4YE4H

Crystal structure of neutralizing antibody hj16 in complex with hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
227
structure length
227
Chain Sequence
MKLMQSGGVMVRPGESATLSCVASGFDFSRNGFEWLRQGPGKGLQWLATVTFESKTHVTASARGRFTISRDNSRRTVYLQMTNLQPDDTAMYFCVKDQTIFHKNGAVDFFSYFDLWGRGAPVIVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HT593.1 gp120
publication title Crystal structure of HJ16 in complex with gp120
rcsb
source organism Human immunodeficiency virus
molecule tags Viral protein/immune system
total genus 47
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H01
3G08B 4UTAH 2E7LA 2VZOA 3QUKB 5EIIA 4HK3J 2NTFA 4CVWA 2ZUTA 5HYSA 1QVOB 2P47B 1HKLH 2FWOA 4JKPH 1G7LB 1I3GH 1JRHL 5IHZB 2ZG1A 4UILL 1IBGH 5I15H 2A1WL 1RQ5A 1UFUA 2CRIA 3AY4C 1NCAH 4X4YB 1GGCH 4H88L 1GZPA 3HPLB 5GHWL 3RRQA 1B0GB 1LO4H 3UO1H 3V6ZA 3C6SB 1RFDL 2CSPA 3OHXA 2D31A 4MD0A 5CKGA 5E5MA 2NW2A 4TUJB 5D7LB 3CDYA 1AO7E 3QIBD 2EYTA 5DVMA 4RMSA 3WHE0 3KLDA 4PB0H 3GSNH 4PJEA 3TN0B 3V5KB 1MCLA 4U6XA 1BX2A 1U92A 2B1AH 3ELAT 4G3YL 5FCUH 3K4DA 3KPRD 5F9AC 5F96H 1OAZH 5CD3B 3SDDB 4KK5D 4OM1L 3TO4A 3VD7A 4XCEB 1UXSA 2VLRA 3X3GH 4YBQC 2Y1VA 3GSRA 1A6AB 5IV2B 5EBMA 4JRXD 4RMVA 1A3QA 3VWKD 5E99L 4O00A 1YNLL 3L7FA 5BJTA 5CEZD 2OR8A 3TFKC 2EC9U 2F58L 5B21A 4F2MB 5FGSA 3ARTA 5E94A 4WHTB 3O3BA 1B2WL 1N5AB 3W9EB 1MHEA 3Q5TA 3RZWA 4HX1A 4TNVK 4I0PD 3ARUA 4P2OD 2EH8L 4YHKL 3ECBA 5CIPH 3RGHA 3WL9B 4R26H 2VDKH 1MLBB 2FYYA 4QRSA 3MCG1 1G9ML 3CCHA 4S1RH 3VJ6A 3J8F7 3MBXH 1GHFL 4B50A 2QQNL 4AT6A 3FZUD 4IRZL 3O2VL 1FNGB 4W6YB 1IGIL 3Q6GH 5TQ0H 5KSAB 1U8OA 4UQ2A 4OB5L 3VH8A 2UZYB 1PG7X 5DUPL 4GH7B 2HTKC 3JSSA 1OT2A 5GGSB 4GG8A 3QQ3A 4GLRH 2AI0L 1FL5A 4YDKH 3SKNA 4O2EA 2KL6A 2FJFB 3QAZC 2EKJA 1KEGH 4RWYH 2XV6B 1XEDA 3T4AA 2ZOLB 3VGDA 2BSTB 1IC5L 1NAKH 1J1PH 1SJXA 3MA7A 3VD3A 4XVUD 5BOZG 4NQTA 4MLIA 3QUZC 4ZOAA 2PO6B 4ENEC 2FO4A 5GS3A 3T0EB 3D85A 1KPUA 1RY7B 4FQQB 5I1IH 3VDBA 2Z31A 1AFVH 2VDQH 1T1XA 3EFDH 1CDJA 5JNYB 1RUQH 2P7TA 1DBJL 4LL9A 5E08H 5C08D 4GKSA 4I4WA 1RUKL 2C1PA 3E2HB 4Z7VF 4Z0XA 1BVKA 2MCPH 1T1WA 3EO0B 4I18A 3WXWL 3CDFA 3GKWH 2OJEA 1MRDL 5E9DB 1DZBA 4K7FB 3GHEL 1M1SA 2YD9A 4YXHH 2GJZB 1N5YH 4HGMA 5CEXA 4GQ9L 2UYLA 4HGWA 4R8WH 3VRLF 3LN4B 1CFVH 4YXKH 4PRPB 2IAND 2VLMD 2VISA 4LCWD 4LHUB 2H1PH 4Z7NF 5I8EB 3R8QA 1D5ZB 2VABA 5DLMH 1J8HD 1ZHLB 3SCMC 3TNNB 2ZSWB 5HHNB 5I1LA 5JOPE 4WU7A 2X4TB 4X7TA 1P7KB 4KDWA 2ENSA 3H6JA 3PQYA 1OSPH 4C55A 3GSWB 4F7PB 1T2JA 3FKUS 3V52L 2W0KA 3MV8B 3SGJA 1KEMH 2CPCA 4JY6A 3ZTNH 3NTCH 1U3HB 3KLSA 1TZGL 4WI9A 5CLWA 4K9EL 1E6OL 5DJCB 2OCFD 3ARDD 3MREB 1F6FB 3TVMB 4GS7C 4O4YH 3U4EA 3V0VA 3PABB 3EDDA 4TULL 4QHUB 4UZGA 1P84K 3KNBA 3GO1L 3STZB 1TNNA 1HINL 1F97A 2MPAL 2ZUUA 4QHLA 1L0XA 2VN4A 4EUPG 4F7TB 5FO8B 5FYJD 3E0GA 3HG1D 2NLJA 5JHDB 4FA8A 4XP4H 2H32H 2GIYA 4OLYH 4XTRC 1OL0A 5LAXA 4Z7QE 3G04B 5D71L 4Y2DC 4YXLL 4JN1L 5T5NF 4WI2A 2BVPB 4JO3L 3KPSE 4U1IB 3F8UB 3HI1A 2AV1B 4GKOA 1A6UH 2F19L 3CSBA 5I76A 1E4JA 4JKKA 5BCAA 2Q3ZA 3MRKB 5C09E 5D93B 1BD2A 4XVTH 3V0WH 4KQ3L 1SYVB 5CSZB 5TE6H 4NBZB 3BZDA 1ETZA 3GIZH 5D1QB 4L3ED 4FP8H 1T0MA 4NRZA 5F21B 2OXGA 3H3KA 2X42A 3VXPA 4B41A 3F12A 1CBVL 5H2BB 4PR5B 1ZA3B 3SJVB 1KJMB 1A0QH 3M45A 1KB5A 4N8PA 3FTGA 5GGVY 3EJJX 2E7BA 4Y1AB 4KRLB 3HS0A 4PGJA 1JGVH 1OSZA 2X4NA 3MYJA 1DANU 2J88L 1JNNL 3O8XB 1KB5L 3CUPB 4HXAH 3EYVB 3P40A 3HC0A 2BY2A 3C2AL 4H8WH 1BFOA 4NUJB 1OW0C 2AJZA 3MJ7B 1F4YH 1ZOXA 1BAFH 5J56B 3IDGB 4P2QE 2DI9A 1DL7H 4JRYB 1QRND 3RU8H 5JDSB 3QI9B 5C9JB 5KW9L 4EN3B 1AGEA 3Q3GB 4I77H 5DRWA 2J8UE 2OTUA 2ZKHL 4HLZG 4PP1C 5E8NB 2EDEA 3RY4A 1DVFA 3RIFF 5I9QC 1T66C 1FLRH 3BZ4B 4JR9L 1E4WL 1A6TA 3LRSB 5ADOL 4P23A 3BUTA 4M7JH 5GPRA 3VI4F 2IQ9H 4WUUA 3VD5A 1XF3A 2GK0B 5T1LA 4P57B 5CJQL 1ND0B 1MIEL 1MFDH 1FO0B 2ZOKA 1U41A 3T2NL 4WI3A 1AE6H 3ZE2E 1CDBA 5SV3A 3H3PH 4JM2C 1KIQA 2XPGB 1RJZB 2CLVA 4WV1A 3RWFB 4KVCL 3KAAA 3I6KB 3BGFB 3X11B 2QBWA 3I75A 4AH2A 4EDXA 5EU6A 4U1JA 3UTSB 4HBCH 5I30H 1WCQA 3FT4B 4FFYL 4KJPC 4PRBA 2LQRA 4G8GA 2A6DA 4PJ7A 3T2OA 2BNQE 4NN7B 3QIWC 4DKEL 4L9LB 1D5XB 2FJGB 4HWBA 1NUGA 4HZLB 4F9LA 2HRPL 1F3JA 4O2CA 3MRNA 1XCQA 1JRHH 5FA3A 1PFCA 5CCKL 5IK3A 1SVCP 1FDLL 3RDTC 1B88A 2MKLC 1VGEL 2FECI 4PJ7F 3WFHA 2NY0B 4HWBL 3PJSA 4H88H 4PLKD 5TDOB 1UH2A 1LO0L 2HVKB 5GHWH 1BBDL 1UM6L 1CLZL 5JO5A 2N1KA 4LSDA 1RFDH 3DYMA 3KPNA 1ZHBB 3PF2A 2VC2L 4PLOB 2VAAA 3FB6B 1F42A 4KUZL 4I48A 4LPVA 4YFLF 5D7JB 3O0RL 4QXTB 5JW4R 4D9RE 4K94H 4POZC 3QIUB 3PV7A 1ZSDB 1CD1A 1L6XA 3ROOA 3K7UA 3ULVF 1EVUA 2Q86B 4ZNEE 4QYOB 3QUMB 4AEIH 4CW1B 1EUUA 1GCFA 1S7UB 3ARGA 2HTKD 3DO7B 1V8HA 4RFEA 