3ARGC

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
204
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSAGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC02
1XF4B 1RHFA 4GMTH 5H35A 5F9OH 4P5TB 2HT4C 3X13A 3DX9A 1HHHB 3HI6L 3C8KA 3ZKNC 4OFDA 4POUB 3TZVB 3TBTA 4PR5A 4TTGA 1NMBL 4AY0A 1SM3H 1DR9A 1J87A 2Y5TB 2DF3A 3TT1L 1RPQA 5F9AC 5L0QB 4KK6C 4Q9BA 2JCCF 2CMRH 1KFAL 2R15A 1CIUA 3L3JA 1KCRL 3BIBX 2SEBA 3HR5A 4M6MH 1WGOA 5E8OB 2DWEB 1YEDB 1U2CA 4OCNC 4HWEH 1Z3GL 3P0VL 4OZGA 3MCKA 3CUPA 1U8LB 4YHIB 4ACPA 5J6HA 1F97A 4LNVA 4Y4KC 1LHZA 1ND0A 2XWBB 1NLDH 3IYLW 3MGTB 3TYGH 5B8CC 1AGBB 3VXQB 2FEEL 1OP5H 4HH9B 5HHPA 4JZJB 4ORGA 3W2DH 3G5YB 1ZANL 1TQCB 4OM1H 2NY6B 4RAUA 5SWZE 4APQC 5J6GB 3FMGH 4LHUB 3RDTA 4NJAH 3KJ6L 43C9A 5IHLB 4Z0BL 1X5AA 1L7IL 4O2CB 5F6IB 2OLDA 5JO5B 2Q76A 1EO8H 3QEQD 4UIKH 1GC1H 1N6UA 1FP5A 3MV11 5C0CD 5EN2B 1CXIA 4EIGB 3KPRD 5FGCE 2VITB 4U0QB 1EHLL 4M03A 2H8PA 4S1RH 1HZHH 3I02A 4RFNB 2Y36L 4EI5A 3EYQD 1X3DA 5ETUB 2YPLA 3AS3A 3H3PL 4PB9L 2EEBA 5CGMA 3I6KA 5A16A 1UWEL 4IOIB 4GS7B 3C60D 3TIEB 3RX7A 3CFJB 1A4KA 4D0CB 1CVSC 4Z7QE 4R0LC 4YPGA 3PABB 4IRJB 4EDXB 2Y6SC 3MRGA 3MRCB 2DTSA 4YDLB 1WZ1H 1NFDF 2YD6A 1X7QA 3BGMB 2E3VA 2VC2L 3IDJA 1S7QA 3NA4A 4XP9L 1UVQA 3S7GA 3KPQA 4FXGA 2OJZL 5DFVD 2R4RH 1QKZH 3DGGA 3H42H 4NBXB 2NR6D 1SY6H 1JYXA 1CCZA 3QUKB 2FO1A 5KN5A 1FFRA 1R3IH 1N0XL 1IC4H 1TJGH 4I4WB 4NQSB 4DZBA 1VGKB 4G43A 5HDBF 3WHE1 4DGVL 4NNXB 4ZPVB 2CGRH 1NAMH 1FNAA 2IF7A 1KPUA 5GS0L 1KEML 1BJ1J 3MRQA 2V2XB 4A2LA 5IVZA 1IGCL 4F7EB 5KVDL 5LQBH 4G8GD 2X70A 3F7RA 5GGRY 3WFDL 1KB9K 3M1BB 5HGAB 2P8PB 2V9RA 1MRFH 4ELMF 1XIWD 5INCB 2HYMA 4DCQB 1LK2B 3HMXL 5F96H 2FL5B 1AQDB 5LCVH 2V17L 1B9ZA 4Q7DA 3PWNA 4LK4A 3S35L 1M71B 3V6ZB 5C6PB 5C0IB 3RTQC 4GXUN 4KK5C 2EKJA 2W0LA 1B90A 5D1ZD 2ZCLL 3T3PE 2EIZB 3TF7C 3GBML 4JKPH 3SQBA 1BVKA 1OY3B 3VA6A 4HAFA 5BMFH 1MIEH 4HUXB 3WFEL 2VQ1A 3DARA 4JPVH 1EJ6A 2J8UF 2Q8BL 4WWKB 5SWZB 4NC1E 4O02H 3EDFA 4G8FA 3B2VH 3VFVB 2GK2A 4KI5F 3LOWA 2YXFA 5J7CC 3AMLA 6FABL 1G7IA 3RVTD 1NL0H 3DTXA 2YA1A 4PFEA 5EOCH 3VCLB 1JL8A 4QHUA 5FK9A 3VWJD 3VFGH 4G8EA 4IOSD 1OP5K 1JMXA 1CFVH 5MEND 3VDBA 4WW2B 5FGCB 4S2SA 1MHCA 1TPXC 2H9GA 3QDMA 1Z6JT 1F6AB 4KKBC 4E41A 5BS0D 3ZDZE 2G5BB 4K3DH 3HRPA 3PXJA 1KIPB 2HLFD 4Y4HC 1K2DA 5HYEA 3C6SB 1IT9H 4B7IA 1RVFL 4QRPD 3IFNH 1G9NC 2E7MA 4NDMB 4YHZL 3FQWA 4C83B 3FO9B 3IS1X 2X4NA 2CLRA 4GRMA 2BY2A 5AWNH 3UPCA 3SDCD 3UJJH 3SGDI 5FHAH 1YN7A 3SCMB 4HZAA 5AZ2L 2GTZA 4X4YA 1A3RH 4M6OL 3IFOB 3DI3B 4P2QB 4HC1H 3GM0A 1S9KC 5GGRB 5GRWA 5F1OB 1BFTA 3PP4L 4X6BB 4H25B 1J1OH 4QY8A 1G0YR 1IZJA 1OTUD 1WFUA 4EJ1C 3EFDH 4DZ8A 2FH6A 4Y4KA 2ZP0T 4EDWH 5B8CA 1WFNA 4I77L 3HG1D 1KCKA 1YNLL 2XI9A 5DVMA 3TBYA 2K3TA 1D6EA 4E42A 3DUUB 3QUML 4KZEL 5CMAB 3ZT6A 1QSEA 4Z0XB 3CLEL 2VDOH 2BMKB 4OGXH 4APQA 1NFIB 3TZVD 4F80A 3E6FB 4YBQC 2YZ1A 4UB0H 5FM5M 3SY0A 4WEBH 4NHUA 2Q1EA 4YH6A 3MV7A 3IAGC 2AI0H 2P7TB 5IMMA 3GIVA 2XY2A 3WBDA 1QSFE 3U83A 3IFPA 5HVWA 3BW9A 2DICA 2DQFA 3MLYL 1FNSH 5DVNA 1BIIB 5HDLA 3LHPL 3PWUA 2AERT 1DSFL 1MCHA 2P46B 3VI4E 4JM4H 4D8PB 2X4SB 1MUJA 1KCSL 2HH0H 3PV6B 4AEFA 3O4LD 2AJUL 5GS3A 5ADPH 3HI1B 3S96A 5T3ZE 4PJGE 3BN9D 4NRZB 1SMOA 4XPTH 4PGBA 5DQJA 2IH3A 4R0LA 2EDYA 1FZJA 5F7LB 5BJTB 2GIYA 2BNUA 2E8ZA 1MCOH 4Z7UF 8FABA 3BUTA 2NY6D 5DQ9B 1CGXA 3BKML 5J89A 3ULUF 1U8KA 2ED7A 1KELH 2LU7A 4HV8B 1A0QH 2I9LB 3EYUH 4R7DB 5B4MD 2KQNA 3C2SA 1SJEA 3ZHLA 3X11B 4JO4H 1M7IA 4P9HC 4LSDA 5F3HA 5CLWA 3Q48A 4QTIH 5D9SB 2BOBB 3QHTC 4JB9L 1IAKA 1P6FA 5F97E 4X9IA 4YXLL 3O0RL 1W72A 2VABA 1IZKA 4Z7WA 5GRXG 3GBNL 5HHOB 1A6PA 1U3JA 4HHAB 4EVNA 4KC3B 5C3LD 5J3HC 5D8JH 5EPMB 5D6CB 2PCPA 4FABL 5I66A 4J6RH 1S9WB 4PS4L 1SEQL 3ALWA 4IRJD 4K2UH 5F1IB 3RTQA 3MLUH 1RK1B 4N8PA 1MLCA 5GS1B 4OGZA 2R69H 4H1LH 4KKNA 4W6WB 1RUKH 2ITDA 3ZKXB 4JPKH 4X8JB 3QUMB 2VE6A 2HT2D 1HI6A 4X6FA 4N0UA 2UZIL 4EXPX 5IIEA 1FNEB 4CNIB 4D9LL 1RJLB 2W9DL 1QPPA 5EC1B 5C8JA 2E9WA 4UOW1 3HNTL 4PB0H 5L2JA 4KZDL 3REWB 3W9EB 4U0RB 3GSVA 4FNLH 1MWAH 3WFBH 4DVBB 1NC4A 3IDNB 1NCAL 1N64L 3RKDC 1MFCL 5L9DH 2FEEI 3O6KL 3MJ8B 4ONGL 3IS0X 4HFUL 5DK0A 1CQKA 1YPZF 4MJIE 3STZB 3SO3B 1QSFB 1S7UB 2ATPA 1LWRA 3W5NA 1FAIL 2R56H 3BAEH 3C5JA 5JHLL 4C56A 1RUQL 1FE8H 3JWNC 3SO5A 4WO4C 2P5WA 2WWKO 3L5XH 3BZEB 2PKDA 1KJ3L 4XBGB 4PRNB 3BH8B 2VDPH 4QHLB 4XP6H 3ZTJG 3LCYA 3SGEI 3EZ8A 4KV5F 4RGMB 4QCIA 5JOPE 4NKMA 4Y4HA 3DO7A 5DHVH 4OZHA 1IAOB 5KZCB 1QBAA 1T4KB 1DUZB 4PJGB 5KBNC 3BP5A 4MDIA 3B2UD 3U6RB 4ZXBB 4KROC 4LDLB 4U6VL 2YWZA 4HGWB 1CFTA 2BERA 4I3SH 4WWKD 2JKXA 5SWZD 2VZ3A 1UM5H 3CAFA 2ADGA 3B9KB 1BEYL 4KKAD 4AIXA 4LSQH 4HUVB 1B2WH 2J88L 5CJBA 4LSTH 2WWMD 2XZAH 2YD7A 2D0FA 4ZUTA 1OSPL 2HKFH 4QYOB 1E28A 3HPJA 4AEIL 4NP4H 2YN3A 2R4SL 3MRKA 3PWPA 2C3XA 4KPHL 3L3IB 2X4TB 5CBEA 4U2ZA 4J7RA 1JZ8A 1U8JB 4DKEH 2E7BA 1PY4A 3N50A 2ICWB 5DMIL 2B1HL 3NPSC 3T0XA 1T7WA 4HWBL 3FQRA 5EO9B 3QIBC 5D93B 2B1AH 3GHEL 4XNYL 4ZFOA 4GJTB 2VTFA 1WLHA 5DJCB 5FGRA 2YUZA 2E8YA 4PJ8B 4PRAA 3WUWA 4U6YA 4OZFH 4PIRF 1FAKT 3W9DA 4OTXL 4FQCL 