4YE4H

Crystal structure of neutralizing antibody hj16 in complex with hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
227
structure length
227
Chain Sequence
b'MKLMQSGGVMVRPGESATLSCVASGFDFSRNGFEWLRQGPGKGLQWLATVTFESKTHVTASARGRFTISRDNSRRTVYLQMTNLQPDDTAMYFCVKDQTIFHKNGAVDFFSYFDLWGRGAPVIVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HT593.1 gp120
publication title Crystal structure of HJ16 in complex with gp120
rcsb
source organism Human immunodeficiency virus
molecule tags Viral protein/immune system
total genus 47
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H01
3GO1L 3ZDYE 5E8DL 2XZCL 5ICZA 5J9PB 3MYJB 1ZA6B 2D7QA 3JWDL 1I85A 4LSSL 5LGJB 3TN0C 5IBUB 4HIXH 3VFRB 3MJ9L 3QUYB 5JIPA 1TVDA 4P23D 5CSBA 5HY9B 1U8NA 5EUKB 2IEPA 5J1SC 3BP6B 4Y5XC 2NY5C 2JK5A 3PG2A 4JM2A 4HIJA 5DXWA 4GG6B 3OB8A 1LEKB 3ARQA 1XEDA 3PXHA 2JLLA 1KCSL 4YZFF 5DHVH 2E5EA 3DXAE 5C09E 35C8L 2BNUA 1OTSD 3ROOA 1JFQL 5D5MF 4KPHH 5F97E 3X3GL 5I6XB 4BSWB 4QOKD 5GRJH 4PP2B 5FCSH 1S3KL 5HI4C 4FRWA 3MRMA 3BSZL 1T0MB 3PQYA 2QADC 3MLVL 2XZAL 1B3JA 2P5EB 1OGTB 1DFBL 4ELKB 3R1GH 5IJVA 2YUZA 2Z31B 1QPPA 3DX9A 4S1RH 3E6HA 3KS0H 3VE0B 3DV6A 2Q3ZA 4ODWB 3JWOL 3LPFA 4MVBC 1CXFA 4QYOA 4TSBH 3IKCA 4APQB 3SKOA 4F15B 3BKCL 2NW3B 5FYKL 4Y2DD 1YNKH 3T0XA 1UXSA 3DYMA 1NKOA 1MJJA 2ZJSL 1NGYB 3QBTB 5FUCE 3V6FA 3M17A 5FYJH 1MIEL 4S1DC 1I8LA 3MRIB 4HUMB 5HHXL 4LQFL 5AYQA 5E99H 3H9SB 1BAFH 4WU5A 2AV7B 1E28A 5JW4R 1KGCE 3LN5B 3VDAA 4FHBD 3LSOB 3C08L 4NIKB 3EOBA 4URTB 4XP9L 4GAGL 2PXYC 4RRPA 1ZEAL 5EN2B 2W60A 1P7QD 3ARXA 5D5MA 5BCAA 1FGNH 2VABB 4GBXB 1S7QA 4LK4A 5EO9B 1F4XH 5DLMH 3VGAC 2FD6H 5JIHA 5ID1A 2BNRA 1OHQA 2UVEA 5F96H 3MV01 4LRIA 5IB2B 1ORSB 1WCQA 4U1GC 4YHYB 1DEDA 3OJDA 5T3ZD 2C3HA 3DHMA 3ZO0A 1BBJA 3I6GA 3Q1SL 1JK8A 3Q5TA 3O6FD 2NXZB 3F5WA 4X7SH 2NY3D 4EUPH 2X40A 2O61A 1H8SA 3D85A 3LN9A 5GXBB 5HHMB 1XR9A 1IC5H 1N2RA 3MFFB 3VFOA 2ZUYA 2Q7YB 3GMLB 2HN7B 4F7TB 3MMEA 4MD4A 5LG1A 5TQ0H 1B4RA 3KPNA 3RUGF 1CS6A 3DVIA 4A6YL 3BKYL 1R24B 4BYHA 3LS4H 3WS6C 1T89A 2Y72A 3OSKA 4YDKH 3T0DA 2VQUA 3KXFA 3O8XC 4U6XB 4P4KD 1IEBA 3V4VH 4ELMF 4K2UH 1A7BA 4XVUD 5D7IF 4H0GA 5HDBE 4GKSB 5I75C 3BX7C 3P4NA 2MSPA 4JG1L 4J3SA 5A40E 2AKRB 3EKCA 4WWID 4FFVC 2VIRA 2GCYB 3E2HB 4HJJL 2FX8H 4OFVA 1L0YA 4LSVH 5DEFA 3MRQA 1T20A 3UROR 1F4HA 4I4WB 2D0HA 1NBVH 3GRWH 3GMNB 1J18A 3V7MA 3RKDC 4JFHE 5IVXF 3QIWD 4NGHL 3CFBB 1K5NA 3RUGA 3NN8A 1JMXA 4TUKH 2WK2A 4BFEA 2R8SL 4AG4L 1S7WA 2L0DA 3NFSL 4PD4J 2HKFL 3O2WH 1ED3B 2YC1A 4GQ9H 5C0JA 3EJJX 1T4KB 1BX2A 4ELMA 5EFIA 2CK0H 1NLBL 4XCCL 3RGHA 5D7JB 3ZDYF 1GYAA 1FLRH 1YEKL 3RWJA 1ZSDB 1FYTB 5D7IA 4XP4H 4L8SB 5EBWA 5MEOA 4NQDD 1FYHB 3TT3L 3HG1E 4Q6IA 3QWOA 1BJMA 1PKQB 3ZE1E 4JY4B 4YUEH 5GPRA 1AR1D 2Y5EA 5JZ7D 4V1DD 4XP6H 2I07B 2E7CA 5DRNA 1MFBH 1QQDB 3MLUL 4GRLD 3X14B 5C7XH 1DQDH 1B90A 3W0WE 5ADOL 5GISH 3WE6A 5CBAA 2OBGA 3S9DB 3VCLA 4C56D 4LLYA 1M4KA 4LCYB 1C08B 2VOTA 3F7RA 2VISA 1M7DB 3FAWA 5E2WH 3PWLA 4G8FA 1S7SA 4LCWE 4NFCA 2UUDH 4N5EC 2R0LL 5D1XC 4N0FB 1CI5A 4KGJA 4TTDC 4F58H 3RNKB 5FYJE 2CGRL 3ZKQD 2JJSC 1C12B 4NRZA 4OGAC 5IWLA 2JJUA 5BRZE 1NCDL 2V17L 3GSWB 4QRPA 2VZTA 4P46C 1R3IH 3P11L 3IFPB 4JFPA 2ZG3A 1IKNA 4BK4A 3FQWA 4P5KA 4GXUM 1QBLL 1I9JH 1I7UA 2VLJB 1GGUA 3SE3C 5C0GB 3MUJA 4GRWH 1MCOL 5MEPA 5EC2A 1RU9L 3H7BB 4JZNA 3RVVD 2C26A 4LLDA 1TETH 1J1PH 2F5BL 5FA4B 4OF8A 1WIOA 3EYQD 4G6KL 4WTZA 1ADQH 1CK0L 3HB3C 1MFAL 2BC4A 4XPTL 1JNHB 1Q0XH 5ESAA 1YPZF 2X41A 2DICA 2FL5B 3V52H 1WGOA 4I2XB 3HC3L 1KTLB 5IB4B 1OGAD 1HZHH 4N8CL 4L3CB 3MXVH 4NZRH 5JIKA 4G6ML 2NY5L 3DROB 4TSAL 2R23A 3EYVB 1RUKH 4M93B 3NGBC 3SDXB 4OLZH 5J06A 4ZTPH 3U30B 5HYSA 1RVFL 4LLWB 3OJMB 5D2NC 4CU6A 3C2AL 4WJ5A 5IM7B 3MV8E 1BZQK 1KB9J 3FRUA 1Z9LA 1HHHB 2OR9L 3BDYH 3IVKA 5DWUH 3MC0A 1OAQH 3EFFA 4M1GL 3FT3A 2DJUA 5TE4H 3SDDA 4RSVA 2DQCL 1A1OB 3L3IB 4Y5VC 1OP5K 4X6BB 3SGKA 5KANI 2WBJA 1EDQA 1Q72L 4UB0L 1OCWH 2FIRT 4WW2C 3WSQH 4C4KO 3HE7C 3QFJA 3BPNB 2YD2A 1C5CH 1AQKH 4G8IA 3TCLA 3PWUB 5J6HB 4NZDA 2LAGB 4XWOC 5D2LE 4P57A 1YPZA 4HC1H 4MNQD 5DMKA 4JQVC 4LSRL 4JKLA 4PJEB 4YHLL 2BSRA 5IR1A 4RMVA 1RZIA 1YN6A 2AEQH 3JTSB 4JKKA 3A6CL 5TDOB 3D0LA 2VLKA 1F8TL 3SDYL 3PJSB 1JF1B 1HHIB 2CRYA 3QCUH 3VMNA 4PRNB 2R0KH 4XMPH 3BZDA 1U8MA 1CXLA 3VD3A 2N4IA 5J3HC 4OF6A 1FNHA 1ZOXA 3D3VA 5I71B 4KK9C 1L7IH 3QXWA 5DJ0B 3DARA 3EO1A 1FSKB 4ZQKB 5CJ5A 2GJZA 3TVMD 5CZXC 3KPRA 1GAFL 3EYOA 4JFDA 1CD1B 5IMOA 3T2QA 1TVBA 1WT5C 4JRXB 1A1MA 4O5LL 4NSKB 1X5FA 1QUNA 4F9PC 4Z7WB 1UVQB 4G8GA 3LH2L 1AQDB 3RY6A 4KKBD 5EZOH 2I9LA 4PJFE 5SWZE 3LMJH 2IAMB 1RIUL 3ARBC 3UTTE 1AO7D 1HOCB 6FABL 5E08H 3DYOA 1MCJA 4P0DA 5ESVA 1A9EB 1ITCA 3MROB 4HBQA 4NQCD 4PGCA 4L4VD 1BIIB 5MHSE 3MJ9A 1T2QL 1Q9WA 4NRYA 4LVOB 1MH5B 1AHWA 3DRTA 4KXZI 1QSZA 4G80A 4X6DF 3F62A 3K7UA 3HZMA 1TZGL 4KUCD 4MLIA 1XIWD 3MLWH 1NCTA 4R7NB 4ORGB 4Y4KA 3W9DA 2ICEB 3EYUL 5D72L 4OD3L 4NO0D 5HGGS 3AREC 3B9KA 2IH3B 3FFCA 1FVCB 3QDHA 1F6AB 4CW1A 2NQCA 4I0PC 4XNMB 2F8VA 3T0WA 5IEHA 1MCCA 3GMMB 2W59A 1ZK9A 2EO9A 4QRUB 3RWFA 5C0RH 2FECL 1IBGL 1X5JA 3KPSE 4U33A 4PJ9A 4RGNB 1QA9B 1RD6A 4YQXL 