3OKOB 4OM1H 1U3JA 4MQXC 4X6CA 4UNVA 1EHXA 4MNQE 4S0TD 5JW4Q 1C08B 1T4KA 3KPLA 4Q58C 5F1IA 1JNLH 4PRAB 2IAMA 3JV6B 2UVEA 5CBEA 3RGVD 1YNLH 2J5LB 3PE9A 1VDGA 1FYTB 2P45B 3SGEI 5E6ZA 4PP2A 2F58H 3O6FD 3R8BB 1MVUA 4PD4J 5DC4B 4JREB 1B2WH 2YSSA 4OF0A 4DVBB 5GS0L 3ULUF 4PJ8B 3RWCB 3HZMB 4YHKH 3QUZD 4ENED 4DW2L 1BF8A 2R2HB 1G9MH 2XG4A 2AK4B 1GHFH 4NC2B 2KQNA 1XIWB 4HCRL 5DRNB 4RX4A 1H3XA 1WVZA 3KLHD 3H2WA 3O2VH 1LE5A 4LPWA 4ZUTA 2X41A 2D0GA 2A6IA 3H9SA 1IGIH 2V7HA 4EIGB 3MRQA 3O2WL 4KI5C 3V6OC 4OB5H 1A7QL 1FIGL 4NM8L 4JDTL 3W9DA 3SO3B 3BP7A 5IBTL 2YPLB 2JB5L 3NZ8A 4XBGA 1IGYB 3TP4A 4Y4FC 1HILB 2LU7A 1OAKH 2BNRB 4AG4H 5LGJB 2AI0H 3RWJB 3C9NB 3QUKA 5EU7C 1MOEA 5F9WC 1G7LA 5IHZA 1UWGH 3SCMD 2I60L 1AY1H 4P5TB 4PJDE 1ONQB 3BH9B 5JW3L 4GXUN 4RQQB 5HHPB 4X4YA 1RAMA 4H20H 3DROA 3HPLA 5L8LB 1B0GA 5JA9A 3C6SA 5IVXB 3QXDA 4NQDE 2F74B 2YD4A 4M5ZH 3UJTH 4KGJA 3ZKXC 3JWDC 3EOTL 2A73B 4TUJA 5C0CD 5D7LA 3VXUB 1RUKH 4CKVX 1PSKL 3RFZC 3ARPA 4PJAE 5K9JL 3TN0A 1MRDH 4QOKE 3V5KA 2OK0L 5DD6B 3GHEH 1GC1L 1R3LB 3DV6B 4A2LA 1OTTC 1AQKL 1JTOA 1A6ZB 1WWCA 4GQ9H 4WHYH 2FRGP 1PG7W 1QLRB 1FJ1B 3CVHA 1ZLUH 3SDDA 3BAEL 4KAQH 4XCEA 3WMSA 3NAAL 1A6AA 5IV2A 4KUCD 1I3VA 1EIBA 4XTRD 3GMRB 3IETB 1BWMA 4F2MA 1LDSA 3QEUB 4Y2DD 4WHTA 4E0RB 5I6XC 1NCDL 1N5AA 4UI2A 3W9EA 4FOMA 4LCCB 4ONHB 4Y5VC 3VFGL 2FX7L 4AQOA 5F7DB 4M3KB 3BZFB 3V52H 1VHPA 3WL9A 2OM5A 1MLBA 3MCKB 3ARFB 4K9EH 1LVEA 4PJFE 4K3EL 3HUJB 1R0AL 4NYLB 1FNGA 3REWB 1QSED 4G6KL 4XMKL 5KSAA 4TULH 4ZNCD 5CBAB 1Z9MA 2AAVA 1HINH 2MPAH 3DX6B 4XBEL 5F3HA 3KYOA 5GGSA 4OZIF 1A9EB 1LP9F 2FX8L 5J7CC 2FJFA 5E6IC 4XPAL 5D71H 4HWZB 3U2SB 2ZOLA 2BSTA 3GNML 1NMCC 4N8VB 4MNGB 2F19H 2PO6A 3CLFL 3NCEB 3V7AE 1HH9B 1KC5L 4ETQB 3T0EA 1LE9B 2ICES 5FGCE 4FQQA 1DN2A 1CVSC 4KQ3H 2XRAL 4PP1D 2XACC 4OD1L 4ZUVA 1IC1A 4OGXL 3N1MC 5I71B 4NSKB 4GRWB 5C0BD 3MLYL 2V6HA 4HDIB 1QG3A 3EO0A 4ZDHB 3VXRB 3JV4B 2CK0L 1A6WL 2GJZA 1OP3H 3A0OA 4K23L 4O2FB 1LK3H 1BVZA 2K1MA 1GAFL 1NCBL 4ORZC 3PL6D 5F71A 4OV5B 3LN4A 3AM8C 1WFOA 1HH6B 4F8TA 4PRPA 4JM2D 1KB5H 2CRYA 3C2AH 1D5ZA 4LNVA 5EA0H 1KUMA 1ZHLA 4ODWB 4XVJH 4BUHA 5HHNA 3U30B 2P5ED 3TYGH 5INCB 2XOTA 3WUWG 3S88L 3QG6B 1K3IA 3ABZA 4GBXC 2X4TA 4KJPD 4RFNB 1P7KA 3MV9E 3ALXA 2X2YA 1KXVC 3SE9H 3GMMB 1OPGL 2D3VA 3GSWA 4OZHB 4F7PA 2CRMA 2DS4A 1SY6A 1OAQL 3DX7B 3MV8A 1IAIL 5L9DL 2HWZL 4L1DA 3DV4A 1CDUA 1E4WH 1U3HA 3RDTD 3QYCA 3LDBB 1PY9A 3FQXB 4FQXB 1JNJA 2X05A 5DJCA 4OT1H 4UAOC 4PJBE 3KGRA 1SY6L 3MREA 3TVMA 4LOUC 5CJQH 3CFJB 3T2NH 4QHUA 4S1QL 3C08L 3STZA 3OJ2C 3ZE0E 3KYAA 3MNZB 4F7TA 5ISZD 3V4PL 2QL1A 2HA1A 2X89A 5FO8A 4JKLA 4KVCH 4PRHE 4F15B 1W2KT 3JWNC 2DF3A 3G04A 1F4HA 4FFYH 1U91B 3B2VH 2W1NA 4DKEH 2BVPA 4U1IA 4JFPA 2AV1A 4X5WB 3AREC 2PCPB 2HRPH 3LPFA 1H8OA 1IAII 2F53E 1YJDL 1UJ3B 3MRKA 5JW4M 2VLLB 1SYVA 2ICCA 5CSZA 4CN1A 1FN4B 3FO1B 3OL2A 5IW6B 3QEQE 1S7TB 5D1QA 4HWBH 1ZLWH 3RKDC 3GDBA 1L9NA 3WNLA 4XT1C 4Q9CA 3EGSA 1UACL 4PR5A 1D6VL 1ZA3A 1NCCH 4UDUA 3SJVA 3VW3L 1KJMA 2VC2H 3P73B 4Y1AA 1LK2B 3WLWC 5DO2C 4N5EC 2DQCL 2UZXB 3MRMB 4G9FE 3O0RH 2VDOL 3O8XA 2ARJQ 3ULVH 1IL1A 3CUPA 3D87B 4KRPC 1V7ML 3EYVA 4NUJA 5EFIB 4L8SB 3MJ7A 3ZSSA 3NCYS 3T2PA 1R6VA 4DN4L 1RK0B 1P1ZB 4TUOB 3IDGA 4OZGE 4JRYA 4ZS7L 4YLQT 5JDSA 3QI9A 3VWKB 5C9JA 5C0AE 3EDJA 4EN3A 1PQZA 3Q3GA 4OZFG 4OFYA 3KG5A 3HNSH 5E8NA 1INEL 3BRDA 3L9RB 4RWHA 4N8VG 2B2XL 4URTB 2DN7A 3X13B 4GW4B 3ULUH 4I0PB 3LRSA 2MFNA 5GS0H 4CJ0A 5HI5D 4Z7UF 4RSVA 3EO1A 2DL2A 1NLBL 2AEQL 2O5YH 5DMJB 4X8XA 4DW2H 2GK0A 4P57A 1ND0A 4GRLD 5A3IC 1FO0A 1DLHA 3TV3L 4P2YA 4J3WA 4Y4KC 5FYJU 2DTSA 1PYWB 4APQD 3CNKA 2XPGA 1JZ4A 1RJZA 5DFVC 3RWFA 5DUBB 1GVIA 5J11C 3O2WH 3I6KA 5HI3C 5DJ6B 3X11A 1A7QH 1FIGH 2XZAL 4NM8H 5B8CC 3UTSA 1OTTD 4JPVH 3FT4A 4KTYA 4ZPTA 3WXVH 1YYML 4KROC 2EECA 4L9LA 1C5BH 2YBRB 3CFDB 2FJGA 4HZLA 3R0NA 3QCUL 3BP5B 5D2NB 2WBKA 5DFWH 2X1OA 1OTSC 3NGBB 2Z8SA 1C5CL 2HLFD 3OJMB 4R4FL 4XNXL 2AJYL 32C2B 5DEGB 5F72S 5JW3H 3F7VB 3DVNB 5TDOA 5IQ7H 2HVKA 2AJVL 3LOWA 3BEVB 5DGQA 2VXSL 5CP3A 1LEIB 1H5BB 5HYIA 5C0IB 1ZHBA 4JEGB 2O93L 3FB6A 3EDFA 4FZEH 5FHAL 5C08B 1UB6B 5KG9B 2AV7B 3TO2B 5TJWK 1URLA 5D7JA 2B20A 1PSKH 2P8PB 4QXTA 5CFHA 2OK0H 4QRPB 1EEYB 3QIUA 1ZSDA 3JUZA 5J1SC 4HIXL 4QYOA 3QUMA 1GRWA 4CW1A 4OGZA 1S7UA 2IANB 4K8RL 5IG7B 4UIKL 3DO7A 1ZV5A 3OKOA 3BAEH 1C08A 5I1AB 1J8HB 4PRAA 4JO2L 3JV6A 4BQCA 4HS8L 3QUML 1MCSA 2ZUQC 1F4XL 1FYTA 5E6ID 3CVHH 2VNCA 5HPMB 4LAJH 2HT4D 5MI0C 1NCDH 4AZ8A 4DVBA 2M8XA 3B3IB 4PJ8A 3FL7A 3RWCA 2FX7H 4KJWC 3VFGH 3HZMA 4S10A 3HNTL 1HHJB 1GPOH 2R2HA 2Z9TA 2AK4A 2PYED 1XIWA 5DRNA 5F70A 4ZFGH 4PY7B 1RULL 3U7YL 3LPGA 1SQ2N 2NYYD 