4UUJA

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujA02
4QHUA 1BJMA 4Y4KA 3BKCL 3PNWA 3JBG7 4P5TA 3QDJE 4R3SB 2VLME 3OKEB 3DECA 3MV7E 1AD9A 5EWIL 4P5MB 1YMMD 3C2AL 3EO1B 4W4NA 4F3FB 1MFNA 3BZFB 4P3WA 3JUYA 2BNRA 2VQ1B 1MVFA 4RGNC 1UZ8B 4MGXA 2IQ9L 3FONA 4WO4B 1UJ3C 3SO3C 2CUHA 2B0SL 1CDBA 2DDQH 1EGJH 5DRZA 5J7CC 1MFEL 1CI5A 4UV7H 3ZE0E 4WENB 3VXPA 2KUTA 1IE5A 1SJHA 4OSUL 3WIIH 3VDBA 4LLDA 1AY1H 3I6KA 5F71A 3WFDL 5HI3C 7FABH 3GSUB 3PF2A 2QKIA 3BE1H 1BIIA 1T1WB 4GBXC 2X1OA 5BO1L 2B7DT 4YHIA 5FYKE 3L3KA 2N7AA 4G6KH 1OF2B 4XI5C 3NH7H 2R4RL 1FVDA 2OI9C 3VCLA 1UM4L 1CE1H 1XR9A 4XI5D 3ROOB 3S3PA 4IRSA 3STZA 2FJGA 1WCQA 2HWZH 3LEYH 3E3QC 2E7LC 2VH5H 1HHGA 2ITDB 5IEHB 4LNRA 4M7ZC 4DKFL 4LCYB 4NQDD 4WI9A 1OSZA 1GH7A 3GMPB 1BQLL 1W8OA 1NCWL 1VESA 2PO6C 4HCRL 5KJRL 1SJEA 4TUKH 3M8OH 5IEKB 5FUZL 1JNLL 3HAEA 3DWTA 3SDYH 3D2UA 4R26L 5FHAH 3BYTA 2F15A 2D7OA 1INDL 2J88H 1KYOJ 2EC8A 3IF1B 3IDGA 1BFSA 5D7LA 3S96B 4TUJA 3L5WB 4P2RD 2XQBL 3DVNB 2X4PA 4LSUH 1R5IB 2FZ3B 3WJLA 4PPTA 1Q94A 5K9QI 2ZCLH 3PHQB 1CGYA 3MUY1 4TSAH 4BQ9A 1XH3A 3TNNA 5C0RL 3RJQB 3OG4B 4L9DA 3VXRB 4WW2B 1G7PB 4DAGL 2MQ3A 5FA4B 5T1LD 3RWEA 1G6RB 1MUJB 1EEQA 1JZ2A 4NPYB 3NN8B 2R1XB 4M62L 4XXCC 3E6HB 2XXCB 3VDAA 3EFDH 4F8TA 2ZG1A 5BZWB 5I75C 1NANI 1TQCC 4V1DB 4X9IA 2C3HA 2CSPA 2OK0H 4R6UA 3SDDB 4MD5A 5D2NE 3S4SB 4ZDHB 1IILE 5FAAA 1WBXB 3O6FA 4L5FH 4OIAA 4XBEL 1WBYB 5IW6B 4RRPG 1KBGL 1F90H 5BVJB 5E08H 3U4AA 2YPLA 3D25A 3UTSB 5HYJD 1DBBL 2WQRA 3DUUB 4KKLD 4RGOL 4ZTPH 4P4KC 2BDNL 2FD6H 3FT2B 3PWUB 2OZ4L 1MOEA 1QO3A 2CLRB 4P4KD 2XFXB 3C6LB 4U1SB 1DP0A 3ULVL 4C56E 4YEFA 1NCTA 3MNZB 3IFPB 4N0FB 2VSCA 1P2CB 2EIEA 1E0OB 3WUWB 1R5VB 3KPSD 5A16B 4JFOB 2QADD 4RMQA 4F15C 1F02I 2VXTL 3CX5J 2H3NB 4JPWH 4JG0H 4WDIB 4CU6A 5CP7A 1UWEL 3QFDA 1ULVA 4BZYA 4P2CG 1ZE3C 3WE6B 1F3DH 1TPXC 3E1F1 5F1KC 4S1RL 2APVA 5HDLA 2W9DL 1GZQB 2DWDB 4FZ8L 3IDXL 3MRNA 4PG9A 4TUOA 1QRNB 1JNNL 4HWEH 1PVHA 5EU7C 1VGKB 2VIRA 4EIGB 4JREC 4YHKH 4O02H 1TJHH 1YECH 2M1KA 3P9MA 5E7BA 5IHBA 4XGZB 5D70H 3IJSB 5K9KA 2BXYA 4Z95L 1S7VB 3WIHH 1RAMA 1UJ3A 5E5RB 2EICA 1EBAA 5E2VL 5JHDD 4YHLL 4KU1A 3B83A 5C0AA 3T1FA 4KJQC 4QXGH 5CGYD 2GHWB 3C2SA 3U9UB 5KS9A 2C7UB 1AGBB 4I48A 2B5IB 1T5XB 1H8OA 4KJQD 5GSRB 1XF2B 1UXWA 3O4LB 3PL6B 4W68A 4OQTH 1YEKL 4NZDA 4GBXA 1MPAH 3MV9A 4RFOH 1HWGB 4JO1H 3JUZA 5KBNC 5DEFA 4APQC 1HINL 4S1SH 1NUNB 2X9XA 1NBYB 2C5DC 1X4YA 1F11A 4AJ0A 3V0WL 3L3GB 1N64L 5AWNL 2WBJB 3D1MC 2OXHA 2E7LA 4ZO7A 3I2CL 2WMPA 1F3JA 1JRHI 1OT1A 2A83A 4LHUA 3HI5L 3RBGA 1KGCE 3RBSA 4XPBL 1H3TA 4QRRE 2PXYC 2PO6A 4RFNC 1ZGLM 3EDEA 4OTXH 3VXNB 5EUOA 4GMSL 2P5WA 1I9EA 5L8JB 3RDTC 2VUOA 3CH1A 4A6YA 3JWNC 4OCMC 4AY0A 1AXTH 1U3JA 1ZXQA 3RA7H 1DFBL 2AJ3A 1ZLVH 1YEFH 4G5ZL 1LDPL 4P3DA 1U8HA 1W0VB 5GISH 3PP4L 4JFPA 1NLBH 2BY0A 3SOBL 5DTFB 1IZJA 3STLA 1Y6NR 2WUCL 2C3XA 3QDJD 1R0AL 2XZQH 2VLMD 5C8JA 5DHVA 5BCAA 2CIKA 4KXZI 2BJML 1DVFC 4XP1H 1F6FB 3MV7D 1J86A 2GK0B 4NO0B 2CGRL 2FB4L 4KHTH 4U1IA 2YRLA 4FG6D 1FL5A 1D5XB 1G7JA 1RHHA 2EH7H 4Z7UB 4XXCA 1I3GH 5C08E 2QL1A 4LRNH 2MPAH 2PKDA 4O00A 4HHAB 4ZFZA 1UWGL 3WUZA 4BSWA 4ZSOB 5C0FA 4S0TD 2O61B 3LB6C 4FTVB 4OGZA 1MHCB 3T2NH 2L0DA 1J1PL 3W0WE 4FQHB 4GUPA 3HC4H 3L9RA 4U1GB 3A6CL 3AU1A 2PW2A 4P2QD 1GC1L 4TULL 1AH1A 1IJ9A 5B38A 3QDGD 2NR6C 4OT1H 4U31A 2A6DA 4XC3H 3ZO0A 1OPGL 1CBVL 1NLDL 2K7PA 1IFHH 1MJUL 2QR0A 3E8UH 3B5HA 4OLXL 3N9GH 1IQDA 1MIML 4P4KA 4LOUD 4OD1H 4M93C 2ARJQ 4PJEE 3B43A 5I71B 4JY5H 3DETC 3KPSA 1FNHA 1C08A 4GW1B 4MXVE 4P9HC 3SJVE 3X3GL 3ZL4H 2X4TA 3DETD 5CLWA 3MLZL 3QEGH 3JTTB 4FABH 2X09A 2P8MB 3RWHB 2Z35B 3QCUH 1NCNA 2E7BA 3H9HA 4JFZL 1H3GA 1YJDC 5D96C 2PCPA 4N8VA 5L8KB 3NABH 3WNLA 2PYEB 4X6BA 3T77B 3U0TA 3V5HA 4TRPL 1S7TB 1O5DT 2IBGA 1LGVA 1MFCL 4ESKA 1NAMB 5DMGC 5EU6E 3MOBH 4HXBH 3T0EC 3ILPA 3G08B 4LVNB 2ADFL 5DMGD 3UJJL 1ZHNB 3CZFB 5J6GA 4PBXA 1BQSA 3TCLB 4OM0L 4EQ3A 5DJAB 3S5LA 1RI8A 5D93C 2WZPD 3DV6B 4PJ5E 5F7NC 3U0WH 2XA3A 4M8QB 2DQTH 2H1PL 1OHQA 2HRLA 2IFFH 5B3NA 1MAJA 3F8UB 3KDMB 4LK4A 5IM7B 1C1EH 1WFNA 4LGPB 1AP2B 4Y0GA 2C4XA 4WI6A 3L1OH 3VH8A 1CIUA 3FT3B 4HWUA 4D8PB 1ZT1B 5FF6A 3OB0K 4QGYA 3D85A 4APQA 4J8RB 2YD1A 3MA7B 3QNYB 4CMHC 4F8QA 3RZCC 1L7IH 4G8GA 2A1WL 3KHOA 3OAUL 1NMBH 2DLTA 2M8XA 4UAOB 1KFAL 4JLRA 3VFNB 5B3JE 2LTQB 4N9GA 4LMQI 4C56D 2PXYA 4WI3A 5KOVC 4Y4FB 1MY5A 2Q86B 3HA0A 4YE4H 2QQLH 1EK3A 3MBEC 4MA8H 4P57B 5T5NG 3RDTA 3TT3L 4JFDE 1NDMA 1BZ7A 5CBEA 5EIIA 5GJTL 4HPYH 1I8IB 4XC1H 5DS8A 4KMTH 2RBLA 4OLZH 4DK3A 3V6BR 4N5UA 5IFHH 1J5OL 2HMIC 1N4XL 3QIWD 4LCWB 4G43A 4TVPH 3RAJH 4L1HA 4MWFA 5CZXD 5AYUL 3NVQA 1MAMH 1XGPA 1CG9A 3V4UH 5I9QC 5F72S 1CFNB 1DVFA 4DVBA 3P0YH 1QTYT 2EDFA 2C26A 3VWKC 2WIIB 4HAFA 1B4JH 4U1LB 5DD3H 4ZFOB 1JZ4A 4X80L 1CLYH 3VWKD 1TJGH 2J2ZA 4JFFB 4RX4A 3VWJB 5T33H 3QUZD 2D3VA 3L3IB 1DUZA 1P7QB 1I4FA 3LDBB 3P73A 4UOJA 4FQXB 3SGEH 5GRJL 4HX1A 4PJXF 1FNAA 3MRRA 3O2WH 4GRWB 2EE6A 4WNQA 5HDQL 2V2XA 3BX7C 5D7KE 1FL6A 2GFBB 4PRIE 1MREL 1L7TH 5I0DA 5DZNA 4NJ9H 2CR3A 3QQ3A 4A6YL 5GRUL 3C09B 3CPLB 