3ARGC

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
204
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSAGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 31
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC02
1KELL 3EHBD 2R2HA 4JY5H 4D0DA 1XZ0A 4JO2L 2ZUXA 3ALXA 3HMWH 4QRPA 4EI5D 1NUFA 4QLRA 1EAPB 3G6AA 3S4SA 3VMOA 4WUUA 4PJFB 3QHFH 1A1OB 5CSBA 4G9DB 1K3IA 1FRGL 2ZCLL 2PNDA 5JO5B 3KJ4B 5JPMA 2AXHA 5CJ5A 1ETZB 5FHBL 1F6AA 1ZT7B 2EECA 3LS4L 1G6RB 1NMCC 3MJ9L 1MCWW 2VLJD 1VGEH 1U41A 5E8PA 5CP3A 5JW5A 3TV3L 3BQUC 1NGWB 3DHMA 5EN2B 3BZFA 4WEMB 4X6DE 4GG6A 5JQ6H 4WCYL 4U6HB 5CJOL 1P53A 2XYCA 2VZSA 2FEEL 1IFHL 3UTZA 3I2CH 5F3BB 2UZYB 3IDIB 5DD6A 1HQ4B 1D5XA 2MOVA 5J12C 4LRIC 2L0DA 1JTTA 3MRDA 2HWZL 4TVSa 2WZPD 4M9PA 1CZ8L 3FZUC 3RZCA 2V2WA 3FTGB 4JFEA 5H35B 5C09B 4R96B 2BNRD 4M6AA 3F58L 4GLRH 4EOWL 3MGOB 5FK9B 5DD3H 1D3CA 5LGHH 3BWAA 3MJ8A 5HD8D 1KN4L 5JW4Q 3HN3A 3HE7C 1ZGLM 3CZFB 2YWZA 3BKMH 4HFUH 4ZS6D 3EYSH 2GAZA 1FHGA 1R24B 4H8WC 3Q6GH 1TPXB 1U8IB 5I1HH 1D5IH 3U46A 5HYJB 3CSYB 3I6KB 5JW4M 5L8KB 1ERNA 2DICA 3L3JA 4AEHH 4ZUVA 3QR2A 4KKBD 4OTXL 3MV8A 5ECJE 3U2SA 1S7TB 4IRZH 4L8CB 4X98B 4XT1C 4ZPVB 3NIFF 1G9MH 5DVMA 2MPAH 2LFGA 3CLFL 1L6ZA 1QZ1A 1AGFB 3MYJB 1S5IL 4YR6A 4WTZG 4RWHA 3OGOE 5J9PB 4OLXL 1CU4L 4FFYL 1S8DA 5DJ8B 5B8CA 4Y4FD 2BNRB 2FNBA 1JFQL 3RA7H 3T4YB 3X14A 3IDJB 3KPRD 2AGJH 3KYMA 3JWOH 5C0BA 3K4DA 5B22A 4JHAH 2MHAA 4JM2F 3H9SE 4NUJB 1TETL 2WLYA 4MA7L 3TA3A 3MRCB 3GGWA 5TQ0L 1T7WA 2FECL 1MCOH 4X5XB 2DQDH 3PWJB 5E8NB 1XGYH 3QQ4A 1JGDA 5LCVL 4JRXB 4QOKB 3OPZL 4L4VE 5CEYB 3ME0A 4LCWE 2VLKD 3CDGA 1S9XA 4OF6A 1W8NA 4BK4A 3QXDB 1BBDH 4OKVB 3BGAA 3AY4C 5D2LA 1UZ6F 3BH8A 1NCDL 2BOCA 4LSQL 4AT6A 5EBMB 3HA0A 5I16B 2Q7NA 3X17A 2VXVL 4M1GH 1CDCA 5C0AD 5IG7A 3RDTD 3OKNA 5GGUB 3X3GH 1XGUB 4IIQB 1PAMA 4RMRA 1JHLH 1WZKA 3U1SH 3I6GB 4N8VA 3T4AB 1T1YB 2IH3A 2PYEA 3ARGD 3SDYH 4K8RH 5CEZL 2GJJA 1RU9L 4O58H 3KPRB 1LEIB 5FOBA 5JNYA 4QRTA 3CFJA 1R3HA 5F21B 3ULVH 3WV0A 5BVPH 5J57B 4U3HA 1JPGA 4AQOA 1LD9B 5J6HA 4XP9H 3FONB 2ZCHL 3CX5J 1ZHNB 5HHPA 1MRFH 2X4RA 5J13B 2IQAA 4F3FA 3LIZH 3P4OB 4BUGA 4H88H 4KV5F 3OHXB 1RZKC 5CJBA 2AJSH 1EJOH 1BBJB 3GMMA 4G7VH 2VDNH 3BUTA 1L9MA 2UVEA 2FGWL 2UZIL 5C0AB 1REIA 2VDQH 4HJGB 4U1HA 5HI3D 3C5JA 5F9OH 3RDTB 4CN1A 2X4NA 5JPNB 5L6YL 1U9KA 3EDEA 1J1OL 4ZNEA 4UT7L 1ZT4B 3ZDYF 3MLTA 1CFQB 1TENA 4P2OC 3KYNA 3ARGB 3BZDA 4YDKL 3DYPA 5CIPA 4RBPK 3SJVE 2HJLB 3IXAA 1ORSA 2JB5L 3AREA 2JB6B 4Q6IB 3O3UN 4JE4B 1INDH 2QBWA 4MX7B 4EN3A 3QRGL 2OR9L 4FG6C 2XTJE 1LHZA 4KDWA 3VXUB 2NXZB 2BDNL 4G8EB 4ODSH 4GSDL 2P7TB 2YK1L 1C08B 5HDBE 1X5AA 1ZLSL 3O45A 4NC1C 5EU3B 1QBML 1LO2L 2H9GA 1GC1H 4IJ3B 5SWQB 3T0DA 1U36A 2BVPA 3HZKA 2V17L 4R7DA 1FAIL 1G7LA 2X4SB 43CAA 1OAXH 1A5FL 5E1AA 4NO2B 1HZHH 4GG6F 1AXSA 2NY2C 3IDUA 1RZGB 4PJXE 5GRXG 3RWHB 4APQC 3SQBA 1IM3B 2XWBB 3MOAL 3IVKB 1FYHB 5IT2H 4OB5L 3MV9A 2NY1C 4S10A 3TBSA 1EO7A 1OHQA 4XCCL 1KLUA 3QEUA 2YPVL 1IC7H 5GGRY 2Y6SC 3CFCH 3GI9H 4GBXA 4N5ED 2VZ1A 4OI8A 1O5DT 3HMXL 3C09B 15C8H 1LK2B 1IAMA 1KGCE 4RSVA 4QNPE 2CIIB 4GAJL 5CEXB 2GCYB 2ICEB 3T2OA 1OP3H 3VDBA 5IESL 3BP5A 1JWSA 4QTHA 4ZTOH 2VL5A 3GMRA 4LK4A 2CJUH 4K3JH 2CUIA 2NY4D 4OLYH 5L9DL 5DO2D 2NXYD 3CVIH 3UTSD 1CDUA 3K8KA 3ZE0E 3MRBA 3T3MF 3B5GA 2AK4B 4JVUA 5CZXC 4PS4H 4YO0A 3H9HA 3S96A 5F93C 2GTZB 3TYGL 3ZT5A 2VLMD 2XZQH 1DN0A 5I6XB 2NR6C 5I71B 2AW2A 4XC1H 3V6BR 5A3ID 4NQXB 5GSVA 4MS8D 3PDDA 1S7SA 4UQ2A 4TQEH 4MB4A 1AJ7L 3SEPA 4O00A 5D5MF 4LSPH 5ERWA 4WW2C 4YGVB 1FLRL 4F33B 3GBNH 5J6GA 3QUKB 1FV1B 2ADIB 4XP4L 3S97C 1AHWB 1RJLB 2J6EL 1I7RA 1OARH 4D8PA 5HGAA 4PJ5A 4S2SB 5GS0C 2QJDA 4MA8L 5IB4B 2W0FA 2F5BH 2YZ8A 1L7IL 3JBG7 4WW1B 4HIXH 4GXUN 1EGJH 4MD5B 4YDLB 35C8L 3O41B 4ONFH 3ARSA 1YUHA 4LKXA 3TN0A 5C0NC 4H26B 4YBLB 3FN3A 3UTSB 5E56A 3E2HC 1ZS8B 3EO0B 3PGDB 4JZOA 3VI3E 1J0IA 4LCUA 4HWBA 3N1PC 4ZOEA 2EIZB 3BJLA 2BOBB 3VG9C 1FNHA 4L8SC 4R4BB 1OT2A 1KTLA 4X6BA 5I8KH 5D2LF 4FQXA 3FOLB 5C0CE 3OX8B 3QBTB 4JVPA 1ZHBB 5D7LE 2XWTA 1OGAD 2H1PL 2QHLA 4MXWL 4YHLH 1SEBB 4PY7B 5DMIH 5KSAA 4JN2A 3V6OC 4W4OA 5C08B 1PKOA 5F88A 2D7QA 2D7TL 1AC0A 2PO6A 3KPPB 5C0RH 4WWKD 5KVDH 1V7MH 1DANU 4Z7UA 5HYEA 3KYKH 4KQ3H 4Q97A 1XIWD 3TCLA 4JFZL 3FT3B 4AIZB 1KTDA 2RIKA 4G43B 3MCG1 3G9AB 2Y5EA 4KAQL 4W6YB 4RDQF 3HI5L 2HLFC 3BIBX 1EDQA 3QIBD 4ZUUA 5FKAB 3V5HB 2OJEB 4R90H 1KCKA 3RVTC 3QO1A 4H8WH 8FABA 3L3GB 1AXTH 5KANG 2BSRA 2VLRE 5T1LA 1A7NL 4NJ9L 5IM7B 3KXFA 1QR4A 1OAUL 5D70L 3UBXI 3GBML 4N9GA 4U6TA 5INCA 4Z0XA 4MJ5A 4CL7A 1XCTA 3RKPA 2RQ8A 3BO8A 4J3XA 5TF1L 4JZNA 3RY6C 3SGKC 1VDGA 3WDJA 4UAOB 4E5XA 1Y0LB 2AJXL 3BDYH 1DQLL 4EDWL 3BPOC 5IFJA 5CUSL 3OAZH 4HIEB 3QDGB 2Y23A 3MA9L 5IGXH 4BA8A 4WWKB 2OL3A 3CPLA 4NBZB 5EZJB 1X7QA 3HUJB 2I60H 5ICXA 1GIGH 3D0LB 4FQJH 4PBVC 2YBRB 4J23A 5A16B 1BFTA 4OQTH 3MACL 5J8OA 2W0KA 4U1JA 5JR1H 2A9NL 3SKMA 3OGCB 2CUHA 4OZIA 4M7KH 3OKLB 1NMCB 3TWCL 4UTBH 4U7SA 4XGZB 5FYJE 3L3DA 5DXWA 1MF2H 4RAUB 1OAZH 2NQCA 4A2LA 1HIMH 4KKAD 5M94B 1CI5A 4YHZH 3BQUB 1F58H 1W72L 3O6FC 5DWUH 