4X4ZA 4JFFE 2X4UB 3RGVB 1IGFL 3FB5B 3DNKA 4AIZB 1ZS8B 2EDBA 4L29A 1S5HA 3L6FB 4TYUA 3OKKB 4XVSL 3PHQA 3WYRA 2EXWD 4LRNH 4LLMA 2PYEB 4MAYA 3SKNB 4PJ5E 4JKWA 5DD3H 2EIEA 2O5XH 1HCFX 4WW1A 1T83C 3IJSB 4MJ5A 3UTPD 4QWWC 3IAQA 4UT9H 4G6AD 2BVQA 3ZHLA 1A7OH 3F58L 3T2PA 4Y4FD 1E27A 1MF2H 4ZXBD 3L3GB 4FXKB 3K74B 4Q9RL 5FM4A 5T5NG 1CT8A 3NFPA 5KOVC 3VA6A 4ONFH 4OLUH 2AVGA 2IGFL 4YAQA 5BOZG 1ZTXL 2WQ8A 2H1PH 1HINH 1JWUA 3EUUA 1KJ2B 4TNVF 3RPKA 4XTRC 1G7LA 5CINH 3P0YL 3U83A 4EI5C 1NPUA 2W9DL 3DX6A 5I66B 3OJ2C 3QIBC 3WFCL 1ZHLA 1WBYA 4ETYA 3ZKXC 3VWKB 2YD1A 3WN5C 5MI0C 1RJZB 2Q7NA 5JO5B 1KCRL 3S34L 3TO4C 4QRRE 1AY1H 3QI9D 4JHAL 3O9WA 3SGJA 2A9ML 4PRDB 5E7FA 1PAMA 4J3OC 4MD0B 1MPAL 2OTUA 4P2RE 2VLRB 5DD6A 4Z7UE 5K33A 3ARDD 4MA1B 3VGDA 5KSAA 1YQVL 4PGBA 3N85H 4U1MB 3DX7B 1D5ZA 4GT7A 3GMRA 4I9WE 2HG5B 4G9FD 1DQML 1I9RH 5GJTH 1XF2A 2AXGB 1EK3A 1II4E 2BRRL 5KG9B 4L8CB 2OJZL 2WWMD 4D9QE 2Z31D 3UPRA 4XNQB 3HLAB 3MRNB 3PHSA 5FKAB 1T6WA 1F11A 5J1AA 4L4JA 5L88H 3SQOH 4A6YA 1RURL 4LLVB 3QXUA 4JJHA 1LO4L 3AROA 5LVEA 1BQHA 5EBLA 3PWNB 1QSFA 2EIBA 4Z8FL 4OF3A 5I73C 3OKLA 4WTWA 5LAXB 4FZ8L 3QJFA 4J1UB 4ZD3H 3RNQA 5CCKH 3ECBA 4JFEA 4P9ML 2HTLC 2XA8H 1G1YA 5DVMA 3AS3A 1NMBH 5AYUL 2AV1A 5D2LF 1UCTA 2VYRE 4U1SB 2V2XB 3F6IA 3HC0B 3MLRL 2EZ0C 4KROC 4GMTH 3BPCB 3V4UL 1RZ7L 5GRYA 2Y06L 4ZS7H 2F58H 4GBXD 2HJKA 4HZLA 1YEDB 1FG2A 4IHOA 3VG0H 3MNWA 4ZS6C 5FB8A 5DVKA 2UZIL 1F45A 5ACMA 3O0RH 1V5JA 1YEGL 2BXYA 4M7LH 4OB5L 4E42B 3O41B 2FO1A 4H1LA 2XTLA 3D6GA 4O9HL 1MHCA 5IOPB 4K23L 3CC5A 4HMEA 4MWFB 1U3HB 5HI5D 5E4EC 3OR6A 1S7UA 2IMMA 4RAUB 4MDJB 1H3UA 2I60H 2NXZD 4D94A 1G0XA 2APVA 4FQPA 1GGIL 2BRQA 5F7EL 4PGEA 5FO8B 4HUVB 4FA8A 4H25B 4LP5A 3SDCA 4GSDH 4ZYKB 2WUCH 3VFVA 3VXSA 1CG9A 2VWEC 3U1SL 2VDRL 4YK4B 3QZWB 1RFDL 1I1AB 5IBLD 4PJFF 3FOLB 4JY5L 3T04D 3ZE2E 3T0EE 1W72A 1YEJH 1V05A 1S7VA 1A14H 1M7IA 1FRGH 4UQ2A 4WEUD 4FFYL 1U95A 4DKDC 4PJIE 5ICZB 1E4WL 5JW3H 2FEEI 2OZ4A 4WFED 2R1WA 4IBLT 5FUCC 1FDLL 3RZCD 2BJML 1SEBA 4Z7OE 3PV6A 4XPHL 1U8NB 1T1YB 1QZ1A 3DVFA 3D48R 3VG9C 3HTLX 3QNZA 4LU5H 4HIJB 4P3CL 1G0YR 3HNTL 5HHOA 4OV6F 4FTVD 3G6JF 4BZ2H 5DC9B 5I1HL 2F19H 3EDFA 2IG2L 4H20H 3LN4B 1TZHA 3OAYK 4B50A 5ALCL 1FLTX 3HPLA 1CE1L 2P5WB 3WDJA 4YFLF 3MRMB 2ZKHL 2OL3H 4ENEC 3BOVA 1I1YA 3NMEA 2ZNXA 5IJVB 4I3SL 4YWGH 3WJJC 3DX9B 3ULUH 4GRMA 3B2UC 3OAUH 4UUJA 4CJ0A 1LK2A 43CAB 5F6IB 3DV6B 3KAAA 5MENE 1I1FA 4C59B 4OGYL 4WGWB 1JZ3A 4OM0H 3IKCB 4TUOA 1EEYA 2ICCA 1IKFL 1MSPA 4OLVL 5ANMA 4JGUA 1UXSB 4WFHE 1MJJB 2AERT 1TJHH 3Q5OA 3V6FB 5L2KB 1V8HA 2CMRL 1KV3A 4JN2A 3TM6A 3LOWA 4WU5B 4EIZC 1L7TH 4KRNA 3TN0A 5CJQH 3FQTA 1R0AH 1EIBA 2WAHA 3G6JA 3EOBB 1RIHL 2YUXA 3K1DA 4MD5A 5D1QD 4AMKH 1FZKA 1ZAGA 2EYRA 1QKZL 4Y5XA 1NFIA 5D5MB 2EXYD 7FABH 3UJTH 1CL7L 1V3MA 3QXAA 1S7QB 4NWUH 3SKUD 1GC1H 1HN1A 4TUJA 1OTSC 3EJYD 2D2OA 4HS6A 5BS0A 4FQ2L 2BNRB 2D03L 4RZCA 5SX5K 4UILL 4YBLC 3NACH 4JO1H 2IFFL 1SY6L 4IJ3C 3O2DL 3OJDB 1L9NA 4MA8L 1BBJB 1T21A 1WFOA 5TPWH 4Z7UF 2B39A 4KUZH 3PGDA 3F5WB 1YYLL 5A2LH 4WY7L 3LY6A 2V9QA 2O61B 4QTHB 1D5IH 3D85B 4NKMA 4X99A 3T09A 3MOAH 1J0YA 5FGSA 5TGBA 1XR9B 1Z5LA 1N2RB 4XPFL 3VFOB 1VPOH 1T22A 4P5TC 4BFBD 1QSEA 1OARH 3S5LG 3MMEB 2XWTA 4UTBH 3KPNB 3LEXA 4NN5B 4PRPA 1NUDA 3GM0A 3OAZK 5IFAH 1OQOA 2K1MA 2VQ1A 1GHFH 4G5ZH 5C8JA 2EDNA 2R15A 4MHHG 5T5FL 2A6IB 3KXFB 4DZ8A 4F7EB 1IEBB 1YMHA 4UMGA 4KKCD 1YEHH 4U1JA 5GGRY 2LVEA 3VFTA 4GQPH 2D0FA 2PXYA 5DSCA 3P4NB 3GIZH 3I2CH 1J1XH 4AYFA 1J8HE 2VKWA 1QRNE 1BHGA 4MDIA 4PRAA 1MWAH 1VFUA 1ZA3B 4K8RL 3KLAA 3QWRA 2F54E 1EFQA 1N4XH 4W6WB 3MRQB 4RISH 2HMIC 2P49B 2XTJB 4OLXH 1RUAL 3O6FC 5E9DA 3OKYA 2NY3C 5DURD 3LQAH 1EEUA 1GJIA 4DFHA 1N5YL 3C5SA 4MB5A 2GUOA 3PE9A 5LQBH 1K5NB 3RUGB 5GS0D 5F7HA 5SWSE 2Z9TA 4UV4L 5KZCD 1CZ8L 1S9XA 5CGYC 2Y1VA 4KI5D 1BD2E 1ZV5A 1UM6L 1KOAA 3I02A 3MLYH 4X83A 3GBLA 2WANA 1CGYA 1S7WB 4BUGA 2YC1B 4JVWA 4X80H 1RUML 3WS6A 4Y1AA 1BX2B 4ELMB 1QPXA 5EFIB 1PG7L 1LO2H 3SY0A 3PP4L 3BH8A 4JREB 5J4MA 3ZKND 3QH3B 3RWJB 4QRSA 1ORQA 5D7IB 1RZKH 1LGVA 5EBWB 3KR3H 5IF0A 5HYQA 5MEOB 3O8XA 5FGCE 1Z3GH 4Q6IB 2J88L 3QWOB 3QG6A 2XQBL 1UEYA 4XVUC 1E6OH 4QNPE 4Z7OF 2BP3A 2A6JA 5GRZA 5DUPL 5DRNB 3B83A 1JHTA 3UO1H 1UWXH 5JW5A 4XAKE 1P4BH 4KY1H 3WS3A 1MCPL 1F90H 2KKQA 5CBAB 4EN3D 1OOAA 4NCC2 3D18B 4Q2ZA 2ICWJ 2BZDA 3VCLB 3KPPB 4LLYB 3O2VH 3QRGL 5MP6L 2VISB 4R8WL 3WLWD 2F53D 2NY0C 3L5XL 1EMTL 5IVXB 3QEQA 4BSVB 4HH9A 4G8FB 3DJ9A 3DETD 1MFCH 1S7SB 2A9NH 2V5RA 1JVKA 5CD3A 2HYMA 2BFVH 4L4TA 3BUYB 5K9JL 1LDPH 4X7FC 3ZDXE 3ZTNL 3QIWC 2AI0H 5BO1L 1QHOA 3JV6A 3QHZL 2J8UE 4HEME 3O3UN 4JG0L 5D4QA 2E9JA 3MRJA 4F57L 2YD3A 1JPSH 1KN4H 2APXA 3MLXH 4NFDA 5TDPA 3GI9H 5GGRA 2DQGH 4QRPB 3RL1A 1ULVA 2ATKA 3GSNH 4CRPA 4Z95L 4U7SA 4P5KB 2RHEA 2AXJA 1I7UB 4GAJL 4L3AA 1KF9B 4TNVK 5EC2B 3ARGA 2X4QA 2YHGA 4JZNB 4RGMB 4PBVC 4HGWB 3RVTC 3EOTH 3MX0A 5E56A 3LEVH 4UNUA 3O6KH 1G6VK 4OCXH 3LQZB 1A6WL 1UWGH 5IFHL 2X7LA 1JPFA 2BC4B 3UEZA 2XZQL 4LKXA 4FP8H 5DFVD 2YPLE 4Y4HC 3GBNH 5E5UB 3QDJE 4G9DA 4MAUH 4NT6B 4X4XB 5DUBB 5BXFA 3DOSA 2DWDA 2J4WH 1X4XA 4HAFA 2YEZA 4GXUN 4TNWF 2R23B 2COQA 