3ARGC

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
204
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSAGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 31
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC02
1KPUA 1JGDB 3FFCD 4X6FB 1RK0A 3WFDL 1T03H 2NY0D 2X9YA 2NY4B 2JJTA 1PDKA 5C07D 3I9GH 2R0KL 1JL8A 4ETYA 4RFOH 3DURA 2ZSWA 2EE2A 5KSVB 2IQAB 1G7HA 2AJSH 1J5OH 3B5GA 5GZND 3RPIA 4X6FA 1VA9A 5L8KB 2R1YB 1CXIA 5E70A 1QUNA 3ZMRA 4OGYH 1G0YR 4IDJH 2CUIA 4IRSD 4WCYL 4ZFOB 4TUKL 1BVLB 4LHUD 2V9QA 1FYTD 1FORH 1QRKA 2DL2A 4X6EB 4HWBA 4I18B 3RX7A 4P2CG 5IJVA 2UWEB 2FATH 5ICZB 5KSVA 3CFKB 2EXYD 3AREB 1S7TB 1TZHB 3RJQB 2UY7A 1DQML 2R1YA 3B9KC 1LK3H 1RUKH 2VAAA 1CGTA 1GH7A 2X4OB 2I9LA 4Z5RA 1M7DA 1ZVHA 5C9JB 2A6JB 4GBXD 5F1NB 3UTQB 2PW1A 3MUHL 3EJZD 2QHLA 4PJIE 4YDJB 3F7RA 3IVKA 3UTTB 5T33L 4HJJL 4L9LB 1YEHL 1A2YB 2YRLA 3NMEA 3DO7A 1B4JH 4UT6H 4MQSB 4HX1B 4HJGB 3MRGB 4HWBH 4WU7B 2UYLB 3QEGH 5CEYA 2X6MA 3MODH 4XWOC 2NY7L 2ARJQ 2YD2A 5DYOA 1RK1B 2XY2A 1TJHL 4MB4A 4HWZA 4FQJH 3MRRA 4Y4FC 3BIKB 4L9LA 3KPMA 3HFML 3EYVB 5DD5H 5IMLA 3WHE1 3VI4F 1CR9L 4PJGB 1ZT4A 4PJDB 4HX1A 1K2DB 3MRGA 3SO3B 4WU7A 3N9GH 1NBVL 2HKHL 5DLML 5HI4C 5GS0L 4M6AA 1I4FB 1F4WL 1X9QA 4KI5F 1RK1A 1FNSH 3EUUA 4AEIL 4PLKD 3IFOB 3LEYH 4P23B 4LCWA 4O4YL 3WNLA 3GKZA 4PJHE 1PX3A 5IEHB 4HIJB 1FP5A 1HE7A 1CFTB 2NY6B 5E8OB 1AHWB 1PAMA 1MUJB 2FEDD 4GG6E 4PJDA 3ARTA 4NM8H 4X9BA 1D5BB 3OB8A 4HEME 1AGCB 5HHMB 1KXTB 3KJ6L 4HSQA 5MERB 4PJFB 3H6JA 3DX9B 3RVUC 5D1QC 5E03A 3VGFA 3ARGB 3IFOA 1AGBB 4F2MB 2XICA 5BV7B 4ODTL 3SKJH 4FQIL 5IEHA 3IFNH 1JNLL 1T1XB 5IB1B 4MMXC 1CFTA 1JPTH 3GNML 5E8OA 1AKJB 1QSED 5F1SA 4P2OB 4OGAC 3CFEA 3NZHH 4WWID 1MCKA 2P8LA 4PJFA 5IEKB 5F6IB 3ARGA 3MXWH 4HDIB 4LNRB 1V05A 4F2MA 3LEVL 1FV1B 1FC2D 3DRQA 2ADFH 3SDDA 4NJAL 1NC2D 3ARPA 4IOFC 1TNNA 5F96H 4LF3B 5L2JB 1HHGA 1AKJA 2J12B 1EK3A 4XMLL 4G9FB 5I8EB 4TYUA 3ES6B 3NACH 3ARQA 3CSYB 3DUHA 3DXAA 3TZVD 1RIUL 1GZQA 2J1KA 3MFFB 3W82A 3QNZB 4HCRA 4HDIA 1ZT1A 3U36B 3C8KA 1OM3L 3L3JB 1C5BH 3PP4H 5TJWK 4BKLA 4KROC 2C5DC 3WBDA 5L2JA 1TFHA 5HVWA 5I8EA 4HWUA 3O6LL 4WO4C 1F6LL 5INCB 3G5YA 3L7EB 5GGVL 5CJOH 3O3UN 4P9HH 4F7TA 4M5YL 3MXVH 1U8OB 3IDIB 5BV7H 4WENB 3VFVB 3QNZA 1A7PL 4LNVA 1OY3B 4KJPC 4N9OB 4JY6B 4Y5VC 1KELL 4ZPTB 1YYLH 2Z31B 3PJSB 3O4LE 4YIQB 1IM9B 4MCZA 4PD4J 1OTUC 2HKFH 3G08B 4BFIB 3B83A 5DXWA 2VH5L 3FZUD 1NGZA 3L7EA 3MCLH 2AJYH 3BHBB 4J3VA 3FONB 4HCRH 4R4FL 2XN9E 4NO0B 1DCLA 5SWSD 1JE6A 5IVXB 4M9PA 5C2BH 4JY6A 5KANI 4DKDC 3TBVA 4ZPTA 1KB5L 2Z31A 1TETL 1MNUL 4G6JL 3PJSA 1IM9A 1KCUH 4MJ6A 3L3HA 4BFIA 5DJZB 2LU7A 4I13B 3BN9D 3L7FB 2R69H 3BHBA 2VXQL 3H7BA 5AAMA 1H8OA 4ZOBA 3OJMB 4XXDA 4NO0A 4XP6L 3JV4A 5T1DL 2VJXA 2R8SL 3LHPH 4TSAL 5E56A 4P46B 3CPLA 3PXJA 4LRNL 1C08B 3K1KC 3UPCA 2QEJA 1NGWB 1A5FH 2FX7L 3G04B 1T0NA 1CCZA 1LO4L 2H2SD 2DQDH 1MOEA 3D69A 3OKEA 5ALBH 2FHCA 2NR6D 3FMGH 1EFXD 4LLYA 4PRNA 1Z6JT 3LKNB 3OHXB 5ACZB 2M8XA 4KMTH 3M45A 1QRND 4GAYA 2J4WL 1G7PB 3H3PH 2JIXD 3QEQD 3K2UL 5DD1H 4HBCH 1KIQB 4HF5H 5T1LA 4QRUB 5C08D 1GGCH 5IROA 5ACLA 4DVRH 5BS0D 1DJSA 2Z8RA 4AIXA 1UACH 4X5WB 4ENEC 1BVKB 2BHUA 2JKXA 2EDJA 3O0RH 3RX5A 3PWNB 1ADQA 4WFGD 5GZOD 4KQ4L 3IXTA 3KHQA 4FFYH 2ADGA 3L6FA 2DMCA 3DX8B 4NO3A 4TVPH 4FQHB 1RZIA 4PB9L 3RU8H 4OCSL 4I0PA 5D7IE 1IGFL 4IMLB 3T0BA 1EGJL 1UQSB 1BOYA 5BMFH 4BYHA 3PWNA 5AUMB 1DBBL 2OP4L 3B5HA 4M8QB 5SWZE 4JGMA 4ZOCA 1IC5H 3Q6FB 4BSWB 3STLB 3PV7A 1BEYH 4P0DA 3VFUA 4NWTH 3EYFA 5IHBA 2QR0B 3BWAB 4CVWA 4TNWK 5JHLL 2J5LC 2Y36L 4DFIA 4L4TE 4YDIL 3BQUC 3QPXL 3INUH 2XOTA 4OD3H 4DAGL 5I6XC 1OAZH 2NY3D 3CFBB 3RNQA 1YEFH 4M8QA 4MXWH 3Q6FA 3QEHB 3FOLB 3Q2CA 4JQVA 2GW5A 3MNVB 1UWGH 2EDXA 1YYML 3ZE2E 2B4CC 5T3XL 4KDWA 1Z9LA 4HK0B 1SBBA 3M8OH 1N2RA 1RU9L 3EHBD 5E4IA 3LZFL 3NTCL 3VD7A 3PWPB 2W65A 3VMNA 5FM8A 3SKOA 4TULL 3TIEB 4M43L 4OKVB 5T1KD 4DTGL 5FYJL 4QTHB 1UCBL 3FOLA 4BM7A 4YGAB 3FN0L 1SY6A 4OUOA 3FT3A 1TPXB 4PY7B 3DUUB 2OL3L 3WO3B 1PJ9A 2NY2C 3JWDC 4XVSL 4DUXA 4HK0A 3BN3B 3CLFL 1ES0A 3DV6A 2D7TL 4F37F 5IW1B 2L7JA 4ZTPL 5HJ3A 5CWSB 1WIOA 4JHWL 2HH0L 3K7UA 2JE8A 4QTHA 3WS6C 4O9HL 3VXRB 2CXKA 3E1F1 1XIWD 4AIZA 4PY7A 3SE3A 3UPRA 2CLZB 4JFEB 5GRJH 3DUUA 2V17L 2R0LH 2FEDC 2ZG1A 2NTFB 3L5JA 2H8PB 3PQYA 3CAFA 3KDMA 4NZJA 4JFDE 1R3JA 4NP4H 1H8NA 5F7EH 1SY6H 3OAZH 1NEZG 4QRQB 5EU4A 3BKYL 3EOBB 3NGBC 1NAMB 5F3HB 3MLXL 2P47B 3PDDA 5SV4A 4QXGH 5DK2B 2X4PB 3RWIA 2GTZB 4N8VG 3CDCA 1H3WM 1U8IB 2WUBL 1ZMYA 1X5FA 1JK8B 1GPOH 4JPIB 4M6NH 5INDB 5CLTA 3KGRA 5EZOH 2IMMA 4Y1AE 2V5SA 5MHSD 3P4NB 4FN0A 1CBVL 2YD9A 2G2RA 2BERA 3GMOA 4U1MB 2VDRL 5F3HA 4DKFL 1H9VA 5DK2A 4KH2A 2DJSA 3VXPB 3DPBA 3K46A 4WW1B 2QHRH 1U8IA 2HT4D 1HH6B 4JDVA 3WXVH 3GBLA 3QQ4B 3BPLB 4JPIA 5INDA 5D72L 2DWDB 3GHBH 1KXVC 4S1SL 3NFPA 5TH2B 4HK3J 1MJUL 5SX4H 2Y6SD 4X4YA 1MCNA 4M6ML 4G80B 1DE4B 1KPRB 3U2SB 3JWOH 3WDJA 3GBML 1R3LA 1MIEH 1HH6A 3OKMA 1JIBA 3HI1B 4O51A 2DJUA 2E9BA 1LDPH 5CP3H 4MA8H 3VXSE 3U4EA 2DWEA 1H15B 1C12A 4XC3H 3TNMB 1JUFA 1KOAA 4QYOA 1SHMA 4LDLB 4NQVB 5JTWA 3H8NA 