3K81A 3HKFA 1F3JB 5JLZB 4BZ2L 3QFJD 3GBLA 5H8DA 5EC2B 4LCCA 2P5EB 5DJCA 3OXRB 1X5ZA 1G0XA 1BOGB 3C6LA 5C07A 2FB4L 3JWNC 3MCKB 2J4WL 3SKNB 3P77B 1WCQA 4Y8AA 4P4KC 4ZD3H 5HVWA 4ZUSA 1A7RL 3H9ZA 4B5EA 3TO2A 4J6RL 3FQXA 3FOMA 3TBWB 3F7YA 1FG9C 1F13A 3W0WD 1F45A 4JDZB 4PRDB 3WEXA 4RFOL 3ZKQD 1RSFA 3LD8C 4RZCA 5AD0B 3RVVC 1YYLH 4OGZA 4X9GA 1L7TH 4P23D 3QJHB 3TNNB 5T3ZD 5EU6A 4HWZB 1S5HA 1LVEA 3WFEL 4FFZH 3IFPA 1CICD 2EZ0C 2P8MA 3LRSA 3BP6A 1U8HB 5IMMA 4H5SB 4XPGH 4NM8L 4C58B 2A73A 5HPMB 1KIPA 3MO1B 4WI4A 5I1KL 3S8WA 4PJ8B 3RGVC 1ZE3C 4D94A 5BO1H 3T2NL 3FMGH 4FQIL 4HUUB 3V0VA 3AROA 4ONGL 3PQYD 4UDUA 4JKPL 5C0IB 5GRUH 3QFJB 1M7IB 1L0QA 4F7EB 5C0DA 4HGKC 2AV7B 3Q2CA 3KPSE 2BY0A 5FYLE 4P46D 5GJSH 2OTPA 1O7SA 4Y5YB 2DL2A 5GIRA 3NABL 4Z18A 1MSPA 5DA0B 3IFNL 3BYTA 4XNXL 1MREL 4BQ6A 4M1DH 4XMLH 1MVUB 1UZ8B 2RCSL 1ZA3B 4ODBD 3DVIA 3TCXA 4P9HL 4GJTB 2MMXA 3E6HB 4PUBH 4A2MA 1BQHB 4D0CA 3S37H 1NPUA 3NIFE 1GZPB 5I1IL 2BVEA 5FO7B 1G9NL 2B1AL 1U8QB 3UTPE 1D9KC 2CH8A 3DVFA 2A9MH 4NWUH 4I77L 3OR7A 3RNKB 5AZ2H 4KROC 3GSOB 3D39B 2FBJL 3REWB 1Z3GH 1Q9WB 4V2CB 25C8H 5DJDA 2ED7A 4JFDB 4XX1E 3NN8B 4XP5L 4QF1A 5BVJB 1ZTXH 4S1DC 4FNLL 2DQEH 5JHDB 1JZ4A 3O3EA 3C9NB 1SMOA 1DQDH 2VR9A 4OT1L 4TSAL 2X41A 1NGPL 3HS0A 3EYFA 3WIHA 4Z95H 5IK3A 3C8HA 1B0RA 3IU4L 4F7TB 3KPOA 1YNLL 4PYHA 4HCRH 3VW3H 3U7YH 1ZSDA 5HJ3B 4KUZH 5GGVY 1QLRB 4KTDH 2WBKA 4ZTPL 4PJ9A 5TPWL 2J1KA 3MJ6A 1P1ZA 3ES6A 3G9VA 4JQVC 2GK0B 4NHCH 2WBJC 1MQ8A 5HGHB 3EHBC 4L9LB 4P2RE 2XWJB 4LGSB 3QJFA 1IMHC 3BWUC 4YUEL 1G84A 4Z7UF 3UTTB 4EI5C 1FGVH 2J12B 4PRIE 3S7GA 2FL5B 1PY4A 5JIKA 1HILA 3GJFA 4U0QB 1AD0B 4MNQE 4R4FH 4X4YB 3BD4A 1TXKA 3DMMC 1IQWH 1MJ8H 3MRIB 1T7YA 5TH2A 2FX7L 2P49B 1LO0L 1VB9A 2ARJB 2ICWB 3TPUB 4M5YH 3QEQD 3JTSA 4XPAL 5ACZB 3AS1A 4P2CG 3CX5K 1MHHA 2HT3C 1JN6A 3MUY1 1OCWL 3MXVL 3GFUA 4X7CC 3DARA 3ARZA 1UWEH 1TMCB 4RIRB 2ZSWB 3CK0L 2HKHL 1HH9A 5B38B 1UM4L 3FFCE 2A6IA 4J3WA 1G6RL 3VH8B 3ARDD 2F53A 5IB1A 5A43C 3CFBB 4D0BA 4Z78B 5F7EH 2J5LC 3T3PF 3VWKA 5KSBA 3NAAH 4LSVL 4P57A 4HWEL 5A2LH 5JW4N 2FJGA 2V9RA 2P46B 5DK0A 1FPTH 3HC4H 1A6TB 4NBYB 5LGKA 3PHSA 5IJVB 3ZDYE 5I73C 2G60H 2R1XB 4YBQC 1AKJD 1EIBA 3QRFM 4OZIF 3CH1B 4H25A 5C6TL 4LNRA 2KUTA 1A7OL 4QRQB 1FN4A 4PJBB 1QQDB 4QRPE 4F15C 2OBGA 5ENWB 3PWJA 4M4RA 1DCLA 5L7XL 2PW2B 3LQAC 4WUUE 1IAKA 1QO3B 1E4WL 1K8DA 3TT1H 4GQ9L 4I0PD 1XAUA 1I7ZB 2XA8H 1T04B 3TIEB 4EUPG 4N5UA 9CGTA 5DYOA 5GGRB 4ERSH 3GIVA 5CHNA 2CDGB 3TBYB 1N5AB 1KYOJ 3EDDA 5D96B 3QDJD 3HZYA 3LQMA 2B1HL 1J8HD 4WHYG 4PGCA 4POYA 1NC4D 2ESVD 2J8UB 4OD1H 3DX8B 4PJDB 1ADQH 3Q48A 4GG6E 4IOSD 5E5MB 4L1DA 3WFHA 2W0LA 3MV11 3MODH 4KI1A 3EOYG 5JMOC 1BFSA 5IHZB 2VN4A 2D2OA 4UBDD 1HQRA 1SJEB 4RMSA 2BVTA 2WUCH 3ECBB 1YEDB 3L7EB 3VWJD 5I2IA 3SE4C 1FZMB 3T1FA 1WEJH 2R0WH 5HYFA 3HMWL 4L3CB 1F11B 2A6JA 2W65A 4LGPB 4JFEE 3M17A 4HQQH 3BEWB 3P4MB 3QHFL 4NN6B 2FIRT 2LVCA 4LCYB 5DRNB 3V79C 1Z2KA 4X6FB 4XI5D 4HT1H 4OFYA 4ONHB 4RGNC 4ZMAT 3UPRA 2YD2A 3MRNB 2AK1L 1DFBL 2O61B 3GUTA 4XNMA 5I1LA 5D1ZA 3U7WH 3MLPA 4CMHC 5HHME 4OZ4A 2DTSA 4BFEA 2ESVB 5CZVH 4WW2B 3K46A 3MLXL 4P99A 1KPUA 4ODXB 3WKML 2IADA 5GISH 1SJVA 1MIMH 4HUXA 3DLQR 4B7IA 4ZXBA 3MV8E 1A47A 1RUML 4ZFZB 3HZMB 3ILPB 2I24N 1NDMA 2X9XA 5TDPB 1HNFA 2DM3A 1XF4A 2OSLA 2R4RH 3BW9A 5IR1B 4E0RB 1TZGL 1JF6A 5I1JL 4QHNB 2YA0A 1UYWH 2DQIL 5FUCE 4HPYH 1VHPA 4OLWH 5KJRL 2EC9U 4M1CC 2YSSA 4XPFL 4AZ8A 1EPFA 1MRDL 3B6SB 3CDYA 5HBBA 2VXSH 5C0BE 2EO1A 2MQ0A 2YPLD 4LF3A 1JNHB 2HT4C 2IAND 3O3BA 5CJXA 2W60A 1VEOA 1YMMA 1OTTC 4ZOAA 5B21A 2AEQH 3PABB 1RMFL 4M4PA 1VACA 1NLBL 4MSWA 4HFUL 1QBBA 1I4FB 1XGQB 2VLLA 2D31B 1IZJA 1GGYA 5HHVH 3VH8G 5I1HL 3WHXB 2FIKB 5JUEL 5MENA 3OR6A 5DZNA 2AQ2A 4KZDH 3FB8B 1JVKA 4XXCA 3RPIB 2APFA 1F4XH 4XWGH 4X4XA 5D2LE 5JOPD 4PJAB 1UA6H 4IRZL 1G9ML 2XY1A 2ZCKL 5TDOB 1BD2B 3VJ6B 2WSKA 2H2PD 1A2YB 3MV7B 1VFAA 3SDCC 3AMLA 4JM4L 4HKBB 3O2WH 2WUBL 4YXKH 3MFFA 3MC0A 2GKIA 3B9KD 2QV2A 2PYEE 3HR5B 4FXKB 4KK5D 4L8DB 5GRVL 4F2MA 2XZZA 3SKUD 3JWOL 5D1XD 1T1XB 5BJTA 1FFPB 4U1KA 2F8VA 4JHAL 4F7MB 5IMLB 4XTRC 2Q87A 1TFHA 4L3AA 2E8ZA 2WP3O 1MCOL 3BP7A 3RGHA 2DQDL 2P47B 3BSZL 2BVYA 1XGYL 5SWZA 3QZWG 1M6OA 3L3HB 5DHVA 1V3KA 2BNQB 2IALA 1AP2B 1CLZL 1QFWM 3G08A 3VD9A 2YA1A 4LIQE 3HAEG 1F2XK 1YEKH 3GMNB 5I74B 3BPOB 3CCHB 4JFFD 5KSBF 4KFZC 4PBWD 4XAKE 3P0VH 3AS3A 1XF5B 2OTWB 1S7RA 3SQOH 43C9A 3JV0A 4DN3H 3L3KA 2KH2B 2E7CA 5I1EH 1F8TH 4UUJB 4FXGA 4M00A 1N4XH 3WDHA 4Z7OF 5FDWA 3WN5B 3X3GL 3BXNB 4ZNEE 2Z92A 1JHLL 3B9KB 1U91B 4LNVA 4KU1A 3SDYL 5F7HA 3N1QC 2A74A 5D1XB 4HKZB 4HZLA 4Y4HA 4HC1L 3QUYD 5KS9A 3EO9L 3QUMH 1T4KA 4XP9L 5GGVH 3WDIA 4TPRH 1WT5C 5IVZB 4FTVB 3ILQD 3RJDA 1MRFL 2VH5L 3ZTNH 2XNAA 5C0JA 4J12A 3CUPB 2KDGA 2V7NB 4MS8C 1EJOL 1U8JB 4Q58C 2GJZB 4G7VL 1QSEA 3B8SA 3QUZA 3H7BB 4Y2OA 2VDNL 4J3OC 4UNUA 3LHPL 4DW2H 1MCNA 4FZEL 5ADPH 2W9LA 3V6FB 1IEBB 3V5DB 3QI9A 5F9OL 1AGDA 4JDVA 3LDBB 4E41D 3OG4B 1KNOB 3WD5L 5TE7H 2A6KA 2MQ3A 3O4LA 3LV3B 3I6LD 3MV9E 3QDAA 4YHIB 3MJ9A 1IKNA 4X9FA 5HYSA 5FECB 2BP3A 3AVEA 2R2BA 4TSCH 1INDL 1MFCH 