUH 4XVSL 1HKFA 4G7YL 2VDQL 4G9FA 2P8MB 3KHQA 4OCSL 2KBGA 1ZHNA 1NCAH 1QSFE 1AGDB 3LRHA 3BP5A 4Z7QF 3DX7B 3REWB 3FTGA 5ISZE 1A6VL 1MCWM 3MUGB 5EA0H 4NM4L 1BAFH 5MEQB 3NTCH 3CZJA 1PLGH 4UT6H 3VXPA 5T1LB 3FQNB 2D2OA 5HDBF 1U8OA 2QEJA 1ZA3B 3FT3B 3FONA 5DJ8B 2QJDA 2CR3A 1R3LA 2X4SB 3IFLL 1JPTL 1P9MC 1NGWB 5B8CC 4JN1H 3MBED 3IDXH 3CFEB 4YDLB 5HYSB 1RK0A 4HIJB 4KK6D 3RTQB 3QIUD 1BVLB 1L7TL 4D0BB 4ZNEE 2DQFB 2FL5A 1UFUA 5E2WL 4X9FA 1HEZA 3QDAA 4YH6A 5E8PA 1J86A 5DO2D 4NGHH 4NQEE 4LAJH 5IBLC 1MCKA 3QIUB 1Q0XH 2MFNA 3WFBH 3WN5C 1FVEB 4EZMA 3Q6FA 2NYYC 2VLKA 3QDJD 5TF1L 4XPBH 1VGEL 4JDVB 3H9SB 5ANME 1A14L 3MLUL 2MHAB 5BVJA 3ILQD 4GAGH 4HIXL 4E5XA 2DLIA 1CFVH 1KLUA 3QDJB 2FD6H 4MAYD 2DOCA 4JFEE 4GAFB 4G6MH 3SGKC 9CGTA 1NUDA 3DMMB 5DQJB 4PY7B 4U1JB 4PB0L 4NNYB 4OF3A 3PF2A 5CSGA 4KTDL 4N0FA 5FEBA 4NRZA 1LO4L 2OSLA 5HVGB 3QNZA 2EDFA 5HY9A 5T3ZL 1ADQL 4Y0GA 3AS1A 3OR7A 5L0QC 1CGXA 3F7YB 4OM1L 3C5ZB 4PG2C 2EZ0D 4FTVB 3UBXA 4HK3N 2IGFL 4HH9A 4EQ3A 1LE5A 1P4BL 1S9VA 4YFEA 5IOPB 3B9KC 1YMHA 5E8OA 1EFQA 5HHXL 4OZIA 1PYWA 4KQ3L 4PJCB 4ZUTA 1QD0A 5J56B 2W9LA 3ARDC 3D0LA 3MOBH 4RSVA 4ZOEA 3SY0A 1TMCB 4LSDA 2VZVA 3MV9E 3WXVL 5DJDA 3QUMH 4ZDHA 1RAMA 1XIWD 3G5XA 4JRXB 43CAB 4POZD 1BD2D 1EJ6A 3FFCE 4GBXB 5D7LE 4XXCC 5IG7A 1GVIA 4QRQB 4Y5YC 2PXYC 3IF1A 4P2OC 3GSOA 4NKIH 1XIWB 1KUMA 3C09B 2NTFA 1XGTB 4KTYA 1WBYA 1BD2B 5JNYB 3QFJE 5CEXB 1NFIB 4NM8L 3HE7B 3VXTB 4GXVH 3WYRA 2PW1A 4WFED 3WNPA 4JM2A 2QQLL 1JWSA 5DGRA 1WBZA 4C55A 1NSNL 1TVHB 4NBYB 4DGYL 4AJ0A 3CK0H 1FV1A 1NMAH 5E5UB 4X5XA 4QHNA 5D72H 3U7WL 1FYHB 3MV8D 1UXWA 5LG1A 4MQXC 4R2GC 3TH3T 4KRLB 4U1IB 2IAMC 3GI9L 1KEGH 5DURD 1X7QB 4JZJA 4Z7VA 1KB5H 1ZHKA 5D1XD 1DCLA 1ORQA 1D5MA 1RZGB 2JB6B 3MGAA 5CEYB 3RWHB 4U6XA 3QEQD 3UZEA 1JPFB 4XVJH 5D7IB 1A7NL 1ZLVK 2B2XL 2DLGA 3MNWA 3EDFA 1IGFH 2D7OA 5FKPB 2EDRA 4PJHE 4H20H 3MA7B 4YHZH 3D85D 5D96B 4AT6A 1N6QL 5I73C 1MAJA 1NCCL 3GHBL 4FQ1H 5DRWA 4AEFA 1HHGB 5IFJB 1YNTB 2ARJB 