3KPRB 2X10A 2J8UA 5AG9A 4DWHA 4CMMB 2VAAB 1UA6H 1NBZA 1RU9L 1KNOA 3DHJA 4G7VH 4ZFGH 4N0CC 2G75B 4GG6F 3ET9F 1RUQL 1QLFB 5B39A 5KW9H 1CR9L 4J2XA 4Q0XL 2R15A 4N0YH 5KN5A 2ZSVA 4CADA 1KGCD 4QHUB 2HVKA 2WBWB 4Y4KB 2DLHA 5ILTH 1CFQA 3PNWB 4P5TB 3HHRB 1TITA 5DSCA 5F3BA 2X89D 5C0BA 2VDRH 4POZC 2CK2A 2JB5H 4KK8C 1MCQA 4HIXL 4M9OA 4POZD 4KK8D 1AHWC 1JGLH 1V5JA 3QUXC 2AEIT 5F1NA 1OAYL 4X8XA 4O5LH 5CHNA 4IJ3B 4FFZH 3IETA 2BNRB 1JIBA 3FONB 1KJMA 1KIRA 2UZIL 5K9QG 3WDHA 1LILA 4OJFH 3B9AA 5DRZB 3T0EA 3S8WA 1KELH 2BVUA 1FGVH 1RD6A 3MLYL 4QRQA 3SKNB 3T3PF 1F2QA 2KKQA 2AW2A 2MQCA 5I66A 2VLLB 3I6KB 2Y36L 5C08D 4ZTOH 2AV1A 2QKIB 2DKSA 4DQOH 4YHIB 3RGVC 1HCFX 2P44B 3ULUH 3PV7A 4X7CC 3W0WD 3SDAC 4LGRB 3KWWA 4WTZA 3VCLB 4AMKL 4OF3A 1GIGH 2VKWA 1XR9B 2NY1B 3STZB 4IRSB 1FYTB 5I1GL 1HHGB 4H0HB 4I77L 1OP5K 5D1ZC 1NFDF 1OSZB 1N26A 3VGFA 2X2YA 3RZCA 2XG5A 1MHHB 1J8HE 1KCSL 5DT1L 1K8DA 4ODSL 2ZJSH 1KTLB 4KK6C 4PJHE 5D7LB 5DK2B 5FXCH 4FA8A 1UJTA 1Y0LB 2OXGA 4TUJB 4E42A 1A7PH 3AAZA 1HSAA 1Q94B 1LO2L 3VFOA 2OJZH 1KV3A 2DM2A 2J5LC 3MBEA 3QHTC 4H88H 1BM3L 5D5MF 1XH3B 1A6ZA 3VD7A 3TV3H 1KCVH 3TZVC 3S6CA 5H35A 5SWZD 3RWEB 2VDQH 4R2GC 1FJ1A 1OGAD 1ZEAH 3MLVH 1MEXL 4RBPK 4MA7H 4JPKH 4KDVA 5JHLH 4CW1A 2GAZA 4LVOB 3A6BH 5DK3A 4ODXA 3VWKA 4B41A 1EFXA 3L3JB 4HKZB 15C8L 1CXIA 4UIKH 5CEXB 1CZ8L 1GOFA 4MD5B 5EU6D 5HHOA 1T3FB 2BK8A 3O6FB 4J3SA 4ZXBC 3N85L 1LMKA 1CICC 1XGTB 3GZKA 1I8MB 2YPLB 4ZXBD 1S9VB 4P23D 4QRPE 2VAJA 5JNYA 1I1FB 5IESH 4WUKH 2AK1H 2A77L 3NPSC 2BVQA 2ZUUA 1L0XA 4X6CF 2V5SA 3FN9A 1SM3H 4J3UA 1JI1A 6FABH 4X4ME 4LPTA 1YN6A 3EHBC 1RZJC 3ZDXF 4K3HA 3E0GA 4X4XB 3A0OA 1CFTA 4M1DL 5SWSE 3QRFM 1LP9F 1YEIL 1MJJA 3KPNA 5EU5A 3QUYC 2H9GA 5EOCH 1YY9C 3RIAK 3ZKMC 1Q38A 2O5XL 1ES0B 4JM2F 1XR8A 4UOW1 3VFRA 5IQ9B 2VXQL 2D7PA 4H1LA 3GMQA 2BNQB 3IDNA 4ODUA 4LKXA 3WUWG 5C0JA 2AK4E 5IB1B 2BSRA 4HF5L 4NO3A 1CGVA 3MXWH 4XNUH 3QPXL 4PG9B 1FFOA 1MJ8L 3K2MC 2VIRB 1ZANL 1JNHA 5HGDB 4H0GA 4WFGE 1AHWA 4CNIB 1OCWH 1YEHH 3QUXA 1U3ZA 1JPSL 4WTWA 4NCC1 3P9MB 3E6FA 5LAXA 1WICA 2XT1B 5K9KB 2VZ1A 3BEWA 3BP7A 1I1RA 1UJ3B 2QTEA 3SO3B 1EJ6A 1H15A 1MFDL 4DCQB 4MJ6A 1UCTA 5C0AB 1VADA 5KS9B 1RPQA 1MQKL 5EBWA 1UXWB 3Q3GA 5FO9A 2KPNA 5LQBL 2NXYB 3N1GC 3H3KA 4Z0BL 4LFHD 4LDEB 2FGWL 5C0NC 4OM1L 2FO4A 5J13C 1IGCL 4GBXB 4M7JL 2R4SH 3RGVA 3VU2A 5D7IB 2F58L 3C5ZC 5DEFB 3SDAA 4JY4B 4KKAC 1UM6L 4P9HL 1F11B 5D7KD 1GGYA 5GS2D 2YK1L 2NQCA 5DC0A 5GS0D 1NGPL 1U3HC 5ICZA 1WWAX 5D1ZA 3AXLB 2A83B 4LHUB 3BOVA 4EDWL 3QEHA 2R1YB 3UPAA 5EUOB 2P5WB 4PJ8B 1QSFE 5DFVC 1D5ZB 4UT6H 1ZLSH 4A6YB 3CH1B 2I9TA 4PGCA 1HXMA 5DJDA 5DFVD 3NACH 1EHNA 2AJ3B 4LU5L 4P3DB 4Y2DC 3ZDYF 1U8HB 1G0DA 4F7EA 3I85A 2VXSL 1WBZB 2OP4L 2ICWJ 3H9SE 3QEUB 4ORGA 5TDNB 2WWMD 1YA5A 1JGDA 2FEEL 5SWZA 5DHVB 1OGAA 2AEQL 1Q1JL 2CIKB 4HS8L 5KAQF 3FOLA 4OF0A 4U05A 7CGTA 5T3ZH 3AS3A 1YQVL 4FQIL 3TZVA 2I60H 4ONHA 3CLFL 3LIZL 1J7VR 4OCSL 4LIQE 3BT2L 3LKSA 1NAKH 3EDFA 2X5PA 1JZ5A 1HHHB 2C3VA 4ZFZB 1D6VH 5MP6L 1TQCB 2Q20A 1S9XB 3ULUF 3V52H 4MSWA 2ZSWB 2V17H 4AK1A 3AU1B 2PW2B 4OZFB 3BPNB 4NBZB 5DZOA 1UB5A 3UBXA 3HNVL 1CICA 4HIJA 4HKBA 2DQEL 3MLRH 1BBJA 1ZT7A 5IFAL 3QYCA 2QR0B 3BUYA 4OLYH 4UQ3A 2GUOA 5L88L 1FNLA 1N5AA 2H2SD 2E7MA 4NUJB 5ISZE 4D3CL 4MAUL 3U4EA 1UKSA 5E2WH 5C07E 1JGVL 2C1PA 1KEGH 4P48A 4XH2A 1YNKL 4WIQA 2NZIA 3AB0C 4CBPA 3VD3A 2DKMA 2KH2B 4KJPD 2X4TB 1EZVX 3QUYA 4XPGH 5EOQH 1CDHA 3TH2T 4CUCA 1EHLH 4YPGB 4Y1AE 2K3TA 1D7FA 5IV2A 4PFEA 4JVUA 4QOKE 1JYXA 2AI0L 1RULL 2PCPB 4YJZL 2APTA 1NGQH 1KB9K 4MCZA 4X6BB 4XVJL 4X6DF 3V5HB 4M9PA 4NRYA 2HVJA 5E2JA 2ZKHH 5FUCC 1XF5B 2VISB 1A7OL 4RCAA 3H6JA 4I1NB 5TE6L 1PFCA 1KULA 5D8JH 1FGNH 2HKHL 5EOTA 3ILPB 4JREB 3FFCE 3B4NA 2VLRA 2P43B 1ETZB 5J6GB 1EEYA 3KG5A 3S5LB 3Q2CA 5DWUH 1R3JA 1EGJA 5IVOA 4HG4J 3MLUH 3BP4A 1F58L 4PTUA 3D5OF 1IGYA 1M7DA 3MUZ1 2CRIA 2AJVH 1SVCP 4OCYH 3VFVA 1K8IA 5IJVA 3IDIA 5A1AA 2HTKD 1N3NA 1FZOA 4HIEA 4OKDA 3UXFA 2J1KA 2R39A 3VH8B 1UKTA 1P7HL 3C9NA 1IGIL 1TETL 4WCYL 4YGVA 4J6RL 5T1KA 2BVOB 4F58H 4QRPD 5JW3L 3C5ZA 3BWAA 3D85B 5D7SL 1RZKH 5IMKA 4APQB 2EC9T 3HG1E 4KAQH 3BISA 1G7HA 1IGJA 1CVRA 3FMGH 4G8GB 2D0FA 2OR9L 4R97C 5ITBL 1QFHA 3T4YB 4U6VH 4YXKH 1U3HA 1EH9A 3ZDZF 2LABA 1U8QB 4JLRB 4N9GB 3CXDH 4LARH 4PRAA 2PXYB 2OTPA 5SWSD 1FIGH 3NCMA 3QI9D 2ATKB 3QZWA 1XGQB 4KDWA 3IU4H 1PLGH 5CBEB 1EMTH 3C8KA 5EIIB 1Q9WA 1B0GA 1UACL 5DS8B 5DD1H 4Y2DA 3L6FB 2H26A 3MLTA 3PGFH 2DN7A 5AAWA 3BRGC 2Q3AA 2DBLH 2IG2L 3QDHA 2VABA 2AK4D 2G9HA 4G43B 5DD0L 5E94A 1XGPB 1XT5A 1DVFB 4HFUL 2VDKL 4QWWC 1FVEA 3L5HA 4PJGF 1QPXA 1N0XH 2W9LA 4M1GH 4CL7A 2QEJA 1YN7B 1MQ8A 4BFIA 3RUGF 4OGAD 5GGVH 3MRFB 2Y5EA 1AGDA 1OM3H 5E8NA 3WYRA 1I4FB 2GSGB 5J06A 2Z4QA 4NZTH 3P73B 4PRHE 4WFEE 4HX1B 1AE6L 2F5BL 1TVDA 5L8LB 4CVWA 3MRRB 4AQ1B 4BM7A 4WNQB 3ULUE 1FL6B 2DL9A 3O6KL 2YMXH 3OKMA 2Q87A 4NFCA 1V3KA 1JK8B 5E4EB 5MENE 3QQ3B 3C60C 4Q6IB 4L4JA 1B9ZA 4Z5RA 3RL2B 1SEBA 1WK0A 2XYCA 1IGML 2VITA 2ZPKH 4OAWB 5IHUL 4X99B 1KNOB 3FAWA 4RAUA 3BWUC 5JXED 2R0WL 1I75A 4O9HL 3GKZA 5B39B 4XTRC 