4UUJA

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/metal transport
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujA02
5BVJB 1H3PH 2WV3A 2JELH 3OXSA 3C2SA 3OKNA 1K4DB 3WFBH 4XMLL 2D0FA 4MNQE 3FHQA 2OTWB 4PTUB 3TYFB 1J10A 3I2CH 5GS0H 1HK6A 5CGYD 3EO9L 3IDGB 4G8EB 1DBJH 3S88H 1DEEB 3ES6B 3K8LA 2VDML 4GT7A 3SDDC 1D5MA 3O2DA 4FN0A 3ARGB 4GXVL 3HPJB 2BY1A 1FCCA 4P3DB 4BH7A 5HTSA 4DKAA 5L0QB 3H3BC 3N9GH 1P7KB 5D1XC 1J7VR 4Q9RH 5EZOH 1GCFA 1KACB 5C0BD 2UZYB 4JFOA 2AEWA 4K9EC 3VMPA 1FGVL 1P4IL 1HHHB 2ZUUA 2X4NA 5BS0E 3CFDB 3V4PL 1OARL 1CN4A 1TVBA 5AD0A 5EA0H 4A6YA 4OFKA 2D03H 4ZOEA 1YDPA 3NFPB 3LKPB 5CP3H 3IDJA 2H26B 4YIQA 5TQ0H 3LQMA 1I8IB 4MA8L 2YZ1A 5GS3A 3DMMB 2DMBA 5HYSB 1WBZA 1I1CA 4BFEA 1PEWA 1GXEA 3GHEH 5BZDA 2YRPA 3V9FA 2QSVA 5MEOA 1E6OH 5F1IB 2XRAH 4JY6A 4I0KA 1Y18A 4NWTH 5F89A 4S1RH 3ARUA 3UAJC 2XWBB 2R2EA 3RL2A 4RMWA 4JPWL 3LQZB 5BQ7B 4BZYA 1NGXA 4X5WA 1PQZB 2YPKA 3L1OL 4CMHB 4KROB 3PIQA 4KK8D 4O2EA 3F7PC 1ZHKA 5DJYA 1P7HL 3B9EA 2XTJD 32C2A 4DGYH 4F37K 1EHAA 4GRLA 2CJUL 4G7VL 1DDHB 3QXDB 3FFDA 1P84K 4Y1AB 1XR8B 4M4PA 1INQA 1QPXA 5E56A 1NGPH 3H3PL 3GMLB 1I8MB 1AI1H 3VXRD 3P4NB 1ZLUH 3T09A 3E3QE 4IDJH 4NJAL 2ZUQC 1MCPH 1SM3H 5HDOA 4JPVL 1AC0A 5C6TH 2GHWB 1CZ8L 5EIIB 5JQHC 3WEXA 1YMME 1TJGH 3FQRA 4N0FB 1M4KA 1HILA 2SEBB 1X5ZA 1KLGA 3LEXB 5E8NA 3FQWB 4ZS6C 4LDEB 3U0WH 4LLVB 1W72L 1LO3L 2G5BA 3BE1L 3IS1X 1T1YA 2BC4B 4OIIL 1G7JB 1EERB 3LMJH 4R26H 4JEGB 1S7TA 4MSWB 4OI8A 5L9DL 9CGTA 3QP3A 3K1KC 4U2YA 2IGFH 1NBYA 3LRHA 2VSCA 2GJ6D 4BKLA 4H1LG 3GRWH 4NQDE 5BO1H 5EC1B 1J1PH 4FQ1H 1MHHA 1BIHA 2DLIA 2EKSA 1HXYB 4Y16D 4JO3L 3H0TB 4JFZH 4LSTH 3LKSB 3L3DB 1IGYB 1LP9B 1D5IH 1PX4A 4H0GA 2V2WA 3Q6FA 3ALWA 2IBZX 4XAKE 1XGPB 1F3DH 4OLUH 2X4PB 3RTQD 3HUJA 1JZ3A 1B4JH 3GSNB 1J0JA 3ZO0A 2JELL 3H9SE 1CD1A 3KPNA 3QUZC 1A6ZA 1FZOA 4QRTA 3VXSD 3JWNC 3CC5A 5C7XH 2WINA 1ZEAH 2GTZA 1YNKH 4KH2A 2BNRE 2UY7A 2DTSA 2D4DA 3PHQA 2RBLA 4OGYH 3UP1A 3ZYOA 3SKOA 4Q7DA 2GIYA 3I2CL 4M6AA 4JRYD 5GS0L 4O51B 5DDHB 4M7KH 2BHZA 1VEOA 5HHOB 5DJZB 1DBJL 3S96A 3S88L 1ZT7A 3CH8A 5C0BA 2NW2A 4N9GA 4HWZA 2NW3B 5TDNB 2HFEB 3NPZB 4CDHA 3PP4H 3BI9X 3N9GL 4HZLA 3BP5A 4GG8B 4Q9RL 5EZOL 4LGRB 5GGVY 1NUFA 4ZUVB 3VXOB 1SEBB 1G7QA 2FH6A 4OQTA 4JFQB 5FUCC 3BEWB 4J3VA 5IVOA 5EA0L 5D5MA 3T2QA 3GKWH 3S36H 3KLSA 1N8ZB 2D03L 1ED3B 4G8GE 1M6OA 5TQ0L 4XTRD 2BY2A 1IQDB 1RHHA 4N5UA 1WFUA 5CGYC 5E24E 1U8QB 2YD7A 4QRQA 1MWAB 3GHEL 2P47B 4RFNC 1E6OL 2XRAL 5DJ2A 2H6PB 4NWTL 4S1RL 3BZFB 5F72S 4D8PB 5I1EH 3EJZD 5CD3B 1HWHB 2OTWA 4K3JH 3TYFA 2NCMA 1AHWB 4PJ5E 4Z7WA 4NQEB 1J0HA 3KPPB 4PJEA 3IDGA 4G8EA 5DJ8B 2FHBA 2UY6A 1OGAB 3ES6A 4DGYL 3TH2T 4IRSB 3CMGA 4V2CB 3S7GA 4U6VH 1P7KA 1AXTH 4TVPE 4BQ6A 1NGPL 5DRXB 3I75B 5CKAA 5KANI 3CZFB 1AI1L 2L0DA 5J0BA 3D2UB 2WP3T 3OKDA 5C0RH 1ULVA 3QUKB 1Z5LA 3RNQB 3WFZA 5KVDH 4IDJL 1RVFH 1HINH 4DKFH 1MCPL 1SM3L 3WJJA 3STLB 1Q8MA 1V8HA 5C6TL 2GUOB 1SEQH 4O2CB 5B21A 3E0GA 3WN5C 5F96H 1TJGL 3RWEB 2ENYA 3DMMA 4I0PD 5HYSA 4KK8C 4L9DA 2X9YA 2ARJB 4GBXD 4M7JH 3MLPA 3U0WL 2XTJC 3VWKC 1HIMH 5F1IA 4RSVA 1FPTH 3VU2A 1NEZG 1L0QA 3FQNB 2MSPA 3LMJL 4R26L 2XWBA 4UDTB 4PFEA 1U95B 3LQZA 1ZS8B 1L7IH 1JWMA 3GRWL 5BO1L 4KRPC 4KDWA 2YBRB 2J88H 2V7HB 1JUFA 3UJTH 4ZO7A 2EO1A 5EB9A 5IR1A 4JFZL 2NY2B 4LSTL 5M94B 2W9LA 3BIKB 1D5IL 4XRCA 4KI1A 4JAMB 4PJGF 3TV3H 4OLUL 3JTSB 3QXDA 4JRYA 1B4JL 4IJ3C 1XR8A 1P7QD 4LVOC 3SPVB 2QHRH 1H3WM 1OGTA 4GQPH 3GMLA 5C7XL 3EDDA 5HVGB 3RVUD 1ZEAL 3S4SB 5C9KA 1YNKL 4MVBD 4P57B 4JFDE 3HAEG 1K4CB 3GMPB 1PG7H 4UMGA 4OGYL 3P4NA 1TVHB 3ZTJG 2JK5A 5F3BB 1C7TA 2GK2A 4P9HL 3V6OE 4M7KL 2EICA 5EIIA 4Q6YA 4L29B 1YEDB 4CVWA 4Z8FH 4ZUSB 1C7SA 4B41A 4PJXB 3NGBC 1IARB 4N0FA 4YBQD 5D72H 2IC2A 3RIFF 3KHQA 1X5JA 3LN4B 3LEXA 3ZSTA 4Y16C 1UQSB 2NX5D 3FQWA 1I8LA 5HHMD 3PP4L 4DN3H 3PGFH 1MUJA 3T4YB 4X7TB 1WQVT 2DYPB 5C09B 2BC4A 1Z9SA 3UPRA 1G7JA 4RGMC 1BJMA 4HEME 4MSWA 4NKMB 5DVMA 1T83A 2HJKB 5IHUH 3RTQC 1FNGA 1S7UB 2X89D 3D1MC 5EC1A 3GKWL 4W4NA 3S36L 4P3WA 4AYFA 1N6VA 3RX5A 3IXTA 1HXYA 4Z0XB 2GY7B 3S35H 2HTLD 3LKSA 4HQQH 5AG9A 4YX2H 1LP9A 1M7DB 1X5AA 4P4RA 5C0DB 2YHGA 4RAVA 4JM2D 4N68A 1XGPA 4U6TA 2X4PA 4YO0B 2VO5A 3GSNA 4CADB 2H2PD 1JNNH 5FGCE 3IAGC 4YPJA 5I1EL 2X9XA 4N8PA 3MGAA 5K9KA 4K3JL 3MLTB 2EDHA 1OM3H 5SWSB 4O51A 3E6FB 3LQAC 5DDHA 4NQVB 2NY7H 2VL5A 4PY7B 1ZVYA 5HHOA 4EI5B 4P46B 1BZQK 5DJZA 1I8LC 3WO4B 3Q3GB 4HGWA 4NO3B 4W6YB 1OF2A 2E9IA 2DKMA 4X6CF 1T6WA 1HHJB 5TDNA 1CD8A 5DQDH 1HXMA 1KCLA 5IQ9B 1YN7B 1T83C 4XTRC 3CXHK 4NQSB 4U6VL 5TPWH 1DVFB 5AWNH 1BVKB 2DOCA 5F7EH 1AXTL 2F54D 4ZUVA 2FDBP 3VXOA 4DZ8B 1MFAH 3V6ZB 2FWOA 2A9MH 2GSIB 5C0RL 4JFQA 2VLKB 3BEWA 5KVDL 4I0PA 1RVFL 1HINL 3FO1B 4DKFL 1CGUA 1DLHA 3HC0B 3UJIH 5E08H 4GBXA 3EJZC 1ED3A 4Y89A 1SEQL 5DUPH 3G9AB 5F9JA 5F96L 1A21A 2DAVA 1ZK9A 2LAAA 4PGZA 1MQ8A 2DF3A 4U6XB 4X9FA 1MWAA 1ERNA 5E5MB 1CL7I 1KIRA 2A77H 3MRLA 4M7JL 2PW2A 5BV7B 4LHUG 5A2KH 1HIML 2W07A 1FPTL 2H6PA 1RJZB 3BZFA 3PWPD 5GSRB 3WUWG 3MBXH 4UB0H 5CD3A 1L7IL 1AHWA 2D2OA 4DKDC 4NQEA 3RA7H 2J88L 