4KUZH 2ERJC 1KPRA 4KK9D 3U2SA 1CFVL 4J8RB 2APFA 3FZUC 5CJQH 1QBBA 4NKMB 5GS0C 1I1FB 5JMOC 1C1EH 4FQLH 1H15A 3CMOL 4U3HA 3TNMA 3S4SG 3NIDF 5LBSL 1YQVH 3TN0A 5KZCD 1UXSA 1HXMB 1TQBC 1BGXH 4M9OA 5HPMB 1PW3A 5SX5H 3C9NB 3MV9B 5KVEH 4Z78A 3BN9C 4TUOB 4PJBB 2OK0L 4Y8DC 1NFDF 2PF6A 1BF8A 1I1FA 5DQ9B 3OZ9L 4PREB 3NH7H 4NO2B 9CGTA 1A6WL 3VFNB 3BKML 2FZ3B 2Q3AA 3WFDH 5IK3A 3P3YA 3BAEH 5HPMA 4G9DB 4U4BA 3ULUD 2XA8L 4F3FB 2HJKB 3C9NA 3C8HA 1YEDA 4NN7B 1MIML 3KAAA 3RTQC 3AC0A 1T7ZA 3V6OC 4TUOA 4D9QE 4DOHB 1KT2B 1A1OB 4YK4C 1MCOL 3U6RB 4ISVB 3GO1H 5C0RL 4NKOB 3VH8G 5LG1A 4F57L 3D6GA 3DROA 3LKPB 2RQ8A 4OIIL 3RVXC 4JFHE 2W9DH 4PJXB 1WZKA 5DUML 1E4XI 4DUWA 4TUKH 1S9VA 4R97C 4K7FB 3GGWB 4QGTA 1KT2A 1A1OA 3F65A 4IHOB 2SEBA 4QXWA 3U6RA 2DOCA 4XVJH 4NKOA 1OQOA 4JY4B 4NWUH 4Z8FL 2VTFA 2NZIA 4RGND 3LKPA 2VUYA 2YA2A 5ID0B 2XWBA 1QPXA 4MD0B 4K7FA 3GGWA 4NUJB 4X99B 1IAKA 5LJYH 1JZ8A 2F15A 5T33H 3C6SA 3U48A 1IGJB 1DTUA 3EBAA 3EYQD 2NYYD 1HN1A 4B5EA 1CD0A 2AEIT 1F2XK 5AYQA 2EH7L 1O7SA 2AXGA 5ID0A 2VLME 2VE6B 1T21B 2NY7H 3QBTB 2P8MB 1T22B 4MCYB 1DEEB 2WINA 2R15A 1QR1B 3C60D 4PTUA 3QDGE 5JIPA 3GMMA 4N0UE 2GSIB 3TA3A 1CR9H 1NMCC 4PPTA 4FZEH 4KKCD 5LVEA 2QADB 1K9TA 4D9RD 2ZKHL 4LVHB 3VI3E 4LP4A 2VE6A 1T21A 1F4WH 1JHLL 3BZFB 3DVGB 5IBLD 3IU3A 2EYTA 3VWKA 4AEIH 4MCYA 3FRUB 5CILL 2BSED 3ISWA 3SDXB 1QR1A 4O4YH 4XNXL 5H8DA 4PG9B 1EUUA 1GYAA 1EDQA 2FL5B 2GSIA 5J6GA 4LSTH 1BQHG 3F58L 2NY5H 1HHJB 1OTTD 4HT1H 4ZQKB 3V9FA 2YD1A 5EO0A 1N64L 1KJMB 2ARJA 4FQIH 1JNLH 5DTFA 3GNMH 1X5HA 1T2XA 5I0ZA 3MRIB 3GEWB 3WFBL 1UKSA 4F8QA 4OBSA 4WIQA 2XQYK 4QRSB 1HHJA 3MYZA 1LNUB 5FM4A 3O8XA 1XIWC 3ZYZA 4R7NB 4Z95L 5KAQF 2R23B 1N0XH 3LEVH 4Q0XH 1IC1A 1HQ4B 3L5IA 4J3SA 4W4OA 2H2PC 4LIQE 4MZ3A 1BJMA 5D2NB 4Z77A 4XMLH 32C2A 1OHQA 3MRIA 1VFMA 1T1ZB 1N7ML 4YHOH 2B20A 2CJUL 5ALCH 3FQRA 4ORGA 2R23A 4NC1E 2R56L 2Q87A 1F11A 1HQ4A 2DKUA 3N1PC 4WFEE 3SDAC 3IS1X 3DMMB 4MJIB 2NY4D 3MUY1 1EHNA 1KCVH 1KB5A 4L29B 2Y07H 3A6OA 2ORBL 4M5YH 3J7HA 2HTLD 2VSCA 1UM5L 4XAKE 2R39A 2BVUA 3E6FA 3KPSE 1EA9C 1MF2H 3BW9B 1KELH 3OGOE 1S3KH 3T65B 1TTGA 4K2UH 1HHKB 3LIZL 4PJIF 2UZIH 2VH5H 3DYOA 3B2UD 3QUML 4R4FH 1T4KB 1E6OL 1RZKH 4JPVL 4YHMH 4WW2B 1KEMH 1EERB 2ZSVB 2AI0L 2FX8L 2LAAA 3MJGX 4QHLB 3NFNA 2XKSA 4KKNA 5DGQA 3BW9A 3FTGA 5C0AB 1D7FA 1FG2B 1KB5H 3WJJC 4NHUA 1TETH 4LP5A 4G6JH 5HYJE 3L3OA 2VLKB 4K3DH 2AP2A 2ZCLL 5E2UL 3WN5B 3KPPA 5DJDB 4O2FA 5D1ZC 4JY5L 1T4KA 1BIIA 4XP6H 4FFWD 5T1DH 4YFDB 3UTTD 5I73C 4AL8H 3N1MC 4TSAH 1U8KA 5D6DA 3OSKA 5L8LB 3O2WL 4Q6YA 4LRNH 4PGZA 1FG2A 5ESVB 3PWUB 1WC7B 1LO4H 2VZUA 1QP1A 1SJHB 1AI1L 3AS3A 3SGEI 4IBLT 5E6IB 5IMMB 1A6ZA 4PJHF 4U05A 4CJ1A 1YJDC 2PTUA 4HKXB 1DLFL 1U8PB 1CDIA 4LCWD 4GG6F 1O5DT 4UUJB 5HY9B 1V8HA 2ESVA 1DBJL 1EGJA 3BGFB 2EDRA 1EH9A 1KGCD 1L7TL 3JVGC 4MNHB 3DGCR 3VD3A 5B38B 4M3KB 3NVQA 4LLQA 5IMMA 4XCNB 3AY4C 3VCLB 3ZDZE 1RIVH 3A6BL 3GSWB 4P23D 4UUJA 4MQXD 1QTYT 1INEL 4FXLA 3VFRA 4BQ6A 2NY6D 4MNHA 4GKOA 5TPWH 1KCRL 5CEZE 1F3DJ 2BSRB 2A77L 4PB9H 1M05B 4WFFE 5HHMD 5TDPA 5CGYD 1IGFH 4WUUE 3JTSB 3FQXA 4X7FC 1DBKL 3ARGD 2XTJB 3GSWA 5GHWL 2FLRT 1NFDA 3BP7B 3DRTA 1DBBH 2OP4H 3SDDD 4S10A 2DLIA 4GT7A 3G6DL 2YPLE 3P9MB 1A7OL 1AKJD 1RJZB 3THML 2BSRA 4CJ0A 4OZ4B 5ILTL 3VFWB 1XCQA 4K3HA 3DXAD 3JTTA 2YRZA 1W72B 4JB9L 4KK8C 4QRPB 1CN4A 2OL3A 4JDZB 4EUPB 4DAGH 1D5MA 1YPZE 1K4CB 1LGVA 3UTZB 1L0QA 3P9MA 5CJXA 3RWFB 4AEHL 3NOIA 1J8HA 3EYQC 3FO2A 2NYYC 4YFLF 2AEWA 4OZ4A 4XMKL 1NKOA 1YYMH 1LEIA 1NMBL 5I1IL 3LDBB 5T3XH 3KR3L 1W72A 4XBEL 2YUWA 2X42A 2GYSA 2BVTA 1DFBL 2R4RH 4KK5D 1P1ZB 4JLRB 3S34L 1NDMA 4DTGH 3HG1A 4HKJA 3ZTJG 3FN0H 2CDFB 5D2LB 4ZMAT 5HPOA 5FGBA 4M62L 2BY1A 2P5EE 1P5UA 1RJYB 4XVSH 3CH8A 3ARDB 1HSBB 5JPNB 2LV4A 3ZDXE 2VLJB 4PG2C 5DRNA 3X17A 5CZXC 5LGJB 4UIKH 5E95B 1J9CT 4JHWH 1P1ZA 4N0RA 2Z31D 3TIDB 1IM9D 3HC3L 4O9HH 2IMNA 1CLCA 2CDFA 4KZEL 4XPFL 2H3NB 1W72H 5DD6B 2V17H 3VWJC 3H7LA 4NO0D 2EICA 2OMBA 5GIRA 1HSBA 2VLJA 2QQNL 3TBTA 3EOYG 4UV7L 3MRFA 1ONQB 2ATPA 1OTTC 4EDWL 5C09A 1A7BA 1AFVL 1ULVA 1W0YT 1JNNL 3TIDA 3BKYH 2I5YH 1RZ8B 3WSQH 3MLXH 2FR4B 5C0JB 4TVPD 3HE7C 5K9KA 2VC2L 1JYXA 3MUGA 4TN9A 2WUBH 3W5NA 1CIDA 2QBWA 1MAKA 3WIHL 5D7JC 4DK3A 5DRWB 1EIBA 3JV5A 1PQZB 4CW1B 1TVHB 1CZ8H 2AJXL 2A83B 4JJHA 3ORJA 4XCEA 3MBEA 4ZFGL 1CBVH 2X4SB 3LKOB 1MSPA 1IRAY 1CLYL 1RZ8A 4FZ8L 3MJ9L 1QPPA 3CDGB 2DQTL 3IDNB 1Y18A 4FFVD 5I9QB 1FIGL 4WTWA 2JTDA 1NANH 5D72H 1F3RB 3O2VL 5D7IF 4MX7B 4NDMA 3QG7L 3SGJA 5T5FH 2BNQB 1WCBA 3LS4L 4M6MH 4RAVB 3CDGA 1FZKA 2CPCA 3QIBC 1BFVL 1DVFA 1I85A 2MPAL 4JG1L 4F15B 1LP9E 3GBMH 1HI6A 5K9OB 1OTSC 1JFQL 4D3CL 2MCG1 2HFEB 2BZDA 4PGCB 2A1WH 3IDGA 1AP2A 4LFHD 1XGUA 5T1MB 4OLWH 4JEGB 3LV3A 3L3IB 1RUMH 1IM3B 5C6TL 4XC1L 1RIHH 2DTMH 5DJ0B 1F4XL 1ZVSB 4WWKB 3IFLL 3B2UC 5F7WC 4I18C 1XZ0B 2ARWA 2FDBP 4GRWE 4LARH 2WLYA 1OP9A 3ZE2F 5DUPH 4Y4KB 2OYPA 3AREC 3WCYA 3OGCA 5D70H 5D1XA 2BX5A 4ZUWB 1OAKL 4PJIB 1G9EA 3RIAK 1G6RB 5DJ0A 4KAQL 1RHHB 1ZVSA 4JDTL 1P53A 4RWYL 4UOW0 2IC2A 2QSCH 2ADIA 4K3JH 4JCLA 4U1HA 1NKRA 3HLAA 5J56B 1A6WH 1XT5A 