4KV5E 5EA0H 1WZMA 5FYKU 4HWBH 4EOWH 3OKNA 4ERSH 1KTKE 4WJ5B 1B6DA 3FRUB 5HVHB 3RWIA 3STZA 1SEQH 1PX4A 2Y7QA 3GUTA 3H3KA 1MLBA 5D1XA 4OI9A 3QNXA 3EFFB 2C7UA 5DQDH 2JJSA 3SDDB 2E3VA 5IGXL 3LKSA 3RVUD 1CGXA 4JFQA 1P9MC 4LQ1A 3Q2CA 4P46A 2PYED 2WBJB 4BKLB 2FH6A 4PJ8B 4FXGA 4L8DA 4PJBA 5DZNA 1A6VH 2G60L 3SE3A 1BOGA 2G5BB 43C9A 3PWPA 1H3TA 4PJAF 3ME0A 4WUUE 3TCLB 4PUBH 5BMFL 3KGRA 4WW2F 4ZUWA 1YPZB 5DMKB 4TQEH 5IR1B 2BSRB 1H15A 3D2UA 3S3JA 3U7YL 1A7PL 1YN6B 5L7XL 1RY7B 2FATL 5CJ8A 2VLKB 3BP7B 4K7PL 3I75A 1NMAH 5I1DB 1IAOA 4L3ED 1I7ZA 3VWKD 5IG7A 5IQ7L 2QHLA 2EEAA 5IHLB 1U8OB 3IRZA 2CDEA 3B6SA 1QSVA 4HBCH 4UNTA 3D3VB 5AWNL 5HGHB 3EO1B 1O5DT 3L7EA 1RZJH 4NC1C 3CVHA 2FBJL 1UT9A 2GJZB 4ZNEE 2AJUH 3G5ZA 4NKIL 2VLRD 5D2NA 3EYOB 4JFDB 3R0NA 4HCRH 3OXRA 3O4LA 5IMOB 3FB6A 3QNYA 1TVBB 4ZFOB 1CFSA 1LK3H 4S2SB 5IESL 1BBDH 3CDYA 2W0PA 1UZ8A 4LPVA 3BXNA 4G8GB 2EKSA 1YY9D 3STLA 5IUSA 1XF4A 3HUJF 3SO3B 1QLEL 1U91B 4DJMA 2I9LB 4N90D 4DZBB 3NIFE 5JW4Q 4LCUA 5I8KL 3AGVA 4Y5VA 4U1IA 1BREA 4PJAA 1P6FA 4P2OD 4DGVL 1WWWX 3H9HA 3HRZA 4WW2A 5CEZD 1YNLL 3IF1A 3HE7A 1K8IA 5ESVB 2XKNA 1JZ2A 1D5BA 4PGCB 1EFXD 5D93B 1Q9WB 1IEAA 1AHWB 2UZXB 1AXTH 3DRTB 2QJDA 4G80B 3FQXA 2OCFD 4WENB 4JQVA 1DQJA 4ZTOH 3HZMB 4Y88A 4PBXA 5C0CE 4HIXL 1NGQH 4Y4KB 3W9DB 3QFDB 2VZUA 4PJGF 1S5IH 1VFMA 1FFNA 1U2HA 5EH1A 4AENA 4RIRB 3MGTA 5J1TC 3B9KB 1CIDA 2MMXA 4QNPF 4TVPH 3MV11 5JHDE 1N6UA 3RWDA 4N0UA 2X5PA 2XRAL 4P59L 5C0AE 5EU6E 2MQ0A 2B20A 4NP4H 4PB0L 3ILPB 4KPHL 1AKJB 3VU2A 4M61A 5GRJL 1U8IA 3RAJH 5HYJE 5C6PB 4PJ9B 1K6QL 3KJ6H 5C92A 1ZLVH 3R1GL 3HUJA 5T3ZL 4L29B 1S5HB 3OG4B 4X4ME 4JO3H 1WT5A 1U3HD 2C9AA 2M8XA 3BZ4A 3PHQB 4F9PA 3NTCH 1U42A 3UXFA 5KJRH 3V79C 3CUPB 5K9QI 4WW1B 4TSBL 5INCA 4R0LC 4MJ5B 4GKZA 4LGSB 3ARBA 5AAMA 1ZLSH 2BVQB 3H9ZA 2GSIB 4X6DB 1YNKL 2CRZA 2MNUA 1RZGB 1E27B 4HX1A 3KDMA 3CFIC 3VXQB 4JB9H 1CT8B 3NFPB 5CLTA 5AD0A 1HQRA 1OD9A 4PJGA 1WBXA 4YAQB 3MTRA 4I18C 2D7TL 3AS0A 3FO2A 1JWUB 2FJFA 1G7LB 5E99L 1FPTL 3TBWA 1BAFL 1JRHL 3DX6B 3FRPA 1JGEA 3VGHA 2Q8AH 5DO2C 4R4FL 3AREA 2YUVA 3O11A 4OFDA 3V2AR 4YFEA 3PP3H 3O9WB 4XMKH 1SY6A 2FJGA 4JM2D 3O2DA 3RX7A 1HH6B 4U7MA 1E6JH 1F4XL 4I0PA 5DLML 3CD4A 2FD6L 1Z6JT 1KACB 5DD6B 4NJAL 1C5DA 5KSAB 4KV5F 3BRDA 4RFEA 4DUXA 1Y6KR 4M6MH 1JBJA 1D5ZB 3GMRB 4M02A 2EC9T 3PQYD 1XF2B 4X7SL 4DKFL 5B3JF 2AEIT 1UXWA 4I3GA 3UPRB 5GHWH 3HAEA 2B7DT 1F11B 4PB9H 4W6XB 1IC5L 2A77H 3MRHA 4O2EA 4A6YB 3DHJA 1UM5H 1FFRA 1KC5H 1T83A 5A2IH 1BQHB 1QSFB 4LMQI 4Y4FC 1X5ZA 4ZXBC 4UOW0 5C0BD 4X9IA 2CLRA 5FV1L 3RNQB 3LS4L 4ODVH 3ECBB 4JFEB 4U0RC 3FN0H 3QUXC 3RDTD 3KYOA 5ITFA 2C3WA 2GFBA 5CILH 2AV1B 4BQ6A 3EOAA 1JZ5A 4LGRB 2J8OA 4EI5A 5L0QB 3QIBA 3OXSA 3DUUA 3PDDA 3WN5A 3BUTA 2EDFA 1CD9B 3W5MA 2ADFL 4NM4L 3O81A 1MOEA 3UMTA 3TO4A 1IAII 5GGSB 3MLTA 5IT2H 2HJKB 4HZLB 1DL7H 1FG2B 3GI8L 5F7DB 5FB8B 4HUKB 4C55A 1JHLH 3QCVL 4Q0XH 6CGTA 1EZVX 3L3JA 4L8BA 4H1LB 4LSVL 1A7QL 3L95B 1MHCB 2IALA 3CC5B 4U4BA 4XXDA 2EDYA 2G75B 3OR6B 1S7UB 3RRQA 4MSWA 4B5EA 2FX7L 3REWA 1T3FA 5DJ2A 4PGEB 3D85D 2BSSB 3VFVB 1L6XA 2EDTA 3VXSB 1CG9B 3LPWA 4TUKL 5D8JL 4HZAA 4O4YH 5M95B 4UV7L 1XF3A 2GYSA 5I1GH 1X5GA 1S7VB 1A0QH 4GQ9L 1M7IB 2HTKD 4IIQC 4KU1A 1CGVA 4UQ2B 5D2LB 3TYGH 1U95B 5EU5A 4YXKL 5INDB 1MAMH 2R1WB 2CK0L 2B5IB 5A2JH 3ARPA 5L9DH 3ULVD 4PTTA 4XH2A 3TBYB 3H42H 2MWCA 5TQ2L 2Z4QB 3V0AC 1J0KA 1YEIH 4TPRL 4XP4L 1SEBB 3PV6B 1BM3H 1G9NL 1QR1A 4JPWH 3INUH 4YDVA 4YUEL 1V7NH 1OAZH 1JGUH 1OTUC 4QHMB 4JZJB 4XP6L 1NAKH 5D6CA 1MQKL 5C7XL 4FG6D 3BGFB 5IK3A 1TZHB 4YE4H 1A5FH 2XG4A 5GISL 2X05A 1XGRA 4U1KB 4DTGL 4K7PY 2CSPA 2R9HC 3VRLE 3HPLB 2LTQB 4POUB 4RMRA 4ZSOA 3ZYIA 5HI5C 1TNNA 5E2WL 1YMMA 2XTJD 3ZL4H 1WFNA 4GRMB 3TFKC 3MGAA 4UUJB 1EUTA 1LK2B 5C71A 4MS8D 4XAWH 1I1FB 2OR7A 2ZOKA 2DMBA 4ZAKC 1OAXL 4F58L 4CADA 4ODHH 4XBGA 2P42B 4N8PA 1EEYB 1JF5A 3V9FA 3T65A 2IAND 3OL2A 1FNEA 5ANMB 3CZFA 3QCTH 4V2BA 4NO2A 4G3YL 1I9JL 5EBGA 4DEPC 2X6MA 3ZLQC 2XY1A 4JN2B 3RZCC 1BOYA 1J10A 5JDSA 3OKDA 1MRCH 3FQTB 3G6JB 4MD5B 5KS9E 2QBWA 3GJFA 2EYRB 4Y5XB 1HKLH 1NFIB 4NNXA 4TNWK 1NDGA 2Y36H 1XGTA 5KN5B 3QXAB 1MRFH 3V52L 2HJLA 2ARJQ 3B9VA 5F70A 1A7RH 2X4SA 1M05A 2RGSA 1D6VH 4HS6B 3WNLA 1NGZB 5BS0B 1B0GA 4JRYA 3MXVL 4RZCB 3ZT7A 1I8IA 1CVSC 4EBQH 2C4FT 1YY8A 4C56E 1Q9LA 2EE3A 5EDXA 3T3ME 1OWRM 1T21B 1N0XH 2QADB 4HFUH 1C1EL 1U41A 1I7RA 3PGDB 3MUY1 3WJJA 4PJCE 1NFDA 2YPVL 4X99B 1FORH 1T04A 2R2HA 1LNUA 4HK0A 1MCDA 4FMFA 2NY2C 3BDYL 5TGBB 3MYZA 4PGDA 1Z5LB 2P44B 5DWUL 4HK3N 2VZ3A 4J4PC 1OAQL 4PJ5B 1T22B 3M1BA 5TE4L 1QSEB 4GW5A 2NCMA 2VDQH 4D9LH 2XWTB 3LEXB 1KIPA 4QRPD 3ZSTA 2EDWA 2VDKH 1OCWL 4IDJH 3WSQL 1NAMH 2AS5M 1B2WL 1UB5B 4B7IA 1GPOH 4GFTB 2VQ1B 1QBBA 5C8JB 4HIEA 1C5CL 5E8OB 3QYCA 4KMQA 1PW3A 4KJQD 5E5MA 4DZ8B 2B4CH 2OI9C 2JELL 1YC7A 5D1QC 4HEPG 4FZEL 4CVUA 4U1JB 2AEQL 3VFTB 1A21A 3CZJA 1DQTA 2PXYB 1ONQA 2QSCH 3AS2A 3QCUL 4R4ND 4XMPL 2R0KL 3VXRE 4MDIB 4PRAB 3V0WH 1E4JA 3G5XB 5KANG 3KLAB 2R29L 1T1WA 2LV4A 2XNAA 1INDH 4P2RB 5GRUL 1MAJA 1BJ8A 4QOKA 4J12A 4UU9A 1UKSA 1XCTB 1L7IL 3ILQD 4M8QA 3ULUC 1D6EA 3P3YA 5E9DB 4ODTL 3UTSB 3FO1A 5T3XH 4Y89A 