5BS0B 3RGVB 5FA3B 1FNEA 4PFEA 4S1QH 4HLJA 4OCLC 1MELA 2HFFB 4NJAH 4NO3B 1UJ3C 4ODSL 1FZKB 4X99A 5F1IA 1EEYA 1FG2A 3DUUA 5GZOC 1CT8A 3DTXB 1MRCL 4JO4H 1L0YA 2E9BA 2ZUTA 3OMZA 4OAWB 2NTSP 1U8OB 4MQXD 5EZLA 2DIAA 1AO7B 1IGIL 1CF8H 2BFVH 3P9LB 1UM6H 3MXWH 4XAWL 4BSWB 4HK0B 1BIIA 4HEPG 4X7FC 1KCRL 2EXYC 3MLRH 1OAXL 2BXYA 3IS0X 3P4LA 5C8JB 3QCVH 4P5MA 3HG1A 4FFVD 5I15H 2NW3A 2EDJA 3BKJH 4PTUB 3MOQA 2QHRH 4Z9KB 5F96H 2YD7A 1QFHA 4G8GD 3VGAB 5HY9A 1W0YT 3T2PA 4U1IA 5E4EB 4CDHA 4NRYA 2OTUB 3RX7A 3NCYP 3FQRA 3CFCL 1XIWC 3QUMB 1UKTA 4GKSA 2DQCL 4P9ML 3RIFK 4JRYD 1WIPA 3VFUB 3LQAH 3BIKB 2PYFA 4PYGA 3OF6D 2YRZA 3L3IB 2X4QB 4DEPB 5T5FL 2BY2A 1CIDA 1I1RA 1U2CA 1UT9A 4FP8H 2DQJH 4O51B 1EV2E 4UT6L 4N0YL 5E8OB 3W11C 4TNWK 4C55A 2CXKA 5FM8A 4FABH 4PRPB 4PP1D 1JGEA 5KVEL 1PQZA 2B8OT 5B3NA 4WJ5A 4LRIA 4AM0A 3P4NA 4JZJB 4XC1L 3WFCL 4MWFB 3UO1L 4C57C 5EFIA 4TQEL 1PLGH 4G8GB 2FJHB 4HIJB 1NSNL 3HC0B 4D3CH 3WMSA 1CD1B 4XBGB 1DBJH 1FH5L 4LSPL 4OIIL 5JXED 4MJID 3QWOA 3OKOA 3SOBH 5DMKB 3GBNL 5AYUH 4DVBB 3HCVB 2FR4A 2HT2D 3WLWC 1NEZG 5BZWB 3D9AL 4Z7NE 3AAZB 2PTVA 1K5NB 2QQLH 3HE7A 4PGZA 4L5FH 1ZT1B 1RK1A 5DJZA 5CLTA 1IT9H 2VDRH 4Q2ZA 1UKSA 3MREA 4Z7UE 4HIXL 4D9RD 1EGJL 1NMAL 1PEWA 1IL1A 1SYVA 2Z31A 4KKAC 4ONFL 4PIRF 5EU7E 3QNYB 4XZUB 3QUXD 3Q5YA 1U8KA 3MLVL 5BZDB 1CWVA 4WENB 1KCUH 5ITBH 4DKEH 5E9DD 4JG0H 4KMLB 3AB0C 3TZVA 2VZOA 1V7NH 1R3LA 3FT2B 5EO0B 3KXFE 1HSBA 1EZVX 5EIQA 5CD3B 5HHQB 1V3JA 4QTIL 1JHKH 3UJTH 1CD9B 3C8KA 4KJPD 4MCZB 4WO4D 4YHLL 3T3PE 1HI6A 2WANA 3LN5B 4P5TD 2FO4A 4P23C 1BFOB 1HINH 3WCYA 3IAQA 1CICC 1MHEA 3OJDA 5L88L 5TQ2H 3WHE0 5KS9F 4XPHH 4O2CA 3KYKL 2VXTH 1XF2A 4CVUA 4QWWD 5DMJB 1R3KA 1QA9A 3MGTB 5DC0A 2YD4A 3MNZA 1KB9K 4OZIE 1EHLL 4QGTA 2JIXA 1YEFH 3AY4A 2YPKA 5HYQB 5J3HD 2OZ4H 3PDOA 3VXPA 5DD0L 2R39A 1F4WH 4XVSH 3VFNB 4J3TA 4X7SH 5K59F 1D6VL 4JFXB 5D7KE 4Q0XL 1FNGA 4HXAL 1KYOK 3DGCR 1KEML 2AXJA 2XQYK 3GSRB 4HS6B 3MUZ1 1E4XL 3IF1B 5IFHL 1MJUL 4N8PA 4IRJC 3ZT7A 2NW2A 1YEIH 3WUWB 1S9YA 2BRRL 3BDYL 1P7KB 4JY4B 1A0QH 3L95B 1JCKA 3MR9A 3TT3H 4W70A 3F7RA 1ZA6A 5DHYA 1IGTA 1OM3H 1H15A 1X6LA 4W4NA 2BZDA 1RZFH 1OTSC 3QXAB 2Y9RT 5T3ZL 2VZVA 5L2KA 5EU6E 32C2A 5ALCL 2F8XC 3LKQA 4PLNC 4OCMC 5F1NB 4PJ7B 5JW3H 4NPYA 5CBAA 5IW6A 1MFEH 1E27B 1YEHL 3VXRA 2X4TA 1T03L 1OAZL 5F9WC 1HIML 2APBA 5DR5H 3D18A 5H37G 2FSEB 2CLZA 3MJ7B 1NFDA 5CMAA 1CLCA 2UUDK 4QXGH 3U4BH 1BJMA 4KKCC 1SYSA 2IMMA 4P2OA 1JGUH 3E8UH 4RFNC 4M6MH 1OVZA 2C4FU 4MMZC 5IB2A 1PYWA 3O9WB 3CNKA 4DCQA 4ZFFA 4PY8J 2IAMD 2M1KA 1Q38A 3PL6B 1C7TA 2NMSA 5EIVA 2W38A 3QDMD 3ZLQC 3LQZB 1OSZA 4MQ7B 3F12B 1ZGLB 4JHWH 1RIUH 4YHPB 5SWSA 1I9RH 3G6JB 3DIFA 1ZANL 1UWGL 5I17B 3IKCB 1NCCH 5IFAH 4TVPE 1U3HA 3U0TB 1OQXA 3WS3B 1N0LA 4PR5B 4XPGL 2CDFB 3VE0B 3UTQA 4GS7B 4UIMA 3Q1SL 3D3VA 2DLHA 5BO1L 1Q9OA 1NBYB 3CC5B 3FMGL 4APQA 1JI1A 2XN9B 4G9FA 4LCIL 4HCRA 4LKCB 1NANH 1FBIH 3QG6A 2H8PB 5HVHC 2BNUA 1YDPB 1VADA 2OXGA 3ARDC 2ERJB 3FRPA 1A3QA 2O5YH 5IB3B 5GJSL 2IAMB 2ZOLB 5E6IC 3ARUA 5BOZG 1I8KA 2WIIB 5F89B 2X44D 3MUGA 3PJSB 5KVMC 3KPQA 2I5YL 3HE6D 3LKSB 5MP6L 4M1DL 2HA1A 3PNWA 4MD4B 1TVDA 2DWEA 4R97B 3EOTH 1H0DB 3QNZB 3UAJD 4LMQI 5HDLA 1VGKB 4HH8A 4M6NL 4DGIL 4PUBL 4RMVA 3DSFH 2Q1EA 4WVRA 3C5SB 3FQTB 5E8EB 5GZND 5BQ7A 1YEJH 2A9ML 4QHMB 1KTRL 3HI6H 1HEZA 4F58H 5AZ2L 4B0MM 2BERA 2D7MA 3KPLB 3U0PB 1VKXA 2KZ1B 3UP1A 3EDKA 1LO5B 1JF1A 1HWHB 2Y06L 2C1PB 4UMGA 4XNQB 1TTGA 1MHCB 3MRFA 2PTTB 3L5XH 5L8LB 1HDMA 3DXAE 1T2QL 2EYTB 4ZFGH 1DQDL 3EW3B 1BWWA 1ZHLA 2AJUH 5KSUB 1PZUB 4Z95L 1AQDA 1EHXA 1NDGA 3JV4B 4GXVH 3F6LA 4GW1A 3B3IB 3Q5OA 3U0WH 3VW3L 4XCNB 4B41A 3RTQC 1P7QA 4KUZL 4Z8FL 4KTDL 2F53E 3HRPA 2CR3A 3S5LB 3WHE1 4X6DB 1LEGA 3BUYA 5DD1H 1WC7B 4MA3A 1QG3A 4GUPB 1WV7T 3SPVA 5DT1H 1X5GA 1RUQH 3VWJC 3TO4A 2RFXA 4BQCA 2EH8H 1MJJA 1M05B 3T65A 3GSVB 3CU7A 4I2XA 4RRPA 4Z7OE 4NCC1 5I8EB 4BKLB 2V2XA 2NNAB 5EU4A 4BFIB 2HN7A 4KI5E 2OQJB 5ITFB 4LU5H 2B4CH 1HHIA 1FO0A 3MSPA 4XI5C 4L8SA 1FIEA 2A38A 1IQWL 2GJ6D 1G7PA 2E7LC 3CLEL 5FUZH 4HS3B 5BMFH 3X11B 2D7OA 4AEEA 3AS2A 4K9EC 4ZPTB 1YN6B 2DM7A 3GMLB 1H3PL 3H9SD 3X3FL 4YHNB 3GB7B 1UWEL 2OM5A 2UVFA 4PGBB 3SDAD 1J12A 3QT2A 1TTUA 3LS5L 1TZHA 1XGPA 1PSKH 4PJHA 3T8XA 4Y5VC 5CP7B 5JXAL 3MBED 3CFKA 5GGTA 3V6OA 2HVKB 2ZOKA 4R3SB 2FZ3A 3GSUA 2C1OA 5J89A 1IAIL 3B5HA 3MUHL 3N50A 3SKJH 5ISZD 3WIIL 5F1OB 3A6CL 5FKPB 4AG4H 1UJ3B 3T0XA 2ZNXA 5BV7C 2HJFB 5C6PB 5IW3A 1FPTL 4JHBA 3TBVA 2EEBA 4XPBH 1HHKB 3FO2B 4DGVH 4NQCA 2Y4SA 3I75B 1MNUL 2VKWA 3TIDA 3RWGB 4F7PB 3O3DB 4QO1A 1ORQA 1HHGB 2R0LL 4CNIA 3ZKND 3H9SB 4WHCA 2PN5A 4KH2A 5F7DA 3RY6A 3SDAB 3SGKA 1MEXL 1I3RB 1OGTB 5DJXA 4ERSL 3PWPD 3MRKB 1MCLA 3INUH 4YDJB 1NCBH 5IVXA 4Y1AD 5HGBB 4WFEE 3VFSB 3BDBA 4WUKL 4L4VB 3W39B 3EYOB 1RJYB 4LCWB 5I1DA 3MLSH 4AENA 3ZKMD 4X7TA 2X09A 4HH9B 3X13A 1OB1B 2VAAB 4ZO9A 1ADQL 5ISZB 2IPKA 4X8XA 5EBLB 4GRWF 3T0WA 3EOBB 4OF7A 4HLZG 5EIIB 2FX9H 1I1AA 3MODL 2DLTA 2VXQL 2X6MA 1FORH 4KRPD 5I18H 1IAOA 4MVBD 5FM5O 3MRGA 3ARBA 3WE6A 4OM1H 2WUCL 5I0DA 1FVCA 4KK5C 4XCFH 1U92B 2DDQH 5GS3A 3W9DA 