3ARGC

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
204
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSAGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 31
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argC02
4MQXC 4FZEH 3VXTB 4GW5B 1MJJB 3MRBB 1AGBB 3BX7C 3ZYZA 2I5YH 3WFCH 1CS6A 1G7MA 1IQDB 1KFAH 3WNKA 2BNRD 1I1FB 2ZP0T 5DUBB 5DUMH 4L9LB 1YNTB 4ELMF 2HFFA 5E08H 4QHKI 4DKAA 2BVQB 3DMMC 4FMFA 1RHFA 2DQFB 5C7XH 4ZQKB 1CDJA 2R0WL 2AV1A 3BJ91 2Y25A 3RBGA 4GRMA 1MJ7L 4P59L 5IT2H 3QNXA 5FKPA 4KJQD 4S1DD 5KVEH 2OMBA 3M8OH 1LEGA 1FZOB 1I1FA 5E6IC 3PWUB 3SDYL 2GEEA 1CE6A 2XXMB 5C0CA 5E2UL 3O41A 4XNUH 1JHTA 4R7NA 5T33L 5I1IH 1ZSDA 5KVFL 5EBWB 2HMIC 5EOCJ 3W39A 2DQIH 2VR4A 1QOKA 1W0VA 2W0LA 4WENB 3QA3A 3KPTA 3NCYS 4Y2OA 3OKKA 2BOCB 4UQ3A 5IG7B 3VH8A 2OJZH 1Y0LB 1F11A 3BP6B 1CD1A 3BPOC 1J12A 4WWKD 1ZHLA 2Z31B 3U4BH 1DN0A 4NQVA 2HLFC 2O5ZL 4PV8B 2BX5A 2X1OA 2CUHA 2W9EH 2X44D 4PRIB 4PTTB 4YZFE 5ISZA 3VXOA 4XPBH 3UO1H 4BQBA 4XVJH 1EAPA 5T3ZL 1VKXA 3H9SE 2NY4C 4NQTA 2X40A 4XP9L 4O2FB 1ZSDB 5D6CB 1FZKB 3KJ6L 1BHGA 3O41B 43C9B 4HWBA 1FNEA 2DS4A 5F9WC 5DR5H 1OGAB 1NANI 1QFHA 3DHJA 4PUBL 5DTFA 3OKLB 5JW4M 3X14A 1AO7E 3V8OA 1H3UA 4N9GB 4LPUA 2VDOL 1E4XI 2XKSA 4GXVH 2WMPA 4XH2B 4K8RH 5E6ID 1U8IA 2CK0L 2VXUH 4FQPA 5DRZA 1QSZA 5LXGH 4CVZA 3VGBA 4MA8L 4KROB 5DYOB 3CSYA 5D2LA 5FYKD 4QRQB 2CIIB 3V0WH 3MV01 1Z5LB 4NKOB 1NFDF 4X6BB 4YWGH 3WV0A 4I77H 3VRLF 2FATH 3BI9X 3WUWB 1A7RH 1LVEA 3H9HB 3EYVB 1CICD 1U58A 4NIKB 4UQ2A 4GKZB 4TVPL 3UJIL 4NUJA 4I2XB 4LBEA 2FH6A 1EVUA 2F9BT 3MGAA 4YHMH 2H1PH 4I0PD 2N4IA 1DVFC 3U4EB 4GUPA 4RFNC 3GMMB 2E9JA 2APVA 2I07B 5KN5B 1LO5A 3GMLB 1H8NA 1C16A 5DGRA 1T21B 3UO1L 1HXYA 1PG7W 2HMID 5E5RB 1A9EA 3CVHA 2UY7A 4XNXH 4F37K 4ZSOA 1I75A 4P23B 3KPMA 5GJSH 4W4OA 2WP3O 4KKNA 1MFEH 2VTFA 2ZCHL 1N59A 4F7TA 4C83B 4FABH 1U58B 1KSRA 1NMBH 1FL6A 1AGCA 5CJOL 4JG1L 2J8HA 5C6TH 4R0LB 1HKFA 3RL2B 4FXKA 5I1DB 1IGYB 4NHUB 2BVYA 2OP4L 1FQ9C 4KKBD 1V3JA 1QHOA 3ARRA 4RRPA 3ZSSA 1JGDA 3DXAA 2A0LD 1T3FA 1QLEH 2VLME 5GGSB 5F9JB 3OKLA 3F12A 2X1WL 1TQCC 2VXVH 1RZIB 3LVEA 3JUZA 5T3ZE 3EGSB 4X6FB 5E2TH 3RWFB 4NQXA 5CJOH 5T3XE 1AI1H 1S7TB 4MQXD 4W6XB 3P0GB 4NO0D 1YEFH 1MCPL 4K23L 1T7YA 4YDVA 4LLAA 3TBTB 2R2CA 4DZBA 5EO0B 5EH1A 2X7LA 4PJGF 3CC5A 4GH7B 2FB4H 2R4RH 1G7QB 3H3KA 3HMWH 2C4FT 5ALCL 1II4E 3U30C 2V7NA 3DMMD 1ZWIB 1F6LL 4MLSA 2F19L 3OZ9H 2A73B 3SKOA 4H0HB 2VXVL 4P5MA 1LP9F 4UZGA 1J8KA 3UAJC 2FHBA 5GGVY 1JWSA 3O3EA 5BW7A 1IE5A 3TN0A 4LLQA 1QRNE 3I2CH 1BIHA 3KYMA 4MCZB 3GMPB 1Q1JL 4J6RH 2DQDL 4PLJC 1ERNA 5D1XD 5J1TC 4QRRE 2A83B 4V2BA 5TDOB 2EE6A 3MLSH 4ETQB 5ICXA 1LO0L 1YYMH 1A7PH 1N4XL 5TPWH 2FEEL 2OQJB 4O51B 2KUTA 2PUQT 3U7YL 1RUMH 3KPQA 1WFNA 4MD4B 4LRNL 4IDJL 4L4VA 1YPZF 1ZGLB 3Q6GH 1U6AL 5HVWA 1AE6H 2HVKA 4M7KL 1MWAH 5F1NB 1A1NB 1FLTX 4U05A 5DSCA 4QRPB 1NC4B 3T1FA 4QF1A 1OY3B 4HUWB 2J5LC 3AAZA 3HI1A 4IS6B 1IKNA 5ICXB 4EQ2A 1L0QA 4QRSB 4ONHA 5LG1A 1UXSA 4LHUD 2AP2A 4UT9H 4E9LA 4WW2A 1AFVH 3UP1A 1C5DA 5F97E 2CLVA 4JFDE 3VDBA 4NQUA 3B9DA 1BVKA 2DQIL 1H3GA 2MWCA 3GKZA 2A9MH 4F15B 5GS2D 4A6YH 4BSWB 4OJFH 5EU3B 1QUNA 1DE4A 1QNZH 3T04D 4J3OC 4TOYH 4JFFD 2ZSVA 3H2WA 1X5XA 5KAQG 2FHFA 4JY4A 3VXMA 3K2UH 4XCNB 5TDNA 3TZVD 1DQLH 3MYZA 3MRJB 1AC6A 4RX4D 3TA3A 4JRXB 2DQJH 3AXLA 4XPBL 5KSBE 2VISA 5GJTL 1IEAB 4AENA 5B39A 4HUMB 2JCCF 4WW1A 2W65A 3FT4B 2OZ4H 4AT6A 5DJDB 3MODL 5GSRB 2D7OA 1KCUL 1E6JH 1Z0MA 4WDIB 4B41A 4M1CC 1U36A 4PJIE 3BH9B 4U0RB 4MDJA 1KGCD 1WWCA 1N8ZB 3RVXC 3LQZB 4TUOB 5D96B 4QHUA 2YZ1A 2WNGA 4JQIL 3S4SB 3AFLA 3P9MB 2YBRB 4UV4L 1J1XL 3CLEL 3K3QA 4M7ZB 4OCYL 5J6HA 5BS0E 1DBAL 4XBPA 5E2VL 1IC5H 3QEHB 3MJ7B 1RZ8B 5L8JB 4HUKB 4WV1C 4M6ML 4PJ7A 4QRPA 4XXCC 3RKPA 3TT3L 3U1SL 1RK1A 3QG6B 5D7LB 4A6YL 2MOVA 3IRPX 3N85H 4JRWA 2VZVA 3TN0D 3WE6A 2CDFB 4FOMA 5DR5L 4IHOB 5J1SC 2W0KA 5JZ7C 4UB0H 4WY7L 5MI0B 4YHML 5E8OA 1RUQL 3K1KC 3MJ8A 4J23A 4H8WH 4XNYH 3HG1B 5HHOA 3HC0A 4EDWH 1T5WA 4GXUM 5GZND 3HUJB 2RB8A 2P5WA 2E7LA 5E99H 1A9BA 2EYTB 5AAWA 1IGIH 4H1LH 1OP3H 2FECL 4Y4KC 4FQQA 4TULL 4NQCE 1SM3H 1OL0A 4PJXA 1YJDL 1JZ2A 4W4OC 3FQNA 3WSQH 1QSFD 4F9LA 3EOAA 4HUUB 1CFTA 4KDWA 5HXMA 3PWLB 2D7TH 5I71C 1BFVL 1X9QA 3VWJA 1KJ3H 5IW6A 3S36X 3IDYB 3LRSB 1KV3A 2EDKA 2X41A 1Z9MA 2Q6WA 2GYSA 3BP4B 5I66A 1KN4L 1JPST 4ODWA 4YLQT 3ES6A 5JW3L 2ILLA 3LKRB 3FT2A 3UYRL 3DYOA 3RVWD 4L5FL 5E6IB 3KHQA 4PJ9D 1TZGL 3U0PA 4LLUA 1OAKH 4U1HA 4KKAC 3DSFL 1IGIL 3BKJL 1KTDB 3MNWB 4P4KB 1ZVYA 5JHLH 1FCCA 3UZQA 5CJ5A 3RVUD 1A5FL 4WEBH 1J0ZA 3U1SH 4ODSH 4Z0XB 2H2PD 3TPUA 3CH1B 1IAOB 1B0GA 4DOHE 4P23C 2VAAB 4GMTL 2GI7A 3NCJL 4O4YH 3ZMRA 1T22A 1G9NL 5FA3B 3NTCH 2A6DA 2B1HH 3PL6A 1IBGH 1KTDA 4KQ3L 4NN5B 5DHVA 4I3GA 1KXVC 5IGXL 3U0PB 1HHIB 3UJTH 2DLFL 4TSAL 4EUPG 1J87A 2EEBA 4EI5D 2E7LC 2BOBA 4LDEB 5A16B 1RMFL 1EEZB 3LRSA 4X4XB 1OGTA 3EHBC 1UVQA 4LLWB 1YYLH 4MDIA 2EIDA 1FJ1B 1EIBA 2BC4A 3SJVA 3W81A 4MQ7B 1MJJA 4FMKA 2I60H 4ZNEA 4BFIA 5KS9A 4RWYH 1CGSH 2F58L 4DQOH 3KS0H 4E41D 3LPWA 5GISH 1JHLH 1CE6B 2BHZA 2Y1VA 3CMOL 3D85D 5IFJB 