3MBXH 2K3TA 3P30H 3P9WB 1BPVA 2N7AA 4J8RB 5C08D 5CIPA 2GUOB 1JPST 4D0BA 5LGKA 2JB5H 1CDJA 1CF8H 4XPBL 4GH7B 5ICXA 1S9XB 3TH2T 1T1ZA 4P5TA 3P9MA 5EZOL 5EOQL 3SDDD 1GH7A 2HLFD 3I02B 4E9LA 2ICWI 1NBQA 4Y1AB 3QDGE 3ZYOA 4X8XA 1UCBH 3QFJD 3B9AA 3BH8B 4NBYB 3I3BA 3DMMC 4QRSB 3IGAA 3UAJD 1ORQB 1T1XA 1EAPA 5CLWA 5IF0B 5HYQB 1BVKB 1C8PA 2P7TB 3WHE0 4LLQA 3QG6B 2GITA 4JKPL 1GC1C 5FO7A 2Y4SA 4U7KA 1P7QA 5DK3A 5GGUA 5DHVA 2VLKD 5I75B 2D9CA 1JHTB 3QR2A 3TEUA 3L3OA 1LQSR 1TCRB 5JW5B 4HPOH 3WS3B 4H88H 5FYLD 4FNLH 4Q97A 4XNXL 5C0DA 4KK6D 3BP4A 2HP4A 2JB6A 3P0VH 4XMLH 4AY0A 3QHTC 5C0RL 5GGVH 4YO0A 3P9LA 3QEQB 4HH9B 3O6FA 5JIIA 4L4TB 3KPRD 4U6TA 3VD5A 4PLNC 2DQIH 4DVBA 3JV6B 3UP1A 1OB1A 5GS0C 1BGXH 1YYML 3MRJB 3VGGA 1IQDA 1LP9E 5TDPB 3UBXI 5GGRB 1NCUA 4LRNL 5E2VL 2MTPA 3RL1B 1A3RL 4G8GD 2ATKB 4NKDA 5DD3L 2O5XL 3QZWG 1WSST 4XP1L 1K4DA 3S36X 3TC9A 5IW6A 3B8YA 1AE6H 4M1DH 1A7OL 1MF2L 3ARGB 1QNZH 1I3UA 1NSNH 2X4QB 4NQCE 2NR6C 3L3DA 3K4DA 2WWKT 5C0ND 1BVLA 2GJ6A 1A6TA 1BWMA 2OS7A 4E0RA 4OLUL 1HINL 5CINL 5D7SL 4I0KA 4Z7VE 3QPXH 4LKXB 2BXZA 3C8HA 4NRXB 5D96C 1DBKL 4G42A 4G9DB 2OMBA 3R8BB 4Y4KD 5EZJA 5ICYA 5BXFB 2DWDB 3FAXA 2YEZB 4FXLA 5I0DA 3B9KD 3FFCD 1AD9A 5D70L 3WLWC 2GIYA 1E4XI 3L5WA 3EJZD 1F4YL 4EUPA 3LQAC 3OKNB 4OUUA 3MUGA 2DLGA 1CXIA 2B1HH 3HI6H 3OGCA 4ZDHA 3N85L 3RWIB 3T3MF 4IOIA 2Y7QB 3N9GH 1WK0A 3GUTB 5TE6H 1X44A 3F8UB 4PJ9D 1MLBB 2NY6B 2NY4D 4NCDA 4CMHC 1I9RL 4G6JH 5D1XB 5GJTL 3QIWA 3QNXB 3BAEH 2VLLA 2C7UB 4NUGH 1QYGL 4AEHL 5JNYA 4PLKC 2ZCHL 3PL6C 1SM3L 5DMGD 5L88L 1AJ7L 2R0WH 4GO6B 4JFQB 3MRGA 4P46B 4MAYD 4PRBB 3VI3E 4FXGB 4PJBB 4XBEH 1BOGB 2WIIA 2X70A 2XKSA 2A6DA 1RZKC 3SJVD 1V7ML 4JM4H 4ZD3L 2DQEL 4P4RA 2VUYA 2XA8L 3VW3H 1H15B 3D2UB 5JOPD 2QTEA 1BVZA 1CDBA 1JF6A 4OCWH 5DFVC 5KSVA 3I75B 2KZWA 4RRPG 4V1DA 2D7OA 1IAOB 3X3FH 4F7PA 1I7ZB 3S7GA 4GMTL 2J6EL 2OP4H 1FIGH 2ADGA 3OKEA 4OM1H 5E00A 5JPMB 3QUKA 1URLA 3KPOA 1W0WB 4G7YH 2GK0A 2CDEB 4GG6E 3B6SB 3PDGA 4ONOA 4FQLH 3O9WD 3NGBB 5C86A 3L7EB 5FHAL 1LEGA 3GRWA 3O0RL 1Y6MR 1HI6A 2NX5D 3K8LA 4QXTA 3G5ZB 3RZWA 4I48A 5D2NB 1QEWB 4FQXC 3OXRB 3O4LB 5KSAD 3FB6B 1KBGH 3QNYB 4G9FE 2VR5A 1CFSB 2P5EE 4HXBL 1I8MA 3VWJD 2I60L 1UZ8B 2ITCA 3BXNB 4QEGA 2EKSB 4IMLA 3OTTA 1F2XK 4WFFE 4Y5VB 1P9MA 4PJAB 2WUCL 3RA7L 3K2UL 3O4OC 1U8QA 3EGSA 5DVOA 4TSCL 3H9HB 3HRZB 4WW2B 3IF1B 3HE7B 1K8IB 4PJ7F 4ZUUB 5I1EL 2XKNB 3SEPA 4YNYA 1D5BB 1QSFD 4MCZA 3IJYA 4GRWF 5IEKA 1FRGL 1IEAB 5JW3L 1S7XB 3FQXB 5LGHH 2DTSA 2HA1A 2Y5TA 5LBSH 1DQJB 3RPIA 4XVJL 3LEYL 4NJ9H 4XPAH 3VXUD 2DQUH 3I50H 2A38A 3NA4A 3H9SE 5TJWK 1R3JA 1FFNB 4AENB 2D31A 1S9VA 3D5OF 3MA9H 3MGTB 1IC4H 3NZHL 4XB7A 4LU5L 4U0QB 5D9SA 3T0AA 5A43C 3RWDB 4N0UB 5FOJA 1IGMH 2H32H 4U6HA 4BZ2L 1XH3A 2R1XB 1T03L 5JR1L 4LDEB 3PNWA 3SKJH 4EKXA 3CLEL 3GNMH 4M61B 4RQQA 1U8IB 3Q3GA 4ZPTA 4KZEH 4XNUH 4LCCC 1JYNA 2ZSVA 5E24E 3NH7L 3HUJB 1JZ6A 3ULUL 1VEOA 4X7TA 3OAUL 3FZUD 5GRXG 5SWSB 3BZ4B 5E0QA 1SJHA 1VFBA 4OM0L 4PJ7A 2BNQB 5HHME 2NXYD 5INCB 1LP9F 4ZO8A 3WXWL 3ARBB 3SDCD 4UT6H 1P84K 2IBBA 3W5NA 4FQCH 4YGVA 3DVNB 2E27L 2FLBT 4HX1B 3KDMB 4HLZG 3UC0L 5AD0B 5CEYA 5ALBL 3SE8L 1HQRB 4MJIA 1K2DA 4MNQA 4OJFL 4PJGB 1WBXB 1ADQA 3DUSA 4WFEE 5DD0L 5FGCB 3T1WA 1L6ZA 3GSQA 2FJFB 4IRJD 1I3VA 2W9LA 1J1OH 5IHBA 3WDIA 1EHNA 5CJQL 4KJWD 4RBPK 1JGEB 4JPVL 3MCLL 4KUCF 5FAAA 4E41A 3AREB 7FABL 3O11B 4Q9CA 4M7KL 1G7PA 2FJGB 2RCSL 1RZJC 2BMKA 3FO0H 4HXAH 1ZHKA 4I0PB 5HHOD 3S37L 1P5UA 1I1RA 1U8PA 1TXKA 2A1WH 2WBWB 1C5DB 1X5AA 2CLZB 2C1OA 4DGYL 1A4KA 4RFEB 3A0OA 2L7JA 5TPWL 4BJLA 1BQSA 3VXPA 3FB7A 2YRLA 1I3RA 1YNTA 2UV3A 3HAEB 5TF1L 1ROWA 4YXHH 3MRHB 3G6AA 2NY1D 3QXDA 4R0LA 5GS0L 1AO7A 3QQ3A 5DZOA 4UTBL 2W65A 1AFVH 2HFGL 1S9WA 5DS8A 4L4VA 4HC1A 3VI3F 2CLRB 5IFAL 4KMTH 2BOCA 1GHFL 2GQHA 2VB5A 4G5ZL 2O5ZH 2IQAA 4I18A 1EGJH 5ITFB 2GFBB 3I9GH 1A7NL 3BESR 1WWAX 3EOAB 4WTZG 4Y8DC 5ERWA 3BD3A 5CMAB 4EI5B 1BIHA 3AS1A 1FYTE 3QIBB 3TN0D 3R4DA 3DUUB 1U8HA 1YEHL 3ZKXB 5MI0B 2H2SD 4NO0A 5FECA 1PKQE 3GSOB 3ARVA 3I2CL 4XXCC 1J1XL 3TO4B 1R3HA 3IFLL 5I15H 3MLTB 5DD1L 1MWAL 1YJDH 2SEBA 3DECA 1UQSA 4HWEH 5BS0D 2HT2C 3JWNC 3L3JB 2EE6A 4ZUVA 4L8BB 1D9KD 2ADJA 5HYSG 1N4XL 3GK8H 1FNLA 5TF0A 3IFOB 4RISL 4Z0XA 1ITBB 2UZYB 2IALB 3U36A 2EC8A 5I2IA 5HI4D 4XXDB 1HNFA 4HW6A 4MSWB 2QADD 3T77B 5CJXC 1L0QA 4PIRF 3REWB 2E8YA 1T3FB 4Z78A 5LQBL 4M7JL 5B22A 3UJIH 1HNGA 2BSED 3WIHL 2BVTA 1KEGL 4MVBD 1QHPA 1XF3B 4OZHF 3VD7A 1QSED 1QLRA 3MLYL 4Y4FA 1KT2A 3DI2B 4W4OC 4ZXBA 5I73B 1D7FA 5CWSA 1U8JA 4NUJA 4PRPD 1BFVH 5EU5B 4X9HA 3RDTC 4ODUA 1UG9A 2VLJE 3QUXA 4PTTB 1LO2L 4LLUB 2EYSA 4WCYL 3GSVA 3BIKA 1IC7H 1MCFA 5HVWA 1QR1B 5DJYA 3FQUA 4DVRL 3DV4B 4YDVB 5EB9A 4KROB 1ZT1B 4LNRA 1CXEA 3MRBA 1FL3B 2PF6A 4MXWH 4ODSH 3V5DA 1IM9B 4I2XE 4JFZH 5I74C 5IK3B 1P4BL 2GTWA 4KY1L 1F90L 3UZEA 1XGRB 1GSMA 2LAAA 3G5YA 4OFIA 1KJ2H 3REVA 3GIVA 1GIGL 1JGLL 2YRPA 4WUKL 5ID0A 3RIFF 3QWRD 1ACYH 4K3DH 3ZE0E 1LO5A 1RULH 2FO4A 4HHAA 3TV3H 3K80A 5F93C 2DQDH 2BSTA 4ZSOB 1WUNT 1YMMB 1MFCL 4RFNC 4HG4K 4WI9A 1LDPL 5F89B 2MOVA 3AMKA 2AI0L 2ORBH 2ZOKB 3WHXA 4OZHA 4OZGF 3OKOA 3MNVA 4CADB 1TTGA 