3RWCA 3WFCL 4HZLB 4ZS6D 5KN5B 4CADB 3EOBA 3SDXB 4M43H 3EDKA 2P5EE 4POYA 4JGUA 5F3BB 4RWYL 1ZWIA 3QXDA 4MXWH 1ONQA 4C59B 2X4RA 3GI8L 4QHMB 3VXSB 5JPMA 5IROC 4OCWL 1Z2KA 3VD4A 3T0AA 5JXAH 2PNDA 4OZHB 1FZKA 4Q58C 1AFVH 2EEDA 1HHJA 4PJDF 4M5ZL 4XNXH 5EO9A 4PYHA 3H9SD 5CHNB 3IETB 3W2DH 1KT2A 3CSYA 3S37H 4FOMA 2V5YA 1KJMB 4PJFF 1GOHA 5BRZB 4U7MA 3T0EB 5JW5A 4TOYL 3S36X 4LSVL 4M6OL 5ESVA 3Q6GL 4B50A 3IAPA 1DSFL 2AV1B 3H9YA 1K3IA 4HPOH 4MVBC 1RZJL 5I2IB 2K9UA 3KWWB 4UTAL 1QNZL 1RUAL 4NBYB 1SMAA 1JP5A 1RIHL 3M17B 4OQTA 2C4FU 1I1CA 5TF1H 1DR9A 3CFEA 1UWXK 4LRIC 2CK0H 2D9QB 2JCCF 3TN0C 1VFAA 3IXAB 3RZCB 3KS0H 5ISZD 1S78C 4DK6A 5C0CA 1K8DB 5C07D 4LEOA 3AS2A 1SYSA 4HS3B 1T89C 2WQ8A 1CXEA 5CWSB 3EAKA 3RZWA 5C09E 1ZVYA 4EDXB 3AAZB 1HSAB 4QEGA 3HAEG 3VFOB 4Z78A 3MBEB 4L9LC 3O8XC 4FNLH 4PD4K 5IK3B 2JJWA 5IHZA 2P8PB 3PWLA 4Y1AD 4GG6A 3ARSA 5DUMH 3UTZA 3OKDA 2DDQL 4H8WH 4JM2C 5H35B 1EGJL 4QOKD 2EIZB 4YFLF 2MFNA 4UV7L 3HZYA 3I6GB 2Y23A 1T7ZA 3U7YH 5KSAC 4JM2D 4CW1B 4YXLH 4PJIF 2VOTA 4Y19E 1DBAH 2A6IA 1P6AB 1FDLH 3F58L 4ODXB 7FABL 5KSAD 2XN9B 2JIXD 3BE1L 4XP9H 1FNSH 1EFXB 1QFPA 2F54E 5LBSH 5HHOB 4G6KL 3V8CA 4KRNA 4K7FB 3OG6B 3NH7L 4EXPX 4JKLA 3FFCD 3QCTH 3TO2A 3BDXA 3IFOA 1HKFA 1CE1L 5HVHC 4FQLH 1FFPA 5JORB 2VL5A 2YUZA 4HUXA 2HWZL 1EVTC 3NCBB 2VH5L 3OXSA 3WO3B 3CCHA 2F5AH 4OZIE 3MLWH 5JNYB 5IOPB 3EO0B 1KCLA 3OZ9L 5CKGA 3EGSA 3CSGA 4JFEA 4TUKL 3M8OL 2GJ6E 3DROA 1T20B 3SPVA 3SDYL 3RX8A 5FHAL 1AD0A 3EJZC 3BO8A 2J88L 3C60A 3EJZD 3GM0A 3VGBA 4EI6A 2AJZA 4GXUM 1QUNA 4LSUL 3HG1D 2IAMD 5BW7C 3TBTA 3EYSH 5EU5B 3TGXA 2E7CA 4OZGF 1MCDA 5I8OH 4TSAL 3TLRA 2EYRB 4IOIA 3MR9B 3VFRB 5E5MB 1XR8B 1VGEL 5BV7C 3FRPA 4YBQC 1NFDA 3GMQB 2B4CL 4LKXB 4ODUB 2UY7A 5C0JB 2NY5H 1T04B 3HUJE 4YBQD 5DXWA 1GZPA 1G7IB 1LEGA 2RIKA 4I3RH 2Y6SC 1MLBA 1INEH 3G04B 4D9QE 5IROA 1FFOB 5L7XH 2Q8AL 2OK0L 3HNSL 2Q76A 4JM4H 1JNHB 4R4FH 2DL2A 3Q0HA 5AZ2H 1AHWB 3QUXB 3HTLX 3ZKSD 3E6FB 3D0VA 2NY3B 4JY6B 5DI8A 1KOAA 3SBWC 3BEWB 5FM5O 3QJFA 4PRPE 5E08L 5IMMA 2P46B 1DQTA 3KJ4C 5E99H 1KPRB 1MCWW 2FX8H 4F7TB 1NPUA 4G6AD 3DTXA 5CP3H 2IBZX 3BSZH 1UC6A 5EBWB 4ZTPL 2IANE 1B4RA 2FD6L 2W65A 3IDMA 3MNVA 2FO4B 1IAIH 3RGVB 4FQ2H 4EI5D 4WFED 3U9PH 3SDAB 1BVKB 4MD4B 4HUMB 3ARBC 3LS5L 3LN4A 3ULUD 3AM8C 5FYJH 5C9JA 4KK9C 2ICEB 1KB5L 4ZPTB 3INUH 2AABL 3O6LL 4FXKA 3KR3L 3O0RH 5D1ZB 4LRIA 3P9LA 1S5HB 3OJVC 4AH2B 4DKEH 5I1KH 3ARYA 3PP3H 1A3LH 1HSBA 1TMCB 3QEHB 4WEBL 2ARJA 3TN0A 1Q72H 3DJ9A 4NWTH 3ARDC 5HGHA 2I25N 2FDBP 2WINA 4XX1G 5TPWL 1YYLH 4KROD 1NMCC 4Z7WF 4W6XB 1MI5E 4X6CA 3ARDD 4PGCB 1HXMB 5DJDB 1T89A 3ZKXC 4IM8A 1IGFH 4TSCL 3IJHA 2R0ZH 4F7EB 4YHKL 4O02L 4XNMB 2BRRH 1QBLH 1TJHL 1YECL 2J5LB 4L9LA 1UM5H 3LKPA 4ORGB 4PGDA 3O8XA 1NUGA 5DQJA 1JGDB 3K4DA 5D70L 3S35H 3QWOB 3TZVB 4ONHB 4JM2A 2DQUH 1JN6A 4OGXL 4J23A 2I5YH 4QXGL 2W60A 2Z31C 3LKSB 1KTDA 4KJYA 5KSAA 2DBJA 2MWCA 5EULV 1TVBA 4FN0A 3V7MA 4UUJA 1CLCA 4Z18A 4PRNB 4OQTL 4L4TE 4M61B 5F97E 1MPAL 4RFOL 1C7TA 2FRGP 4JO1L 5HVFB 1I8KA 1IQWL 4PP1C 1IAMA 3VFWA 4S1SL 1X5ZA 4K23H 4R4BA 1UB5B 2J8OA 1CICB 3GJFH 4HIJB 4HKBB 4K8RH 3OKLA 4KPHL 3NCYS 1BBJB 1ZT7B 5DJ0A 4L4VD 4RZCA 4HC1H 1XCTA 3BUYB 3PUCA 4UQ3B 4UZGA 4PJAE 3U30C 3RTQC 1N5AB 2I26N 2FHFA 2XA8L 4UOW0 4YHNA 4G8IA 3U4EB 43CAA 5E0QA 5B38G 3RTQD 4XH2B 3QIBD 4PV8A 5CEZE 3RA7L 3CMOL 3U1SH 4DGVH 1YEFL 4PBWD 4U0RC 1V8HA 2Y07H 3UEZA 5BW7A 5GISL 1NLBL 3QUYB 3QNZB 4R7NA 5EZIL 3X12A 2Q7YA 5F89B 4EQ2A 2NYYD 2XZQL 5FHBH 3F12A 4UT9H 5IV2B 2AQ3A 1YYML 2CH8A 3KPLA 4XP1L 4PJCF 4WFHE 5HTSA 1MRFH 2ORBH 1BEYH 1X7QA 4MCZB 1G7MA 1G6RH 1ZV5A 1E4XH 1ZTXL 2A74A 2IPUG 1KTKE 2MPAL 4HWBH 4IOFC 2PR4L 4BUHA 3VD9A 3T2NL 3NCJH 4N8VG 4U0QB 3IU3A 2NXZD 4IOFD 5EOTB 2VLRB 3HC4L 3WL9A 1EEYB 4PGBB 3DXAA 3UTTE 3SBWA 1QSEB 1AIFA 2E7HA 2GITA 1QVOB 3O3EA 1R3JB 4JRWA 1PD6A 3QG6A 4GSDL 3BP6A 5CJ8A 2DOCA 3BP4B 3BN3B 4LSSH 3JXAA 4LLWA 3UBXI 1IGYB 4UV4H 5TQ2H 1J18A 2F54D 5I1IH 3LKRB 1IFHL 2L7JA 3VFVB 3E8UL 5IJVB 4JRYD 5DR5H 1NSNL 3IDIB 2CMRH 1JUFA 4F7CA 1N3NB 1FZOB 4NRZA 5EPMB 1HZHL 3S5LG 2GSIA 3LQZB 4OD1L 3B3IA 3N0PB 5JOFA 2OBGA 1IM3A 4YGVB 3JTSA 3C5ZB 4M7LL 1BZ9A 4QXTB 5D4QA 5T3XL 4GJTB 4PV9A 3ARBA 2E6PA 2NY2C 3O6MH 3ZL4L 3AM8A 3QEGL 3X11B 2GJ6D 4FABL 3QG7L 3VH8G 3QHZH 1NGYB 1U3HB 2NY2D 3QCUL 2H2PC 4FP8L 3OPZH 1N5YH 4NHUB 5F9WC 1FFNA 3ORJA 4PRAB 5DUPH 4MNQE 3NABL 3ARDA 4IDJH 1TLKA 3TVMC 4JN2B 2GT9A 4NQCD 3ZE1E 3C8KB 2D03H 1B0GB 3TO4D 3LRHA 1ZLWH 3ZYIA 4Y2DB 5D1QC 3QDAA 2H26B 2VWEC 4IRJC 4HXBL 1T1XA 3DVIA 1S7WA 4EUPA 4H0IA 4PG2C 3I02A 5E94B 4Y5VC 1MCBA 3HZMA 4CJ0A 3RKDC 4XB8A 4D9QD 3NPZB 3LPGA 3RY4A 3DO7B 4XCFH 3U0WL 3JV4B 4WI5A 1MH5A 2KQNA 2Z31A 5C0DB 2IFFL 3MUGA 2UWEF 2VXVL 4MAYC 4BFIB 2VO5A 4JZNB 3O2DH 4XMPH 4X6DA 1AGDB 5E8NB 2IPUK 3BQUD 2Z4QB 1CT8A 5GGQL 4HUNB 5DD5H 3EBAA 1OTUD 3RHWF 3RVXD 3K8MA 3PWPE 5FGCE 1RVFH 3DX9B 5I16A 3SY0A 3VE0A 1L7IL 2IAND 1NMBL 4MNGA 4NQEE 3FT4B 1ND0B 4N1HB 5ANMA 4Z5RB 2GTZB 3LKQA 1JPST 3KPPA 2ED8A 4ERSL 2CUMA 1LE9A 4DW2H 3RTQA 3S9DB 3VGDA 1BD2A 1MLCA 4YZFF 1BJ1J 2VITB 4NN6B 