4QHKJ 2OL3B 2R9HC 4KTDL 1A9EB 1N5AA 1Q8MA 2KQMA 3MLZL 3OGCA 3SCMD 5C2BH 4FQLL 1FL5B 1V8HA 2RQ8A 1BZ9B 3GJFA 3L7EB 5I1AA 5GS0D 1KULA 5CLTA 4P2QD 3EJYC 2HFFB 1I1FA 4M7LH 3FT3B 1RAMA 1CDUA 2VDLL 1N6VA 4KHXH 5IK3B 4NO0B 4JKLA 2X4QA 4K9EH 4LSPL 1J7VR 2BNQE 3ZDYF 1SEBA 2CLVB 1MPAH 4MJIB 1WJ3A 4Y5VB 2OK0H 2AQ3A 3MYJB 2VIRA 3QCVH 4OUUB 5IFAH 3BN3B 1WICA 5SV3A 2F8VA 5CJ8A 3L5WA 3QAZB 2V6HA 2ZUXA 1J8HE 4QKXB 2CJUH 1WITA 2PXYB 1BVLA 5HGHA 3X3GL 2XA8H 3B6SB 4JPIB 3KYAA 1RZGA 3K2UH 1UZ6F 2VQTA 3MA7A 5J11B 2VDRH 5T5FL 5E8DL 4GAGL 3JSSA 4RMTA 1JGUL 3L3KB 4PGDA 4HKJB 1KT2A 3JV4B 1OVZA 3O11B 3PGFH 4X7EC 4HJGB 5C0JA 1FO0L 4NCC1 3VXUE 2APVA 1T83C 1N3NA 4TN9A 4OLUH 3P9LB 4JM2C 2F19H 4MQXC 5I30H 3QDGA 3C5ZC 3DX6B 3F8UB 4ZYKA 1WC7B 1WCBB 3WLBA 3REVA 4AZ8A 3BPNC 4JZOA 5DS8B 1BAFL 3HAEB 3QQ3B 5F88A 5I0DA 3O3DB 4FP8H 1L9NA 5B21A 2R1XB 1J1XL 5CKGA 1BD2E 3MSPA 2C1OB 4HIIB 1G7MA 2ZPKL 3L95B 4LNRB 3DV6A 1UM6H 3RVVD 3BMWA 1I1RA 1DVFB 3FO0L 4CMMA 3KXFA 3HFML 1U6AH 3LMJL 4AEEA 1PVHA 4YDVB 4RA0C 5CSGA 4XCYB 3BGFC 1G7HA 4WTZG 4K23L 4P46B 3BPLB 4QXGH 1KLUB 2UUDH 4WI3A 3ZYZA 3DX7A 5BOPA 3T1FB 5MI0B 1DEDA 1ZKAA 3U7WL 3H7BA 1JRHL 4XNZB 1VGEL 5TFSL 3D9AL 4K7PY 5HHOD 1JVKA 1KJ2L 4L8CB 4HK0B 5C0RL 1TCRA 4KJYA 3GKWH 4GG8B 3IXTA 4V2BA 3FFCA 2HKHH 3NH7L 4DAGL 1Y0LA 1HQ4B 1FH5H 2CR3A 4HCRL 5B39G 3DXAD 3ILQC 3NCMA 3GM8A 4JFZL 4O5LL 1ONQA 2O61A 4G42B 5FFLA 1NGZA 4B5EA 2GJZB 5JPMB 2ENYA 2UZXB 5JQ6H 2BNQB 4OFPA 3N1GC 3R0MA 5M94B 1MCWW 2VLJA 1PZUB 3VG0L 4HIHB 5GGTA 4F15B 2R1YA 4GRLC 5AYUH 4XPFL 2YSSA 2ICEB 4TRPH 4X6DF 5E94A 4XCFH 1GSMA 1PG7H 1URLA 4L4TA 4MJ2A 2EXYC 1J8HB 3VXRE 2B0SH 4P59H 1NH6A 2A73B 2NY1C 5TH2A 1OTSC 2VAAB 5FF6B 2P8LB 4LF3A 2W59A 5AAWA 4P5MA 2A9NL 3BGAA 5GRJH 1I9RH 2R29L 1FO0B 2MNUA 3PG2A 3Q6FA 4HK3J 2GTWB 3OAUL 1QFWH 3GI9L 3TNNA 4ZUVA 3VXUB 1NGXA 3GNMH 4LLYA 1FGNL 3I3EA 2KBGA 3L1OL 1YEKL 3C09C 3PHOB 2P1YA 5F1NB 5I1CL 1ZT1B 1LNUA 2I27N 2WAHA 1UXWB 2VJXA 2XPGB 4GKNA 3IDXH 5KZCD 3KR3L 5BVJA 4TVPH 4YZFE 1WWCA 4WDIB 3IF1A 3LKOB 1YMHB 5DTFB 1FL3B 1AGFB 4ZXBD 5IMLA 3BO8B 3IVKB 1RUPL 1QHOA 1BD2B 1X5YA 4LDOB 3B9KD 3OSKA 2NY2B 3GSNL 4XVUC 4MGXA 2BXYA 2WBJC 3BIAX 5FCUL 5C70A 1A6VL 3M07A 1A8JH 2CR6A 3MLWH 1AXIB 2IPKA 4TSAH 4JVPA 5D2NC 3Q3GA 4LSRL 3L3OA 4UV7H 3C6LB 3H9HB 2ARJA 3WKNA 4P3WA 1MAMH 1EEYA 1KJ2B 3ULVE 4D3CH 3QXVA 2QHRH 1QR4A 4XVSH 4BKLB 3HNSL 2J6EL 4FZ8H 4NO3B 3PWJA 4I0PC 3ULVL 3E6HB 2BY0A 4WHTB 3W39B 4X7TA 3TA3B 5D5MF 4KUCD 4MSWB 1JPSL 3L3GA 4QOKE 4BQ6A 4OCSL 4PJ8D 4PP1C 5FUCC 5FB8B 4G6FB 1CLOL 3BEWB 1MCCA 4DTGL 5GGSY 5LBSL 2DL9A 4F57H 5DMGD 4WU5B 3VW3H 5SWQB 3FCTB 3QCTL 4M6NH 4M1DH 1S5HB 2HFGH 5D4QA 2IFGA 3G5ZA 1NMAH 2WINB 1J0ZA 3K0WA 1IKNC 1T83A 5E6IC 2R0WL 1Q0YL 4O9HL 3S37L 1EO5A 4AG4L 1NCTA 4NO0D 5C08A 3NIDE 5D96C 1G9ML 1P5UA 2HWZL 3C5ZA 1BJ1H 1MCJA 3EYVA 3VG9B 5EU4A 3MBXL 4MJID 1XGPA 1A6AA 2EYTA 4XP4L 3PGCA 1FG9C 4MVBD 2DQTL 2NLJA 3VXNA 5FDYA 2K7PA 1UJ3C 5I8KH 3TN0A 3U1SL 4I48A 3BPCA 2PYFA 1EK3A 5HD8C 2VR9A 3RWDA 2PXYD 3AMKA 2XQBH 3KHOA 4ODHH 5DR5H 1CT8B 1YEFL 1BGXL 4YHML 5JOPD 2D7MA 4XBPB 1J1PL 5EU7C 4KAQL 3WE6A 4OV6F 2VXQH 1FFOB 3OKLB 4G6JH 3THMH 2UZYB 1SJXA 5D7LA 3DROA 1DN0A 1IBGH 5IMOA 2DLFL 3P3YA 4YO0A 2IAMB 3LVEA 4HIXH 1II4E 2Y07L 1MAKA 1FJ1A 4N68A 4N8VG 3HZKB 5C0GA 4RAHA 2HN7A 4ZD3H 4ISVB 4LCUA 1Q9OA 4MD5A 4WHYG 2EDEA 9CGTA 4XWOD 3T65B 1RSFA 1SBSL 3IU3B 3O4OB 5L7XH 5E5MA 5ICYA 4GBXA 4TQEL 4HJ0D 5I1JH 2DM3A 3WIHH 3B3IA 5FO7B 4N5ED 2XN9A 1VDGA 1MHEA 2WANA 3I85A 1DVFD 3MJ7B 4L9LB 1T0NA 4LKXA 4IIQC 1QHPA 2BDNL 2FX9L 5EIIB 3U9PH 4GRLA 3UYRL 5IF0B 3IJHA 5KS9F 4OZGE 5GGSB 1TZIB 4NQDA 1P2CA 2HTKC 4PRIE 1DE4B 4WJ5B 3MUGA 4P46D 4F7CA 4QOKB 4OCYH 3QDJE 3RZWA 1ZS8B 3RJQB 1CFNA 1ORQB 3PDGA 2Y25A 1K8IA 5DD6A 1NUNB 1R3KA 5D72H 1DLHB 4YBLB 4LCCA 2XXMB 2G60L 3E8UH 3EJZD 5K59E 2XZCH 3G5XB 4OT1H 4QTHB 4P2RE 1MRDH 5ALBL 1IKFH 3PQYA 4JCMA 4IJ3C 1JHLH 1RJZB 3FONA 5C0FB 4KK8C 3GSUB 3QO1B 3PHQA 5I76B 1CE1L 4U3HA 1LMKA 1MCIA 4LGPB 3LV3A 3V0VA 2GFBB 2ZUVA 4TUOB 5EBMB 3D85A 3RVUD 2N7BA 1DBAH 2FIKA 2UYLA 4KI5D 4P48A 4FOMA 1C08A 3V9FA 3DSNA 1PAMA 1Q0XL 3CVIH 5HHXL 2OZ4A 5EU5B 1PX4A 3VFOB 1QVOB 1AO7A 4HT1H 5GXBB 1ADQL 1REIA 3MLRL 2FWOA 4HUUB 1H0DB 4NQCA 4OCXH 2BRRH 4RGOH 4XB7A 5E2WL 2Y9RT 1NC2D 2HVKB 4QHNB 1J8HD 2YN5A 3WFHB 4KUZL 4LVHB 4P49A 4AMKH 4POZC 4H20H 3ZE0E 1UCBL 1QUNA 2VZUA 3QXAA 2BSSB 1EEQA 1RIHH 1U58A 5DD0H 1BMGA 3WKML 3HB3D 1S7WA 1C16B 4JREB 1U93B 4EOWH 1VFUA 3D87B 3U7YL 3NTCL 4QXUH 5TGBA 2YD2A 5I75B 3C8KB 5IB3B 3MXVL 2GT9A 5IMKA 4ORZC 4QXTB 4Q9CA 4XMLH 3BYYA 3ZKMC 5DI8B 5TQ2H 1I9JL 3CFEB 3VXTA 1AGEB 1JRHI 4FQIL 1BM3H 3RNKA 4G9FA 3CX2A 3RQ3A 4MA1C 3MRHA 5DRXB 1WTGT 2NY2D 2D0HA 4FQXC 4PV9B 3AC0A 5EO1B 3S35X 1QBLH 3G04A 4X9HA 5CJOL 4P4KC 4Q0XL 1QNZL 1UENA 3P4NB 4R90L 4PRIB 4A6YL 4UT9H 5I1KL 3ULSB 4IMKC 3ET9F 4PPTA 4UIMB 1IKNA 3QDJB 1GGTA 2VXUL 3KS0H 4X4ZA 4GMTL 3U4EB 5F9OL 1YY9C 4K7FA 4NYLB 5HVFB 1X5XA 4H5SA 1JFQL 4P2RB 4WI4A 1LGVA 1S9VA 5ITFB 3V0AC 4X5WA 3B5GA 4G8IB 3WO4C 3EFFA 2A6KA 2W9EH 1UJ3A 1SM3L 4HLZG 1A6UH 