1NCWL 4LEXL 2OLDA 2R0WL 3O6FA 4XVUD 1ZVYA 4HQQL 4Q9BA 4NQVA 3IT8D 4O4YL 5ID0B 2XTJD 1KB5B 4GLRI 4QHUA 4M48L 4HT1L 5JDSA 4MA1B 4E42B 4F8TA 2JJWA 3EZJB 3GRWL 3VFWA 4P4KA 4IRSD 1Q94A 1N7MH 3ESUF 2VR4A 1MHPH 1N2RA 3DV6A 1YMME 1AGEB 4YEEA 3RU8H 4GAYA 4MAUL 4G8IA 4QGYA 4QYOA 4OCYH 4Y2DD 1NCTA 3ULUD 3LOWA 4U1SB 4I5BB 4HAGA 4WTZA 5IEKB 2GW5A 2W9EL 2Q86B 1A14H 3OKKB 1AY1H 4PRNB 3S5LG 5MENE 4XH2A 2OCFD 4DQOH 2EH7H 4CVXB 2CKBA 5LWYL 1TCRB 3HRZA 4QXUH 3QQ9D 1OF2A 3TF7C 2P5WD 4KY1H 1LDPH 4N0UA 5ESQB 2BVOA 4F9LC 2X89A 1RAMA 3SJVB 3QUYC 1IGYB 4HPYL 4AEFA 1Y6KR 1CXEA 4K71C 3IDNB 1KC5H 1IC4H 3T0VA 2XTJB 1RZ8A 4CU6A 3RVWC 1U8OA 1QOKA 2V7HB 5SV3A 3RWEA 3VD5A 1SY6A 1J1PH 5D7JD 3GSNB 3ARFD 1G7HB 1N6QH 3O11B 4LVOB 2B0SH 2N7AA 4MNHA 4UT9L 2AEQL 1AE6L 5EOQH 2C3HA 1H3VA 4R8WL 4JQIL 3B4NA 5JW4R 2CRZA 5L0QB 4N1EA 3DBXB 4ZO6A 1J87A 1UM5L 3VXMA 1KT2B 3RJQB 1G7MB 3GK8L 3FO9B 2EDEA 4GRLD 3ET9F 1D9KA 5T3XH 1EEZB 5DHXB 1F4XL 1UVQB 4PJXB 2GY5A 3QFDA 1P5VA 1BECA 4M61B 3K2UH 1I1FA 1UC6A 5EA0H 4KK8C 3T0BA 5ETUB 4YPGB 1JTOA 1DN2A 4UNTA 4N90E 4PGDA 2H32H 4YXKL 2DLEA 1MH5B 3V4PH 3DECA 3EJZD 2GI7A 3ARYA 5D8JH 5KW9H 5J1TC 5HHOD 2YEZB 3FN9A 2A1WL 1GAFH 2DQHH 4QT5B 5D7JB 5KS9E 3ARFB 4I18C 3STZB 1YY9D 4Q74A 3HLAB 3RZCC 1G7JB 1JI2A 3QPQD 4IRJB 2WBJA 1I9JH 4JQXA 1S9KC 5HHNA 3T09A 4FFVC 2Q6WA 1FDLH 4PJAF 4XWOC 1GGTA 3ULSB 2ZSVB 1FIGH 3RWCB 1D5ZB 1VCAA 1QSEE 4EI5A 1LNUA 3SQOL 5K9JH 2EIEA 2HVJA 4ODWB 3S37X 4KK6D 5LVEA 3LZFH 1N4XL 3DMMA 1MLBB 3E1F1 4WNQB 3V6ZA 5D7LD 2VE6B 2ADJB 4RNRB 3KDMA 1UB6B 3O4LE 2HLAA 3LEXA 5ID1B 5EOCH 1K4DB 3JTTA 2VLJA 3W2DH 2OYPA 1VSCA 1JV5B 2FX8H 1RUPL 1VFBA 5E2WL 4HKJA 1I7UB 1FZOA 1QVOB 2OP4L 3OKEA 4IS6A 3GSXA 5GGVL 5EPMA 2BMKA 2V2TA 3PHQB 1MUJB 1QBAA 4L29A 3D2UB 3UZVB 3ZTNL 3WSQH 1T22B 5FUCC 5IVXF 5DF0A 5B8CC 4IOIA 1X4XA 1KG0B 3UBXB 4DK6A 2R0KH 3OXSB 1MWAH 2Y36H 3IDXL 1SBSH 3ZO0A 4LLMA 3EYQC 4RGOL 5FA4B 5JDJA 1SBBA 5AEAA 5DRXA 2DBLH 4OCXL 4DW2L 5JXEC 2XFXB 5BOPA 2OMNA 5ADPL 3HG1E 5BXFB 1BIHA 3M1BA 5C0CB 5D7LB 1U8LB 2H32B 1T20A 2RJMA 4OLUL 4YHYB 3KPMB 1SHMA 4XP6H 3D25A 2XZCH 4HGWB 2E6QA 4HJ0C 1KN2L 4LSRL 2VABA 5CKGA 1K2DB 1OSPL 4OCSL 2H26A 5DRZB 2VQUA 5IIEA 3ZKXC 1FGNH 1EMTL 1CD8A 5KAQG 3V8OA 1CE6A 1KJVB 5I0ZA 1JGLH 3KLSA 4YE4L 5CGYC 1WCBA 4U7MA 1JHTA 4U6VL 3FB7B 4K9EH 3REVA 4ODHH 5I66B 4C59B 2VAJA 4WHTB 5IMOB 2YRLA 4OV5A 3HNSH 4BH7B 4BQ9A 4Z7WA 5GGQL 4WFFD 4OD2A 3W5MA 2PXYC 1EFXB 4LASH 4CADB 4U6XA 1JL8A 3FFDA 1CF8L 1EA9C 1BQLL 2B2XH 5FYJD 3MJGX 1NMBH 3FJTA 1A9EB 2WQRA 4YDIL 4YX2H 3IRZA 3MLRL 4KTYA 4LLUA 2GQHA 4Y4FA 2VLRB 4PRBB 2B5IB 2P45B 2ZG1A 4F37K 1QSFD 4FS0A 4KJPC 4NO0B 1TQBC 5LGJB 3SE4A 1JPFA 5CILH 4Y5XB 2LQRA 4BQBA 2NY3D 3BKJL 4KTEL 3W5NA 1IZKA 4NFCA 2ZG3A 1LMKA 5F96L 5FYLH 2I9LA 3L5IA 2EKSA 4Z7VA 4NN5B 4CMMA 2X4UB 5D6CB 3QEHB 3GMPB 1ED3A 1INQA 3ZL4L 4XBEH 4U1LB 3KWWB 2VLKA 4DZ8A 4QWWC 5SX5K 3VRJB 2EDNA 3MBXL 4JB9H 1UJTA 1BEYH 3PGCB 4UILH 3TJEH 4OLZH 1BGXH 4ODUA 5F7LB 5F7YC 2ADFL 2VO5A 5EUKB 1IEAA 2IPTH 2AKRB 4K3EH 4Y8DC 4FXLA 1MWAB 4FP8L 2DQJL 1DQQA 3SDXA 1C16B 1D6EA 2F54A 5KVFH 4FQ2L 2EYRB 1YJDL 3RTQB 4LVNC 1VENA 3PXHA 4BH8B 3FQNB 5I76A 4Z76B 1TVHB 3QAZC 5CEZE 1J05B 4UOW0 1YPZA 1GGIL 1C5DA 5A40E 3MRQA 4HV8A 5T1DH 5C0EA 4U1MB 2W9DL 1A22B 1PLGL 1QD0A 5AYQA 3BEVA 4X6EB 3VRIA 4DN4H 1T7XA 2Q76A 4JY6B 1RURH 4NT6B 4O02H 4CVZA 2X40A 4EXPX 3SOBL 3WO4C 3FKUS 1XR9A 3IXTB 1C12A 4DZBA 1F3DH 1P4IH 3OZ9H 1BAFH 4K94L 2QQLL 1R0AL 1RJCA 1NJ9B 3FQUA 3EOAA 5DMYA 1S9VB 4TTDD 1XGRA 2CMRH 4TNVK 4FQQB 2YD6A 2H45A 2D03H 1A21A 3MRHB 1J0HA 3KLHC 4XNYL 4CVWA 1MCKA 2VQ1A 1TNMA 1DDHA 4HIIA 1DBAL 3MA7A 1IQDB 3IGAA 4YAQB 2DLFH 1A3LH 3VFTB 3NVQA 3SDCA 1EBAA 1R3IH 2GYSA 3LVEA 4Y89A 4HC1A 4LPXA 1AR2A 1XFPA 4P3CH 4HUNB 3KPSB 1R5IA 1I7TA 1W0WB 4YFDB 1QNZH 3PIQB 3MQIA 4PP2A 3CDCA 3UJTL 1T83C 4TUKH 5JMRA 5JOFA 3GNML 5F6HJ 1UXWA 4GG8A 2P44B 2FATH 4EVNB 4XMPL 3NH7H 1UXSB 2V5SA 4KK9D 3TYFA 1IGMH 2EEAA 1KV3A 4L3ED 4CJ0A 1NGXB 4JO1H 1BF8A 2ARWA 3DUSA 2I07B 3KYOB 2VITB 2PW1B 2VB5A 2VXTL 4XCYA 5L2KE 3VDCA 2Q3ZA 5EOTA 2X4OB 4DFIA 4M43L 2PCPA 3ESVF 3PWVB 4DAGH 3TFKD 3KS0J 5IF0A 3VXSD 1YEFL 1G7QB 1FL5A 1FCGA 3VXRE 2OZ4L 1AGBA 4CN6A 1FVEB 1RHHA 3GMOA 4NCC2 2VDPH 3L7FA 2EE6A 4NNXB 4JM2B 3F7VA 2W0PA 3GSQB 4UU9A 1EXUB 2Q7YB 3VFVA 1NFDE 3BJ91 1DQJB 4BQ8A 3LKPA 1T21A 1ZV5A 2AEPH 1MCQA 4LFHD 3WYRA 1CQYA 1T5XA 4RGMB 4DWHA 3RWIA 3FRUB 3UAJC 1SJHB 3QNXA 1YEIL 3GJEB 2NX5A 3NOIA 2R1YA 4M9OA 1S7XA 4R0LC 3HI1B 1KJ2A 3U6RB 4KKNA 5GZNC 2AXGB 1GHFH 1A0QL 3O8XC 4LLWB 3TT3L 1DEDA 4GRWE 1HKLL 4X80H 5SWSE 4M03A 1Q9KA 3G5VA 4C56D 3MRLA 1OM3L 1H3UA 4NC1E 1ZXQA 1LILA 1II4E 2R0ZH 4ORGA 1IE5A 1QFWH 4ALAH 4XVJL 4PRIB 1DBMH 1K3ZA 3NTCL 3RIAK 5JW3L 4MNQB 1XF1A 2P24A 3QIWB 4NGHH 3NZ8B 5KSAC 1IC5H 1KCSH 1WWWX 2E7BA 2WWKT 3QHZH 4Z7WF 1X44A 4W4OC 1ZK9A 2FEDC 3D3VE 2QQNH 4FQCH 4QRPD 3VD3A 5DR5L 2Z93B 4G9FE 5DVLA 4ZNCD 4PLKC 4OI7A 2ICWI 3NZHL 4YIQA 4QXGL 3U4BL 2NTFB 2BC4B 5E7FA 4P5KA 3S3PA 1F97A 4KQ4L 3RI5K 1JGUL 3E8UL 2ED8A 3BIAX 1T0PB 2DYPD 1OL0A 3FFCB 3SKOB 2YOCA 5L2JA 1WSST 4NQED 