5FKPA 2QQLL 4MA8L 3B2UC 4NN7B 1QR1A 1BPVA 1QG3A 5KSUA 3FB5A 2ESVA 2MJWA 3DSFL 1EIBA 5IVXB 4XCYA 1UB6A 4XC1L 3AB0B 3B2UD 2HKFH 3B9KC 1PKQA 3NMEA 4KMTL 2NX5A 3VRIA 2FBJH 3GO1L 4OLZL 3S34H 3ARFC 5DYOA 3SCMD 3B9KD 5D6CB 1A1MA 4TVPL 1KB5B 3RAJL 4X7DC 1ZWIB 1ONQB 1MAML 2NW2A 2X4RB 5B39G 2XTJE 3V4UL 5IQ7H 2OM5A 3P0YL 4P3CH 1OWWA 4ZAKC 4M4RA 5DD3L 1B4JL 1EPFA 4YX2H 1CLYL 1RJLA 5EO9B 1KT2B 3CSYB 1GGIL 5T33L 3EDDA 4HBCH 4GRLC 4YBLC 3QPQC 3FQXA 1Q9OA 5JW5B 1ZHKA 1DQQA 3CX2A 4LLVB 1IMHC 2XKNA 1H0DA 1UVQA 1L7TL 2ADJA 3ROLB 1V7NL 1NCAL 5F1OB 4NJ9L 4JRYA 4NC1C 1T6WA 4HKXA 1MFEH 5HHNA 3QO0A 5FCSH 1QOKA 1Z9MA 4I0PC 4JRXA 2PW1B 4PJGA 5HGAB 4MS8C 3RKPA 1HWHB 1C5DA 5IBLD 3RUGA 1IT9H 4I0PD 5CBAA 2B1AH 5F1IA 4ZFGL 1EERB 4G7VL 2A6JA 5DC9B 3DLQR 5C0EB 3MYJA 5KW9L 3S7GA 1RZKC 3H7BB 4N0YL 5BV7L 4K3DH 3B9DA 1UCBL 3ZLQC 5JW4N 1L4IA 1TDQA 1TZIA 5GRXG 4WTZG 1AGCA 3MCKA 3K7UA 4R97B 2EDYA 5ILTL 1UM4H 1U91B 2BMKA 2OTWA 4UNTA 3O3DB 1CN4A 3KXFE 5C0CB 2VDRL 1SYSB 1CFVL 4WW2F 2EDJA 5D71H 4NQCA 1CYGA 1BQLH 3SDCC 5F44A 1NCWH 1CIDA 1JGLL 3TVMA 4O5LL 5EC2B 3SDCD 4FFZL 4R26H 3HR5A 5IHZB 5I19L 1A7BA 2HJLB 1V05A 3PWLB 3OKDB 4OJFL 5D1QA 4IRJA 4QTHA 1KELL 1EDQA 1I9RL 1ZOXA 3HZYB 4LAJH 4WFHD 1FGVL 1NAMH 3EYVA 3MSPA 4PG2A 5CJBA 4S1DC 4Y5VA 2DI7A 1SVZA 2A6IB 4XNYH 3VFUB 5IG7A 1WIUA 4S1DD 3PQYE 4YDLB 3OAZK 1BLNB 3WXWL 4LLYA 1NKOA 4DQOL 4J1UA 2XPGB 4DAGH 4I5BA 3PGDA 4U3HA 3T3ME 4H25B 4MAYA 4PJDA 4XAKE 5DQDH 3DX6A 4JJ5B 1QFUH 4M62H 3RY6C 1FFPB 5AZEL 4MLIA 4Z6AT 2W1NA 2YD6A 2GTWA 3TNMA 5I1AA 3DSNA 4PJFA 1ZGLP 4WW1B 3CVHA 2AXGA 3LVEA 5CEYA 2OCFD 2X7LA 3QUKA 3RWDA 4M6NL 3EGSB 4JFEB 3DROB 3QEQA 3SPVB 1MELA 4XVUC 3BO8B 3M1BA 5HHPB 3C60B 4LCCC 4XWGH 3OXRB 1JYNA 4J3TA 4EI6B 1A7PL 1FAIL 3AY4C 3JWOH 4GKZA 3TBTB 5T5FH 4M8VA 2EE2A 2OJZL 4GRMA 3KLHC 4HLZG 3HC0A 2OZ4H 2ILLA 5HHQA 4JQIH 3OX8B 5FK9A 3KLHD 3B9KA 1KCVL 1NFDB 2VDQL 4U1MA 4NQXA 4PJ9C 4C55A 1ZEAL 3ARFA 4Y7MA 3K2UH 4MNQD 1WUNT 2JCCA 1U8JA 4LSRH 1GZPB 3FQRA 1LEGB 5JHLL 1A9BA 1S7SA 3A6BL 1MLBB 1VERA 2FH6A 2CKBH 2VXTH 4HFWA 4H1LG 4QRRA 3V5DA 2JE8A 2Q76B 4ZAKA 1Q9KA 1F42A 4HEPG 3WNKA 4W6YB 1KN4H 3FQTA 3D0VB 5DI8B 1WSST 3KPQA 2IADB 5K9OA 3LSOA 1KF9B 4XNQA 1UYWH 4FZ8H 3QJFB 1NMAL 3RNQA 5IMMB 4YO0B 3HB3C 4GRLA 3VXME 2NY6C 3DTXB 5IESL 4WJ5B 4WUKL 1SEQH 3P4MB 4JPVH 2AK1L 1UEMA 4GRWH 5JLZA 1GGBH 4LASH 4OUUB 2A0LD 4PJIA 4AT6B 2W65B 4Z95H 1HE7A 4XPHH 4S0SD 1NH6A 5TGBA 3TFKC 2R56H 3VXTA 1SM3L 4MZ3A 4YHLH 1JF1A 2Y4SA 4RSVA 4DEPC 4YPJA 2EEAA 4I0PA 1BX2A 5ESQA 4WHYH 3D3VB 3EYQD 1BOGA 2NMSA 1QACA 3Q5TA 2X4UA 5L2KE 4P2OD 3EJYD 2N7BA 3P9LB 3KYAA 3NCCB 4HT1L 4ZQKA 4YDVA 4F2MA 2Z8SA 3TN0B 1A64A 1Q8MA 2PETA 1HINH 5HGHB 2AV7A 1T21A 4P59H 3V0WH 1N64H 5AWNH 1UZ6F 3MXWL 4XNUL 1EO8H 4NQTA 3WCYA 4J7RA 2CIIB 1T4KA 4PY8I 3I3BA 4XPBH 1M6OA 1ZKAA 3SDCA 1ACYL 1J05A 1YEHL 4G9FE 4L9LB 4NDMA 4PGDB 1GHFH 4GMSH 4OZGA 4P2RB 4JKWA 3BD3A 4H8WC 2E8ZA 1A8JH 5E9DB 4O2FA 1DFBH 1JN6B 2DQJL 2DWEA 1TVHA 1P7KA 4JG1H 3BGMA 3HS0B 4KMLB 4Q2ZB 1KTDB 3ULSA 1M71B 4LLQB 3REWA 3SOBH 4UUJB 3ARQA 4S2SB 3GMMA 4HDIB 1R0AH 1KG0A 3VRLF 4QHLA 4R4NC 1V3JA 5FB8A 4HXAL 2W0PA 3BW9A 5BQ7A 1I8KB 3VFWB 1YEJL 5HVHB 2M2DA 3RY6A 3TF7C 2C3WA 4O2CB 3OSKA 3OKLB 5D7JC 4GAFB 2V5RA 4PJBF 1HKLH 1BHGA 1NJ9A 5GRWA 4XBGA 4LVEA 5D7JD 4QRTB 1XCTB 1CGXA 2FIKB 2OJEA 4Z8FH 1Q9LA 2WNGA 1HH6A 2ZUYA 5F7LB 3UBXG 3R1GH 1CLOL 3OBAA 5HHXL 3V0AC 43CAB 1GC1H 4TULH 5E8PA 1ZLSL 4L3CA 2CD0A 1H5BC 4LCCA 4PV8B 3GMLB 1ED3B 1A7QH 3NACL 1G7QA 2YEZA 2DLGA 1CBVH 4LAQL 3AY4A 2BSSA 2FSEA 3MRCB 4L8BB 4OLXH 1MIMH 3X12B 3MRIA 1KIQA 5E8OB 4LNVA 3KXFD 1P4LA 3EIFA 1CXFA 3QUMB 5BV7B 4TNVF 1BECA 3KPLB 5T3ZL 1TCRB 4YEEA 1VFOA 4PJ9A 2NY5C 4WTXA 2V7NA 1OP3K 3X3GH 1A22B 1X7QB 1NAKL 3G6JE 3JSSA 3PWNB 2ERJC 3VW3H 2A74B 2IH1A 5I1LA 3B9EA 4Z7WA 4KUCF 1D6VL 3CVIL 4HJ0C 4WI2A 2CLVA 4V2CB 3V52L 4LF3A 1RV6X 3IU3B 5BS0B 3CVHL 2V17L 2UVFA 4G3YL 1A9EB 3U48A 4JFDA 2IC2A 3WL9B 2Y06H 3DXAB 1AIFB 2GITB 3O3EB 2EKSA 4N90E 1MFCH 3BP6B 3N06B 1FCGA 1O7VA 3VXUD 1WJ3A 3LKOB 2VDLL 3O4LE 1XIWD 4O2EA 4OLYL 2WWKO 3SGEI 4F7CB 5JHDB 2HYMA 4NRZB 2GSIB 1A6TA 3IDJA 4MJIA 5E2WL 3AREB 2EYTA 3NIGE 2IALA 1K6QH 1A1OB 4ACPA 1MFAL 1BZ9B 2YWYA 5E70A 2P8LB 4LFHG 4PV9B 3ARBB 3SGKC 2HJFB 2D7TH 4GW4B 1R24A 4I2XA 1T0NB 2AQ2A 3RPIB 1EHLL 2YD8A 4Z7NE 2CJUL 1S3KH 4GAGH 4IMLA 1HOCA 5FYJD 5JPNB 4RA0C 2BCKA 3EZ8A 2ZWLT 4FXGA 4OLUL 5HJ3A 4I4WA 2GEEA 2VZ3A 8FABA 4FFYH 2EDOA 3AROA 2LU4A 1S5IL 1A6UL 1RIUH 2BSED 3OAUH 1RFDL 1UEYA 2GT9B 3PJSA 1LVEA 3D39E 1BF2A 3A6OA 2ZKHL 4BSVA 3FO2A 5HPMB 2HFEB 5D8JL 3DGGB 4XCEA 3U4BH 2EXYC 3WFEL 3G6AA 1JV5B 4LQFH 3X3FH 4EUPB 3QZWG 2UV3A 3I02B 2HT2D 3HZMB 5DWUL 2Q8BH 4Z7UE 5GJTH 2P24A 2R2CA 4PJCA 1MH5B 3RRQA 1M05B 4KQ4H 2AJVL 1NGXA 4GRWF 3K3QA 4OCYL 4FTVE 4WO4D 5EIQA 4X6DB 5AYUH 3MV7B 4JQVC 5ENWA 1CT8B 5IBUB 1I7ZA 5JW4Q 1SJXA 4F58L 4QY8A 1RZKL 4X80H 4HULB 1BBDH 3KYOA 4NJAH 4R9HA 3SY0B 2HRPL 3QQ4B 3TM6A 3FMGL 1BWMA 1A0QL 3MMEA 4K8RC 4XP4H 5D7JA 4MNGB 4YDIH 2WUBL 1OTTD 3IFLH 5ANMB 3SN6N 2VUYA 3OKKA 3CXDL 4LARL 