1QSFB 4QOKD 1P2CB 2FLBT 1NC2D 4JRYD 2XNAA 5I8EB 2AV1B 1C5CH 4MQ7A 1QVOB 4WUKL 4PJBF 3QPQC 3SDDB 3MRGB 1U2CA 4GG6F 2EYRA 2X4NA 3RZCA 1U8OA 4IRJC 5IB3A 1EBAA 2VUYA 3IGAB 1JNHA 2VDNH 1NPUA 1FNSL 5FEBA 5E9DD 3QXDA 4FQJH 1D5IH 4XWOD 3BESR 1HEZA 5IBTH 3U0WH 4ZAKC 5C8JB 1ZT7A 3UTSA 1RIVH 1KCVH 3LEYH 2O5YH 1CR9L 2GFBA 1TNNA 4G6AD 4K3EH 4LNRB 1AY1H 1LK3L 5TE7H 1KXTB 5IVXA 1JRHH 5DDHA 3TVMC 1N6UA 3U4BL 4H5SB 1HSBA 3EJZC 3TWCH 5J13B 43C9A 3FMGH 5CKGA 4AYFA 2LFGA 1MEXL 1AC0A 1VADA 4KH2A 4QOKE 1HYSC 5ALBH 5H35B 5IHUH 1AO7A 4LPWA 5E6ZA 3VCLB 4XAWH 4ZOBA 4BH7B 4HKZA 3KPSA 2ICWI 2OR7A 4QRUB 1PZ5B 1T2JA 2VXTL 1VADB 5DJ8B 2L4OA 4PLJD 5JIHA 2Z31A 3U7WH 1HI6A 3NZ8A 1JV5B 1B3JA 2Q76A 3C6LC 4LPTA 1F11B 3BP6A 5IIEA 1BQHB 4NRXA 4HPOH 4LARL 4D3CH 4KUCF 1TTFA 3T4AA 2DJ4A 4K2UL 2ZOKB 1QLFA 5C07B 5FGCE 1E4KA 5CMAA 2OS7A 1JPTH 1YJDC 4LK4A 3UTSB 4R7NB 1J1XH 2XKNA 1R3JA 4TSBH 4OD1L 4L3EB 1HNGA 2XWTB 1XMWA 5CHNB 3ZHDA 3IU3B 1U93A 4U6XA 1RIVL 4EN3B 4H8WC 3QO0B 1VFAA 3CVHH 5GGUA 3F7PC 1ZLUK 3KYOA 4FQXB 3LQAL 5HDOA 2AJXH 5HPOA 1NBZA 1UA6H 1E6JL 5D2LB 2KL6A 5DVNA 3MRRB 1SY6H 5C0BA 1GZQA 2PXYD 1JNLH 3D85B 1FVCA 1HHGA 1U8IB 4OZGA 3A67L 5CEZL 3JV0A 1OP5H 3GMQA 2NY5L 3VRLE 4N9GA 1BBDL 2IJ0C 2FGWH 2VH5L 3LRGA 3QHTC 5CHNA 5K93A 1WVZA 4L3EA 2MKWA 1NMBL 2ORBL 2I26N 2Q8AL 4G6KH 1M05A 4PGEB 2R9HC 2CXKA 4M6MH 2HJLB 1S78C 4JN2A 5C08D 4PJEF 3L3JB 1QTYT 2VLJB 3MMEA 5DA0B 3L3IA 5KG9B 3VRIB 1YECL 3O3EB 5HHME 1NAMH 3G5YA 1HYSD 5C0RL 5BJTB 4N8PA 1AXTH 3IRZA 4PTUA 4LCCA 3LHPL 3IDXH 4DOHB 2P8MB 1NGZA 3S35L 2WANA 4N8VA 3UBXB 2EXYD 2QSTA 4LHUA 5DJ2A 3GRWL 4M62H 4LIQE 5EORH 4UT7L 4HS3A 2J6EH 3LB6C 3LMJH 1KJ2H 3FRPG 3FO1B 2HH0L 3EO0A 1NCBH 4X9FA 3D0VA 3ARGD 2OSLB 3MLZL 2IALB 3GJFH 4OBRA 4XBEH 3A6BH 4G8GB 1YYML 2DQTH 4ZD3L 2JCCB 3W0WD 5JPMA 1TZHA 3CDYA 4IRZL 3KPSE 4G8FA 1JGDB 4NCDA 1DANU 2IALA 3O11B 4KVCL 1J0IA 3FFCE 1REIA 4RMSA 4ONHB 4PJHF 4QTHA 4GBXC 2HH0H 1RZGA 4X7DC 2NXZD 5DWUL 3VFRA 4YEFA 3ILQD 3IDYC 3FCTB 1J05A 3G5VA 4D8PB 1E27A 3RVVD 1Q0YL 3MLSL 1UFUA 3BJLA 1OB1B 5C0BD 4M7JH 1ZLVH 2QSCH 2E27H 4YEEA 1A1MB 1RUKL 5CEZE 1AQKL 4Q2ZB 3EHBD 4OZHE 3VU2A 2D03H 1UWEL 5T1LA 3IFNH 1AXSA 1HDMA 5BZWA 4JJ5A 2WLZA 1RMFH 1CVSC 1MWAL 3LDBB 3QWRD 1JYXA 3VXNA 3S97C 3HE6B 3H9SD 1F00I 4NCC1 4XWOC 3K2UL 1G9EA 3MLTA 3EDKA 4XB8A 4LFHG 3D39A 3N1GC 4AQ1B 1CU4L 4XBEL 1RK0A 1U9KA 4X80H 3MLVH 3D25B 4A6YA 2E8ZA 2LU7A 3PWJA 1WITA 4XC3H 4BM7A 1HINL 4BQ6A 3VFRB 4Z76B 1MCOH 2HLAA 4PD4K 2Z8SA 4I0PA 4HEPG 3H9SA 3QAZB 3DURB 4PJBB 1NQBA 4ZNEE 3RZWA 3RUGA 3L5XH 2VZ3A 2ESVA 4HGMA 4WVRA 4RQQB 3PP3H 1K8DB 1KB5B 5FYLL 4ZFOB 1WZ1H 5JPMB 1U3YA 1E4JA 3BVNB 4LOUD 3DSNA 2DBLL 2R39A 2Z92A 5HYEA 1HZHL 3CNKA 3ULSA 3BISA 3QG7L 1AIFA 3QIBD 5HDBF 4AQOA 3LQMA 1QFPA 4U1LB 3GKWL 1IEAA 1WTGT 4AENB 2G2RA 2YWZA 1QR1B 5C0GB 4YHZL 1TJIL 5A1AA 2CK2A 1YY9D 4XAKE 2NYYD 4RNRA 3WDIA 5HDBE 3U82B 5IVZA 5FM5M 5D2NC 2AGJL 4U7MA 1GPOH 1SMAA 4HPOL 4JDZB 4LARH 4OLWH 1HQRA 1FVEA 4LSQL 4Y16B 4FFZH 5DURB 4U1LA 5E8PB 3T77B 1DCLA 1ZGLP 1TMCB 5ABDE 4BSVB 2VLLA 5T1KB 3BSZL 4B0MM 5GRWA 4DKFH 4HLZG 4PRDB 4NP4L 4MB4A 1L9NA 5D8JL 5F9AC 2XOTA 4HFUH 5CLWA 4OZHF 1SHMA 1ND0A 2Y36H 4HG4K 2IADA 4X4YB 2IFFL 1FNAA 1I9IH 4KJQC 1NGQH 2VXTH 5IB5A 3CFEB 3DVGA 3NAAH 2ZSWA 5GZOD 4PJXE 3H3BC 2RFXB 3L9RB 2X05A 1BMGA 3TYGH 1HXMA 4M3JA 1TENA 3RKDD 5L8KB 5HHQB 4JFED 2BNUB 4YDIH 5EO1B 1T5XB 2GAZA 3QIBC 4GAGL 4M7LL 4OF3A 4WO4B 1A6TA 5EC1A 1DBMH 2FECI 1Q38A 1QPPA 3O2DH 3BZDA 5LGJB 1YJDH 1P1ZA 4Y5YB 1D5BB 4N0RA 3ZKMC 4ZFGH 3BPNB 1TFHA 3DECA 5T1DH 2GTZA 4I18A 3TO4A 3WEXB 5CZKA 4F7CB 5IQ9B 1Z9OA 2ZNXA 7CGTA 3U9PH 1WF5A 3C5JB 3EO1B 3SPVA 1WFOA 5KZCB 1V8HA 1I9EA 3T2NH 4JM2F 5JO5A 2BRQA 3IFPB 4PG9B 4CDGC 5A3IC 5AWNL 1KTLB 1YC7A 4XWGH 3QDJA 3T0AA 1GRWA 3RIAK 5JZ7D 4UV7H 1C08A 2KZWA 5FKAB 3RWGA 1I8LC 3X12A 1NBYB 2XZCL 5T5NF 4H1LB 5I15L 2BC4B 1HH9A 3J8F7 3TLRA 4ZPTA 3GSVA 1M1SA 2Z4QB 3LKSB 4P2QB 4X8XA 4G8GE 1ONQA 4LSUH 4UU9B 5H8DA 5FHBL 4JRXA 3MV9B 1EEZA 3DLQR 4Z78B 4HC1A 2H8PB 5FYJE 5DQDL 1HH9B 4HK0B 5DMKB 1WBYA 4YHOL 1T7XA 5JHDA 5SX4I 1LEKA 3RWGB 5GZOC 4KZEL 3BHBB 1JHLL 1T66C 3MLUH 3QP3A 2H32B 3I6LE 4MS8D 3WFBL 3LPGA 1G6RA 4JVPA 4OF5A 4WHYG 2NY3D 3D9AL 4OIAA 5TE6H 5I1GL 2RHEA 3HI5L 3B6SB 2Q7YA 4P2CG 5IK3A 3B4NA 3S35H 4PJ5B 4OSUL 1S7QA 1CFNB 2NY7L 5C0CB 2BXYA 3VFTB 3Q5YA 4FQHB 2NX5E 4JO3H 1R3KA 3TO4C 4ZO7A 3NOIA 2XYCA 1T5XA 2GAZB 5JXAL 1G1CA 4XXCA 4MNGA 3SOBH 5F1SA 2OP4H 1A7BA 1RY7B 2WZPD 5HYSB 1MPAL 3I3BA 2AEIT 2J88L 2WIIB 2DQTL 4ZD3H 1QVOA 3WN5A 5HGAB 4JN1H 4KHTL 5IP4A 4U1JB 2EH7H 4CBPA 2ATPA 1RZ7H 5EA0L 5DEGB 2IPTH 1AQKH 4L9LA 5JMOC 1S5IL 4BZYA 3I6KB 5IUSA 3UTQA 3UTTA 4PYHA 1CLOL 1MFNA 3GSOB 4EIZC 3VD3A 3KPNB 2C4XA 4PRNB 2IH3A 1U3HD 4G9FE 4NOFA 1F97A 4LSPL 1CF8H 4PJCA 3CDGA 5DUML 4PJEB 1WCBB 1NCUA 2DWDB 2F54A 4WGVB 5ECJE 3WHXB 5K9KB 5F6HI 2GTWB 4IRSD 1MSPA 4NKOA 3OKOB 1T6WA 1ZA3B 3EOYG 5EOQH 4LRNH 3CXDL 4JHAL 4O2EB 1N64L 3ZT5A 5CJBA 1GGBH 4BH7A 3I3DA 2FX8L 2W07A 3RDTD 3G6JA 4Y2DD 1M6OA 3C2SA 3V9FA 3E1F1 5DRNA 3TBVB 4JDTL 4TUKH 3MFFB 4TSCL 2NYYC 