2Q6WB 4K3EH 3BPNB 3O2DA 1MLCA 4GMTL 4FFVD 5I75B 4ZFFB 4ZOBA 4XMKH 2MWCA 3RWDB 2JJSA 1I8MB 4I13B 2YPLA 1NDMB 3O2DL 1IGYA 3BT2L 3KXFD 3SDAC 1HILA 3HG1B 5LGJA 3RWJA 3C9NA 1PKOA 4PGEB 3AMKA 4PGCB 1UA6H 3RIAF 4X6DE 5T1DH 3EO9H 5JPMB 2MTPA 2YMXL 4P5TA 3NCBB 4YHYB 5D2LF 1ONQA 3BH9A 5HHPA 4RQQA 4K3DL 3CLFH 1UJTA 1FNFA 1KC5H 1NKRA 2I5YL 3O41B 4E41E 4H0HB 4ODXB 4X6BB 3UZQA 5IVXA 1NCUA 2X4OB 2F74A 4OGXH 5JIHA 4Y19E 4WO4C 2A73A 4K7PY 3TH2T 5FUOL 3MLYH 3VXUA 5DD6A 2CK0H 1R3LA 3DV6A 4K23H 4YPGB 4LOUD 3S97C 1A6ZA 5F7WC 1GAFH 1YPZE 1M7DB 3NMEA 2WQRA 5CILL 5H37G 1QLRA 1FJ1A 4I1NB 5EH1A 4XP1L 1Z0NA 2GTZB 5JUEH 3L5HA 2ADGB 2DM2A 3S88H 5IB4B 4HIHB 3IETA 2Y25A 3WUZA 3QEUA 3IKCB 2R23B 4Z0BH 4E0RA 4LMQE 2DI8A 2BRQA 1OPGH 4LCCA 4ONHA 1U8KB 5F7DA 1M7XA 3BZFA 1F8TL 4ACPA 1IAIH 5L9DH 4V1DD 4KZEL 3MCKA 4DKDC 3NN8B 1KTKE 3ARFA 3STBA 3GBNL 4LBEB 5HHME 3A6CL 1KFAH 3RKDD 3LB6C 3LKRB 1SY6H 1NGQL 4WWKC 4NYLA 3REWA 1NAMB 3TIDB 4U31A 4X5LA 1IGJA 5CBAA 1U6AL 4S1QH 3C08H 2NZ9D 3BI9X 3WLWD 2DTML 3DX6A 4P9HL 5IW3A 4N5ED 3U46B 3V4PH 4X7DC 1BZQK 5D7IB 1W0YT 3I6LD 3KPRE 3NACL 2LFGA 5FKAB 4KRPD 3RPKA 1XR8B 3ZYZA 4DUWA 5HYJB 1BWWA 4HWZA 4MJIE 5C6TL 5CGMA 4M43L 4L4VA 1HCVA 4JRXE 1FZMB 4N8VA 4MNGA 4MD5B 3FFCA 3S4SG 1SM3H 1YJDH 1HH9A 4WFFE 4ETQA 1LE9A 3QO0B 3DHJA 5JW5B 1KGCD 4XPHL 1VGKB 4NPYB 3UC0L 2GJ6E 4NSKA 3W2DL 4HDIA 1UACH 4ZDHA 3L5XL 3VXRA 4PJIF 3JV4A 2EO1A 4O2FA 3QHFL 2JK5B 5EUKB 4Y4KD 4OV5A 3MLSL 2X4PB 5SWSD 5C3TA 2VDOH 3GSOB 3KYKH 1HH6A 3SE4A 1ZTXL 3GJFB 4WTXA 2VJXA 1V7MH 1IEAB 5IJKC 4XP6L 2IBZX 1MJUL 4ODWA 5HI3D 4PJ5D 5JR1L 3DTXB 3QG6A 3BDXA 4OBRA 1MF2L 1KIRB 3CDCA 3GMMA 4KROD 3RGVB 4CRPA 4OZHA 3QAZB 1INEH 3DX7A 4FQ2L 4JPKL 1WT5A 2B2XH 2VXQH 3OF6D 3SY0A 1OTSD 4GXUM 3SBWA 3SPVB 1SBBA 4KTDH 4Y16C 3FQXA 1DP0A 3QUZB 2BOCB 2R15A 5SWQA 2LABA 1RUML 2VUYA 4J23A 1NLBH 1G7QA 2AEQH 2JIXD 3CFJA 2GJJA 3TV3H 1UVQB 5I73C 3VFOA 3DGCR 1XF4B 3MNZA 5E4EB 3CZFB 4U0RC 1FNHA 1P2CB 1FO0H 4L8DB 5FYKD 4YWGL 2XZAH 4G6ML 3KPPB 4LCWE 3HHRB 5DJDB 4BFIB 4PFEA 1U91A 3B9KC 2OI9C 1AD0B 4XZUA 5JLZB 4XNZC 3WDJA 2PCPA 4MA7H 3QCUH 3S37L 3SCMB 1FPTL 1UJ3A 1WWWX 3CD4A 2VLLA 1FN4A 3FO1A 1U8IB 4M4PA 5IW6A 1C5CH 4H0IA 2PXYD 4R4FH 4XNXH 1S7TA 2AJYH 2ITDB 1ZMYA 4PS4L 5F7EL 5FYLE 1F13A 2AJVH 4JHWL 3DI3B 2VXSH 5B3JF 3JWOC 3WHXB 1D9KC 3A67L 5KVDL 4ZOCA 4M62L 5DURD 5C0CB 3UX9B 1ZHNB 3P73A 1LK2A 4OCSL 2EXYD 3MRMA 1JGDB 2QADC 4D9LL 3PP4H 5CP3H 4GS7B 3HR6A 3MACL 4JFHD 3BSZL 3KVQA 4OD2B 4PRNB 5C70A 3C5JB 5EFIA 1VFBB 3S6CA 5EU5B 1EA9C 4UIKH 1RK0A 1P1ZA 4P4RA 4TUOA 1AGDA 4OUUA 4JO2H 5LXGH 3VWKA 4AEFA 1A21A 4M00A 3BIKB 3QUMH 2BHYA 1HI6B 3G5YB 3L9RA 4Y2DB 4TVPH 2EICA 2FIRT 4YBLC 3WLBB 3X13A 1P69B 4GW4A 4I0PA 3DOSA 4GG6E 4EI6B 1F90L 5CEZL 2DWEB 1EJOH 3HNTH 1EHLH 1DBML 1NQBA 4TSAH 4RAUB 1B9ZA 2G75B 4Q6YA 4NNYB 4EI5C 1RULH 1I8LC 4WO4D 3U7YH 1PYWA 1QSEB 3BYTA 2YA0A 1ZE3C 1RHHB 5BZWB 3D3VD 3QDAA 2DDQL 4GMTH 2DM7A 1MWAH 5DUBA 3AB0C 1TJHH 1KG0A 2CUMA 3QWOB 5DJ6A 2VXUL 4LLQB 1P7HL 4M6AA 2JJTC 3WFCL 4UOJA 3QB7C 3O2DH 2IEPA 5ELIA 3BT2H 2VMFA 2RR3A 3QUYD 3HC3H 3HA0A 1JI2A 2AEPL 3BFOA 1CE6A 2DYPA 3X12B 4Y7MA 2VRAA 1GGYA 4C56D 2YBRA 4EZMA 1IMHC 3CFDA 4K07A 1IQWL 3V6BR 2C3HA 2HJLB 3BP5A 4XI5D 5D2NA 3EJYD 3PWNB 2F8XC 4KKLC 1YEHL 3FRUB 3QPQC 3TCLB 2W9EH 3MLRL 1QRNE 4HW6A 1VA9A 4OAWB 9CGTA 2D7OA 5MHSE 5IB5B 5DEGA 32C2A 4K3DH 4RBPK 3TBTB 3F7VA 3DVNA 1XCTB 2QV2A 4YHZH 3BEVA 1RZKL 2MHAB 1LEIA 1H5BA 3RWGB 4MJ4A 4DGVL 3WFEL 5LQBL 4LDEB 5C0BB 5F9JB 5KG9A 1CZ8L 2FD6L 1KV3A 1UB6A 4OFPA 2CR6A 5FUOH 2AV7A 3TO2A 2BX5A 4XAKD 5I1CL 2P8PA 3MZGB 3LB6D 3O4LE 1EEYA 4QRPA 5KJRL 4WWKD 3QDGE 3W5NA 2IANA 3IAQA 4MJ2A 4JM2B 5IG7A 2ILLA 2DBJA 4Z7WE 1FH5H 3BKCL 3L3DB 5I1AA 3MROB 2P5EB 5DJAB 4J3OC 3D0LB 3O6ML 1AHWC 1Q38A 2BSED 5HPMA 5JOFB 1NMBH 1HQ4B 3F7PC 3ORJA 4BZYA 3QIWB 1DEEB 4N1HB 4CL7A 3B3IA 4JVUA 5KVMC 1JWSB 1F8TH 4KU1A 1HHJA 1J0KA 1KB9K 2WBJC 4KZEH 3RDTB 1I85A 4LQFL 3BWUC 3ZT5A 8FABB 2DQHL 3QHTC 2P5WD 3GBNH 4HF5L 4PY7A 4IRSD 1PLGL 4WU5B 1NGQH 4JHAH 1WBXB 1CLOL 2E7HA 3B9EA 1KPVB 1YC8A 2A6KB 4ZFFA 3RWDA 1I8MA 1U6AH 5AWNL 5E7FA 5ISZB 2DTMH 4LSPL 5DMIL 1E4KA 2IMNA 3HG1A 4G6FD 3NACH 3WFDL 4TSBL 3MUY1 4PGEA 4PGCA 3NBNA 3NCMA 3HB3D 1WC7B 1AXSB 1CWVA 5JPMA 2YD6A 3L3OB 5FYJL 3RZCC 5AZEH 4M43H 2FH6A 3RUGE 4U33A 4N68A 5E4IA 3BH8A 3QWQB 2QQLL 3BIAX 3O41A 5L6YL 3I3BA 4ODXA 4NCC1 4X6BA 2VDML 3QDHA 2FLBT 2X4OA 3MRFB 1ZEAL 2AK1L 1IGTB 5B3NA 1UENA 4NOBA 2ZUYA 5K9QG 4FNLL 5LGHL 3MUJA 1QKZH 3L5XH 4MXQC 5E2VL 4HUUB 4CJ1A 4YPGA 3QHFH 3ZKNC 3P4OA 1M7DA 3U0TA 3MLSH 1W8NA 4PJHB 2FBJL 2VTFA 3MO1B 3O9WC 1ZTXH 3LS5H 1SHMA 3J7HA 3MLUL 3PGDB 4XP6H 