5IF0A 3U30B 4JE4B 1LE9B 3CH8A 1BD2B 1MLCB 3VDCA 5HDQH 5DC4B 2FEDD 5FKPB 3K1KC 3IU4L 1PLGL 5C71A 2CDEA 3TC9A 4P5KA 2ESVB 1EMTL 1H5BA 4YR6A 2FJHB 2Z8WC 4MA1B 4XCYB 1UB6B 5L2KD 4LMQE 5GRUH 3VRIB 1C5CH 4QRUB 4MB4A 2CRYA 3PGFL 5I74C 4CDGC 1FVCB 5D2LE 5DEGA 1DQJB 1RU9H 2RQ8A 1HQ4B 1B90A 1LK2A 1JGUL 1GOGA 4GKSB 5DHVH 1AQDB 3BKJH 1TQBC 4NT6A 5INCA 4WW2C 5TDPA 1T5WA 1J1XH 1A7NH 1N0XL 5IB4A 4M1GL 5CS7A 4HW6A 1RJLB 3BD5A 3VXRD 4GLRH 3U2SB 5GGVL 4N8PA 1W72A 3DHMA 4PJHA 2AJXH 4UQ2A 4MLSA 3W81A 1PG7H 4NZTL 4QO1A 3FQXB 3B5GA 2FYYA 2CDFA 5DMKA 4PLKC 4V1DD 1Z5LA 2HLAA 1ZHBB 2FIRT 4DTGH 1H9VA 3OL2A 5GRYA 5LXGL 1J88A 2YMXL 2XKNB 3SDDD 2ADJB 4OZFH 1BQUA 3D0LA 4HKXB 3KLAA 4M1CC 2R2HB 3L7EB 1A2YB 1ZHLB 3QO0B 5HHNB 5CZVL 1T0PB 1JTPA 3GSRA 5ICYA 4HUUB 5DJXA 1C5DB 1G9NH 3UTSD 4TQEH 2ZPKL 1DEDA 3C5JA 3RWFA 5CBAB 5F1IB 4GT7A 3PHOB 2A6JB 5GIRA 4QHNB 5I1EH 1Q0XL 5MEOA 2HN7A 3SGKA 4M43L 4YHML 4UIMA 3C6LD 1H3PH 2OTWB 2R2EA 1X5AA 3RY5A 2AGJL 4MXWL 4OCRL 5I1GH 5SV3A 2EZ0C 4K3EH 4OCXH 1CWVA 1PW3A 5JXAL 4LBEA 1AFVL 3ULVE 2EZ0D 2EDWA 1QR4A 3BP5A 1U42A 4XNXL 2E9IA 1OW0C 1JHTA 3WDIA 5DT1H 3HR5B 4ODSH 2HFFB 5D1QB 1S9KC 1I7UB 4XPTH 4LPXA 3WLWC 3EYVB 3MOQA 4PD4J 5SX5H 2EDQA 4Q9QL 1QRND 4KK5C 1LO2H 1JYVA 4N1EA 3BZFA 3ZE2E 4KK5D 1XFPA 4JFFE 4OKVB 1RK1B 4J1UB 3QIWB 4JHBA 4I5BB 4ZUUA 4HPOL 1NBQA 1OAZL 2CR6A 3MRGB 4MAYB 5GJSL 3DX6B 3H3PH 4FS0A 3SEPA 4JQVA 4DFHA 3BD4A 4GKNB 4GRWE 1YPZE 4L8SC 5I1AB 3ALWA 3CVHB 5CEYB 15C8H 4NBXB 4WV1A 5DRWA 3RWDB 3IKKA 3FO9A 5FECA 2CK0L 3O4LD 3PL6D 3MRPB 3QUZB 1I8LC 3CAFA 3GJFA 3KPRE 5ELIA 3TBVB 1HYSC 3QWRD 3ALXA 3N85H 1LNUA 4Y4HB 3ROOA 3V4VL 3BYYA 3D69A 4HC1A 5IEHA 2WBJD 1XF4B 1S7UB 2P7TA 4MJ5A 4RMSA 2DQGH 4GRMB 1KC5H 3HC0B 3P3YA 4FNLL 5HYIA 3BKYH 4Z7QF 5DUML 4M48H 1DN2A 2IEPA 5I18L 2JTDA 1IKNC 4U1MB 4NQXB 2AJUH 2ZZUT 2RR3A 3DVNA 1R5IA 1U8JB 3U7YL 3FQRB 4X6EA 3LMJL 1A9BB 1S7SB 4YXLL 2QSCL 3IFNH 1OAKL 1CGTA 1DBAL 4LL9A 4L8CA 1MJ7H 1FDLL 4M7LT 3FRPG 3KYNB 4QRRB 4XP9L 1FNSL 3V5DB 4R96B 2XY1A 1U95A 2VXQH 4ZAKB 2BNRE 2MKWA 4WW2A 3VXRA 1G7PA 1IAIM 3DIFB 5LBSL 1QSFA 3T2QA 4WUUA 5FA4A 3JV6A 4HGMA 1JL8A 3FQTB 5KS9F 1G6RA 2HFGH 4HF5H 3KPQB 4Z7OF 1PY9A 3LSOB 3NN8A 4NO0D 3E6HA 4FQLL 4HWBA 1OD7A 4XNQB 3QPXH 5BZWA 4YBLB 4V1DA 1MJ8H 2F5AL 2FLRT 2RGSA 4ZO9A 5D7IF 4AENB 2FR4A 5TFSH 3BPOC 1U93B 1JPSH 4FTVD 5JLZB 4ODWB 5EFIA 1MF2H 1WBYA 4U1GC 5IW6A 3NFPA 5TGBB 3VXTB 1G0YR 1ZLVK 3VFGH 1JF1B 4ORZC 5K59E 3FTGA 5K33A 3UTSA 1LO0H 3QB7C 2YZ1A 1BX2B 1D3CA 1BOGB 5F3HA 2WP3O 1QKZH 5I8OL 3PWUA 5LQBH 4Z0BH 5T1DH 5J11B 4OCNC 2ICWA 4UBDC 3W0WB 3G6DH 4U1SA 2DJ4A 4F2MB 4OD3L 4X98A 4NIKB 2NY5L 1P2CA 1T21B 1UM6H 5D7LE 4P9HH 5A16A 2W9EH 1W72L 1INEL 1NGPH 1T4KB 5L7XL 3P2TA 4ZFFA 5ITFB 4WDIA 4AZ8A 4OLWH 4R4FL 1M6OB 5EO1B 3F62A 5AZ2L 1RUPH 2YD5A 3UX9B 2AKRA 1OW0A 4PJEB 4OZGB 2DWDA 4OFYA 2PYED 2I24N 1KIPB 4JJHA 1QRNA 3SJVB 2DWEB 5IP4A 1TVHB 3H2WA 5E99L 3BGMB 5KG9A 4G6MH 4WY7L 2VXSH 2DIJA 2OP4H 5C0GB 3V5KB 4P49A 2VZVA 1NKRA 2YWZA 3GMMB 4XGZA 1AI1H 3QQ9C 3ECBA 3IJSA 4YFLI 1Q1JH 1A4KB 5J1TC 4FQ2L 4QCIB 2X05A 3LIZH 4KHXL 4KY1H 5BQ7B 1EV2E 1KJ3H 3D48R 4KUCD 4PB0H 5KVDL 2YPLE 1LEIA 4YBHA 3WHXA 5MP6H 4L8SA 2VDMH 5EU6B 1NJ9B 3INUL 2BC4B 2R9HD 1F4XH 1X5LA 4ZYKB 4XBGB 4YWGH 3BH9A 1Z9SA 2NY4C 4DKEL 5I1KL 1HIMH 1A3LL 3I3EA 2YUWA 2OJEB 1Q9LB 2Z8RA 1I8LA 1HH6B 4JKKA 1Q72L 4NWTL 1VFMA 1YYLL 3TT1H 3L3GA 3HNVH 1SBSL 4PJ5B 4L3CB 3U82B 2APWA 2KQMA 3G9VA 2ICCA 4XHJC 1PZUB 3CSBA 4RNRB 1G7QB 1MWAB 5CSZB 5IFAH 1IGFL 3JWOC 4M7KH 2BSSB 4XHJD 1MCHA 2R0ZL 4DZ8A 5KSVB 4PY7A 3WKNA 3OV6A 5L88H 3MRLA 1DE4B 3ZT5A 4W6WB 2BRRL 1U92A 5DD1L 1UM5L 4K3JH 1CFSB 2EE3A 1P4LB 4Y4FD 1YNKH 2VZOA 3S35L 3T09A 4EVNB 3QA3A 4W4OC 3K4ZA 1IKNA 2DQUL 2Z8VC 4PJ9B 4PLNC 3CXHK 2I5YL 2WLYA 2V7NB 1W0VA 3ULVD 3OF6A 4YNYB 5DTFA 2IH1B 5I1LB 1ZA3A 3TPUA 5L9DH 1TTFA 2VZUA 4LLUA 4EN3B 1G6VK 4LCWD 3RVTD 2WBKA 4RGNE 2GK0A 3T0DA 2YKLL 4JFDB 1D5XA 4K23L 5C0AE 3ZHLA 2EKSB 3VWJC 4K8RL 4HHAA 4I9WE 3BIAX 4OB5L 5KS9E 1A7OH 1E28B 2O61A 4JFFD 1MHCA 3O3BA 3VWJD 1KSRA 4HC1L 4X7FC 2HKHH 4GS7C 4O2EB 4Z77A 2JJUA 1AGEB 3MV9E 3WV0A 1CD1B 4FQXD 3RVUC 3IDJB 4MJIB 3HMXA 2EYTB 4BZ1L 5KAQG 2BOCA 2GK2A 1J10A 1RIVH 4XX1E 5I8KL 3HCVB 3E3QE 4DGVL 3ZKNC 3P0GB 1T03H 3CC5B 4I2XB 3KPRD 2XKSA 1F4WH 1IVLA 1I1YA 3SE3C 4PRHA 5ERWB 3UYRH 5FHBL 4I8DA 1HOCB 2W59A 3F65A 4UT9L 1IGIH 2P5WE 5EUOE 1TETH 4FXGB 4PJBA 4WCYH 4DVRH 4ODTL 4WHTB 3KHQA 5ACZB 5KTEH 1WFUA 1TXKA 5HJ3B 5TJWK 1JGEA 4GW1A 1MRFL 3VMNA 4PRIB 1KCUH 2ORBL 1BEYL 1KJ2L 5ITBH 3JTTA 3PJSB 1E4XL 5C2BL 1IEAA 2YA1A 3Q5YA 2NY0B 3VMPA 3RWHA 3GIVB 3NGBC 1RZGB 4Y4KD 2XWBB 3GB7A 4P5TD 4JDVB 3BN9C 3NCJL 5J1AA 4XCEB 3HRPA 3G6AB 4ODBD 2ITCB 4LLMA 3VG9B 5CKAA 3V6FB 3T77A 4IJ3C 2AS5M 3QP3A 4UT7H 4FFWC 2X1QA 5DUBA 4WRLA 1AO7A 2P24B 3MFGB 4LSSL 5IBTL 3OR7A 4PJCB 1NAMA 2BNRD 4LIQL 4UV4L 5TQ2L 5I1IL 1VCAA 3UYPA 1BQHB 3LKNA 3G08A 5DGQA 5DR5L 3TA3C 2CMRL 2FO1A 3CZFA 3WS3B 1K5NB 4YAQB 3TCLA 2D7MA 4PLOB 5DJAA 5ENWB 3PIQA 4OFPA 4NFDA 4ENEC 4HFUH 2X9WA 1MCEA 3DV6A 2VDKH 3O9WC 4QY8B 3VFTB 