5B39B 4KI5C 4I18C 3P4OA 5F89B 4F33A 2I9TA 3K8KA 4XRCB 2DL9A 3JWDC 4XP6L 5JIHA 4ZUWA 4R0LC 1FORH 3WHE1 5EIQA 1OSZB 4YHYC 4IIQA 2VITA 2Q1EA 3MRPA 1NAMA 1XH3B 3DX9B 1T1YA 5DJ6B 3S5LB 2VLME 4PJXF 3QWRD 3DSFL 3SBWC 2VLJD 3V7AE 1LK3H 3WIIL 4PJFA 5FUCE 3OKNB 3VGBA 1FL3B 1SYSA 2HTLC 4XBEL 4QYOB 1DBAH 3WFCL 1J1PL 2VLJB 2G5RA 4AENB 5HBBA 1ZT1A 2EDTA 4LSPH 5JUEH 3CMGA 1I7UA 1D5IL 5E9DB 3MLWL 4IRZH 4U1GB 1JUFA 4S1SH 3JWNC 3OPZH 3BSZH 1NDMA 4HS8L 4FOMA 1TXKA 5IESL 1R3IH 1NC2A 1WGOA 1MCRA 4HFWB 2AERT 3TYGH 5GGVL 3WE6A 1AGFB 2ZSWB 4FQIL 1FAIL 5C86A 4GW4A 4Z0XA 2OYPA 3G08B 4HDIA 1LGVA 1WZMA 4MJ5A 1HXYA 4X9IA 3LKSB 5SV4A 1IKFH 1ORSA 4N9GB 2XZQH 3BHBB 5JLZB 3AC0A 3U82B 1F90H 4JQVA 4PRDA 5T5FL 3VDAA 5F9WC 4I4WA 1F11A 2GITA 2X4NB 1UB6B 4M7LL 3Q1SH 2XV6B 2XFXA 1NGYB 2IQ9L 4H1LH 3VFNB 5B38A 2Z91B 3TLRA 3MYJA 2AABL 1BF2A 4R7DA 2EDNA 3IETB 5J13C 3ES6B 3MXVL 4HMDA 4PBWD 4QY8A 1B88A 5CBAA 3DGGB 4XI5D 3CFBA 2ZCHL 1FP5A 3MROB 5I17A 3LB6D 3OB8A 5ESAB 4LKCA 5C07A 4JY4B 1QSFD 1G1YA 4MVBD 5ISZD 1S3KL 3SE3C 3HAEG 4NCC2 4LPUA 4BSWB 3FO1B 2PETA 5H2BA 5FO8B 2CKBH 1QSFB 5ISZB 1OLZA 2PO6A 1U42A 4F7PA 3T3ME 4ODSL 2EECA 4OZFG 3OX8A 2UZYB 4JFHE 3NABL 1EHNA 3VFVA 4YXLH 4QTIL 3G6AB 3CH8A 1SJEA 3UROR 4KDVA 4Y16D 2NY7L 1KB9K 2QKIB 5BJTB 4OLWH 1KBGH 3AAZB 4AMKH 4L1HA 4JY6B 5DJZA 4NQED 3FOMB 1ACYL 2FNBA 4B5EA 4YDIH 5K9QI 4ODHH 5F7HA 1T5WB 4HUVA 2LU7A 4NQEB 5I66B 4Z5RB 4OGAC 2HA1A 1N7ML 2HVJB 3NCCB 3BEVA 1D5BB 3ZDXE 4LSSH 5DWUH 1RULL 2WP3O 3IU3A 3V79C 1AE6L 5LBSL 5IHZA 1CFSB 1NCTA 4P59H 3PGCB 5ANMB 4PUBL 2DQTH 3HA0A 1DVFC 3MRNB 2VDPL 2X4QB 5C0EB 1EAPA 4UNUA 5K9OB 1EXUA 2C4FU 4PBXA 4OB5H 4JFEB 5HPMB 5KVEL 2KQMA 1CIUA 1BOYA 1MEXH 2JK5A 1KLGB 3W5MA 4OCXH 5AZEL 5K9JL 3MOAL 1KLFA 1CLYH 2Q87A 1KCUL 1UWEH 5HD8D 1IM3B 2X6MA 3ILPA 4EQ2A 3VWKA 2XQYK 2JLLA 4QTHA 4KROC 1X5JA 1I7RB 4Y5XA 4QXGH 1Q9OB 1VPOH 1CF8L 3QIBC 4PJBA 4O4YL 4R9HA 4XCFL 3CPLB 3T4YB 3BESR 1DFBL 1ZHBA 1OP5K 4XB8A 2HLAB 1F45A 4U1NB 