1MJUH 4BM7A 3UZVB 1OQOA 1Z6JT 2ADGA 5GS2D 1T5WB 1QLEL 5IB4A 1REIA 2JCCB 4HIHA 4Y4FB 1WZKA 3E6FB 4IDLA 3IKCA 2R23A 1MF2H 1MRCH 5EPMA 3B9KD 3IS1X 4A6YB 5F9WB 1U8KA 4K3JL 4PJCB 4IDJL 4R90L 4TOYL 3RL1B 3GBML 2FHFA 4ZQKB 4J4PD 4JPKH 3W0WD 4AY0A 2JTDA 3NN8A 2YC1B 5I1KL 3AY4A 4LBEA 2DMCA 1RUMH 1J88A 1EO7A 4FABL 3VGAB 4GRLB 2OMBA 1J18A 1NAMA 4Z7QF 1KTLB 3TIDA 4MQ7B 2RAMA 1G0XA 3LS4L 1D9KD 2WUCL 3ZKXB 1B6DA 1J5OL 2ARWA 3H9HB 2X4RB 1M71B 4ONFL 2PTTB 3U46A 3V95A 5IF0B 1FVDB 4AL8L 5D7IA 1NAML 4Z9KB 3IXAA 4ZFOA 3CXDH 1YY9D 4YWGH 1QD0A 5FKAA 1JGEB 2FHBA 1OD7A 2A83B 4O02L 1XR8A 4LAQL 4I9WD 2HFTA 4JFEB 5HYJA 2DBLL 4CBPA 5D7IF 3U0WL 1FZMA 4L1HA 4MD5A 2E8YA 1NGZA 3QFJE 1FPTH 4R0LC 3QO0A 5JW5A 5IB2B 4NPYA 5I6XB 1PGRB 2YWYA 4PS4H 3U4AA 4Y5VB 4ELMB 4JHWH 1I8KB 4FTVD 1WAAE 3RVWD 2B5IC 1T0PB 5KVDH 1D3CA 3VD4A 4M62H 1TJIL 4OCSH 2JK5A 4NCC2 3ARQA 3V7AG 3C2SA 2M26A 4D9LH 2X4PA 4OIIL 4FRWA 2DQDL 3GSOA 3CMGA 4X5XB 1A3RH 2GITB 3GJFA 2J8UF 4W68A 3DURB 2OR9L 1YEDB 1IEAA 3BSZH 4BSVB 3LN5B 3OAYK 4N9OB 5A2LH 2H2PC 2I25N 1F5WA 4KPHH 3DTXA 3VXSB 4CVUA 5DJXB 5EUOB 4JZJC 4IOSD 4ONGL 4MAYC 4RMUA 2OBGA 2AXFB 2IFFH 2F54D 1KIRA 2LU3A 5T33H 4OKDA 5E6IB 3NIGE 3V8CA 3ZE2F 2JJWA 4JPWL 1WISA 4KKLD 5FIEA 3QPQD 5SX5H 4U1GB 1I9JL 1NMCB 3SPVA 3KJ4C 4HHAB 1F90H 1MUJB 3ME0A 3QUZA 2BOCA 5IVOA 5CEZH 3MNVA 1RUAH 2PYFB 1TVHA 4H1LG 1NH6A 1KIPB 1DBMH 5BO1H 3ARRA 2YD8A 3OBAA 4GKNB 2ZPKL 4JZNA 1UVQA 2BOBB 5IMKB 4HUVB 5DDHB 3UTTB 4HUNB 4PJXE 1XF4A 4HUXA 3CZFA 2X6MA 1LQSR 1P2CA 4L8DA 4XGZB 1VFAB 2E7MA 3NIDF 3PDGA 2VXUH 2F8VA 2R4SL 1RMFL 3WFCH 3KXFB 3KPPA 4B0MM 1ADQA 4LNRB 2H3NB 3GK8L 5FHBL 5DJDA 4BFIA 4DGIH 4LSVL 4P3CL 3BISA 4R6UA 3T04D 4Y8DC 1AD0A 4V2CB 1WIPA 2BDNH 3INUL 4HSQA 5JLZA 2CR3A 3EZ8A 2AQ3A 4RISL 3DX9B 3SCMA 1ADQL 3MUZ1 4YDVB 4ZNEA 4KKNA 2ESVE 1U8IA 3MLRH 2CH8A 1TCRB 1J86A 1KYOK 4OGYL 4I3RL 4OJFL 4A2MA 2AXJA 2ITDA 4X83A 5MEND 5E2JA 1QO3B 1CGUA 5CZXC 5J06A 4M4RA 2YK1L 1YECH 4FQHB 1PDKA 3WHXA 4EQ2A 5KS9E 4DGVH 5C0CA 3WFEH 3EW3B 1ZHNA 2WBJD 5B39B 1CZ8H 2FD6H 4NZDA 2FIKB 4ZUUA 1AI1L 4N0FA 1JGDA 2D0HA 5GSVB 5I1CH 1EBAA 5KJRH 1V3JA 2IBBA 3N06B 2XKNB 1FNAA 3QA3B 5IM7B 5IHBA 4J3SA 4OD2A 4PRNA 3SGDH 3C5JA 1VFBA 2AERT 5EU5A 3RA7L 5L2KB 5KTEL 3ZHKA 4OI8A 3BKCH 1IFHL 3N9GH 1S7XB 4QXGL 3D85D 1E27A 3BIKA 3IDNB 3CX5K 2ZUVA 2JJVA 2Y23A 2Z31D 1HI6A 4NNPL 3G5YA 4Y2DA 5JZ7D 3WLBA 1SJHB 1CS6A 3NFPB 3PWPB 3AREB 5AG9A 2DWEA 1UCTA 4V1DB 3VXME 4YHPB 3G6DL 5I74B 3RIAK 1FNSL 4RAUA 4LQFH 2G75A 1B0RB 5DQJB 4NNYA 2D7QA 5JDJA 1VERA 2Q76B 4CADB 3T0VA 1PLGH 1RHHA 1CLOH 2MQ3A 5BZWA 4MXQD 3LEVL 3QWOA 4O58H 2HT3C 2EIDA 4ODHL 1JHLL 4MDJA 4LLQA 4PJDF 5AWNH 4U05A 4BZ2L 5DMIH 3ZDZE 1P9MC 5ITBH 1P84J 5HVWA 3PQYD 3D5OF 4KRPB 3X12A 3P4MB 3WFDH 4HQQL 1G7JB 2HJLA 1OW0A 2UWEB 1P6FA 3PWNA 3HR5B 5FYJH 3KPMA 2EKSB 2WLYA 4OAWA 5MERA 1Z0MA 4PJAF 1M05B 4X9FA 2Q3AA 3CFKB 3OKYA 3OJVC 3TBTA 1XCTA 4KJYB 3MSPA 2QQLH 3PWLB 5L6YH 2MHAA 2XKSA 5DYOB 3RWGA 1ZEAH 5F9JA 5C0BA 5ABDE 2AK1H 3MFFB 5E1AB 1XGYH 4ZD3L 1CVRA 2GSIB 1YYLL 1XMWA 5E2VH 4BQ9A 5J4MA 4XVSH 1HIML 4OI7A 4H25A 4Y4KB 4NRYB 1UADC 5SWSB 4R97B 4JM2A 5FUCC 2QHRL 2RB8A 4UBDC 3L3DA 2Q8AH 5JXAL 4Q9RL 3MROA 3OAZH 5J11B 4K3HA 1N64L 3ILPB 5DJAA 3D0LA 5B8CB 3AS1A 2FR4B 3BESR 1QPXA 1QLEH 5FKPB 4IIQC 5JOFA 5FM5O 1HQ4A 5TDNB 4KROB 5E2WH 5ITFB 3QIWA 5I66B 1DEEA 4QY8B 4LRNL 3RHWK 3DNKA 4DK6A 4K55A 3BO8B 1JWSA 4LU5L 1A1OA 5ANMB 3N50A 4IDJH 4TOYH 4F57L 3GBMH 1A7BA 5IOPB 2KUTA 3RDTA 1UKQA 8FABA 3QXUA 4MXWH 2R0KL 5LWYH 4NO0B 5HDQL 2HAZA 4X4MA 2JIXB 4UT9L 1VESA 4FABH 2R9HD 4WU5A 1BQLL 1WBXA 1NBQA 1KPVA 2A6KA 4WGVB 4ZSOE 3ZSTA 2DQIL 1J5OH 1U8LB 2AVGA 3T0DA 4C54A 5ISZA 4M6OL 4ZPVB 4AL8H 1NAMH 3K4ZA 4LIQL 2UUDK 4UV7L 3VFWB 3K2MC 4WW2B 2EDQA 5EC1B 4UUJA 4YUEL 1MHCB 4TRPH 1WC7A 1WWAX 4JFDE 1KXQE 4O02H 2EYSB 4LAQH 1AXSA 5CJBA 3GGWB 3L3OA 1JL8A 2DBLH 3MTRA 4P23D 4OFVA 2XNAB 4NO3B 4M6NL 4MAYD 1MJ7L 3LEYH 2ZUQB 1D5MB 5CGYD 5T1LD 5F93C 1G6RB 2IG2L 5D5ME 4LPTA 3FMGL 1CFNB 2BY0A 3MRFA 5MI0B 1WUNT 1IGTA 3FFDB 1CF8L 3WNNA 3E3QE 2LAGB 2G2RB 4X7CC 5DURB 2VL4A 5F3BB 4HUUA 2PYEE 4MD4B 5JPNB 4OSUL 2G9HA 5I1GL 4Q2ZB 4AMKL 4D0DB 1F00I 3GRWA 3RNQB 4G8GD 4NKDB 3WIHA 4YZFF 5HHOD 1RVFL 2WINB 4OIIH 4PJHA 5I16B 1UT9A 3MO1A 1RZGB 2OR9H 2G5BB 3PGDA 4HIJB 3V6OA 2H9GB 3EYFB 1MHHB 5GIRA 1UYWL 3GRWL 1RZFL 1T5WA 3MBEC 4JKWA 4ALAL 2JCCA 3C09C 4Y4FA 3WYRA 1BREA 1X3DA 3GJFH 4ONGH 4UTBL 4J7RA 3E6FA 3HI5H 4PRHA 2YD3A 4KI5F 4A6YA 4D8PB 5AAWA 1CDYA 1MFEH 5E70A 2W0FB 1OQXA 3Q1SL 4PJCA 3RL1A 3ULVD 4ZQKA 2J7LA 3ZE0F 2JCCF 4U2ZA 1JE6A 1DSFL 1I9JH 5D7KD 4BQBA 1I7ZB 4A6YL 5KN5B 3IDMB 4FQCL 4HKZB 3G9VA 1NSNL 