5AYQA 4M8QA 4XVSL 4OF7A 3KYOB 4QXWA 5D9SB 4JO2H 3KDMA 3O6ML 4YHYB 5HI4D 3C5SB 3MMEB 2GW5A 3QCVH 1AP2A 3QHZL 5IBUG 3OPZL 3FT3A 3OKKB 4D0CA 2NY1D 5IF0B 5DUPL 3SDXF 4IRSD 1I9JH 3UPCA 2DMCA 2CXGA 3KPSE 3MA7A 3QNYA 1ERNA 1GC1C 3ARTA 1RZ7H 3O6KH 4TTDC 3UAJD 5C70A 3HZVA 5HD8D 4P5KB 3BRFA 1OAUH 3S37X 1H5BB 3MQIA 2D03L 4OZHF 1E4WL 2BZDA 3S97C 1J9CT 2XZZA 1K9TA 1IGMH 3GSXB 2DYPB 4G9DA 5D7LD 2Q86A 2OZ4A 5IHUH 4HK3J 4B0MM 5DEGB 3BKMH 1EAJA 4HWNA 2R0WH 3W11D 4Y16C 3BEVB 3WO4C 1EUUA 5E6IC 1I8IA 4W4OA 2ADIB 5TDPB 1T5WB 4XCFL 4Y2OA 1MHPH 1J8HB 5IB4B 1VFUA 4UINL 4BK5A 3ZMRA 1G9EA 5EU7E 1JTOA 4LCWA 1W72B 3PWJA 4QF1A 2CKBA 4PJHB 1N59B 4UQ2B 3GI8H 5FEBA 4NFBA 1MFBL 1UADC 4OCWH 3EKCA 1CFNA 3H9ZA 4IEFB 5C09A 4HZAA 5DD5L 2H6PA 2FYYB 5HBBA 2CDFB 2WIIA 4U1LA 4ZFOA 4M5ZH 5DMKB 4S11A 2A9NH 1Z5LB 3V8OA 4QNPE 2HLAB 1X6LA 3O6FC 4N5EC 1YY8A 4Q74A 1XGUA 2OX5A 1JHLH 1P7QA 3O6FD 4X9HA 1PAMA 5AG8A 4TOYH 2J3SA 3GSRB 2XZAL 4KRLB 5ICYB 3EYOA 3K8LA 5DJXB 2YPLD 2E3VA 5MI0B 1D6EA 3C5JB 3Q6GH 3C8HA 2O5YH 3MZTA 3VGAB 3UTPD 1DSFH 5GIRB 4IHOA 4NUGL 1DANU 5E5UB 1S9WB 2VSDA 4ONGH 5MEOB 1OTSD 5LCVL 3CPLA 2HN7B 2FBJL 4UTAH 2OYPA 2VAAA 2R2EB 1J8KA 5L0QB 3MX0A 3SE3A 1RIHH 1WTGT 1O7SA 1WVZA 4PLJC 5A2IH 3B8SA 3QDMA 3LV3A 1CGSH 4J3XA 4P3CL 2WAHA 4LBEB 5C7XH 4KFZC 4HK0A 4UDTA 4YX2L 3P9WB 3QFJA 2LVCA 5FYKU 3CDCA 1JHTB 2F53A 1SBBA 2BNQD 3KLSA 4ZD3L 1JWMB 4GQ9H 1S7XB 1TIUA 4HBCL 1CXLA 1NC4A 1VHPA 5GGRY 3WEXB 4NQUA 3MGOA 5KVFH 5IMOB 1UH4A 5DFTA 2J6EH 5DURB 3QBTB 3HNTL 3UJTL 4U6XA 3HMXL 5FYLH 5HGBA 2R69H 4ZUUB 1EEZA 1RZIB 4RGND 5IIEB 3SKNA 3TA3A 3HPJA 4P2QE 3KPMA 2VLLA 5C0AD 1IT9L 2VNCA 1WQVT 2B1AL 3F58H 1OSPH 3QDGE 2NXYC 4I9WD 3QHFH 5ID0B 2HT3C 3O9WA 5I0ZA 4WV1B 5DRWB 4XT1C 5HI3D 3FO9B 5FECB 4K3DL 3EZJB 1P53A 3NIFE 2HT3D 1IAII 3BHBB 4GBXD 3GJFB 2J8UE 3MV9D 1XF1A 1YEDB 3DI3B 1LNUB 3KJ6H 3CD4A 3MRHB 5HDBE 1FYTA 5B8CC 3D69B 1DQLH 3LHPL 1JZ6A 4NM8L 5D71L 4ZUWB 3LD8C 2P7TB 4OFDA 4MJ5B 3OZ9H 1UKQA 2DMKA 4LHUD 4PJ8C 1MHHA 5JQ6L 2PO6D 3FCTB 5J3HC 4MB3A 4MQSB 1FRGL 1PG7W 2P5WD 1TCMA 1KTLA 3A67L 5DK2A 5C0BE 5J3HD 3IYLW 5I74B 1Y0LA 2YN5A 2YPVL 1KYOK 2YC1A 1NAML 3O4OB 1RZFL 1U8LA 4LSPH 1FLRH 5BZDA 4X6EB 3R4DA 1MVUA 2M26A 4L8CB 4L8DA 2UVEA 2H41A 4XNYL 4Y16A 3QNXA 4QRSB 5E6IA 1VGEH 1TQBB 1U95B 4KI5F 3FN0L 4KKCC 2B4CH 1QSFB 3FOMA 1KJ2B 4WUUB 3JV6B 1IC1A 5DQDL 1QFUL 5E2TL 4D94A 3MJ9H 4BJLA 4CKVX 2F74B 1T83C 2Q8AH 2FR4B 3OKOA 3L3JA 4HKZA 3HNSH 4XPFH 5CEXA 4HV8A 1U58B 1WC7A 1T3FA 2DLIA 5C0IA 4RMUA 2PYFB 5EFIB 3VI3F 4EOWH 3HKFA 3BPNC 1KPUB 2EECA 1A3RH 3OR6B 4OBRA 3NFPB 1XGTA 1I8MA 1I3RA 4XWGL 4IIQB 3FTGB 4DKAA 1S9VA 4L3EA 5SWQA 1I1FA 3TJEH 3J7HA 2XOTA 5LKNA 3MROA 4UDUB 4YHPA 3ZSSA 1BWWA 1G9NC 3JWOL 5T5FL 1NGWA 4K9EL 3MREA 5F3HB 4QYOA 1FBIH 2XWJA 3DBXB 1AQKH 1CD8A 5I1DA 2FNBA 5F1SA 2ICWB 5F7EH 4JQIL 1URLA 1HILA 5BXFA 3S35X 4BZ2H 4X98B 3K2UL 4X4XA 3LS5H 4LSRL 3O11B 3Q6FA 1KB5H 3WSQH 2AABH 3O6LH 3NIDE 2CKBL 1KENH 2X4NA 3KR3H 5E8EB 1B6UA 4ZFFB 1ES0A 5IQ9A 5I73C 4PREB 2O93L 2BNQA 3GHBL 4WEBH 1M4KA 1KN4L 4ZFOL 2AKRB 1U2HA 4PUBH 5TPWH 5IB1A 3KLDA 3RQ3A 3WNPA 3TEUA 1AGFB 1UYWL 1E4XI 4B7IA 2ZUQB 2VLJA 5KG9B 4TSCH 5HGDA 5GHWH 4CNIA 1SEQL 4G42B 4G80A 2JF1A 4JPVL 2GIYA 1GGBL 4LASL 2XTJC 3SGDH 1F13A 2DJUA 3V95A 2QJDA 4XBPA 3ECBB 5EORH 4XPHL 2R0LH 2R56L 4KVCH 4LLAA 3VGEA 4DCQA 4OGXH 3ARZA 2ZCKL 5CMAA 3CFDB 5H94B 1LEIB 2JIXB 1LHZA 1IM9A 2PTUA 2J8HA 3WHXB 1LDSA 3FHAA 4L8SB 1FE8L 3BH9B 5D7IA 3FKUS 4E9LA 1L9NA 3FZUC 4WEUD 3UTTA 1IQWH 4JY4A 2ICWI 4F33A 1TNNA 4P59L 3ESUF 3D85D 2V7HB 4KPHH 4APQD 5B8CA 1EO8L 4G8GD 4I0KA 3HLAA 2VDNL 3AXLA 5T1MB 1BJ8A 3CGTA 2C1OA 4DZ8B 3MO1B 4PY7B 3MRLB 1D5IH 5KVGH 2R1YA 2XA8H 1RJZA 1U92B 2IMMA 1GHFL 4PJ8A 4LKCA 2AXHA 3GI9H 5HHME 2PXYD 1D5ZA 3VFPB 5IKCA 3HI6H 5DHYB 1JWSA 5IW1B 1FPTH 2H45A 3QA3B 3CMOH 3RDTD 5IMLA 1G84A 1BFVH 2GJZA 2CRMA 4JG1L 4FMFA 3FB7A 1WBZA 3QEUA 5EZIH 1ZA3B 3TPUB 5TDNA 3QR2A 2RHEA 4ZO6A 4LLUB 4AL8L 1YYMH 2D0GA 5D1XB 2VMFA 2O5ZH 3TIDA 5EBGA 1DVFD 2D31B 1HHHA 3MNWB 1ZTXH 3NTCH 4Q6YA 2VB5A 4X0KA 2RB8A 1T83A 2PR4H 1S9XA 1HKLL 5FDWA 1JBJA 4HMEA 4RX4D 3V79C 3O3BB 3BPOB 4Z8FL 4P46C 2ZSWA 4Z77B 3DMMC 3LB6D 4YXHH 1OB1B 3IRZA 3R1GL 1DQDH 4OZFA 3RVVC 2OL3H 2VXUL 5LWYH 4JO4H 5E4EC 1UG9A 2BOCB 4GSDH 1A7QL 4M03A 4Q6IC 3R06A 2H32H 2NR6D 3H0TB 3GMNA 2DQIH 1NSNH 3CDGA 3HZKA 5DD6B 2W0FB 4NUJA 1EVUA 2JJTC 1I1YB 1HZHH 1VDGA 4PRHB 4PJBB 3PWPA 4WHCA 4CDHA 4M7LH 5MEQA 5T3XH 3V6OC 1JGEB 2VE6A 3CFBB 4ZUTB 5MENB 3QG7H 3VW3L 1IEAB 3ILQC 1GJIA 3L3HA 4YPGA 4FP8H 3GB7B 2OTUB 3FQWB 5J1AB 5SWZE 2CRZA 3QULB 1OGAE 5C0BD 4NP4L 5FIEA 2VZSA 1XF3A 4LLMB 1QLRA 3I9GH 4XRCB 1QPPA 2Y06L 5DFWH 3MRDB 1SMOA 1Z3GL 3T0WA 3CUPA 3GHEL 5DUBB 1XF5A 2VISA 1AO7B 5TQ0H 1KCRL 3OR7B 2GJJA 2P5EB 4F57H 4ONFH 3LKNB 3ZYOA 1D9KB 3BZDA 1LD9A 5F21B 3GMOB 1DQML 1ETZA 2ED9A 3T0ED 1QSVA 3ETBF 1PSKH 2OSLA 3PIQB 1QFWL 2PF6A 1X5GA 1K6QL 3HFML 5JDSA 4UB0L 3ARPA 2VXVH 5C92A 4DZBA 2D7TL 2VDPH 3OGCA 5DK0A 5ID1A 1GAFL 1F5WA 4YFDB 4NKOA 2QQQA 1CDCA 5JZ7C 3R8BB 1S3KL 4GAGL 5IVXF 1YUHB 1QA9B 