5E8NA 3U0TB 2VNCA 3WS3B 4KRPC 3VMNA 4UNVA 4FS0A 2CMRL 3GUTA 3X14A 5I1LB 3GIZH 1FNFA 4JFYA 2Q6WB 2F54A 3QHZH 2CDGB 3ECBA 4M6ML 4YHLL 1GZQA 1HILA 4ZAKC 2DI7A 2R23B 1KIUA 1XCTB 5DD3H 4TTDD 1H3PH 2B20A 25C8H 1YY8B 1T03H 3OG4B 2C7UA 3VGBA 1A6ZB 3I02B 4XXDA 3SHSA 2O5ZL 4Y2DB 1NLDL 4RX4D 3SKJL 3VXOB 4F3FA 3EKCA 1XF5B 1W0WA 3CJJA 1D5XA 4UMGA 1AKJB 3GMRB 4FXKB 3UBXB 3W2DL 5D1XB 3P4OB 3MACH 4FFVC 2AJXH 4OM1L 2ED9A 1XH3B 3FMGL 1CQYA 3KPOB 4NJAL 1S7QB 2NQCA 2R1WA 5HYSB 3V5DA 3DGGB 5FOJA 3GMQA 3UTSE 1CLZH 2AQ1A 2HJKB 1F13A 4MX7B 3FQXB 3OKMA 3IDGA 1GC1L 1J88A 4MCYA 3AAZA 2WW8A 1A14H 1UQSA 1B4JL 4PLKC 3HA0A 3NIFE 2F74B 5DA4A 3IJYB 2QADC 2FYYB 1CL7H 4S1RL 4QRSA 1AXSB 2IAMD 2BVOB 1MVUA 4N9GB 1EGJA 5HDOA 3V4VH 1RD6A 4I18B 5GJSH 4A6YB 1QSEE 4G6KH 4OLWH 4X9FA 3PWNB 1WZ1L 4UQ3A 4FTVE 3B9AA 2J1KA 1QP1A 1JIBA 3ARBC 5BV7C 3NBNA 3MRRA 3ORJA 1NSNH 4Z7NE 3MV7E 4OLXH 2R4RL 1QKZL 3H42L 2RFXB 1SY6L 3ULVD 4YHOH 3S34L 4BQ8A 4LPWA 5C0ND 2Q7NA 1IC4L 2DMCA 1TJGL 1S7TA 5ISZA 1RUAH 1IAIM 2CGRL 3MMEA 2XA3A 5KVEH 5HBBA 1B0RB 3TVMB 1D5MA 3LKPA 1DCLA 4A2MA 4NO5B 5JTWA 4GH7B 5LQBL 3MBEC 4PJXA 5FDWA 2I24N 3F5WA 2QQQA 5DO2C 4X7CC 3A6BH 5DWUH 3HE6C 5F96L 3HPLB 4DN3H 1KTDA 2NZ9C 4JY4A 5GJTL 4YX2H 3BH9A 4M02A 1CICC 2VZSA 4ZUWB 2A6IA 5HHVL 4P3DB 3MOBH 4IRZH 3GB7A 4XNMB 4KDVA 1A7BA 1LD9B 3QWRD 4JKPL 5EZIH 3OKDB 1TTFA 1KJVB 3SBWC 5BMFL 1MIEL 3OGOE 4Y5XC 5DGQA 4LLWB 1JGEB 3QZWA 4PJFF 4JPVL 4X4XA 5B38A 4J1UA 5EU6E 2CLRB 4HIEA 4L29B 4X5XB 4O02L 4XB8A 3QI9B 1IGYB 5D7JA 1BFOA 1DL7H 3B2VL 3I75A 4PLOB 1FGVH 5E2TH 4PLNC 1Z9LA 5KSAD 3A6OA 1BP3B 2JF1A 4RBPH 1NL0L 4MA8L 1H15A 5EFIB 1F4XH 3LRHA 4FQXA 5EOCL 3UTSB 2DB8A 5DEGB 5ESQB 2DJ4A 3UCRA 5IHZA 1RZ7H 3VGDA 5HGDB 3VFGL 5C86A 1CFVL 1HKLH 1KB5H 1RULH 4ZQKB 1EEUA 3RUGF 1G7QA 4Y4KB 1ZLUH 4L8SA 1B0WA 4ODUB 5FECB 1U91A 1YUHA 2IANE 3TBYB 4HUNB 4YFDB 2HG5B 3VDAA 4Z76A 3VRJB 1T1XB 3C5SA 3U0PB 1IT9L 4NQVA 3IFNL 1KGCD 4P2OA 1NUFA 2GUOB 4WTXA 5GZOC 1LO2H 1OLZA 1T1ZB 4APQB 1NCUA 4PLJC 3R8QA 1QFOA 2VL4A 4FTVB 1BQHB 1D9KC 3VE0B 5J57B 5AWNL 4AQ1B 3MV7B 5I17B 3UJJL 4LLQB 2HRLA 2EDQA 2ADIA 5FHAL 4LLAA 1FVDB 1A3RL 2AS5M 5DT1H 4OGAD 2YC1A 3BW9B 3K3QA 3F65A 4HC1L 1NDMA 1A64A 1J1OL 4PRID 3M17B 1U8HB 3LN5B 3EFDL 3T0DA 4QWWC 3TESA 3GRWA 1FCCA 4EDWL 1OAZH 5A2IH 3T2PA 3GMNA 3OKNB 1K4DB 1I85C 3LN9A 2F5AH 1T2XA 8CGTA 4B53A 2GHWB 1XGRA 2VDOL 4MMXC 4OGXL 2Y06L 2DIJA 4HMCA 1IM9A 4JQXA 3HS0A 4UB0L 1N8ZA 5FHBH 4WEBL 3RL2A 5IP4A 3WNLA 4LL9A 4GOSA 3LPWA 2H3NB 1RY7B 4FMKA 4RGNE 1IC7H 3CH1A 7FABH 4X6EA 4WI5A 3LQAC 5FYKH 3VJ6B 5KG9B 3T8XB 1FNSL 3UBXI 2IPUG 1PX3A 5C7XH 1F58H 5EU6B 1QFPA 1TDQA 4QGYA 5ICZA 3W0WD 1SJHA 1ZGLM 4JM4L 3JTTA 2Z9TA 2Y1VA 4J3SA 1TENA 2G2RB 5ADPL 2RHEA 5KTEH 1U8OA 4XPTL 1AKJD 2YPKB 2V9TA 4WIQA 1F90H 4TOYH 5IHUL 5F7NC 4NUGH 5D1XD 4DEPB 4QF1A 1MCOL 5DJ0A 5F72S 2P45B 4XMKH 1FLRH 3ARBA 1S9YA 2YPVL 1KELL 1RJYA 1A0QL 2ITDB 3EYUL 2BSRA 3JZ7A 5KSVB 4PY8J 5DXWA 5E1HB 2IANB 5C09E 4H8WC 4JO4L 4RBPK 4CL7A 1CE6A 3LKNB 4QTIL 4BFEA 5H94A 2FD6H 4C57C 1DEEA 2EE6A 5L2JB 5JPNB 3KYMB 4M1GH 1HEZA 1VADB 2VH5H 4PD4J 3KG5A 2VSDA 4R6UA 4RZCA 3EYQC 1IM3A 3MBEA 4OF0A 2IC2A 5ESVA 3DRTB 2OXGA 1NGYB 3C60C 4Z7VA 1ZLUK 3SKOA 5IV2A 4J6RL 2OTWA 4R7NB 1YJDC 4BSWA 5HYJE 4K2UL 2XV6B 4JKMA 1I1CA 4Y16C 1NJ9A 3MLUL 4N0CD 5EUKA 5CBAB 1TPXB 2R69L 3ROOB 3TIDB 3KDMB 2D7PA 5EA0L 2YXMA 1RUKL 2G5RA 5MHSD 1VKXA 4JPKL 3NACL 5DFVC 3WFCH 5C0BD 3S5LB 2NR6C 2C5DC 3SBWA 4EUPA 5FYJE 2B5IC 4N90E 4RDQF 4Y5XA 1KLGA 4GAFB 3MRFB 1FSKC 3VFWB 1MOEA 3BP5B 2W1NA 1OT2A 3MLVH 1FQ9C 3P4MA 4PB0L 3WXVH 1TMCB 2MPAH 4FNLL 1MWAL 1WZLA 3ARYA 3WFBL 3X3FH 2J7LA 5EORH 1T89C 5L9DL 2NMSA 4RGNB 1JI2A 1MFBH 1XIWC 3QDAA 2I25N 2R56L 4P2CG 2NW3A 1FE8L 2PYEE 2UY7A 2VLKE 1GVIA 1CDCA 1A5FH 3L5XL 4YZFF 5D7IE 3MRKB 4HULB 4XC3H 4J8RB 4XP6L 4CJ0A 4LPVA 4ZMAT 5D1ZC 5M95B 3VU2A 5DJZA 3FB5A 4UNTA 3KXFE 4IEFB 5DJYB 2P48B 4PP2A 3IJSB 3EUUA 2G9HB 1AHWB 2QKIB 5KSBF 2X9XA 3U4AA 4EEEA 3V7AG 3BIKA 2GY7B 5IJVA 4I3SL 1H3TA 4Y5YB 1RZKH 1H8OA 1S7SB 4X6CF 2H26A 1UM5L 3QI9D 4XGZB 1H3XA 2OMBA 4U1JB 5I16B 1RZJH 4QHMB 3NGBB 4LSQL 1LO5B 3RVTC 5FUZH 4LHJB 1B2WL 4K94H 3Q2CA 4E9LA 1GXEA 3UTSD 2JJSA 2XZAL 5C09B 4BFIB 3VWJC 3GJFB 5IFHH 2VLLA 4NP4L 4M4PA 4DJMA 1JWUA 2FO4A 3LD8B 5ANME 4DKEL 2LTQB 2WSKA 4JHWH 2X4QB 4QNPF 3DUSB 2ESVA 4ETQA 5T5NF 2IGFH 2HLFC 5CZVL 1TVHA 4OZIA 5DD1H 1OHQA 3TBSA 3GHBH 3MRDB 3TO2B 3SGKC 3ZDXE 1FL6A 4KTEH 3BUYB 4V1DD 2B1AL 4HS6B 4H1LB 5HYJB 1CXKA 4RRPG 4L4TE 3NOIA 4LRNH 1LILA 3SKNB 3WD5H 3D0VA 4FTVD 1UACH 1JZ7A 1CK0H 3SDCC 1BVLB 5DHYB 2VAJA 3NIDF 3MJ9A 5C2BL 4PJIE 5CILH 5EZLA 2BVTA 1UYWH 3GO1H 3MA7B 5MEQB 1R5IB 4MJ5A 4XCEA 3V8OA 1MWAB 4EI6B 5DVKA 4HWUA 4KQ3H 3STLB 3BD3A 4M7LL 3U9UA 5CZKA 3PNWA 4KHXL 3EZJB 5HHNA 1NBZA 4K9EL 2ID5A 5IOPB 4NO2B 2IG2H 3AB0C 5ITBH 1E4KC 4U3XA 4U1LA 1DQQB 4P23C 3U0WH 1MPAL 3BP4A 4U49A 5DDHA 1MEXH 2OSLA 3HZVA 3MREA 4HXBH 2WBWB 2PYEB 4JFEE 2VLKB 5IFAL 5D7IB 3TZVC 4D9RE 1FIGH 1XGYH 5AAMA 2CJUL 3VFNA 4GT7A 3NFSH 3X12B 5DHVB 5HYQA 3O9WD 3KYNA 3DV6B 5DSCA 3BZFA 2XA8L 