5D1ZC 5IB3B 3O3DB 3ES6B 1CXHA 1MQKH 4PJCF 5CZXD 1ZXQA 1KTLA 4MQ7A 1AR2A 2VIRB 4O51B 5ENWB 2QR0B 2ZPKH 4PBWD 4WO4B 5KOVC 3H9HA 5T3ZH 3UTPE 4LLDB 1M71A 3D3VB 3CMOL 5F88B 2PTTA 4QRRE 3VFSB 1FVDA 4AYFA 3P0YL 3ULUD 4IS6B 5CIPB 4P59L 1MHPH 1CLYH 5LBSL 2R4SH 2W91A 1JGEA 1RMFH 2A83A 1KCUL 5IGXL 4JFEA 5J13C 2HMIC 1S7QB 2QSQA 2Z0BA 4JY4B 2DQEH 4PGDB 4G9FA 4LSVH 4P3CH 4C56B 3T65B 3PHOA 2C3GA 2XZQH 3HAEG 4Z76B 3INUH 3AS3A 1GJIA 3N1GC 4RISH 5HGBB 4LLUB 2I9LB 1OD9A 2ZCHL 2CK2A 1MNUH 4AEHH 2UZIL 4MVBC 2JJUA 5IB2A 1QR1A 4OJFH 1BIIA 3F6LA 2R56L 4Y5VA 4ELMA 1BZ7A 1I8KA 2DQGH 3ZKSD 4BH8A 4LKXB 3T8XA 3CVIL 1NGYB 3HFMH 1NFKA 4YHMH 4OZGF 1AI1H 5FUCE 1JHKL 2MNUA 5A2KH 1J05A 4WWKB 4KFZC 5C9KA 4X5XA 3H9YA 2GITA 3RAJL 2XTLA 3DURA 4F33B 1YEDA 3IFLL 4BSVA 5I8CB 3LN5A 2HT3D 2PW1B 3PWJB 3RA7H 3VXSA 1ZVHA 3L3JB 4Y88A 4YBHA 5EUOA 1J12A 1IFHH 4QXGH 2Y06L 5KSBB 2AXFA 4FFWD 1OP5H 5E6IA 4JJHA 3LKOB 4NHCL 4NNPH 3MV7D 2VSCA 4Q6IC 1TETL 4AIZB 4NKOB 2RHEA 3IFNL 3D39E 4HHAA 1MUJA 1HQRB 1FQ9C 4JFQB 1RZIB 1II4E 5GS1C 1KGCE 3C6LC 4NC1C 1KIPA 2NY4D 1JWUB 2VWEC 3G6DH 5DHYB 4XWGL 3MRIB 4GKNA 1T1YA 5E1HB 1YEFL 2BRRH 4IRSB 3IF1B 1NDGB 1NGWB 5IMKA 3UTTA 1G7MB 2IBZY 3T1WA 4L3AA 3SDDD 3BP4B 3UPCA 4AM0A 4EXKA 4OLZL 1FFNB 43CAB 4GUPB 4POYA 3LEVH 3QPXH 4ZXBC 4LLVA 4XGZA 1JHLH 1VFAA 1Q0YL 2EH7L 4BZ2H 3KXFA 5GGTA 4KXZI 2V2XB 4LNRA 1BVLB 4NQED 4G6FB 3K8KA 3AM8A 3OXSB 2XTJE 5D4QA 3BD4A 3OR7B 4XCYB 4UBDD 4XPTH 4PJ5E 3TF7C 1CK0L 4M03A 5TE7L 3DX9A 4LPCA 5GGTL 1PVHA 4YDVA 1UB5B 5DF0A 1MSPA 4BFBD 1JPFB 4GBXA 1PEWA 1YEJL 1TCRA 5GISL 2GTWB 4UIMB 3VFVB 1QFPA 4KQ4H 1QO3A 3EYOB 4BQ6A 5ADPL 4FQHA 2VXTL 5KSAD 1UQSB 1DDHB 5B39A 4OQTA 1K2DB 3RP1A 1G9EA 5C0JB 4Y16B 1YC7A 2FIKA 4TQEL 3WKML 4ZD3H 2NXYC 5GSVA 1YYLH 4DKAA 1KN2L 4OBSA 1FL6B 1HIMH 4S2SB 2XKNA 4OQTL 3QA3A 1Q9WB 5IM7A 1HCFX 5I73B 1JPTL 2WQ8A 1YNKL 5L2KA 5E56A 4GOSA 3GMOB 3LIZL 4U0RB 5FYKE 1CU4L 4XP5L 1S7XA 5JXAH 4Q9RH 4NUGL 2PO6D 2MJWA 2BSRB 1ZLVH 2WMPA 7FABL 4DKFL 5SWZB 4NQSB 5FDWB 4HV8B 5I0ZA 3B9KB 1SJHA 2EDRA 5KSUB 1JYNA 2OI9B 1S5IH 2O26U 3NFPA 5EU4B 3PWPA 4XNZB 2OZ4A 3AREA 4LU5H 4HMCA 3M8OH 4V1DA 3W0WB 3WJLC 4G43B 2OX5A 4YHPA 4MMZC 4GXVL 4ELKB 2WM0A 2L4OA 1B0RA 4M1GH 1RIHL 5DQJA 5HDQH 2Q76A 3P0VH 1QQDB 4CADA 1RK1B 4UT9H 4X6DF 1BQLH 4DAGH 3G6JB 4ONOA 4AENA 2WK2A 4DZBB 1D9KB 1S78C 2KZWA 5D70H 5BVJB 2B8OT 1N0LA 2DQIH 2ZP0T 5IVZB 1NANI 3PDOB 4M1DL 4P9ML 3VXTB 5GRYA 1XGUB 1BFVL 1CDHA 2QADB 4L29B 1NCWL 4JFHE 4HPOH 3T1FB 1L7TL 3BKML 2LAAA 4UV7H 3IDXH 3P4MA 5M7QA 4YUEH 2Z91B 1UM4H 1UZ8B 1G7JA 5EULV 5F7LB 2UWEA 4PJGB 3HR5A 2ZCKL 2VLJE 2EYRB 2EKSA 1CFBA 5C0DB 2AGJL 5C0GB 1JMXA 1U3HD 2P4AB 3U4BL 3R06B 1W8OA 3CFKA 4M1CC 2XWJB 4RGOH 5JIKA 4OD3L 2ATKB 3TVMD 1YEGL 3ZT7A 3SDCC 1AH1A 2IFGA 2WIIB 1YPZF 3BHBA 3D69B 5DD1L 1KLUB 4XPGL 5DYOA 2R0ZH 4YBLB 1JI1A 3S7GA 4ORGB 2XFXB 1YMME 3MFFA 3MLTB 2APWA 1CF8H 3OAUL 5E1AA 2MSPA 2IPTL 1CG9B 5CLTA 4NN6C 1I75A 2OL3B 1AJ7L 1JJUA 2DKMA 4OSUH 3L1OL 4L4TD 4HT1L 4GMSL 3FO2B 4AMKH 4EI5B 1TVDA 4GSDL 4UINL 4Y4KA 1CL7L 4NO2B 4NRYA 5SWSA 2YD1A 1X5XA 1RVFH 3CDGA 2YZ8A 2GUOB 1IQDB 1S9YB 3QEHB 3VFMB 3AB0B 4BK5A 2C1OB 3ILPA 4FQPA 1I7UB 3HAEA 1HHIB 1UYWH 3GRWH 5B8CA 3NIFE 2IGFH 2VDLL 3WIHH 2DQFB 2FR4A 1S3KH 5FKPA 5BRZE 4UTBH 2F54B 3PUCA 5TDNA 2HMID 5ITFA 5I66A 5ILTH 2K9UA 1I1AC 2HFGL 4JQIL 1WEJL 3Q1SH 1WTGT 1FVEB 1RJYB 4Y1AD 5IOPA 4MJIA 4MVBD 5I2IB 4NO0A 4A6YH 1EO8L 2JIXA 1T1ZB 2R0LH 2OJZL 1CL7I 2R39A 1D7FA 5IFAL 1UH3A 1U58B 4WW1B 3B5TA 1U8LA 2GJ6A 3DVGB 3CU1A 3CMOH 3QCVL 3GSRB 1JCKA 4ZPVA 2J4WL 4JRYD 5EBMB 4CN4A 1PKQE 2N7BA 3VFWA 3S3PA 4CGTA 1X5GA 4WW2A 4EN3D 1MY5A 5EC1A 3JWDH 4P59H 1A8JH 1BHGA 5LBSH 1MHCA 4OIBA 4KTEL 2EYSA 3GGWA 1MPAL 4R4ND 1NEZG 1MCQA 3SE8L 5FYKL 4QTIL 12E8L 2A6JB 3MPCA 1NJ9B 3MRLB 5I1EH 2XNAA 4NO3A 5CJXC 3WFBL 4Z78B 4MNHB 3SDXE 1DQLL 1D5MA 2ZCHH 2VLKD 4NGHL 4B5EA 3FOMB 3B2UD 1G6RA 3AVEA 2UZIH 5T1KB 3VWJC 3RVVD 1A7OL 2XN9D 5MENB 1CFNA 3P0GB 5TF1H 4M48H 3FFDA 2BFVH 4P2RD 2G2RA 1G6RL 2BZDA 2YD5A 5F3BA 2P5WE 2WBJB 2CQVA 4MD4A 3CVIH 5JPNA 5KSVA 3UTSD 4Q2ZA 4PG2C 1NEUA 4D0DA 4WFED 4NKDA 4UTAL 2HRLA 2V9RA 2WINA 1OGAE 5DRXB 2XY2A 1UZ6E 3GM0A 5I16A 1RZGA 1BQSA 5I0DA 2J6EA 2G5BA 3IFLH 4HIJA 1IBGL 1OCWL 2H9GA 1NGPH 3EYFA 1MHHA 5GJSL 1OWWA 2VDNL 1DBBL 4U7SA 4KRMB 1NCAL 4MCYB 1VEPA 3SDAA 4Z7VB 2NY0D 2VH5L 2Y06H 1UKTA 1KPUB 4BFGA 2J6EL 4EOWH 1XGQB 5IBUB 1NFDE 1LO4L 5D6DC 3UO1L 4YK4C 4D8PA 4W6XB 2W0FA 4NHCH 1TETH 1S7SB 4GAJL 1VB9A 4NQVB 2B4CC 1T1WB 5AYUH 2DLTA 1I7ZA 5KN5A 1G7PB 3IDMA 4HKZA 4QRTB 4WJ5B 5IMMB 5IB3A 4OLXL 1IGML 3O3DA 3ES6A 1ZGLM 1VACB 3G5VB 3N85L 1IT9L 1RHFA 2A74B 4XWGH 2VIRA 