3BKMH 3HHRB 1W8NA 1T20B 2V5MA 1KUMA 3BH9B 4N0YL 4RNRA 4NYLB 3GSXB 5DZNA 5EU6E 3QIUB 5EZJA 2VXVH 3NBNA 4OLVL 5C0BE 3L5XH 1RV6X 3MLTA 1AIFA 1RHHA 3AM8A 5J13B 2FJGB 1E4KA 4KZDL 2HLFC 1YNTA 1Q9LA 5C0RH 3EYSL 3DX7A 2CQVA 3WFHB 2V5RA 3BH9A 43C9B 1J0JA 1BWWA 4NYLA 1IAIL 3UTOA 1AGEB 4OF3A 4MQ7B 3QIBA 2WNGA 3ZE0E 5FYLE 4X5XB 3MTRA 5EWIH 1OGTB 1P5VA 2NX5B 4YNYB 2DAVA 4K94L 1HOCA 3HR6A 3FO0H 3OJVC 2ZNXA 3RWEB 2I07A 4MXQD 4GG6B 4ZPVA 5I8CA 4Z8FH 5I2IA 1WWBX 2F53E 1J0ZA 3WFHA 4JQIL 3VFGL 5FO8A 4P23C 3ARXA 2VR5A 3HR5B 4Z6AT 1XMWA 1AGEA 2NNAA 4NRXA 2IGFH 4ODVH 3G5VB 3S3SA 2BVPB 4W68A 4X5XA 4PV8B 5DHVB 4KI5D 4D8PB 4JKKA 3H9YA 3QAZB 4PJHA 2D2OA 3HPLB 5H2BA 1YMHB 5CGYC 4F33A 5FCUH 5FDWA 4GG6A 3GI9L 4Q6IC 3N1QC 4IIQC 4HFUH 1OAQL 2F8OA 1DQLH 4JO2H 4M1DL 3VXME 1EEQA 1IVLA 3HR5A 2X4QA 1DUYB 5J7CC 5C8JA 3VXQB 3I84A 5HGHA 3LD8B 3EYUH 3TNNA 5I18L 1N3NA 4HUUB 4I4WA 4P2OC 4KY1H 3VJ6A 3MYJB 1OP5K 4DW2H 3CDFA 3HPLA 3UYRL 5TGBB 3S36H 5F6IC 4X8XA 3Q3GA 1IKFL 1T7VA 5D6CB 2BFVH 1PYWB 1SYVB 2XI9A 4PY8I 3V0VB 2GUOA 4JM2B 5E1AB 4HS8L 1DN2A 4P5TC 1S7RA 3MCKB 2ED9A 2J6EA 3MYJA 2AQ3A 2PYEE 3GMPA 1QFUH 2E27L 1QA9A 4TTDC 4HAFA 4RBPH 3RZCB 4PJ8B 5JZ7C 4YQXH 1PYWA 1SYVA 4NIKB 1OAUL 1YECL 3MCKA 4RGMC 4OCRL 4RFNC 4PS4L 3GSUB 4KC3B 4DZBB 1MREL 5E5RB 1MJJB 3O4LB 5DC4B 4TSBL 2G60L 5L88L 1I9EA 2EEDA 2VABB 3TN0D 1OVZA 3CXHK 2GTWB 4YH6A 2J6EH 2CMRL 1I7UB 2XN9B 1GGTA 1A9BA 1U8HA 4YUEL 3HC0B 4LIQL 3I85A 5F97E 3PP3H 2LU4A 2DICA 3MRJA 4Z95H 5FKPB 1MJJA 3O4LA 5FV2A 3GIZL 1LEKB 2HJFA 3SDCC 4QF1B 4XNYL 1BAFL 2OTWB 4WEBH 5DHXB 2VXSL 3OXSA 2XN9A 1FN4B 2DQEH 5E24E 2QTEA 4YPGB 2CJUH 4N0CD 2H1PL 1N5AB 3QUMA 5JQ6L 3MLRH 4ODHH 2FGZA 4XP5L 4P46C 4I1NB 1EUTA 4D2NA 2OJEB 2X4NA 3SBWC 5J3HD 3LY6A 4PRPA 4C56E 1RJLB 1ZSDA 4NKDA 5DWUH 4YPGA 5K9JL 4R7DB 1YEGH 1XF3B 1AE6L 4ZSOB 3SJVE 3G6JE 3GMQB 4B7IA 2V2TB 3UDWC 5L7XL 2VKWA 2OJEA 1MJ7L 2HMID 4CADB 3A6CH 1N6VA 1J0HA 4NQXB 1E6OH 5J1AB 3B6SB 4FXKB 5F9OL 4XPBL 5FHBL 4ELME 1XF3A 4PJ7E 1KPVB 1E6JL 1UJ3B 4HEPG 4M6OL 2V2TA 1FLTX 5LCVH 4OI9A 1ZA6A 2BC4B 5E2UH 2X9WA 2R29L 4PGBB 4AJ0A 1FPTL 3MMEA 1P4LB 5J1AA 3MLUL 5SWZB 4XXCC 5MEPA 5EBMA 2XZQL 3F6LA 1HSAA 3X11A 5CD3B 3TA3D 3VI3F 3WJLC 2Y7QA 4K9EC 5D7IA 1I8MA 4G6KH 1AI1H 4L4TB 1IKNA 1S7WA 5SWZA 3MGAA 2Z35B 3SHSA 1YUHB 1LVEA 3BZ4A 2IH3B 4LEXL 3STZA 1DBJH 5CD5D 3TYFB 5CD3A 1NCWL 4Q2ZB 1JF6A 1L7TH 1VGEL 5DDHB 3VXOB 1N59A 4NQSA 2QADD 3SBWA 4K8RC 4WRLA 1W0WB 1LK2A 3ECBB 3ZTNH 1JGVH 3IGAB 1UEMA 4PLOB 5EOCJ 5E9DE 4CVXA 5CEZL 4LCCB 3LQZB 2VQTA 2VR4A 4N5UA 4ZD3L 4CMHC 3AMKA 4M1CD 3WFZA 4L8CA 1YUHA 2IAMB 3HI6L 3OX8B 2IH3A 4KJYB 3OKDB 1LHZA 3LRSB 4XB7A 4LPCA 1INEH 3WMSA 4H26A 1KCRH 1G9ML 2A77H 3MJ7A 1W0WA 3I6KB 3ECBA 4X7DC 5M7QA 4RZCA 2PO6B 3IGAA 3ULVL 3O8XD 4Y16B 3OJ2C 5B4MC 3KHOA 1P6FA 1A1MA 2J88H 3LQZA 1RZ7L 2G9HB 2H9GA 4HIIB 4FTVB 1CL7I 2FIKB 5DJAA 1F2QA 2IAMA 4EN3B 5GHWH 3LRSA 3RBSA 4Y5XB 4LBEB 4O2CB 1C7SA 2EZ0C 1NGQL 3KLSA 5GISL 3HKFA 1D5IL 3OKLA 1XGTA 2APBA 3D39E 4JZJA 1MCPH 1GGIH 4JFDB 5J11B 3V7AE 4HIIA 3RIFF 4JB9H 4DN3L 4N0FB 1CF8L 3QIWB 4EN3A 3D3VA 4XHJD 1PY4A 4LBEA 4F7EB 2ZCKH 3BT2L 3GKWH 2EDFA 1Q9OA 4E5XA 2ITCB 4XMKH 3I75A 1MHPL 4GFTB 4AEEA 5FFLA 1X5GA 1WVZA 2Y9RT 4WHCA 4BFEA 2A6IB 1ODAA 4XBEH 3OKKB 3E3QC 4H5SB 2GY5A 4WI5A 4Y1AB 1F4AA 1B0RB 4AEFA 5GGUB 4ZFZB 1ZHBB 3TCXA 4MJID 1G1CA 5FK9A 1FE8H 3FO9A 2VRAA 1F13A 5E6ZA 1T83A 3P73B 2I27N 3ILQD 4RX4A 4QOKE 3UBXB 3W0WB 4E41E 1NCTA 2C3XA 4H5SA 4OM1L 4RDQF 4JFXB 4Y1AA 1AGDA 5ICYB 2FWOA 5GGUA 3O11B 1HYSD 1R24B 1ZHBA 4RISL 4M7JH 4JR9H 4EZMA 1CVRA 1EEYA 4OGZA 4R4BB 3P73A 1KJ2L 1P9MC 5FV1L 4HKBA 2XQYG 4K55A 1BQLL 3VXSB 1Q94B 3MJ9A 2QQNH 3I02B 1OP3K 5DQDH 1QEWB 1AFVH 4XP1L 4Z7WA 4NPYA 4HG4J 4KWUA 3WNKA 1TIUA 4NQDE 5JW4Q 4KKAD 4V2CB 3U1SL 3F7PC 4XZUB 3RX8A 5D5MB 5L2KB 3IETA 3VRLE 4Y4HA 2ZUXA 1OB1B 1UZ8B 5EUOE 2YEZB 1XAUA 5EN2B 3VXSA 1V7ML 1KF9B 5J1SC 4C58B 5C3TA 3DVNB 1QEWA 2ESVD 1QLRA 3C5JB 2AJXH 1JWSA 1QOKA 2ZUUA 4KV5E 4UB0L 1PBYA 4Z7UB 4ZFGH 4LRIC 2D31A 5ERWB 3ZDZF 3MJ9H 3N50A 3PHQB 4TUJA 5E6ID 1XGRB 3OJDB 1OB1A 3R4DA 3P9WB 1T66D 3QG6B 4HZLA 3IS0X 1FIGH 1OAXL 5TQ2H 4U0RC 1BECA 5AAWA 1G7MA 2QKIB 1U95B 1UWEL 3O2VH 4P99A 3IJHB 3HA0A 5DJ6B 1AXTH 3LS4H 4LPUA 5ERWA 4QHNB 3OJDA 3SCMA 3TBYB 3LN4B 3ZKND 1BFVH 4NZRL 3T04D 2X89A 5F7YC 3QDAA 4GRMB 1AJ7L 5J3HC 2A0LD 4NN7C 1VACB 5T3XD 4KK6D 1AD9A 1HYRC 2QKIA 3LKQA 3RY6A 5FIEA 5SV3A 2GSGB 5KJRH 5F7DB 4JKLA 3V52L 4EI6A 2DQFB 3TCLB 4K7PX 5C6TH 3O9WC 1V7NL 5DO2C 3TBYA 1YPZF 3KLAA 2MCPL 2XTJD 3IFLH 3PABA 1YEEH 4GRLA 2W59A 1KJ3L 4M3JA 1TJIL 1JNHB 2E7CA 3MLYH 3K80A 4G7YH 4Y0GA 2Y5EA 2GSGA 1Q72L 5F7DA 3CX5J 5IT2H 1AR1D 2X1OA 1UM6L 4K3GA 6FABL 1OAKH 3TV3H 3U0WL 4KAQH 3O2DH 2WBJB 3ALWA 3X3GL 5CHNB 5FYKL 1JHTB 4YXKL 1QBML 2NY5C 1WEJH 3FO1B 3MACL 3H9SE 1JNHA 3HG1D 4NUGL 4N0YH 1WGOA 5CJ5A 2FH8A 3O3EB 1G9NC 5HGDB 3ZDXF 5EPMA 1P4IL 2APXA 1EJOL 4P9ML 4C83B 1TZIB 3K8KA 3UJJL 3P4LA 2WBJA 2G5BB 1P69B 5KOVC 3FO1A 1U2HA 5EFIB 5FYLL 1NFKA 3BH8B 1HWHB 3EYSH 2CO6B 4IRJA 4LSQL 5C0ND 3BZDA 2JCCE 3O3EA 4F9LC 1IGTA 