4P2YA 4PB9H 3JV6A 3LKOA 1NAKH 3PP4L 2CDEA 3D69B 2IG2H 5DDHA 1XT5A 1MJ7L 3H3PH 4NZJA 4MCYA 4Y19E 3SCMD 1TCMA 4DVRH 3D5OF 1A4JB 4CRPA 2BY1A 3EYUH 1CDIA 3FT4B 3AM8A 4U05A 4N1CA 4YNYA 2X4PB 1N59B 1NCCL 5IFAL 4NOFA 1DZBA 5HI4C 2HTLC 4JFQB 1BX2A 1MY7A 4TULH 1ULVA 2R2HB 4X5WA 4FOMA 1PJ9A 4D0DB 1LO3L 1RUAH 1XZ0B 4UOW1 5TE6H 3IFLL 3SBWC 4LDOB 4QRPB 3SDXF 3TP4A 1OGAA 4JFED 4KKLC 3G6AB 3S4SB 2CLRA 4WUUB 4G5ZH 5TE4H 4MMXC 5JPMB 2ZKHH 1CGSH 1YPZF 1F6AB 4MZ3A 2J88L 3N06B 1ZLUK 2YMXH 2O5YL 3MZGB 5KSVA 1A7QH 3DO7A 3MNVA 1XIWA 4OGAD 5E8PB 3G6JF 5JW5B 2A83A 5D93C 3BZFB 3WJJC 1FL6A 5BW7A 4GG6B 1OP5K 3QO0A 2HTKC 2DIBA 1N64H 3QIBA 4K7PL 3VGHA 3OL2A 3DYMA 4G3YH 3QCTH 4UV4L 3UTZB 4Y4KC 2X1PA 3HC3H 2JLLA 4I2XE 5DD6B 4JKKA 3STBA 1D5XB 1SMAA 3HI6L 2R56H 3BGFB 3MRDB 4F58L 2QTEA 1UACH 2O5XL 4J8RA 3RZCB 3ZKNC 2V2WB 2WQ8A 3O2VL 4JFEB 1NFIA 4P2QD 1BMGA 5GHWH 3PP3K 2BJML 3L5HA 3KVQA 1LEKA 2R4SL 4M8VA 5IQ7L 1R5VA 5IP4A 1MCPH 4ZFGL 3U79A 3BWAB 3MJ8B 2VZUA 5GS2H 1YEEL 1JNNH 5K9KA 4GXVL 3CXDH 3HTLX 4H1LH 4OFVA 4WWID 4PJHE 3SDDD 3ZKMC 5C2BH 3GJFK 3KHQA 1LO4H 5HHMB 3V6OE 4PJCA 2GAZB 3B83A 3U30B 4NBXB 1OY3B 5I1GH 3LB6D 3TJHD 3U46B 4KRPC 4LIQH 5DD1L 2VTFA 3L3JB 4ZUVB 3MV8B 1RUQL 3U2SB 1T1WA 4JO3L 3R8BB 4CGTA 1TNNA 4FMKA 3QHTC 3CU1A 4EUPA 5DTFA 1PW3A 3RKDD 4YR6B 4ZUWB 1R3JA 1CK0H 1H5BA 1S8DB 1VFOA 5B8CB 1SVZA 5J0BA 4NQCE 5FUZL 5FIEA 4N0RA 4IRSC 4LQFH 5CIPH 3X14B 3KYMB 5C0BB 1F90L 3V5KA 4JPIA 2MHAB 4Y2DC 1JPSH 1KB5L 3RL1A 1XCQA 4HIHA 4OSUH 3TA3B 1VFMA 3GGWB 3W0WA 1YZZA 5E00A 2DQUL 2LTQC 2XRAL 3MLWH 3A6BH 3L6FA 3QQ4B 2Q8BH 1LE9A 4LFHG 5IVXE 1JGDB 5I19L 2F15A 4P23A 3BE1H 4WI6A 3V4VH 1WIOA 1CICA 1E6OH 2W07A 2YD1A 1P9MC 5F71A 2NY5H 3CDGB 1S9XB 1PGRB 4J4PC 1HYRC 3QQ9C 5DMGD 2DD8H 5DQDL 1V3LA 4UIKH 4MXVF 4XAKD 5D2LB 3BH8B 4M3JA 2BOCB 4AT6B 4U4BA 4AG4L 4C4KO 3PQYA 4MHHI 5J06A 3KPNA 5IG7B 5CSGA 3MMEA 3OKNB 5ESVA 2HH0H 2N56A 4DGYL 4XPBL 5C0FA 4OIAA 1J88A 2EDYA 4LLDA 4PJ9C 4N8VB 4BELD 4V1DD 2GITA 4P46A 5CCKH 2IH3B 2PYEB 5IUSA 1OAKL 3HNTL 4AY0A 1CDHA 4KC3B 3DGGA 1GOFA 4WIQA 3DV4A 2OI9C 5FOBB 5JNYB 4LHUA 2G9HA 4QRTB 3CFJB 1R3HB 4EN3D 1JPGB 3BPLC 5F7NC 3RAJH 4F80A 5J6HB 2D9QB 2VSCA 2W59A 5LQBL 1A6WL 3OAYK 1NAML 5HHPB 3EDJA 3INUL 3GSNL 2FGZA 4ODTL 2X4RB 1NCBL 2IQAB 3K4AA 4F3FB 2F74A 2OJZH 4JJ5A 4GRLC 3ULUL 4QHKI 3MLSL 2NYYC 4OJFH 3TGXA 4GRMA 3GMMB 3NCMA 5IHUL 3GM0A 3C60D 3SO3C 5IHBA 1FORL 2QSTA 4QRUA 4U1HB 5I18L 3BVNA 3C5JB 1INEH 1I85C 5SX5H 2X4NB 3HNVH 2VUYA 4N0UE 3MLTB 12E8L 2D4DA 1CXHA 3KYNB 1Q0XH 5CIPB 5IBUG 1ORSB 2DN7A 3AREB 3IXAB 2XZAH 1I3GH 3PWNA 4NDMA 2DI7A 3IJSA 4EN3B 1YY9C 2L7UA 2XA3A 3VXQA 4YXLH 4LVNB 1GZQA 5D71H 4GBXD 4OM0H 3WL9A 4LSDA 4QRSA 1UH2A 2EDWA 3QAZB 1HE7A 3QPQC 3MLUH 1N7ML 2B7DT 2VSDA 4KI5C 3ARTA 3I02A 3RU8L 3O45B 5CWSA 4OCYL 1JK8A 1IBGH 1OD9A 2H9GB 5I1CL 1A02N 2WIMA 1OQOA 1PKQA 3DURA 2CK2A 4YBHA 5JORA 2BVPB 4BYHA 3HZKB 3WO4B 4R7DB 5KTEH 1G7LB 43CAB 3B2VH 3VXME 4HWBH 4YK4C 5DEFA 5E1AB 1JPTH 1AXSB 1IRAY 4MQTB 4NRZA 3QEQA 3TNMA 3UJJH 1YC8A 1M7XA 1N6UA 4ENED 4QXUL 4AK1A 3EDFA 4KY1L 1LDPL 4H20L 3QCUH 3ZHDA 2Y7QA 3U4EA 1IGCH 1IGFH 4I3SL 5GRJH 3SHSA 4HS8H 3MV9B 4UDTA 3TBSB 2C26A 3QZWA 4O2FA 1KLUB 3QEUB 4M8QA 3SE8L 4U7KA 5ILTL 1CL7H 3ARDA 4Z0BH 2JCCA 3DX7A 3HAEA 4GBXB 1R5WA 4I8DA 1JYNA 4X6CA 3ZKSD 2WMPA 4PJ5D 1ITBB 1J1PL 2DLIA 5E6IA 1QKZH 2FHBA 2B0SL 3BP5B 3O3AA 5D7IA 5EOQL 1JWSB 4QTHB 4PGJA 2VL5B 1RZJC 3GMRB 1EUUA 1M71A 3CFDA 4YZFE 1SJXA 3TC9A 4JFYA 3MRRA 1S7WA 4PJCF 3MRBB 5CSZA 4ZSOA 2B39A 4MYWB 5ALBL 1OPGH 4AMKL 1NL0H 1AKJA 2HFTA 3WFBL 3R0NA 4YO0B 3H9HB 3H42L 3IAGC 4KGLA 3S96B 1KENL 4Y16D 1DN0B 2FYYA 5FDYA 3ARXA 3WKNA 3PWLA 1GRWA 3NGBB 5GSVB 1S7SB 1YEGH 4FQXD 4UQ2B 1NBZA 4I0PA 3T04D 5F9JA 5ERWB 3AGVA 3T0EC 1CTNA 3EKCA 3PHOA 1P6FA 4AJ0A 4KXZH 3EYVA 1MFAH 5J6GB 5D8JL 1LP9A 4N8VG 4EI6A 4HJJH 3QDJA 4OCWL 3BRDA 2VLJE 1I7RB 1QP1A 1J8HA 4D8PB 2UY7A 1GAFL 5HGAB 4PJ5B 5EO1A 1NC4A 5E2VH 5FYKD 1NLDH 2PO6D 5HHXH 5FAAA 2W0FB 2X70A 4NQDD 1ONQA 2DIJA 4JPKL 2DTMH 5B3JE 2CKNA 2E9JA 1J9CT 1WK0A 5T1KD 2CO6B 1YUHB 4LKXB 3TN0B 1I8MA 3LCYA 3G04A 2LU4A 4JZOB 3FO1A 4ISVA 1HOCA 4RDQG 4IHOA 4LCUB 3RIFF 3VWJA 3D1MC 1MCBA 1FIGL 1IVLA 4EXKA 2NY3C 1S78D 1QLFA 2EDXA 5K9JL 1KTLB 3V7AG 4X6BB 3S6CA 4FQXB 3GDBA 2VUOA 3KXFD 3LZFL 4TSBL 4TNWF 4MAYD 1TLKA 2XWTB 3I3DA 1H3TA 2AI0L 1MFBH 4F57H 1QRND 3STLA 2RB8A 5EOCL 1K9TA 4QNPF 5KSAB 3H6JA 5DJ2A 1MI5D 4JN2B 3EO1A 2FX8L 4GMSH 5E94A 5F88B 2PO6B 4Y5VA 1CFVL 2Y5TA 2VDKL 3MX0A 4YC2C 4Z7UB 5M95B 3OB0H 4XXDA 3D85D 2ITDA 3WUZA 3TCLB 1YQ2A 4WU5A 5E2JA 2GHWB 1RVFL 1J0ZA 2CIKA 1KTDB 4XNZC 2UYLA 4Z7WE 2GY7B 2R0KL 3FHQA 4GW4A 3B5TA 1MWAL 1WQVT 3C5ZC 3NFSL 1AD9A 5FYJL 4D9LH 1RULL 4ZUUB 1U8NA 3DROA 3NPZB 3WXWL 3QO1B 5KZCD 1HHHA 2RGSA 8FABB 4YXHL 2BSRB 5T1LB 1O0VA 2Q8AL 4KVNH 4M7ZB 1AGCA 1DUYA 3KXFB 3NCEB 2AJVH 1FNAA 4N9GB 2YPLA 4UINL 2EDBA 3L9RA 5FGBC 4PLJD 5D2NC 4Z0XB 5INCB 4MJ5B 1KEGL 1XCTB 2IANA 3BO8B 2ZPKL 3SY0A 4GOSA 4JZNB 4R6UA 5FO8A 5C07D 3K1KC 2FWOA 4POZD 4Z7VE 3RHWK 4E5XB 2XPGA 3TPKA 3F6IA 5C86A 2BHYA 2PUQT 3LPGA 