1RZKC 3KPPA 4PJFF 1G6RL 2V9RA 3UJTL 2IPKB 4NC2B 1P7QA 1OGAA 5CEYB 1R3HA 3WJLC 2XPGB 5E8OB 3MJ7A 3VWJB 3O6FB 3N0PB 3KYAA 3H3KA 2L4OA 3TV3L 2JJTA 4IRSA 4PJ9B 3QFJE 5IHZB 4NHUB 3WO3B 1GGCH 1MIMH 4MXQD 4I0PC 2CLVB 2FHCA 2QHRL 5DRXA 3I75A 4FFYH 3W5NA 4GBXC 3CZFA 4Z5RA 4K3HA 1R5IB 3TO2B 4F9PA 1PG7L 4OZGE 3Q5YA 3AC0A 3EFDH 5ANME 3RNQA 4YDVB 4UNTA 1RULH 2D3VA 1FFRA 5GZOD 2GUOA 3FQTA 5IVXE 2YOCA 3I84A 4NQUA 3RWEA 3DVNA 3FRPA 5D72L 4F7CA 1T2QH 2GW5A 3IDYC 1ZLVH 2E27H 4DN3L 4X83A 3PGFL 1QFPA 2XQYK 3K7UA 3MCG1 5SWZD 4CW1B 1QLRA 3FQNA 1OWWA 3WDJA 3KPSD 1LE9B 5FM5M 1JI1A 4Y19E 4Z7VB 4UDTA 2ITCB 3FFCE 5IHUL 4M7LT 2OLDA 1ZS8A 3MOBH 3TCXA 5E7BA 1QLFA 3OAUH 1MFNA 1PX3A 2YBRA 5L8LB 1UJ3B 2V7HA 5MP6H 3U9UB 4JM2A 4MVBC 2EIBA 4H26B 1CFBA 3S35L 3WKNA 1PY4A 3KPMA 1JGVH 2I9LB 3BIKA 4HQQL 4Z7UB 3DUUB 4YX2L 2IH1B 1A7RH 4OM1H 3O4LE 3GJEA 3QZWB 4AQOA 4F9PC 5H37H 3ILPA 3QUYB 2Z8RA 3NCJH 3SPVA 1SVCP 2D7TH 4YBQC 4C4KO 1A0QH 1JNNL 3OV6A 5CZXD 3BO8B 1H3UA 2EYTB 3S4SA 3GBNH 1GL4B 2OR7A 2VXVH 4P57A 3BWAB 4NN7B 3U30B 1TVHA 5J1SC 5T5NG 1OM3L 5F3BA 4F9LA 3CFBB 2NY7L 3DYOA 1YEDA 4ONFH 4TSCH 3MODH 2F54A 1GGTA 4PJXA 1JIBA 3BHBB 4NCDA 4X9GA 1QFOA 3LN4A 1AH1A 5DQDL 1UQSA 2HTLC 5F7DB 3SJVB 4ALAH 5TPWL 1XF4A 4X7TA 5AWNL 3T4YA 5F7EL 5C09A 5A40E 3P30H 5J9PB 4JM2C 1MFAL 4FQIH 3E8UH 2A9ML 2APXA 1JNJA 1S7UA 3K46A 2H2PC 2X70A 5FK9A 4X4XA 2ZOKB 4XWGH 4K8RD 4HV8B 3UJIL 5E08L 1U3YA 4S2SB 1CFQB 4Z0XA 5DUPL 4JZJA 4QNPE 1G6VK 2IAMD 4NUJB 2OL3H 2X4UA 1G84A 2HFGH 3K4ZA 3RIAK 4PGDA 1SBBA 5F93C 4AT6A 1U8JA 4D9RE 2A77L 4E41B 1IZKA 2HTKD 3L3GB 4CADA 2YD4A 1MCHA 3ESUF 1EPFA 4F9LC 1C5CH 3MBXL 4JG0H 4UB0L 4EDXB 4Y4FD 3MLTA 1WAAE 2ZSVB 4KRMB 5SWSA 3E6FA 3RA7L 4PB0H 3F7YB 4EI5A 1KCSH 3IYLW 2NY1B 4NO3A 2YR3A 4Z0BH 2I9TB 1QHPA 2DIJA 3S5LG 1FLRH 3TBTB 2CDFB 5IB2B 3IJYB 2YUZA 3I6LE 4KK9D 4NDMB 5SV3A 1GGCL 1EEYA 1DVFA 2CUIA 1MIML 1Q9OB 4NC1C 4FFYL 3MR9B 1I7UB 3RI5F 2YD8A 5JZ7D 1BQHG 3QG7H 1ZLWK 3EFDL 4HIEB 2VZVA 4RGND 1RULL 3FO1A 4J3XA 4JHZA 3HC0A 1TXKA 3UDWC 3PV6B 1UXWA 1U2HA 4U6XA 5BW7A 3W81A 1T2QL 5GXBB 4AIZA 2LAGB 2E27L 2GCYB 1YC8A 1T6VN 2VZUA 1NMCB 2IPUK 4RMRA 3PQYE 4P3CH 5D1QB 3BVNB 1RJZA 4XHJD 4GLRH 5DQJB 2XNAB 3U2SB 1TDQA 1A9BA 1HEZB 4HUUB 3WS6A 3CSGA 4Z7NE 2B4CC 3MOBL 4MXQC 3LEVH 3MJGX 3OAUL 1OAQH 5MP6L 4PJAF 2EKJA 3GSUB 5FCSH 2ICEB 1OD9A 4GKNB 1JGVL 4WFGD 2ZUSA 2XPGA 5E8OA 3VWJA 3O6FA 1W0YT 5LG1A 5GZOC 2EYSA 5DJXB 1ZWIA 1A7RL 4OM1L 2WIIA 1RZGB 3VI4F 1CT8B 5IHZA 1I1YB 2BVQA 3AU1B 3NCJL 2CLVA 1EVTC 2D7TL 5JHDD 1CL7H 1A0QL 3QXUA 1QFWM 1GGYA 3EHBD 1U8KB 3GBNL 4J7RA 2VXVL 1C1EH 4F57H 1IEBB 4R97C 4MXWH 4Y2DC 2CKBB 3ZL4H 2LVEA 3AAZB 3T0EB 4QHUA 2OXHA 3W5MA 5I71C 1AD9A 1AKJB 2DQHH 3BUTA 1OD7A 3TA3B 4UT9H 4ONFL 1HOCB 4TSCL 3VRLF 3MODL 3CD4A 4TN9A 2R1YA 3JVGC 3ESVF 1J11A 5DA4A 2OSLB 1VFAB 4N9OB 2RB8A 4ALAL 1ORSB 4Y5YB 4ZO9A 4CW1A 3P30L 1INEH 3SQOH 4FQIL 3VXME 3E8UL 2WWKT 2XFXB 2IAMA 2P5EE 3CFEA 1HH6B 5IW3A 1ROWA 2MHAB 4FXKA 4QTIH 5FYJD 2IQAA 4XWGL 5CZXC 1UJ3A 3MLRH 4HIHB 4UOW1 3U9UA 4YFLF 4H26A 5L7XH 4P9MH 1LEGB 1QKZH 3IGAB 2OZ4A 3LRSB 3EOBA 2OL3L 4HG4K 2HFGL 3DUUA 4R0LC 2HYMA 5CIPH 5IKCB 4TUJA 2IH1A 1BIIB 4ODUB 5CZVH 4ZYKB 3QZWA 4PRDA 4Y4FA 1FSKC 2BSED 3NAAH 3QUYA 4LKCA 5D93C 2APBA 3BO8A 2EYTA 1C5CL 1RPQA 3BWAA 4JG0L 1MHCA 1REIA 2A6KB 4LMQE 5KS9E 1AXIB 3CFBA 4PB0L 4HK0B 2Q1EA 1QRKA 3TPUA 1KCSL 3UXFA 4BSWB 4F15B 5CILH 4K8RC 2W9DH 3QRGL 3BHBA 1EZVX 1FLRL 3OR6B 5IEKA 5F7DA 2IAMC 2VZ1A 4HMDA 4ORGB 1N5YH 3FB5B 4IS6A 4U1SB 4IDLA 2P45B 3V5HA 3W82A 5J9PA 3MZTA 1AR2A 2HTKC 3DTXA 4OIBA 3QG7L 1X5KA 3GM0A 1ZVSB 1YPZB 1DUZA 2ZOKA 5FYKU 3V4UH 2R39A 5IFAH 1D5BA 4NKQB 4HV8A 2Y9RT 3VFTA 1BAFH 3TN0B 1FL5B 3IXAB 4Y4FC 2UWEF 5T3ZE 1EHLH 1NBQA 4Y8DC 2VUOA 2OQJB 3HR5B 4FQJH 1CK0H 4DVBB 2C1OB 4JREC 1TCMA 4FHBD 3LAFA 3VXTB 5E2UH 3DI2B 1F58H 1AO7B 1AP2B 4KFZC 4NFBA 4P3CL 1WEJH 5HVHC 4D9QD 3WLBB 3ARVA 4GRWB 1G9NC 4KK9C 4JFEE 3LEVL 5CBAB 3IKCB 1T21A 1OAQL 3DROA 3VRIA 4MB3A 1VADB 4LSPH 5JZ7C 1RZJC 1BJ1J 3CMOH 2OR8A 5LGJB 5FM4A 4CJ1A 4RGNC 3WBDA 4U1IB 2ZCHH 3GNMH 1KGCD 5DO2D 5KVFH 3IJYA 4AEIH 3D85B 3X3FH 3LDBC 4NDMA 4IM8A 5I8CB 2FIRT 1Q9OA 1FYTB 3UZQA 1CL7L 3HI1B 3T77A 4EDWH 1ITBB 1EA9C 1Q94A 2X09A 1C1EL 4F57L 3V7AE 1IZJA 4HIEA 4MXWL 3ZL4L 1H15B 2QEJA 4BJLA 4XVUD 1K8DB 4XHJC 4NNXB 3ARYA 5DHYB 2Y1VA 4ZD3H 2J8OA 2FJFB 2DQHL 3IFOA 4UT9L 2X4RA 2WBJD 3HZMB 1TCRB 3PV6A 5HD8C 2Z93B 4NQXA 2Z35B 3CFKB 3MOQA 1MCQA 2GCYA 4ZPTB 5CGTA 2CDGB 4WJ5A 5INCB 1MCFA 3O2DH 1F4AA 3BP7B 2V5TA 4RX4A 5DZNA 1I7RA 4ETYA 5DQJA 4FFZH 1INEL 3U2SA 1YY9D 4B5EA 3SQOL 5EO1B 1OVZA 2DL2A 5T1LD 1HHIB 1OAKH 4NBYB 3PL6B 2JB6B 4QTIL 1AD0B 3JTTB 2WBKA 4JY4B 3TYGH 3D3VB 3EHBC 3MLRL 1G7PB 4AH2A 3GJFA 3MYJB 4P9ML 5L7XL 1QKZL 1FVDB 2ICEA 2GJZB 1NDGA 2JCCF 3GFUA 3BD4A 1JPTH 2V5MA 5HPOA 3HLAB 1RZGA 4M61B 1DUYA 1X5FA 5E2VH 1CT8A 1MF2H 3QH3A 3TJHD 1I1YA 3NAAL 1NGZB 1JGDB 3KS0J 4P0DA 1U92A 1FN4B 5CSZB 2OJEB 3FAXA 3QEQD 5HGDB 4LCIH 4ODWB 4BSJA 2BVPB 2FJGB 3O11B 2DWDB 4EIGB 1E27B 3T0EA 3MJ9H 3MV9B 4XBPA 3KPRB 3OHXB 1XF2A 2PW1B 