2BY2A 3IJHA 3QIUC 1KN4L 3K81A 3ROLA 2LABA 3T65B 2R0ZL 4KI5E 4KHTL 5FO9A 1U3JA 2AJXH 1FNEB 1RV6X 3CZFB 3IU4H 4M5ZH 4NO2B 4NQED 2DI8A 4IIQA 4Q58C 5EOCJ 2P8PA 4OCMC 1KTDA 5DTFA 4Y1AD 1VADA 3EOTL 5JDSB 3OKDB 3FO9A 3O6KL 1RMFH 3VXMA 2BDNH 1M71B 25C8H 3BZFA 1UWGL 1I9IL 4NQXA 3O8XD 2VL5A 3VG9B 3GJFB 5KVEH 4PJEE 2CUMA 3BIAX 4FP8L 3MR9B 4NNXB 1N6QH 1NDGB 3WD5H 1XGTB 5B38A 2DQHL 1F6LL 2HJLB 2Z8VC 4MAUL 2CIKA 4WHTA 5DK0A 3GKWL 4LASH 2UY7A 2X4SB 1JTOA 5I18L 4WEMB 4FG6C 4JRYB 5J89A 5CZVH 1WIUA 3C5JA 2Z92A 1G6RL 5EA0L 1YY8B 1Q9LB 4HDIA 5KVGH 1EXUA 4HWBL 4OT1H 4KQ3H 2F53E 2XXCB 4EOWL 4ERSL 1CFVH 3JZ7A 5C2BH 1WF5A 3HRPA 3G08A 4OZGA 2H26B 1BECA 1SEQL 1T04B 3OWEA 2R2HB 4KRLB 4PGDB 1WZ1L 2VO5A 1MY5A 4ZAKA 3RKDD 3M1BB 3BVNB 3CLFH 4LIQH 4JRXE 1EAJA 1KG0A 3VFWA 2E9WA 4N0YH 4ZPVA 4KRMB 1KIPB 3LDBC 4DAGH 1WV7T 3S96A 3OB0K 1A6VL 1T80A 4HIEB 4MJ2A 2X4OA 5C9KA 5E8NA 4PUBL 1MIMH 4YX2H 5DUMH 4OZ4A 3RZCA 2DKSA 4P5MA 5KW9H 4P23B 3CMGA 3W82A 1OP5H 1U2CA 2J6EA 3QISA 1RJCA 1CGSH 1Z9OA 1NMAL 4IRZH 3V5KB 3D25B 4FFZH 4OTXL 2HRPL 2VAJA 3PGCA 3CH1A 5EIIA 3EOYG 2IADA 4QOKB 3E3QC 1NCWH 4HBCL 1LEIA 4YBLB 4PY8I 2HFEA 1T7YA 1C5BH 4R7DA 4IJ3B 3B43A 3C8KA 1D6EB 5CJBA 1BFSA 2RFXA 3IXTB 1Z2KA 3FO1B 1G9MC 4ZMAT 4HCRL 3NCCB 3ULUF 4R9HA 2EEDA 5CIPB 2JCCE 3U0PB 1LK3L 4ZO9A 3QEHA 4J4PA 4POZC 5D1XD 4TTDD 5ICXB 2ZOLA 2EDQA 1T1ZB 2Q76A 4P9HC 4P5TB 3P9MB 5F7YC 5D7LA 1BQHG 4OGAD 4AH2A 2PYEE 1JIBA 1FO0L 2XXMB 4P46D 4TRPH 1UZ6E 5HVFB 5T1MA 4X6FA 1CLZH 5F9AC 2WM0A 1KLFA 4Y5YC 2FHFA 3PWPD 3V6ZA 3VDCA 3IGAB 1T1XB 1WWCA 1JYVA 1EAPB 3IETA 2UYLA 2QKIA 5L6YH 4GMSH 4LLQB 5D1QA 2GITB 3DURB 3UTZA 4X5LA 5BVPH 5FO7B 1NGQL 3EDDA 4HV8A 3X12B 4L5FH 4RMTA 2KBGA 1P7QB 2PR4H 4GKNA 1DUYA 5DHVB 4R4NC 2KQNA 1JL8A 4L3EE 3W39A 2F8XC 2MJWA 3L3OB 1ETZA 3QQ4A 2OTPA 4TVPL 5IHUH 4PJDF 2JE8A 2BERA 3OGOE 3ILQC 5I1LA 5C0DB 3BP4B 4QT5A 4H1LG 1TQCC 4PLJD 5E94A 1AI1H 3D39D 4XNZC 5DRXA 4YO0B 1ZHNA 3P9LB 5ACZA 3TF7C 5CEXA 3T0VA 5BQ7A 3O6FB 1GGBH 2VLRE 2NY3B 3ZE0F 4C4KT 2AEPH 2LQRA 4DVBB 1W0VA 3DLQR 4QXGH 5EWIL 5L8JB 3JTTA 4JO3L 3ZT6A 1KYOJ 4K9EC 3RBSA 3NTCL 2AJVL 3JV0A 5KJRL 4BSJA 2HLFC 4N90E 4NKDB 5IW6B 3WMSA 3N1MC 4W4NA 5CEZE 4MGXA 5H35A 1IGCH 4JLRA 5C6TH 3L3DB 3UAJC 4PRIA 4JB9L 4GLRH 1BVLB 5TFSL 1A6TB 3NCYP 3NIDF 3DMMA 4GXVL 4K3HA 4NNPL 3PWVA 5JQ6L 4LSQL 1CBVH 5FOBA 1KPUA 4XWOD 4Y2OA 2PYFA 1MREH 5BV7L 4QLRA 1YECH 3NABL 3W9EA 4PJDA 1TZIA 5EZJB 3DRQA 4B53A 4NZJA 4HT1H 4XI5C 5K9QG 4V2CB 4WI4A 3HFMH 4XMKL 4MJ4A 1E6JL 3TH3T 3GB7B 2XWJA 3MZTA 4KK6C 5T33L 1AD9B 5J3HD 4HWNA 4MA3A 1QFWH 5F9WC 4EUPB 2NY0B 3EDEA 4OUUB 3MUGB 4QGYA 4P2QD 4PS4H 3OGCB 4MJ6B 4ZDHB 3LKRA 3CVIH 5CZXD 1NMCC 5DFWH 3QIWB 1FFOB 1MRDH 2VLLB 5GHWL 5JNYB 5F7MC 3S8WA 5F88A 3O3DA 1YZZA 2CQVA 3T2NL 3U2SB 3MRGB 1HDMA 4M5YL 3A6BH 2AK4D 2B2XH 1FBIH 2RAMA 2WIIB 4KQ4L 2KQMA 2V7NB 3ARBD 2D4FA 2A6DB 5C9JB 1ND0A 3IDXH 4KAQL 3JV4A 5C0NC 2VXVH 4APQC 4F15C 4P4RB 4N8VA 4NQDB 5FDYA 2OM5A 1P84J 4RA3A 4NQUA 1TJGL 3PWJA 4S1SH 3ULVL 4WI3A 5E7BA 3JVGC 5IMMA 4HUXA 3FTGA 4Z7NF 1ZE3C 4V1DB 2ENSA 1R3KA 1MWAA 4GG8B 4F7PB 3TIDB 3O6LL 4OIBA 5IKCA 3OKEB 2ADGB 4GRLB 5E00B 1X5HA 5EZIH 3QUKB 2Y6SC 3HC4H 1AC0A 2GK0B 5F9OH 4MCYA 1AGFA 3ZKMC 2WWKO 1HXMA 4C56B 4LAQH 3HNSL 4RMQA 4I0PD 1HI6B 1JHLL 5HHVH 4ZFZB 2IMNA 2YA0A 5DJ6A 4RFOH 4YLQT 4I48B 2J2ZA 1Q9KA 2NY4C 2CD0A 3PQYE 1IGTB 4PJHF 5SX4H 1NCNA 1I8MB 2ITCB 2FEEL 5F7WC 4BM7A 5IQ9A 1HE7A 5GS1C 3VXNB 4IMLB 2JCCF 3PL6A 2DLFH 3ESUF 4J3WA 4XWGL 3EGSB 4FN0A 4G6FD 1OQXA 4YNYB 4QWWD 4MCZB 2Y9RT 5FV2A 1DTUA 5IEKB 1P2CA 2VZOA 4K7FA 4M8VA 3MRLA 2CO7B 3BPLB 2MCG1 3UYPA 3RPIB 2DYPA 3O3AA 4F33A 1BM3L 4XTRD 1R3JB 4JPWL 5GZOC 2D31B 4EI5D 1S9VB 2P24A 1OGAB 3L5HA 1JGUL 3WIIH 5D9SB 4YZFE 4XRCA 1RJLA 3BKJH 4HKZA 2N56A 3NCYS 4U6HB 1HK6A 5D5ME 1A1NB 1IAMA 2R4RL 5E6IC 5E8EA 3PNWB 3L3HA 1AGBA 3AU1B 4YE4L 1A5FL 3MRKA 4RQQB 1FL5A 2BNRE 4PJHA 3Q3GB 1MI5D 3UYRH 4FQXA 2ZSVB 2UVFA 4DQOH 2EDOA 1CDYA 5KVFL 4JAMB 4X7TB 3VWJC 1N5AA 2CDFA 2A74A 4OZFH 1LD9A 2H8PA 2Q87A 1G9ML 3GSNA 3T3PF 1VFBB 2J8HA 3IDGA 4PJ7B 5LCVH 1T7ZA 4DCQA 1HQ4A 1N59A 4GRWB 5J13C 4LCIL 4J2XA 4AL8H 5A16A 1LO0H 1NEZA 5FM8A 1CTNA 4P9HL 3BWAB 4D8PB 2A6KB 2JTDA 4HJ0C 3QCTL 4WHCA 3CX5K 4MJIB 5FM5M 1K2DB 4MNQB 5I1AA 3DUSB 5EU3A 1U8KA 1ZLUH 3ULVE 3U46A 4EXKA 1T7XA 2HTLD 5JDJA 2ESVD 3HMXH 1MRCL 4UIKL 3KXFE 1U8LB 2XQYG 2EE9A 4F9LC 3THMH 1N7MH 2VUOA 1QVOA 3OPZL 3KG5A 3IXAA 4JQIH 1G7PB 2FJHA 3BGMA 4LEXL 2JIXA 3WFDL 2BMKB 1DANT 1DN2A 4KROD 4OZIF 1A7RL 4HWBA 1ZHKB 1D6VL 1BF2A 3BN9D 4OIAA 3B2VL 1U8PB 4EBQL 5EU7E 2WUBH 1JHKH 2NMSA 4ZS6D 3ULSB 4JFXB 1A4KB 4NHCH 3FQRA 2CR6A 5C09D 3AY4C 4LCCA 2XTJE 3VXPB 3FB7B 1GRWA 5C0FB 4BH8A 2H45A 1I3RB 1YNTB 4JR9H 1FORL 5SX5H 3G6AB 3P0GB 4HPYH 2NXYC 5CD5D 4WDIB 4ORZC 3AXLA 3QXDB 2X4PA 3H2WA 4HG4J 3RUGE 1AO7B 4D9LL 3GM8A 3BKML 4K9EL 1FIEA 4P48A 1MFEH 2W65B 1AXIB 3RWHB 1SBSH 5F3HB 1S9WB 1H3XA 2NYYC 4L4VB 4IDJL 1NAML 4OQ1A 4WHYH 5CP7B 3BI9X 4FQJH 4NCC1 4IRJC 4I18B 4ELME 1XIWB 4KJWC 3HR5A 4JFOA 3JSSA 3IDJA 5D7IE 1U8HB 5IB3A 4OZIA 4NO0B 5EU4A 2XKUA 4QKXB 1HH9A 2QSCL 4P2YA 5FECB 3OAZH 3JWDH 4LSSH 2ENYA 