4O51A 2XIDA 2EIEA 5ENWA 1YEFH 2QR0A 4WO4A 3V79C 1R5VB 2HT2D 4LLDA 3X3GL 4LASH 2W59A 3D3VA 4X6EB 4TVPD 5F88A 1R3KB 3GSQB 4OLZH 3VFSA 3L6FB 2NXYD 4IS6A 4H5SB 1IGFH 3N1FC 1Q0YH 1P5VA 2HKHL 2EH7H 4GAFB 5GGSY 5HHQB 1S7QA 3PQYB 4JY4A 4PGDA 3O9WB 4C56A 3T65A 5C07E 2D9CA 1EAJA 1JF6A 5EO0A 2VDKL 1BPVA 2D03H 5HXMA 1CK0H 1Q8MA 2W65A 5HGBA 3EOYG 4NJAL 5GGTH 4S1RL 2I9LA 1IRAY 3MBXL 5AUMB 4JFFE 1BECA 3LPWA 2QQKL 4DFIA 1HXYB 1YEJH 3P9MB 5EC2B 1Z9SA 1IILE 5CJ5A 2R0WH 2KPNA 2Q87A 3WBDA 3Q6GL 5TQ0L 2KZ1B 5HI4C 4NQCE 2VXTH 2PR4H 4KJQD 3DJ9A 2VSDA 4LKXA 4MQSB 4RGNE 4WNQB 4HKBA 3ZDYE 4XPBL 4AEEA 1NGYA 4NC0B 3MV01 5AEAA 3S5LB 1N6QL 1X7QB 1SMOA 4KDVA 4QWWC 3NFNB 4G8IB 3WKMH 3IJSB 4PRIE 4FXGB 1PZ5B 4LSRH 4WWKA 4CDHA 5ACZB 5F9OL 4G8FA 2DI7A 4HJ0C 4F33A 4OQTH 1JZ7A 4JCMA 1S78D 5I8CA 1J1PL 5IKCB 2PW1A 1P53A 3PWJA 4P5TD 1QSFE 4GG6F 3JVGC 3LIZH 4NQXB 3L3JA 3PDDA 3TH3T 1CQKA 3B6SB 5KSBA 4JG0H 5D72L 4MLSA 4NUGH 4WEBH 2L7UA 1KOAA 5IR1B 1CFTA 1D5BB 7FABH 2VDQL 4DKFH 4RFOL 3LKOA 3EFDL 1XR9B 5FCSH 4QHMB 4NKOA 2ZUXA 5E08L 3DHMA 3VXUD 3GKWL 1HQRA 2LTQC 4JFQA 4M1CD 1RZIA 3EKCA 4R0LB 1T5XB 1FORH 3QFDA 1Q9KA 1JWUA 3L3IB 5DHYA 1KTDB 4GLRI 4W6WB 4R8WL 3DARA 1RIHH 3IF1A 2OZ4H 1NDGA 1NGWA 4FTVE 3QDME 2JE8A 3OSKA 1G7MA 2F5BL 3R4DA 3BP4A 1H15B 4MA3A 1FFNA 2B5IB 4XH2B 3QDJE 3VGFA 43CAA 4GUPA 2AJZB 4P9MH 2WWMC 5A43C 1BFVH 2R2BB 2V2XA 2GAZB 1BVLA 5TH2B 3P30H 3QQ4B 5GGVH 1OSPL 3OXSA 1HWGB 2X7LB 3OR7A 4XCYA 5IJKA 3LVEA 35C8L 2ZCKH 4N9GB 2MOVA 2AGJH 3ARFD 1JPFA 4JZJB 4O5LH 2GTWA 4MAYB 4UIMA 3VFVA 1A22B 3W39A 1V3LA 4OD3H 4R3SB 5TGBB 2NX5B 5E03A 1I1AD 3EYOA 3QO1B 4IOFD 5I1HH 1UQSA 1YQ2A 1GOGA 2EO9A 4PJEE 4Z7WF 3KJ4B 4Y16A 3TPKA 4F9PC 5C0JA 3OAUH 5DZNA 2IPTH 2CDGB 3OKLB 3V9FA 4JDZB 1HXMB 4XP4L 3I75B 4HS3B 1BFSA 1EZVX 1FL6A 2EDDA 4S2SA 1Q9WA 4HT1H 2V5YA 1R3HB 3EFFB 4GSDH 4UINH 5HHOB 2X4UB 2VLRE 2BP3A 1JHTA 4R9HA 1A6UL 3GMOA 4L4VD 3O3EB 3PGCB 4O2CB 1F3JB 2OSLB 5M94B 1UKSA 2HKFL 2CO6B 3FFCD 5MEOB 3S9DB 2BSRA 3ZKMC 1GOFA 5TE6L 3RNKB 2VDLH 5M95B 2B7DT 5SWZA 2X9YA 3GIZL 1FP5A 4NQSA 5FDWA 4HV8A 1MRFL 5I1JL 5KVFL 3B9KA 1RZJH 5KSUA 5AG8A 2E9BA 3HAEH 2AW2A 5EU4A 1CQYA 4JQIH 1WEJH 5IESH 1YEKL 4F58L 3BKJL 3W0WA 2AP2A 2QEJA 4G43A 4W4NA 5E0QA 4QKXB 4U6VL 4ELKA 4HK3N 5A40E 5B4MC 1KCLA 1IAKB 1QQDA 5FEBA 4HXAL 4LLAA 2Q8BH 4QXUL 3ROOB 2Y7QB 5J3HD 2OJZH 4OGAC 2O5ZH 4GO6B 3G6JA 4YDLC 4DZBA 1D9KA 5HHVH 4RIRB 5BVJA 1F4YL 5IFAH 5IVZA 3PDOA 1FBIH 2PW2B 3VXTA 1R24B 1T4KB 5BVPL 3RUGF 1DL7L 3I85A 3QCVH 1TZIB 1TITA 4FFZL 3JWOL 4L29A 1EJ6A 4TN9A 3T1FA 3S35H 2Z91A 2K3TA 2VB5A 1UZ8A 4KTEH 3IFOB 1T21B 1MPAH 5H35B 1RU9L 1GGUA 4PJGA 3UTQA 5CWSB 3REVB 3CH1B 2EYRA 2IQAA 5C0DA 4P49A 5C0GA 4QTIH 3ZYJA 2V5RA 4OCNC 4V2BA 4OLVH 2NY1C 3R06A 2IQ9L 1I7RB 2XWJA 3WFBH 4WI5A 2ATKA 4NGHH 1NFIB 4Y5YC 2WIIA 3D69A 4I0CC 1KLUA 3T0WA 3RQ3A 4YGVB 4ORGA 1AQDB 3SQBA 2XFXA 2ATPB 3MLTA 4JB9L 1CG9A 4XHQA 3AS2A 2OL3A 3W9DB 4HBCL 1MVFA 1WF5A 4BA8A 1V3MA 2CUHA 2AJSL 4EI5A 4NO2A 1I8LA 4XNYH 1CFSB 3PP3K 3C60C 1ZS8B 2GUOA 4BKLB 2OL3L 1IQDA 1S9YA 4X9BA 3QEHA 3VFMA 2L7JA 2C1OA 4NDMB 3D0VB 1OCWH 3PGFH 5GJSH 1I7UA 1HHIA 4Q0XL 2JJTA 2DQFA 2VDNH 1DBBH 5E8EB 5CKAA 2GEEA 2F54A 2VH5H 3DROB 2J6EH 1QP1A 3WS6C 4NM4H 4WCYL 3TZVC 3QXDB 3MV7B 1KCVL 1A7NL 4MMXC 4MB5A 1FVEA 1X5LA 4GAJH 1RJYA 4MA8L 5D1XC 2FB4L 1A3LL 3RVUC 5I2IA 5DC9B 3ZTJG 3OV6A 4K94L 3JBG7 4EUPB 5C1MB 1T1ZA 2NY4B 4S1DC 3QFJA 4OLXH 4YHLL 5K9KB 1IGMH 4YHOL 2E5EA 3N85H 4AEIL 1IT9H 5HI4D 3KR3H 4KDTC 1QLFA 3RBGA 1U58A 4WW1A 1TPXC 3CVHB 1FGNL 4N0CD 25C8L 2XQBL 3DVGA 4TVSa 4I2XE 1JNLL 4HH9B 1JRHI 5FK9B 4LVEA 1WAAA 1TVBB 3KJ6L 1KXTB 2ZZUT 2HKHH 4HJ0D 1NC2B 4NQEB 3DSNA 4OLWL 1LEGB 2FEDD 3DBXB 4U6YB 1MIML 4D2NA 4LLYB 2I26N 4N0RA 2A6JA 3GBLA 1BD2E 3CPLB 1NJ9A 3MRLA 1WAAF 2C5DC 1AC0A 1O7VA 1NCTA 1U8HA 4MNHA 4Z78A 4NJAH 2YUXA 1AHWA 1TZHB 3FOMA 4IIQB 5T1KA 1JVKA 3UXFA 2QQKH 2H8PA 3QZWG 5MENA 1X44A 4OZIB 5DVLA 1LP9B 4X80L 4N0UB 5BQ7B 2WBJA 2DM4A 4KK9D 4XPBH 5F3HB 1BFTA 3KYOB 5BOPA 1N6QH 3L5IA 1OAKL 1AO7D 4AG4L 5J1AB 1MFAH 4KRNA 5DFTA 5DRXA 2KKQA 4D9QE 2DYPD 2XXCB 5F9OH 2B1HL 3NIGF 3JV5A 1BEYL 2COQA 2EE3A 2HP4A 3F65A 1HN1A 4X9HA 1UWGL 2VQ1B 5FOJA 4M7LT 4NP4H 1N59B 1AY1L 1BQHG 5HBBA 2X5PA 5DK2B 2VL5B 4HAFA 1NUFA 1U9KA 2WWMD 4PJXA 1A2YB 2EDOA 4MCYA 5HJ3B 4Z7VA 2XXMB 4H20L 4RRPG 4XNUL 4ZO8A 5D72H 2E9WA 1XGQA 5D8JL 2C4XA 4Z7OE 5MP6H 4ZUVB 4RFOH 1NBZB 4M5ZL 3UJTL 1S7SA 4PJXF 4NQVA 3L7EB 4WUUE 4IOIB 2E6QA 4NJ9L 1C12B 4NZRL 1IZKA 1G7PA 4QRTA 4WJ5A 5IMMA 4MB3A 4QRPD 4RZCB 1RURL 1VACA 3G5VA 2A74A 2ESVA 1KB9J 1R5VA 4KAQL 2F5BH 2PKDA 1V05A 1VCAA 1FG2B 4X6EA 1R3KA 3GSQA 3L6FA 5EU6E 3TYFB 