1QFWH 4WEUD 5CILL 2W9DL 2FHFA 3KXFD 5GGTA 3RWJA 3HUJE 5C08D 3WN5B 1VFAA 3AS1A 1B4RA 1AQDB 5CWSA 5DK2B 1VA9A 3VFNB 4K7FB 1ES0B 1Q38A 1N5YL 1S9YB 5FKAB 1ORSA 2VDKH 4Y5YA 3RDTB 3RY5A 1JZ7A 4G8FB 1XGUA 2XFXA 4RWYH 1DN0B 2FD6H 3FT3B 3VWKB 5EOCH 3MRIB 1CYGA 3V4UL 5IFAL 1XGRB 3TO4B 2NY4B 1BAFL 5C0BE 4KRPB 3IGAA 1EHLL 1V3KA 4X9HA 4A2LA 4FQJL 5KSBB 1CK0L 4ZFOB 2VAJA 1NFDF 1BIIA 4UUJB 4ODUA 3FONB 1BF2A 5E2UL 4CN4A 3K0WA 1AGCB 1F58L 4XI5D 3UBXI 2Z0BA 4ZPVB 4LP4A 1WEJL 2MQ3A 2EDXA 5D5ME 1UG9A 4QYOB 1BM3H 5CFHA 1UZ6F 5BOZG 2A6KA 3FZUD 5E8EB 4HK0A 4LSPL 2O61B 3CMOL 3DI3B 2FO4B 4EJ1C 2ICWB 4NCC1 5HPMB 2NXZB 2VXUH 3K4DA 2ZCHL 1IAOB 3GNML 4LARH 1KULA 1I9JH 4WV1B 1QSFB 3OR6A 5KVFL 1NMBH 4AEIL 3X3FL 3CU7A 4PY8J 5J89A 1A9EA 3DVFA 2EXWD 5EOTB 1C5DA 1R3JA 1LWRA 1KOAA 1M71B 2XTJE 4EDWL 1MFBH 4PJCB 4I2XE 4XP6H 2F58H 1KIQB 3P4OB 4Z7WE 5F3HA 5D8JH 2EEAA 2YPVH 4PJEE 2GT9A 1YPZA 5FO9A 4P2OD 4ZD3L 5D9SB 3NVQA 3QUXD 3H9HA 3TN0A 4F7EB 1FL5A 1X44A 3F62A 3IXAA 3ZSSA 5D1ZD 4EUPB 2OQJA 3HR5A 4JPIB 4DVBA 2CIKB 1H8SA 3KNBB 3EKCA 3MV7B 4PGEA 1S9VA 5KG9A 3VXTA 1G0DA 2HT3D 3O2DL 2HMID 1AO7A 2IH3A 1AP2A 4HWBA 4QO1A 1WTLA 5DO2C 4FFZL 3WLBA 5KBNC 1OAKL 3G6JF 1XGQB 3T1FA 3DYMA 3VFSB 4XXCA 4KJWD 2AXFB 3IKCA 3PWLA 4L4VD 3TYGL 5J6HA 2BNUB 4YDKH 1VADA 2RIKA 4JDVB 4OQTH 5LGJA 2LE9A 4UU9B 4XVUC 1UVQB 4U1IA 1JPTL 1MCWW 1WWCA 1OW0A 3RQ3A 1PYWB 3M45A 4YBHA 5E2VL 2WBJC 3SE8H 5D7JB 1PEZA 5EBLA 1V3LA 4ENED 3UZVB 4OCNC 4E5XA 1HYSD 1KIUA 1T0NB 1U3HD 3BOVA 4LCIL 2FYYA 5F9WB 1Y6NR 2G5RA 3LPGA 2V17H 4GS7C 1H15A 1K8DA 3MJ9L 1YY9C 4Y5VB 2X10A 2OMNA 3PGCB 3VXSE 2YD6A 2FJFA 3FQUA 3MRGA 4HCRH 3UZEA 4OF7A 1QFWL 5IG7B 3HZMA 4KVCL 1TCRA 4X98A 3LKRB 4JRYE 5ERWA 2Z35A 5E9DB 1DQJB 2CDGA 3VH8B 3VE0B 3E2HB 1JNHB 3B9VA 4K23H 1OQXA 2PNDA 4XXCC 3IDUA 2VDKL 4R3SA 4D0CB 4JFXA 2D31B 3MV8B 3MRBA 2ZZUT 3TNMB 4RWYL 1HHIA 2FD6L 3TJHC 2JB6A 2YXFA 5EOCL 1AD0A 4OF3A 3KLHD 4JY4A 5F7FA 2C3WA 1CD9B 1OW0C 2OTUA 1G7PA 3MYJA 3GSRB 3SE3C 1BVZA 4GW1A 5L2KD 1IC1A 1K5NB 5DK0B 1P1ZB 1ZXQA 4I4WB 2HKFH 5IIEB 3HLAA 4I3RH 2NQCA 1K2DB 4YDLC 3SGEI 1FP5A 2Y36H 4ZNEE 2KPNA 4KMTH 5ISZD 1CDBA 1NGZA 1JGDA 1OCWH 1U58B 3SCMD 3LKQB 2BNQD 4ZAKD 2ADJA 2OJEA 1F5WA 4ODWA 5FHBH 3S37X 2NR6C 2DICA 3GBLA 3O11A 2FJGA 3U4EA 1BM3L 1EFQA 1HDMA 2OMBA 2P49B 1E27A 3MV9A 1MRCH 1KXVC 4RIRB 3OHXA 1LP9E 1DCLA 2VXUL 3QXWA 4G6MH 3A67H 4LARL 1I9JL 4DGIH 1HSAB 4MAYD 3MLVH 2WUBH 1NMBL 5DK2A 3VFNA 3C8KA 1OT2A 2JIXD 3SDAB 1ZT4B 4GRMA 1S9YA 4P2OA 1K6QH 3LOWA 3QUXA 4L8SA 2IQ9H 1MFBL 1WCQA 4XP6L 2F58L 5D1ZA 2BSSB 4XI5C 5D8JL 2YPVL 4X6DB 3MRIA 1NGWB 3PE9A 1A5FH 2B1HH 3HZKB 4HT1H 3TO4A 4UAOB 1K8IB 1S7XA 4OD2B 2R9HD 5KSBA 1UGNA 3FZUC 3NCCB 2EE3A 4G9FD 4ZFOA 1LO5B 3FONA 2F53B 3RNKA 4PGCA 1CXKA 1MCRA 4L4VA 4ZPVA 3T0AA 2CLZB 5C86A 1NCBH 4PRID 4G6FB 1BX2B 5DC9B 4QYOA 2EXWC 1II4E 3BPCB 2VXTH 5E03A 4YDKL 4LLAA 2C4XA 5E8EA 3SY0A 4OQTL 1CDUA 4N1CA 4JKPH 4NRZA 2ICWA 3BGMA 3JWOC 5HI5D 5HPMA 3WDIA 4P2OC 3HNVH 2EIDA 4L8SC 4B7IA 5DWUH 1QG3A 5D1ZC 3NIDF 3B4NA 2OK0H 4NN5B 1T04B 3VCLA 3SE8L 5EOTA 4WEBH 4PJCA 1KIQA 1GRWA 2D7QA 2F8OA 2HT3C 3GSNH 4LGPB 4NQEE 5B8CA 2HMIC 3CIQA 4IRJD 3TESA 5D7KD 5H35B 5EBWA 2V17L 4MD0B 5BRZB 3N06B 4ZODA 4HCRL 4P2QD 3NCFB 2DQEH 4KJWC 4ODXA 4L3CB 3WHE0 4EUPA 5CEZH 1O7SA 3QIUD 2AGJH 3BGFB 1T7YA 3G04B 3KNBA 8CGTA 1ZLSH 4EN3D 2P8PB 2RFXB 3MV7A 5ESQA 3DYPA 5AZ2H 4I18A 2OS7A 3GSWA 4K23L 4H5SB 3Q5OA 4PJDF 2IMMA 5IB1A 1BD2D 5EN2A 1RSFA 3MRKB 1MVUB 2FX8H 4K07A 1XGQA 3O2WH 2NX5E 4CKVX 4JPKH 3CVHB 5DMJB 5HHME 1HSBB 2AXFA 4M93C 4ENEC 3R0NA 1HYSC 3QUMA 1U3HC 5CAYB 3NABH 2BNUA 1U8NA 3KPLB 4NWUH 4MNHA 1X6LA 4UU9A 5ISZA 4PRHD 3T0VA 4F80A 3SGDI 3OMZA 2OYPA 5HVWA 2HKFL 4WUUB 1H3TA 5F7HA 1NUNB 5KZCB 1PYWA 4YHIB 5IJKA 2WM0A 3P4MB 2X7LB 4I3RL 4QRPD 1GZQB 1T1ZB 3BP6B 1MJJA 5B8CC 1UM5H 1CXFA 2Y36L 3LKOA 4KMTL 1KTDB 3OB0K 4L3EB 5D7JA 5ELIA 1OCWL 5I30H 5FYLH 3ZE1E 1MWAH 1K3IA 4Y5XA 4LQFH 1T0NA 5C0AB 5CJQH 2P4AB 3EDJA 3ZHDA 5C0EA 3C8HA 5FHBL 15C8H 5HSFA 2EDFA 4Z7OF 4NRYA 1MRCL 3MRFB 1UKSA 2ILLA 4X9IA 2PTUA 3GMRB 2VRAA 3FT4B 3KLHC 4G6ML 1GVIA 3HCVB 3OKLA 4PJ7E 3A67L 1Z6JT 1RMFH 4KPHH 3MLVL 3SKMB 3U6RB 4XX1E 2WUBL 3P2TA 1DQJA 4HEPG 3VH8A 4LK4A 2CDEB 2NYYD 1JNHA 2AJZB 1K6QL 2IQ9L 1FO0B 3OJ2C 1U8MB 5HY9B 1KB9K 3T3PF 2KUTA 1F90H 1G9MH 2P8LB 3SCMC 5L88H 4ZAKC 4G9FA 5EDXA 1A5FL 1MY5A 2B1HL 4IMLB 4LLDB 4HT1L 5GS1C 2F54E 5IJKC 3ECBA 4E42B 2D7PA 2XI9A 3MC0A 1SYVA 1I9IH 1K5NA 5DK0A 1P1ZA 4I4WA 2Q7YB 2LTQC 3LD8B 5IIEA 1RY7B 4Y5XC 3V0AC 4NBZB 4N8VG 5C09E 4V1DB 1K2DA 4KI5E 1EFXB 4RDQF 5C0CB 4JO1H 1KNOA 4C56D 1SY6A 3FB6A 3MJ8B 4I48A 3PWNB 3LKQA 4MAYC 5ESVB 1NCBL 2QJDA 5MENB 2C4FT 4OZFA 2Z91B 2HLAA 1JP5A 1QBBA 2Y23A 3QWRD 3D69B 3VGDA 2O93L 5HYJD 1PKQA 2VXTL 4ZSOB 5B39A 4RIRA 4JKPL 3V0VB 4Y2DB 3JUZA 4IOSD 1T7VA 5J7CC 1YNLH 2DI7A 5L2JB 1HSAA 3HNVL 1U93B 5J6GB 3L3KB 3RP1A 5ETUB 5DWUL 1FDLH 2R9HC 1MAKA 4WNQB 4ISVB 2OK0L 4MD4B 3SDAA 4WFED 4X4YB 5LWYH 3C9NA 2VDPH 4ZOCA 2H32B 4ZUTB 3SGEH 4WEBL 4P2QA 3QDGD 5SWSE 3GSNL 3C5SB 1WFNA 3V8OA 4KDTC 1MAML 3HZKA 4EN3A 