1KTLA 4M93B 4UV4L 1S9XA 4C83A 1TZIA 4CBPA 1F45A 2CKBB 3ARDD 4LVHC 4CL7A 2VLJD 1VEOA 1JZ4A 3QDGA 4UTBH 4N0UA 1F8TH 2ZUYA 3B9EA 4PBXA 5C09D 2IPTL 3QI9B 4HIXH 2DLEA 4NJ9L 4YGVA 4RMTA 3VFGH 5L9DL 3BP4A 1FLRL 3W2DL 3F5WB 4NQCB 5EU3A 4NN6B 4HH8A 4U1NB 2W0FA 2P5WE 1CIUA 4XCYB 1EHLL 4ZUUA 5DVNA 5BRZB 1A6VH 3UYPA 3BMWA 2IBBA 4LDOB 1FZJB 2NW2A 3GJFB 3SKMB 4OCWL 3VFTB 2A9NL 3MBED 4M1DH 4HHAA 1EHXA 1EFQA 4NRYA 1IC7L 1MCIA 4JHZA 5CGMA 2CK2A 4GJTB 5FECA 1D5XB 5I18H 2ENSA 5BCAA 4XCYA 5FA4B 2HVKB 3PG2A 2VIRB 1A6TA 4R96A 3PNWA 3T8XB 2HT2D 1IKFH 3FN3A 3RNKA 3VFTA 1FFOB 1QYGL 1MPAL 2W60A 3QHFH 3UTSE 1RZKC 4Z7OE 1AXIB 1J1OL 3SDYL 1A14L 1MCDA 3HZKB 4XHJC 4WVRA 1KXQE 1LP9F 4PJEB 4P2RE 3GUTA 3L9RB 2F5BL 4J12A 5D2NC 1SM3L 3RVVC 3ZHLA 3LH2L 2WWMD 1UH2A 5DD0L 3S37L 2VIRA 4WFHE 3O6FA 3OR6B 4KGJA 5IQ9A 5T3ZH 1LE9B 4CRPA 1U8LB 3ZYIA 5ECJE 3FCTB 4P2QE 4GW4B 5IQ7H 2VDNL 3UTPE 2ZNWA 3AXLA 3JV6B 3BP6A 2W9LA 2EDBA 2BNQD 3HZKA 1TJGL 4H25A 2HA1A 4M7KL 1OAUH 5H37G 4FQXB 3L9RA 2ZZUT 3DMMC 2FX9H 3NCJH 4CU6A 4GRWF 1X5YA 2DJ4A 4AMKL 1MREH 4OLZH 1U8LA 1DANT 5JMRA 2VYRE 3SPVB 1EBAA 1GC1H 3FCTA 4GW4A 2EC9T 1BD2E 4TSBH 3TBWA 3CIQA 4M7ZB 2Z93B 1KLGB 4EOWH 1FRGH 2CMRH 5D1XD 1CU4L 5L0QB 3IF1A 4X9IA 1HZHL 5GGSB 4WWKD 2HT3D 3KPSA 4PP1D 2Y72A 4GW5B 4JFPA 3QUZB 1FSKB 1CDJA 3MNZB 3RGHA 1KNOB 1RURL 5DJ2B 5HYJB 4WW2C 5A16B 4ZAKB 3BIAX 2AK4A 3QA3A 4LAQL 2WM0A 1D6VL 4I0CC 2Z93A 1IARB 1KLGA 4Q9RH 4XNYH 1BAFH 3BESR 2DQGL 2VXSH 1S7XA 3FQWB 1RZJC 2YS4A 3GB7A 1BLNB 4ZNCD 2Q86B 4BZ2L 3O6ML 1XH3A 1S78D 1CFNB 1S9YB 1UENA 2W92A 3WN5C 2YUXA 5DFVC 4F7MB 3QUZA 4LLAA 1F3JA 3MNZA 1QFWL 2H1PH 1KEGH 1NMAL 1KNOA 3KPTA 3RWCB 5HYJA 4TTGA 3ULVC 5CP7B 4ZAKA 3MJ8A 4XP5H 3ZE0F 4NCC1 3QIUD 1CTOA 1PKOA 1BLNA 4Z0XA 2Q86A 1FG9C 2KPNA 5I75B 1CFNA 2N7BA 1OSZB 2VZVA 4TQEH 1CGWA 1T3FB 2HFGH 2V2XB 5E6IC 1H5BA 1WV7T 1AE6H 1T66C 4A6YL 3WD5L 1K8IA 4GQ9H 5GJTL 4I5BA 4PD4K 4L4JA 4ODUB 4XH2B 4OF5A 5I8KH 2NX5D 4PRHE 3PV6B 2NW3B 4K7PH 2V2XA 5F9OH 1RULH 4LQ1A 5FHBH 4YLQT 2A6KB 1D9KC 1BOGB 4KK6C 1U8QB 1YEJL 4ODUA 4XH2A 2R29H 4HH9B 2O5XL 5AG8A 5AD0B 4QRTB 4D0DB 4P48A 2FJHB 4MXVE 2NPLX 3NAAL 4PJ9B 2YHGA 4LLVB 5EBWB 4IMKA 2CLVB 1UYWH 4B50A 4PJ5B 4WUUA 1RZFH 3E8UH 4HH9A 2H41A 4RMUA 5F88B 3MOBH 4QRTA 5C0IB 1LQSR 4D0DA 1NBYB 5BVPH 5SWQB 2FJHA 3T0EC 3S3PA 2YPLA 3BI9X 3U9PL 4CN6A 4LEXH 4QTIH 5BO1L 3SE9H 3QFJE 4OFPA 2CLRB 2E7LA 4ERSH 4RWHA 1OARL 5EZIL 4YDKL 7CGTA 4UT7L 1JPSH 4DQOH 1YPZA 1QKZL 5CEZH 1IGML 1IC4L 1LO2L 3LDBC 1IAMA 4G3YH 3X3FH 2VQUA 1CDGA 3RZCD 5CCKL 1I1AA 4GLRH 4JRYB 4NNPL 3CD4A 1F4YL 3OR7B 2CLRA 4I2XE 2P5EB 1DL7L 1MAML 5A3IC 2DDQL 2DKMA 4DCQB 4UNVA 5C0NC 5I1LA 1NCNA 3ARFB 5JLZB 5DRXB 4NZTL 3RL1A 4PP2B 5DMJB 1MJ8L 4ZUSB 2ZPKH 3O4LD 3RZWA 3ARDC 2VDML 1CK0L 2B7DT 2A73A 1RUPL 2QL1A 3WFCL 1BVZA 1NGQH 3CVIL 5EBGA 4G6AC 2O61A 2XN9D 2P5EA 2D0FA 1SYSB 1WITA 1UFUA 3T2NL 2ZUWA 1IFHL 3HC4L 5C0GB 4JN2B 1MI5E 4DN3H 4WI9A 4ZUSA 2EE3A 4G8EB 4X6CE 1JYVA 4JPWH 2PYFB 4LKCB 2FB4L 4KDTC 3C6LB 1IGYB 3CJJA 3Q48A 2YPVL 1T7WA 2Y23A 1UM4L 1SYSA 3D18A 5DGRA 4GO6B 1MHPH 4ZXBC 3IKCA 3U83A 3T0EA 4UBDC 2XV6B 3G6JF 4KRPB 5C0GA 4AQ1B 3MUJA 2OJZL 1I1YB 2E6JA 1KIRB 1RMFL 1YMMA 4G8EA 2V2WA 4JN1H 1TLKA 3LVEA 3KWWB 4I3SH 3S5LB 5KSBE 5D93C 2HT2C 3VXUE 1L6XA 2G75A 5JUEL 1R0AL 2QSVA 5BW7C 1HNFA 1FNLA 4CUCA 4U1JB 4ZG1A 4ELMF 4MS8D 3B8YA 4PJ7F 4MLSA 5KVGL 3ROOB 4H8WL 1MHEB 2YUZA 1I8KB 1WT5C 2WWMC 4OZGE 5I9QC 4KI1A 3ARBA 2BSSB 4RISH 1BZ7B 4GG8B 4LOUD 2FH6A 5DRZB 1CFSB 5IIEB 1LP9B 3EW3B 3NN8A 5GGSY 2NY0B 5EDXA 5EO9B 3QO1A 3ROOA 3ZSTA 4NFBA 1G7QB 1G0XA 5C07B 1MHEA 2DQUH 4F15C 1MFEH 1AC6A 2AEQL 1OSPH 4K7PY 3NABL 4R6UA 1C8PA 3N1FC 4HZAA 5F93C 4XP1H 3ZLQC 4MNGB 5ITBL 4GG8A 1NFIB 3BE1L 3U1SH 5E99H 5IIEA 3UAJD 5KS9E 2XZAL 7FABL 3QEUB 2EECA 5SWZD 5DEZA 5ANME 1G7QA 5B38G 4AENB 1Z9OA 1FGNL 2BVQA 4LHUB 5HHOE 2YWZA 3P0GB 4WWKC 3OL2A 2HT3C 3HMXH 4Q9BA 3X12A 4JHBA 5F9WB 4UB0H 5DC0A 2GITA 5GXBB 1A0QH 3B9DA 3D25B 5F44A 3HZMA 4HXBH 4KVNH 4L4TD 4Y4KC 2IALB 4ZXBA 1U6AL 3QCTH 3QB7C 5AZEH 1R5VB 5CZVL 4E0RB 1QQDB 4AENA 1I8IB 1X7QA 3VFMB 3R8QA 1ZGLB 4UDUB 4GBXB 2H32B 1S78C 1OAXH 2OR8A 3HZVB 4L3EE 3EYOA 1KULA 1KB9J 3ALXA 5JW5B 2BVYA 3LRGA 3SOBH 1X5LA 3BO8A 4I3RL 4Z0BH 1JMZA 3UP1A 4NZRH 2DYPB 5IFJA 2IAMD 1Q38A 4XI5D 2EDQA 4XNMA 1R3HA 5DT1L 1FZOB 3EJYC 5J13C 5EU6A 2KQNA 2AXJA 2C4FT 1DUZB 5B39A 3GJFK 5DK3A 4EUPG 5C0BA 1NUGA 3PDGA 2ZJSL 3V52H 4Y16D 4DGYL 5FA3B 4BSJA 2DYPA 2VWEC 1P2CA 4HFWA 2MCPH 2JJWA 5EOQH 4QWWC 4EN3D 3VGEA 2Y4SA 4OZIE 4Y7MA 1U3HB 5EBLB 3PL6A 5J9PA 3HI5L 1A4KA 1BX2B 1OWRM 3NFSL 4U6HB 1DUZA 1FFPA 4N1HB 1CD1A 1CD9B 1ORQB 1Q72H 5IF0A 5MEOB 2AVGA 1BJ8A 4FQCH 4YFEA 4F58H 5HHPA 1UM6H 4JFDD 4UQ2B 3B8SA 3BD5A 4HS3B 4WHYH 1KJVB 2D9CA 1EJ6A 1BBDL 5J4MA 4XPHH 1AO7E 5MEQB 3X3GH 2IG2L 5KTEL 4Y89A 2F53A 5ID1B 2HRPL 4KKLD 3P4MA 3VXMB 1JGUL 1R3KB 1WBZB 1MFAL 1U3HA 5F7MC 1FAKT 2QSTA 3MZGB 1XFPA 4K3EL 4NUGH 5I17B 2Q7YB 1WFUA 3O41B 3K4ZA 3KYKL 2OTUA 1ORQA 2EKSB 3T0DA 1TCRA 2PTTA 4MAUH 1FAIH 3M07A 4U6XA 4NHCL 4RX4D 5EU5B 4OTXH 4P9MH 1J1PL 1QSEB 4HPOL 