4JKPL 1FN4B 1M6OB 3G6DH 1EUTA 5C07A 1RZ7L 1A4JA 4G42A 2ZOKA 1J7VR 1LILA 2VB5A 1LO2H 4HS3B 5CJQL 1BOYA 2VL5B 5JLZA 3K46A 3ZE0F 4OGYL 4N0CD 5L2JA 5DLML 3NFPB 1ZT1B 3MV9E 5SWSD 2B39A 5I1CH 2HJKA 4H0IA 3RFZC 2NX5A 1KJ2B 1JV5A 5CBAB 3RI5F 3D0LB 5FOJA 1NCDH 3RUGF 3D0LA 5HVFB 4QRUA 4ZDHB 4AEIL 4NQCD 1A7QL 5HYJA 5IG7A 4UT6L 1HOCA 1R5WA 2LV4A 3H42H 3PWVA 3REVA 5IB3B 1NC2B 4JN2B 3KJ6H 3MLYL 4X7TA 3RY6C 4RCAA 1MCKA 3PWPB 2HG5B 1RZKL 2BDNH 2FNBA 2AK1H 3HRPA 4FFWC 3VGFA 1TJGH 3EYOB 3SE8L 3QHZH 2VC2H 5JOEA 3TBVA 2VLRE 3T2OA 1P6FA 4GMSL 3V6FA 1VB9A 3OMZA 5IF0B 1T21A 2R8SL 1TVHA 5TE4L 2YPKB 3UTPE 1TJIH 5DDHB 5KN5A 5HHNB 4OCNC 4K07A 5J1AB 4NFDA 2XQBH 4G6AC 3GMQB 3U30B 5IROA 2DMCA 1JP5A 3LKQA 3QWOA 5E4EC 1PQZB 3FQRB 2B7DT 3MR9B 3TZVC 3BRGC 1MNUH 3NIGE 5HPMA 1DEDA 4IRJA 3HPJB 2NTFB 4Z7UE 4OZFH 2ESVE 3NCBB 4PREA 5KSAB 5GRJL 2ICEA 5I1KH 1FLRH 4PRPD 4YQXH 4XPHH 4ZUVA 3N85L 2VLKD 3MR9A 3BE1H 3LKQB 3TV3L 1AGFA 2QQLH 3BWUC 4H26B 2PYEA 1A2YA 5KAQF 1NCAL 5ITBL 4KTDH 2VLRD 3ULUF 1C8PA 3BIKB 3D39E 3T4AB 4R8WH 3V6OE 4G8GA 4ALAL 4V1DB 1NL0H 1AP2B 2IBBA 5D2LE 1UWGL 2BNQB 1JN6A 1PAMA 1CXEA 2FJHB 4NKDB 3CUPA 4ZFFB 5CKAA 3ULVF 5L7XL 2DQEL 3FQUA 3RIAF 3G9VA 1NLDH 4GRWH 4OLYL 3STBA 3CX5K 4FQCH 3SDAB 4LHUB 2VITA 1YY8B 3ME0A 5C0JA 2P8MA 4NCC2 1NEUA 1UCTA 4Y5YC 4X6DF 1J0YA 3QXAB 4Y2DA 4ZUWB 1AP2A 5BJTA 4KAQL 1B88A 2VLKE 3L3OB 4JPKL 5BOPA 1L6ZA 4XWGL 4K9EC 2ZPKH 5BMFH 2ADFH 2X1PA 5C09D 2QR0A 3IF1A 1E4XH 2HJFA 2JCCA 4OI7A 1FLRL 4RFNB 2GJJA 4MSWB 4QNPE 4OLYH 1RHHA 3RWCA 3T2QA 3TPKA 4O58H 4NFBA 5GIRA 3EO0B 5DMIL 3CU1A 5MEOA 4WHYH 5E1AB 5BQ7B 2EDEA 1FBIH 3QUMB 1QRKA 3KPLA 3RX5A 2WV3A 1T80A 3IJSB 1KUMA 3BH8B 1CBVL 1UWXH 1LNUB 1NDMB 3VGGA 3PGCB 2EDDA 3PWPE 4LASH 4KROC 5E94A 5MP6L 2GY5A 3GMNA 4B53A 2YXFA 4M00A 2X4TB 3QUZB 3RQ3A 1AE6L 2C7UB 4AEEA 1G7PA 2GJZB 3IDJB 3BPCB 2VN4A 3FO9A 3TCLB 1FFQA 2J8OA 3C60A 4BK4A 2M8XA 4DW2L 4HK3N 3VGEA 5CSZB 5E24E 1S5HA 1L7TH 1V05A 3LB6D 4AH2B 5DO2C 4LSSL 5EIIA 4WCYL 2RJMA 5C3LD 3RY4A 1LEIB 4QLRA 5IHZA 5AZEL 1KPVB 3EZJB 5EC1B 4PRHE 2GJZA 3IDJA 4Q2ZA 4HKBB 3CMOH 4LEOB 4UTBL 5IBUG 2FEDD 1KC5L 3MGTB 5E8NA 3T65B 1LDPH 2ZNWA 3SKOB 4HJJH 4XNMB 5FO8A 5JMRA 1XF2A 2VO5A 5E2WL 4DW2H 5F3BB 4V1DD 5C0GA 5D1QA 1I7UA 5GGRA 1MREL 3QJHA 3K81A 3AXLB 2VZOA 3SCMB 1YDPA 4NRZB 5DJAB 4ESKA 4LSPH 3HB3D 4AIZA 2W60B 4JY4B 4DGIL 1N6QH 5D9SA 1UB6B 1AIFB 3DI3B 2XZAL 4WTZA 2BNQE 4Y19B 4LOUC 2YBRA 4MJ4A 2VLLB 5T1KA 3VWKB 1UM4H 3FB5A 5D5MF 1ADQA 2VXSH 1T83C 5E8PA 1KB5A 1RULL 2VOTA 5HYIA 4PD4J 4YDJB 4QRRB 4HJ0C 3THMH 1N5YL 1Y6KR 2AQ3A 5DJYA 4FQLH 4OFYD 2GY7B 4Q6IC 1MQ8A 2VDOH 4WW2B 4AT6B 4B5EA 4KKLC 1ZA6A 3BP5B 1G0DA 3UJJL 2HKFL 4AIZB 4BELD 2BNRA 4WW1B 5DEZA 4JO4H 5C0AA 1F6AA 2APBA 4D0DB 4LSTL 5JUEH 3EOAB 3L5WB 1SYSB 3MJ9H 3KXFE 1DQDH 3VXMB 3LKNA 4PJFA 3LV3A 1K2DB 3KGRA 4I3RH 1FORL 4PJIF 2IAMC 1UQSA 3HMXH 3SDAD 3IB4A 3L3HA 4ZFOA 4PRAB 2ESVB 2X5PA 5C0FA 4LU5H 5IEHB 3EJJX 5DQ9A 3QEQB 3ARGB 1A6WL 3TYGL 2XZCH 4IMKC 3WEXA 3FAXA 2PW2A 1F90L 5IW3A 4PY7A 4BZ1H 2CDFA 3OX8A 2NY5C 1Z9LA 2UZIL 4P5KB 2AJ3A 4ZAKD 4CADA 4XPAH 5GGQL 1A6TB 2G75A 3RZCC 5HJ3B 2JB5H 3PWNA 4PJ7B 5HJ3A 3PQYE 1TCMA 3ARPA 3GJFB 3L7EB 1T2XA 3U0TB 2FZ3A 1AD0A 2HT3D 4HIHB 5D96C 1PY9A 3IFLL 5E0QA 5GS1A 3DX9A 3GBLA 1CTNA 1FPTL 3GRWA 3L3DA 4OZFG 1MFCH 2AEPH 1YEGH 5DQ9B 4BQ9A 3J7HA 1VFMA 3CGTA 2ERJB 4WGWB 4NDMB 3V6ZB 2ZCLL 4TPRH 4F8QA 5FO7B 2DQUL 5ELIA 1MY7A 2H3NA 3FO2B 1BVLA 5DFTA 3BHBA 3SDDD 5D93B 2WWKT 1MVFA 4MD5A 2X09A 4HK0A 5DMKA 2B1AH 1I3GL 4MQTB 1IFHH 2P5ED 4HKXB 2IBGA 1J10A 4I3RL 1UADC 1MRCL 1FC1A 4HWEH 1OGTB 3MNWA 2R0KL 4P4KA 5EU6B 3WSQL 4HJGA 3DIFB 4U6HB 2UZYB 1OP3K 2BSTA 4KHXL 5KS9E 1A7PL 2Y07L 3GI9H 1NMAL 1H15B 3GJEA 4RNRB 5ACZA 5TQ0H 3NFSH 3X12B 5JHLL 5MERB 3DIFA 4U6HA 1KTLA 3PWLA 3DX8B 5D7LE 5MI0C 4GW4A 2MCPL 2D2OA 2DL2A 1Q72L 3ZDXF 4E0RA 4MD5B 2VAAA 5E8EB 5K59F 1OSZB 5I75B 4JRYA 5F8RC 2L0DA 5HHOD 3MLRL 3L5IA 4KTEH 3P0YL 4XGZA 1K85A 4DN3L 3KPOB 3T1WA 1KIRA 3G6AB 1OAXL 2EXWC 2XZZA 4NKIH 1XFPA 4U0QB 2VR5A 3OF6D 3D18B 1CL7L 5E8DH 4X6CF 5KTEH 3VG0H 2XA8L 2ARWA 1OAUL 3GHBH 2V7HB 4Y19D 3AVEA 4WI3A 3QAZC 3WJJC 1EUUA 4QNPF 4X6CB 3OKMB 4LGSB 2FX7H 5BXFB 1U6AH 2G5BB 5KBNC 5L2KD 5DS8A 5JOPE 4N0YL 4R97B 3N1QC 4OM0L 4X6BA 4Z7WF 5DT1H 1BX2A 4NQEA 3HRZA 2WBKA 3QEUA 4P4KC 3INUH 2P47B 43CAB 1PQZA 3TESA 3TO4D 4PJ5E 5J3HD 1RURH 5FK9B 1I9JH 3L7FB 3CDFA 1LO4L 2B20A 3BXNA 3TVMA 1A1OB 5CJQH 5B3JF 4XVTL 4S1RH 1IC7H 3QPQD 1XIWC 5GGTA 5GHWH 1X4ZA 4YAQA 2VE6A 4NRXB 3UTTD 1OAQL 1JI1A 2BRRH 1YY9C 4YDKL 2V5SA 3QO1B 3EYOA 4JJHA 3T0DA 2VDMH 1ZTXH 4OJFL 3V52H 3C9NA 1VFUA 4O02H 5CD5D 2IAND 1DSFH 4LGPB 2I5YL 3WFCL 4QTIL 5AYUH 1WIUA 1HKLH 2CIIA 2P7TB 3MCKB 5T33H 4N9OB 4ZDHA 2E27L 3GNML 3O6FD 1FNSH 3VD4A 1N6QL 3IJYB 1F6FB 1X3DA 4L3CB 2FEEI 3EW3B 2BY1A 4O9HH 4RAHA 2YPLD 3CLFL 2VDML 3VXSE 4PJ5D 1W0VB 3C87A 1IVLA 5GGSA 3M1BA 1RFDH 5CEYB 2NXZC 2CIKB 5F1IA 3WKML 5EU6D 4R26H 3LEVL 3O4LD 5D6DA 4MXQC 4OAWB 3KR3H 5D6CA 5BV7B 4OF0A 3FB8A 3NZ8B 4GW1A 3N50A 5CINH 4D9RE 3CLEH 3M17B 1BJ8A 3PWUA 5I1LA 4GBXA 4Z5RA 1D9KD 