2VQ1A 2DM3A 5GS0D 4OD2A 2DQEL 2QTEA 5CEZL 4GAYB 2AGJL 1WCBB 2XKUA 1ZLSL 5LGKA 4YLQT 4X7DC 4OFYA 5AZ2L 3P4LA 2F53A 5HI5C 5I2IB 4DWHA 1T7WA 2P5WB 2DWEB 4U4BA 2CLZA 1EAPB 1X5IA 4DEPB 4PRHA 4P2RB 2FX8L 2X41A 4BH8B 3NPSC 1BX2A 1DR9A 4FNLH 5I15H 1DBBH 4IIQC 4JPKL 5ITFB 3BPCA 1UZ8B 5GZND 3NABL 4NWUL 5I73B 3KPSE 4M8QA 4IRJC 4JRXB 4LPUA 5SV4A 3MRHA 5FA3B 1FNLA 2DL9A 4QY8B 1UM5L 4PYGA 4TNVK 4X8JB 1IT9H 1T04A 1I7TB 3QIUC 3HS0A 1NCTA 2R29H 5I30L 4HFWA 1D6VH 2DB8A 5B38G 5FYLL 1MWAL 4EN3C 4LQFL 1IKNC 5HGBA 5CJQL 2G9HB 1D3CA 3VFVB 5H35A 1MSPA 4MD0A 5BRZA 15C8L 1SQ2N 4XWOD 3KJ6H 5D7LB 1S9WA 3PDOA 5F1NA 2DLFH 4KVNH 5DURB 1I3UA 4LHJB 3C60D 4MNQD 1RMFL 4KPHL 2IADA 1VKXA 1NUDA 1IFHH 1RIUH 3KLAA 1P6FA 2N56A 3KJ4B 4H5SA 1Q9LA 1WC7A 1P53A 4BQCA 3MRKA 3M17B 1KBGH 1YECH 1JV5A 3DVIA 3T8XB 2X44D 1F90L 1G9ML 1HSBA 2AP2A 4KKNA 1RK1B 3NFSH 1BLNA 3KPLA 5DHVB 2V2TB 4H1LB 1DQDH 3V4VH 1G7HB 2W9EH 1I9IL 1NLBH 3DURB 4WUUA 3CPLA 4ZOAA 4MZ2A 4FS0A 5BCAA 2QL1A 3C08H 4YHIA 4X6EB 5BS0D 4YHPA 1GZQA 3SE4A 5DMKA 4OZGF 5CBEB 4LCWB 3QWRA 4JO1L 5E1HB 4QTHA 3RGVD 5JW4M 3AMLA 2QADB 3CVIH 3BJLA 3M1BB 5ICYA 4QHKI 5GRUH 2ID5A 4NFDA 5BV7H 1EAJA 2NYYC 3QEHA 2GTWA 3FRUB 4M62H 2ZPKH 4NO2A 3Q1SH 4PRBB 3JV4A 1QSVA 3MRFA 4QRSB 3QDJB 1HZHH 3FT4A 1ZOXA 2J5LC 1YNLL 3HCVA 1WGOA 4TUKH 3SKMA 1FDLL 3IJSA 4ELMB 4LLMB 1E0OB 5HYFA 5DVLA 5KOMC 4JVPA 5FDWA 5LWYL 1TQBC 2VDPL 4OAWA 1OT1A 4Y88A 4Q9BA 3ELAT 4HDIB 2ZP0T 1U8MA 4J2XA 2BJMH 1EMTH 3GSQB 4CVZB 1NFDA 1JFQH 1EV2E 3G5VB 3UTSD 1L0XA 2P8LA 3MZGB 4MQ7B 3FJTA 2ZUXA 3ARPA 4IMLA 1W8OA 3DGCR 3C6LD 1QPPA 3MNZB 3RKDD 3ZYZA 1NDMB 3S34H 4RGNE 4RRPA 2NXYD 1EFXA 4DKEH 4X7SH 5C0CA 4ZFZB 1E6JH 2HJLB 3LY6A 3PWNA 5ESVA 3S9DB 2UYLA 1QBLH 1KFAH 4S11A 5FGSA 4FNLL 2Z91A 5I15L 5CP3A 1DBBL 4OB5H 4HD9A 5FA4B 2ESVB 4LF3B 3MTRA 1BZ9B 4Z7QF 1PZ5B 3TIDB 1UWEL 4JG1H 4Q6IA 1FG2B 1A2YA 1U93A 1INDH 3L3KA 4C83A 3NIFF 3NN8B 3WKMH 3K3QA 4WNQA 1YEIH 4NQDD 1IT9L 3BPNB 4WGVB 1D6VL 1PFCA 2GQHA 4FMFA 2H32A 5A2JH 3DGGB 2IBBA 4ZUTA 4WHYG 3TVMB 4G7YH 4X80H 1G6RB 3C5SA 5GISH 1JTTA 3V5DB 4L8CB 4P23D 3KJ6L 4P59H 3FB8B 1EHXA 1U8IB 4J3TA 3VGAB 1R3LB 4CGTA 5J06A 5F44A 4X5XB 2DLFL 4KVNL 5GZNC 3G6JA 1WCBA 1LGVA 2PTTB 2MCPH 1MVFA 4K71C 4NNYB 4KWUA 1IFHL 3O6LH 5KVGH 1RIUL 2P5WA 3ARFB 3BKCH 1EAPA 4OCRH 1XCTA 3T65B 2XA8H 2BVTA 3V5KB 1J88A 5GIRB 3HE6D 4P2RA 4BH8A 1KBGL 1YECL 4MA3B 2XKSA 5DVNA 4ZQKA 1UZ8A 5E5RB 4Q6IC 4I5BA 3NFSL 5ADPH 5SX5K 1BPVA 1DQDL 3V4VL 1D9KD 2RGSA 4N0UA 4JRXA 2W9EL 2NNAA 1FG9C 3RGVA 1I4FB 2IEPA 4Q0XH 1NLBL 4XWOC 3CJJA 4PJHA 5FYJE 4O2FB 3P9LB 1SJEB 3C08L 4QGYA 5FA3A 4JKMA 4CMMA 1RAMA 4IHOB 1VERA 3N85H 4R7DA 3JXAA 3C60C 4F3FB 4PJGE 4G8GD 2R4RH 3CVIL 3GRWA 3LN9A 4XH2B 5GRUL 2GSGB 4M9PA 5BV7L 3QWOA 4HLZG 3I3DA 4H8WH 4GKZB 1QRNB 3HAEB 1UT9A 5D7LA 4M62L 5DRWB 2ZPKL 5B3NA 1I1AB 3MFFB 2AV7B 3Q1SL 3T04D 5EC2B 1HZHL 4YR6B 4PS4H 2V5RA 5FYKE 3BQUB 2GK0B 2EDLA 4TUKL 5F88A 1JRHI 3ROOB 3DHMA 5ALBH 3UTSA 4PJ5D 4Z7NF 5EPMB 1BBJB 2P43B 3C6LA 3QNYB 4BA8A 4X6CB 5AUMB 2BJML 3SGJA 1EMTL 3MROB 5D6CB 3M17A 3T0EE 2DIBA 1JFQL 2XG5A 3T8XA 5ICXB 3RGVC 5GS2H 2NLJB 3OJDB 1RK1A 1U91A 4RAUB 1GSMA 4XCCH 4H1LA 4WWKB 3ULUH 4TNWK 1G7HA 2FZ3A 3NZHH 4U6YB 2PYEB 2DQCH 3BT2H 5DZOA 3HZYA 4DKEL 5CBEA 4LCWA 5J4MA 1ZV5A 4X7SL 2N1KA 4LPYA 4LDOB 1E6JL 3MA7B 2A38A 3M1BA 1QBLL 1KFAL 3HTLX 5I1HH 4JKKA 3GSXB 2HWZH 1S7RA 3BPLB 1UXSA 3QSKB 1Z9MA 3W0WD 4OB5L 2PYFB 5KN5A 2BY3A 1Y6MR 1JVKA 1U9KA 3RY6C 2C1PB 3ULSA 4PRBA 4AIXA 3VD5A 4D9QE 3QDJA 1SVZA 4U0QB 4JG1L 4Y8AA 3C6LC 4Y0GA 1INDL 1YC7A 1JGEB 3HNTH 5IBUG 3RKDC 3HE7D 5I75B 3WKML 1GZPA 1YEIL 5SX4I 3D25B 1NQBA 5HHQB 4OLWH 1OL0A 3DXAD 1KGCE 4X9BA 4Y4KB 2NXYC 4G7YL 3GSQA 4X80L 5IBTH 2P48B 4CVZA 5GISL 3G5VA 4LL9A 4TSBH 4MQ7A 4DZBB 4P59L 3K2MC 2YWZA 3MNZA 5IK3A 4R90H 5DRNA 2CKBH 4K9EH 1TZGH 5MEQB 1DQTA 3D5OF 1I3RB 1NDMA 2BERA 5JHLH 4LHQB 2PKDA 2MCPL 1X6NA 5D6DC 1VGKB 3HE6A 3BDYH 4BSVB 1JTPA 1WSST 5D7IF 3EJJX 3O6LL 5KVGL 3PV7A 1NFKA 5LAXB 4V2BA 3BKCL 2HJLA 1AGBB 4OCRL 1U8PB 5KS9F 2XA8L 4LHUB 2V7NB 1RZIB 1D9KA 1YPZE 1L7TH 1OWRM 3STBA 2A74B 3VXUB 1J86A 3WL9B 5J12C 2B5IC 1X7QB 3OXRB 5ADPL 3GHBH 4LF3A 1BZ9A 1T2JA 4P5MB 5E6YA 4EVNB 1PZ5A 3TIDA 2AK4B 4JANB 2VZ3A 4P23C 1MJUH 2FB4H 1NC4D 1F2QA 1UCBH 3K81A 4Q0XL 5DC0A 4YC2C 2YXMA 1FG2A 3QDMD 5JNYB 5DT1H 3TIEA 3QG6B 3N85L 5GSVB 3C8DA 3QCTH 5TE4H 2R4RL 1CQKA 1CU4H 3MGOB 3BWUC 3JSSA 2X5PA 1C16B 3V7AG 1G6RA 2EIZB 1E4WH 5C70A 4H8WL 4MA7H 3RZCD 2AK1H 3V5DA 4L8CA 3BZ4A 4O5LH 1U8IA 2MOVA 1X5LA 3HE6C 1R3LA 4NRXA 3QEQE 4PS4L 4KU1A 2COQA 1AR1D 4AQ1B 4W81A 3EYSH 2V5YA 1AY1H 4NNYA 4KMQA 3QDAA 5ALBL 4W6XB 2HJFB 3BDXA 1EIBA 3ARFA 2VL4A 3JV0A 1WK0A 2VERN 5F6HI 3T65A 4LVHB 4U1HA 3QJHA 4D0DB 4WW2A 5C08E 1WWAX 4MA3A 3ET9F 3AXLA 3SO5A 2W65B 5B22A 1U41A 4LCCB 2CKNA 3MNWB 1AGFB 1G0YR 4XCCL 5F6IB 3L3HB 4PPTA 3ULUL 5MERB 1I4FA 3NZHL 3WV0A 1YNTB 1SJEA 2BOBA 4K7PH 2DQCL 3WHXA 3BT2L 3W0WA 1ZGLB 2H9GA 1AGEA 1R24B 4FG6D 5IFHH 3BW9B 1QACA 2EEDA 1V7NH 5EOQH 4WI3A 5DI8A 1RURH 5E4EC 1A6UH 1S7SB 5I1HL 2HWZL 1QLEH 3IJHA 5I8KH 