2Q3AA 1A22B 3EO9H 3MJ9H 3V0WL 2OK0H 2YN3A 2A73A 1INDL 3KPMA 1UQSB 4XGZA 4JM2F 4HCRA 4ZUVB 1SYSB 4X9BA 2ADJB 3TYFA 1NC4D 4ALAH 4YHPA 4BQCA 4YHZH 4Z0XB 2KZ1B 2CH8A 1INEL 5I2IB 3C6SA 1JFQH 5T3XL 3X3GH 3MBXL 5IV2A 4ENED 2R1YA 3P30L 4EDWL 5I17B 5GQBA 3D9AL 1DLHA 4DN3H 3B2UD 4Z78B 1JNNL 1WAAA 4LKCA 2JB5L 3CXDH 2NY1C 1FO0A 1EJOL 2Z91A 1CF8L 3QXVA 3V8OA 4OGXL 1FFQA 5F9JA 1DSFH 5IVZB 2BHUA 3VMPA 5F8QC 3S35L 4AEEA 4J3TA 4XZUB 1QLRB 3CDFA 3I85A 4Y4FB 4QRPE 1KT2B 4OCLC 4ZXBB 2I24N 3JWOH 3C5ZD 1U8JB 4NUJB 3FKUS 3KNBA 3KLHC 4U0RB 4ODUB 4PREA 3QUXB 1UCBL 4U1NB 5FYKH 3MODH 2EYSB 3GSVB 5HJ3A 1ES0A 3LV3B 3K8MA 5DJYB 3FQUB 1MIEH 2H2SC 1JZ4A 1J7VR 2AQ2A 2JJVA 5HHXH 4AEIL 5EUOA 4LQFH 4LNRB 3NOIA 4Y19A 1IEHA 3QI9B 3VFPA 5AG8A 1KCUL 1EERB 2EC9U 2VH5L 2W0LA 4XXCA 1IE5A 3VXTA 3V5DB 3C08H 5I8EA 1F3DJ 3CSGA 4GAGH 3H0TA 4YBQC 5FF6A 3IFNL 1KCKA 2XPGB 5GSRA 3G5YB 4FNLL 3LZFL 1D9KC 3ARDB 1ZEAH 3GIVB 4FQIL 4W6YB 5ID0B 2A83A 2R56H 5KSBF 1KIRA 1LO5B 2FO4B 3P0VL 4HHAB 4XMLL 5A2KH 2BSTB 5GGVL 4G9FB 4MXQD 3GJEA 4OFPA 2ATPB 2HH0H 4YPJA 5TDNA 1FNSH 4R6UA 5CJXA 4PRHA 2DQIL 1FSKC 3WHXB 4OZHB 1BGXL 3Q1SH 3OKOB 3MNVB 4JQXC 3IJHB 1A6UL 2Y23A 5DHXB 2V2TB 5F3BA 3ROLB 4NZUL 1AXSA 2YK1L 5FO9B 1M6OB 4Y0GA 3ZDZE 4P5TD 1P4LA 3R06A 5I9QB 1R5VB 3KYKH 5C0BA 4W4OA 4C83B 3W11C 3QG7H 2JKXA 4IIQB 4WVRA 1AE6L 2P8PB 4AZ8A 1RZ8A 3P77B 4XC3H 1KTDB 3RDTA 1NSNL 2GEEA 3QFJE 1VADB 3SBWC 3FO9B 3SO5A 1IT9H 2QR0A 4A6YH 3BKYH 3VXMB 3Q6GL 1MJ8L 2OSLA 4JO4H 4NYLA 3ULVF 3BZFB 1YPZE 4C58B 3C2SA 1X5XA 4NQXB 2VL5B 3AFLA 1PSKH 1K3IA 2L4OA 5B38B 1YJDC 2VLKE 4M6OH 3UBXG 1HHGA 2CIKB 4WHTB 3B8SA 1CFTA 5DK0B 3IDMA 1YQ2A 3HG1D 5KSBA 4DUWA 1PLGH 3CFEA 1CXKA 3GSXA 4JANB 5FYLE 1H9VA 3C5JB 5GRWA 2Z92B 4F3FA 1FAKT 1PG7W 4HDIB 2KPNA 1CFNA 4JG1H 4XC1H 1EXUB 2HT3D 2ZPKL 3D3VE 4J3VA 3IB4A 2HMID 3FHAA 4HJJH 2B1HL 3G08B 4OZGB 4ZFGL 2Z8SA 2UWEF 3KPRE 5TE6L 4JFDE 4AEFA 4ZAKB 1Z9SA 5SV4A 5JOFA 4NUGL 1KG0B 3VFWB 3QIUA 4RGNC 4EIGB 4LHJB 4LCWD 3TWCL 4PG9A 4ZPVB 2Y07H 4G8GE 2CJUH 2BCKA 5CGYD 5F44A 1J87A 3X13A 3DVGA 3S96B 2VZ1A 1HKFA 3C09C 4XBEL 5FYJD 5HYIA 4E5XA 4PP1C 3FFDA 4DEPB 4HIHA 5J56B 4R26H 5E8NB 2DTML 1H0DA 2CXGA 4OZ4B 2R8SH 3RZCB 4P5MB 3NFSH 3ETBF 2GJ6D 2HKFH 3K3QA 2OXHA 1KB5H 3TBSB 4K71C 3FRPG 2E9BA 4K55A 5EULV 1UM4H 1MUJA 3FN3A 4OCWL 5BVJA 1OPGH 4HWZA 4FTVB 1T5XA 3HZVB 2H41A 4LPWA 4LPTA 1JPGA 1CU4L 2OP4L 1FIGL 4OM1L 1JJUA 5BZWA 3CH1B 4G7YL 4G8EA 5EIIB 5JA9A 4X6CF 3T1FA 2P47B 3FFCE 1WIPA 2LU7A 4KTDL 1LEIB 2CKBH 2AJ3B 2HFEB 3B9EA 3QB7C 4LPYA 4R97C 4R7DB 3DWTA 3C8KB 3KVQA 2UWEA 5F6HI 15C8L 1E0OB 3MLUH 2RFXB 4OCSH 2DB8A 2NY0D 5DRWA 1NL0H 4JCLA 2V7HA 4MZ3A 2C3VA 3HAEG 1W8OA 4O00A 3RI5F 2K9UA 4OBRA 2YA1A 3QEHB 5B8CC 1RI8A 2V9TA 2Q76B 1R3LA 4BZ1L 2IANA 4K94H 4GAYA 5FYKE 3BRGC 4KZDL 3BWUC 4AH2B 1JI2A 2R2EA 1KJMA 5DI8A 1D5XB 3U9UA 3V6OC 1TLKA 5MERA 5T1MB 4X6FB 4OI7A 2PTVA 1NCDH 2V17H 2QQLH 4X6DE 3V6ZB 3TPUA 3UJJL 2NZ9C 9CGTA 2UYLB 2QKIB 1QBLH 4ONHB 1M1SA 3RVTD 1VESA 1W72L 5JOPE 5AEAA 5D1QB 3UTZB 1MCOH 2C4FU 4M1CC 4XPAL 3OJVC 5HSFA 2DQUL 3IKKA 2OZ4L 5ADPH 2X4RA 1DUYB 3RTQC 4X6CA 3WXVH 1RHHB 3IDNB 4Y4HD 2BVYA 2EICA 1IC4L 4CJ1A 3VRIA 1ETZB 3QQ4B 3CFDB 3CFJA 1UYWL 5ECJE 1CK0H 3VI4F 1IGML 3FCTA 4HKJA 4YHMH 4Z9KB 5I1LB 3HC3H 2PCPA 3SKJL 5DRXB 1ZHNB 5ACZB 2D4DA 5DYOB 5CEXB 4N8CH 1P1ZA 4KZEL 5B39A 4XNUL 2NY5H 2V2WA 2CKNA 1YA5A 2VXUL 3K1KC 1NGWB 4MQSB 4KC3B 1W0VB 3ZTJG 1MCQA 3MRFA 4HH8A 1RVFH 2CXKA 4KVCH 1MFNA 4QXUL 3C2AH 4LDOB 5I76A 2OR9H 1DEEA 4WU7B 4M1GH 1RIVH 4UT6L 4NDMA 5FHBH 3P2TA 4XP5H 5DHYA 3ZDZF 4FQCL 3U7WL 4KFZC 1QSFE 4JLRB 4YHOL 2WLZA 1GVIA 4PRIB 4Y5YA 2LVCA 3TZVC 1A3LL 3DMMB 1WTLA 2QHRH 3PWVB 5FOBB 4UB0H 3UTTD 3MV9A 1KPUB 5F21B 1I1AC 4JFEE 2PYFB 2V5MA 1H3PL 1J1OL 4WO4D 5I1IL 5E6ZA 2D3VA 3W9EB 4PJDB 3TBTA 4TTGA 1TZIB 3DRQB 4FABL 5JORA 3G5VA 4YHLH 2ARJB 3BO8A 3A6CH 3MLPA 1K8DA 1F8TH 2B0SL 3EZ8A 4GW1A 3SDYH 2MHAA 2CIIB 2XWJB 1GOGA 4PLJC 1CICC 1UH2A 1GXEA 5HBBA 4IOSD 1FCCA 5DURB 1U36A 4CGTA 3LKRB 1JGDA 4QTIL 3CPLA 3QUML 1HYRC 1KCLA 4MQ7A 5C08A 3BISA 3VA2C 4Y8AA 3U9PL 4BZYA 4H5SB 3KPSD 3TIEA 5KZCB 3SCMC 5CSZB 3O3DB 1EEZB 4PJXF 4YXHL 2BVOB 3BPOC 5J11B 3TESA 3GDBA 1YEFH 3T4YB 4L9LA 5GGVY 1NAMA 3LRHA 5IW3A 1KXQE 1HDMB 1CDUA 3BMWA 1QLFA 4LVEA 4IMKC 3VXSE 1MJUH 4RAVA 4FQQA 3CDCA 1AFVL 1ND0B 5IB5A 3WO4C 2VXSH 1OP3K 5LKNA 1RIUH 1IAIL 3VD9A 1JZ7A 1KPRA 2O5ZL 4MJID 4QCIA 1IILE 3PWJB 1OAUH 5IMMB 4WI2A 3FTGB 3CX5J 5D96B 1R3KB 1MWAB 5AZ2L 4Q74A 5IKCB 3IDYC 1T5WA 4E41D 4MCYB 1AGFB 3V8CA 4EN3B 1ZT7A 1HXMB 1UWEH 5HHOE 1YJDL 1DBML 5D72H 3BP6A 4OD3H 5JA8B 2F53B 3NFNA 4HWEL 2PO6C 2IPUG 5DJ6B 1PEZA 3HE6D 1LEKA 3GK8L 5GGQH 1Q9KB 3S6CA 1F58H 3N1FC 4PJXA 1K4CA 1MCHA 2KUTA 4PP2A 4PTUA 2RIKA 3VFUA 5DGRA 5IQ9B 2L7UA 4DKEL 1RAMA 1AIFA 1WFUA 2H9GA 2HT4D 3PL6B 4WTXA 1OT2A 2DBJA 4S1QL 1OGTA 1R5IB 4ELKA 4R90H 3NA9L 1ZXQA 1F5WA 2YPKA 1OT1A 2NY7L 1NCCL 3N06B 4XVSH 2YWYA 3U82B 5ANME 1P2CB 4K7FB 2DM3A 2VC2H 1BFVL 4APQA 3RWCA 2VXTH 2HVKA 1AGDB 2DYPB 3O3AB 4JDTH 3O3BA 3F58H 4RMSA 3WEXA 5FFLA 1IC7L 4F33B 4Q9RH 3JVGA 4IDLA 1WCBA 2HVJA 3L5JA 3H3BC 2P24B 2GTZB 2IFGA 2IGFH 