5JORB 5MEQB 3FRPA 3U7WL 4H5SA 2A0LC 4G8GE 4PJ7E 1MCBA 3BXNB 4QCIA 5HHQA 1PX3A 3E6HA 1IE5A 3GMLA 3O9WA 1FZJB 4D0BB 5KS9F 5AD0B 3ZKMD 3DV4B 35C8H 3MBEB 5AUMA 2O5XL 4Y4HC 5FB8B 4YHNB 3C09B 1HXYA 5FECB 3P9MA 5EC2A 1OARH 5FFLA 2KQMA 5CZKA 1DE4A 4NO5B 1G1CA 3K1DA 1WCBB 5D7KE 2GSGB 1X5JA 4LVHC 4WNQA 2EDTA 3I2CL 3E2HC 3UBXG 3S5LA 3I50L 1X7QA 2FDBP 3OKMA 5B4MD 3NFNA 4G8IA 4YAQB 3IJSA 5D1ZB 1Y18A 4FXGA 1PZ5A 5ACZA 1A4JB 4L4TB 3VXMA 3OQ3B 1YA5A 7CGTA 5ERWB 3TBYB 1Q0XL 1IARB 4X6CE 3MJ6A 1P4LB 1XGPB 3GMQB 3BOVA 3MGOA 5IKCA 3GUTB 3ALWA 4ODTH 4JFPB 1INQB 4NQXA 1MELA 4LLWB 2ZSVB 3B6SA 1ACYH 2HKFH 5CHNB 4N5UA 1JYXA 1Y0LB 1D5BA 5IR1A 2IBGA 2JLLA 4EBQL 1XR9A 5JOPD 5J13B 4XCFL 1MRFH 4QHMA 5I1JH 5KVFH 4PBXA 1MI5B 3EGSB 3ZT6A 5I19H 2VUOA 4UB0L 2DMKA 5GS2H 4UDUB 1W0WB 3GSUA 2NY1D 1YEKH 4DOHB 4F58H 3BKJH 2ZUSA 4J3XA 4R0LA 1G7IB 1LK3L 1T5XA 3EYQC 4U6VH 3L3IA 1KTDA 3F6IA 2CGRL 3H9SE 2CLRB 2N4IA 4WFGD 2F15A 1IL1B 4CDGC 2DKSA 2D7MA 1H15A 4QXUH 5EA0L 1ZT1A 4XH2A 4XVJL 3DXAB 3TYGL 5IB1B 2XYCA 1KTRL 2AJ3B 5BVPH 1B6UA 2BC4B 4UMGA 2R2BA 2GAZA 2EZ0C 3OXRB 5TH2A 4FFZH 3SE9L 3JWOH 5IMOB 3QQ4A 4Z7UB 1MY7A 4P46C 1PQZB 3BUYB 2VDPL 3C60D 1IM9D 2X7LA 1CDIA 1RJLB 2ED9A 4LSTH 1RU9H 4FQLL 4N9GA 1FAIL 4JZJA 4OT1L 4MAYA 3EO1B 4XNMB 2F8OA 5FM4A 4AJ0A 5ESQA 4DEPC 3KPSD 4XRCB 3DGGB 2VLKB 4FQIL 4R3SA 5TGBA 5F7KC 1FZKB 1DLHB 2C3VB 2NX5A 5C09D 1J1XH 5EO9B 3RX8A 3VDAA 3QO1A 2XN9B 5DA0B 5D7LE 3M1BB 3W81A 1K5NB 4P2RB 4ZO9A 5D1XD 5FUZL 4NBYB 2R1WB 4JB9H 3RVUD 2CDGA 3OKLA 5GS1B 4JDZA 1HXMA 2OR7A 3C6LB 4LEXL 4CUCA 5ALBL 4S1DD 4HS3A 2XI9A 1J8KA 4ZPTB 2AJSH 3H9ZA 1R3HA 1T2XA 3EFFA 3ESVF 5HHOA 5HYJD 2X4UA 3B2VL 3IS0X 3KHOA 4MWFB 1J0ZA 2OL3H 3O3EA 4YBQD 1FV1B 1KJVB 3PGCA 4I3SL 5FM8A 5IUSA 2OSLA 4WFHD 5C2BH 2PTUA 1OY3B 1R5IB 4P3DA 2A38A 5MEOA 4ZXBB 5C0NC 1QEWA 4HFWB 4ZSOA 1WITA 4Q0XH 3RNKA 3TFKD 5ECJE 4XCNB 4NHUB 4WDIA 4P2QD 3DECA 2HFFB 2XG5A 4WCYH 3C5ZC 1NCCL 3MRRB 5FGRA 1KCVH 4LPXA 3BMWA 1A7NH 3ALPA 4B7LA 4UU9B 3CFBB 4J12A 1A6PA 5A2IH 4MA8H 1YEEH 4J3VA 2FB4H 1A3LH 1IAKA 1CTNA 3ULVL 2FGWL 5GRUL 3EJZC 2Y7QA 4YHLH 4D3CL 4YHOH 1VFUA 1RUPL 4PJ9C 4RIRA 5EDXA 4S1SL 3RJDA 1FGNH 2PW2A 2XQBH 25C8H 1R24A 1YDPB 3IDJB 2VXVH 1TZIA 2NXYB 4HKXB 3KJ6H 3HNSL 5F6HI 4LGPB 5D5MF 3O81A 4XB7A 2YN3A 5ICYB 3LRGA 1BQUA 4OLWH 3IFOA 1T21A 1AD9B 4YEFA 5H35A 3ULUL 5CWSA 3REVA 3CH1A 3ZMRA 1MIMH 2BNQD 3T0EE 3D48R 3GSXB 5T3ZD 5HD8C 2O5YL 1I7RA 1MWAB 4MS8C 1KENL 4YFLI 1NFIA 3UAJC 2IH1B 3W5MA 3ARSA 1ULVA 1S7VB 4YGVA 1MLCB 1AQDA 2ATPA 5E9DE 3UROR 2DJ4A 3GIVB 4X80H 5E2TL 1KYOJ 2FX9L 3O6LL 5CZVL 1BF2A 2WLZA 2DM3A 5JXEC 4JO1H 4U6TA 1T3FB 4JPVL 3WXVL 4K8RC 4PRPE 1HDMA 5D2LB 5KVGL 4JY5L 3WUWB 5B38B 5BV7C 1CFSA 1C5BL 1U2HA 4WVRA 5DD3L 5T3XH 1ZS8A 2QJDA 4BKLA 2B1HH 4D9RD 1BEYH 1XF2B 4LVNC 4Y8AA 4OCWH 4R7DB 5TFSL 4NDMA 3D0VA 1T03H 5T1MB 2A0LD 3Q6FB 5E8EA 1P9MA 1NGXB 4MNQD 4XNUH 5IQ7L 5DGRA 5ESVB 3MV8E 1U36A 5D8JH 3MV7A 1AIFB 3WIFA 1T89C 1HNFA 1QFWL 2QSTA 4FZEL 4OF5A 3CX5J 3T3PE 1ZT4A 4Y4HD 3NH7L 5HYFA 4HG4K 1TQCC 2J1KA 4NJ9H 4NZRH 2NW3B 4EUPA 3UBXA 4WIQA 3Q5OA 5K9KA 2NY3C 1RURH 4Y5XC 3DVIA 3QUXC 3BPCB 1TJGL 5HGDB 5JHDE 4HH9A 3RL2A 1WV7T 5FK9A 3WIIL 1QOKA 4NN6B 1ZVYA 1TVBA 3U7WH 2X4QB 4JANB 2ED7A 3CVHL 3OB0K 1EVTC 1T22B 1NC2A 4NQEA 4FXKB 1S9WB 3S36L 2MQ0A 1LEGA 2V2TB 3DBXA 4U6YA 4LLYA 1QRKA 3CPLA 1J11A 4GFTB 3WO3B 1GPOL 5CP7B 1QFWI 2AJXL 4RGMC 2YOCA 4L5FH 1G9NC 1TZHA 2O5XH 3VG0H 4IIQA 4ZFGL 1Q1JH 5MEPB 4OZIA 1S7RB 4ZS6C 3SJVE 1LP9A 1I1AB 3MRJB 4Q9BA 4QGYA 1IGJB 3G5ZB 4Y1AE 3K8LA 2Y6SC 4N0UA 3AGVA 3L3KB 1UWXK 4NQDD 4U4BA 5TE4H 5BQ7A 3EYQD 3I2CH 5ID0A 2CKBH 1EK3A 3I50H 4PY8J 5LJYH 5J1AA 3Q2CA 5GGRB 1UA6L 4QOKD 3IVKB 5FV1L 3CFCH 5T1DL 3EO9L 2W07A 2VQ1A 4JFZL 3ARZA 4OZFB 1Q0XH 1N59A 5SX4H 4KZDH 5DHXB 5DK2A 2VL5A 4JRYE 4L4VB 1A2YA 1ZGLA 5HJ3A 4U7KA 3FFCB 2CRZA 2EZ0D 4P46D 3NFSH 3VU2A 4PJIB 5EWIL 3VG9B 4UT6L 4J2XA 4DUVA 1NBZA 4EBQH 3TBSB 4XCFH 1T66D 4CMMB 3L7EA 4CNIB 5DMYA 1FSKC 4L9DA 4UB0H 4IOIA 1EERB 3LSOB 3T3MF 1C12A 3ARWA 5IW1B 3MGAA 4HUMB 2CMRH 4RZCA 1C16B 3VWJB 1T04B 4HUWB 5EORL 1LGVA 1CFQB 2Y36L 2CGRH 3VXQB 4P9HC 4C59B 5ID1B 1FG2A 3TYFA 5JORA 3UTSE 4KMLB 5MEQA 1I7TA 5JUEL 1KLFA 5DHVB 5B38G 1D5IL 4H26B 1PG7H 2XWTB 2WWKO 3BXNA 4NKMB 4Z0BL 5HVHC 4YDJB 1S7WB 3HN3A 3QIWD 3QJFB 2R69L 1DFBL 2VDPH 1DEDA 3DLQR 1FZJA 15C8L 1HSBA 4D0BA 1K85A 5ICZA 5AD0A 1BOGB 4ERSH 4MB4A 2ZNWA 3EIFA 4Q7DA 1UWEL 2XZZA 5BS0B 3V6FB 2LU4A 4JGJA 3SY0B 4FQLH 3MBEA 1FAIH 5FB8A 4YHNA 3MJGX 5SWQB 3WNPA 1QYGH 5FECA 1KFAL 1G7QB 5GSRB 4FQIH 4YK4B 3WD5H 3C5ZD 4NO5A 2MMXA 4JFXB 1C7TA 1HSAB 1WCBA 4JO4L 1ORQB 2GSGA 3VFOB 3GI9H 5FUZH 3ZHDA 