5LJYH 4HWBH 1KIPB 5EU6B 4GKZA 4IOFD 5IMOB 1QRNA 3HAEA 5CP7A 4GRWH 1Z9LA 1EBPA 3MUGB 2VE6B 3GO1H 3MFFA 4HUWB 4Y2OA 2B7DT 2AJVL 1T89C 4OZ4B 3OG4B 3DXAA 3BQUA 3TBWA 3BUYB 5I74B 3HNTL 4PRNA 2XN9B 2QSTA 4RWHA 3KDMB 1ADQH 2VC2H 4OLWL 2BP3A 4M6MH 3FN0H 4JJHA 3FHAA 2PCPA 3DHJA 5IFJA 3PGDB 1CFNB 5K9OB 1B6UA 3MROA 5D6CA 1E4XH 2ITDA 5IBTL 3MV9E 2CUHA 4WI5A 4HW6A 43C9B 5ICXA 1A14H 3QA3B 3DLQR 5FFLA 1MCKA 3QFJD 5EZJA 3UTQB 5ITBH 4URTB 2NY0B 4MJID 3QHZL 4R90L 4WFFD 2CKBL 4K9EL 1TZGL 3GIVA 3IVKB 1NJ9B 4KKLD 2CIIB 5JHLL 3AB0B 3EOAB 4YE4H 4U49A 3GK8H 3BDYL 4L8DB 4I77H 4HUXB 2EE2A 2ATPB 2R15A 5C2UB 1FL6A 1YYMH 3HE7C 1D5ZA 1F13A 3BIBX 3QPQD 1L7TL 3GBMH 3HG1D 3MPCA 2PYFA 1HH9B 1S7VB 2XWJB 4O4YH 3QDMA 4KGLA 2B1AH 5LQBH 3GHBL 1I1FA 3HUJF 4NYLA 1J5OH 4OLYH 5C71A 1IM3B 1P5UA 1MJUL 2FB4L 4OZIB 1UCBL 1JGEA 5J13C 2N7AA 4L4VE 1DQQB 3VXQB 5DT1L 1OY3B 2IAND 2AXGA 2A6IA 4NKDB 3D25A 3S5LB 3RZCA 3REVB 3QCTL 5TE4L 1CU4L 5HHVH 2HVJA 2XIDA 3G5ZA 4Y4KA 1KLUB 3V52H 4ZG1A 3D0LA 4IEFB 1E4WL 3S97C 3V6OC 3SDXA 1S9KC 4MA7L 1WISA 2AK1L 3O4LD 4DZBA 1YN6B 1BQHB 4O5LL 3ARED 4X8XA 5CJOH 4Q97A 4ZXBD 2PXYB 1TQCC 4LAQH 4PB9H 3EDEA 1I3RA 5GS1B 2AV1B 5I1KH 5I6XC 2FEEL 3FOMA 3EYSL 1VGKA 1AY1L 1F11B 3TGXA 4BSVA 1KJ3H 4KY1H 4WENB 4R7NB 3F7VB 4PJCE 3X3GH 5LAXA 4QRUB 1F3JA 4W68A 1OP3K 1U8PA 4LLQB 1MLBA 2E9JA 5SX4H 5BJTB 4AEHH 4LHUA 3F7RA 4PRPD 5EU7E 3W39B 3ARBD 5ACMA 2A74A 3VXUA 4WDIB 3GSVA 2MFNA 5HBBA 3HZVB 2AKRA 3OL2A 4R4FH 1X5YA 5H2BA 1GPOH 3BDBA 5HYSG 1T66D 4P5MA 1TIUA 4EVNA 2AK4A 3RZCC 5DSCB 1F00I 4JR9H 4RMUA 3QQ4A 4PRAB 4K7PL 1T20B 1FFOB 3QEUA 3G5YB 3ZE2F 1FCGA 4AZ8A 3QG6A 1S9XB 1AR1C 2NTFB 3L3OA 3ZHKA 5IFHL 1O5DT 5EOQL 1V7NL 3W2DH 3MGOA 1YEJH 1RURL 4HK3J 4XVSH 1A6UL 1QLEL 5I8KL 2EIZA 3LB6D 1MI5D 4GG6B 2E7HA 5ISZE 3H42H 4D9RD 1RD6A 3GO1L 2HG5B 3LVEA 4FQPA 5CSGA 5HXMA 1PKOA 5E8PB 2RR3A 1XGYH 5HYIA 2JLLA 2O5ZH 3IF1B 5FOBB 4Z78A 3VRLE 5KSAB 1S7QB 2HJFA 3X11A 1ADQL 2PF6A 3L5WB 5JXEA 1JWUA 4M6ML 4MJ4A 3VMNA 3FN0L 2VWEC 2IG2H 3B5TA 4MJIA 2DQFA 4FXGA 3N1FC 4D0DA 1OHQA 3QJFB 4RBPK 1E4XL 1S7WA 2F74B 4JN1H 4FG6C 3FQXA 3CXDL 1A14L 1AJ7H 2YK1H 4LCCA 5EUOB 1EDQA 2Z4QA 1AGFA 1GHFH 1J9CT 5ITBL 4YQXH 3L3HA 4IOFC 2MNUA 3B43A 5MERA 3ZE0F 4XPAH 1KN2H 3I6GB 4YE4L 3CK0H 5F97E 3GK8L 5ACLA 1I7ZB 1AIFB 3RY4A 4I77L 5DEFB 1W0WB 1R24A 1KG0B 2BHUA 1CLCA 1P9MA 3BW9A 2B0SH 1YYML 4P5TB 3INUH 3L7FB 1S7SA 2P8MB 4G9FE 5TFSH 2X4OB 1FGNH 3GBML 2NPLX 4PJBB 5EU6A 2DDQH 5IMOA 2KKQA 4O4YL 1NAMB 3OG6B 4QOKD 2OL3A 2B1AL 4JB9H 5LQBL 4G5ZH 2MKLC 3N1MC 4HUWA 2IANA 1J5OL 3PQYD 4OLYL 4XBGB 3JUYA 2P46B 1Y6KR 4OZ4A 3HPLA 5GGQH 4ZUUB 4RFEB 4JVUA 4M48H 3NA4A 3VDCA 1OB1B 2G75B 3B6SB 2XN9A 1J0IA 3D48R 4KKLC 3O9WB 5AZEH 1WFTA 1WWBX 3AREA 4BFIA 1JPSH 5HHVL 1YZZA 1KYOJ 3V52L 1XZ0B 1H5BC 3TP4A 5K9OA 4U3XA 2ICCA 1PKQE 3CSYB 4ZNCD 43C9A 3F5WB 4OT1H 5CJOL 3L95A 3UTQA 3QPQC 4LAQL 1RUQH 2C5DC 4PB9L 3IVKA 4YEEA 4CRPA 4CU8A 4XNUH 1XIWD 1NJ9A 4UDUB 5I1KL 2CIIA 1RZ7H 5D7KE 3SDCB 3ARBA 2UZXB 1KJ3L 4KY1L 3VJ6A 4P2YA 2XWTB 1ZT1B 2UWEE 4GUPB 2YPLD 4HUXA 4P2QE 3IDMB 3X3GL 5DQ9B 1A64A 3UTPD 3UTZB 3VFUA 4GXUN 4AEHL 4YBLC 3MRRB 1KB5B 2VYRE 4UOW0 3T3ME 4XNMA 1LP9F 2R2HB 1IC7H 3BKMH 3Q0HA 2P24B 5ACZA 4KKAD 5B4MD 2W91A 4R4FL 5D2NA 1BD2E 1GPOL 1MCNA 1J8HB 1BQLH 4QRRB 4JGMA 5E2WL 1M05A 3G08B 2NY3D 5J57B 4QLRA 1F4XH 3L3JB 1LNUB 4JR9L 4OBSA 5HGGS 4XCEA 5I66B 3AREC 5DRZA 3HRZB 4OZIA 2F53E 4ZXBC 2P5ED 1DQQA 1MI5A 4RQQB 1DBMH 4NKDA 1SJHB 4EBQH 4HS8H 3BYTA 4X6FB 1TZIB 4PRHE 3ZDXF 4ZFOL 1LK2B 3W2DL 4XP5H 1FFNA 1YEJL 4XVSL 4Z76B 1TQBB 4JFPA 1GAFH 3HA0A 3UMTA 5JA8B 3B8YA 4X7EC 1B3JA 3BN9D 3H42L 4G6KL 5DFWH 2VKWA 1NSNH 4JHBA 4LOUD 2PXYA 3OF6A 4GAGH 3ARBC 4M1GH 2YD1A 4KJPD 3OGCB 1J8KA 2AV1A 2EH8H 4NNPH 1XGYL 2O5ZL 1WVZA 1T66C 4FTVB 1IJ9A 4U1JA 1DJSA 3F7VA 3U4BH 3ULVH 4NT6B 4F58H 4X6BB 4BELD 4XPHL 5IMKB 1LQSR 5ID0A 2IG2L 1NC2D 4LRIA 5BRZE 5D2NC 4HUNB 1MFCH 3UJJH 3W39A 2X1OA 1TZHB 4JN1L 4NQCB 4YAQA 2YK1L 1AJ7L 1UEMA 1XF3B 3HZVA 4M02A 3LS4H 4OUUB 1GHFL 3FRPG 3LB6C 4YQXL 2PO6D 1MJ8H 1YUHB 4JZOB 3KYOA 4ACPA 4UILH 1KN2L 4XPAL 3U79A 4LFHD 1YA5A 2E7LA 3CK0L 5IMMB 3RPIB 1ZLWH 1IC4H 1R3KB 1FFOA 2WWKO 3G5YA 1T0MB 3P9MA 1S9XA 3QNXB 2NTFA 2E3VA 2KBGA 1CS6A 3DRQA 5K9JH 4NJ9H 2B0SL 3INUL 1BWWA 3MO1B 3VD4A 3BRGC 5TFSL 4WHTA 1FGNL 3CFJB 2DDQL 2BCKA 2NY6B 4KUCD 1KJ2B 4Q2ZB 2FCBA 1MCWM 5F8QC 4JB9L 4G5ZL 4PP1D 4P4KB 4UV4H 4W4OA 4C56E 2HG5A 3L7EB 4XNQB 1A7PH 4MNGA 4QEGA 2VR9A 5I16A 1J1OH 5GGQL 3GUTB 4DW2H 4XX1G 2BX5A 3BSZH 1CGVA 3L9RA 1VESA 2E8YA 5HYJE 2E7BA 5I8EA 5KSAA 1JZ4A 4UOJA 3L5WA 5F9DC 5AZEL 3F6LA 4HKXB 1JPSL 2EDKA 3ZTNH 3DIFB 1S8DB 3VFOB 2MPAL 1XIWA 4GKSB 3TH3T 5FUZH 4WFEE 4OT1L 5EUOA 3B9KB 4S10A 2E7LC 1L0YA 5EZLA 4R2GB 4ONOA 1Z3GH 1RUQL 5JO5A 2YPLA 3QDGE 4XNUL 3MGTB 5IVNA 3I6GA 1RZ7L 3ZE1F 1CLZH 4OFPA 2DMKA 1GOHA 3TFKD 4OGZA 4M6NH 3O6KH 4KTEH 1KC5H 4U0RB 4CJ0A 2WLYA 1NFDE 1B9ZA 4P5TA 3RUGA 1LEIB 4PD4J 1U0QA 4TOYH 4POZD 4PJBA 3L5HA 4C4KT 1IC7L 3BKML 3X13B 4NZTH 4YK4B 1NAMA 3IS0X 5DJ0A 2IBZY 1ND0B 2YC1B 1BQLL 5CEXB 3CVHH 4XBGA 