1ZTXH 3G6JE 4XRCB 1J0JA 1KLGA 2OQJA 2KDGA 4JGMA 5DO2D 1X5IA 4ODSL 3WFCH 3CDGA 4O58H 5E8EB 2FGWH 3L3HB 4K3JL 1DBJL 2IQ9H 1AGBB 1FHGA 3MRKB 4WV1C 1FL5B 5BS0E 4KDTC 3S34H 1MEXH 1DDHA 3ISWA 4PJHB 1KFAL 4LMQE 1WTGT 4KMLB 4JHAH 3TV3L 2DQDL 1EBAA 1RK1A 5EO9A 4EQ2A 2YBRA 1FN4A 3K8KA 1H5BC 4LARL 4NFBA 2JCCB 2ZUSA 2A74B 1LD9B 2LE9A 3PIQA 1ORSA 4Z0BH 1YQVH 5F9DC 3S3PA 1S78D 4LPUA 5EORL 1SJEB 4RA0C 5GS1A 3OKMA 1HQ4B 1N59B 1U93A 2AQ3A 1Q9OB 3O4OB 1F97A 2OJZH 4QHLA 5A16B 1NEZB 1MLCB 1QSEE 3IU4L 2X4TA 3SJVA 4M5ZL 5ISZA 1RURH 3BH9A 4PRPE 3GMLA 2HN7A 1LO4H 4F7TA 5I1AB 4DN4L 4UTAL 5EU3B 3F7PC 1U8KB 3U46B 4Z8FH 1BJ1J 3QUXD 3T0ED 1XZ0A 4FZ8H 3I6KB 2YXFA 1R24A 2BDNL 3NBNA 25C8L 3DUHA 4L3EB 5KVEL 5L2JA 3MLSH 1IQWH 5AYUH 2E6PA 5JTWA 1G6RB 1IGYA 1J88A 2FJHB 3BGMB 3HZKB 2JIXB 1J5OH 3SQBA 4WNQA 1T66D 4D3CH 4ODBD 5E6IA 3BEWA 2NX5A 5DDHA 3MOQA 2PUQT 3LAFA 2IWGA 1RZ7H 3FQRB 3CU1A 2Y06H 4MLSA 2AKRA 4X5WA 5KVGL 4P99A 3U4BL 3JXAA 1A2YA 4LCCB 2I9TB 3FONA 2UZIH 1CFVL 5C2BL 1CXHA 4NWTL 4BH8B 4OB5H 4UT7L 5E9DE 3VWJA 1YDPA 3UTSE 4O9HH 3SE9H 3VGEA 3CLFL 5DD5H 2PTTA 4LIQL 4HUNB 5DA0B 3AXLB 2PTUA 4P2OB 4DKAA 1LO3L 3GMNA 3WL9B 5MEND 3E1F1 2AW2A 1EFXB 2AABL 3CFBA 2YWZA 5CBEA 3GBML 2FR4A 3U1SH 1UJ3C 4A2LA 3AAZA 2VDRH 3LS5L 4Y1AE 5DUML 1IKNC 2DI9A 3VXUA 4WFHD 3SN6N 2IJ0C 3HR5B 4JFOB 4M3KB 4FFYH 1VA9A 1XF5A 1HILA 5IB3B 4OZIB 1T4KA 3VXMD 5EU4B 3K4AA 1BFOA 4F9LA 1HH9B 2VDNL 4UDTA 5DJ8A 1ZSDA 2APTA 1OTUD 3BN9C 2A73B 4M43H 4F2MA 1TQBB 4XGZB 1YEEH 4Z76A 1NCWL 4OCYH 5CUSH 3TYFB 4EUPG 4YHPB 1C5BL 1XR8A 5GZNC 5E4IA 4U1LA 2R9HD 2IG2H 3C6SB 4B41A 3AY4A 3X14A 2VLME 5D7KD 5IV2B 2YD8A 1A3QA 3QEQE 2C1PA 1WISA 1F02I 3CVHL 1J11A 1DLHB 5ALCH 4L4TE 4KJPC 3TFKD 2ZKHH 4RCAA 1FVDA 2C5DC 5CD5C 1FO0B 1U92A 1OSZA 5F9JB 4I3SH 4ZAKD 3U0TA 5HVHC 3QO1A 2BHYA 3B5TA 1FCGA 4N0FA 4YHKL 1VHPA 2ID5A 4NOFA 4OGYH 1SHMA 2D7NA 1EHLL 3KNBB 5DK2A 1CLZL 4PREB 1IKFH 4IRJA 2ZUXA 1KJ3H 3IFPA 5EOCH 4CVZA 4PJ8C 4BA8A 5HJ3B 1ES0B 4KKAD 5L6YL 4BFIA 4GMSL 3OMZA 2QSTA 4IS6A 3S4SG 2HFFA 2H32A 5FUOH 4L5FL 2OXGA 2JK5B 4Y19B 5TE7L 3VFPB 4JM2B 3VXTB 1JNLH 4C57C 1TMCB 5I8EB 5IHUL 1RIHH 3H0TB 5FF6B 2BNUB 5GSRB 3ROOB 1QKZH 2R4SH 5GS2H 3KHOA 3KHQA 1CL7H 1X6NA 2A83B 1FP5A 1NKRA 2DD8L 1J8HD 1VGKA 3OZ9L 1QRND 3QEUA 4JVUA 3NIGF 4M00A 3PQYB 4I3RL 3GJEB 2D03H 4F7MA 3RIAF 5TDNB 1WWBX 2YMXH 2DL2A 4PRHB 1X4YA 3GSUA 4UAOC 1U6AL 3CIQA 1CDIA 3E6HB 4QXGL 3SDXA 4N1HB 1Z0NA 4MA8H 3K2MC 3AB0C 2NY2D 1PZ5A 5DQ9A 4J4PD 1YYLH 4QYOB 1AXSB 4MHHI 4WI8A 1JI1A 3SKOB 4NC0B 5DGQA 1P4LB 5C07A 3R06B 4OIIH 3C5ZC 5D7LD 4KTEH 4XCYA 5DQJA 4XPFH 5C0BB 3PUCA 3MV7A 1CFBA 5DA4A 1JUFA 1RZ8B 1CTOA 3FT2A 3H6JA 2NTSP 3M17B 3RDTB 5BV7B 4PJBE 1BD2D 4X8JA 3J8F7 4WRLA 5T1DL 2E8ZA 2QR0B 1E28B 1DQLH 2DLHA 4NYLB 3MJ6A 3BT2L 5AZEH 1E4XL 2YD5A 3QUZD 1YECL 4KK5D 3WKML 4JO2L 2E7LC 5DVNA 2W60B 1CFTB 2ERJC 3IDMB 4HT1L 5KSBB 1RZFH 2FCBA 1FNFA 5IVNA 3MSPA 5I74B 3CFEB 3GSXB 3NCJL 1EBPA 4LSPH 1N64L 3PJSA 5ID1B 4F3FB 1A8JH 1HHIA 1D9KA 3QUMA 1CFNB 4U2ZA 1KULA 1QFWL 4MXQC 4NZTH 3OQ3B 4K8RH 4XAKD 3I6GB 4PS4L 3ULUD 3TJHD 5GJSH 1JK8B 2P4AB 1OM3L 5D2NE 3TGXA 3ZYZA 3O4LE 1GOHA 1MRDL 4HGKC 1RUAH 4JQXA 4RDQG 4POYA 2X1WL 3NAAL 4PG9B 2BCKB 4WGVB 4MD4B 5CHNA 3X13B 5F7LB 3A6BL 3DVGB 2ITDA 1JZ8A 3PHOA 4M62L 4PJAE 4E5XB 3LKNA 3FFDB 1EGJA 4MNHA 4Z7WA 4HIHB 1AQDA 3IDXL 2VXVL 3RBGA 1H0DB 4PY7A 2QQKL 3C9NA 4PRID 1NUGA 5FUZL 1MVFA 2MQ3A 3SBWA 3DMMD 3OF6A 1UH4A 5EPMA 1Q8MA 5BJTA 3KLDA 1BIIA 2LU4A 2RQ8A 1T5XB 5CJOL 2ZZUT 4HQQL 1GGCH 3GHEL 1JPGB 4PBWD 1BZ9A 5EZIL 4YDLB 4G8EB 3ARTA 3HC4L 2VIRB 2XQBH 3T1FB 3U48A 5F9OL 1JPTL 4CDGC 3QHFH 4AQOA 4N0UE 1GCFA 3VH8A 3MCKA 2GK2A 2HT3C 4NKQB 4UIMA 2XN9A 5DEFB 2EDHA 2UWEB 3TO2A 1JWSA 3O6ML 1T20B 2IH3A 1ZWIA 3QWQB 4RFOL 2EH8L 1MCPH 5IB1A 5DRWB 1MQ8A 1U3ZA 1X6LA 5GIRA 4FQ1H 4UI2A 4X7EC 5DR5L 2V7HB 3GMMA 2C3VB 3QRGH 1WC7A 4H26A 4RGOH 4QRUA 2R2BA 5MP6H 4CVXA 3LB6D 3L5XH 3OBAA 3HUJE 3VFGL 3IAPA 3I6LE 4MXVF 3NN8B 1F3JA 1KIQA 2IANB 1TJIH 2JJWA 4GAYB 5E2UL 1CLOH 1NBYA 4R3SA 3GZKA 1S9KC 3OHXA 3ZTNH 2WMPA 3VFMA 3LDBB 5BO1H 5DI8B 1DBBH 5T1KA 4JHBA 2BNQE 3EIFA 4NQEA 4JG0H 3U9UB 3BZEA 1XGPA 4OLWL 1TITA 3H9YA 5MERB 1T2XA 4KDWA 5J7CC 5C0JB 1A02N 3C87A 4IOFC 3AC0A 3SKNA 3TPUB 4X7CC 3F7VA 3FHQA 3AMLA 4Z95H 1T2JA 2IH1A 4I1NB 3WUZA 2NR6D 3U7AA 1ZHBA 1UKTA 4S11A 4PJGE 3WNPA 4OLEA 3WFBH 4X6CB 1NCBH 3UTQA 2NW2A 3WNNA 5F1IA 2AJSL 1CR9H 4JHZA 3VRIB 2CPCA 2PETA 3BKJL 3CFJB 1MJ7L 4M3JA 5H37G 2DM4A 3FCTB 1J05A 4HKJB 2YR3A 3WE6B 4BUHA 4Y16D 4XVTH 2PCPB 2NLJA 3WUWA 3VXOA 5JO5A 1FZMA 3ES6A 1P1ZB 1UACH 5B39B 1JN6A 1CDCA 3PWLB 4ODXA 3BP5A 2IBGA 1EHXA 1EUUA 4KK8D 3MRFB 1QBML 4XCFH 3LQMA 4JKMA 5D71H 2D0GA 4XNYL 5B8CA 1PG7X 5IBTH 2W0FA 5I76B 4NRZB 3HMWL 3IT8D 3D87B 5KBNC 4PLKD 1LDSA 1KIUA 3PL6D 1DEEB 4JFPB 5KG9A 1JE6A 4NDMB 4L8CA 2VDPL 3FQWB 3V6OA 1LO0L 4OV5A 2DQJH 2VDML 2VAAA 1HEZA 5MEPB 5GSVA 4Y5YB 4LLVA 2Q8BL 4LLDB 3TH4T 4DGIH 3MV9B 4PJBF 4OUOA 5SV3A 2ILLA 3HMXL 2DYPD 2MPAL 4Q6YA 5BMFH 3TBTB 5AAWA 5ESAB 3RTQA 1A6PA 5JORB 2B5IC 3G5VB 2YZ8A 3U7YH 1A7PH 2W92A 3BO8B 4JQIL 4LVNC 5C0CD 2FATH 4U6YA 1K8DB 1NGPH 2ZG1A 