3MRLB 5GGTH 5I8EB 3MGAA 4LEOA 3K2UL 3EIFA 3QEQA 2VDRL 4RMQA 1MCKA 4XNXL 5C0CA 2DRUA 3KPRA 4B50A 3PGFL 5EU6D 1G7JA 1CGVA 1J9CT 5ACZA 5JORB 3ARGD 2CRZA 2W91A 3BRGC 4OLUL 4NN5B 3QNZA 2F19L 4Q2ZB 3U46B 4ZSOE 3G08A 5E5RB 5I30L 5FYLE 5J06A 1A1NB 3BP7B 1TCRB 4KJYB 3C60A 4L3EE 4R8WH 3BN9C 3RWEA 5FYLL 4JRWA 1GIGH 1Y0LB 4WO4B 4OZGF 1TQCC 1WBXA 1RI8A 4K8RC 2NY6C 5IB2B 3UO1H 2EDWA 4P5KA 1JWMA 3K7UA 1GJIA 5EUOA 1NCNA 5ANMB 3JTSB 1NGZB 4HDIB 2EDTA 5B4MC 5TDPA 4XC1H 1HYSD 3DIFB 3QXTA 3FB7A 5HJ3B 4JJ5B 2OR8A 1AH1A 4FQHA 4ZUSA 1U6AL 2IAND 3LRGA 5JMOC 1EFXD 2UVEA 5I1DB 4TULH 2W60A 3EHBD 2Q20A 4PJAE 1I8KB 3GSWA 1CR9H 4KROB 3K4ZA 4QXGL 5I74C 1FCGA 2H45A 4P99A 5F89A 2YRZA 1FFQA 2Q8AH 5GRVL 2F5BH 1T89A 4UDTA 2IPTH 4FFWC 4G8GA 2VN7A 2ZCHH 3MYZA 4GS7C 4PJIB 3GKWL 5IVOA 3K46A 3D39A 2HKHL 4IRJC 1FH5L 5T1LB 3D3VE 4NRXB 1I1YB 4CVUA 1PKQA 4HWZA 2EZ0C 1P7QA 5JIPA 5BQ7A 1NGXB 3VXSB 1N0LA 5D1ZA 1MIMH 1CI5A 3T3MF 2EDJA 5T1KB 5JHDE 1CIDA 2WM0A 3S4SB 3WEXB 5JQ6L 2X2YA 4J12A 1GAFL 2HT2C 3QIBB 4PJDA 5TQ0H 3JUYA 1R5VA 5AYUL 2AXGA 4XHQA 5HTSA 5D7LE 4N0FA 5GIRA 3ROLA 4TRPL 4JFEB 4XCFL 4S11A 4J3VA 1BBJA 1CFQA 2B0SL 4P59L 3JVGC 3N1QC 3T04D 1BOGA 4BH8B 4RGND 4MB5A 4LBEA 1HCFX 5GRJL 4U6HA 5FUOH 1I9RL 4WFFE 32C2A 5MENA 5DUBA 1JYNA 2QSTA 1G7PA 1L7TH 3I84A 3BYTA 3GGWA 1QFWL 3VXME 4PGCA 3PDOB 3NCJH 1JHTB 2A0LD 3QBTB 4ZSOB 5IJKC 1EERB 4BSJA 5HDQH 5CHNB 4TVPE 5SWSE 5L8LB 2W0FB 2YBRB 5C07E 1IGJA 4OB5H 4L3EB 4RNRA 3IDXL 2AJ3A 3IKKA 4TVPL 2NY5C 1G6VK 4ETYA 2A83B 3S97C 2DD8L 2Y5EA 4WWKC 4YR6A 4YBQD 2R0LL 3G9AB 4MAYA 4U1NB 2WMPA 4KKAC 3SDCA 4GAYA 2J12B 4NC2B 1W8NA 2WWMC 4YBHA 5C09D 3S36X 4TSAL 1FFPA 2ZNXA 2MOVA 1MY7A 4PJAB 1HSAB 2X9WA 3ILPA 4UV7L 3WHE0 2H32A 1FVCB 2F15A 4FG6D 4D3CL 4JM2B 2QHRL 4XVSL 3OJ2C 2OJEA 1EUUA 4FZ8L 3HE7B 2L0DA 4UZGA 3HG1A 3AXLB 5HI3D 1XF4A 3LN4B 4KDWA 4MQ7B 4YHNB 3T08A 4P5TA 1OM3H 2EYTB 1HHHA 4IS6B 3RAJH 1CXFA 1P5VA 5DHXB 3TPUB 1JPFA 3D3VB 1AO7E 1F5WA 3TZVA 3Q1SH 4XWGH 3H9ZA 5GGVH 3MCLL 2Y5TA 3RWDB 4F57L 2C9AA 5JHDB 4JFDE 2EO1A 3VW3L 3SCMC 4Q74A 4BZ1H 1F3DH 2R2BB 1FZKB 3QDHA 4JHZA 2HFEB 4M1DL 4M6NL 5D2NE 2HFGL 5E8OA 5GS0C 2DWEA 1YEDA 4GUPB 3BGFB 1NMAL 3UPAA 1DN0B 4YHIA 5T3XH 1HXYB 3WLWD 3SOBL 1CFBA 1FJ1B 1L6XA 2XWBA 1PYWB 3MGTA 1AGBA 3BD4A 5A2LH 3VXQA 1P69B 1IARB 2X89D 4HH9A 3OV6A 4PRPE 3E1F1 4GG6E 4AIOA 1UM4H 3T2QA 4FQQB 3G5YA 5E5MB 3GSQB 4MHHI 2PYED 5BRZD 5I8KL 3LDBC 5FUCE 4BQBA 1JK8B 5J6GA 3VXMB 3RWIB 4LHUA 3VI3E 2Z31B 4HAGA 2E6PA 1MLBB 2XQBL 4KY1H 4ODHL 4L5FH 5DR5L 4LASH 4O2CA 5SWSB 5CEZE 5JO5A 5C07B 4PRHD 1YNTB 2VXQL 4GRLB 4LSUL 2NXYD 3THML 3AS0A 5EN2A 1YYLH 5JDSA 3G6AB 1IBGL 3OF6D 2VITA 4FQJH 4KXZH 4NNPH 4NZTH 4NC1C 4S1QL 4HIXL 1ZGLB 5ETUA 3LQMA 3T4YB 2BCKB 3H9SE 4ZD3L 4HQQL 4IOIA 2J5LB 3TIEA 2Z92B 4OM0H 3N9GH 1A7RH 1C7SA 3CFJA 4PGJA 3CSGA 4D0CA 5L7XL 3PABA 4IRJA 3V79C 3S3PA 4EDXA 2CUMA 3MRCA 4WO4D 4V2CB 3QR2A 5D70H 4JRYE 3F7YB 2FGZA 3BGMA 3TT3H 3IDYC 3WIHL 2ITCA 1BZ7B 3ME0A 4YHPB 3C09B 4H26A 4BUHA 3RVVC 5EBLB 2F54E 3AU1B 5JLZB 3SKMB 1F02I 4I0CC 2AXJA 3D85B 3QUKA 5EU7E 1JHKH 1RZFH 4QRQB 3U9PL 1QG3A 2UYLB 2DMBA 4I4WA 4NQSA 1VGKA 2AJVH 2CXGA 3CIQA 3KLSA 4NNXA 4ZPVA 2BSTB 2HFTA 3E3QC 4LLVB 3LPGA 4OCYL 4Z95L 3EYFB 1XGTB 3JVGA 2IBZX 4MCZB 3QEGL 4F7EA 1KLFA 1B0GA 1NBVH 4Y8DC 3E8UL 1EXUB 5HGAA 2WBJB 5I71B 4JFDB 2XZCL 2P8PA 4F9LC 4K3HA 5DMKB 4OT1L 4AIZB 2BVYA 3C08H 1MRDL 5INCA 4DCQA 1IKFL 4J3TA 1LK2A 5D2NB 2FL5A 1AQDA 5T1LD 1JHLL 1M71A 3V6ZA 5C0IA 4OZFG 4AQOA 3QNYB 4Z7WF 3L6FB 3VFMB 4UOJA 3VXSD 2PTTB 1XGUB 5IJKA 2EIZA 3ZKXC 1A22B 4YXKH 3PWLB 3ELAT 5T1KD 3W82A 3OX8B 4I0PB 4Y88A 4M1CD 1OCWH 3VWKB 2ARWA 4YHKH 1N5YH 1NGWB 1DBAL 5DRZA 2GT9B 4PRPB 4HUXA 4GG6B 3QISA 3CVIL 3B8SA 1I8IB 3MRIB 5CD3B 4JFED 4HT1L 4WWKA 1T04B 5SWZA 4JFOB 4U0RC 2BRRL 4RGOL 2Q3ZA 4D9RD 3VFVA 3RNKB 1J8KA 4KMLB 4AMKL 3VCLA 3JV6A 4H20L 3G04B 2BJMH 3QPQC 1P1ZB 4XMPH 2APWA 1WAAF 1ZHKB 2BNRD 1RIHL 3T0WA 1NCCH 5DD0L 4F9PC 1F6AA 5E6IB 1QFUH 3P0YH 4EOWL 3H9SB 4K7FB 4QXUL 4XVJH 2VXSH 2IH1B 3T2OA 4L3ED 1ZVYA 4XMLL 5GGUB 4NDMA 3EFFB 4C83A 3FO9A 2XTLA 5TQ2L 5IWLC 4NQEE 1UJ3B 5HHQB 4ZXBC 4JRYB 1BM3L 3GI8H 1ZE3C 4Y19E 4PJXE 1RJCA 2XKSA 3B9KC 2DQEH 1HWGB 4NOFA 1LEKB 3SJVE 1S3KL 4WHCA 2F54B 3SCMA 1QBLL 1M1SA 4OZHF 1HH9B 4JG1H 3ZTNH 4P2QA 1YYMH 5GGRA 3IETB 4UT9L 3HRZB 4X6BA 4H25A 5D1QD 2FJFB 1CD0A 2CDEB 43CAB 5FOBB 1EGJH 2K1MA 3QT2A 4JM2D 1GGUA 1PEZA 4DFIA 3HZMB 4U05A 3HE7D 1KPVA 3EJJX 3CFKB 2LABA 1AR1D 1ZHNB 3DUUA 4TSBH 5CMAA 4Z0XA 1DANT 2BMKA 4AH2B 3FAWA 3J7HA 5KJRL 1A6UL 1NFIA 4PJ8C 4M7KL 4D0BB 2BK8A 2BOCB 3E6FA 2K9UA 1BFVH 3GIZL 2AV1B 3QHZL 5DMGC 2P7TA 4IIQB 4BJLA 4BA8A 3PDDA 1H3PL 1QFWI 1BIIA 1AE6H 1NDGB 25C8L 1RHHB 1T03L 3NCYP 1KCVH 4D8PA 2X4SA 2X4UB 3PV6A 3VMPA 4X7DC 4C58B 1HWHB 5FKAB 3ZKQD 3HI1A 3WN5C 4LCYB 3MACL 4NRZA 2AJXL 2GK0B 4WUUD 4MVBC 1NQBA 1G1YA 1FFNB 4PJ7B 1D6VH 3U79A 3BDBA 3TJHD 2HJFB 3JBG7 4IJ3B 4AK1A 4CDGC 5DQ9A 1FZOB 3ILQD 1OSZB 3VXMD 2JIXD 4HV8A 2Z31D 2I9LA 4R7DA 1CLZL 2PXYC 5HVHB 3D6GA 4Z18A 4TVPD 3X11A 3ARFD 3G9VA 5SWSD 3TO4B 5E8PA 5CP3A 