1F4XL 1UZ6E 4ZUUA 4M43H 4RFEA 3C5ZB 1QEWB 4PYHA 4DCQB 4L4TB 2G75A 3B6SA 1CE6B 1DBML 1CXEA 4EBQL 1XIWC 4HS8L 3O9WA 4POYA 1VEMA 1UACH 2N7BA 4M03A 3C2AH 4XP5L 2YUVA 1XZ0A 4PJXF 3ROLA 3ZDZE 4G42A 1GAFL 2WBWB 3CSYA 3U83A 3WIFB 5INDA 4M7ZB 5D7IA 1KEGH 4ESKA 1NSNL 1FQ9C 4GAGL 4M1GL 1T5WB 3F12B 2E7CA 4KI5F 1ZHBB 5IB4B 4UDUA 4KKAC 2EH8L 4HIIB 1NC2A 4NNPL 3S3JA 5B4MC 4HX1B 4HAGA 4X0KB 1VDGA 2XWTA 2NY3C 3KGRA 3U4BL 3MMEB 3ULVL 4ERSH 4GUPA 4F58L 4I3SH 3IDMA 5T3XH 3UTZA 1FAKT 2PO6A 3MRRA 1MFCL 3UJJL 4HKBB 4GW5B 2R2HA 3BH8B 5C6PB 2P24A 2I5YH 1FO0H 1NUGA 4PUBH 3LS4L 1UB5B 4F7TA 5JIIA 1KPUA 3D39D 3G6JE 3ZYJA 2I07B 4F7MB 1MJ8L 5E00A 3TBYB 3L3JA 4XNZB 1IC5H 3BN9C 5I1IH 5I66A 4UILL 1IE5A 2VIRB 4LOUC 1F6FB 4QT5B 3QQ9D 4H25A 2P5WE 1IC4L 4DN4H 5DFTA 4KJPC 3O8XB 5MEPB 3CX5J 1G7IA 4KK5D 4P2RE 5K9JL 1R5VA 4NJ9L 1LK2A 4ZDHB 5C07B 4LPXA 3MBEB 4LLUB 4Z76A 2AQ1A 3R8QA 4MJ5B 5BXFB 3DARA 3LSOB 3EYVB 4EQ2A 1E4KA 5IW6A 3BP4B 3QIBB 3RWCA 4N0UE 4UV4L 3O4OC 1A7PL 4PJHE 4S0SD 1DBAH 3ARDB 3OGCA 1WIOA 4XCYB 5JPNB 4QHMA 2RHEA 1B88A 1J1OL 1IAKB 4TPRH 3TZVB 4XXDB 4DW2L 1EUUA 1YMMB 4B7LA 3BSZL 4QF1B 4FTVA 3KPOB 4NO0D 5JORB 1HKFA 5CSBA 3IDNB 4NT6A 1Q9KB 5IMKA 3ZTNL 4FQCL 1P2CA 3MJ9A 4NKOB 4KV5E 1TZHA 4NQCA 2FGWH 2H32H 2BDNH 1F3DJ 5FUZL 2DJSA 1XF3A 1AC6A 4GJTB 1CXIA 4OUUA 1MCBA 1Z3GL 3LZFH 2F5BH 5T33H 1YUHA 1MH5A 5J11C 2EDQA 4HH8A 3UTSE 1KSRA 4PP1C 5KVMC 5IM7A 1CLZL 1S5IH 3O3AB 5DJCB 3RPIA 3RWDB 5IMMA 4HUKB 1ZSDB 2VAAB 2B20A 4M6NL 3O6KL 1T0MA 4KTEL 4FRWA 1KC5L 2PR4H 3IU3B 3H7LA 1A47A 1G1CA 3H9SB 3ARGD 4JM4H 5ABDE 2Z8SA 4HC1H 4Q9QH 4TOYL 2BNRB 4WI4A 2E6QA 1GJIA 2R56H 4NZTL 3RWHB 4Q2ZA 1KJ2A 4NN6B 1S5HA 1MCIA 4DFHA 5DXWA 2FATH 3CVHL 4PR5B 3QZWG 3BX7C 4PP2B 4M43L 1MHEB 2H3NA 4YXLH 1KPVB 4LCWE 4DVRH 5CJXA 3IT8D 4WTZA 1YEKH 4HKZB 4PGBB 5EO0B 4HF5H 5HDBF 3CDCA 1UACL 5K59F 3C2AL 3DMMD 3TFKC 1S8DA 3FT2A 1LK3H 3C09C 1IAII 3QI9B 4NZUH 3I85A 3DBXA 3QHTC 1KEGL 1LD9B 4ZFFB 4GRLC 4QHLB 2M26A 4POZC 5F9OH 4Y4HB 5DYOA 4KQ4H 1KT2B 4Z7VF 1YY8B 4L1DA 2BSRA 1QHOA 4KROD 4WCYH 3UBXB 4WUKH 4ERSL 4I3SL 5T3XL 5EFIA 1B0GA 1X4XA 3RWFB 5CINH 3D39A 1A22B 2QQLH 5BZWB 1RUAH 3CLEH 3CUPB 1ZVHA 3KPQB 4RNRB 3X13A 4Y1AD 2I5YL 1OTSD 1FO0L 4P9HH 5FM8A 2BOCB 2VTFA 4PUBL 2JJUA 3S8WA 1H3XA 5F21B 3UPCA 4NM8H 5CEXA 2DI9A 1KXTB 1IC5L 3SN6N 5I1IL 1JYVA 2Q6WA 3C5ZA 1QEWA 2J4WH 5DHVH 4DCQA 4H1LH 4L4TA 2I60H 4GW4B 4DN4L 3K1DA 1ORQB 3CU1A 1N5AB 4P2CG 1Z9OA 4NPYB 2HFFB 3MRJB 3WLWD 2VISB 4YJZL 1T1WB 3CDYA 3NIDE 4DUXA 2VKXA 1EH9A 3IB4A 5TDPB 3QFDB 2GITB 3WIFA 2DQTH 2C9AA 2XZCL 4WWID 3SHSA 3DSFH 4NO0A 1ONQB 3VG9C 1T5WA 3F12A 1DBAL 1ZHBA 5A43C 1H0DB 2VH5H 5I1DB 4TPRL 1QFUH 1RJLB 4HX1A 3SO3B 1IGJA 4X0KA 2R0WH 5BVJA 3MMEA 4WI9A 3IFPB 1FV1B 5JMRA 1RZ8B 3QQ9C 1K4DA 4UQ3B 5C9JB 2O5XH 4WI2A 1CGTA 4GAFB 3DX6B 4PTUA 4PJDE 1GOFA 4KK5C 4HCRA 1HYRC 2FGWL 4M6OH 2BDNL 5GRYA 4MGXA 4LRNH 1UB5A 4HJGB 1SBSH 1EJ6A 1KCVH 5M95B 2I07A 1WBXB 3LZFL 2F5BL 1DEEA 5T33L 3TBYA 3BH9B 5DD6B 3X17A 2VIRA 3ARGA 1S5IL 5CEZD 3T4AB 3HPJA 4P3DA 4LBEB 5HHOD 3O8XA 4K2UH 5MEPA 2PR4L 3CFIC 5AAWA 4KTYA 5J13B 5F8RC 3HMXA 5C07A 3NZ8B 1HHHA 1QO3B 4JM4L 4LLUA 4HC1L 4Q9QL 3CFDA 4JFDB 4MJ5A 5BXFA 3HMWH 3NMEA 2R56L 3AM8A 2CK0H 3QO0B 2ERJB 3BP4A 3T2PA 3QIBA 2YUWA 4X7CC 3WFHB 4AG4H 3NFPA 3BPOB 3LKPA 2FATL 2H26A 2VLRB 4F37F 1I8IA 2DBLH 1FL3B 5IJVB 5D96B 1A6AB 3W0WE 3TZVA 4XXDA 1A4JB 4YXLL 1YMMA 5I9QB 4DVRL 4Z7OE 4BQBA 1YEKL 1FNEB 3NIGF 3KPOA 5AYUH 4OBRA 4HF5L 4U1NB 1DEDA 1QVOB 2ARJQ 3TBVB 4J8RB 1Q9KA 4HIXH 5FYLD 3UPAA 3DRTB 5BQ7A 1LK3L 4CNIB 1PQZA 5FXCH 1VSCA 4OLVH 3V7MA 4NZUL 1QD0A 1D7FA 3ARGC 1TFHA 2QHLA 1G6RH 4HH9B 3C87A 5F9OL 4G8IB 1RK0B 1K85A 3T3PE 3DXAE 3VFMB 5L0QC 3SGKA 2ZKHH 1VHPA 4LEOB 4KQ4L 2GFBB 1CFTB 4PLJD 5F9AC 2W0FB 3O3AA 3OKEB 4NQED 3RWDA 4WCYL 3U46B 1DDHA 3DETD 2ZSWB 4WUKL 4Y1AA 3U7WH 2H2SD 1WV7T 2B2XH 1OGAD 4N8VB 1Z0MA 1SMAA 4TYUA 5CINL 3WJJC 1I8MA 2W0PA 2QQLL 1DANU 4UZGA 2WSKA 5FGCB 4Q9CA 1RUAL 3BEVB 3CLEL 4IRSD 4KJYB 5FOJA 1A6TB 4TUOB 3RWHA 1GGUA 3EO1B 3DMMC 1DLFH 2Y6SD 2ZG1A 4NM8L 4PR5A 4LSQL 3D2UD 5DHXB 4HXAH 1YEGH 2VXSH 1ZGLM 4PP2A 1MHEA 2J4WL 1KPVA 2SEBA 2I60L 4HKZA 1RJCA 4PGBA 4C57C 5EO0A 4LLVA 1RZJL 4HUVB 4CMHC 5J3HD 1JF6A 4KROC 3QDME 1URLA 4Q74A 2VDNH 2DQTL 1DFBH 4ZFFA 3DSFL 4KTDH 4QHLA 4Y4HA 3H0TA 5CZKA 3HAEH 3UTTB 1Z2KA 3L3DA 2VH5L 4FABH 1OTSC 2WIMA 1IGYA 1MCEA 1QFUL 3SQBA 2YMXH 3ZTJH 1D5XB 2R0WL 4P49A 3UBXA 4YEFA 5EG6C 1NL0H 3MNVB 2O5YH 2NY2D 1OLZA 4PG2A 3MRQB 1FVEB 3RWFA 5TGBB 3SDXE 4M1DH 1KF9B 2O5XL 3EYFB 5BZWA 3B2UD 4PLKD 4LVNB 3CUPA 3DO3A 4KQ3H 3KPQA 4RNRA 2WMPA 4M6OL 1ZKAA 3WLWC 3U36B 3W9EB 1CDHA 2BOCA 4LRNL 1SBSL 3K4AA 3QXTA 1KCVL 3QIWB 4HS6B 5DVOA 1B6DA 3K74B 4DQOH 4JKWA 3TT3L 2NW3A 2HFEA 5GGSB 3LPWA 2K7PA 2X1PA 4FA8A 4K2UL 3DPBA 4GG8A 1N5AA 4NPYA 3FL7A 3MRJA 3THMH 1SEBA 2VISA 3VXUE 4HK3N 1JPFB 4IOIB 4KAQH 5B38B 4OV5B 5TDPA 2VWEE 2ED8A 2HN7B 2GITA 2X1XR 3HMWL 4OZGB 4PTTB 3SKJH 2CK0L 2DYPD 1L4IA 5FAAA 5C09D 1R0AH 4KI5D 1N8ZA 4AG4L 1ONQA 4AY0A 2DBLL 2AJ3B 4YNYB 3PP3K 5I1DA 1IQDA 5IVXB 3VFWB 