1KJVA 3TWCL 3LD8C 1JPFB 4WGWB 5MEQA 4WHTA 4I48A 4U6YB 4Y1AD 5ID1A 4PGDB 3STBA 3VXMA 2OZ4A 2ICCA 5FYLH 4U1KB 1KENH 2GI7A 3NZ8A 5I17A 3ZKMD 2UY6A 4QHUA 4ZYKB 3P9LB 5E8EB 4ONHB 3VA2C 2BXYA 3P40A 4OZHE 1FNEA 4NN5B 4UV4H 1JZ2A 4JM2C 2GCYB 1DN0B 3BPCB 3OXRB 2GIYA 1WWWX 3PHOB 3I2CH 1JPFA 2AXFA 3GK8H 4U6YA 4PGDA 5D8JL 1ROWA 3BEWA 3TZVB 3IU4H 3S96A 2IPTH 4NJ9H 1V5JA 2V5YA 4UILL 1FLRH 1JP5A 3VRLF 1A6AB 1YZZA 4PV9A 5E8EA 5EUOF 3SE4C 3RZCC 4MDJB 4PJ8C 5EA0L 2DM2A 5DSCA 5JW4N 1MELA 2PYEA 4J7RA 2BY2A 4Y4HD 3EDDA 4X8JB 5FHAL 5FCSH 3VXSD 1DANU 2OZ4H 1JZ5A 4KV5F 1C7TA 1FVEA 2X9XA 4N5ED 1MRFH 2HLAB 2A9NH 2QLVB 4HULB 1H8SA 5MENA 4L3AA 4UOJA 5F9DC 3TVMB 2ZG2A 1A6AA 4L3CA 5E7FA 1S9WA 4MDJA 3C5ZA 4GW1B 1Q0XH 3OAUL 3W39B 3P11H 4BQCA 3MLWL 4IRZH 3GI8L 1JGLL 1IL1B 3HAEA 2CGRL 4RGOL 1M7IB 3IJYB 4FABL 4HUXA 1ETZA 1YQ2A 1Q0YL 4NGHL 4X4XA 1YN6A 3CFIC 5E2VH 2EDHA 1H3UA 2HLAA 1MPAH 3MOQA 3RWGA 2C3WA 4X98B 4S2SB 2E7HA 2AGJH 3ZKQD 5FGCE 4IOIB 4EJ1C 3MRLB 5GRZA 1A14H 2FBJH 3SDYH 4R4ND 3V0AC 2VLRE 3UC0H 3GSNB 5JW4M 5IJKC 2O26U 3SCMD 1SM3H 5JHDA 2I9TB 3LH2H 5GRWA 2X89D 3U7WL 5JA9A 1M7IA 1TITA 3IJYA 3MR9B 3TO4C 3N85L 3T1WA 2NXZD 1G6VK 4LGRB 3SY0A 4POZC 4JAMB 4BSVB 2F54E 2J3SA 2VDNH 5JPMB 2YMXL 3QRFM 3PWVB 4X98A 4OB5L 4S2SA 1AR2A 2C1OB 1U3ZA 1EX0A 3FB5B 3H0TA 3MFGB 1KTKE 4O58H 4DKAA 1TJGH 4OGXL 4M7KH 5I0DA 3GHEH 2RCSH 4D9QD 4AT6B 5IKCB 3MR9A 3CSPA 4GRLD 3SJVB 3G6JB 1SQ2N 5IGXL 4GKSB 3T0VA 3KXFE 5EUKB 3QZWA 3TJEL 3PDOA 4MAYB 4BSVA 3MQIA 3PWVA 1U91B 5A40E 4C56A 4YHKL 3EZJB 1X6LA 3WO4B 3QJHB 5F7UA 1WBYB 2X09A 4Y2DA 1I3VA 2D03L 4ELMB 4YDLB 4HLZH 3G6JA 3SJVA 4GOSA 4CDGC 2R2EB 5A43C 5FOJA 1RURH 1HWGB 3O3BB 5EUKA 4GSDL 3ZHDA 4MAYA 5GQBA 1W0VB 1D6VH 3GSNH 1QLFA 3WHE0 4U2YA 4PRAA 1MCBA 3CCHB 4A6YA 3MNWB 2MHAA 1WBYA 5HHXL 4G8FA 5SWSE 1KYOJ 2WWKO 3RGVC 4XBPA 4ELMA 2RJMA 2WBJD 4OLEA 3EFFB 4PJ7A 2UUDH 2XTLA 2BNRE 3PE9A 1T89A 2C3HA 1WIUA 3O3BA 3QUKB 2JCCF 5ENWA 2NXYC 4U7KA 4IRJD 4YO0B 4JKPL 1HDMB 4P4KC 4H1LB 2AK1L 2VLMD 4EKXA 4W81A 3CCHA 4FXGB 3DSFL 3MNWA 1JGEA 3ROLA 4U1SA 1EMTH 5L6YH 3DBXB 4LVEA 4XHQA 1E27A 3BDYL 4OQTA 5CIPB 2OSLB 3DOSA 3HAEG 1UVQB 3BPNB 1C5CL 5GSRB 4KPHL 4A6YH 3WD5H 1HDMA 4H1LA 5B21A 4QY8B 2J8UB 3V6OE 2NY3B 5GJTH 1T5WB 5I1EL 4LQFL 2OTPA 4Z76B 4X7CC 5FO7B 3DBXA 4H88L 5J1TC 4APQB 5TDNB 3MV8E 1YDPB 1YNLH 4MD5B 3QI9D 4LCCC 5GSRA 2VXTL 4W6XB 3RUGB 3NIFE 1OAYL 4P59H 4QY8A 1UB6B 4EEEA 1KN2H 4NQCD 1C5DA 2RFXB 3FQNB 3V6ZA 5E9DA 1YEJH 1XGPB 3L95B 4OQTH 5BZWB 5FO7A 2O5XH 3JBG7 2Q8AL 5F9JB 2AEPL 4CVZB 4WFGE 2PO6C 1J7VR 4KRNA 4GMTL 4H1LH 4Y16C 4Z7OF 3OF6D 1XF4B 5E00A 3VA6A 4OLUH 4ZO7A 2LABA 3QXTA 1UB6A 3QZWG 1OQXA 2XXCB 4Y5XC 3D39B 4ZDHB 2RFXA 5I71B 3GIVB 3FQNA 1GIGH 2XA3A 4R3SA 3T4YB 5CIPH 1Q1JL 4J1UB 1A7NH 3LKSB 3ALPA 4XP9L 4JM4H 4FQQB 3GSVA 1FFNA 5C92A 3C5SB 4I77H 1QNZL 2BK8A 4AH2A 3QIWC 1CLOL 1JV5A 3MV7E 3D39A 3WUZA 5DMKA 5I1HL 2BRRH 4P2YA 4NBXB 1OARH 5EZIH 3T4YA 1RZGA 2YWYA 4YDKH 1E4XL 2X41A 3RKDD 5D7SH 3BKJL 1IGMH 4FQQA 4PJAB 5HI3D 2P49B 1M7XA 4MJ2A 3V4VL 1Q9KB 4YX2L 3MRHB 1F4YH 3WS3B 4QOKB 2GFBB 2ICEB 5C70A 4XAKD 2RIKA 4YPJA 4QRRE 2AJ3B 3HUJB 1RSFA 3KPSD 4TPRL 5DS8A 3JSSA 1T2JA 1KC5H 5DMGC 3H9HB 2F19H 2FD6H 2OI9B 3KPRB 5FOBA 1BBJB 3ZKXB 3G9AB 1CK0H 1BFSA 4Y5YA 2XRAH 1I9RH 3QUYB 3MRHA 5IW3A 3CVIH 2Y5TB 4DN4L 3WS3A 4QOKA 4K71B 4DZ8A 2ICEA 4YC2B 3TM6A 2R1XB 2YD6A 3HMWH 4E41A 1NLBL 2FGWL 1YY8B 1KIPB 3T2NH 4MDIB 3QUZD 2K1MA 1LE5A 3WUWA 1IFHH 5HYJD 4PRBA 4N1EA 4ZAKD 4OCNC 4OAWA 4NQDB 5JW3L 1VSCA 5TE7L 1B0GB 2VZSA 1XR9B 3QUYA 3ZDYE 2Y5TA 2CDEA 5EUOB 2R1XA 4U1GB 3KNBB 4JRXE 2LVCA 1CGXA 3MRMB 2EO9A 1NGXB 1PG7W 1KIPA 4WUKL 3MROA 5DJYA 2OJZH 1FGVL 3LRHA 4L5FL 2ICES 5D4QA 5FUOH 4IM8A 4NQDA 4GKZB 1K5NB 3MC0A 4G43A 5GSVA 2ICWB 3S8WA 1AQKL 5IFHL 1DDHA 5EUOA 4G8GA 3HPJB 5JUEH 2BDNL 4DKEL 4RMRA 3O3AB 4X80L 5E5MB 5J06A 1NGXA 5EOTB 5KVGH 1PKQB 5CEXA 4ODWB 4X0KB 2AKRB 4LPYA 4XWGL 5IG7A 5E2TL 5IOPA 2EXWC 5IB5A 4HUVB 2B1HL 1MAJA 3B9VA 3NA4A 1MH5B 4MXVF 3O3AA 1I7ZB 5LWYH 4X0KA 5CEZD 2AKRA 2AEQH 5D96B 5I1DA 2I60L 3QUXA 5TDOB 3EAKA 4WFFD 2FJFA 5ITBH 3MREA 4WUUD 4HUVA 2IF7A 5JR1L 1MH5A 5AYUH 3A67L 4LLUB 1DQJB 2Q6WB 2XZAH 7FABH 1FL6B 2H6PB 1UB5B 2YPLD 1FGNH 4PJ9D 4LU5L 5GGTH 3HE6B 3D0LB 2WBWB 3WKML 2ZG3A 3PHSA 2XG5A 4YBHA 1QSFE 4PJ5D 3UJIL 3EGSA 4F9PC 4ZFFA 1ZTXL 4WTZG 3IDJB 4UDTB 1S5IL 4LSVL 1DQJA 1WWAX 1FL6A 2H6PA 4KTEH 5I1KH 5CZVH 3I6GB 3H9SB 1LD9B 2DLHA 4JZNA 4R2GD 1NCDL 5E08H 1B88A 3CZFA 1I1AD 3WUWG 3HE6A 5IHZB 5EOCH 2Z8VC 5KVDL 1MRDH 5AZ2L 1XF2B 2C3VA 1NJ9A 1XEDA 3ZSSA 3OBAA 3CVHL 1BZ9A 1X5KA 4WHDA 4MLIA 1OCWL 2NQCA 4L4VB 3S3JA 1F6FB 4JREB 4JO1L 3V5HB 3X14B 3F7VB 3I6GA 4JQXA 3E6HB 3DX6B 1LD9A 1SMOA 1A3LH 2DM7A 4U2ZA 3FRPG 3KPLB 1MWAB 2L4OA 2JCCB 5DT1H 4PLNC 1LWRA 2DQIL 1FL5A 5IHZA 3VRIA 1XF2A 1ZE3C 3OKOB 2P5ED 3VMPA 3O45A 3C60B 4KRLB 2CIIA 4URTB 25C8L 1FQ9C 2ZJSH 1I75A 3DETC 4PLJC 3QO0A 4X6CF 3V5HA 4M93C 4DGYH 1TVBB 5B8CB 4I9WE 4UU9A 2HVJA 1JJUA 1PLGL 5JOPE 1NLDL 3KPLA 5HI5C 3HI5H 3HNVL 4Z7VB 3NFSH 4FQ1H 3Q5YA 4RMSA 5BOPA 3OKNA 4U0QB 5JXAH 