3NGBC 4GUPA 5L2KA 2BSTA 2RIKA 4P5MB 1MWAA 3THML 4G5ZL 3FFCD 3NFNB 3EGSA 5D7LD 3GO1L 3ZO0A 3W0WA 3TV3H 3UTOA 3MV9B 2Y4SA 1IM9B 1T2JA 2APFA 4R90L 1A7PH 3VFOB 2NW3B 3L5XH 5DEFA 4JREB 2VXUH 3FFCB 3QFJD 5E8DH 5D7LB 4XNXL 3EFFB 4MAUH 1LEIA 5HYSG 1LO5A 2VXSH 2XN9A 3PV6B 3UYPA 1LO2H 3QUZA 2R2BA 5E6IA 4XC1L 1E4KC 2QSQA 3TT3H 5DZOA 4ZD3L 1F6LL 3QFJB 1RUKL 2CRYA 3U9PL 3DV6B 3KJ4B 3V52L 4TUOB 4KI1A 1ZVHA 4FQQB 4HT1H 4WI7A 5LGHL 1FFPB 1Z3GL 2OX5A 4K23L 3KPOA 2DS4A 3LKRB 4M7KL 3S4SA 2I07B 4YAQB 3BIKB 1HCFX 4H8WL 3ZTNL 3HB3D 3GUTA 5F9DC 2W0FB 3U9UB 3DJ9A 4JFOB 1G84A 4APQD 1DQQB 3VG9B 4OD2B 1XGQA 2UV3A 1YPZE 4FQXA 4AK1A 3F12B 4Z7UE 4XCEB 2Z9TA 1IZKA 3ETBF 2MKWA 3DI2B 5MEPB 1EMTL 3F7VA 1RJZA 1VFAB 3T77A 4NUJB 4MDIA 2ZUWA 5EU3A 3NFPB 4JPWL 3IS0X 4NQXB 4L5FL 1DBML 3BP6B 4P46A 4PJHB 3WD5L 1EBAA 5I76B 1CICA 5I1JL 1I8MB 2V7NA 4L4TE 5FF6A 4BFBD 1G7MB 1ZTXH 1EHXA 2P45B 5C0ND 3I02B 4HFUL 3M07A 4HMCA 1U3HC 4PR5A 4W6YB 5BW7C 1XF1A 3VH8B 5HHOB 2BY0A 2DQUH 4HW6A 1HKLH 1TJIH 2RQ8A 5IIEA 1BF8A 2ITDB 4AH2B 1QLEH 2CD0A 5ICYA 1UACL 4ZXBB 2VLMD 5L6YH 4CJ1A 4WO4B 4QGYA 4M48L 4JRYE 1DBBH 2M2DA 4JZOA 2J12B 4XP1L 3T65B 1A3LH 3B83A 2H6PB 3JV4A 4TOYL 4FFVC 4WW2B 1M05A 1WCQA 2NY1D 2R0KL 3WS3A 1IAIM 1HK6A 1PFCA 3M1BB 3WO4C 1PG7H 3EOAB 1KF9B 5GHWH 3U0TA 3T0EA 4Z78A 2X9WA 3ZE0F 4D8PB 1D5XA 4UB0L 1QOKA 4OFYD 2NY1B 43C9B 1PG7X 1DLHB 3MRBA 4UTBH 3L6FA 3MX0A 4GAJH 2CQVA 2YD4A 2VZOA 1KTLB 3UC0H 4M6NL 2UVEA 4YHIB 5SWZE 1FH5H 3S36H 1R3HA 2FEDD 1U8PA 1U6AH 1WT5A 2F53A 4KKLD 1CBVL 2AK4E 1IGCH 3NH7H 3DETD 4AM0B 2NY3C 1RZKC 4I8DA 1TCRB 1JZ6A 5I9QC 1J1XH 1X3DA 4TRPL 3C60C 5C92A 2GEEA 3BISA 2LE9A 4Y5VA 5DD0H 3RL2A 4ZYKA 2AQ2A 1A1OA 2G2RA 1U41A 3EO1A 5EPMA 1GRWA 1KTDA 2BVUA 3SE9L 2XIDA 4XTRC 4ZQKB 3F5WA 3CUPB 1DQLL 4UU9A 3QUXC 3D0VB 1RY7B 1I7ZB 2Q8BL 3MO1A 2XY1A 3ZDYF 3QBTB 1EFXD 2ZUQC 1OAZL 2QL1A 5CILL 4GS7B 4UUJA 1PZ5A 3KNBA 3WHE0 4FNLH 1OGAE 2A6DA 2LU4A 5B39G 2WNGA 4YHOL 3E6HA 1BVKA 2GKIA 3BZ4B 