1XF1A 3Q3GA 4WV1A 5HD8D 1IGCH 1BLNB 3PNWB 1CD9B 3QNXB 4O9HL 4ELKB 4NM4H 2VUOA 4WNQA 5FDWA 1GOHA 3WKNA 4ZFFA 3PGFL 4J12A 1N5AB 1KCSL 2GKIA 2QSVA 5IBUB 3SKNB 2AS5M 1CGXA 4F7MB 1HH6B 4KJWD 4OD2B 3SJVE 3VXUD 4JR9L 3PIQB 3QUYD 5DD0H 2EDNA 3WLBB 1P6AB 4WU7A 1IT9H 4Y4FC 3V5KA 2AQ2A 2FX9L 3G5ZA 3GGWA 4GUPB 4JKLA 3MRQB 4RGMB 25C8H 4H26A 1F8TL 2EDQA 4M02A 3GMOA 4EKXA 5J89A 2KDGA 5GRJH 3DBXA 4YHYB 3N1PC 5I1JL 2J8UA 4UQ2B 5FHAL 5L9DL 3B43A 1ZLUH 1BFOB 1KG0A 3FO9B 2Z91A 4FQCL 5HI3C 1IAKA 2BJML 5DK0B 3O3DA 4TVPH 4JFOB 1I1CA 3LH2L 3HFMH 4KI5E 1R5VB 2AJVL 3JSSA 3FQRA 4MD0B 4GG6E 4CVZB 3U46B 1UACH 1B2WH 5EUOA 1BD2B 2MTPA 1S9WA 3W0WE 4P3DB 1BECA 1GIGL 2EE2A 3G9AB 3C5ZB 2DQHH 2EDFA 3KPLB 4XX1G 3BDBA 3OKDA 1AD9B 1BFOA 5DMGD 2ORBH 3W0WA 4G80B 3LMJL 3K0WA 3TJEL 2YPLB 5IKCB 2OTUB 1A3RH 1X6LA 3DPBA 1DP0A 3GMOB 2A6IB 5EZIH 4BUHA 5IFAH 3LDBC 1TJHH 1I8KA 4GRLC 1VACB 3ARUA 3EGSA 4X6FA 3PGFH 3RWFA 4CW1A 1LD9A 3ULUH 3B2UD 4NC2B 1FBIL 2J3SA 1TITA 3MOAH 1MRCH 1ZT4A 5DD5L 2MFNA 1Q9OB 3QWRA 5E70A 1OAYH 4K3DH 3CFBB 4DGVL 3F7VB 5J13C 4PTTA 3VXOB 5ISZB 4G9FB 5EOCH 3FOLA 5IGXH 4NWUL 1KJ2A 3TYFA 4TULH 1J8HA 3V7MA 2ZCLH 2GJ6B 4TPRL 4PG2A 4UOJA 1FNFA 1VA9A 4PR5B 3EOBA 2X89A 3RBSA 3OR7B 4BA8A 5F7UA 4R7DB 3ZTJH 8CGTA 1FV1A 4WW2F 5CIPA 4S1QH 4JGMA 3CUPB 2XTJE 3NN8B 2A6IA 5AAMA 2JF1A 4K94C 2E9WA 4Y4FD 3U9UA 1JIBA 4GRWB 1OAKL 3ZDZE 3TBWA 3VFMB 1FIGH 1R24B 2DQHL 4QRPE 3OKEB 3BIBX 4AIOA 1KC5H 5D7JC 3CFCL 3QDGB 3LY6A 4IEFB 4DGYL 5F7HA 4FG6D 5EUOB 1PKQB 4U6YA 4ZUUA 1ZHKA 1MF2H 4N1HB 3RA7H 4JM2A 3IXAB 4U1SB 2X4OB 4PJCF 1D5XB 3MRIB 5HY9A 5CP3A 1U8HB 4YBQC 1BBJA 2PKDA 2FJFA 5DXWA 5E2UH 2Q1EA 1WZMA 4BKLB 5IQ7L 3BKCH 4NYLB 5DF0A 1NGPL 4GAYA 4TTGA 1F4WH 4TTDD 2YC1B 3OKNB 4HIJB 2WBJC 5AEAA 4PY7B 4ZO9A 3VXNB 1WBXA 1WIPA 2DLFH 3CSGA 1W0YT 1B4JH 3MGTA 4FZ8H 4TSAH 2FYYA 3RHWK 3QWQB 4F58H 2VN7A 3MGOA 4PJFF 3CVHB 1HYRC 4M8QB 2PYED 1MH5B 2ED9A 2P8PA 4ISVA 3DVIA 3AU1A 3DHMA 4Q9RL 1CL7H 5E8DL 4HSQA 3GSRB 4MXVF 2Q8BL 4JREC 1EPFA 3HC0B 3EDEA 3B9AA 4MAYB 5E2WH 4WUUD 1EFXA 4MNQA 3THML 1N5YH 4ZFOL 5DC4B 5KANI 1RZKC 1CU4H 3LV3B 4IIQB 4HIJA 1U2HA 4PJ8C 2A1WL 2DQDH 5I1IL 2KH2B 4OF8A 4OI8A 3IAPA 2ID5A 5CUSL 4L29B 3EOBB 4W6YB 2OCFD 2RGSA 4NO2A 1BF2A 4HUXA 3TA3B 1FIGL 3QUZA 5BVPH 5J6HB 1FNGB 4D0CA 3SE9L 1UZ8B 1YEEH 1OWWA 2LU4A 4MYWB 1QRND 4QRRA 4Y5XC 4HGWA 4K7PY 1OTSC 1XCQA 4UNUA 2B4CH 1MWAB 1NSNH 2AJSL 3D48R 1U8JA 2X1XR 4TUOA 4WRLA 4KJPC 4JEGB 2EDBA 4MJIA 4PS4H 4KZDL 4LRIC 4GLRI 2XRAL 1NGPH 1WZ1L 2J1KA 3ULSB 4BUGA 2UVFA 1N3NA 4WUUE 4GKNB 1FFNA 3EYFA 5JUEL 5CP7A 3BKYH 3LS5H 5JXEA 1F02I 3TNNB 4UU9A 5B38A 2BSED 3CIQA 3GHEL 2BSRA 3EDJA 2HT4C 4Z95H 4XCNA 5TDNB 1NSNL 3H9SB 1MHHB 1RI8A 1W72B 1NEZB 3ZZ1A 2E9BA 2AEPL 5E8NB 5SWZA 5JIIA 1LP9E 5DHYB 1FYTA 3GJFA 4KMQA 1X5JA 1AHWA 2CSPA 2VABA 4GRWE 5FO9B 2E6QA 5JQ6L 4M3KB 4OCXH 3W5NA 1KELH 1HN1A 1WFUA 2WWKO 3T3PF 2VLMD 4LSQH 5FOBB 1KN2H 3TA3C 2DF3A 5E2VH 4F7CA 4NNPH 4YX2H 1MCQA 5JIKA 1JZ5A 1BVLB 3RI5K 1I9IL 4Y5YA 4Z7WB 2WQRA 1MELA 1DBJL 5I1CL 3E6HA 1XGUA 3QRFM 2YD9A 1YEGL 2ADJA 4JFHE 3HE7B 5HGAA 2ZKHL 4TNVK 1RSFA 3DETC 4H25B 4M7LH 2FZ3B 5HYSA 2IANA 1G9ML 1UH3A 2HT3C 4TVPE 1IGMH 1Q9WB 1YNKH 1ZVSB 4JFYB 3E6HB 5E99L 3ZKMD 1D7FA 4KKLD 3RIFF 4X4YA 3KDMB 5DUBA 3ZHKA 4Z77A 3W11D 4OZHA 1X4XA 1IQDA 1ZEAH 1BGXL 3VWKD 2BY2A 4Z7WA 3UTOA 4NO3A 3MRCA 3TPUB 3O0RH 2N7BA 4ZTOL 3WFEL 3VGHA 2DM7A 3OXRB 1SEBA 1T83A 1F4AA 1V7NH 2DDQL 4UB0L 5HI5D 3RAJL 4APQB 1CFQA 2FR4A 3OR6B 3KWWA 3OB0K 3H8NA 5DA4A 5I15H 4P46B 1OTUD 5DZLA 2FRGP 4M1GL 1RJLB 5E6IA 3N06B 1LK2B 1A6PA 3ZKQD 3PDOA 3LKRA 3VFNA 5C0NC 2PTTA 2JLLA 5L2KA 4KDTC 1ZEAL 3CFJA 4J8RB 4NM8L 4PB0H 1FZJB 3QDJE 3O6LH 5F96L 4GKSB 1BQSA 2CKNA 3BMWA 4TN9A 4TTDC 4XP1H 3VFNB 3E6FA 4PJXB 2G5RA 4PP1C 1G7JB 4P57B 5LBSL 1UZ6E 3FB8B 4GW1B 2NQCA 4ZTPL 2UWEB 1P84K 1U92A 1RJLA 3B2VH 1S7UA 5SV4A 3HR5A 1MJUL 2QSCL 2V9TA 2VE6B 3O2WL 3FO2A 3C08L 3OGCB 3KPRE 1DLFH 4XPFH 4HUVB 3O9WD 5EU5B 4CNIB 1RAMA 5EWIL 3ARVA 5IW1A 1WK0A 2CH8A 3CK0H 4NO3B 1A6AB 4HIEA 4RIRB 2DI7A 2BVOA 4RGNE 1F3DJ 1M7DB 2V9RA 1TIUA 3T8XB 4F7EA 3VDAA 3NABL 1FVDB 3HRZB 4S11A 1RZJC 5KSUA 1I9RH 5I8OH 4KUZH 2ZJSL 3KDMA 3QXDB 3HPLB 4Z77B 1AQDB 4ODXB 1MCNA 4Q0XH 1JNHB 3NCJH 2W0FB 3TCXA 4S0SD 2HVJA 3HZYB 5D2LF 4NN6C 3CCHB 3Q0HA 4CAGA 3C9NB 4OQTH 1BWWA 1J1OH 1VGKA 4W68A 2XWJB 4HAGA 3U2SB 3PL6C 4RIRA 1OVZA 1QA9A 3S6CA 2DYPB 3CZFB 5JPNB 1DUYA 2RCSL 4YXHL 4DVBB 1HILA 3KYAA 2M2DA 3QZWG 1AJ7H 5MEPA 1J5OL 5DURD 3WHXA 5K9KA 5BRZD 3DV6A 4Z7VB 4M7KH 2F54B 1FH5H 3ZTNH 3LN5A 3IFOA 1FNEB 4JCLA 3FQXB 3PHQB 1NGWA 1S7UB 3MBEB 1OSZA 5JDJA 5HTSA 3KXFD 1S7VA 4LBEB 4EI6A 3OXSA 4RFEB 4PP1D 5TDPA 1VERA 1RUKH 1N6VA 3O2VL 2C3XA 3RWJA 5KSAC 3ILQC 2NY3B 4K3JL 5DJCA 2EKSB 2DKMA 4LHQB 4X6CA 2IPKB 3JWDL 3QRGH 4RDQF 1DN0B 4M48L 5E2JA 3Q1SH 3V7AG 4N5EC 4PG2C 2YS4A 3NCYP 2V7HA 3BPLC 2NX5B 4Y2DC 3VFSB 3RL1A 4GS7B 3NFPA 5KSVB 4POUB 3DTXA 4KC3B 4WI4A 5HDQL 3ARDA 1YN7A 3DUSB 1DFBH 5E5MA 2MQ0A 4F8TA 5I8KH 2YD6A 4MQSB 2VWEE 1RZKH 2BDNL 4RMVA 4G6ML 2ZCKL 4YDLB 4LLYB 5AZEH 2CRIA 5D70L 3F62A 4OQ1A 