1L7IH 5E6YA 5I1GH 4NN6C 3KJ4B 5B8CA 1MCRA 1GHFH 2IG2H 5KTEH 4OLYH 5KSBF 3DTXA 1FVDB 4AIOA 5HYSB 3BRGC 4YHPA 2H26B 1FVCA 4NNYB 4LASL 3QDMB 4BZYA 4LPWA 1NSNH 2P5WA 3KYKH 5CMAB 3V0WH 2B4CL 2PETA 4NHCH 1GC1C 4L8SA 5ESQA 1GRWA 4OZGF 2OCFD 5ISZE 3VGAB 4HPOH 3UCRA 3TWCH 1ZVYA 1MWAH 2GJ6E 2BMKB 5C0FB 5TE4L 5IBTL 1FVDA 4KKBC 2XQBH 3UTSB 4HIHB 2AXHA 4HGKC 2Z4QB 5DFTA 4FP8L 2A9ML 2BOCA 3F62A 4G5ZH 5CMAA 1KPUB 4EBQL 5EH1A 3JWDL 4EDXA 2Z8WC 1DLHB 4OCXL 2BVOB 3BSZH 5FUZL 1ZXQA 3UTSA 4WI3A 5KOMC 3VE0B 4P2RA 4XB8A 1N26A 1G7HB 2Z4QA 3SGDH 5KS9F 4UILH 3EJJX 3RPIB 2VR9A 5DJ8B 3HNSL 3QFDA 1PZ5A 4Y19E 1CICC 1N6QH 3S88L 2P7TA 5FHAH 4FQXC 1DLHA 4P2QA 3ULSA 2BVOA 2E7BA 3QXVA 4LSPL 4CNIB 3O3DB 4PB0L 5DJXA 4G8IB 3V8OA 1GOGA 5IJVB 5JIIA 3VE0A 1ZGLP 2BXZA 3QXAA 3QDJE 5DJ8A 3NCYS 3JUYA 4J4PC 4ZODA 2VAAB 3MLWH 3QQ3A 1FO0L 2I9LB 1JGLH 5IVZB 4Z5RB 3LB6D 3RDTA 1M7DB 3BKCH 1S7VA 5HVHB 5JDSA 1BD2A 1BIHA 1KIUA 4NCC2 2VNCA 2PW1B 4CNIA 3O3DA 4WJ5A 4G8IA 4YBLB 2C4XA 1FSKC 3IVKB 4PIRF 1Z9MA 3S9DB 2CR3A 3P0YL 1PY9A 2KQMA 3RY5A 3BVNB 1T1WA 3DO7B 5IVZA 2NMSA 3OAYH 5CEYB 2Q7NA 5F3BB 4GAGH 5DYOB 4H20H 1E4JA 4HWZB 1BJ1J 1CLZL 3QCVH 3GM8A 3U9UA 5EU6D 3MRRB 2CDGA 5F6HI 3FB8A 2ZUQB 3C08L 5C0BD 5CUSH 3MRQA 3KPMB 1ZLSH 1ZV5A 2YBRB 1XF5A 2QQLL 5IMLB 3BVNA 1ZT4B 4OZIF 4LEOA 1NBQA 2DYPD 1DSFL 5FYJU 1NAKL 1KLFA 4P4RA 4CMMA 4QXUH 1ZT7A 4V2BA 5I75C 4HUKB 5IGXH 2HG5A 5F3BA 3TJEH 2FO1A 3PGCB 2IJ0C 2HRLA 4JE4B 2X4RA 4LCWB 4YHKH 5FYLD 4MSWA 2V7HB 5BXFB 4XCFH 2YBRA 1L9NA 1CICA 4AZ8A 5DVOA 2D03H 3CU7A 1P84J 5M95B 2F53D 4QO1A 3VFPB 1U3HD 1EXUB 3PGCA 4NQEE 1EO8H 3VFSA 5CBEA 2O5YH 2Z92B 2V7HA 2AABL 4UMGA 1IT9L 3U4BH 5BXFA 4M48H 4PRHA 2B39A 5HHXH 2UWEE 3WYRA 5LGKA 3CFEB 2F58L 4KQ3L 2AAVA 4HK3N 2P8LB 3KYAA 3VXMD 3GSRB 3VFPA 2PXYC 2ZOKA 4Z18A 3VFOB 1B9ZA 4ETQB 1EXUA 4OZHF 2J2ZA 3MA9H 3UZVB 4HV8A 3V6FA 4KHXL 5F21B 1HCVA 2Z92A 3DRQB 4OIAA 3SDDB 3D85B 3EO9L 3B9KA 3BGAA 1HHGB 5TF1L 5DZLA 4DGIH 1J88A 5JORA 3BDYH 4J3UA 1SJVA 5F6HJ 4AG4H 2P42B 4U6VL 3GSRA 1ZLWH 4YAQA 3DXAB 3VFOA 1C5CH 1MQKH 1PFCA 5TF0A 4M1GL 3WIIL 4ETQA 1GZQB 1E28A 3BD3A 1ZT1B 5IB3B 3C8KB 5JXED 5C0CA 4BKLB 1CDUA 3D85A 2DRUA 2PYED 2VN4A 3UZQA 5DEFA 1I3GH 2EDEA 1I7TA 1YEKL 2CK0L 3G5YB 4OI7A 4D9LL 4F7TB 4PJGE 3QFJA 5HGAA 3CLEL 4Y4FA 5LQBL 5IB3A 2YKLH 3S6CA 2VXUH 3IKKA 2VDKL 3CUPA 4TNVF 4MCZB 2Q8AH 3UBXI 5TE6H 1NCUA 4LHQB 4EI5C 3VG0H 3ARFC 3LMJL 1NGZB 5HGBA 3GMNB 4I2XA 2BP3A 2VDOH 3TT1L 2P8PB 3TVMD 3TP4A 3CH1A 3TBVB 1NL0H 2CRMA 3P0VH 1E4WH 5KSAC 4MJ6B 1MI5B 3RVWD 3L3HB 5HHVL 5EULV 4X6CB 4XAWL 2X70A 2MFNA 3H7BB 3QXUA 1N5YL 2YD3A 5D1QA 3I6LE 2BY3A 4XXDB 3GMNA 3JV4B 2P8PA 3GBNL 1CLOH 3CPLB 2Q8BL 5DHYB 5I1HH 5E2WL 3RI5K 1CE6B 1IEAB 3C6LC 1T0NB 1MI5A 3D69B 4FMKA 3OKEB 4X6CA 3KYNA 3T4AA 1A6UL 1UZ6E 4LLYB 5HD8D 5C6PB 5F72S 4PUBL 5KSBB 2D0GA 4KRPC 2VDQL 4PRPE 3VXUB 3MUZ1 2AJVH 4G9FE 4HUNB 3MRCA 4OFYA 4PRNB 2QQKH 4YX2H 3V2AR 1FFRA 2GEEA 2JJVA 4GAYB 4QHMA 1H3GA 4R0LC 5DHYA 2PR4H 1CE6A 5CSBA 1IEAA 3DO3A 4Y2DD 2XFXB 4WO4B 5T1LB 4OZGB 5HVGB 4PGJA 3EOAA 3SJVD 4M5ZL 4NZUL 5KSBA 5IM7A 1KV3A 4MAYD 3VXUA 3T77A 4DGVL 4L8DA 3QQ9C 3FT4B 3IXTB 4BZ1H 4DN4H 2ADGB 3L6FB 2VISA 4NO3B 2XFXA 4WO4A 4N8VB 1NCAH 1RZIB 2FGWH 4OZGA 1JI1A 5B3JE 3Q0HA 4I0PB 2NY0C 3AUVA 2AQ1A 2V9TA 3OPZH 1NEZA 5A2IH 5TE7H 1SEBA 3DNKA 4GAJH 3FT4A 4Y5VA 3GRWL 4CU8A 2VITA 3BMVA 4MB5A 3VFUB 4TOYH 3EYFB 2Y06H 4N8VA 5GZNC 5J6HA 4WUKH 5EORL 5KN5A 1A4JB 3FAWA 1ZLVH 4PTTA 4IRSC 4L5FH 3WNMA 4HBQA 2COQA 3RNQB 1BMGA 5KS9A 4O5LH 4KJWD 5F9WC 2QV2A 1LO0H 2BDNH 5ANMA 1FBIH 2APTA 2O5ZL 3FQTA 3QULB 2EXYC 4X80H 5HHOA 4AK1A 4DUVA 3PWJA 2QJDA 1A4JA 3MRBB 3NIFF 4LMQI 3S7GA 3JZ7A 1IAOA 1ADQH 1N2RB 3V5KA 4XWGH 5DQJB 5E2TH 2W65B 3CGTA 4GBXC 3SKOB 1REIA 1FH5H 3EJZC 4LSDA 1MRCL 2W9EL 1XF1A 1OT1A 2B1HH 1VERA 3OB0K 3SKUD 3QULA 5CBAA 3FT3B 4APQD 3CVHB 1A7RL 2R0WL 5GGRA 2EIEA 4ZUVA 1TMCB 3MRBA 3F8UB 3MRPA 3IAPA 4FNLL 4L3EA 4OF8A 1ES0B 3DV6B 5DQJA 2I60H 4UTAH 5HJ3B 4HG4K 4FS0A 4ZS6D 1TZGL 2OXHA 1B6DA 2R4SL 4AIZB 3CVHA 3UPRB 4HQQH 4O02H 5DK0A 3HRZA 3PQYB 4LU5H 4KHTL 3MLZL 2VZOA 1AQDB 5ESAA 4DEPB 3KDMB 3WKMH 3D39D 1R3JB 3UJIH 3S4SA 3AS2A 4UNUA 4PLKC 5EU4B 1HINL 1K8DA 2WAHA 4JHAL 3D3VE 1AO7B 1S5IH 1CE1H 4LSVH 5IFAL 5BVJA 1YJDL 4OZIA 2EDDA 4YE4H 3RWIB 4IRSA 3BQUB 4S1QH 1DZBA 1AQDA 5I6XB 5KVDH 4WTXA 4G6FD 4P5KA 5AZ2H 3T3ME 2EEBA 2HTKD 4OV5A 5E0QA 4F8TA 4XTRD 3CVHH 1RQ5A 2BOBA 1AO7A 5IMOA 4MYWB 3D0VA 4HMCA 1F00I 2G2RB 3GMOB 1OCWH 4XPAH 3R06A 3CXDH 4H0HB 3P77A 3RHWK 4R8WH 3BQUA 3UJTL 5DI8B 3OG4B 5J12B 4KTDL 4JDVB 3VH8A 4ONGL 2WANA 2CIKA 5HTSA 2N7AA 2FLBT 4QOKD 1DBAL 25C8H 5JDJA 5KSUA 3QPQD 1WUNT 3NFPB 1FCCA 4JANB 5JXEC 3PWPE 4K23L 4PBWD 5DC9B 4EQ3A 1GGYA 4X4YB 4NN5C 3QJFB 5DD3H 3BPOB 3BYYA 2NY2B 3KPRD 3V4UH 4YBQD 3ZDYF 1PLGH 4XNUH 5DI8A 2B2XL 1R3LB 3F12A 3OKMB 3QUYD 5AWNL 4GS7B 4JFFE 4O51B 4OZHA 3TZVC 2EIZA 3EFDH 3U4EB 1H3PL 2DWEB 1C12B 1MFCH 4JANA 4MA3A 1JUFB 3G5XA 4QGYA 3S5LG 4QYOB 4Z7WE 3QJFA 5TFSH 4MD4A 1KCKA 5I30L 2FHFA 4UINL 3VXRE 3EDJA 4XVUD 4EQ2A 4NQDD 4N8PA 4G6MH 4LSUL 5GRVK 4JFEE 