4YHPB 3GSWA 1KT2B 2W38A 1YEIL 2VL5B 2DLFL 2VXTL 1NEZG 3QRGH 3UPRA 2R0ZL 1KTKE 3PWLA 1QFPA 1R3KB 4H26A 4DTGH 4Q2ZB 3UTZA 1KC5L 4HS6A 2EE6A 3LDBB 3S5LG 5B4MC 4K71B 1IGJB 4LEOB 1UKQA 3RGHA 4JFHD 4Y2DA 2ZPKH 3O9WB 1IRAY 1NBZB 5EWIH 3TBVA 5C0DB 2XWTA 4EVNB 1FO0A 3P77A 3FKUS 3TZVD 2AV7A 3GKWH 5K59E 4P2QA 5ICXB 5F7EH 2YC1B 5KG9B 4OAWB 2P49B 4QCIB 3R06B 1RZ7H 2PYFB 4AG4L 5JHDA 2RFXA 3LH2L 3SDXF 1YN7A 3U0PB 3QQ3A 4U3XA 1T04A 1MHEA 3SDAB 3IS1X 3QNXB 4FRWA 1OLLA 3HZMA 4LKXB 2GI7A 4LP4A 5EZOH 1VEPA 2FBJH 5J57B 3KR3L 4WI5A 2EDYA 1BQLH 2IMNA 3ARVA 2ID5A 4WCYH 3B6SB 4JANB 1XR9B 4Q9BA 4ALAL 2YUZA 5GS0C 5CEZL 3WNKA 4GW1A 4KFZC 1BPVA 3BWAA 3GMMB 4XPGL 4Q9RL 5EFIA 1J0ZA 3STLB 5JDSA 5EU5B 2NXZB 5D7SH 2V5SA 2IADA 1JGEA 5IB5A 3RWGA 3JWDH 4HK3J 1HQ4A 3RWIA 5F9OH 4Y4HA 4I13B 5FECB 3FQRA 1UKTA 2K1MA 3UJTH 5C70A 3QJFB 5D2LA 5BQ7B 2VXVH 4WI8A 4OUOA 1KXVC 3QO1B 4WWKD 2BOCB 1FIEA 2DLEA 5EO1A 1VFBA 3UO1L 1DQJB 1PY9A 3H0TA 3K1DA 4Z95L 3D87B 5H35A 3L5IA 2X1OA 4J1UB 3CD4A 5GJTL 4LGRB 3IYLW 2VXQL 3QDMB 5C0BB 5EIIA 1PEZA 4WWKB 5DS8B 2DMCA 3NA9L 2K9UA 5ALCL 2N56A 1I9EA 2BY1A 2MMXA 1GPOH 4KUZH 4F7CA 3T2NL 3VE0A 4UIKL 4N5EC 3DO7B 4MMZC 1G9MH 4PJ9A 3S35L 1JPSH 1DDHA 5HHNA 5KSVA 1X6LA 1LP9A 3T2PA 1NGZB 3MGTA 2GAZB 3EYSL 2Y9RT 3MV7D 1A6PA 1I8LC 3NAAH 4G9FE 4LOUC 2FIKA 4PJAA 4UQ3A 3EYOB 4V1DB 5FK9B 4ZUSA 3L5JA 2QADB 1W0VA 3QG7L 5ILTL 1J0IA 4NC1E 1RURH 4PJ8D 5IWLA 4G6JH 2CIIA 1PKQA 2P44B 3BKJH 3DUUA 3Q6GH 2HTKC 4FXKB 1N0XL 3OV6A 5J1AB 3HHRB 3SJVD 1BOGB 1SM3H 4UQ2A 5IF0B 5D9SA 3OQ3B 1AKJD 3P11L 4L4VA 4NO3A 4PJEE 1JRHL 5EU4A 4L9LC 1UC6A 2YUWA 3JWOL 5IFHH 5KZCD 1E4XI 1U8LB 5EO0B 3QG6B 2J5LB 3KPLB 1AKJB 3PDOA 4C83A 1S7UB 4P57A 3H2WA 3KPQA 3BPCB 4LCIH 4N8CL 3E0GA 2VLKE 3N1GC 4NZTH 1P7QA 1YEFL 4XPAL 4Z7UB 5IW1B 4AL8H 1DEEB 1KPRA 4HWBH 5KS9A 3QZWA 1VGKA 3CLFH 4YDJA 2M8XA 5JORA 4L4TD 1MSPA 1Q72L 4G8EB 2BFVH 4NBXB 1DQDH 2A6KB 1K8DA 2X7LB 3WJLA 1G6RA 3TGXA 2BJML 5MERA 2KDGA 4L4TB 4ONOA 3DOSA 