2XACC 4E0RB 1A14L 4HK3N 4KVNH 5D9SA 2BOBA 4NQEB 3DVGB 3QWQB 3BKJH 5BVPH 4O58H 2AABH 2P49B 4Y19B 3SE4A 5HHOA 5TE4H 4ZNEE 1CD1B 2JELL 3SJVB 4HHAA 2AXFB 4F9LA 3V4VL 2DQDH 4XWOC 1CDHA 3CFDB 4G6KL 4OLWL 5D6CA 5EPMA 1S9WA 3RWCB 1N6QH 1V7MH 4UV4H 4WI2A 5ALCH 5F1IA 3DXAA 4Z77B 1RK1A 1MFAL 2XTJC 4HJ0C 5IKCB 1NSNL 1KTLB 1XEDA 2Z91B 4OLXL 5IBLD 1QRNB 1YEJH 4YHOL 4N5EC 3RY5A 4X8JA 4BQCA 1OTTD 3QUMA 5T33H 1RUAL 4WHYH 4N1CA 1MF2H 3O2WH 4CAGA 3B5HA 4GMSH 2EXWD 1OAKH 1FNEA 4CNIA 4J1UB 2NY0B 4WY7H 2HTLD 5KVEL 5EC1A 3BEVB 4RWYH 3REWA 3BPLC 4S0TD 3W9EA 3RGVD 1FYHB 4PUBH 4DVBA 5MI0C 4RDQG 1X5KA 2FEDD 4XNZC 3A6BL 4FQXB 2OBGA 3ETBF 3MJ8A 3EJZC 4DN3L 3STZA 2X7LB 1S7UA 3V8CA 3VH8G 4P4KB 4PD4K 4YX2L 1A3LL 4CW1A 3V4UH 3VGEA 3BZEA 2DI8A 3GRWH 1MNUH 2VZ1A 3FRPG 4F9PA 4PRNA 3MOBL 5CIPH 4QHLA 4OLZH 2F8OA 2JJTA 2XFXB 1WEJH 4OGYH 3CFCL 4RFEB 3FB6B 2CKNA 3S3SA 2X1OA 3RVUC 4NFDA 3VWKD 3G6JB 1T4KA 4KI5C 5HPOA 1DUZA 3NFNB 1LQSR 3MO1B 4PJGA 4PRPD 4NRYB 4F15C 5JXED 5IWLA 1EO7A 1C5DB 3U6RA 4ZXBA 5E2TL 1FGVL 4HGWA 3FOLB 1EHNA 4ZDHB 4C54A 1EDQA 3DHJA 4KRPB 3B9KA 5CSZB 4XAWH 1A7PH 1F4XL 5EOTB 1X5HA 4HUVA 5HI4D 5JIIA 5F71A 4PJEB 3BHBB 4YE4H 4YAQB 4ZAKB 1NDMB 4QYOA 4Y1AE 1FPTH 3ARPA 1HKLL 1KB5L 1RULL 1GYAA 3DV4B 5EBWB 3FL7A 3L3IA 2X4TA 4POYA 1CLYH 3HB3C 1KN2H 3HLAB 1U8JA 1XF3B 1GGCH 3D2UB 1PY9A 4EQ3A 3H9SD 1IILE 2D7OA 1QR1A 5EO9A 3V6FB 1WK0A 5IB5B 3CX5J 2BVUA 2VL5B 3P0GB 1LO2L 1MJ7L 3RFZC 5DJCA 5CEYB 4OIAA 2W0PA 3HS0B 4U4BA 4PJ8A 4UUJB 5T5NG 4JRYD 2VISB 1PSKH 2NY2C 1A9EA 4CADB 1VFMA 5DT1L 1M7DB 3GJEB 2V5TA 5F7KC 4HZLB 1BZ9A 1E4WH 3L7EA 4ERSH 2LFGA 4PJCE 1BREA 2X9YA 2QADB 5E4IA 3O6FB 1H8SA 2CK2A 1MFNA 2HFFA 2RB8A 3FT3A 2EEAA 5DRNB 1OAZL 1MI5E 4NO0A 5AUMB 2IFFH 2F5AL 1U8OB 4O4YH 2CLVA 4MJIA 4Y5VA 3MYJA 4DUWA 5EH1A 4OUUA 2PR4H 4XBEH 5FHBL 1MAJA 1RMFH 2PTVA 4JFFE 3PWVB 1YQ2A 2PXYA 5ACLA 3UZEA 1GGIH 7FABL 3B6SA 2VDQH 5DJDB 4JPIA 5FYKL 5IW6B 2VERN 4Q6IB 5H94B 4JG0L 1F58L 5KVGH 1XCQB 2HTKD 3L3KA 4TTDC 2BC4B 5TE6H 4Q97A 1HEZB 4HKJA 3O11A 3JV4A 4NM8H 2DN7A 2FZ3A 4HJGA 1NFKA 1L9MA 2QEJA 5K9JH 4MD4B 3P4LA 3ARXA 3P9LA 4KJQC 3VD9A 1DQDH 1VACB 1MVFA 5KTEL 4PTUB 3KLHD 3DX6A 3HE6B 1WC7A 1XMWA 1F90L 1KB5B 4LSVH 1VHPA 4TOYL 5MP6L 5GSVB 4NUGL 4S1DD 5DJXA 4Y1AB 4JHBA 2HLAB 3HAEA 1UH3A 3QQ3A 4XMKL 2DLGA 1CICB 3O3DA 2P42B 4JE4B 1ZLWH 5L8JB 3SDXE 1C1EH 4KTYA 1EV2E 2R1XA 2C1OA 4JGUA 4HIIA 3L95A 4LNRA 3M8OH 1EHAA 2AP2A 4HBCH 1LEIB 1I9IH 3BSZH 1DVFA 4WW1B 3RDTD 1LP9E 3TO4D 1IL1B 1CWVA 4H0HB 5IW3A 4YDVA 5CWSB 4N0YH 4XCYA 4M1GL 2VH5L 2MHAB 3NZHL 4P46A 3MPCA 1KLUA 4NQED 5D2LB 4FXLA 4JFQB 4QT5B 3FQUB 3T1FA 4F7TB 2IAMC 2WQRA 2R8SH 4PBXA 3GEWB 4Y19D 3QUXB 4UILL 1C8PA 3K4AA 4L8CA 4HK0A 1DDHB 1XGQB 5T1MB 3W11D 3OKYA 3BP6B 4POZD 3QUYB 1E27B 4E5XB 1QSVA 4GG8A 2WUBL 3BQUB 4EI5D 4JQIH 1I3RB 3ULUH 4PJCB 1HQ4A 1AXTH 5CJQH 4Y8AA 1CZ8H 1DBMH 3WFCL 1OL0A 4RQQA 3ZYIA 2XWTB 4G42A 5IFJB 3ULVC 5JPMA 2GJZA 1QRND 1MI5B 5C0NC 1NLBH 3TYFB 1H3VA 4PP2B 2BNQA 4ZFOL 4HPOH 4L9LC 1K5NB 5C0CE 4HIHA 3RNQB 5J13C 3S88H 4ODTH 4M8VA 3MLVL 4ODWA 4D94A 5K9KB 1B6DA 5DJ8B 3FOMB 1T21B 2NY0D 1KACB 2ICEA 2CRMA 4JDVB 4YHYB 1D9KB 4HKBB 3X3FL 1ETZB 5EORL 3HUJF 1J8HA 4JFFB 5IW1B 3HMWH 2RBLA 2VAAA 4AENB 5FF6A 3UPRB 1MFBL 2P8LA 3TFKD 4HPYH 4JLRB 2COQA 4BSVB 4XRCB 1UEYA 3SDYL 1CGYA 4M93C 2VLLB 1MHPH 1F4WH 3EGSB 1A5FL 4XC3L 1FO0A 4BQ9A 4MXVE 3RHWF 3LEYH 2GTWA 2APXA 5JOFA 1MREH 5EUOE 2YKLH 4YPJA 1G9MC 3RA7H 1JF5A 5E7FA 4OCRH 5EG6C 2DQCH 4LARH 2XG4A 1S7XB 1V7NH 3PHOA 5F1NA 1ZT1A 3S8WA 3F7QA 4ONFL 4GRWE 5HPMB 3AGVA 1UXWA 2XPGA 1CVRA 3DNKA 5I8CB 5JW5B 2FR4B 4WDIA 1RZKL 3LKOA 4M5YH 5DTFA 1FL3A 1AGFA 3ZT5A 3SDXB 5KSAC 3IVKA 4FQ1L 1RZJL 3OKEB 5FUZL 1DUYB 4K94L 2VB5A 1HYRC 4LVHC 5EZLB 1NANH 5IFHL 1OT1A 4R26H 3STBA 4UTAH 3S9DB 4HFWB 1LP9B 2H2SC 2ICWJ 4ZAKD 5CZXD 1DBBH 5F6HJ 4LRIC 1OLLA 4PREB 3PNWB 3H9HA 5DF0A 1KJ2A 4JHWL 3IDIB 5J4MA 1ZLWK 5LVEA 2IGFL 1WZKA 2ZOKB 2V7NB 4BKLA 4JREC 2F8XC 1FNGA 1ZEAH 2VDKH 4PJDE 1FN4B 5DD1L 3N85H 4NO3A 1L0QA 3D2UD 3GHBL 5C2UB 1PG7X 3QDMD 5C1MB 5I75C 3E6HA 4WHTA 3EO9L 4HCRA 4OLVH 4NFBA 2APBA 3TA3A 4WFHE 3MZGB 4LRNL 4MSWA 4G80B 1F42A 3ARTA 1RK0B 1D5BB 3CFBB 1LO0H 1UACL 1CK0L 3SE3C 4K7PX 5FB8A 5HYQB 2EICA 3KYNB 3BEWA 3UC0H 5CILL 3HN3A 4OGAC 1UYWL 3GO1L 2XRAH 5SWQA 3FCTA 4JN2B 4NCC2 4NPYB 1HN1A 1S5HA 4U31A 4KQ3L 3T0VA 2B2XH 5HHMB 2WINA 5BS0E 1Q9WB 2A2QT 3O6FD 3EOYG 4X98B 2R0ZH 2EDBA 4RX4A 2IG2L 3R1GH 4N8CH 1NMCC 2MQ0A 3KLAB 3C60B 3U0WL 4Z7UA 2AJSH 1MEXL 4QRPE 2YR3A 3CZJA 5C6TH 4HXBL 1AGCB 3RWEB 3RWGB 1OOAA 1KCUH 3CK0H 2X42A 4Y16B 4Y7MA 1XGYL 1JWMB 3H3KA 2I5YH 2GITB 1HHKB 3NFSL 3ARDB 5I1EH 5E00B 2DAVA 5I15L 2B5IB 5DA0B 1CT8A 1OW0C 1FSKB 4GRWB 2W60B 5TF0A 1GPOH 5ERWB 3F7PC 3GSWB 1FFOA 2IWGA 3OKLA 3L3HB 5F89B 3MXWH 2L4OA 5LGJB 2IAMA 2O5XL 1XT5A 1LO4H 3LH2H 3R06B 4HLJA 4JHAL 2C4XA 1XIWB 4R8WL 4ISVA 4Q9RH 3F7VB 1P6AB 4FZEL 4C59B 2WK2A 3BDYH 4O51B 1CDBA 1GIGL 3IXAA 3T65A 3V52H 3IU3A 5DZOA 5F7UA 1Q38A 3P11H 1K8DB 3UO1L 1E4JA 3H9YA 1CICD 3S36H 2J6EA 1PW3A 4XC1L 5AYQA 4L9LA 4MNGB 1TCMA 