5GGQH 2NY4B 4RMTA 4D0CB 2BVOA 4N8CH 3JV0A 4NO5B 4FFYL 1I1AC 1T7XA 1BMGA 1DJSA 3MRBA 1NEZA 1RIUL 5KZCB 3HZVB 2SEBA 3T4YA 5CEZL 3RZCD 1U8QA 1DDHA 4JQXC 5JO5B 1N6VA 2YXFA 4DGYH 3U4BL 4ERSH 5KSBF 1U36A 4G9DB 4OFKA 4LQFL 3X3FL 1PQZA 3G5XA 1ZA6B 2ATKA 3LS4H 1XGQA 1LO5B 1WFTA 4JVPA 2KZ1B 4NOBA 1II4E 2Q8BL 3DSFH 4X4YB 5JW4M 3MBED 4GH7B 2DD8H 4NZJA 1ROWA 4CJ1A 3L6FA 3GO1H 1R6VA 2FH8A 4KQ4L 1IL1B 4JFXB 4JHWH 3O45A 5DRXA 3OJ2C 2GCYB 3EOYG 4JKMA 5GGSY 3VGHA 3PWJB 3UMTA 4HGWB 4QF1B 3V0VA 2CKBB 2H8PB 5AAMA 2HMID 3VG0H 5C09B 4MJ2A 4DN4H 1PJ9A 2BOBA 1HHIB 1OAQH 2H6PB 4KC3B 1KXVC 2RFXA 3D6GA 5TF0A 4RISH 3THML 1HYRC 1BBDL 2XN9D 3WDJA 4NJAL 1YN7A 1EFXD 2OQJA 4F37F 1YY8B 4XP4L 1XGUB 1GGIH 4RQQB 5HHOD 2YN3A 3MRFA 4YDIL 3IFLL 2D9CA 1MCIA 2GSGA 4JDTH 2B8OT 1NDGB 4P46A 1JF6A 4GS7B 5EUKB 3EYOB 3DMMA 4F9PC 4Y19B 5TDOA 5DDHB 2Y25A 3G5VA 1D6EB 2ZUTA 4K7PY 4X9BA 2F54B 3BXNA 1JK8A 1V7NH 1NCAH 4IHOB 5KANI 1CE6B 4S1QH 4JFYB 2FL5B 4Q6IA 4ZNEA 3G5YB 3RL2A 1C5CL 3MGTB 3SE8L 3PABB 3U6RB 3BZEB 4WWKB 2JJTA 4OAWA 2WLZA 4X99A 3TESA 3HMWL 4PRDA 5GS3A 3QDMB 3LV3B 3BKJL 3H7LA 3QUMH 5BV7H 3V6OA 1UCBH 4HZLA 4N0CD 4HK0B 5H8DA 4OV5B 4UDTB 3SDXA 1J1XL 1A7NL 3QFJB 1MRCH 5LJYH 3GBNH 2F53B 3CSPA 5DJCB 5E56A 5HHMD 5JA8B 1F4YH 3NGBB 2AJXL 4QHMA 3VXSA 1CFVH 1PG7L 4MX7A 1NC4B 2YA0A 4OZHA 3MGOB 5IR1B 4KUZL 4PGZA 4MXQC 3MJ7B 3U36B 2YD7A 3BAEH 4DTGL 4TPRL 1G7LA 2NY3C 1OQXA 1K4DB 5I19H 2NNAB 3QUXD 4U6XB 5HGBB 2W92A 4U3XA 32C2A 5BRZA 2YD9A 1EEZB 3ZTNH 1I9RH 5ALBH 4KI5C 4QXUH 3TA3B 4RWHA 1DLHB 3HPJB 1G9NL 3KPMB 1FNEA 4TQEL 1U8MA 1YNLL 4KI5D 1KN2H 4EZMA 1U8KB 4X8JB 4BH8B 3WXWH 3O9WB 5I1EL 3WD5H 1WZ1H 5HGGS 3F6IA 3DURB 5I2IA 5I8CA 3RGVD 1H3PL 4PRPB 4NQVA 5AZEH 2JJSA 3BMWA 1F3DJ 3SDAD 3M17A 2PN5A 1FH5L 4K3EL 4OCXL 5HHVH 5DVNA 2DLFH 1V3MA 3KYMA 4M6NH 5IW3A 3MV01 1I1AA 2YUXA 5D1ZD 3IXAA 3IGAB 1X4ZA 3LN5A 1BFTA 2JK5A 1P9MC 1J0YA 3W9DA 2BY3A 3ZHKA 2V6HA 4JQXA 4HS3A 3EOTH 1GPOL 4XPTL 5CWSA 1FAIH 2YC1B 1U8LB 5BZDB 4EDXA 1FV1B 4KK6D 2OR7A 1MVUB 1PEWA 4EUPH 4L8DB 3HN3A 1ZLUH 3TYFB 1C7SA 3D18A 4Y16B 5IK3A 3QNXB 1VFBA 3WO4B 4YC2C 2P8PA 5E6IB 4R0LB 5F93C 2EH8L 3MCG1 5K9JH 3BIBX 5F96H 3RHWK 4IDLA 1NCDH 3FOMB 2EIZA 5JUEL 5FFLA 1QYGH 3I6GA 1MI5B 4NCDA 3TZVD 3H3PL 5E8DH 3F7VB 4R2GD 3WFBL 5IJKC 3OMZA 1Z9LA 3PP3K 2XN9A 3TBYA 3OKOB 2I27N 3MJ6A 5F7WC 4HV8B 4UU9A 1WC7B 4JFHD 4K7FA 5GRZA 5C0IB 1QP1A 4PTTA 1OWRM 2QHRH 5JORA 1NMAH 4XMLH 4NC2B 1I3RB 5IB5B 2MHAA 3BESR 4L3EB 5SWQB 1CICD 5IOPA 1LEKA 3S4SG 1BAFH 3EO0A 3RJDA 3MROB 4YHPB 4F9PA 1AKJA 4EBQL 1NGWB 2DQGL 3MREB 3P77A 5JIHA 4R90L 4QYOB 1MHEB 2XWJB 4L4TB 1T20A 1KC5L 4PJXE 5I1DB 3CFIC 2EDKA 4NHCL 3BKYL 1J12A 1HILB 2AERT 1CU4L 3BZ4B 5CIPH 5BXFB 5F6HJ 3FO0L 4M48L 5FYKH 3MYZA 2AJUL 4G6FB 4ZOCA 4O51A 5ADPH 1OOAA 2X9YA 3EHBD 4XXDB 4ZODA 1WWWX 3IFNL 3Q6FB 4KV5F 1MJ7L 3LRSA 2EYRA 2X4NB 3UJIH 3MR9A 3GNML 3QUYD 4PJAB 5E5MA 1P84K 4HT1H 4WEMB 1YY9D 2X4QA 4TTGA 4GG6E 3ZKMD 1T1YB 1T04A 2HFGL 3GJFK 3TJHC 1G7IA 1A3QA 3L7FA 35C8H 3J8F7 3G04A 1YZZA 4YUEH 5DGRA 2VLJB 3H42H 3BPCA 5TFSL 4ELMF 1ACYH 4Q9RL 4G80B 4PYGA 3JV5A 4QT5A 5CJXC 1YQ2A 4YQXH 4B7LA 4JY6A 1MF2L 4XBPB 5I30L 2VLRD 3VFGL 2DQJH 3EO9H 1LO0L 3G6JA 3DNKA 4G8FB 2IFGA 1KPRA 5CMAB 4XMKH 2UZYB 4F7TA 4YK4C 2E6QA 2P47B 1IM9B 5F9OL 1QKZL 3WIFA 5T1DL 3NAAL 3T3PE 2QSQA 4HXAH 3G6DL 3HE7A 5SX4H 3V2AR 3G5ZB 5J9PA 9CGTA 5TE4H 5C0ND 3UTTB 1BVKA 4MD4A 4PGJA 4F33B 1YEJH 3QSKB 5T1KD 3C5ZD 1V7MH 4KKAD 1A4JA 3T8XB 5B8CB 2W9EL 2ICEA 4ZPTA 3HLAB 1PX4A 1A02N 2IPTH 1X6NA 1I3UA 1S5HA 4AH2A 4NZUH 2F8OA 1F8TH 3LD8B 4OLWL 2C1OB 1U3HD 4X4ZA 1RUPL 3STBA 3EOAB 1RJZB 4BYHA 1NFDE 1P9MA 4LKCB 4WI4A 1CLOH 5HHXH 1JJUA 4Q97A 2COQA 5IKCB 1JWSB 4URTB 4BUGA 1ZT4B 1HDMB 1WAAF 5IMLB 3FHQA 5JR1H 2NW3B 4FHBD 2GJZB 3M07A 4LAQH 2XG4A 4G6ML 4LCIH 3FB7B 1G0XA 5ADOL 1M1SA 1CXKA 4XNMA 4Y2DD 3RGHA 4UNUA 3UYOD 4ODVH 5IVNA 1AI1L 1S8DA 3VMOA 3BH8B 2UUDH 2VDOH 2WV3A 3CXHJ 4RDQF 1X5FA 4MNQB 2A73B 2B4CC 2E8YA 3QWOA 5D5ME 2BVTA 4KJWC 4KY1L 3TIDB 1KIUA 1KJ3L 4PB0L 3IS1X 4KJWD 8CGTA 1RJYA 1HI6A 5IJKA 1JCKA 3M45A 4X0KB 4WGVB 2VDML 3CVIH 4PRNA 5FDWB 3TIEB 4M61A 1F4XL 4I18C 1T66C 3TWCH 4YWGL 4YLQT 1HIML 3CVHH 1A6PA 4G3YH 2XZCL 1IAKA 5FV1L 1NL0H 1R5WA 5J12C 3TT1L 4JKPL 2XTLA 1ZLWK 3X14A 2BX5A 2VDLH 3R06B 1R3HB 4M7KL 3MCLL 2A6KB 3GMNB 3CDGB 3HZKB 2EO1A 4NN6C 4K3JL 4BFBD 4NN7C 1CDGA 1KTRL 2BVEA 4NKDA 1ADQH 3PWPB 5FGCB 3MLSH 3P4NA 1B0WA 1WFOA 1MFAH 3FN3A 5AD0B 5MEQB 4X6CE 1G9ML 2VE6B 4H20H 4NQEB 4FQQA 4P2OB 4WI8A 3ZDXE 3QNZA 5JMOC 1FNFA 3OAYH 5F89A 3L3HB 5L9DL 2CJUH 1LP9E 3O2VH 5I73B 4OLUH 4CVZB 4F7MA 1XF3B 3IDYC 1QLRB 1S5IH 1A6UH 1J0HA 5CGMA 3I6LD 3MJ8B 1RFDH 3WXVH 4TVPE 3CUPB 4GLRI 4ETYA 1LWRA 3GSQA 3DX8A 3WFEH 2F8XC 3WN5C 1LD9B 2J6EA 5CJXA 3VRJB 2XTJB 4LGSB 3MA9L 4PGBA 2OSLB 3QIUC 1JTTA 3UDWC 1QSEA 3GBLA 1CLZH 1QVOA 3ZE0F 2KDGA 1RIVL 3R8QA 5JDSB 3LKRA 1T03L 1FZJA 3GK8L 4DZBB 3OGCB 5DK0B 5ID1B 3P0VL 1X4XA 5EPMA 4NKOB 1F4WL 2KL6A 5C1MB 3LQZA 3ZSTA 3CZJA 3UYRL 3FQUA 4DVRL 2UY6A 1KLUB 3FRUB 5KTEL 1AR1C 1AXSB 3QH3B 4QXTA 