3K74B 1KFAH 1ZWIB 2CK0L 5B3JF 4LU5L 2X89A 5DJ2A 5FIEA 4NQVA 1HQRB 5DK0A 4DCQB 1H3TA 4XP9L 1IJ9A 3WV0A 3AY4C 4WUKL 2IALA 2K7QA 4JRYD 4M7LT 2O5XL 2OK0H 4NZRH 1OAUL 4RX4D 3DPBA 3IJHA 4MD0B 1Z9OA 1OWRM 3AM8C 4JRYB 2VISA 7FABH 5KSBF 3CFDB 1VADB 2DQCH 4F7TB 3W11D 4K9EC 3SN6N 4DZBA 4KKCC 1U91A 3QH3A 5BOPA 3BT2H 2W9EH 2CSPA 3NBNA 1MFEL 3MACL 5KSAC 5GGTH 2DJ4A 1I85A 3O8XA 4F2MB 5F9AC 5T3XH 4BH7B 3PWNA 5C9JB 4K3EL 5SWZD 5DRZA 3O3DA 1K8IA 4EI5C 4IJ3C 3HMXL 2WBJD 3MRKA 3LEXB 1KENH 4KMQA 1T0MB 4TTDC 1S9YA 5EBWB 4IMLB 5J6HA 4QHMB 3LEYH 2J7LA 1MCDA 5HI3C 2BNRA 4GRWH 3HS0B 5GGQH 2CGRL 3TBSA 1MRCH 2AK4B 1RU9L 4QXTB 4MCZA 3VD7A 1A6WH 5HGAA 4JVPA 4ODVL 4CGTA 3HR5A 1YEKL 1EUTA 1Q1JL 4P49A 5H37H 2YOCA 1HYSC 1AD0A 3PQYA 4WHTB 1BFVL 1C1EH 1JNNH 3OKDA 2EKJA 1JHTB 2DM3A 1EO8H 3B5HA 3MLYL 4PJIF 5JXEC 4XCCH 3CH1A 3O6FC 4Z7VE 5EBLA 2PCPA 1OGAD 5A2KH 4P5TA 4JE4B 1AP2B 4YBLC 4LLDB 1T2QH 1YY8A 2R1WA 4AEIL 4M1GL 5IVOA 1OGAB 2YPKA 2COQA 2DQGL 3GSRA 4QXUH 4RMTA 2XZCL 4G9DA 3K80A 4G8IB 1GGCL 2EXYC 1FVDA 1RJYB 4M5YH 5IJVA 5HGDB 3KWWB 1TNMA 3BWUC 5HI5D 3V5HB 1OARH 2XA8H 4OCWL 4NNPH 1T21B 2Y36H 1R5IA 2F8OA 2CRIA 3VGAC 4J8RA 4CNIA 3U46A 5ITFA 2UWEA 4ZS7H 3T0BA 4ZFZA 2X4OA 4D3CH 5DT1H 5EU7C 3TIDA 1O5DT 2FLBT 3KPMA 1H3GA 1AJ7L 2P24B 2Y7QA 2YUXA 3GHEL 2Z8VC 3NZ8B 3IDUA 1BFOA 1U95B 3QUYC 4PJFE 2FECL 4LCWE 5I8OH 1A9BA 2DIBA 2R1XB 1INEH 5J7CC 3SO3B 3N85L 2HT4D 5EZJA 4GSDH 1M1SA 3PABB 1C16B 3N9GL 4JPKL 4JAMA 5GGSB 4YDVB 4U3CA 3VRLF 2WW8A 4L8SC 1IAII 2IFFL 1WISA 4F9PA 2ZOLA 4Y4KC 5C0JB 3VFTA 2AQ1A 3QHZH 4BJLA 4ODTH 3BKMH 1XGUB 4TUKH 2J1KA 4EBQL 5IKCA 4QT5B 3RJQB 3LIZL 4XP5H 1MCHA 4F37F 4LLAA 1U8QB 5TDNB 3OJDB 3BIAX 3FRPA 5HHPB 5AG9A 4U6HB 4D94A 1M7IA 3E8UH 3RU8H 5EOCH 4FQLH 1T6WA 2GSGA 4EDXB 4WDIA 2BVOA 1RHHA 2VSDA 4NKQB 1S7QA 3W5NA 1HZHH 1WAAF 2YD5A 4P2RD 4X98A 2NQCA 4I2XA 3KJ6L 3ZTJH 4WFGE 1QFUH 4DOHE 5L9DH 4JG1L 1ULVA 3KPSE 3TJEL 4Y4FD 4P3CL 4WHDA 4RMWA 5DRXB 3B2UC 4D9LL 5IQ9B 1AFVH 