4H88H 5EIIA 5IGXH 4ODXB 1XR9B 4GQ9H 5GISH 1KJMB 2QQLL 1SVZA 2R2CA 1J0HA 1TZIA 2KKQA 1DE4A 4GW1B 4WJ5A 2Q8AL 4QOKA 2F5BL 1ZS8A 2IPTL 1ORQA 1ZT7B 3O4LE 3OG6B 4LAQH 1CGUA 2ZCHL 3QUXD 4M3JA 1KF9B 3VWJB 3CSYA 1OD7A 3G5XA 4RAVA 4I18C 4QTHA 3IB4A 3QUYD 2Z4QB 2EIBA 1JGDB 3BQUD 4N0CC 1OP9A 4XXCC 4GAJH 1U8NA 5BS0B 3EBAA 1RJZA 5C0FA 5TE7H 3GSUA 2NTFB 4K8RL 3QO1A 4R9HA 5C0AE 3AY4C 4MXQD 5I76A 3HTLX 3QWRA 4U1IB 3PL6B 2FIRT 3AVEA 4TUOA 5EBMA 5TQ0L 3T0AA 1CXHA 3UJIL 3CVHH 4WCYH 4URTB 4QRPB 1MRCH 5HY9B 4NBYB 4L4JA 2Q86B 1IGFH 3WS6C 1HQRA 4PLJD 5EU5A 3VFOA 3DLQR 1QVOA 4HUUA 1H0DA 3OAYH 2DTMH 2HVKA 3QEHB 4JFFD 4WENB 3U36A 5FYKD 3WFHA 3MRNB 3S6CA 3CDFA 1RFDH 3Q6GH 1J0JA 5E8EB 1L7TL 1DBJH 4PG2C 4YK4C 3EAKA 2BSSA 2NW2B 4LRIA 4MB3A 1RV6X 3NCJL 5I1HH 5F7FA 1S9XB 3T1WA 4GXUM 4OD1H 4PJXF 3AB0B 5HDQL 1U41A 4PJHF 1C16A 1U93A 5JXAH 4P23B 2P5WD 1A7QH 4OB5L 5FKPB 3WIIH 4WFEE 1ULVA 3DJ9A 5IB3A 3I2CH 4ONHB 1Q72H 1YDPB 3C8DA 3GK8L 2WLZA 4QXTA 1JPFB 3B9DA 5DI8A 5E1AB 4IBLT 3FT2B 3CFEA 4Y0GA 3QI9C 1AGEA 3SE3A 1DQMH 1QOKA 5C9JB 4OFVA 1BHGA 1GC1C 5DRXA 4QRRE 4PV9A 3MV8E 2P4AB 5IVXE 5EO1A 4XTRD 4OKVB 3I6GB 3P4NA 2VR5A 4PRIA 1MJUH 4KRMB 3B5TA 3ULSA 1BIHA 1PEWA 4UIMA 2CK0H 2WLYA 3QDJA 1HH6A 2IPUK 2X1WL 1JPTH 3O4LB 5J12B 2XZZA 2Y7QB 4OD3H 3U4EA 1ZHLA 4OUOA 3PWPD 1GRWA 4NYLA 1W2KT 3RAJL 4P2RA 5DEFB 4UTBH 5ITFA 3CLFH 4G8IA 3Q1SL 4OF6A 1FNLA 2NY5L 4XWGL 3KJ4C 4L4VD 3ARRA 4WI6A 2EIDA 3U0TA 2VKXA 5C0AB 1ORSB 2LV4A 3WS3A 1OGAE 1MCPH 4BZ1L 5I1LA 2Q6WA 2CDGA 3KYOB 4RCAA 4F37K 3TH4T 5JDSB 1ADQA 2BY1A 5I74B 1I3VA 2R23A 1XCTA 2LAAA 3KNBB 5T3XL 1YMME 1ZHBB 5HHMD 1FYTE 2UWEE 1YY8A 3OKKA 1A6ZA 2YD9A 3SDDD 1EPFA 4Y2DA 3VXOA 1XF5A 5IB1B 2H2PD 3FN0H 4LEXH 3WUZA 1AKJA 3GMRA 1EBPA 4FXKA 1UM4L 3UBXA 1VPOH 1QO3B 3BE1H 5CP7B 3WUWG 1ZA3B 5D1XA 3P4OA 3IT8D 1IFHH 4Y16D 1XH3A 1JN6A 1CXLA 3KPOA 2ITCB 3TH2T 3O9WC 3OJMB 4YQXH 5HYSA 4H26B 2AAVA 3ARDD 4WEMB 5DRWB 4KY1L 4L5FL 1TLKA 4LASL 2B7DT 1WZMA 3F62A 2HJKA 3OAYK 4MX7A 3FQXA 2UY6A 5IT2H 3K81A 4P2QE 4HXAH 3OPZH 4Z0BH 1P9MA 3MODL 2F74A 1IE5A 3IJYA 4FQJL 4AL8H 4NNPL 5E2VL 2FYYA 3ARGC 3QFJB 3OZ9H 5F21B 1G84A 4BZYA 5BCAA 1JUFB 3BKCH 1AXSA 1QYGH 1B0GB 2XYCA 2BVOA 2EH7H 4N9GA 2CKBH 4QRRB 4U1KB 4AT6B 3MV8B 5IVXB 3N9GL 1QD0A 4JZNB 5CGYD 2Q7YB 4M8QB 4I18A 5JIKA 3IDMB 2E7CA 4A6YA 4XXCA 4DEPC 5D70L 5EU3B 2AV7B 3TT3L 3VFUB 1F8TH 3J8F7 3AY4A 5C0EB 5C0BA 1L6ZA 1HYSC 2RFXA 1G7LB 3AS2A 1JHKL 1RZFL 1MJ8H 5DRZB 3IFLH 5K9QG 5CD5D 2AJVL 4JANB 3EHBC 3WS6A 1A21A 3TLRA 2DWDB 1B0RA 4WFHD 3TVMA 5IG7B 4MB4A 3NIGE 2DJSA 2DKMA 3UDWC 3BD5A 3QIUC 3OL2A 4NO5A 5ILTH 1NBVL 3OXRA 3LS4H 1OGAB 4UDUB 3BRFA 3C08L 4ZTPH 3JV6B 5LXGH 1T5WB 3HPLA 2AGJH 4YC2C 4PG2A 4N1HB 1YMMB 4ZUWA 1FYTB 5KSUB 2UWEB 2CQVA 4P3DA 5I8OH 4L8BB 4XNMA 4YXKL 3FFCD 1LD9A 4DFHA 1E6JH 3OKDA 4XP1H 1OCWL 3PL6D 1KJVA 4YHKL 4Z7VF 1N5YL 3O2DA 4LLWA 1JGEA 2CLZA 4OD2B 4DW2H 1FG2B 4L3AA 4P57B 3E3QE 4U6XB 4TNVK 4L29A 4X5XA 3QI9A 1IGYA 3VRIB 3JWDH 3I9GH 5HHOE 2EYSB 3D25B 4NGHH 4NUJB 5HVGB 4F58H 1C5CH 5EFIA 4RGNC 4ZPTB 4UINH 3UTSA 5DEGA 1FZMB 5ESQA 2Q8BH 1YEGH 2PO6B 5HGDA 2M26A 3DXAE 1A1MA 2D9CA 1A9BB 1NCCL 4GSDH 4ZQKA 5DC9B 5MERB 4ZO8A 1FORH 3P0YL 1F3JB 2A0LC 3CCHB 5H2BB 4ZG1A 3QRFM 4ODUA 5FECA 3L9RA 3QIWB 4XVJL 4YUEH 5H37H 2HG5A 4P23D 3VRJA 2XG5A 1T1XA 1KPVB 5ID0B 2NYYC 1H5BB 3U0PA 1AHWC 2ZUQB 2FX8H 2GUOA 5HGBB 3BJLA 4UAOC 3LDBB 1T1ZA 5F3BB 3VXPB 4PJBE 3GI8L 1I3UA 1IEBB 4FTVA 4Y5YC 1BQHA 2VWEE 1SY6A 2AEPH 4QXWA 5DLMH 3VE0A 2DQEL 5I17A 3O45B 4OQTL 4LLQA 3NGBC 1INDH 5CP3H 2A6DB 1FVDA 3ZTNL 1HINL 4NZUH 5BZWA 3QRGH 1YYML 3ZYOA 4NJ9H 1CDGA 3LS5H 3M17A 3LD8C 4FG6C 5AZ2H 3TGXA 1U8HA 3LN5A 2LTQC 3UP1A 3VRLF 1AC0A 5I73B 1HHGB 5HI3C 4IHOB 3PP4H 1WT5C 3DRQB 1K4DA 3OKNA 5EO0B 2B4CH 1KIQB 4TSBL 2V5MA 1OD9A 2AKRB 3RU8L 4K8RD 3RI5K 5I9QC 3IDYB 4XPHH 4NWUH 3VA2C 1NPUA 2J3SA 5C0AD 2H3NA 4MXWH 3CLEH 4OZIF 4LLMB 3CX5K 5F7EH 4NM4H 3MOQA 5E8PB 4Z9KB 3OR6B 4QRTB 1X9QA 3VJ6A 5B39B 5KG9A 3T8XA 3MV01 1AE6L 4YWGH 3MJGX 5EU6A 5IHBA 3ARGA 2YUWA 3BX7C 3WLWC 4XPAH 1JNHB 3NCFB 15C8L 1IGTB 4FFWD 3OXSB 2G2RA 1T5XB 2JJVA 1MELA 3CGTA 4G5ZL 4UQ2B 2OP4H 2YPKA 1I7UB 4JY5H 1D6VL 2JCCE 2XIDA 4OF7A 5C08D 3DXAB 3KPPA 2EZ0D 4YFLI 2ZOLB 4KFZC 3CXHJ 3O41B 1I8MB 5KSVA 1P7KB 1DLFL 2IANA 1KEGH 5T3ZH 1Z9OA 3TN0D 4LVOC 2D4DA 4WFED 3LKNA 4KVNL 4LCWD 2NXYC 3ALPA 1UWGL 1A6WH 3BKJL 5BVPL 5JPNA 3KYMA 1VADA 4O58L 4PJBB 2AABL 3UDWA 3QFJD 4NN5C 5TE4L 1BLNB 3UXFA 2DQDL 3DRTA 1NGYA 2EDOA 1KBGH 4QRRD 2MCPH 3MV8D 4ZO6A 3DURB 1TQBC 1R3HB 4R7NA 1V7ML 4CW1B 3C2AL 1N6QL 5ALCL 2PN5A 5CBAA 1VENA 3ROOA 3TIDA 3KDMA 1X44A 3H8NA 4M7ZB 4EBQH 1PQZA 1MSPA 1YZZA 2WNGA 5FYKU 3S5LA 1J05B 5T33L 4D0DB 3AS1A 4GBXD 1MF2L 3O2WL 1NBYB 4G3YH 4GMSL 3MRFA 1OAKL 1UH2A 3LY6A 3VFWA 4WY7L 1RIVH 5FGBC 3IKCB 4Z78A 2OTUB 2LVEA 4GLRH 4XPGH 5E5UB 4PUBL 2OL3H 5ICXB 3OMZA 3PGDB 3CDGB 5EUOF 1BECA 2JB5H 3ZMRA 2W9DH 1NFDE 2R0KH 4ZFZB 1OGAD 2FB4H 3DGCR 3PIQA 1BPVA 1R3JB 12E8H 3V4UL 5T3XD 3UTOA 5GS2H 2XTJE 5F9WB 4ONGH 2HAZA 4J8RA 3GRWL 3C8HA 4HFUH 4K9EC 2NY3B 3BT2H 3UTTB 