4LNRB 1U8QA 3OSKA 5AYUL 1YPZF 2FBJH 1I85A 3IFPA 1MJ7L 3PJSB 1RZ8A 3P9WB 1KTRL 5KSUB 4UQ3A 3FAWA 1NANI 4HIXL 4D8PA 1KUMA 1QOKA 2VABB 4Y19B 3FFCB 4OLVL 3DO7B 1W8NA 4HMCA 3V0WH 5DJ8A 4LEXH 1R5WB 1WBXA 2XY1A 1AFVH 2ZKHL 4GRWF 4XCNB 5TDOB 1WUNT 5SWSD 5HYEA 3S3PA 4U1GB 1XF5B 4LBEA 4YFLI 4EI5D 4P46D 4F33B 3ZKMD 3U7WL 1J0YA 1EEZB 1UWXK 4MJIE 2AVGA 2B2XL 4WFFE 4HWEH 4U2ZA 3ZZ1A 1C12B 5FDYA 4KK6D 4FQXB 1WF5A 4PJ8B 1UKTA 4N90E 4DOHB 3D2UA 1G0XA 4C55A 4WI8A 3QUKA 2MCG1 1DVFD 3QO0A 3GGWB 1CGWA 1DLFL 5ICZB 3STLA 1QA9B 3WFHA 5AYQA 4O2CA 2VLRA 4HXAL 1YEGL 2VXSL 1JE6A 1I85C 5IJVA 2VLKD 1VACB 1A6AA 5CS7A 3HG1E 4L9LB 4NCC2 1FNEA 1AQKH 2ARJA 5MI0B 2Q20A 1LO4H 2C3VB 5KSVB 2FR4B 1QVOA 3TBVA 1AHWC 3OB8A 5DEGB 5E6IB 4PLJC 3FCTB 4J8RA 5EU6E 4Q58C 3DRTA 3R1GH 5DEZA 1U95A 3DETC 2H2SC 2E8ZA 1F2XK 2VDNL 4J12A 2IANE 5FO7B 4CN1A 1JZ8A 1DFBL 3RVUC 3QAZB 1K3ZA 4KTDL 3X12B 3OB0H 2JJTC 1RK0A 4IRSC 4OKVB 2Z92B 1KTLB 1GOGA 1VFUA 1IM9B 3VFMA 3KLDA 3RBGA 3ZT6A 2YWYA 1A02N 4HFUH 2GFBA 4FABL 2Y6SC 2L7JA 2YMXL 1G9MC 1WZLA 4JAMA 3OKEA 4HIJB 2WAHA 1X5GA 4OSUH 3FN9A 1JWSB 3U46A 5HYQB 3JTSA 5A1AA 2ZSWA 1EJOH 3GMNB 1NL0L 1BVLB 4AMKH 2O5YL 4O02H 3VWJD 1T5XB 3O6FD 4WO4B 4UTAH 1VGEH 4M1DL 2WWMD 1K4CA 2VLME 3GMPA 2OI9B 3V6BR 1A1OB 4FFVD 4PJ9D 1A6TA 4KQ3L 4MD5B 5C0ND 5J3HC 1CVRA 3EO1A 2V2XB 5CMAB 3RAJL 5DJ6B 5T1KB 4L29A 4PRPE 2HRPH 3IRZA 4ZUSA 5IROA 4DQOL 3PDGA 3BZDA 4YPGB 4Z7QE 1OAXH 2FIKB 5I1LB 4MHHG 5JOFB 4OCSL 2DYPA 3RHWF 4POUB 1JF1B 4JRWA 3THML 3NIFE 1MREH 4NKMA 1I75A 4KAQL 3W9DB 2HJKA 2NY2C 5D2NE 3SKJL 1CWVA 1F6LL 3QQ3B 1R0AL 3B2UC 4PLKC 3NACH 1MAJA 5JDSB 4WFHE 5KAQF 1L6XA 3PWJB 3V95A 2R2BB 4UV7H 3UTTA 1T4KB 3SBWA 1MI5E 1M7DA 2VB5A 5C0DA 4JFHD 4CU7A 4YO0A 1M7XA 2Z31B 1IBGH 2FBJL 4ODSH 5HGAB 2B39A 2YD3A 4NP4H 1FVEA 4UNVA 3B2VH 2FSEB 3EYFA 5HHPB 5KSBF 4RCAA 3QUYD 5IROC 4EUPG 4NQVA 4PY7A 1UKQA 1HHGB 3V0WL 4P46A 4LEXL 5DD3H 5EO9B 4CVXB 1N2RB 3Q3GA 4HS6A 1E28B 1N59B 4F7PB 1AFVL 3QO1B 3OAZK 3QRGH 1XAUA 4DGVH 4KI5C 5C0GB 1HHJA 3PHOB 2VLJB 3PNWB 1FAIH 3QCUH 4LIQH 5GGSA 2FX7H 3ZKQD 4KC3B 5IQ9A 1LEKB 1YN7A 4NQSA 3LH2H 1RJYB 3QB7C 1BVKA 4HWEL 3TCLB 4APQB 1DL7H 3SEPA 5GPRA 1WT5A 4YDJB 4DZ8A 3NA9H 3V6ZA 4IOIA 4MDJB 2GSIA 4JZJC 3SJVD 4LSRH 4ONGH 1UB6B 4HHAB 2VLKA 4PTTA 35C8H 2IF7A 4O58H 2E6PA 3FO9B 2CLRB 2HKHH 2ZWLT 3TNNB 4PJCF 1BP3B 3NFNB 4QOKE 5E5MA 1AQKL 1XEDA 4OZHB 1LO4L 1CICB 2VZOA 4FXLA 4PREB 2VITB 2BY0A 5GSRA 3SKNB 4P46C 4EI5C 3R1GL 3ZKMC 2VABA 3WO4C 3VXMB 2DQIH 2W60B 4E41D 3WFEH 2ICES 1FNSH 3DO7A 4MNGE 4KK6C 1F97A 2CRYA 3AS3A 2IPKA 4YHLH 1HE7A 3VRJB 5CEYA 1BECA 2OXGA 3ILQD 4OM0H 2GAZB 4YUEH 1DVFC 3RPKA 3VH8G 1MPAH 3E6HB 4HFUL 4NM4H 4XCNA 5I17B 1WT5C 1JHTB 1XF5A 4OSUL 4K3EH 4U05A 4PJ9A 4RMVA 3QXAB 3NCMA 3SDDB 4NHUA 2CO7B 2W92A 1EJOL 1KJVB 1T3FB 2NY1D 4AMKL 4O02L 3DSNA 1T22B 1C12A 4UTAL 1VGEL 4FQXA 1R5IA 3TO2A 5D1XB 5EUOE 5TE6H 5IBLD 2LU3A 4YDVA 5MHSD 4G80B 4UI2A 5ICZA 5C2BH 2YPLE 5BW7C 1JGUH 4JN2B 5GS2D 5CHNB 1QSEB 4L5FH 3UTPE 3DX8B 5BV7C 5DGQA 1VFMA 2HRPL 5CJ8A 4XPGH 4OD1H 1NFIB 3K80A 3ULUD 2XQBH 4PJIB 4HPOL 3SDYL 1OAXL 3WS6C 2C3VA 1IGCH 3RUGE 2FR4A 5IBUB 4OZFG 4OFDA 5IV2B 3FCTA 1LE9A 1MREL 4PJBE 2YRLA 4Z7VA 5B39G 3S36X 2ITCA 5FO8B 3MREB 3QRFM 3VWJC 3O6FC 4RX4D 5D1QD 3J7HA 2WWMC 3X12A 3NACL 4FFVC 4PJ9C 2Z92A 1KTLA 1D5MB 5C0NC 3ALPA 4UV7L 2I9LA 4MMXC 3A6CH 4Z7UA 5DFVD 4BH7B 1CF8H 3RVTD 1EO7A 5KOVC 5HYQA 3D6GA 1IBGL 4ODSL 4JFOB 3M8OH 2X4NB 4MXVF 4NP4L 4WO4A 3B2VL 3ME0A 3T0XA 2XTLA 5D7IE 1A1OA 5FYKD 1IGFH 5I1CH 4GH7B 4JFEB 1ZHNB 4A6YB 2KL6A 1JYWA 1WAAA 1YDPB 3C6SB 3GIZH 4YIQB 5T1KA 3RIAF 5DD3L 1O0VA 3T08A 4NZRH 3CLFH 5CKGA 1N6UA 2ZUQB 3O45B 1TNNA 4DGVL 5BZDB 3T0ED 3QCUL 1FAIL 4LIQL 3FN3A 2FX7L 3SJVA 2W0LA 3BMVA 1AKJD 3LH2L 3TA3D 5I1LA 2IPUG 4M3JA 4JY6B 5JOFA 4WU7B 5F89B 1DL7L 2NY5H 4JFFB 1XF1A 1UJ3C 2R2EB 3RL2B 3NA9L 2Q3ZA 4X5WB 3PXHA 4U31A 3W9DA 3ULVF 2YPKB 4LSRL 4ONGL 1NBZB 2X9WA 3EDFA 35C8L 3QQ3A 3B5HA 4O58L 4S2SA 4A2MA 5DJYB 1CFQA 4ZTPH 3AGVA 3GDBA 4NUJA 5JDSA 1KELH 1NAMH 3MRCB 1MRFH 2HKHL 1T4KA 2R2BA 3QUYC 2DS4A 2QLVB 4GRLB 1LMKA 4LP5A 2VMFA 1JHLH 1YEHH 5HDQH 2A6DB 2KDGA 1OAUH 4X6DF 3FFDB 4KGJA 3U30C 4NN7C 2V6HA 5GRZA 4E41A 3T3MF 3L3GA 5HGAA 3QWQB 3UYOD 5K9QG 2FSEA 5HHPA 3QUZB 1B90A 4EDXA 2DQIL 3WFEL 2ZSVA 1FNSL 3U0TB 1QBAA 5IB5B 3F7YA 4YHLL 4PV9B 3JV5A 5EO9A 1N2RA 3ABZA 3WEXB 1TPXC 4F7PA 1E28A 5JTWA 3FQRB 4OM0L 4YUEL 3MYZA 1HHKB 2I9TA 4FTVE 1MPAL 1HILB 4NM4L 4EOWH 1KLGB 2AJXH 2AEPH 3TBTA 2CDFA 2OM5A 2VLJA 3O81A 5IB2A 4K3EL 1WJ3A 4XPFH 2EDNA 1T1YB 4L8BB 1RJYA 4APQA 1PG7X 1S7TB 1QR1B 3MR9A 4XPTH 5AAMA 1I7UA 1NBYB 2UV3A 2XACC 3BKYH 4MDJA 5EU4B 2YS4A 4UTBH 5TE6L 3A6OA 1TITA 5EBGA 4N8CH 1MHHB 3R8BB 1NEUA 5C2BL 1KB5H 3RBSA 1JGUL 1TJHH 1KENH 5GGSY 4L5FL 4P5KB 4XPGL 3TNNA 4NBXB 4OD1L 1UC6A 4H8WC 5E7FA 2V2WB 2XQBL 3NFNA 5EOCJ 4ZS7H 1EEQA 1OLLA 2Q86B 7CGTA 4OZHA 3TN0D 3ILQC 4XVJH 1IGCL 1A6ZB 1CICA 4PREA 2WINB 2GTZB 3BVNA 5D1QA 5E94B 5SX5H 2XNAA 1EVUA 1HEZA 1TJIH 4E0RB 4HUUA 3DX9B 1DE4B 4RFNB 2NY1C 1MCJA 2W60A 3S35X 1AO7D 2QSQA 3DUSB 