4Z0BL 3T0WA 4CU6A 2NY0D 4JO4L 3TN0A 1O7VA 5D4QA 3V9FA 3VXSE 3MRMB 3MCLH 4HULB 3SKJH 1YYML 1A7QL 4H5SA 5GXBB 2GSIB 1QNZL 1FGNL 3O45A 1JPGB 2Y5TB 4N90E 3PIQA 2C3HA 1VFMA 4G9FD 4LLWB 3VI3E 5JOEA 4PY8I 3HC0A 5C07E 3HCVB 3L3DB 5D1ZA 2Q7NA 3RIFF 5C0RL 3SDDC 4LVHB 5D5ME 4G9FB 2A6IA 3PP4L 4R3SA 5F1KC 3L3IA 1ZHNB 2QV2A 2AEPH 4KV5F 4IOIA 3BP5B 2XKNA 5C0CA 1V7MH 3FTGB 1DL7H 3BJLA 1ZLWK 3G6JA 4CKVX 2XG4A 1RZKH 2WWKT 3S98A 3C2AL 3L7FA 1TZIA 5T1DH 1E4XH 3VXPB 4UV4L 1U8OB 1T83A 3FONB 5F97E 3EAKA 1R3LB 4PFEA 3T3PF 5E2TL 4I3RH 5C09A 1RK0B 1RIHL 4ZOAA 5BOZG 2MQ3A 3O4OC 4OCYL 4U1HA 1QBAA 3QUKA 2FL5B 3T0DA 3QCVH 5TE4H 1HEZB 2VLKD 3HC3L 5EB9A 3A67H 5E8PB 4M3JA 1J12A 3W2DH 1BM3L 5ALBL 3D9AH 3BPNC 4MA8H 1IFHH 1OW0C 3RVVD 5EUOE 2JELL 4W68A 3VGFA 4FP8H 1JTTA 3C5JA 3QRFM 3Q6FB 2HFGL 2VLKB 2AVGA 4RISH 2I5YL 2VB5A 3V6OA 1JK8A 4HEPG 5IHBA 1R5VA 4LLMA 4K7PL 2EDOA 5BVJB 3ULSA 2EXWC 1YNKH 4E5XB 2AJUH 1KLUB 3C6LA 5FOJA 3WSQL 4LEXH 1MPAL 2BRRL 4M00A 5I1EL 5GGRA 4P23D 4PGEA 5TE6H 2PW2A 2IPTH 5B22A 3RUGA 5DVMA 4J6RH 4N0FB 4NRYA 4UT9H 1TJGL 4S1QL 4NRZB 1MFDL 3BPLC 4M6OL 2OSLB 4OT1L 4JB9H 2NXYD 3QNZB 1N64H 3NCBB 3VA2C 4DUWA 5HY9B 2WZPD 5IB4A 3OR7B 4DKEH 4GMTH 1OWWA 2Y06L 4UNVA 4KXZI 4PJ7A 1OPGL 3ZKNC 3UBXB 4LASL 3E2HB 4HH9B 1LE5B 5AZ2H 1S9VB 3IAGC 4B41A 1YMHB 5E8OB 3PUCA 2E8YA 2DF3A 4OZIB 5DMIL 1PYWB 1I4FA 5L2KE 1XGPA 5DUPL 2W9DL 5F93C 4ZUTB 1KPVA 1A4JA 3D0LB 4JO2L 1GAFL 3SY0B 3W0WE 4UAOB 4ZFFA 4TULH 4X0KA 5DJDB 3VMNA 3ARFD 4ZDHB 1OAQL 3G5XB 5GS0H 1G7HA 4BZ1H 4YDLC 1RSFA 1LDSA 4ZMAT 3RTQC 2BVPA 2PTUA 5IG7B 3EYFA 3BUYA 1JZ4A 4JM2D 2XN9E 3IF1B 2IC2A 2PYED 1I8KA 3GSOB 4M1DL 4XAKD 2NTFB 1WBYB 2BMKA 4RDQG 4KK6C 3QIUC 5CJOL 3SKNA 4N0CD 4YQXH 1L7IL 2PW1B 1HDMA 4JM2B 1JWSB 4XNYH 1WBZB 3JXAA 1FZOA 3Q48A 4QRUA 2FEEL 1BEYL 2DM7A 1QKZL 2FX7H 1CGYA 1FV1B 4OLVL 4X5XB 1PGRB 4QHNB 1DANT 1UXWB 3TIEA 3VCLA 3O3EA 5F88A 5J11B 2FZ3A 1MY5A 2F8XC 3DMMC 4R26L 1C5CL 4JZJB 4Z7VB 5CD5C 1ZHKB 1U36A 1ORQB 