5GRUH 3PHOB 5GS1C 3JWDH 1YQ2A 2AQ1A 1KT2A 1AD9A 4IOFC 3QZWB 1T4KA 5I1EL 4ZUTB 1DR9A 2IFFH 4P3DA 3ETBF 3SHSA 3H9YA 1NAKL 4QOKA 4FRWA 3KNBB 4L4VD 4UBDC 2BVQA 1ZHLB 4WUUA 3BN9D 3QG7H 5E9DE 1IT9L 1ZHBA 5I1DA 3FMGL 3RRQA 5I6XB 4GXUN 5HVGB 4PJGB 4XMPL 1GOFA 2DTMH 4CVUA 2BY3A 3DO7A 1CE1H 2WBJA 3L95B 2J8UB 1LD9B 5DUPL 4PJAF 4AL8L 4RFOL 1S7VB 4UDTB 1B0RA 2ICWA 4K55A 1K4DA 2X6MA 1GL4B 3ARFB 4NQDB 4I18C 1P2CA 3DETD 5D72H 6FABL 3GGWB 1QLRA 2FWOB 2HRLA 5HHNA 5D2NA 5ITBH 1QRNB 2FWOA 4FA8A 1X5GA 1M4KA 3BXNB 5IF0A 4RISH 1H9VA 2CRMA 5F9WB 1HH6A 5KS9F 2WSKA 4ZNCD 5BRZB 5I17A 1KF9B 3VW3H 4I2XA 4XCCH 1R5VA 3K2MC 3EYVA 2DQEH 4XC1L 3CFDA 4MZ2A 4XP9H 4G8IA 5D1XB 5HHOE 4OGAD 5I6XC 5DK0A 1UYWH 3QIWA 5GGRY 1X5LA 4GBXB 5HPMB 4YK4B 5E1AA 5BQ7A 1PYWA 1YPZB 1FORH 4XPHL 2XKNB 1KN4H 4HLJA 4C58B 3IU4L 4JGJA 1YUHA 2J6EA 3HAEG 3I85A 2N1KA 3FHAA 4LKXB 4UBDD 4N0FA 1U8QB 4Z7UA 3F12B 3AY4A 3RAJH 3BD4A 3ARDD 4F15C 5ALCH 3MLUL 2EH7L 5L2KE 3PIQA 2EYSA 3QISA 5ICYA 5DEFB 2QQKH 3NN8A 2AABH 4GRLB 3CMGA 2MJWA 2L7JA 3TBSB 3QXAA 3QDAA 3VXUA 2YD4A 1CFSA 2C3HA 1R3HB 3MRLB 5E4EB 3WUWG 1YY8A 5J8OA 4M5YL 5D72L 2IBZY 1FAIH 3KPRB 3IU4H 4PR5A 3HAEA 2AXHA 2XN9A 3B3IB 3MLZH 2JJTA 2YUWA 3TYFB 3QIWD 4TYUA 2WWMD 3PGDB 1F4YH 3D5OF 4PTUB 1QBML 4RX4A 3TA3D 3KPMB 2OZ4A 1QFWH 3GSQB 5IJKC 5I1HH 5I2IB 4LCWD 3MRFB 2VDQH 4NPYB 3MMEB 2VDLL 1J8HE 2LVCA 3LS4H 4XHQA 1UYWL 4J3VA 4YHYC 2NY0D 1SJEB 1GGBL 4JG1H 1I8KB 2E7MA 2UWEF 1JWMB 3MJ6A 3GK8H 3B9KB 4IS6A 2GSGA 5EU7E 3TCLA 4DN4H 3P30L 1QQDB 4Q58C 1YEDA 1NC4A 3DV4A 1BP3B 3HG1E 4NJ9H 3VWJC 1BBJB 3VXSD 1P4LB 5IR1B 1YMMB 1ROWA 4PJBA 4CRPA 4FQXD 4I0PB 1OAZL 4RMUA 5TJWK 1IM9A 2HA1A 1B9ZA 1I3UA 5DK2B 1WFTA 5JR1L 3NA4A 1I7RB 1YMMA 2E7BA 1J88A 2CDGA 2YMXL 4PRHB 1KB9K 1NGXA 3FB6A 4CMHC 3QUMA 3MJ7A 1XAUA 1T7WA 2OQJA 4M5YH 3SGJA 5IT2L 2O5XL 3ULVH 1MIEH 4WEMB 1GZPB 3V4PL 1U95B 1J8HD 2RAMA 2P43B 5EUOE 1KEML 3N9GL 3ARGA 2VDRH 1UT9A 5DFVC 1JHKH 3S4SA 1T6VN 4NOBA 4CGTA 4K9EL 1T1YA 4GAJH 5DJXB 2EIEA 5ESVB 2NR6D 2OJZL 5IWLA 2OXGA 4LMQE 4AK1A 2O5YL 4HJJL 4L4JA 1D5ZA 1A7NL 4HBCL 4HCRA 1CZ8L 5FXCH 1VGEL 4E41A 1DVFB 3RVTD 1R5IB 2W65B 3MBXH 2C9AA 2XQBL 4MCYA 3V6OA 3HN3A 5F7YC 2UY6A 5B38B 1JL8A 1DSFL 4JQIH 3PP4H 1WICA 2HLFD 4HFWA 4MA7H 4L4TE 1ZA6B 5CEZD 2EXWD 3B9KD 4R97C 1HINH 1XF4A 2VZTA 1GGCH 3S5LA 5DJYB 4FN0A 5D5ME 5E00A 1Y18B 3DROA 4HPYH 3U7WL 4O2CA 4MX7A 1IC7L 4PV9B 4Y4HB 1FNHA 5SX5H 1NLBH 5IHLB 4A2LA 4PJGE 4LU5L 2V2XB 4LLUB 1XZ0A 2OBGA 4BH8A 1UB5B 5JOFA 1JUFB 1DQLL 1H15A 2FLRT 2W60A 1AD0B 4I0CC 1QFWI 4JB9L 3ZDYF 4Z6AT 2VL4A 1UEYA 4ALAH 5J9PB 4L29A 2ZWLT 2AEWA 3ROOA 3SBWA 2OR9H 4CADB 5F7KC 2QTEA 4UNTA 4PJ9B 2PTVA 2HFEB 2H1PL 4H25A 2XI9A 5TF1H 3DVNA 1KCSH 3R1GL 5JW4N 1KJVA 5C0FB 4YGAB 5D7IE 2CUIA 4JZNB 4Y1AB 1T1YB 2IMMA 2P8PB 3CXHJ 4ISVB 3T0ED 1Q8MA 5HI4C 1EFXD 4MNQD 5ADPL 2ZOLA 1FSKC 1XIWA 1RD6A 2GHWB 4K8RL 4PRID 4HC1H 3P0VH 3DX9B 4JHWL 3DNKA 5CFHA 1M7XA 2JJUA 3TIDA 4U6VH 1RK1B 2YKLH 1IM3B 2UZIH 3NZHL 5F3HB 4GQPH 1N7ML 3SKUD 2EDOA 5FGBC 5HHXH 5T1DL 3RGVD 4D94A 4MMZC 4OT1H 1Q0XL 3DVFA 2DYPD 3V0VB 4R6UA 3VFTA 4IJ3B 1NMAH 2AK4B 1JNNL 1JK8B 3QFJD 5TQ0L 3C6LA 2X4QA 3LSOA 3IFLH 5IB5B 1LO3H 4Y4HC 5TQ2L 1V7ML 3HS0B 4XGZB 5I9QC 1X5YA 4JANA 1T22B 2NY6B 2B1AL 2XIDA 1E4XL 5JW5B 1GC1C 3JV6B 5FYJL 2X10A 4XC1H 5HGHB 3JV6A 3HZMB 3C8KA 1S7SA 5I8CA 4P0DA 1FGVL 3MLRH 3FHQA 4P3CH 1BFVH 3RWEA 3ZL4H 3O45B 4EBQH 1CQKA 3GSNB 3MREB 3OSKA 3MRJA 5DJ0A 4YBHA 3NFSL 4R8WL 3O2WH 1PEZA 3ELAT 4H1LA 2YEZB 2B0SH 4POZD 4ENED 5DJ0B 1IEBA 5BZDA 3VA2C 1BWMA 5F9DC 2B5IC 3QFJA 3MFGB 4MJ5A 4P59H 3U79A 3L5JA 3UTTE 1K3ZA 1IZKA 2VDLH 4JPWL 1JNJA 3TVMB 2D7QA 2Y6SD 3W39B 1UKSA 3L7FA 4KXZI 3LRHA 1IL1A 3HZMA 2K3TA 3MLVL 4B50A 4ONOA 3UBXG 2VZSA 4AG4H 5D93C 3VMOA 3F5WB 4NQEB 4U1KA 2YSSA 3DV6B 4Z7VA 4X6EB 4R2GC 4Q6IB 5KTEL 3O8XC 4XP4H 4GS7C 5DK3A 4F3FB 4IMLA 1R3LB 4IOIA 2VKXA 5J57B 2JB6A 1N0XL 1DQML 1PG7L 1JYVA 2FIRT 4S2SB 4U1MB 4JQXA 2JIXA 1GHFL 3KG5A 3LN4B 3M8OL 5DFVD 5EU6E 3W2DH 1FG2A 1JMXA 3PL6D 4S1QL 4EN3A 1UKTA 2VLJE 1ZS8B 3VXPA 4WI8A 5IQ7H 2ARJA 2JELL 1KNOA 4XVSL 1M7DA 3T8XA 4GJTB 1MCOL 1EHAA 2PW1A 2R56L 5C0EA 1ZHNB 5CMAB 5DJ6A 2BMKB 3GZKA 4JZOB 5EU5A 1RQ5A 4GW4B 3FB7A 3MCLL 3CFCH 3P9LA 3OGCA 1J18A 3MRKB 3Q1SL 1AHWC 1RULH 3UPCA 4OZ4A 2CLZB 2VXQH 3QCVL 4YXKH 4PRPB 1D6VH 5FDWB 4R90H 1EAPB 5LXGL 4P46D 4HS8H 3DGGB 1H0DA 5F7EH 4ACPA 3REVB 2W0PA 4YE4H 1FSKB 1HOCB 3EOTH 2IMNA 2FIKA 4WU5B 1CFBA 5T3ZH 2CO6B 4JDTH 4X83A 4K8RC 4HIIA 4HFUL 4LVEA 4F9LC 3O8XA 3QR2A 4FQIL 3T09A 1ORQA 1VEOA 3WDJA 1PDKA 4OAWA 4Z7UF 3K4AA 5IK3B 1HSBB 4NO5A 3VFGL 1M71B 3IDIA 4LCCC 4S1DC 3WIIH 3RU8H 3MRDA 3V5HB 1ZLWH 2MQCA 5CP3H 4G9FD 1TQCB 1BIIB 1DBBH 5LCVL 4JZOA 1GSMA 5I76A 5AUMB 1VGEH 3MV8B 1H8OA 1JPGB 1YZZA 5C09A 1AGFB 4TOYL 3PUCA 3D0VB 5F88B 4PJAE 4KK9C 1OW0A 3S7GA 5DD3L 4PLNC 3ULUE 4NN6B 4ZFZB 4HMEA 3C09C 5GGQH 5D2NE 2PO6A 3QHZL 5DC0A 3SBWC 3UJIH 4C83A 1GZQB 4K7FB 3EFDL 3BD3A 4KRNA 1BOGA 5LCVH 1KJMA 3FN3A 5TF1L 4ZSOB 1QSED 4JFFE 3BKML 3G5YB 1YMHB 4XBGB 3TWCL 4LEXL 5KSBB 1C16B 5F7EL 5DMYA 1ACYL 1F8TH 