4NN7B 4TTDC 5IFJB 5JHLL 1FGNL 4RGNE 5K9OA 3ZYOA 3GMQA 2OL3B 3CPLB 3LPWA 2VLKE 1X7QB 5ICXB 3JZ7A 4WV1C 4HHAA 4GW5A 4U1GB 1NC2D 2Z91A 3IS1X 4L4TD 4TVPH 5F7UA 4U1JB 5EU6D 3O6LL 4OZFG 3SKMB 3HNSL 4OZIB 4X9IA 1J10A 4LASL 5AZEH 3SDXE 2B2XL 3L3DB 1BLNA 4FQHA 5B4MD 5D9SA 3O4OC 2EE9A 4OLVL 4JPVL 1DBKL 1NCAH 4NM4H 1DL7H 4G80A 4BK5A 4J3SA 1NEZA 4MLSA 4HUWA 1OWRM 4LCCB 5DJCB 3R8QA 6CGTA 1EERB 3C6LB 5C07B 3WIHH 4P2RA 5FYLL 3KNBA 1TQCB 2NY6C 4ZUSB 3DX9A 3TO2B 3FQXB 1Y18A 4HDIA 3FOMB 1CFTA 3F7YB 4MQSB 4X5LA 5HI5C 2IBGA 3PP3H 4HBQA 3WEXB 2GUOA 2JCCF 4RZCB 3TFKC 1A1MA 4X6CF 4TUOA 2C3GA 3GHEL 3QQ3A 4R2GC 5FO9A 4JFFA 1BEYL 1QSZA 3TJEL 4OLZL 5EU6B 1BGXL 1S5HB 2YKLL 3IFPB 2P8MB 3LRSB 4N0CC 3BP6B 5IMMB 5E24E 3D48R 5J11B 2QL1A 4K3EL 2A73B 3OKYA 4OD3H 1B4JH 1KIPB 3GJFH 1PG7H 1X5LA 4BSVA 1J5OL 1X5JA 2JJSC 3V0VB 3F65A 3GIZL 4UDUB 3HZVA 1DLFH 2BSSA 5T1DL 2DQFA 4WU7A 2A0LC 4N0FA 2VDMH 4F9LA 3RL2A 4GQPH 3VCLA 5C0DB 3QUYA 5B39A 2VWEE 2FDBP 3ZYIA 1RURL 5GIRB 4ZAKC 4AL8H 4PB0L 5CBEA 4WGWB 5LXGH 3RFZC 1A6UH 3OZ9L 3S3JA 4LSUL 2Z0BA 1BAFL 1TVBA 4D0CB 5T33H 1S7QA 5C1MB 1YC7A 1ZLWH 3RVUC 2RHEA 5C09D 4LP5A 2CMRL 2CR6A 1FJ1A 2SEBA 1XF3A 3DVGA 3OR7B 3CFEA 3VFMA 1U8MA 3EJJX 4NO5A 4E41A 1P6AB 3LEVH 1F00I 5DJDB 1KCVL 4I9WD 1NBVH 4Z5RA 4QF1B 4PTTA 3O6ML 3VI4E 1A3LL 2DMCA 2XG4A 3EFFA 3O3EB 1WZ1H 1Q0YH 4NC0B 2W92A 3E0GA 1R3IL 2DM2A 5FGSA 4P3CL 3BAEH 3HS0B 3EYFB 3IDYC 3TVMC 5GPRA 5IK3B 3SCMC 2DQGH 5HYJD 1B0RB 3KPOB 2JJTA 1Z6JT 3JWDL 1EEUA 1ZSDB 3NACL 2NX5E 2FATL 1GH7A 2FHCA 4PJ9B 5MEPA 1IGML 1P1ZB 3BN9D 4I18A 3ES6B 1JPST 1ZWIA 4MXVE 2OI9B 4K2UH 2HG5A 3QJFB 1F02I 1WTGT 2BXZA 1FSKB 2MCPH 3BPLB 1DEEA 3MROA 2EE2A 4BSJA 1G6VK 4W6XB 5E08L 4Q9QH 2VLME 1OLZA 1GOHA 2YUVA 3BH9A 4DAGL 1D5MA 1HILB 1BQUA 3GJFB 2IPUK 4KVCL 1T80A 1B0GA 5M7QA 5F7MC 5TH2B 1JF5A 4LBEA 4WHDA 3JTSB 1KLFA 3LN4A 1MHHB 1JN6B 2GK2A 5K9QI 4XP1H 1BZ7A 4JRXD 4EEEA 1PZ5A 4QOKD 6FABH 2A6DA 1CG9A 4ZODA 3BKYL 2Z31C 5DURB 4JRYA 4M93B 2DBJA 2VOTA 1HH9B 3Q5TA 4Z77A 5CZKA 4LRNH 2A6IB 2UWEA 3OF6A 2F53B 3CMGA 5IB1B 4D0BB 3OJ2C 3WLBA 4LOUD 2VC2H 3VWKB 1GHFL 5KSBB 3BKCL 3T77A 4GMTH 5IOPA 3TZVC 2ZG2A 4P57B 4ZUWA 5INDA 1NH6A 5C0GA 3WNMA 2F5AH 5C7XH 2FJGB 1A6VH 5TGBA 2R0ZL 1A9BA 1GVIA 2PR4H 5DK0B 4ETQA 4QCIA 1ND0A 2WWMD 3D87B 5DJ0A 3PF2A 5IMKA 3DOSA 2IGFL 4H25B 1B3JA 4LNRB 1EH9A 2QQNL 1FN4B 5JXEA 3UC0L 2YA2A 1OGAE 3MLZL 4MJIA 5DLMH 1DVFC 1IAKB 3THML 2X10A 3SDDC 1NANI 1K8DB 5DZOA 5FCUH 1HCVA 4OUUA 4RISH 2X1WL 4IDLA 5DYOB 5GSRA 3GIVB 1YNTA 5CHNB 2UZXB 3X12B 5DEGA 3A67H 1I1YA 3KLAA 4HMEA 4GO6B 3HZYB 1CE1L 1NAKL 4IOFD 1I1CA 1X4YA 4PGCB 2I26N 2P43B 3H3PL 5I9QC 4DVRL 3QUXA 4NQSA 4AEIH 4GT7A 3RKDC 4A6YA 5I75C 3WFHB 7FABL 5ACLA 5E9DA 2PXYA 2WNGA 1NGYA 1HQRB 1KPRA 1U2HA 5E99L 5DUPH 2VKXA 5I2IB 3VXUD 2NXZD 3F7QA 4YGAB 3T1FB 1RUAL 3HB3C 4JCLA 2A6JB 2W65B 3U7AA 4H1LA 3M17B 4WO4A 5HXMA 4PRAA 5IROC 2EDDA 4P5TA 2RBLA 2E27L 3IU3A 4O9HL 4NZRH 1C5BL 2ZKHL 3UPRB 4WRLA 1FZJA 4KMTH 3P30H 1YMMD 3GUTB 3EJYD 3GKWL 4XNMB 3FB5A 5I1LB 5D1ZB 5DMGC 1QTYT 2JJUA 1E6JL 2QR0A 4OZ4B 4PJCE 1T3FA 5IQ9A 5MI0C 5DHVH 1KPUB 2QADB 1AI1L 2HMID 2IADB 4HUXB 4JG1L 4PG2A 4ZXBB 4G3YL 3QCTL 1KXTB 2Q3AA 4K8RD 4NUGH 1NDMB 3AUVA 3N85H 3ULVD 1H8OA 1XF4B 2XIDA 2OSLB 1UACL 2D4FA 3BW9B 3LEYH 4C83A 4PBXA 1YYMH 2CGRH 4O5LH 5GHWL 2NZ9D 4TUJA 2E7HA 2YSSB 3D0VA 5FHAL 1QFPA 4FQ1H 3BD3A 2AJ3A 1BQSA 1U3HC 1QPXA 1UCBH 4LF3B 4RFEA 2F19H 1RZ7H 3O3BB 3IDMA 2W60B 1JNNL 1YMMB 3W0WE 1AQKH 5FEBA 1LK3H 5TFSH 5IB5A 1VACB 5SWZD 4MSWB 4UTAH 2C3VA 1F6FB 1YN7A 1BREA 2BY3A 1LO4L 2QSCL 4QXWA 2AK4D 5FYKU 5T3ZE 4NKMA 3RUGA 5ADOH 4XVTH 2VLLB 1W8OA 1KELH 3QIUC 1JRHI 2ID5A 4JN1L 4PLOB 4LIQL 5MENB 2FD6L 3E3QE 3OR6B 4N68A 4OF0A 4JO2H 5J1AA 2Z4QA 4X4XB 2F9BT 4UZGA 5F3HA 5CAYB 1FRGH 3PQYE 1BZ9A 1OAYL 1VFAB 2NY0D 4I3RH 5FHBH 4XC3L 4ZOBA 4N90D 1CK0L 4QHLA 1B9ZA 1QRKA 3MFFB 5FF6A 1T6WA 3MJ9H 2AJZA 3UMTA 4F2MB 2J8OA 1OLLA 1A1NA 3QDMA 5F9AC 4ELKA 4U1KB 5BJTB 4Y4HD 3TV3H 1JPSL 2XKUA 1MAML 1WFTA 1JYWA 3LKNA 1BM3H 1T83A 4WDIA 1FLTX 3BP7B 4DJMA 5DUMH 3MLWL 1U3YA 2C7UA 3A6BL 5SWZB 1VERA 3QA3A 1KJ3L 3DRQA 4E9LA 5JZ7C 1IFHH 1M6OB 2MKWA 5DHVB 1DUZA 2IALB 1ZAGA 2YUXA 3G08B 2NY5L 2E9IA 1Y6NR 4ENEC 4LAQL 3RWDA 4I48A 1YECH 1QSED 4UIKL 4JR9H 1JMZA 1S7RB 43C9B 2L4OA 3L3KB 1QACA 3JVGC 3R1GH 3PV6A 4FXGB 2NY0B 2AS5M 5FDWB 2HH0L 1BVKA 4JFOA 4JDTH 5C08D 2Z92B 2HKFL 3NPSC 1KN4H 1UB5A 5CCKL 2HFEA 2RR3A 4LEOA 4MDIA 1T0NA 2A74B 3N0PB 2PETA 4HZLB 4Y4HB 3TO4C 3HE6A 5KS9B 1T4KB 2ITCA 4PJGA 5GGSA 3BGMA 2GTWA 4R0LA 5T3XE 1KLGA 2XNAB 2DWDA 5C0JB 3O8XA 1TJGL 2LU7A 4G8FA 2MCG1 1PKQE 4OLEA 3O2DA 1S5IH 4FFYH 1QSEB 3QUZB 3BPNC 5EORH 3SN6N 1JFQH 4CAGA 3QEQE 3UYOD 5FXCH 3UPCA 3QI9B 1AGDB 1INEL 4JDVB 3HNVL 4R4NC 5FGCE 5EO9A 1TETH 3QDGD 2A6KB 3O4LB 5BRZA 1Q0XL 1XR8A 3AS0A 3LMJH 5HYSB 2XZAL 2R2BB 5HDQL 5LCVH 3GKZA 1FNEB 1J1XH 4YXLL 1MCEA 3N1MC 2JCCE 1T2XA 4X6CE 4X99B 5F1IB 4JFHD 1EEYB 1FG2B 3DUUB 4JAMA 1KPVA 1CT8B 1FQ9C 4JREC 1PY9A 4LSQH 1NCDH 5D7IE 1LGVA 3BQUD 1IBGL 1B2WL 2VXVH 5EZLB 3VGBA 4EIGB 1S78C 2BVUA 4YQXH 4FZ8L 