1D5MB 1ES0A 2BHUA 3O2DH 4U6XB 2AJYL 1SEBA 3MNWB 1ITBB 5HGBA 3MLXL 2BSSA 2OI9B 4DKDC 3ARXA 3WLBA 4RA3A 4HPYL 1AD9A 3C5ZC 5AYQA 1EGJA 1PW3A 5I2IA 4AT6B 1FG2A 3HNVL 1YNLH 3LCYA 5DRWB 3V5KA 3ZSTA 4YHKH 1G6VK 3P4OB 2EZ0C 5FGSA 4O00A 3DVGA 4F33B 2I9TB 4WFHD 3EJZC 3FHAA 3HI5L 1XF5A 1CQKA 2EH7H 4ZUWB 1J5OH 3DECA 5EC1A 1IAMA 3WJJA 3ULVL 1LK2A 1FNEA 4IIQB 3O11A 4HJGA 4LCWD 2VITB 3MRPB 1NAMB 1AXSA 3HC4H 4LL9A 3VW3H 1T1YB 1IT9H 2OTPA 2CR6A 1IAIH 1EHLH 4GBXC 2Q76A 5INDA 1ZV5A 4PJFB 4FFYL 1MH5A 4K2UH 3MLPA 1HOCA 1SYSB 2C5DC 3NMEA 4JJHA 3T0EE 4P99A 4AQOA 3CX5K 3LN9A 1E28A 3U79A 1XIWC 3SOBH 5J9PA 1BVZA 1H3PH 3C09C 3GIVA 1XGYH 4KK5C 4Y2OA 4POZC 5E03A 1ZT1B 3HE7C 5DD5L 3TYFA 1SBSH 1I7UB 2XKUA 3DURA 1NAKH 1A5FL 4KGLA 1INQA 2ZJSH 1JUFB 2F15A 1NDMB 1ZXQA 5ERWA 1I3VA 2MCPL 2F53E 4YGAB 1KJ3L 2ZKHL 1H8OA 1KN4L 4RIRA 3U1SH 2QHRL 3JSSA 1NC2B 3SKOA 2VZ3A 3ZT5A 2X4TA 3WE6B 4GW4B 4H8WC 4JDTH 4Z0XB 5HYQA 1YEJH 2XTJE 1OAXL 4HDIB 4M62L 4WFGD 1NGQH 4MJ5B 1HXYB 3KPSD 1BGXH 3WKML 1ORSB 3HI1A 4DN3H 3GKZA 3PV7A 3SDCA 1CU4H 1GOGA 2N7BA 4PRDB 4PLNC 4PLKD 5D96C 3VXSD 4DOHB 1K4CA 3N1PC 4PP2A 5EZIL 4I4WB 1F11B 2GITB 3VI4E 3ZYZA 2IF7A 2XFXB 4K9EH 3VFMA 3CXHK 5B38B 1NQBA 3K8MA 1IC7H 4LRIC 3MYJB 5IFAL 4XVSH 2DI7A 4G7YH 4R7DB 3RZCA 2VDQH 3OAUH 1N8ZA 4OCSH 5C07D 4QY8B 3GFUA 1N5YL 1ZEAL 5CKAA 2R9HD 3EOBA 5CBAB 3CFBB 1A6VH 4KJPC 4ENEC 4NM4H 5I17B 4LKCB 2B0SL 5C07B 5IW6A 2ARJQ 3DUSA 1PX3A 5E6ZA 5DR5L 3IFLH 1JPTH 1IEHA 2ICES 1I9JL 5H2BB 3CVHA 5B3NA 4OFKA 4XZUA 2JJSA 4LF3A 1HSBA 5ECJE 1L7TH 2PO6B 5CBEA 1X5HA 3GJFK 4F7PB 5E2WH 1JGLL 1JHLL 3OX8B 4P2QE 3X3FL 3I50L 5LGKA 4U1GC 3VFVB 3IVKA 5F8RC 1SJEB 5JHDE 3ULUD 3HRZA 3RRQA 3EIFA 2WINA 3OHXA 4HH8A 4O51A 5TF1H 3NIDF 5DJZB 1VGEH 2LABA 2R69L 5J3HC 1A14H 1BFTA 3MLUH 4C56E 4HIXH 4HUVB 4NQCA 3ZYJA 4PJ5A 3RI5F 2MTPA 4CVXA 5L7XL 2YK1H 4KK9D 2AJXL 4FFWD 2H1PH 4K3HA 3BEVB 4OIIH 4PB0H 2BHZA 5F7WC 1CDYA 1CZ8L 1RZFL 1AR1D 4Q9QL 3IU3B 5K9KA 1S78C 5IHZB 3KYMA 