1AGDA 2I07A 2XRAH 2GCYB 2JJSC 1YEKH 1TQBC 4ZG1A 3DBXB 3BN9C 3ARGC 2CUMA 3HUJF 3FQXA 2OL3A 1AI1L 5GPRA 5ANMB 4ZYKA 3L95A 1E27B 2K7PA 3V5KB 2X9YA 1JF5A 1NC2A 3WUWA 1OPGH 1Z3GL 4NT6A 4G6JL 1R5WB 1BZ9B 2ZG3A 3MXWL 4PREB 5CILH 1IZJA 4HT1H 5KSAA 3STZA 3BUYA 1U8HA 5AZ2H 1JGVH 4OD3L 5GSVB 1S7XB 4KTEL 1FVCB 2A73A 4UUJB 4NC0B 3PGCA 5DJ8A 2QHRL 4P49A 1Z2KA 3V6OC 2HYMA 1EJ6A 5FECB 3BH8A 4NQDE 1CGYA 3LN9A 1NBZB 5KVGH 3ARQA 3ZO0A 4QRPD 3OWEA 1I7TB 5IB2A 3PJSA 3NVQA 3IDGA 3TZVA 4QHMA 3TIEB 4PJ9C 4JY5L 4ONGL 3RA7L 3TBSA 1X5HA 3ARFC 4J2XA 4NNYB 4LVOC 5AZ2L 2FBJH 3R06A 2EYSB 4I0PC 1VKXB 1BJ1J 2HJFB 1IGTA 4Z7VE 1BF8A 4I1NB 1JNLL 4P9MH 3P0YH 4YPGA 2FB4L 2R4RL 1AH1A 3WFHA 3QUKB 5C0AD 3JWOH 1IAIH 5GS2H 3MOAL 3VD9A 4OCWH 2AJZB 4OZFB 4KAQH 4QHNB 4ZUWA 1OLZA 2Y6SC 3N1MC 2EDWA 4YR6B 1ADQH 3HC4L 3UJTL 1FFPB 3PG2A 2VITB 1I7ZB 3F7VA 3ULVL 1RUAL 3AS2A 1R3HA 5EIVA 5EBGA 4XVUD 3BYYA 3VXUB 4KFZC 4IIQA 2VLKA 1BD2E 2OJEA 5C07D 4G43B 2VDPL 3L6FA 5EFIA 4P4RB 2DM2A 5GGVL 3HZKA 1GGUA 5T1LB 5EULV 1ZANL 3BUTA 1JGEA 3OKDB 4WHDA 4PJ7F 3GMMA 4X7FC 3IDXL 2DB8A 2PYFA 3UPRB 4KJYB 3ARDC 2X4TA 4P2RE 4XCEA 1A0QL 4NHCH 3MV9D 4NZRL 3AC0A 2R29L 4NYLA 1CLYL 4NJAL 4YNYA 5IOPA 2MMXA 2ADGB 3FAWA 2PR4H 4G8IB 2ITDB 3UEZA 2QBWA 5L0QC 1RK0B 1RZGB 3JZ7A 1MHPH 2JJWA 5J56B 4Q97A 4OLEA 3P73B 1FP5A 4L4VB 2YOCA 5DGQA 1ZGLA 1NJ9B 3DGCR 4J3SA 3T3MF 4HXAL 1AY1L 1LK3H 4EDXA 4MGXA 3QDGA 1MRDH 2A6JA 4ODTL 5BZWB 4FHBD 5ID1A 1UJ3A 3X13B 1T1WB 5I16A 2B2XH 3VFMA 4QHUB 5CZVH 2NW2A 3N1FC 3PXHA 1UQSB 1SEQL 5L88H 5IMLB 4WDIA 3T3ME 4G43A 5DWUH 1CL7I 1JFQH 5I71B 5CUSH 3KR3L 4QO1A 5ISZD 1ED3A 5EIQA 25C8L 5F7DB 1JGUL 2NXYC 1FO0A 4MA3B 4TQEL 2AK1L 3MRPA 4JAMA 3C2AH 4X6DB 2YUXA 4C55A 1EEYB 2Y5TB 3UTSE 1IARB 1D5IL 1R5IA 3CH8A 4JO1L 1VEPA 3FJTA 3TC9A 5MENB 4XP6L 4NSKB 5F7NC 5FYKU 5TH2A 5F9OL 1XGRA 4XRCB 1CXKA 2EEAA 2MPAH 5D7SH 3RKDC 4ETYA 4KKCD 2UUDK 4K71B 2E7CA 2NW2B 2GITA 4I9WE 5E95B 2F8VA 1QKZL 4YBLC 4GKNA 3QULA 3RWDB 3VJ6B 2I9TA 3HI6H 3WIFB 2HKFH 1Y6NR 5SWQA 4FTVD 3TT1L 2GQHA 4LVNC 2H8PA 3TM6A 1DBML 5IFAL 2AVGA 1VCAA 1DQQA 1UM4L 1URLA 1XGPB 3UZEA 1BJ1H 2D7TL 3LSOB 3O6KH 2HKHH 4HULB 3GSVB 2IANB 1UH2A 2PO6C 5I9QB 5GS1B 4JQXC 2CKBA 4LP4A 4KRMB 4OGXH 2D9QB 3T2NL 5ADPH 4OCSL 1CDGA 4NNXA 1TZGH 5HHMB 4QWWC 4ZS6D 3VFPA 4YFLF 2YA0A 3EO1A 3ARWA 4NP4H 5D1ZD 4PRDA 1LP9A 2YD1A 4M6NL 1FGNH 5IQ9A 1MLBA 4NN7B 3RDTB 5LWYH 4GG6A 3P4MB 3BQUD 3E3QC 3OAUH 4QT5B 1CGWA 4X98A 1FRGH 3ZL4L 5I1EH 1J0HA 3ULUL 3MTRA 4LCWE 2A6KA 4MDJB 3K1DA 1P4BL 5IJKA 3MJ8B 2BERA 2H2SC 4M7LT 1GPOL 1U8NB 3SKMB 1OAYL 4K3DL 1VFBA 1IEBB 4JPKH 1K2DA 2AXFB 2N7AA 4GXVL 2CKBB 1VGKB 4KDTA 4AZ8A 5LVEA 1BFSA 1KGCE 3O4LB 2GK2A 4Y4KB 3QT2A 3PWPD 4HF5L 5K9QI 3IETA 3TNNA 3IKKA 3VDCA 2YRZA 3F58L 1YMME 2YSSB 4XTRD 5LQBH 3OV6A 5L8LB 3SO3C 3QUXA 4IJ3C 5C6TL 4DUWA 3LH2H 5BS0D 5E8EA 4IRJD 5JW5A 1HHHB 1UACL 4GKOA 1LGVA 3L3KA 2OI9C 2DIBA 1RUPH 2JE8A 1G7HB 4KHXH 4HUVA 2P4AB 1W8OA 1HSAA 4MX7B 3ARZA 3LPFA 2J88H 4R4FH 3QUXD 2UWEE 4LLDA 2YEZA 4XHJD 1WBYB 4LQ1A 4W6WB 2IH1A 4UDUA 3GUTB 5F3HA 1L7TL 4M6OL 3ESUF 3ZTJG 2IBZX 4PRIA 1KJ2L 4LIQL 3FONB 3DX6B 4OQTL 1NBYA 1KLGA 2XNAB 4P2RB 1N2RA 3M07A 2OTPA 3PHQA 4Y5XB 1KIQA 1CICC 2A6KB 1K5NA 3MO1A 4YHIB 3TEUA 3UTQB 3HS0A 1LMKA 2BNQD 2Y23A 2AEQL 3WLWD 1N0XH 3B5GA 3EYSL 4G7YL 1YC8A 2EC9U 1KB5L 1KJMB 3X3GH 5FHBH 2YD5A 2XWJA 1IGFH 4PJ8A 2JTDA 3AS3A 3LEXA 1BQHG 3DUUA 1ORSB 1RUAH 4MNGB 3EOTL 4U1NA 5F89B 4BQ8A 3IGAA 2XZAH 1I9RL 4U7SA 1HXMB 3AB0C 2D3VA 4FQHA 2MHAA 3NACL 4QXUH 2IGFL 2BHYA 2P24B 4M1CD 4OCRH 1F4XL 2VDKL 1SJHA 5KZCD 3WIHA 5D7LD 3ABZA 5EU7C 4XHJC 4F3FA 3QDMA 3FFCD 4ZPVA 3K74B 3LS4L 3U83A 4NQEE 3OGOE 1YNLL 2Y06H 4JGUA 4YHIA 1I4FB 5IM7B 1EX0A 5L88L 3HNSH 5FUOL 3SKJH 1EERB 4N0YH 2MNUA 1N2RB 4KV5F 5ESQA 4YZFF 4WWKC 1ORQB 2VRAA 4YXLH 3CAFA 5EN2B 5ITFB 4K9EH 4WU5A 1OT1A 3PV6B 1XR8B 2NNAA 4P46C 2FH8A 5MERA 2PXYB 5ILTL 1G6RH 1BZ7B 3STLB 3NCEB 4J7RA 3PQYD 3BQUB 2RIKA 1PZ5A 3BZEB 4DCQB 5FF6B 2HJKB 1K6QH 1OT2A 2LU3A 1I8LA 4H0GA 2QJDA 3QA3B 2NY5H 5A43C 1AO7B 2YRPA 3MUZ1 2DBLH 4EEEA 4LKCA 1ZXQA 1AKJA 4FXGA 5BVPL 2HTLC 5DHVH 2PW1B 3CX2A 1KB9J 4PRBA 4KGJA 5DI8A 4X4MA 5F1IB 4M8VA 1I3RA 1HHKB 1C12A 5FDYA 5GS0H 1A47A 2F54E 1EDQA 2J8UE 4BFEA 1HILB 2LTQC 2PYEB 1K6QL 4TNVF 2FHCA 4QWWD 4ZS6C 5EB9A 2X4RA 4X5WA 4G3YH 1VESA 1NAML 2BHUA 1A64A 1TVBB 3OAYK 5KVGL 1RZFL 3F7RA 4YDLC 3VI4F 3BUYB 3WFZA 4OLUH 2ICEB 1DVFD 1FDLH 3DUHA 4PP2B 1Z5LA 1A7RL 1FL6B 3L3JA 2APWA 1FIEA 2D4FA 4I0KA 2VNCA 1G6RL 5BRZA 1BGXH 1CXLA 4PRNA 5IMMA 4DZ8B 1A21A 1HXYB 3RWIA 3DMMA 4Y8AA 3CSPA 3O4LE 3V4UH 1CD0A 1LO5B 3GMLA 1P4BH 3JWOL 5SX4H 1DN2A 4D2NA 4EOWL 5KSBA 4DZ8A 5HYQB 2DWEB 4XNXL 1IC4H 2OJEB 3WD5L 1B0RB 3T0WA 4OCYH 4WNQB 3WUZA 5C3TA 5JQHC 3IS1X 4Y19E 3RTQD 1T20A 3U36A 3OR7A 3CK0L 1TJGL 2NY2B 3KYOB 4FQXA 5I19L 3CC5B 3TNMB 3VCLA 2GJ6A 1ZKAA 1FGNL 4HG4J 2XXCB 2G9HB 2HTKD 5HHXL 5H35A 1RIUH 3IU3A 2FBJL 3TBYA 2IPUG 1JI2A 4YR6A 3AREC 4QOKB 4C59B 5EBMB 3MSPA 4L1DA 1PW3A 1LE5A 1ZMYA 4XH2A 5DEFA 1V3LA 1A6UL 1SJEA 2E8YA 3BW9A 4WFHE 4X0KA 3IDNA 5ANME 4ZTPH 1DTUA 