1BIIB 4ZSOE 2EDOA 5D1QC 1RJZA 2P5ED 5GS1C 1WWCA 4HWBL 2GJ6A 4NHUA 1JPTL 1Z5LA 1QR1A 4MAYC 3K4ZA 3PXJA 4P5MB 5CEZH 3HG1B 1F2QA 2NW3B 1CFBA 3PWUA 5TJWK 4JANA 5DQJA 2DQTL 3QYCA 3FZUD 4B50A 3SBWA 1SM3L 5HY9B 5GRJL 1EHNA 1JGVL 4XNUH 4I1NB 4U1IB 1SEQH 3MBEA 4OZHA 1CXFA 4Q9RH 1LP9E 1HCFX 4NRYB 3M07A 4Z0BL 3QDJE 3FQRB 4K3DH 5FCSH 1I1AC 4GKSB 2FLRT 3G5ZA 3R4DA 1J8HE 1YY8A 5FYKL 3WNPA 3HE7D 3ARBC 4YDVA 3GM8A 3ZDXE 4X9BA 2PYFB 4PJ8D 4I13B 2DJ4A 2P42B 3QB7C 2FGWH 2UZIH 3IDYB 4YFLF 1BVZA 3WJJA 4X4ZA 2R69H 4P4RA 1MPAL 5EZIL 3TBTA 2ED9A 2P4AB 5L6YH 4JGMA 3KHOA 4HMDA 1TJIH 1ACYH 4Y4KA 1JGEB 3S35H 4PLJC 1PQZB 4ZUTA 4WJ5B 5J12B 4P9HC 4AM0B 3P4NB 2XKNA 4GAGL 4POZC 5CINL 2OR9H 2MKLC 1TJHH 5EFIB 1G9NC 3UZEA 1Z9SA 5TDNA 2BDNH 4KZEL 5ACMA 4TYUA 1U95A 5ICYA 3BRGC 3PWPA 3UYPA 1OAQH 3QWOB 3OKOB 4LPTA 1ZLSH 2VR5A 1MFAL 4Y1AA 1UKQA 1I3VA 2FR4B 4HJJL 4F37F 1QBMH 2DMKA 3ZTJH 2ZP0T 3R06A 3HE7B 1NLDL 5HHXL 3OJMB 4DOHE 2V17H 4NNYA 2OL3L 1RK1B 3D39D 5DJZB 1QFUL 4Q2ZB 1KTKE 3NCFB 3MREB 4X8JA 5A2IH 1A4KA 1A5FH 5B4MC 4JFDD 1IL1B 1SYVB 2Z31B 4K3GA 1RZKH 3KR3L 5JHDD 1HXMA 1KXVC 1JZ7A 3NA9H 3OKDA 1FE8L 1JUFA 4KGJA 2IH1A 1U8KB 3MOAH 3RX5A 2H2SD 2DI9A 2IFFH 4TOYH 1QBLL 2VXUL 4XCCH 1DQMH 1HSAA 5GRWA 3TZVB 1R3LB 2R29H 2XQBL 2VYRE 4GH7B 3ARQA 1HSBB 3WBDA 4KHXL 2YPLE 5E7BA 2ADGA 2YC1A 1NAMA 4IRSA 2IANE 2P8PA 4NKOA 1G7IA 3C8KB 2MJWA 5EWIH 5IESH 1HI6B 4Y2DA 2R1WA 2FO4B 3A0OA 2DF3A 5L9DH 1B6UA 3UTTD 4GMSL 1MHEB 3OJDB 5MEOA 4GRWH 1HNGA 1A7PL 3C6SA 1XGTA 1CVSC 2IQ9H 1JWMA 3S88L 5E8DL 4LPYA 1P4LA 2ZJSH 1MFNA 3KJ4C 3NFNA 4U6YA 4O2CB 1P9MA 1ROWA 1XF2B 1DQTA 4AH2A 3TYGH 4PJGF 3RWFA 3ZDZE 5JOPE 1R3KB 4J4PA 1QA9B 1RUKL 3MNZB 2EDFA 2P5WA 2JIXB 1ZGLP 2YPKB 1AJ7H 1KOAA 2WV3A 3PDOB 3VXPB 5DC9B 1FLRH 4G6AD 1GCFA 4NYLA 4TNVF 3NFPA 3V52H 4KVNL 3V0WH 2BVQA 1AXIB 1FNGB 4P3DA 4FA8A 4JKMA 2DB8A 1Q9LA 2VISA 2BCKA 1U3JA 5I30H 1JZ3A 4JQXC 3QXTA 2FJFA 2NW2B 1L7IH 4Z7NF 1IAIM 3AC0A 3CSPA 4V2BA 5LAXA 4FG6D 2YD9A 1S9YB 35C8H 4NZUH 4ZFOL 3P3YA 3MR9B 3NCBB 2YR3A 3DRTA 5SWSD 1ZA6B 5DHYB 3QH3A 3ZHLA 1IGTB 1H15B 4WY7H 4PRHA 4GRLA 4HULB 5C2UB 2EDKA 5IEHA 4TVPL 4JFFE 5L2KB 32C2B 3H2WA 5GRZA 3LKQB 3WJLC 4ORZC 4XRCA 3O6KL 4W68A 3DXAA 3EZ8A 4NPYB 5CBAB 5IW6B 3CXHJ 3CX2A 3VXRB 2X4TB 3CJJA 5CJQL 5IV2A 3O0RL 4ESKA 2NY2D 3D18B 3FO0L 3I3EA 2H1PH 2MSPA 4APQD 4G9FD 2CLZB 4IMKA 4MXWH 1I85A 1NFDB 3SGEH 1NCAL 2AABL 5CMAB 1RZIA 5E2UH 2KZWA 5T1MA 5HHOA 3U9PH 3CSBA 3N9GH 1TIUA 5EBWA 1SYSB 4P2OB 2NY1D 2D7TH 4KPHL 3OJVC 4RBPH 5IB2B 3W81A 1PYWB 4NKDA 3WIHL 4DCQB 4ZFFB 2BK8A 1ZVSA 4L1HA 2EYSA 2HAZA 2Y6SD 5IWLC 2HP4A 1OSZB 4PREA 1QEWA 3G5XA 5GS0H 4JFZH 4NP4H 4GRWB 4OZHF 3WFZA 5SWSB 3VFPA 5GRVK 4BZ1L 3MTRA 5F7KC 4FMFA 3DIFB 3HI5H 4DTGL 2G75A 3UYRH 1N5YL 1U3HB 4LGRB 5HD8C 1KB9J 2AJYH 1WBZA 3UJIL 4QRRA 1RQ5A 1OAUH 3C87A 1L6XA 4L8BA 4QKXB 3UTQB 4OD3L 1B4JL 4UIMB 3GBMH 4ZS6C 3D3VB 5CZXD 4H0IA 1Q9OB 4E41E 1FO0H 2NY2B 1UQSA 2CK0L 3X12A 4LLVA 1IC1A 4G9FB 2NR6D 2K7QA 1FC1A 4APQB 4WFHD 1J86A 3I6LE 2AJXH 4M6OH 3GI8H 1V8HA 3QG6B 1DQLH 4HF5L 4EDWH 4RMWA 1PVHA 4KKBC 1DLFL 2BNUB 5CUSH 3RIAF 1VADB 2DL9A 2NY1B 2P8LA 1CDJA 4LOUC 1JP5A 4MGXA 1I8KB 5LG1A 4AL8L 1O7VA 2VDOH 3MUGB 4I0CC 4K23H 4X4ME 5GGTH 3KPQB 4IIQC 4W81A 1ZOXA 2A9NH 3RY4A 5GS0D 4M5ZL 5LXGL 4PJIA 1BQHG 3PNWB 4WFGD 4Y4FC 1TZIA 3U36A 2DWEB 1A6UL 3TWCH 1HH6A 5F97E 3RI5F 5MERA 4JY5L 2WWMC 5T33L 1G1YA 4DUXA 4PJEA 4HWUA 5C0ND 5BQ7B 3BI9X 1KIQA 1HEZB 4BZ2H 1T1ZA 5J13C 3WIFA 5FV2A 3MRPA 1VKXB 2DMBA 1JF1B 2FB4H 2YN5A 2WINA 5I8CA 3MRFB 1FNSH 4S1RH 1HDMB 3HPLA 3UDWC 1VGEL 1NUNB 3T0EA 4RCAA 3P73A 4IOFC 1ZHLB 5KAQF 1JZ8A 1G9MC 1AQDB 1NDGB 4RFOH 4JRYE 2DQGL 4GW1B 5JQ6L 3RDTC 5DRWA 4ZDHA 1BVLA 2J3SA 1V3MA 1P7QB 2UWEE 3WFEH 2FHFA 4HAFA 4K7FA 3I2CL 2QQQA 3ARGC 1LEGB 3BUYB 1BD2D 4MA3B 4Q6IC 3JWOC 3MV7D 4K2UL 3NCJH 3SPVB 3AU1A 3OKMA 3TO4B 4I3GA 2RFXB 2MCPL 2OK0H 3FCTA 1MJJB 3T65B 1S7VA 4I2XB 2ICES 4ONGH 4EBQH 1IM9A 1M1SA 1DE4A 1QFWI 3VXTA 5JTWA 3PG2A 2J8HA 2V2XB 3E2HB 4U2YA 4MXQD 4Q9QL 1QSFA 5EU4B 1N8ZA 5AWNH 2HN7B 2HLFD 5DD3L 3VG9B 4I4WA 1HHIB 1FO0B 5LGHL 4L8SB 4YHKH 1G7PB 1EJ6A 4IJ3C 3JUYA 3H3KA 3I84A 4MJIE 4X7DC 3BKML 2PKDA 3EYSL 4XNXH 4XP1L 1MREH 5B38G 2RCSH 3Q6GL 2BNQD 1WAAA 1D5IL 5C9JA 1TZHB 1XGPB 4P9HH 4PJHB 5IVNA 1EX0A 5HI3C 3T8XB 4EDXA 1FCCA 3QXUA 3CFKB 4LRNL 4AEHL 5I1IH 3VD7A 2B1AH 2ZOKB 4D9RE 2FZ3B 3GSUB 1KFAH 2A77H 4LSTH 2C1OB 3CVHA 3FQWA 4I77H 4K8RC 2VC2L 2MPAL 4GMTL 2FBJH 4U33A 4PGEA 2ATKA 2F5AL 2VWEC 3C09C 4XP5H 5E9DE 3VRLE 2CKBH 3RA7L 3TBVB 1GSMA 3C5ZA 4EKXA 2AGJL 5DSCA 1JNJA 4OT1H 4TSAH 2WP3T 4JREB 4NFBA 4NQCB 4M3KB 3TIDB 4FTVD 2F58H 3MYZA 4HX1A 4HUVA 4LHQB 1RD6A 5DLML 1ORQB 5FGBA 3V95A 4CNIB 5D2NA 5TPWH 3QP3A 4RISL 5F7DB 2GFBA 1E4KC 5DJXB 4P4KD 1SY6H 5FFLA 5I6XC 5I71C 1T7ZA 5IVXB 3A67L 3FRPG 1BBDL 5FB8A 4YUEH 5I1AA 5EZOH 3LKRA 5EDXA 3G5YA 5I1DB 4OBSA 4M1GL 4AENB 4WV1A 4X7TB 3U82B 3X13B 4AEIL 2IPKB 3I3BA 4KI5F 4N5EC 3K80A 4KWUA 1AHWC 2FX7H 3U1SL 1I1AB 2EZ0D 3RNQA 5IW1A 4HWNA 4XPAH 1IAOB 2ILLA 4K8RL 4O58L 3MRGB 3ARBB 3WE6B 4AIXA 3VFOA 5BS0D 