4KC3B 1LO4H 3QCUL 1J9CT 1ADQH 4OGZA 5F3HA 1EAPB 4JQIL 3VFWA 1EXUB 2F9BT 4KXZH 4OM1H 3PWPA 2J6EA 4F3FA 4TVPD 1I1RA 4QLRA 1JWMA 3RZWA 2JK5B 1JHKL 5DZNA 3H3BC 3ZDZF 3RWCA 2IGFH 2L0DA 1P4BH 2YD8A 5D2LE 4RWYL 4ETQA 1X5KA 3QPQD 5HHXH 2XZAH 4XMKL 4CU8A 5EBMA 3ILPB 1F6FB 4DKAA 2O61A 3VWKB 2ZOKA 4QTHB 4D0DA 4Y5XB 3FB6A 1BBDL 3HE6D 3M45A 4PJGE 4UZGA 5GZOD 1I1AD 3WXVH 3BQUA 1T5XA 4PJBB 2R4SL 4W4OC 2D0FA 4YIQA 1ZHBB 3S34L 1F6AA 5FYJU 4GUPB 3GRWH 4TNVF 1FL5A 2BSTB 5L2KB 1XF4A 1MWAB 1LP9E 3FO0L 3EGSB 3RP1A 4PJAE 3W0WB 3FB8A 4NM8H 1WFNA 1XEDA 3G04A 2XN9D 2VR5A 2QQLH 2V2XA 1NSNH 4QKXB 5DEFB 4RGNB 4DGYH 2E9BA 1PKQE 1LEIB 3QPXL 1LMKA 1LO5B 4I0PD 2P5WA 2XN9B 4J4PD 3U7WH 3QUZB 4G3YH 4GG6A 2R2BB 2H32H 5E6IB 3MLRL 3GI9H 3S97C 3V8CA 3EO0A 5J1SC 1H0DA 1OL0A 1R5WA 5EULV 2ERJB 4L4VE 1YC7A 1AXTL 3KPOB 4DVBA 2IG2L 4M6AA 3S4SB 1A7NH 2B2XH 3GUTB 5FHAL 1REIA 5DYOA 1J8HA 3I6GA 3QQ9C 4LARL 4LVNB 3OKMA 5DD6A 2E6QA 2XWBA 1PEWA 5I1DA 1XGQB 1N6QH 2VZTA 2XKSA 4FQXB 1NCCH 3REVA 3GHBH 4ODBD 4ESKA 35C8L 5KS9E 3F7VB 1RJZB 3T77B 4MDIB 4S1DC 5ICZA 5EU3B 2HVKA 1I1CA 1JGUL 3HAEH 4RRPA 3T0XA 3T4AA 4XP6H 4P46B 4QWWC 2CUIA 1CICB 2I60L 3QWOA 2V7NB 5D1QA 5FF6B 4JFZL 1BZQK 5BMFL 1MREH 4OZFH 4PR5B 4OF7A 3DSFH 4ISVA 3UBXG 1NAML 3WIIH 3ZE2F 4HPOL 4HWNA 2CJUL 3T1FA 5IIEB 2V2WA 4KMLB 12E8L 5A1AA 4XBEH 1N5AA 5KN5A 3WFCH 5ICYB 3S37X 1J1PH 4OLUL 2BOBA 3O4LD 4JZOB 1OT2A 4X7SH 1D5IH 3MLWH 4WJ5A 4OZHA 4M02A 1R6VA 3S7GA 3JV4B 4OD1L 4JREC 1A64A 1M05B 2E6JA 3P9MA 4N8PA 5A43C 1FE8L 3WS3B 3PL6A 2E27L 5HI4D 3P73A 4ZO8A 3T0EB 4Z7WA 3U0TB 4DEPB 4Z78B 4PJCF 4HS8H 4IHOA 4S0TD 1D5XB 2EDWA 4MNQD 5JZ7D 4XMLL 5IESH 3SE4A 3KJ4C 5GGVH 3MRBB 4FQIH 1FAIH 2DLTA 3L6FB 4RAVA 5FO9A 2HFEA 2PTTA 4RA0C 3VWJA 1V5JA 4NBZB 5F9JA 5HYJA 4IOFD 4YGVA 1FZMA 2BNRE 5J8OA 4HC1A 1R3HB 2O26U 1U8PB 2F53B 2XTJD 3UYRL 3VG9C 5MI0B 5T5FH 4YHML 1BIIA 3HB3C 5J06A 1XFPA 4C54A 5E8EA 4M7LH 3NIFF 3JWOC 2BX5A 2B39A 3PQYE 3RL2B 4Y5VB 2IQ9H 3BDXA 2XTJB