2V2TA 3SCMD 2QR0B 3TBWB 2NY1B 1I3RB 1LO3L 3MRDB 4WEUD 4HKJA 1I8MB 4JHWH 1EZVY 1OLLA 2BNRE 4NNYA 5F21B 2FL5B 1UB6A 3REWB 3TIEA 15C8H 2XFXB 1JZ7A 5ENWB 2V5MA 3KPRA 4M6OH 4X4ZA 2D9CA 1GVIA 2QQLL 1A1NA 3G08A 5FECA 1SJVA 1CFSB 4HDIB 2CJUH 4F37F 1S5IH 3H7BB 2DI9A 1JN6B 1S7XA 3KPQB 1OAUH 4Y0GA 3HCVB 1QBLL 5F6HJ 5TQ2H 1DQJB 3U6RB 4KHTH 3L3GB 3A6OA 4NM8H 1CICA 4KQ4L 3GSRA 1XF5B 4R96A 1KYOK 4GO6B 4O02L 5TDOA 2CKBH 1NLDL 3OHXA 5ADOL 4O58L 4RAVB 3RNKB 1MUJB 2W9LA 2DLGA 1MUJA 1NEZG 4R3SA 2R23A 1IGFL 3P73A 1OB1A 1K8IA 2VQ1A 1KYOJ 3LQAC 5I74C 1LE9B 3H9HA 1H3XA 4FS0A 3BWAA 4FFYL 3NTCL 3FB6B 4YUEL 4PRHA 5EO1A 3U7YH 1NDGB 3LKPA 1F2XK 1I7RA 1K9TA 3EYQC 3DYPA 4P5MB 2DJSA 2B0SL 2WW8A 2X9XA 3CLFH 3PE9A 4OCRL 1W72A 1ZHKB 5C0CE 4HDIA 1NDMA 1ZWIA 4H20L 4N68A 4LNVA 3X11B 5C71A 4JZJB 4QHLB 4DGYH 2CQVA 3IJSA 3O6ML 4NWTL 4PUBH 4G6FB 4YHPA 2R2EB 5T1MB 1WJ3A 3RVWC 3JWOC 4YGVA 4PV9A 4Y4HA 2X89D 1FFNB 2ED8A 4M4RA 4AIXA 4ZOEA 3GBML 5KVDH 4K94L 2K1MA 3VA6A 1Y18A 3DROB 4C56A 5J6GB 5IEKB 1RHHB 4GAJL 3RWCB 3BKCL 3P9MA 1J1OL 2OSLA 3RWDA 1DQTA 3S35X 4KK9D 2LQRA 3F6LA 1PFCA 3PF2A 4POZC 2HN7A 4ENEC 4P2YA 1HQRB 4WFED 1FYTB 4LSRL 4XRCA 3MA9H 1QNZL 4ZAKB 2GJ6D 4M43H 2VLRB 5D5MB 1UZ8A 5BV7H 2E6PA 2V17H 4AEHH 5C0JB 3QIUD 1CD8A 5HBBA 2VYRE 3MRPB 3ARXA 4JAMB 4KZDH 3WIHL 1I1RA 3P40A 1YEJH 3T0VA 1ACZA 3K8MA 1GGCL 4HKXA 3ZSTA 5M95B 1MI5A 2ENSA 4LDOB 5HGHA 1EBPA 1C08B 5TE4H 1I8IA 5EU3A 1SVZA 2NXYD 4RWHA 1WBZB 5BOZG 2H3NB 3LEYL 2P5WB 4DEPC 5BS0B 5CEXA 2JB5L 1DUZA 5I1AA 4M43L 2VC2L 1INQB 3HNTL 5TE7L 3S96B 4OGYH 4JFPB 4XNYL 2R8SH 2P44B 1P7QD 3QXUA 3TN0C 5MENE 4IHOA 3MC0A 4LF3B 5E5UB 3ROLA 4OZHB 3TJEH 2OR9L 4LRIA 4XCCL 5KSBF 3BT2L 2NY4D 1WAAE 3G04A 5IHBA 2FO1A 3PWJB 2HTKC 1CFTB 3BEVA 1RJCA 1GYAA 1T04A 2R2BA 5A2KH 5I1KL 4IRSB 3G5XB 4LLVA 3HE7A 1OM3H 5IESL 4HUNB 1RJZB 5DD5H 2PW2B 1MFBL 4LAQH 5L6YH 3FFCB 2ZZUT 3KXFA 4H8WL 1NUFA 4F2MB 3AY4C 4ZXBA 2EXYC 1OSPL 2P45B 1LEIA 1C5BH 3P9WB 5F71A 2AK4E 1CVRA 3P4MA 1I8IB 1AO7D 2HT2D 3WO4C 3TVMD 3G5XA 5ETUB 2HWZH 2P42B 5F1KC 4NQSB 3BAEL 3AB0B 5SWSB 3SO5A 3KYKL 3VFVA 1BEYL 4KU1A 3CFIC 1KIUA 1DL7L 1BPVA 5C92A 2WUCH 1Q1JH 4J6RL 5DHYA 1P5UA 1T1XA 3QQ4B 3GJEB 4UAOB 1N7MH 5GGSY 1LK2A 1HHIA 1IILE 2ADFL 3VH8B 1V7MH 4JN1L 3V4VL 3V95A 3C5ZC 1F58L 3KLAB 2Q7YB 3QQ3B 3TP4A 1JNNH 3G6AA 4JVUA 4F9PC 3ULUC 4WHTA 3O81A 1G7LA 4Y5VC 3GM0A 1MF2L 1KCLA 4C4KO 1A02N 4PJHA 3MRCB 4ZXBD 1FYTE 5HYJE 4GFTB 3MJGX 8FABB 3NPSC 4GSDL 4PB0L 5AYQA 1UWXK 2NY7H 3VJ6A 2I9TB 2DBJA 3IJYA 3CH1A 3BGFC 2BSSA 1MIEL 1QFUH 3GEWB 3L5HA 4NFCA 4UOW1 1ZLSH 1PEWA 2R0ZL 4OGAC 3E2HC 5T3XL 5JXAH 1PLGL 2EE9A 4JFHD 1B90A 2V5YA 2IQ9H 1CT8A 1QR4A 3WS6C 5IJVA 3LD8B 3H7LA 4EN3D 2Z35A 2EYRB 3UTZA 2DDQH 4J3WA 5K9QG 4JPVH 1JK8A 5C0DB 4RAUB 5C6PB 2Y72A 4GOSA 3L7EA 2BSTB 2Q86A 1XR9A 2HFFB 3CXDH 5T1KD 3KWWB 2QADB 3C8HA 4I5BB 5A2IH 4APQA 3ARTA 1YEIL 4UILH 4UT7H 5JIPA 4JRXD 5C1MB 2DLIA 5F93C 3RDTC 2R69H 2MKLC 1ZHNA 3QJFB 1AGBA 2JJSA 4YFEA 2A74A 4R2GD 5C08A 2NZ9C 5HGGS 5C08B 2ICWB 5KJRH 2KBGA 2NY6C 1OF2B 4FXLA 4QY8A 3GSOA 4BQCA 1KEMH 3I6KA 3ZE0E 1FG2B 1KPRB 5FYJD 2VDQL 5JORA 5D7JB 5HSFA 4NQCA 2EIBA 3V2AR 4R4ND 5FUCE 4JFEB 2D03L 3MODH 1SJHB 1FZMB 1BAFH 5HGBB 1MHEB 3QDJD 5EWIH 2WIIA 2WP3T 1FZMA 3I2CL 1JF1A 2M1KA 3MRNB 4F57H 4ELKA 2C3VA 1S3KH 5DT1L 4E42A 1CT8B 5F89A 4DGIH 3Q3GB 1KG0B 4UDUB 3GUTA 4KKBC 3NIDF 1HHKA 2PR4L 1NCWH 1OQOA 1SVCP 5D7IA 3ULVE 4Q0XL 4WTWA 1QFOA 3KPRD 4U31A 1BJMA 3ULUD 1JRHI 2A74B 5JDSA 1J9CT 1AKJB 4EI5B 2QL1A 4ODTH 3BZFA 1QFWM 4MWFB 5D7KE 3ZE2F 1MCRA 3I84A 4Z95L 5KVMC 1JRHL 2NY1D 4YO0A 4MNGE 4LVHB 3WBDA 5HGDA 2C1OB 3VWJD 1OGAA 4RGND 1M71A 3DXAB 1B6UA 4OD2A 1HQ4A 5HDLA 4RGOH 2OLDA 3MCLH 1UM6L 1S9YB 3BZEA 4OM0H 3EUUA 5C2BL 1HI6B 1OW0C 3V79C 3MRMB 1MEXH 4P48A 4RAUA 1C1EH 1HIMH 4XI5D 4HWZB 3MCKA 1HWHB 4JM2C 2UZXB 4L3AA 3HC3H 5DJCB 1A6VL 5FYKL 2CRYA 4HHAB 4HKZB 4QCIA 5KVDL 2X4UA 4N8VB 4NNPL 3UBXA 4GQ9L 4HMDA 2CGRH 4TVPD 4WI2A 4RSVA 1FL3A 4CMMB 1SM3L 3ZYOA 2CLZA 3QYCA 5IMOB 4R4NC 4NKQB 4V1DA 5BRZE 1NFDE 1M7IA 3P4NB 3WL9A 2RQ8A 1Q0XH 2NW3B 2VL5A 4MLIA 5L2JB 5LGHL 1PG7X 3BIKA 5HHPA 1A4JB 1A1OA 3O3BA 4G42B 2CMRL 4W70A 2ITCA 5DRXA 4LKXA 1T3FB 2NY6D 2AJVH 4CW1B 1W0WA 2NTSP 4XI5C 4FQLL 1TPXC 3LOWA 1B2WL 3F65A 3VXRB 3MXVH 2EE3A 1A3QA 1OGAE 1K4CB 2G9HA 2ZCKH 4OTXL 2H32H 3I50L 2QADD 5EZJB 3V5DA 3VG9B 2E5EA 1T20B 3U36B 1CIDA 1AGCB 3N0PB 1DLHB 4OZGB 4LFHD 5FM8A 4AY0A 1MJ8L 3U46A 1T1ZB 2MCG1 2ADIA 5J06A 2R1XB 5D7SL 4CN1A 2DLHA 5J11C 3O3AA 3A67H 5DD0L 1QSFA 2YZ8A 3UC0L 4Y88A 1S78D 3QO0A 5SWSE 1A6VH 3DMMB 5GJTH 3U9UB 4I2XE 2BK8A 1CK0L 1IGCL 3B9VA 1MFEL 4OIBA 4I77L 5CIPB 4ODSL 4X7TB 1L4IA 3NIDE 2BVUA 4NZTH 3BP7B 1NAMA 4GAFB 2QSQA 4ZTOH 1AKJD 2FJGB 1WZLA 3QNZB 2VAJA 3HCVA 1J8HB 4HWEL 2QKIA 4JREB 3IXAA 4QYOB 5C07E 2WBWB 5DYOA 4HT1L 4L8SA 2F58H 2VJXA 4XZUA 4J3TA 4ZUUB 3STLA 12E8H 2X4RB 3GM8A 2C3GA 3O11A 4M1GH 1DE4B 2DMKA 2ZUQC 3QUKA 3IYLW 3O6FA 2X7LB 1T0MB 1IQWL 5FYJU 1JJUA 2ZUUA 4DZBB 2F53D 2A38A 5KW9H 2ARJQ 4NZJA 1T66D 4NKDA 4E41E 2DM4A 2FL5A 1VACA 3MNVB 1KPUB 5I8OL 4OZIE 