1FVCB 1OCWH 2HRPH 3RGVD 3F5WA 3ULVL 5BVPL 3W9DB 4NIKB 2R23A 4YDLC 3BYYA 3CK0H 3O6FB 2NY4C 4XBPA 5DO2C 2NXYC 1UM4H 4YBLC 2CUMA 4NQVB 2M2DA 2Y72A 2XTLA 4QHUB 3LIZL 5F1KC 4H88L 5JDSB 4LL9A 4L3EA 1WBXA 3VFWB 4P4KB 2CLVA 1Q94B 1AO7D 1N2RB 3DV6B 4LPVA 2AJSL 5A3IC 4GAYB 4G8IB 4QYOB 1K4CA 2XY2A 1K6QH 3RUGE 1CFNA 3LD8B 1FP5A 2VDQL 4YFEA 4RAVA 3VXSA 2R8SH 4PJIF 4XH2B 5K33A 5C6TH 2FBOJ 1D9KD 1A7OH 1I9IH 2FO1A 3KG5A 2CKBB 3HRZB 3BOVA 3DI3B 4NUGL 4M02A 1OF2B 2NCMA 4PJEF 4GQ9H 3HHRB 2R9HD 3B8YA 2BVOB 2JJSA 4N0UB 3LEYL 1S9WA 3BMWA 1UWXK 1YYML 2LE9A 1GXEA 2CRIA 3AM8C 1RZ8B 2YUZA 4NZDA 3QDME 4FQ1L 1FFOA 2EO9A 1GC1L 1UCBL 1T66D 3CIQA 3RWEB 2F19L 1RZ7L 4G6FD 4ZAKA 1UADC 4X83A 5ICZA 1I9EA 3HFMH 4MNHB 4C56A 2EDQA 3MRMA 5E6YA 5TFSL 4PRPD 2I9TA 2GSIA 4UTAL 4PY8I 1HZHL 2X2YA 2EEDA 2G2RA 3T08A 5MHSD 2WBJD 2YXFA 4UAOC 4MHHG 3VXMB 4KHTH 1U8PA 2NLJA 2F8OA 4LVEA 1D9KB 4YFLI 5IT2L 3OAZK 3RBGA 2COQA 3QFDB 4F8QA 4KROB 4R7NA 1I1FB 4WWKC 3OQ3B 1IC7L 3GI9L 3DMMD 1T5WA 4I3RL 4N8CH 4PGDB 15C8L 2AK1H 1DFBH 4JEGB 4P48A 2DYPA 5BW7C 1PG7X 2HT3D 4NQEA 4ZQKA 3QIBC 3IJYA 4ZTOL 4QY8A 1Q72H 3TVMA 2CJUL 4K3JL 4OLYL 3RZWA 3SCMA 2JELH 3DNKA 3MLXH 5D6DC 4G6FB 1RK0A 1BM3L 3CVIL 1JE6A 5ESAA 2B20A 5DUML 4PJGE 1BWMA 1EO5A 3WKMH 2CRMA 1RIHH 3UEZA 1WAAF 5DI8A 1RUMH 4PS4L 1E28A 2XZQL 2WBJB 1OOAA 5HHNB 4HZAA 1JMXA 3BP4A 2Q6WB 3I50H 1D5BA 1NBQA 4IMLA 1TZGH 3Q6FA 1Q1JH 4OF3A 5I1JH 3MNWA 1YECL 4EI5B 1LNUB 2DQIH 4JR9L 4IBLT 4GFTB 5KJRH 2HVJB 5KOVC 4XPFH 3R1GL 1MIEH 1MRDH 4P59H 3VXNA 3DMMB 4YBQD 3V6ZB 1OARL 1X5IA 4JDTL 2DLGA 3KDMB 1MCCA 3J7HA 5BRZE 2HLAB 3LEXB 1YMHA 2F5BL 1MCFA 2AV1A 3JTTB 1RMFH 1NLBH 2D3VA 2LVEA 2VLJB 4PJ8C 5E0QA 1W0VA 1P4BH 1VFBB 1KIRA 4HKJB 4PV8A 1FZOB 4PV9A 2E9WA 3C08H 3OKEB 2WLZA 4IS6B 1A6ZA 3GSXB 5EPMB 5JUEH 1HWGB 2WM0A 2BMKB 2V2TB 3RWJA 4L29B 5DS8A 3DWTA 2J5LB 3CXHK 1H5BC 3R0MA 4YH6A 4ELMA 4IM8A 4IOIB 5A2KH 2ZCKH 2H41A 5D5MA 4Y5YC 5I8KL 4LLMB 1QHPA 1WBYA 4JM4H 1CQKA 1MAKA 3ARPA 2WUBH 2BSTA 2X05A 4P2QA 5EORL 5DRXB 2GJ6E 4D2NA 5I73B 5DMIL 3M1BB 3AXLA 2GEEA 3QSKB 4KRNA 2MNUA 1T20B 5MEQA 5H94A 4F15B 3D25B 1I75A 2VQTA 5C0RL 1R6VA 1DVFA 5KVDL 1V7ML 3BSZH 3SDDA 4HFWA 3E3QC 1FVDA 3LMJL 2VABB 5ANMA 1Z9MA 5F7FA 2H26B 4KQ3L 4OZHE 5IIEB 1J1XL 1CL7I 5DFTA 2VDLH 4RGND 1S7UA 2FH6A 1CE6B 4WI7A 1CLZH 1WCBB 2ZUUA 3U9UA 1I8LC 1JHTB 2IBZY 4U1NA 3QG7H 5ISZE 3REVB 4GKNA 4R90L 1GGCH 4X0KA 2H2SC 4OV5B 4H8WL 4D9QE 4P46C 1AXTL 4Z7WB 4OD2B 4RQQA 4U6XB 3FFDB 2ZZUT 4YQXL 1QLEH 2F54D 3L5WA 2AEWA 3P9MA 5DK2A 3IJHA 5CFHA 4J1UA 4LLUB 4QXTA 4FQPA 1ES0A 4Y4FB 1CFSA 5DVNA 5EC1A 1X9QA 1WZLA 1FYTA 3O9WD 1EVUA 2OXHA 3PL6D 2ZUYA 4L9LC 1J11A 1KBGH 1JPFB 4HC1H 5DJ6A 3EO9H 3SGJC 5IGXL 2I9LB 3BZEA 2D9CA 2EKSB 4Z7VB 4CMMB 1LE5A 4M1CD 2I60L 5IROA 2W91A 1GIGL 2X9YA 3PWPE 4KXZI 2VH5H 4XNUL 4FQJL 1SEQL 3ROOA 4Y1AE 1ED3B 1INQB 4Q9RL 4OQTL 3K1DA 3OG6B 4RGNB 5JR1L 2HT4D 4K3DL 4MJ6A 2V5TA 2VLKB 4NRXA 4DZ8B 1OTTD 4M7KL 4NOBA 5HGDA 3EGSA 4UTBL 4CMHB 1N26A 3RHWF 1MF2L 4ODUB 5EUOA 4YHZL 3LHPH 2XN9D 1F58L 2LV4A 4FZEH 1T6VN 1IEAB 5DWUL 2R69L 2WW8A 1N3NA 2Z35A 1DQQB 3SDXB 3C2AH 4G6AC 1D6EB 2F54B 1G0YR 2X7LA 3HMXA 1TJIL 3WD5H 1ACYL 3GSWA 5FGRA 4TTGA 3H0TA 5I76B 2AP2A 4V1DA 3S35L 3BDXA 3IKKA 4KUCF 3VXOA 4ZD3L 1YPZB 1C5DB 3MRQB 4HV8B 3SDCD 3DVNA 5CKAA 5C0EB 1TJHL 1WFNA 4WGVB 2IFGA 3LSOA 2X1QA 3BEVB 3VRIB 2Q76B 4MDJA 4CVZB 1MRCH 1OAQL 1YYLL 2H3NA 5FOJA 1MCDA 1GGBH 1L7TL 3AFLA 1XR9B 2FH8A 3SO5A 1C12B 3ULUE 4FFZL 1MCRA 1KJ2H 4DZBB 4BFBD 1BPVA 4XTRD 1CIUA 1IGIH 4G42A 3LRGA 2EDRA 3QPXH 4XAWH 3FQUB 3EOAB 1KCRH 1XGRB 5KG9A 3C60A 3QIUA 1MCJA 3Q3GA 1RZKL 1X4ZA 5KVGH 1QHOA 4Z7QF 4GKZA 2J6EA 2P5WE 3P11H 3NA9L 5GRUL 5D96C 4JKWA 4YWGH 2IBBA 2VQ1B 4JFPA 1DDHB 2IFFL 4HIIB 3MA7B 1QFOA 3IGAB 4TOYL 1NKRA 1S3KH 3ROLA 1DQML 3SDCB 2R29L 4Y19A 2C3XA 3VFRA 4XMLL 1R5IB 2DQCH 1I7TB 3K74B 4P9MH 4NSKA 4Y7MA 2GT9A 4PP2B 5JOFB 4OZFA 1UXWB 4GG8B 2NX5D 3S37L 5EWIL 5T5FH 2YWYA 3TYFB 1AR1D 2IF7A 4NWUL 4UT6H 3DX6A 4N0YH 4LPWA 4UV7H 2MWCA 3DUSB 2IQ9L 4NN6C 1Z3GL 2OR8A 2ZJSL 4URTB 3QWRD 4I0PC 4PRHE 25C8L 2PF6A 3FAWA 2X5PA 4HKXA 3ARVA 4XCYB 5KVEH 1I8IA 2DJUA 5EOTB 1F42A 1ZTXL 3BZ4A 2DQEL 2PCPB 2XXMB 3WFCH 4KJWD 5IF0B 3UO1H 4ELMF 4CN4A 1FL5B 1NSNH 1T0MA 1AGBB 1FH5H 4OIIH 3GMOB 1RHHB 3L7FB 3JVGA 2EIBA 3F7VB 4UU9B 5EBGA 1P2CA 5AUMA 4HCRL 3VFVB 3U7YL 3V52L 5DQ9A 3V0WL 5HHOE 3LKPB 3B9AA 1T21B 3D9AH 3WUWG 1T5XB 4OIBA 4JHZA 3BHBA 3OTTA 4UBDC 5I30L 1FL3A 4NHCL 3RWIB 4KJYA 3QNXB 4JLRA 2NX5B 5D72H 2R1YB 2YHGA 1S7XB 2ATPA 1NMAH 1KJ2B 4NZUL 2EKJA 1X6NA 2NY4B 2G5BA 1FGVL 5GZOD 2NXYB 1DANT 4F7CA 1Q9KB 3G5VB 3MLVH 4R4FL 1PD6A 3MRLB 1MJ8L 1JWUA 4WY7L 1U93A 4ORGB 5KN5A 4HEME 2KBGA 1LWRA 4Y16A 4M5YL 5T5NG 1WWAX 4EIZC 4QRRE 1U58A 2P24B 5GJTH 2EXYD 3BPCA 4UQ3A 4WI8A 5AAMA 4QTIH 2H6PA 1K8IA 1CLOH 1OW0C 5DJYA 1EK3A 3S34H 2X9WA 2E5EA 4YIQB 1E4JA 5E2UL 3U9PL 4L4VD 3L3OA 3N9GL 4P5KB 1JRHH 4LCWD 5F7EL 4Q6YA 3W9EA 3QULA 3NAAL 1IGJA 4NQDA 5L88H 5L2JB 5DJAA 2JK5A 3MRJA 3JV6B 3LKOB 3DHJA 1W72A 5T1KA 2CDEB 5DDHB 1UWXH 4MCYB 5GS0L 4NP4L 4PJIE 3HC4L 5F6IC