2IQ9L 3RKPA 1ZEAL 3WS6A 2DQHL 3NGBB 12E8L 2B4CH 3TN0B 1UXSB 4CKVX 4L1DA 4PJCE 5TE4H 4LPXA 1F5WA 2IBGA 3RVWC 4E42A 4FG6D 5FGCB 1WZ1H 4Z78B 4RIRA 1UXWA 2VLRB 1YNKL 4GMSL 4NOFA 2IFFL 5C3LD 3KPQB 2A9MH 3E3QE 2EDKA 2GK0B 4FP8H 5DMIL 5MP6L 3GSQA 4EBQH 3JWDH 3NA9L 5HYIA 4ZS7L 5IK3B 2V7NB 1CDHA 1NGYA 2BY0A 1F90L 1I1RA 2YD7A 3BX7C 3QXDB 1FO0A 1CQKA 1YEDB 3DHMA 3LN5B 1CL7L 4YDVA 2VLRA 1RUAH 5HD8C 1QLEH 4LHUG 3KPQA 4WI8A 1XCTA 2GK0A 1BQHA 3HNSH 3DROB 1NC2A 2V7NA 3LEXA 1T03L 2E8ZA 3TFKD 3QXDA 2F54A 5I15L 2H2SC 2X10A 1S9VB 2R0KH 2BHYA 4PB0H 3LN5A 5EC1B 2NR6C 4RFOL 1Y0LB 2SEBB 1UCTA 1WTLA 2R1WA 3DI2B 2XIDA 5EC2A 4YEFA 2RGSA 1FO0H 3KXFA 1D3CA 4WCYH 4OGYL 1HCFX 4IDJL 3FQUA 2XWBB 5IHLB 5EC1A 1IAKB 3HE6D 4RA0C 4YDLC 4WI6A 1FORL 1Y0LA 3KYOA 3C6SB 3S97C 3U30B 3SEPA 5C0DA 2ZCHL 1DQMH 5FXCH 3QDHA 1O7VA 5GZOC 1TQBB 2BNRB 2JJSC 5LXGL 3UX9B 1RUKL 1A9EB 2AXGB 1FJ1A 3H9SD 1EEZA 1HEZA 4NRZA 3MRNB 1U2CA 1U92A 3V8CA 1CLZH 2ADJA 3T09A 2WINB 1XGQA 4HJJH 2LAGB 1YEHH 5SWSA 4PTUB 3D48R 1O0VA 1R5WA 2QQLH 3GMMB 3MV9E 3C8DA 3TA3B 4PJBE 2BNRA 4L4VD 3I3EA 1B4JL 1A9EA 1QBLL 1NAKH 1JYWA 1WBXB 3QNYB 3QEGL 3MRNA 1TJHH 2EYTB 3IU3B 3VWKB 3G6AB 3U7YL 3BPNC 4YZFE 3IAQA 4XGZA 1ZS8B 3HFMH 2NY3C 5J6GB 1M4KA 4ZFOL 4U1LA 3ARVA 1NBVH 5H35A 3BJ91 4R97B 2HKHH 1WBXA 5DLMH 3QNYA 5GS0H 3DV4A 3FN9A 3RTQA 3V6OA 3DYPA 4APQC 4PJXE 3D2UB 3G6AA 1EFXA 5ITFA 4S1RL 5EO0B 1BQUA 3NCYP 4GKNA 3K8MA 3EHBC 2ARJB 1ZS8A 3LEYL 1IT9H 4LLMB 2GQHA 5DTFB 3RVTD 1EAPB 4YWGL 3IT8D 4P5MA 3MV8A 5GRVL 4NM8L 5DFWH 4MVBD 3KJ6H 2AV7A 2VB5A 3O8XB 1P7HL 5EIIB 3D2UA 3QDMD 1M71B 2GAZA 2EYSA 3QRGL 4ODTH 1WAAE 4C55A 2XWTB 4LLMA 5ADOL 3WEXA 1EAPA 4N1CA 4WU5A 3P30L 4F7PA 4TNWF 4Z77B 32C2B 2WSKA 1MCWM 3L3DA 3VW3L 4H0IA 2WBKA 3NZHL 4U6VH 3UTSD 3KPOB 1KFAL 3MV7B 1HK6A 5GGQL 5EIIA 4M1GH 3FQRB 3L3KA 4P2RD 4ORGB 4YHYB 1M71A 3HZYA 2DLGA 1F11B 4NJAH 4Q58C 2XWTA 3RY4A 5CINL 1TTUA 2X5PA 4JO3L 2ADFL 4WFHD 1GXEA 5F96L 4D0BA 2HTKC 4KJQD 3WNNA 4I3GA 3VXNA 3G5ZA 1KB5B 4P2QD 1B90A 3UTPD 2P24A 4OFVA 4HWEL 1CXHA 3NACL 4WV1C 3MA7A 3KPOA 4BK4A 4D9LH 1D5ZB 3AU1A 3WHXA 3MV7A 4NT6A 5I19L 1RIUH 5LQBH 5I74C 4KFZC 5I1AB 1OM3H 3E6FB 1EZVX 3T1FA 1FDLL 1U8MA 5J57B 1U8JA 3PP4L 1ZKAA 4QXTA 1LO5A 1U8NA 1BFOA 3HCVA 3RDTD 2J8HA 3IAGC 3SDXE 3O6LH 3QNXA 1BD2D 3LMJH 5GGVH 4BQBA 1D5ZA 1KLUA 3QWQB 5CJOL 1K6QL 2AJUL 4M00A 3MXVL 5I16A 2OI9C 5I1AA 1A7PH 2HT4C 3NFNB 4QRRA 3LQAC 3FTGB 1GCFA 4NHUB 1EBPA 3L3OB 1YYLL 2AK4E 5T1KA 5IVNA 5HHVH 4LLDA 4K71C 4YC2C 3KPPB 1QFPA 4O2FB 4XAWH 2HKFL 3DGGA 1BIIB 2Y6SC 3MCLL 1GJIA 5IWLC 1JNJA 2OR7A 2PCPA 3ZHKA 3BUTA 2Z9TA 1U8KB 3M1BA 1I7RA 3SN6N 1CI5A 3FHQA 4JRXB 3U4AA 3LPWA 5C2BL 1DEDA 1MNUH 3QCUL 1ZHKA 1MCHA 1KCUL 3WLBB 3REVA 1HKFA 3FT2A 2VXQH 1XIWA 1A6UH 3OAZK 5D2NE 4Q9CA 1A6ZB 2R69L 1QG3A 2VLLB 5ADPL 2VDQH 3IRZA 2R8SH 4KK9C 5BJTB 2ESVB 3LHPL 4JRXA 5HYEA 3SDAB 4G42A 2FX7H 1MCLA 2E5EA 2EE9A 1A5FL 1R5IA 2GT9A 3GRWA 4X83A 1NPUA 1ZHNA 2DQDL 3TPKA 3WLBA 5IR1B 4WV1A 2CXGA 4M5ZH 4LLQB 5ALBL 1U3YA 1U41A 4YJZL 3FMGL 2VLLA 2Q76B 3TLRA 5KBNC 4YXHL 1UGNA 2UWEF 2XWJA 3GMLB 5BJTA 1KCLA 5GS1C 1MFBL 2J4WH 4PRHD 2YPKB 3SDAA 2KH2B 3VFRB 3K2UH 5KW9L 4LVNB 3H3PL 2D7PA 2KZWA 4QEGA 3CC5A 4HBCL 5IR1A 1MY5A 4HF5L 5TDPB 1BPVA 1PEZA 3PWLB 3FQXB 3ZTJH 3CU1A 4DVRL 2Q76A 1CGYA 3E2HC 3ULUC 4IS6B 1UACL 5IHUL 1S8DA 2IBZX 1B4RA 3GMLA 5IMKA 1NFDB 3O0RL 3DRTB 5D96C 5E8NA 4KQ4H 3T0WA 3GRWH 2K7PA 3DHJA 2YPKA 2X1PA 1INQA 1NUFA 3CFDA 2FECI 1J87A 1QHPA 4OCSH 4TVPL 5C0AE 1XCQB 5EORH 4X4ME 3PWLA 1FZMA 3JTTB 3EDKA 1DQDL 2VLKE 5I73B 4IS6A 1EGJH 4UI2A 2OL3B 1D5MB 5BMFL 3D85D 3WJJA 3ULVE 3BUYA 3BEVA 4L8BB 4NCDA 1J8HB 1ZLUH 4PJGF 3FO2B 4RGNC 4JFOB 5D1ZA 4XWOD 2JB5L 4NWTL 1MLCA 1LEIB 5JHLH 3O6KL 6CGTA 3QR2A 1U58A 2Y36H 5DJCB 2PW2B 1QSFA 3QFJD 4V1DE 1T6VN 1WF5A 1GGUA 4YDIH 2A74A 3QPXH 2XNAA 4OD3L 3U82B 1OAZL 1MRCH 5SX5K 1NDMB 3HG1B 4HKJB 4L8BA 4P3DA 5HI4D 4JFOA 5T5NG 2R0WH 2V6HA 4RRPG 5DJCA 5D9SB 1T1YA 2PW2A 4JREC 4FNLH 1NC4B 1RU9H 3LZFH 3NTCH 5DRNB 4TULH 5K93A 4M43H 5E94B 3JVGA 3B4NA 5FYJH 3ARUA 1UCBH 3C60C 1MVFA 3B43A 3DARA 2R4SH 2OL3H 1VKXA 3RVUD 3AY4A 4KKCC 5D9SA 2WIMA 1NC4A 5GIRB 3MLZH 5GGVY 5MI0B 3CLFH 1IE5A 3TBTB 4K9EL 2D7TH 3MRFB 3T0AA 2ATPB 4ZTPH 5IBLC 4KGLA 2X4TA 1I8LC 4LKXA 2HH0H 5E94A 5C09B 4MA1B 4OGAD 3QQNA 1MI5D 5IFAH 1UZ6F 1EVUA 1YJDH 3AFLA 3LOWA 4OUUB 3TC9A 1RPQA 1Y6MR 3KJ4C 5K9KB 2A2QT 5EB9A 2R0LL 2XKNA 3MUGB 3W81A 3T0EE 4J2XA 4IOFD 1KB9K 4K8RL 5ISZB 4HS6A 4NP4L 1YMME 4XCEB 5F7EL 1SY6L 3MBEB 3WIFA 2GJ6B 4QRPE 4X9GA 3LQMA 4OZFG 1EEUA 4ONFL 2HP4A 3TPUA 5DZOA 1VHPA 1J05A 1Y18B 3VXUD 4QXGL 3UJTH 3IXAA 2B8OT 1AH1A 2CRYA 1UA6L 4ONGH 4WY7L 4HMDA 1Z0MA 5F7LB 5ISZA 3BP5A 2JB6A 1DBAH 5B3JF 1XGYL 5EZOL 2GJ6A 4NDMB 5DA0B 4AM0A 4WO4D 5T1LD 3T0XA 4K23H 1FNAA 1WCBB 4CAGA 3MRDB 2VDRH 4DKFH 1FZKB 1DVFB 2JJTC 1G7JA 1M6OA 2OQJA 3MLSL 2GKIA 1HI6B 3U0PA 3KS0H 5D2LE 1FC1A 2VDPL 4IJ3C 5AWNH 3MZTA 4KJPD 4KUCF 4Y19B 4XNQA 3WXVL 5DEGA 5EO1A 3IDGB 3L5WB 1AP2B 4OLXL 4S1SH 1XGUB 3GHBL 1MJUH 2DI7A 3LV3B 3MRDA 4I0PD 2NY4C 4M7LT 2NLJA 4N9GB 4PG2A 