1CFSB 4OLZL 1YMMD 2FJGB 5HDBE 1FYTD 2QTEA 4OGYL 3FT4B 5JQHC 1B6UA 2AQ2A 5DJYA 4M1CC 5D7SH 1QR1B 2OI9C 3IJSA 2NXZB 1Z9SA 3SPVB 2KPNA 5L2KE 3SGJC 2G9HA 1AHWA 2QKIA 3BDXA 1PDKA 1BQLH 4NKDB 2X10A 4KXZI 2JCCB 3WNMA 4ELME 4Y5YA 1S7SA 3ZSSA 1CBVH 3NABH 5F7WC 4XGZA 5CGTA 3TNMB 4R4FH 1A7PL 2BXZA 1LK3H 4XAWL 4U1JA 5I16A 4QHMA 3T4AB 1LO5A 3PJSB 3P2TA 4PJDF 5C09A 4YE4L 4BFIA 1RQ5A 1DQJB 2PO6D 4NFCA 4D9QD 3F12B 1FPTL 3WIFB 1J10A 1BZQK 2W0KA 3QHFL 2XNAB 5E03A 4Q6YA 4Y4FC 4TUJB 1CLYL 1KN2L 3RP1A 5DYOB 3QQ4B 2D2OA 1GGCL 2J8UE 3DUSA 4JN1L 1A6TB 5C0DB 3QIWD 3WN5B 1LE9B 4KI5E 3MRDA 3TO2A 2FDBP 1NGPH 3BUYA 2P24B 4HS6A 2MFNA 4H1LA 5HYJA 4HGMA 4JFHE 1MH5B 3U30C 2X5PA 4HMEA 4N8VB 3SKNA 3FQNB 4MDJB 5FO8B 5EIQA 1PSKL 3HC0B 2R39A 3FO1B 4LLDB 4XNYH 3CSPA 5DHYA 5IEHB 4LAJH 1G6RL 1Y18B 1CYGA 4UBDD 5ENWB 1D5ZB 1E4WL 4WHDA 5MEQA 3GSXB 4L3CB 4ERSL 5IR1B 1QTYT 1R5IA 4TNWK 1MCNA 1ZLSH 1MWAA 2HT3D 4EI6A 2F53D 5D1QC 3STLA 2FZ3B 3R0NA 3ZE2E 3CXDH 3BFOA 1U9KA 5IOPA 2GSGB 4NO2A 3HE7C 2WUCH 4W6XB 1NFDB 5DJ2B 1JWSA 2X89A 1DQQA 4O4YL 4CVWA 1EAPB 1AR1C 3MNZB 1O0VA 1BQSA 5IM7B 3K1KC 5DJXB 2DYPB 4F37F 1T80A 5CIPB 3D69B 4P4RB 2PR4L 4UT6H 2PYEA 2VLKA 2XTJB 3GSOB 5D7IA 3FO2B 1RMFL 5E6YA 1D3CA 4CBPA 4WU7B 1DJSA 4R97C 2FSEB 3X12A 1R3LB 1ZV5A 5DHVA 1DFBH 4PTTB 1GGIL 5DD5H 3OHXB 3MRLA 3JWOH 2VDQL 1CDIA 3VMOA 5I8EA 3KGRA 4PRHA 1ZTXH 5L2KB 3EOBB 5KVGL 2HMIC 2D4FA 4NM8L 4ELMB 1TJIL 2N56A 4HGKC 1JMZA 2A77H 5JORA 5K9JL 1EEZB 4OFKA 1I7RB 2MKWA 4Q2ZA 1NCDH 3U46A 1DQDL 2MMXA 2DI9A 2DQIH 5DK2B 4ZOAA 2NPLX 1A1NA 3BP7A 4LSVL 1U8MB 1KYOJ 4MZ3A 1LO3L 4KMQA 5E95B 3LEXB 3TEUA 3TJHC 3MJ6A 5E99L 4WO4A 4NCDA 5IB2A 1C1EL 3KPMB 3FRUB 4F7PB 4RQQB 5ANMA 2Z31C 3JTSA 3M8OL 3C9NB 4HDIA 2EE2A 4HBCL 3DHMA 2J8UB 2I26N 4ENED 3DIFA 5HJ3A 4JJ5A 3ARFC 4PY8I 3QULB 5I1DA 4ODWB 4N0YL 2JLLA 2ZPKH 1ZK9A 5FGBA 1I1AD 1I8KA 3I3BA 4K3EH 3ARVA 3OBAA 1ZGLP 1T3FB 1PBYA 4H0GA 3HFMH 2R8SL 1NC2B 2VUYA 3LMJH 1G6RB 5CEXB 2E9IA 2ORBL 4Z7UE 2WIIB 1JV5B 4RMUA 2J5LC 2JB6B 4K7PH 4PJIA 3QPQD 1T0MB 2VSCA 4JQIL 3ULUL 5T1LA 2GSIB 4XH2B 4NRXA 1I1YA 3I6LD 1AXTL 4J3OC 5JOFB 5CJQL 5LKNA 3UTQB 1BQUA 1CZ8L 3MRMA 2W9LA 4GW4B 5IBLC 3VXSA 1SBBA 1NLBL 5T1KA 4DAGH 3S4SA 1OTTC 3WEXA 3RY6C 4RA3A 5FAAA 4HPOL 2L7JA 4HCRH 3QIBA 4X7SH 4WVRA 5T1DH 4J3WA 3SGJA 2EXWC 3S88L 4ODTL 4LPTA 4WEUD 1HIMH 3LQZB 5H8DA 1Q94B 1AD0B 2HTLC 4BFBD 5TF1H 4FFZL 4MA7H 3O81A 1WIOA 4JFEA 2EDDA 3RGVC 5BW7C 2FLBT 2HVJB 1WBYB 3HMWL 2FEDC 3PP3H 3N0PB 4QO1A 4R3SA 4XHJD 3ZL4L 4BH8A 4HPYL 5F9DC 2CIKB 2DIAA 5I71C 5E7BA 1ZVHA 5AD0B 3HC3H 4CDHA 1MHPL 1F4WL 3QFDB 1INEL 4TNVF 1X6NA 2VLMD 1TVBB 3LEYL 1MREL 3PDOA 2YKLL 4TVSa 2NY3D 2ADJB 3UTTD 4OCRL 2DQCL 1JHTA 2A9NH 4LARL 3D5OF 1V7NL 4BH7B 4ZSOA 1FNGB 5CHNA 5LGKA 5IB4B 2W0FA 1AD9B 4RISH 2YBRA 3W5MA 3OAUH 3VWKC 4L3EA 2G75B 2NXZD 3ZLQC 1O5DT 5JXEC 3L1OH 2BRQA 3KVQA 2A83A 3DMMB 1YPZE 4O2FB 5IEKB 2DKSA 4ZFFB 2C3VB 4U1NA 5TPWL 4B41A 5HI4C 2FECL 2A74B 4R26L 4UTAL 3QO0B 1UA6L 4K07A 1PLGH 1DBBL 1J5OH 3DVFA 4PJAA 1HSAA 1MFDH 5ESAB 2GAZB 5D1QA 4YDIH 1FVCA 3A0OA 4JM2A 2R2EA 3MX0A 4J23A 3QZWG 1ZEAL 2VDKL 3HE7A 3N85L 3EYSH 4Z7UB 3AXLA 3LN4A 5B38G 2ARJQ 4LSRH 3EO0B 2DQUH 4MQ7A 4YHNA 4OLVL 4IS6A 3V0WH 1L0YA 4ELKB 1FDLH 3TPUA 3D3VA 4WW2F 1SVCP 1LO0L 5IROC 1RUMH 3QG6B 4LDEB 3RWFA 4P2OD 4B0MM 3UC0L 1CGSH 2APTA 4X0KB 5LWYH 5JHDA 4LPYA 1C7TA 5JW3H 2XRAL 2R2BA 1GGBL 1FZKA 4DKDC 2HFEA 4Z7QF 5DJ6B 4GUPA 2B2XL 5LBSH 3RI5F 5DFWH 2ZJSH 3GSNB 4JDTL 3KWWB 2R0ZL 1KG0A 3MLTB 4HUWB 5AZEH 1HXYA 3RGHA 3VD3A 3R1GL 4N8CL 4Z6AT 2AJSL 3K4DA 1PYWA 5C6TL 1KGCE 3IXAB 4HBQA 1KCUL 2BP3A 3CK0L 4WUUA 2HJLA 4FQQA 2DYPD 1Q0YH 3GSQA 5KVFL 1SYSB 2VQUA 2I5YL 5L88H 2XTJD 2BVPB 1JK8A 3VXMA 4MNQE 3RWIA 5I1EL 1NCBH 2ZUTA 2Z31A 3O6LH 2HRPH 5CFHA 4DQOH 1MLBA 4PJ5E 4DGYH 4S10A 5SWSA 3PP3K 4ZS6D 5C07A 5J13B 1YNTA 1GPOL 2GCYB 5L2KD 4CU8A 3MXWL 5E56A 3ZDYE 3G6AA 1YPZB 4PG9A 4HEME 1RZ8B 1TJHL 4JO1H 1ZWIB 4CVXB 1DN2A 4KAQH 1INQB 3LH2L 1ZGLA 3T3PF 5E0QA 5JW4Q 4IMLB 3T4YA 2BCKA 4TUKH 2W07A 2APFA 1JTOA 4Q9RL 3KLHC 3CSYB 3BDYL 3P9MB 4RAVB 4M93B 2Z92A 4XCNB 3V52L 1BF2A 2D7TH 2VZOA 4S1DC 1TTGA 35C8H 2CDFB 3P11L 1A2YB 3EO1B 1U8NB 3S36L 1UZ6E 3F7YA 1UZ8B 4KVCH 3VD7A 1BZ7A 4YHPA 3RY6A 4JRXE 5EBLA 5SX4H 3AU1A 5JLZA 3SKMA 3V4PL 5HVHC 2C3WA 3FQTB 4TQEH 4GKZB 3RDTC 5IGXL 4QRQA 4GQ9L 5ECJE 5GISL 3TO4C 4F33B 5FEBA 2EC9T 3CPLB 3DVNB 2AVGA 4JO2H 1Y6MR 2QL1A 3KPSE 1HQRB 2BSTA 3W0WE 5C71A 4LLVA 4JFHD 2YS4A 1YQVH 5BW7A 5KSAB 3EYFA 1XGTA 4P0DA 3ZDZF 4MCZA 4LAQL 1X5LA 3U36B 4PY7A 5IBUG 3BOVA 1EXUA 2WBJA 3W11C 4JFDA 3AREB 5DMKA 4AIZA 3HKFA 4EI5C 5D2NA 4YNYB 4GAJL 3SQOH 5TE7L 4EN3B 1MHHB 4R2GD 1VFAB 4HEPG 3QNYA 4DGIH 4PRDB 3TBVB 3L6FA 3VFMA 2X1XR 2PTTA 2KUTA 2NCMA 1XGUA 2QV2A 3PWLA 5E2UH 4YGVB 3OX8A 4I0PA 3QXDB 3CVHL 4WCYL 3VWKA 1MRCL 1NGWA 4MNHB 2V2TB 3IU4H 4PRPA 2V2WB 4GG6A 5JXEA 1XF2B 1IGFL 3LRSB 4NT6B 2NY0C 5IQ7H 4HX1B 1FIEA 4OIBA 1I8IA 3MRIA 4RSVA 5CD3A 1T04A 3DYOA 4JFOA 4MNQB 4ZOEA 5F8QC 3GMLB 3TFKC 5HHXH 4PJ5B 3VGAB 1RFDL 3Q6GL 1OARH 4LIQE 3MOAH 1P1ZA 4LIQL 1ACYH 4I3RL 