4GW1B 2MHAB 1G7QA 1TVHA 4LGPB 3HHRB 1TQCB 4EI6A 4JZJC 4XNZB 4LSTH 1FH5L 4RBPH 3S88H 5HYSB 1PKOA 1JGDB 4HUUA 3CPLB 5JXEC 5B3JE 2IBZY 1JGVH 4G7VH 1PJ9A 4MQ7B 5C08B 4FQXD 4UOJA 3BD4A 1SVCP 3GHBL 1XCQA 3ARFD 2FBJH 4K94C 3IVKB 3TIEB 3A67H 3O41A 5HYJD 1TENA 1NGXA 1HIMH 3FT3B 4LPCA 4XHJD 3GMPA 1U0QA 3QSKB 4HPYL 4L9LB 3T4AA 1NAMB 2X2YA 5AUMA 4DOHB 4RAUA 1QLFB 2EIDA 2VXQL 3CX2A 3F6LA 5C1MB 4YHNA 1A6AA 2BHZA 1SBSL 5IB5B 3QFJB 1QLEH 3UZVB 4HUVA 3PDOA 5HI3C 5I8KH 4G8IB 4ZYKA 1CLYL 1XGUA 3TZVA 4D2NA 1KPRB 5FCUL 4P57B 4WO4C 1RZIB 4MNGA 4HMCA 4K3EL 3D0LB 3STBA 3QQ9D 4X0KA 2DBLL 5DF0A 5B38G 3F65A 4M7ZB 5C0EA 5JUEL 4HFWA 2DF3A 3UYOD 1S8DA 1U8MB 3RJQB 1T5WB 3UTOA 3EO9L 1ZT7B 3TT1H 2JIXD 2OK0L 5FGBC 1T1YA 1DVFC 4XPGL 4M4RA 2ICWA 3D39A 1CICA 3NFNB 5F9WB 4ALAL 3CSPA 4HS3A 4OKDA 4YHZL 2XRAH 3KPRB 3S97C 3G6DH 4P59H 5J57B 3VDBA 1NMCB 3BMVA 4PB0H 4CL7A 4PJXB 3LN4A 4ZSOE 1K4CB 2D9QB 4K3GA 1YMME 3Q0HA 4PTUB 2AK1H 1HYSD 1A1MB 3VFUB 4DN3L 3SCMA 4IRSD 2P5WA 1AIFB 1K6QH 4R2GD 5BW7C 2H9GB 3CXDL 1DSFL 5T3ZH 2YPKB 3DBXA 1LILA 4IMKA 3MQIA 43CAA 1EX0A 3J7HA 4K7PX 4H8WH 2DI7A 2VWEE 1WFTA 4NOBA 4HULB 4B0MM 4HKBA 1Q1JH 3RWCB 5CGMA 2AGJH 2CDGA 4NRYB 2DAVA 2HVKB 3MODL 3O3BB 3WEXB 2B8OT 5DZLA 1WCBB 2HVJB 5HPMA 5L2KA 2V5YA 1TPXC 3FT4A 1RK0A 4I0CC 2D7TH 2HWZH 3C6LD 1KLGB 2OQJB 1FPTH 1MCLA 3UBXA 1JRHH 4UOW1 4EXPX 3FFCB 4QHNA 3CDGB 4CW1B 1I75A 2YSSA 5IEHB 1Z9MA 4AIOA 2D7PA 1DDHB 4JRYE 3HE6C 4R4FH 3RIAK 2PO6A 4P2QA 2J5LC 2R56L 3MA7A 3RWFB 1RK1B 2OTWA 3MREA 2YBRB 1TFHA 1FN4B 2VSCA 2NY4B 2VR4A 1UADC 1FVEA 3QO0A 2Q6WA 3RVXD 2HH0L 4NJAH 1FNSL 1H3VA 3PIQB 4S1RL 4WIQA 3SDAD 4CBPA 1NFDE 4QRTA 2HT4C 3L3KA 5GS1B 2Z93A 3OKMB 2ZUUA 2RJMA 4LLMB 3HR6A 1U93B 4MAYB 3LKPA 4DKFH 2AK4A 3EHBD 1U9KA 2JJTC 2ZG2A 4QHLB 4QTHA 2MFNA 1QFUH 2CUIA 2X4TB 2QV2A 1IM3A 3SJVB 5ILTH 4J7RA 3KYKL 5ISZB 3BH9B 3QG7L 3BHBA 5DC4B 4XC3L 5FYJL 3NPZB 2VDOH 1XZ0B 1IT9L 3QDMA 3O3EA 1BQLH 4JO4L 5FKPA 1W2KT 1ZHLB 1WBYB 5L2JB 4LFHD 3BQUC 5B4MC 2O26U 2CO6B 1B4JH 4TVPD 1PSKL 1SBBA 5KTEH 1IGYB 4M6OL 5ITBH 5DJAA 4WNQB 2A6IA 5B21A 1FGNL 2X4NA 4Y19D 4F7EA 1PLGL 5E6IB 3BEWB 3RWGA 4M7LT 2NX5B 5DDHB 4WV1A 2ADFH 4NM4H 4KDTA 2OTUB 5F96L 4YEEA 4QOKE 4X5WB 4XC1L 5HGBA 2HT2D 5FM5O 3RVWD 3GI8H 1A2YB 4PGBB 3FONB 1ZA3A 4YEFA 1H5BA 3S98A 3QCVH 3VWJB 1YDPB 1JWMA 1S78C 1A7QH 1JNJA 3BGAA 4HF5H 4PRHD 2A0LC 1DQQA 5J1AB 1EV2E 2PTTB 3C60C 4PLOB 5J13B 2FX7H 1O7SA 3VFNA 2Y07L 2CJUL 2I25N 4LSDA 2ZUTA 5EBLB 4CNIA 5C3LD 5SWQA 5TQ0L 5CBEB 3OKLB 5FDWA 1AR2A 2FR4B 3QJFB 1YUHA 4HKXA 4PV9A 5D8JH 3AAZB 4R26L 1CIUA 4UV7H 5IIEA 1UKQA 3T0EC 3VXUB 5IROC 4YDKL 2XA3A 1KB5L 1XF5B 1HILB 4ETQA 3V4VL 5E2TH 2EDJA 1UM4L 3ARGC 4YXKH 1BFOB 2ZCLH 1OPGL 4UDTB 3OB0H 5TQ2H 4K2UL 3QH3A 3ABZA 5DJ8B 3CK0H 1T66C 2XQYK 1ZLWK 4TPRH 3K4ZA 4KHXH 5LWYH 1G9NH 1ZVHA 1IJ9A 1VKXA 1HWHB 5GGTH 1KEMH 2X1OA 4IHOB 3TNMA 4F2MB 3MNWB 4Z76B 3UX9B 2CKBL 2FX8L 1MI5A 1XR8B 4YR6A 1F3DH 4U1LB 1MQKH 2YS4A 5T3ZE 4OCSL 1UA6H 1NBVL 4DTGH 1G84A 2C1PB 3GRWL 1NL0L 3D18A 4OF7A 3KPPA 4NC2B 1AH1A 3L9RA 1FVDB 2QEJA 5IMKA 3QRFM 1U92B 5IVXA 1OSZB 2NXYB 3F7QA 4HS8H 4R96A 3PABA 4CKVX 2W38A 4BSVA 3U0TB 3SDCB 5HD8C 3QO1B 1A4JA 4K94L 3BUYA 3SE4C 3BYYA 1I9EA 3QIUD 2NY6C 4P3WA 3HA0A 1OY3B 1J0ZA 2XACC 2YUWA 3V0VA 4S0TD 1OAXH 2XWBA 1W72B 1KELH 1NANH 3O2WL 5DK2B 2QQLL 2K7PA 1UJ3A 4N8VG 1DANU 4IRJB 3WV0A 5CAYB 4O51A 2DDQH 4CVZB 2ESVA 1FLRL 5B3NA 3IDUA 2YKLH 4BFIB 2GJ6E 1A64A 4G3YH 4JE4B 2UY6A 4IS6B 2FSEA 4YDJA 2HFFB 1S7RA 2H32B 5ADPL 4HGWA 2RBLA 3QNZB 2EYTA 2P8MA 3WXVL 4NN7C 1UEMA 5HHOB 2EE2A 1FFPA 4BK5A 4PG2C 3LQZA 1MFBL 2CRIA 1DQDL 3TJEH 4YC2C 4F37F 4YHML 3WLBA 2G2RA 4NT6A 1VGKB 3VXRD 3QEUB 4X4XA 2DJ4A 5DUBA 3DXAA 5C09A 1MCSA 4OZFA 1L0XA 2GJJA 1I1YB 4F7MB 4KTYA 4P2CG 4OGZA 3GSUB 3MCG1 2DWEA 4KVCL 1C1EH 1PZ5B 2NY1B 5DQ9B 5ABDE 4RMUA 1NFDF 4CAGA 4X5XA 2QSVA 2YPVH 3U0WH 4TUOB 5C07B 4XCEA 4XCYB 5DQJB 1R3IL 5K9OA 1RIVL 1DN0A 1T0PB 5FHBL 2HAZA 3MV7B 1KNOA 4XP5L 5AG9A 1JUFB 3FT2B 1FGVH 4X8JB 3LHPH 3HMXA 5I8CA 5CP3H 3JV5A 2QHRL 4KKAC 2WQRA 4BKLA 5F1NA 4PJ8A 1TETL 1J1PL 3TN0B 4DK6A 1B2WH 2G5BA 3QDGD 3RHWF 4NQDE 1ADQL 5HDQH 1FZKB 5HXMA 1Q0XL 2V5TA 5DJCA 4LOUD 1F42A 3MRCA 4V1DE 2JELH 5FXCH 4FZEH 4TUJB 1HZHL 3BP7A 5KAQF 4NZRL 3MRPA 3QUMB 1D9KB 5I1DA 1NC4A 5E1HB 4H0IA 5T1LA 1RUKL 4OLZL 3WHE1 5HDBF 2R29H 1LMKA 4KKLC 4ZTPL 4KKNA 5GRUH 1U8OA 3FN9A 1ZGLA 2VL4A 2FNBA 5HGHA 4NKMB 4AIXA 1IFHH 2RR3A 5H37H 4LPXA 4NO5A 4ODTH 3VJ6A 4POZD 3CMOH 1YEFL 2APFA 2W91A 5CHNB 1NEZG 3C5ZA 2ITDB 4ZFOA 3PHOB 2FH8A 3NPSC 4PRPB 1Q0YH 4S2SA 4XPBH 1MJUL 3LKNB 4MNHB 5JW4M 4FFWC 1DUZA 2VE6A 2VXSL 5J12C 1U91A 4OCRH 5EOQH 4DZBA 4PY7B 1AQKL 4GW4A 1AGEA 3C9NB 1PD6A 4HC1L 2HKHH 5EPMB 4CU8A 3QUZC 1YMHB 3MV9D 1G7HA 4KK5C 2ZCKH 1OAUL 3DSNA 4GUPA 2WSKA 2P43B 5BJTB 1N0LA 4NQSA 1RQ5A 5DSCB 2E7LA 4WWKC 1NCAH 2EDEA 1BZ9B 3DO3A 1OGAE 4JKPH 3S36H 3VGAB 3VRJA 1UWEL 3QFDA 3VH8B 3MCKB 3PXJA 4UIMB 2XN9B 3TO2B 3ZE1F 4ZFFA 4M9OA 4RIRA 4U1GB 1JWSB 1ZWIB 3WFHA 3TJHC 4I13B 1VERA 5IB1B 4NC1E 2OYPA 5GGQL 5GIRB 5IW1A 4XNXH 1F58L 3CFCH 2C4XA 4YGAB 2R69H 1WC7B 3ILPA 4H26B 4FOMA 2YXMA 2R2BB 3DYPA</