2A1WH 3GSUA 3EZ8A 1ZT7B 5IBLC 5DJAB 4GKNA 5C0BB 1UWGH 2GAZA 1U8LB 4HWZB 2CQVA 4I0CC 1AE6H 3A6CL 2FGZA 1CTOA 1JHTA 5DJXA 1CF8L 1CDYA 5F1OB 3MFGB 4HZLB 3QXAA 3BP5B 3AU1A 3M8OL 3ULUC 1T22A 5FB8B 1U8KA 1WTGT 5FUOH 5FECB 2Q8AH 4WGWB 5D1XA 4TTGA 1IEBA 3D85D 5D5MB 5I1CL 1IGFL 2CKBA 3AAZA 5EH1A 1FYTD 4M00A 3GIZL 3LIZH 1FC1A 4O9HH 1M6OB 1AKJA 1N64H 5CHNA 1QSEA 3TA3A 4NZRL 1NMCC 3CLFL 1HOCA 4P48A 3PXJA 2ZG2A 1NFIA 4KVCH 4G9DB 4DUWA 5D1QC 2DD8H 4PJIA 3UEZA 2OSLA 5K33A 2BRQA 4YFDB 3D39E 1ETZB 5DJ2B 1QQDB 3STZB 2NY5L 5DFVC 5IV2A 4WI7A 3RVTC 1UFUA 3VDBA 2XTJB 5FO8A 1HH6A 2MHAA 3OAYK 3MREA 4I2XB 3VGHA 5JIPA 4Z7WB 1ZTXH 2D9CA 1Q0YH 4PJEB 4QCIB 4HIHA 1CLYH 1CCZA 4ZTPL 1GYAA 1LEGA 2F9BT 3OKMB 1KELL 3MQIA 3PL6D 4L4TE 1NAML 1KJ2H 1MRFL 3LRSA 3VXRB 4AM0B 2E9BA 5IKCA 1JHLL 1YEHL 3D3VD 3EOYG 5HDQL 1OAUL 1UJTA 1YMHB 4ZYKA 5E99H 4XPBH 3I3BA 3T0EC 1DN2A 3OKDB 2Q76B 4IJ3B 1Z5LB 1YJDC 4LVOB 3TA3C 4M5ZH 4JFEA 1ZHNA 3C6SA 2HVKB 2WZPD 1M1SA 3OGOE 4BSWA 1ODAA 1MRDH 4EOWL 3O45A 4Y5YC 1IQWH 2AJXL 2AEPL 1J87A 3MV9D 2GJ6B 3KPRD 1MEXH 4XPFL 5E8DH 3ZDZF 3NGBB 4ORGA 5IHBA 3FB5A 4WU7A 2GI7A 1C08B 4JFFA 4U1SA 4JLRB 4Y16B 4XPTL 4N0CD 3ZE2E 3BKYL 1JWMB 4UTBL 5EIVA 1NBZA 4XCFH 4N8CL 4RGMB 1ZVSA 1JUFB 1KCRH 1JHKH 2MKWA 4GMTH 1KB5L 2Q7NA 3RTQB 3RDTD 1TJHL 5F7WC 1KENL 5I76B 5IR1B 1FNFA 3VXSB 3VWKD 1H9VA 3MRCA 3Q2CA 4XRCB 4QXTB 2C1OA 1VENA 4ZS7L 2Z8VC 4NSKB 2A6DA 4OUOA 1V3JA 5DF0A 3TO4D 2NY4D 4JRYB 2ADGB 2PUQT 4XVJL 5C07E 4HWNA 1OGTB 4KRPD 5E2TH 1PJ9A 2PN5A 5L8JB 1AGDB 1TJIL 1I8KB 3QUZA 4S1DD 4F15C 2JK5B 5CBAA 1OTTD 6CGTA 3U0TA 2A1WL 5IB5A 3GMOB 2ADIB 1LO2L 4KDVA 3TF7C 1SYSB 4PV9A 4FZ8H 1UWGL 1HHKA 1AE6L 1TLKA 1ADQA 2R4SH 4J3OC 1MUJB 3D85A 1KJMB 5I8CA 4L8BA 4DFIA 4JJ5B 6FABH 3UPRB 3ZE0E 4OCLC 1FYTA 2NXZD 2DLTA 3HI1A 1QR1A 1QSFD 1FNGB 5FUOL 3FKUS 3GJFK 3TN0C 5EU4A 2Q8AL 2VDQH 4PJHF 1MELA 2D0HA 3IXTB 3JWDH 4NNXA 5DHYA 3LIZL 1CGYA 4O9HL 1N64L 2AQ3A 1NMAH 3OKKB 3AS2A 5BOPA 5A2FA 5B3JF 4P5KA 4P4RB 4RAVB 2DD8L 2YSSB 4Y1AE 2Z93A 3RX7A 3IAPA 3CFKA 2Q86A 2CH8A 2Y5EA 1H3PL 3RIFK 4ZPTA 5F7UA 5INCA 4KV5F 3BP7A 3WFBL 5E6ZA 5E94A 1A7QH 1V7MH 2E9WA 3BKJH 5EO1A 5K9KB 4E0RA 2FX9H 3BIAX 1DE4A 3DX9A 3PL6A 3MV7D 5M7QA 1F8TH 1ZTXL 3HMXH 3JTTA 1Q0YL 2VL5B 3DUSA 4WW1B 4N0RA 3D3VA 4I3GA 4YDIH 1CLYL 3MUY1 4HGWB 2WUCH 3V6FB 1WWWX 1OF2B 1FVDA 5DJAA 1NCAH 2GJZA 3RJDA 1KJ2L 1U8LA 2J12B 1HXMB 1Q9WB 4LSSH 2DM4A 4M61A 4OFVA 3BGAA 4XPBL 5E99L 5DMYA 3KG5A 3VXNB 1FN4A 5CSZA 5FB8A 2FWOB 3LCYA 5FECA 5HGDA 2BRRH 4I0PB 3VA6A 1EHNA 4JGJA 4M5ZL 2BVPA 1DLHB 2DWDA 4GBXB 1P4BH 4XP4H 5D7JD 2VXQH 3KPRA 1H8NA 5F9JB 4JVWA 1JBJA 1UADC 2WQRA 2PW1A 5A16B 5GRVK 1MRDL 4G9DA 4HGKC 1IQWL 1KIRB 3MRLB 3WN5A 2PW2B 1G7LB 1MEXL 1AQDA 3PL6C 5E8DL 5KTEH 3VG0H 4K7FA 1ES0A 1ETZA 3JV6B 1QQDA 3STZA 5FKAA 1HN1A 4KZEH 3OKOB 3RDTA 3IDYB 1L9NA 4G8FA 4S1SH 1DN0A 3ALXA 5I8OH 3D87B 3FT3A 3VWKA 2G60H 4I2XA 1FRGH 2MTPA 5E9DD 5CEZE 4RA3A 4W6WB 4XCFL 2OX5A 5HHOE 3ZDXE 4G3YH 1KCRL 4ELMF 4QCIA 1JHKL 4GMTL 1XGRA 5EULV 1BFTA 1P7QB 3MV8D 1R3HB 3ZMRA 4UT7H 3OKMA 3MJ7B 4HWUA 4IBLT 3VXRA 1HQ4B 4AM0A 2VNCA 5FCUH 1VFOA 4UUJA 3QYCA 5DUBB 1YMHA 1AGCA 4OGXH 3RX8A 5E2TL 4Z5RB 3RKPA 1FIGH 2Q76A 5IHLB 5D2LB 4LQ1A 4CN6A 1ZAGA 1BFOB 1WZKA 3RWGB 2NX5B 4I9WD 5HHMB 4N0CC 2HVKA 3VA2C 3FQTB 1A6WH 2EXYD 3MV11 2O61A 2FO4A 5JIHA 5FYLE 3DVNB 4FZ8L 1KEMH 4F7CB 1IAOA 2R4SL 3GKZA 4WV1A 1QSFA 3RDTC 3QUXC 4D0BB 2VR4A 2GJ6A 3EGSB 1TTGA 3BZEB 1VPOH 6FABL 1QLRB 1C08A 1YQVH 4JLRA 4Y16A 1M71A 3ULVD 2IGFL 3TO4C 2NY4C 3P4OA 2VDQL 1F4HA 1QLFB 1J1PL 4FQ1L 3SDAD 1MAMH 4JM2B 2LU4A 1BBDH 3JWDL 1OGAE 1U42A 5I1JH 5D9SA 3RTQA 4CDGC 4F7EA 3KPMB 3L5XH 5I76A 4S1DC 1NMAL 3VXSA 1OTTC 1OP3H 4BK5A 2C7UB 4JPIA 2CIKA 1FZJB 4QXTA 3GJEB 4NSKA 4PJ7B 3ILPB 2ZUWA 5EWIH 4LCYB 2ADGA 4PG9B 5I0ZA 1A6PA 3P73B 3W11D 3QT2A 2F8XC 4U6HB 1A7QL 1V7ML 3BKJL 2YD5A 1AGDA 2J8UB 5CLTA 1I8KA 2FX9L 3I6KB 2Y7QB 2XXMB 4MWFB 4OFYD 1F8TL 4K7PY 5C3TA 2DIAA 2F53D 5TE7H 3VFSA 1JZ2A 2NXZC 3HMXL 4TVPH 3M07A 2VLRE 1IVLA 3GMOA 3IFNH 4WV1C 2ADIA 4DTGH 4YDIL 4JDVA 1SJVA 1SYSA 2WUCL 5TH2B 1HI6B 2F54B 4JHWH 4G6FD 1NCAL 3AS0A 1UVQA 2XICA 4LSSL 4WW2F 1EBAA 4TQEH 1XF4B 1KJMA 1F3RB 4HSQA 4JJ5A 4ZNEA 5EU7C 1A6VH 4BQ9A 4RDQG 3F8UB 4GAJH 2X70B 2QQQA 2BRRL 5FK9B 3NOIA 4X4XB 2CO6B 1RIVH 2FLBT 1P4BL 5I0DA 2C4FU 4XP4L 2VXQL 2Y07H 4Y5VA 4S0TD 3CFCH 3PGCA 4JZJB 3OKKA 4QHNB 1FZMB 1PZUB 4I18C 2X4UB 3Q48A 3AY4A 5IG7A 3PWPB 4PGDB 5BRZD 3LKRA 4TRPH 4AT6B 4RBPH 1U8JB 4YHYC 2YSSA 1KCKA 3Q6GH 5E9DA 1JPGB 4D2NA 1NKRA 5EZIH 3OKYA 5KTEL 2FNBA 1DANT 3VE0A 4OIAA 3VG0L 2AJYH 4KZEL 4FMKA 1OP5K 3OPZH 1BMGA 4D0CA 2D31A 4S1SL 3MV8A 1TMCB 1IGIH 2IMNA 3RHWK 3TNMA 5I8OL 5LVEA 2G60L 1FRGL 1V3MA 1B2WH 3PWVB 4G3YL 4WW1A 5GGRB 4PJXE 1CQYA 1BFVH 3V6FA 4UT7L 3GSRA 4U7KA 4M3KB 4HZAA 1I9RH 5D7JC 1Q9WA 4MB4A 4GLRI 5FCUL 3UO1H 3WJLA 2MMXA 1EEYB 3MRMB 2ZUVA 5F9WC 3MLUH 3VXNA 4OGXL 4OLZH 4HMEA 1FJ1B 1U58A 2RAMA 4WUUD 4Y5VC 3I50H 4MB5A 5FIEA 5KZCD 1FIGL 4RMSA 4EI6B 3LHPH 4UT6H 4AEFA 3AY4C 5D70H 4L3ED 4S1QH 4MS8D 4AENB 1A6WL 2R69H 3UTTE