1ZHKA 5I1HL 5MHSE 1HH6B 4EUPG 5C0BE 4LPCA 5E6IA 2BY3A 1NEZG 5JXAL 1NMCB 1UCBH 4XP5H 3BKYH 1A7QL 1ZHLB 3H9SA 3WIIL 1EJOH 2IH1A 3I2CL 4QRUA 1Q72L 1ITCA 5GGUA 3WIHA 3DMMD 3QYCA 5HHQA 5IROA 4AJ0A 4JRYA 1DQML 5HYFA 3VFTB 3VI4F 2YHGA 1WFOA 1JGLH 5FO9B 1LEKA 4P9MH 4JRXB 2AEWA 3V7AE 1I4FA 1U92B 1HH9A 5DEZA 4FQIH 2OYPA 3VGHA 4HWEL 4PJGF 3WL9B 3UTPE 5CZXC 1GOFA 3KPSB 1MJUL 3IETA 3HRZA 2Z8SA 2WP3T 3W0WB 4HS8H 2CK0L 3OKKB 4NN7B 2FJFA 4FN0A 3ARUA 2CDEA 1JPTL 3QH3B 5DK3A 5FOBA 43CAA 4LU5H 4KJQD 5CUSH 3TYGL 4OD3L 3HZMA 4A6YH 3G6DH 3JV5A 1HKFA 5J1AB 3CFKA 3ULUD 3ZKSD 1ZHNA 3NA9H 4UTBL 4TNWF 4U1MB 3CLFL 1JN6B 4M61B 4AH2A 4D0BA 2BOCA 4LOUD 2VDNH 4M43H 1JFQH 3CVHB 2HP4A 3NFPB 1A3QA 2YD4A 1MCPL 3LIZH 2AV1A 1K3IA 1EO8L 1KXQE 4IIQA 4UIKL 2NY7H 3FTGB 1U0QA 2YWYA 1VFBB 5DJAB 3MA9H 1YC7A 3V5KB 4KUCF 3OJDB 2ICCA 3A67H 1NDGA 1RHHA 3O6FC 4J3UA 1HZHL 5D5ME 4YHLH 3FAXA 4LKCB 2X4UA 3DOSA 3FN0L 4LEXL 3H7LA 5FKAA 4V1DE 1VPOL 4LCYA 3BE1L 1AQKH 5L6YH 1IFHL 1MCEA 2GK0A 2O5ZH 4XAKE 2C1PB 4PJ7A 1FFNA 3SKJH 2E5EA 1AC6A 2HJFA 2WIMA 2VXVH 1FZOA 4HKZA 1OSZA 2GY5A 4YQXL 4FA8A 5C0BB 2BZDA 3O2DH 4OI8A 2FECI 1NANI 4KHTH 2VYRE 4X6DB 1R3IL 5IT2L 3TO4A 4HXAL 3OPZL 4E0RA 2PUQT 4Q6IC 1KXTB 1NAML 3QJFB 4AL8L 1JF1A 4NQEA 3DVGA 3OZ9L 2YMXH 3BKCL 1QYGL 1DTUA 1VEMA 4Y19A 3V6OC 3OXRB 2D31A 2EH7L 1B4JH 1BJ8A 2CKBL 1HHIB 1CD1A 1MRFL 3ZSTA 3SJVA 2AXFA 3MGOB 3CFDA 5LCVL 4YK4B 3RWCA 1K4CB 4Z77A 1TETH 5LAXA 1F8TL 2LAGB 5IKCA 1KTLA 2Z91A 4OLYH 1ED3B 4NC0B 2JJUA 3UTZB 1QRNA 3ABZA 3RJDA 1FRGH 1MJ8L 3IFLL 2CLZB 2VO5A 3UJTH 4YDJB 2XY1A 3MLXH 4M5ZH 3S34H 3CXHK 1C5BH 3BEVA 5GRZA 3RIAK 4JY6B 5DZNA 3LKRB 5ILTL 1M05B 1BBDH 4PYHA 3LS4L 4OCWH 4JPWH 3QUXC 1CS6A 4ZTPL 5LXGL 5DMYA 3ARED 4J4PD 2AGJL 2X7LA 1BFSA 3QUYC 4NZDA 4P4KA 2H2SD 1HXMB 3BQUC 4DOHE 1A1MB 3GMOB 4N0RA 1NKOA 5I1IH 2VXTH 4IMKA 1GL4B 4KJWD 4EN3D 1G0DA 1I7ZB 4K3DL 3WXWH 4I13B 1J18A 4MXQC 5I8OL 5KS9E 1GZPB 2XFXA 3D39D 5D5MB 3FZUD 5GJTH 1E6JL 4XP1L 3BZ4B 4XX1G 2A1WH 3L9RB 3QEUB 5SV4A 3CZFB 4RFEA 3FB6A 1P7QD 3MLSH 2CRYA 5DMJB 2AJYH 4HS3B 4N1EA 4DW2L 4V1DB 2X09A 3G6JA 5HHVH 4F8QA 3NFNA 2X1PA 3MO1A 4NRYA 4U2YA 4I9WE 3KJ4B 4W70A 1C5DA 3WDHA 1MCFA 2CH8A 4YHYC 2YK1H 3FOLA 4IM8A 4ZDHA 3ZHKA 3JWDL 3I9GL 4NN6C 4NGHL 3MV9E 5EZJB 4MNQD 4F58L 1C5CL 2NX5E 5CSZA 2E7HA 4UINL 5EOTA 1WCQA 1OQOA 4EQ2A 1ES0B 1YEGL 4KK9D 1NAMB 4PJ5D 1GCFA 4NSKB 4PJEA 1CG9B 5BZWB 3BHBA 4YAQA 4ZAKA 3VD5A 4GSDL 4MA8H 1W72H 4M48H 3DV4A 3TCXA 1E4XH 4OBRA 5FM8A 1FORL 1G0XA 1AJ7H 5EBWA 2CKBB 2IALB 4U1HB 3INUH 4Q9QH 3HLAA 4JQVC 1XF3A 4YUEL 3KPNB 4ZNEA 1QA9B 3D2UA 1IQDB 2WZPD 5JW4R 4X83A 2FATH 3V6FA 1QFWM 1RU9H 2FJHB 2XWJB 4WRLA 4JR9H 5LG1A 2FX8L 5IB5A 2VL5A 1O7VA 1A1OB 4F2MA 5DLML 5CEYA 2AEPL 2YZ8A 4UUJA 3FKUS 3A6CH 3O9WB 3ZE2F 2AI0L 2VISA 1INDL 3QP3A 5K93A 4HKXA 4CADA 2DJUA 3O3BB 4JRXD 1M7DA 4XTRC 4NZUL 3GJEA 3DI2B 3MR9B 2I07B 3RWJB 4MAYD 3QRGL 4HZLA 4XZUB 1RZIB 2Z93B 4NJ9L 5CCKH 3WCYA 3R8BB 3LS5L 3KPSD 3ARGB 3O6FA 4NHCH 2VLRE 4CVZB 2HH0L 5GGQH 5DRNA 1JZ5A 1T20B 2JK5B 4CN1A 4KJPD 4O2EB 1Q1JH 2E9BA 5AUMA 2B4CL 3RZCB 3OKOB 4ZFGH 2OXHA 2OS7A 4DOHB 4MJ6B 3KPPB 5BZDB 4XPHL 3HR6A 1WBZB 4NWUL 2IMNA 4P5TD 1T0PB 3KPLB 5KS9B 3MNWB 4MXWL 3PWVA 1U3YA 1H3GA 5F7EL 4NM4L 1J12A 2X44D 1G9NH 1EFXB 2Y06H 5DJDA 3B8YA 3MTRA 5IW6A 1T1WA 4OF3A 1ZA6B 4Q6IA 3ARZA 1Y6NR 4YWGL 5MEPB 1N4XH 1XCQA 2BC4A 4XPAL 4CRPA 3QIUB 4PBVC 1YECH 5F9JA 3MV9B 3SDDC 4MD4A 1IMHC 3V6OA 3QNXB 1F3RB 5C9KA 2NX5B 1VACA 3OWEA 2H2PC 5KANI 4PTUA 1FC1A 2OP4L 1QEWB 4YXHH 1ZSDB 5D8JL 1LEGB 2RJMA 3HE6A 1KB5A 4YC2B 4JY5L 3NAAH 5GSVA 3MRJB 1SQ2N 5JNYA 3MROB 4O00A 4Y1AA 5F7MC 2R2HB 2HLAA 1CICA 4X8XA 3MFFA 4NZRH 3RBSA 1OGTB 2V5YA 1PQZB 5IHUH 4DVRH 5TJWK 3ARDC 5ACMA 3L5HA 1KEGL 1LEIA 5T3ZL 3DETD 2P8MA 4WW1A 1T66D 2Q87A 4LHUD 2GJ6E 2YPVH 1R5WB 1IL1A 2RCSH 5CINH 1RZKC 3B9EA 2Z8WC 2ATKB 1UCTA 5CWSA 2IQAB 4Z78B 1A6WL 1ZXQA 2MHAA 1RZJC 1PD6A 5BXFB 1EZVX 4K94C 5D2LA 4MMZC 4QT5A 4JFQA 4F7TA 3FQUA 5A3ID 1HSBB 3KS0J 5EC2B 3QUXA 4ZOCA 2IQ9H 1KBGL 3GJFH 3PIQB 2MCPL 1DDHA 1XGQA 3BAEL 5KANG 5T1MA 3G5VB 1KTRL 5CGYC 3BP6A 3QUYA 5KAQF 1E27A 4E5XA 3DSFH 4LHUG 1UB5B 3BQUA 3CD4A 3U82B 5BRZE 2DBJA 1R24B 2P5EE 4M9PA 4R96B 1I3RA 1IEAB 1Q9KB 3WMSA 4PJCA 3UTPD 1I7TB 3O8XB 2VDPL 3H0TB 2Z8RA 1OAUH 4EBQL 1M6OA 1JF6A 2VLRB 1KYOK 2XWTA 5IFJA 1MI5A 3TYFA 2X4PB 4PRHE 3NVQA 4G3YL 3O3AB 5CD5C 1K5NA 5EA0H 4OLEA 3RNQA 1RIVL 3NACH 4UAOB 5K9KA 3QA3B 5I1GH 5DJ8A 3FOMA 1T21A 4XPGL 3CC5B 4JDVA 1D9KA 2OL3L 1YNKH 4HKBA 4LLUB 1ETZA 2JB5L 3NZ8B 3ULVF 4JFFA 4OFIA 5IW1A 2QSVA 5FYJH 2R0KL 3D0LB 1JGVH 4P9HH 4AENA 4TSCH 2FB4L 3UPRA 1WAAA 3ES6B 4LSTL 4BUGA 4JLRA 4U1GB 12E8L 2HKFL 4BSVA 4UNUA 3OR7B 4XRCA 1N7MH 2FX7H 3L3DB 3EGSA 2X4OB 4OV5B 2KH2B 3BT2L 5INDB 5ID1B 1TIUA 5GZND 1YEHH 4JQVA 3V2AR 3AUVA 1S7XA 5D7SL 3PL6C 2EC9U 1I85A 2V7HB 5HPMA 2O5YH 2H6PB 1BQLL 5I8CA 1QFHA 3BZDA 5JW5A 3RWHB 4XAKD 4Z7OE 2FR4A 5I9QB 2YEZB 3K8KA 2NNAA 1CF8H 1CBVL 3NABL 3SDXA 1KN4H 4R4FL 1LK3L 3JXAA 1UKQA 3HI5H 2A6JB 3D18B 2IEPA 3EOTH 3OKEA 4G7YH 3T09A 1DUYA 2I9TA 3KHQA