1AY1L 3LSOA 4LSUH 1MIEL 4Y19A 2IQ9H 1MCWW 1ZEAH 2HTLC 1LDPL 1KTDB 3L5WA 4KRMB 2DQHH 1A22B 2YD4A 2MOVA 4MQTB 4LPTA 5HHOD 4HAGA 1NAML 4KTYA 3OGCB 5D1XB 1OGAE 3VWJA 2W0PA 3LCYA 4OM0L 1CFVH 3K4DA 1YN7A 4M8VA 4OFKA 3K1DA 4N9GA 1X6NA 5HVHC 3QDJA 4GMSH 2ADIB 1VADA 4U1HB 5CJQL 3HLAB 4YBLC 4MA7L 3GSOB 1KTDA 1GAFL 2YRPA 3CMOH 4FHBD 1C1EL 4RNRB 5LBSH 1IZKA 5EZJB 1WZLA 3HE7A 5FGSA 3MLPA 1FFQA 1MHHA 1M1SA 5GS3A 3MLTB 1AIFB 1T0MA 4QKXB 3VGBA 1CL7H 5D7JA 2OK0H 5KVEL 3OZ9H 1YNTB 3RP1A 4YHZL 1Q9LB 3GSOA 4F7CA 4FFWC 3DX7B 3NH7L 4L9LC 1CFQA 1T04A 5FYKE 3LPGA 4RCAA 3QIBB 2XA8H 4ENED 5I15H 3BAEL 4GQPH 1MIMH 4ELKB 4RAUB 2BNQE 1HOCB 1MCOH 2BHZA 1BWMA 2I07B 1J10A 4ZPVB 5I8CB 3GO1L 5I2IB 5FO8B 4F57H 1UH3A 4OUUA 4OIIH 2DKSA 1JGDA 2NNAB 4NRXB 5DUMH 3TO2B 2W9DL 3VD4A 1U9KA 2RR3A 3T3MF 4CU7A 3PQYD 4NQEB 1Z9SA 4ELKA 3SO3C 4RAUA 4PJHB 5H2BB 4F33B 5FDWB 4OCLC 2IQAA 2RHEA 5CSGA 4XVJL 2ZCHH 1AO7D 4NWUL 4F37K 4XMPL 2HJLB 4MQXC 43CAB 2X4QB 2ZP0T 5LXGH 5C8JB 3TO2A 2NY6C 1AHWC 5HGHB 2DLFL 3TNNB 1N3NB 4I4WB 3BQUD 4ZFOA 5BOZG 4NQEA 3VJ6B 1BVLA 4A2LA 3TF7C 4X6EA 4I18A 3Q3GB 2UWEA 1K3IA 5ICZA 1QO3B 3ARGC 3KPNB 4P9HC 4LCUB 3CFKA 3AREA 1S7TA 5BV7C 2HJLA 1TZHA 4J3OC 3SDDC 43CAA 2EH7H 2GUOB 1I9JL 2KZ1B 1S7RB 1QBLH 4W6WB 2X4OA 3K4AA 1MLBB 5C9JA 2A6JA 5D7LE 5F1NA 4XX1G 3GMPB 3UTQA 3U7YH 4E9LA 5JOEA 2EO1A 4YDJA 1QO3A 3UTTA 1QA9B 5HYSG 4Z7WF 3KPNA 4RFEB 4LCUA 1G7LB 2IPUK 1A2YA 1T80A 2XACC 3NCBB 2K3TA 5F1KC 4FZEL 2ZKHH 1EZVY 2NY2D 1MLBA 4HJGA 2UYLA 2F8XC 1JHLH 5HVFB 4Y88A 1HXYB 2VWEE 4S1RH 5CILH 1J18A 4XNXH 3BIKA 2NX5E 4RFEA 1G7LA 3IJSB 4PJCF 4YWGH 3EYVA 1KYOK 4S0TD 4KK5C 3F58H 4LSTL 4PJGA 3SO5A 5MENE 1VB9A 1UWXH 1A9BB 1U8HB 1K2DA 2NY5L 5HGGS 1I4FA 1HXYA 3MRJB 4HT1L 1N64H 3QRGH 4RA3A 3BRDA 1G9NL 4Q6IB 5HDBE 4IIQB 5EIQA 1HHHB 4P23A 2HJFB 4HUWB 5ADOH 2I25N 3IJSA 1QHOA 2HN7B 4J3XA 3P30H 4HIJA 3OXSB 2Z31C 1OL0A 1AHWA 1MUJA 3WFBH 3VW3H 2XXMB 1SMAA 3RJDA 3ZT7A 1D5BA 1KFAH 4TVSa 1AGCA 5GGQH 5MERA 5JHDE 2VLRD 3DX9A 3QUMB 1ZLUK 4Q6IA 4IIQA 1N0XL 1AGBA 1HHHA 1J12A 4HUWA 5CINH 4JO3H 4Q0XL 2HN7A 1T1XA 5IB1A 4P5TB 2X4NB 4JFYB 4W6YB 2F54D 4P2OA 4PRPB 1N7MH 5E8PB 4HWEH 1JRHI 1ZSDB 4NKDB 4YHOL 5CLWA 5I19H 4P57B 5ALCL 4HLJA 4ZNEE 1AD0B 5IEKA 5L8JB 2R56H 2ICWI 4X6DE 2BSTB 4Z9KB 1FDLH 4LNRA 4UZGA 1FV1A 3OQ3B 4LF3A 2XT1B 3KXFD 4P5TA 4JFYA 4RGMB 1KCVL 2R0ZL 4G9FA 5E8PA 2CD0A 3ES6A 2X1XR 4RFNB 1INDL 2ORBH 3CSYA 5IROC 2Y07L 1K6QH 2AJUH 4N90D 1BFTA 1UM5H 5GRXG 4P57A 3ZYJA 1SJXA 1AD0A 4FFVC 1JTOA 3Q1SL 3MFFA 2BSTA 4LK4A 3U36A 2I24N 3DLQR 3L3JA 3EO0B 3VU2A 1MF2L 4NQTA 4JKMA 1S3KL 3MJ6A 1ZA6B 4K2UL 2IBZY 3VDAA 4LLWB 3LIZH 3QUMH 4Y8AA 5INCA 2UZIL 1AGFB 3MMEB 4JPVH 4I0PC 2K7QA 5MEPB 5GS0D 1RZKL 4YHML 3AMLA 1JBJA 1U8OA 3IDIA 5EBMB 4ODXB 1KEML 4PJBF 2AI0H 2FX8H 3VFVA 3BFOA 4N68A 5FYKU 1HSAB 3EO0A 3X11B 2KDGA 3SDCB 1BJ1H 3WFEL 2Y7QB 4EVNB 3QCUH 5D7IB 2BNRD 1UKTA 1I8MB 4S0SD 2ZCLH 4LLWA 4YIQA 4K3DL 2MQ0A 3G08A 2LU3A 4JY5H 1AGFA 1S7WB 2Z91B 4M03A 5CAYB 4YZFF 5FUCC 4B7LA 1CXLA 2M2DA 3FONA 5ADPH 4ODXA 3BZ4B 4AL8L 2KBGA 3STZB 3O2WH 5IVXA 1LILA 3SDCA 4EVNA 1N59B 4NQSB 35C8L 4PJXF 1LK2B 3ZL4L 2ICWJ 5DJZA 4JQVC 3RTQD 5HXMA 2Z91A 3L7FA 3VWKD 3BD4A 4CVXB 1IEHA 4C57C 1DLFH 4YXHH 4L8CB 2CKNA 3DIFB 2LFGA 2PTVA 1MFBH 3RVXD 4P46A 5GS2H 3SKNB 4H26B 3TH4T 3MV8D 5KW9H 1C08A 1NGWA 4P49A 3G04A 3MJ7B 4ZSOE 1OLZA 4RZCB 2E9JA 4OFDA 5DF0A 5E5UB 2OBGA 1A1MB 1WAAF 3D2UD 3WV0A 2H9GB 4CVUA 3KG5A 3A6BH 5IHUH 5DJAB 1RIVL 3DIFA 3IRPX 3LKNA 3OHXA 5ACZA 1RZJL 3UDWA 4F80A 1J0IA 3SKNA 1G7PA 4C4KO 5TPWL 8CGTA 1KIQA 3OKLB 1XGTB 4JZJB 4QRUA 1Z0NA 1TPXC 2IADB 3SE3C 1A21A 3DUSB 1DBKH 1DQDH 1KBGL 4X5WA 1BVKA 3D3VB 4DEPC 5HDLA 3G6DH 3SGDI 1A7OH 4MXQC 5E4EB 3THMH 3RIAF 1Q9OB 4E5XB 3DX8A 1UC6A 1TVDA 3I75B 5ILTH 2JB5H 4FQHA 2UVEA 3O6KH 1JN6B 5F71A 3MV7D 2IADA 3DUSA 4POUB 4XXCA 4BH8B 4IMLA 1TTFA 4KI5C 1UQSA 4M61B 3SDXF 3WJLA 4OJFL 5AUMA 3JWOC 4AEHH 3NIGE 5FK9B 3D5OF 3JWNC 4BSWA 3STLA 3FO9B 4LGPB 3RPKA 3UXFA 4LGSB 4HGWB 2M26A 1JN6A 1NMBH 5I1IH 2QR0A 2FO4B 3BWAA 4FA8A 5F1IB 4BH8A 3KR3H 4CMHB 5HYQB 4AYFA 1DFBH 5JNYB 5J12C 4QRRD 1AGDB 3CFBA 2FWOB 4M61A 2R4RL 3S34H 4QT5B 3QEHA 2FHBA 1EEYB 4M62H 1TDQA 3MNVA 1V3JA 4NZDA 4HGWA 2FO4A 3C2AL 4HKBB 3OKYA 4JFFB 4JCMA 5F1IA 5CJ8A 3BPOC 5HYQA 3FHAA 4K9EH 4LSSL 1WIPA 5JNYA 1HILB 3PWPA 1IEBB 4UIKL 4GS7C 4QT5A 3TIEA 3WIHA 4KXZH 3BPLC 4Z7WB 3U0TB 1KACB 3HC3H 4OKVA 4FTVE 1KTRL 4NPYB 1MEXL 4MZ2A 4KZEH 1FNHA 5IW6B 3LN9A 3T2PA 4XPFH 3IETB 4Y4HB 4JFFA 1W72L 4LCYB 4FQPA 4UV7H 1HILA 1OT2A 4JRXD 4EDWH 1QLRB 2H2PD 4K8RH 2ED8A 1JWSB 5IW1A 1IEBA 1JNNH 5CWSA 3U0TA 2UZYB 1RJCA 4ONFH 4PJCB 2I5YL 3VXRA 2D31B 4NQUA 5IW6A 3TN0C 4TUJB 4FRWA 3WSQL 2VC2H 2CLZA 4G8GE 4JFEA 4AY0A 4LCYA 3D87B 3QH3B 2NTFA 4HZLB 2F74B 2H8PA 3BZEB 3WIHH 2D3VA 1UA6H 4WY7H 1G7MB 3SDAD 1GOFA 1PG7L 5F1OB 2VAJA 3MSPA 1CZ8L 2A38A 1XGYH 4QRQA 5GRUL 4PJCA 3EOBA 3ZKSD 1CLYH 5CP3A 5CGTA 4FZ8H 3EOTL 1NAMA 3SCMB 2DQTH 1VFBB 2O93L 4LFHG 4TRPL 3MLSH 2X4PA 2GTZA 1CXFA 3DJ9A 2VDPH 3QH3A 2F74A 2NXZB 4WW2F 3BZEA 2APWA 3QYCA 1X3DA 2M1KA 4N0CC