4LSTH 1FYHB 1KCUL 2HRPH 3MRBB 1NEZB 2G60H 1AJ7L 1A0QH 3X11A 3GSNH 2SEBB 3ZT6A 5CFHA 2WUBH 5E1HB 4TNWF 3KYKH 1NGYA 1PG7X 4NHUA 1DDHB 3KPOB 4GAYB 1FC1A 4OGYH 4FFVC 5C0CD 5KANG 1JYWA 3QO1A 5A2JH 1PQZB 4HH8A 3G5XB 4Q9BA 5IWLC 1UGNA 4JN2A 1IAOA 5HYSA 4OLEA 4J3OC 5DHXB 4UT7L 4M6MH 4MQ7B 1OARH 3DOSA 1U8OA 4ZOAA 3EW3B 1AXIB 5EH1A 5DRXB 2DF3A 4E0RB 3O45B 2KZWA 3KXFB 4QHKJ 3D9AH 3V0VB 3ZDYE 4X7EC 4OI8A 1JGUH 1PYWA 2F9BT 3DXAE 2BOBB 4D9RE 4AEEA 4YDLC 2RFXB 3DO7A 3JV4A 5C3TA 1EA9C 5C0DA 4JO2L 2OQJB 4QWWD 3MJ9A 4JZNA 5E4IA 3QCVL 1CTNA 1HN1A 1E6OL 4I18A 4KKNA 4U1HB 1IARB 4OLVH 4P46B 1I9JL 2DIAA 3DMMB 5TDOB 3DRTB 3DX9A 1E4JA 3G5VB 5LXGH 3PQYB 1RZ7L 3EDJA 3LQAL 1U6AL 3BXNB 1OAUL 4MD0B 4N0RA 4JFED 2C4FT 3FT4A 4TNVK 1ND0A 4GQPH 2GTZA 5LGJB 2EDLA 1MCKA 4D9LL 2AEWA 5CZVH 1MWAH 4U49A 3C60D 3T4AB 4X7SL 1AC6A 3F7QA 3U79A 3BKML 3V9FA 1MNUH 4JGMA 4PRDB 1INQA 1KLGB 4LPYA 1X5XA 5IVXA 1Q0XH 2AJSH 4WHYG 1MHPL 4U6HA 4YHMH 4XTRD 5T3XD 1X5YA 4YDKL 3U83A 3ZHDA 3KAAA 5D6CA 2AJYH 1KB5A 1KJVB 2AGJH 4OCRH 2VLKA 3E2HB 4MX7B 4XPAL 1UH2A 4ZUSA 2WIMA 2BY1A 3WNOA 4HMDA 4XVTH 5KSBA 2A9NL 2J4WH 1NFIB 3G9AB 5I1HH 1G7LB 1QQDB 2PTVA 4LDOB 4U6YA 1JHLL 4DUVA 32C2B 4X6DE 1NC2A 3PXJA 3WN5A 4Q9QH 4HH9A 1FC2D 2ARWA 3OQ3B 4PJ7A 1FNEB 2DICA 2AXJA 1U8MB 4LLVA 3QIUA 4OIBA 2O5YL 3UDWA 1FO0L 1FIEA 2EE9A 3ROLA 1Z6JT 4L4VE 4X6FA 4MNGE 4ONGL 5EOCJ 3OHXB 1OAZH 1FSKC 3MGAA 4U1NB 3RI5F 2PW1A 5ANME 5HGAA 5GJSH 5I8CB 2KBGA 4NQVB 4MVBD 2WM0A 3VXMB 4RGMC 4ZPVB 1BD2E 2VRAA 2MTPA 3L3DA 3RIFF 3D3VD 4M02A 1CGSL 5C0EA 1HH9B 5C7XL 3H7BA 2ESVE 3KYMB 5I1CH 4ZOEA 1I1AB 2DQCH 1NUFA 3LN5B 1PKQE 2JK5B 5GS2H 2NX5E 2ADGB 4BQ8A 1U91A 5E6ZA 5GS0H 3O3DA 3W9DB 4CVXB 3WFHB 3V4VH 4KGLA 3TN0D 4GQ9L 1H3WM 4C54A 3B8YA 4TVSa 4CN1A 1DTUA 1S78D 3ZDZE 1NBVH 1QEWA 3MV8A 4F80A 4P4RA 5KVFL 2DKUA 5IWLA 5L2KB 1DL7L 4WFFE 4E41A 4NQSA 2J6EL 5EC2A 3D18B 1VFBB 5IFJB 2HJLA 1GGUA 3BGFC 5FYLL 5KVMC 2QHLA 3O8XD 5I18H 2R69L 3VFSA 4O4YH 2R1WA 4HEME 3BPLB 3LMJH 5E9DD 5ICXA 2QSCH 5MHSE 1OAKH 3GKWL 3GRWH 1BP3B 4Z7VA 3WKML 4TVPD 2VR4A 1OSPL 3VFUA 3TBYB 3QHFL 4N9OB 1QFOA 4Z76A 2FEEI 1BLNA 43C9B 4G9FB 4AG4H 2XPGA 4UU9B 1HXYB 4BFEA 4JRYE 4PTTB 4H25A 1RMFH 4GMTL 4JJ5A 1SHMA 4JRXE 4PJGE 4IRZL 3KJ6L 4JANA 3TBWA 2FCBA 5GZOC 2MHAB 1DQLL 3RUGE 4WW1A 1ZGLA 3W82A 1LEKB 5K93A 3T2OA 3P11H 5GZOD 1AKJB 4MDJB 3P77B 1FZMA 2OL3A 2YRZA 3IDUA 3ISWA 3TBSA 5AUMB 4NN5C 2DQFA 2C3GA 5HHPA 1IKFH 3OXRA 2H32A 4KKLC 1GRWA 4O51B 5FCUH 1I9IH 1FLRL 4LSPL 4G6JH 4PJEF 4NQCE 2YXMA 3LRSB 1Y6KR 2ICES 4MXVF 3OX8A 2P42B 2X4QB 4UILL 4OD3H 2WK2A 1JWUA 3W39B 2QADC 2VWEE 3L7FB 4HUVA 1IBGH 1DZBA 3MJ9L 1W72H 1WWCA 3H8NA 4Y89A 4CRPA 1BVLA 2Y6SD 3BPCB 4DJMA 4XPFL 5T3ZE 4QT5B 1T0MA 3CIQA 4X5WA 1JHKL 3ARGB 2X1PA 1I85C 3W9EB 2IADA 4EOWL 1K4CA 5BS0D 3N1PC 4PJDE 1A3RL 1YMMA 1EJOL 2ZNXA 4YO0A 2RJMA 3DXAD 4D9RD 5E2UH 5IT2H 3G6JB 1LE5A 3TJEL 4PJFE 4WY7H 4WJ5A 4XHQA 3P4MA 1W2KT 4C57C 4OUUA 1FBIL 3WIFB 2QQKH 1AQKL 2YD2A 4AT6A 3AREC 5F7EL 3HE7B 1RZ8A 3QEQE 5CGYC 4JHAH 5J9PB 4KHXH 3ARED 4KMQA 2CXKA 5KVDH 4BZ2L 2F19H 3UPRB 1QLEH 6CGTA 25C8H 3D3VA 5EN2A 5CUSL 1A4JB 3ZTJH 2Q6WA 3ARBD 3WSQL 1KENL 4HD9A 4AEFA 4AIXA 4AM0B 5LGHH 4KK9D 3GMRA 3RL1A 1SYVB 2ATPA 3DUHA 1DLFH 2BY2A 4PUBL 5H37H 4JO3L 3RFZC 4JAMA 1SBSH 2CO6B 5B3JF 1C12B 3FJTA 1DBMH 4NQDA 2JCCE 1T2QH 5FOBA 1IC7L 1P4IH 2CIIA 4JFQB 1D5MA 1J0JA 4LHUG 1UFUA 5GGUA 5GHWL 1EXUA 4AQOA 2GQHA 2VR9A 1S8DB 4YC2B 5EORL 1QRKA 3NFSH 4C4KO 5JIKA 2R0LL 4P2RA 3L5XH 4KVCL 5KOMC 4X7TB 5E9DA 3IXTB 2LU7A 3HS0A 4DN3H 3D39B 4Q2ZA 3FFDB 1B6DA 1M71A 4LLQA 1W0WB 2PTTA 1RJYB 4U1JB 1HI6B 4S2SA 5FO8B 2Z31D 2D7QA 1MCNA 4HDIA 2E6JA 5T1LA 4XP6H 3CK0H 4PJIE 1LO4H 4FG6C 4JZOA 3AVEA 4NC1E 1IAKB 2YKLH 4ELMA 1I7RB 4D0BA 3VGGA 1R5WB 5F7FA 3L5JA 4O2CA 1JMZA 3X14B 4PP1D 4OB5H 3SKMA 2APFA 3KNBA 3ABZA 2B2XH 4DOHE 2DQDH 4QRTA 2FIKA 2R8SH 1S7RA 1D5IL 5KVGL 4OZFG 5F6IC 1FO0B 4NYLA 4KRPB 3GI9L 4NWUL 3RU8H 5HYJA 3ES6A 4BZ1H 1ZK9A 3GJEB 2JB6B 4NKDB 4HKJA 1BD2D 3HI6L 1A6AA 3P4NB 3GMLA 1DEEB 1ED3A 3KPTA 4MA1C 1FPTL 5I8KH 3HE6B 1BFVL 2ESVD 3NFNA 5FYKD 3MRCA 4LOUC 4L8BA 4FQQB 2ZP0T 2NX5D 1DUYB 3KVQA 3BDYH 4QLRA 5E8OA 2IQAA 3LCYA 3QUMA 4N0UE 4ODTH 4F7MB 4OZGE 1TCRA 2ZUSA 4ODHL 1MCPL 2O5ZL 4NNXB 4OZ4A 4Z9KB 2XWTA 3X17A 1KJ2H 3SHSA 3PWNA 4WFFD 5C2BH 3NTCL 4RMRA 3GSQB 1VPOH 1WAAA 2X4SA 3DX8B 4POUB 5BS0A 5D2LB 5L6YL 4GOSA 4YXHL 1A9EA 1K2DA 1I85A 1DQDL 5MHSD 1U8NA 2HH0H 2OL3L 1PDKA 4NNYB 5HI5C 2IBBA 5LWYL 4JO4L 1FFQA 3GIZL 4PR5A 1OGTA 4WI7A 5IBTH 4LIQH 5DMIL 3LKOA 5HI5D 1HQRA 1FZJB 2A38A 5C3LD 4YK4B 2DQIL 1IC5H 2V9TA 2N1KA 1XGYH 3CFCH 4WU7A 5JHDA 3WS6C 4JRXD 3AREA 3FQUB 5D2NC 1F45A 3JWDH 1A1OA 4XVSH 2P8LA 3RWIA 4XP5H 2HJFA 3REVA 4GW4A 4ELKB 1FORL 1T0NA 2XY2A 3RPIA 1S7QA 5JPNA 1F4AA 2EDRA 3B2VH 1MCLA 2H2PD 3QO1B 4PRBB 2BFVL 5EZOH 5HVWA 1NEZG 3I9GL 1GGCL 4LSDA 1IAOB 4PJHF 1WZMA 5HYSB 3GGWB 3TVMD 4Y5XB 3MBXL 1CK0H 5JIIA 5TQ0L 1U8OB 1DBKH 2LAGB 4Z7WE 5HPMA 2HFEA 5EZJA 2BNUB 1E4WH 4F57L 1KLFA 3DGGA 5DF0A 4ONFL 5IB2B 1JV5A 5CD5C 5D1QD 4JGJA 2B20A 1X9QA