3WJLC 5E4IA 4FXGB 1DL7H 1SY6A 4QRSA 3SN6N 1FAIL 5I0DA 4D9QE 1Q9KA 4YIQA 3OB0H 4ZOCA 5IB2B 3OG6B 3T1FB 1XCQB 1A2YB 3QJHB 2VKWA 5DJ2B 4X0KB 5FM5O 5F3BA 1EO5A 1A4KA 1LE5B 1GAFH 4XZUB 1NJ9A 4NSKA 1LWRA 1INDL 1CI5A 1LDPL 5D1ZC 1U3HC 1TZIA 3QDMD 1CDUA 4G9FA 1L6XA 1NDGA 4LEOA 3RL2A 4LVOB 2CKBL 5ADOH 2NY4B 5ESAA 3VRIA 1C5CL 4M61B 3TO2A 3BWAB 4EN3C 2HN7B 2MSPA 4POYA 4R90L 5KANG 1EGJL 5CS7A 4R3SB 1F5WA 4XCEB 3MX0A 3HTLX 2BP3A 3HMXA 4LLMB 1A9EB 4NRYA 1F4HA 3INUL 3LKOA 4XAWL 3X3FL 3BPNC 5J4MA 3GMRA 1DEEB 1S7RB 5GRXG 3SDCB 1JGEB 4OFPA 3WFBH 3RWIB 2VABB 4M93B 4N1EA 1G7PB 2P5WD 1UJ3B 3I9GL 3TFKC 4EI5C 4PLOB 4EUPH 4KV5E 5IVNA 1RJZA 1OAQH 4LVNB 4Y4FA 1UXWB 3C09B 2O5XH 4I9WD 1CLCA 4M61A 3TO2B 1F6AB 4H88L 2P48B 1EFQA 3MUJA 2FJFB 4B7LA 2XFXA 3RY5A 2YN3A 4JM2B 4U1SA 3MLWH 4FTVE 3NBNA 5GRUL 3SEPA 4XP6H 4LF3A 2Z8VC 5GRVK 5CSGA 3QUXC 1PKQA 4U6YB 4Z7NE 1NUGA 5F9OH 1SBSH 1P69B 3RZCD 4PY8J 1QZ1A 1IKFL 2V5TA 1QSVA 3EYUH 2XV6B 2AGJH 1XF5A 4OIIH 1SYVA 4O5LH 3T0BA 3W2DL 3UMTA 3L3GA 1U91B 4O2CB 3BH9A 4HGKC 1BAFL 5CEXB 5I1AB 2VSDA 3X3GL 4HCRH 4JLRB 5GQBA 1A7OL 1IGJB 4MS8C 2VLKB 2P5EA 4CU7A 4X9GA 2VR9A 3LKNB 4BSVA 3DX7B 2CD0A 2XWBA 5MENA 1IMHC 3V0WL 1SYSA 3EIFA 5HHVL 5DJAA 5GISL 5A3ID 5JA9A 1QEWA 1FVEB 3IETB 3WS6A 4JKPH 5CAYB 1QEWB 5ENWA 4OZIF 2X70A 3GB7A 2CGRL 2FD6L 1E28A 3D3VB 1R3IL 4MVBC 4E41B 1KCUH 3T65A 1X5AA 2XN9D 1VFBB 4HKBA 1QR1A 5HYFA 5IW6B 4XNQB 3LZFL 4BSWA 5DJZB 2QHRH 3BGFB 4GAGH 3NPZB 4NC1C 4I18B 4JFQB 5IVXF 1BBDH 3GSXB 4Z7QE 4LLVB 2DQJL 4U6TA 3QUXB 3UCRA 1FL5B 4PJBE 3HUJA 4GQ9H 3E0GA 3SE8H 2HKHL 4Y89A 2YPLE 4NNXB 1CR9H 3I50H 3IDMA 1NGQL 4XMLL 2DN7A 4X9BA 4PGCA 3L3DB 5GRYA 4HIHA 3DRQA 2IC2A 4PBVC 3HE6C 2WK2A 3JTSB 5FA4A 3PWNB 3S96A 1WC7A 1MCEA 2I9LA 1H3VA 2IADB 4OD1H 2AABL 3O9WA 1EO7A 3S34L 4Z7VF 1ND0B 1KIPA 2Q20A 5DVMA 2FCBA 4RGNC 2Z93B 4U7KA 3NA9H 3MRBA 4ELMB 5EBLA 3UX9B 1WTLA 3BZ4A 4X5XA 3SJVB 1XCTA 4RMQA 4TNWF 3I02A 4AJ0A 3O6LL 3S37L 3RHWF 3VD5A 3W9EA 3D3VD 5DS8B 4JDZA 5BZDB 1HK6A 3RVUC 1U92B 1S7WA 4WHCA 3VXMD 5C9JB 3D9AH 3KS0J 1MHHA 4RMWA 4EDWL 3VRJB 3I75B 4GKSA 4OUUB 2GSIA 4DVRL 2AJYL 1JCKA 2LVEA 4GSDH 2IH1B 3VE0B 5FA3A 4WI7A 4X99B 2BSSB 3NH7H 2EECA 1NUDA 4P5TB 1G6VK 1TJHL 2R0ZH 5A40E 1S9VB 4LHJB 3BE1L 3TV3H 2ENYA 3VGDA 4XPGH 2FR4B 5E9DB 2HFGH 1OTTC 3MOBL 3PQYA 3ZHLA 3C5SB 1IBGL 4KQ3H 1RUPL 2VERN 4JO2L 3WYRA 1BZQK 3GHBL 3VFSA 1PGRB 5ICZA 1ZT7B 3QNYA 3S98A 3C6LB 1FO0L 4CL7A 2W59A 5A2JH 1C7SA 3BQUA 2AK4A 3FT2B 4XNZB 1S9XB 4BK5A 1P1ZB 3V7AE 3ZDYE 3VXPB 1A0QH 2P7TA 2D0FA 4HH8A 4U1IB 1T1XB 5D71L 5M7QA 3OKOA 5EUOF 5FYLH 4M5ZL 4HJGB 4LPCA 3ZTNL 3PP3K 3DARA 1H0DB 1ORSA 3EAKA 4CJ1A 5TFSH 5I18H 3MRGA 3HZVA 4EI6B 2OTWB 4JFEA 4Q9RH 2EZ0C 2GJ6E 5FIEA 1D5MB 3HC4H 1A7NH 5IFHH 3P9LB 1CZ8H 2BVPA 3P77A 4HD9A 4N90E 1TVHB 5DJ6B 5B38G 4Z18A 2J2ZA 4GBXD 5F8QC 3WKMH 2IG2H 5EG6C 1QA9B 1S3KL 2R1XA 5DVLA 2ZUWA 4U1JA 5JW4Q 1HIML 3HZVB 2G60H 1FJ1A 3X17A 1ZOXA 2ARJB 3QSKB 2WBJB 1E4WH 4AMKL 5D1QD 4MA7L 3BGMB 3O4OB 3LAFA 4I5BA 5F6IC 2PCPB 2DRUA 4AG4L 5D1XC 1PBYA 5C0IA 4ODXA 2EDTA 1A14H 4IRJB 2CPCA 1E0OB 5INCB 1QG3A 1I1AD 1XH3B 2DQCH 1H3PH 2OZ4L 3M17A 2N56A 2R1WB 1MI5E 3MV11 2BVOB 4KK8D 3UTZB 2OK0H 3QUML 1J5OH 2R0LL 1YEEL 3QZWA 5B39G 5CEYA 1X7QA 4Y4KD 4X6EA 5AD0A 1KT2B 2VZ1A 3X14B 3RWHB 2HAZA 4OGXL 3F5WA 1GHFH 4YXKL 2PN5A 2V9QA 3P4NA 3WL9B 5CGMA 3QH3B 4CVWA 3RNQA 4YK4C 3PP4L 3MFFA 4NZUL 4L3CA 3MUGB 4KI5F 1MHCA 5DRNB 2HG5A 3PWPA 4MHHG 2A1WH 3S37X 5C9KA 2VDNL 3RPIA 4KRPC 1QLFB 3G6JB 1YN7B 3DUSA 4QRTA 5GS0L 4XMPH 3H0TB 3TT3H 3DTXB 2WUBL 5DLMH 3QRGL 4PGDA 1TDQA 3RGVB 1TCRA 4DCQA 3B8YA 4O2EA 4LSRH 2Q76B 4P2QD 1FRGL 1R3IH 3MRMA 2AK4D 2R1WA 1TCRB 4S10A 5EOTA 1HQ4B 2NNAB 4NN5C 1DDHA 1ULVA 5AWNH 2C1OA 3QFJE 3GIZL 1H8SA 2Z0BA 2FX9H 2DWDA 2CXGA 3QPXL 4Q9QL 4S0TD 3RPIB 3F7QA 4DKEH 3TFKD 2YHGA 1ZV5A 3FTGB 2OL3B 1JBJA 4HF5H 4JM2D 2OM5A 3MBEA 1EV2E 4MAYD 2B4CC 5F7MC 3S8WA 2YPLA 2F5AL 5CD3A 1CTOA 1LHZA 4BFBD 3C5ZA 3FRUA 2JIXB 4LDLB 1WIOA 3HFML 1HHGB 4FFZL 1TVBA 4NUJB 4UAOC 5C0BB 7FABL 1NL0L 4PYGA 4HZLB 3UDWC 5EZOL 4MMXC 5IMKB 1YNTA 3QIWB 3FRUB 3GBNL 5GGUB 4EZMA 1HWGB 5D70H 1KELL 3E8UL 4OV5A 3WO3B 4D0BB 2XWTA 3VXRA 2OYPA 5LQBL 3S3SA 3SGEH 4QHKJ 1EZVX 4MJ6A 2ZUTA 1JPGA 2FO4B 5DRXB 1KEGL 4KJWC 1H5BB 5DQDH 4WU7B 3QDGD 1HHJB 4XCYB 4UIMB 3FO0L 1EO8H 2A9NH 1MCSA 2NW3A 3FQTA 4IOSD 3SGJC 3MOQA 3H7BA 4UDTA 2AKRB 5LJYH 1X5ZA 3C60D 3QI9A 1FV1B 5FYJH 2BZDA 2YD3A 3VXSB 2W92A 4JFDB 3SGDI 3G08B 1BQUA 4N8CL 1B6DA 2D4DA 5IVXE 1ZHBB 5B22A 5J3HC 1EGJH 4QTHB 4RGNB 3REWA 4YHKH 4KUCD 2KPNA 4S1SH 3SCMC 2X1QA 1UM5L 1KCKA 2FJHA 2WBJD 1EXUA 3U7AA 3OG4B 1JVKA 7FABH 2C4FU 4HXBL 4YPGB 5DC9B 1ETZA 2VLJA 1IGTB 2F15A 3HE7D 3UDWA 1U8QA 4Z7UB 2DL9A 4L4TB 1KOAA 2HJLA 3C08H 4G6FD 3X13A 5GJSL 2F74B 4EDXB 1X6NA 4JHAH 1YN6A 4Y2DB 1XF4B 4D0CB 4KROD 1XF3A 4PJXF 1G0YR 3TBYB 4NHUA 4MJ2A 4HUWA 2ITDA 3OAZH 1KTRL 3TGXA 2ADGA 3NABH 4KZEH 3MLWL 1OQXA 3QUZC 4TUKL 4XT1C 1WT5C 4YXHH 1CXFA 3HE6A 4F58L 3ZLQC 5I1HL 2NCMA 2HFGL 2DWEA 5IR1A 4JJ5B 3EYUL 3DV4B 5F72S 4Q9BA 4OKVA 4MAYA 3JTTB 4OSUH 4UIKH 1MFDH