4YAQA 3ZTJH 5D1ZA 4POZD 4LEXH 1KCSH 1PEZA 5ALBH 4FMFA 1A4JA 4L4TA 3WHE1 3BPLC 4Z77A 5ERWA 4PJ9D 3TBYA 4TVPE 1P4LA 1XGPA 3GMQA 2D7TL 3O4OC 3LMJL 5DA4A 3GUTA 4MQXD 4XZUB 4K71C 1INQA 5L88H 4LLWA 2DJUA 4I3SH 2ZSVA 2Y4SA 1SM3L 5CHNA 2IJ0C 1FYTE 1TTGA 1Y0LA 4DZ8B 3MJ8A 2FO1A 5DT1L 3VGEA 1EFQA 1MI5A 1K6QH 1V5JA 3BD5A 4HEPG 2NXZC 4CVZB 1W0WA 3MGTB 2ADIB 2AK4E 1MFCH 1G7IA 4HAGA 4MS8D 1YY8B 3HCVB 3OG4B 4IM8A 4F7CB 4FQXC 3UAJD 1CI5A 3H0TB 3KYKL 1OTUC 2CLRA 3NZHL 4YFEA 2FGWH 2X9WA 5GRUH 5DEFB 4RMTA 3GM8A 3BYYA 4W4OC 4D3CH 1VPOH 2H6PA 1RUPH 3RTQC 4KI5D 2YPLE 3DXAA 5JXED 4S1SH 3U9PH 5IB1A 5F89B 2AJ3A 1XAUA 2BNRE 4P4RB 4FG6C 1IC4H 1YMMA 4Y4FD 1AGDB 1F11B 2BC4A 4OUUB 5IMOA 3OXRA 4F15C 1VENA 3MQIA 4Z7UA 3BUYA 2FATL 3NA9L 4PRHD 4G80A 1RJLA 2EXWC 3HKFA 3V5DB 1KELH 3JUYA 3OKEA 2VXQL 1BJ1J 1IZJA 3EYSH 4KTDL 3DMMC 5CSBA 4JHBA 1VFOA 2FBOJ 3CK0H 4XNMA 3BDBA 5IVXE 4XRCA 3DGGA 4LGRB 2VLKA 4Y0GA 1KENH 1C5DB 1FZKA 1DTUA 2C3VA 5HYSG 5EO9A 2XN9A 4Q6IA 3M1BA 2XY1A 3VXUE 1ERNA 1K5NA 3G5XB 4F37K 4P2RA 4Y2OA 2R1WA 2MQCA 5E2TH 1FO0L 2LTQB 1RZJC 4LHQB 2FX9H 3O6LH 1KG0B 5CZVH 5GS1A 4C58B 3C6LA 2XA8H 4H0GA 3NIFF 3QIBC 5K33A 4HJGB 1QFOA 2VOTA 1ODAA 2NY3D 3BQUC 3FHAA 5F44A 1F2QA 1AO7B 5LCVL 2YUWA 4OV6F 3QUXD 4JFED 5CINH 5KVGH 4JY5H 1CE6B 1IAIM 2DYPB 2OP4L 4G9FD 4MWFA 2YA1A 3FT2B 2DLGA 4NZTL 2EDFA 4XPFL 5DD3H 3WS3B 1Z3GL 1FV1A 1KJVA 2E27L 4MA7L 3LQAC 1R5IA 3QEGL 4L8SC 3NCFB 5TFSH 4ZXBA 1MCDA 1JYVA 4HFWA 2PUQT 1T0NB 3P77A 4XCNA 2BSSB 4NHUA 5E7BA 3HNVH 2CO7B 3SE3C 4I2XB 3TH4T 2HFFA 3LZFH 1JZ2A 1GXEA 3MRRA 1SJEA 1ZVSA 1M6OB 1FNEB 2ADJB 4UU9A 1QFWH 3CFBA 4P2OC 1D6EA 4BH7B 2VITB 3NH7H 3HUJE 1EZVY 5DJ8B 3PP4L 5BZDB 2F9BT 4PTUB 2RFXB 3SKJL 1OVZA 2C4FT 4ZS6D 5FO9A 3PNWB 2LVEA 1DBKH 3FZUC 2GT9B 1I9IL 4RBPH 2I24N 1TJGH 3VXSD 1YDPA 4EUPH 4ODUB 3UPRA 1J7VR 3IDJA 5LXGL 3WIIH 3SDXF 2BCKB 4NN5C 4HKXA 1OWRM 1LDPL 5ICXB 3S4SB 4TVPL 5ICYA 3S36H 4QXWA 3VH8G 1AD9A 1MCIA 3VE0B 4MA1C 4MNGE 3SHSA 1OGAA 5IROC 3GSXA 1EJOL 1EHLL 2YRLA 2I27N 1O0VA 2NMSA 3IJYB 3S96B 2AJXH 4NT6B 1RZKC 4TSAL 1MWAA 4MSWB 3NGBC 2IH1A 2HFEB 4G6JL 4GRWE 4TSCL 3VFNB 1L7IH 3ZLQC 1S7VA 1FFQA 1UZ6F 3UTTD 3VXRE 3GIVA 1UH4A 1MWAL 1NKOA 1TJHL 1ED3B 1SEBB 3AUVA 5CEYB 3WJLA 1WTLA 3FAXA 2NY5C 5HY9B 1T3FA 2EDXA 3NVQA 4OCXH 3RPIB 1XGTB 5D2LA 1LEKB 3HC3L 3MODL 3QHZH 2YEZB 1RD6A 3WUWA 5B38A 4PG9B 1NFDF 3V0AC 3PIQB 5FO7B 1FIEA 1QZ1A 4BZ1H 4YDLB 4WHCA 4WHYG 4N90E 1LNUA 1XF2A 2UY6A 1EHAA 4JFZH 1H8SA 4R7DA 1BMGA 2W9EL 5C71A 3B8SA 4RA0C 5T1MA 1A14L 3Q6FA 1GGBH 4GBXD 3EOBB 1NGXA 4YDIH 3SOBL 5IHLB 4OZHE 4KHXH 4YHZL 3BH8B 5JTWA 4ZOEA 5ESVA 3B5HA 3GSVB 5EWIH 4UT6H 4HLZH 1AIFA 4O9HL 1QR4A 3A6BL 2NY1B 3IU4L 3HE6C 3F7QA 2NW3A 4IJ3C 3P4OB 4F80A 4Y5YB 3WO4C 4YNYB 5EORH 4JFFA 3U0TB 2Y36H 3ARDC 2D7NA 3BPCA 2G60L 2VERN 2MKWA 4MCZB 2B39A 3I6GB 5JMOC 5L2KD 1FH5L 5HGDA 1AGBB 2BXZA 5DUML 2YRPA 2X4QA 4JANA 1D5IH 1IVLA 1NMBL 1T22A 4FXKA 1S9WA 1R3IH 5H8DA 2X1QA 5EPMB 5I8KH 2V2TA 2YPVH 3C60B 1A5FL 1IM9B 2R69H 1DFBH 1Y6KR 3PWPD 3ARED 15C8H 3UZEA 5CP7A 3MRDB 2YXMA 1UWEH 1EGJH 3ZDYF 5KZCD 3CFEB 5FA4B 5TQ2L 3L3GB 3KPSB 3CLEL 5MEPA 4DFHA 1LO3H 2CDEA 2G5RA 1S7RA 4JHAL 3TZVB 5C09B 2DLHA 1I1AA 3MRJA 1JZ8A 3K4AA 2NXZD 3G5ZA 4LPYA 4E41D 1EEZB 3VMOA 3L3KA 4JO4H 4U1SB 5HGAB 3BD3A 5D1XB 2ENYA 4PY8I 5DO2D 3RHWF 2FL5B 4Y19D 5IVNA 2APBA 1FE8L 2A9ML 3P3YA 4KGLA 3IXAB 3D2UD 4ZFOB 1I1RA 2E8ZA 1OTUD 1PJ9A 5GGRA 5TF0A 2WSKA 3IVKA 1HHGB 5E95B 3STLB 3CXHK 3RTQD 3VRIB 4OZFA 2XZCH 1TPXB 5AZEL 2D7TH 2YUVA 3LMJH 3MR9B 3NABL 3QXVA 1MCPL 5CEZE 3K46A 1NGZB 1TNMA 1XZ0B 2BVOB 4PJIA 4RMQA 2BJML 2P42B 5IIEB 3N0PB 1JF5A 3T2QA 3DRTB 2DOCA 4ZTOL 5DT1H 4HGKC 4P2QB 3H3BC 3TBSA 1FGVL 4CNIA 4CMMA 1T20B 3DMMD 5C6PB 1QKZL 3LSOA 1TTUA 2J8UB 5CJXA 5IW1A 1WK0A 1KT2B 2Y9RT 3D25B 2IWGA 1C16A 3VWJA 5A3ID 2R8SH 1T04A 2CIKA 4HUWA 1CFQA 3MLZL 3VXQA 2P48B 5ETUB 5HDBE 3NZHH 5HHMD 3LS5L 5ID1A 5DFVD 3B5GA 1VKXB 3FOLB 3LEXB 1UEYA 3K0WA 5DHVA 4H26A 2JF1A 2XWTA 3BQUD 4PG2A 5DSCA 2VO5A 2EDLA 4NKMA 3FJTA 3OG6B 3TA3C 4YDJA 1MRCL 1I1FB 1S7WA 2YRZA 1GZQA 3QJFA 5GGQL 2FATH 3NA9H 1BP3B 4ZUSB 1VFMA 3TGXA 3RWEB 5D2NE 2WBWB 1R5WB 3IAPA 1BOGA 2R2EB 1J87A 3V6FA 5BS0A 2BNQB 4PJEF 3IU3A 2V5TA 4Z18A 5K59E 4MJID 1ZT7B 4PBVC 3OAYH 4KK8C 3MNVB 4NO0D 1MCWW 1TVHB 3UJJL 3NCJH 3P9WB 5D6DA 5GSRA 3VGGA 4RDQG 1VADB 5JW4N 4WFFD 1A9BB 4JFXA 3KPQB 1HSAA 5C08E 4JZNB 1WGOA 4PLKC 4HFUH 1ORQA 1H3WM 2RBLA 1CGYA 3OKNA 5F97E 4HUXB 3OR6B 2GJ6D 4AK1A 5HTSA 1EO5A 4HH8A 4QRPE 3CXDL 1MAML 1L9MA 1TTFA 4J6RL 2IANE 2VLME 5GRWA 2B4CL 2APFA 4JKMA 5LCVH 3WN5C 2ZG3A 2J2ZA 3HZYB 1J8HE 2PNDA 2OP4H 4NIKB 1NLDL 4NZTH 4XPFH 1Z3GH 2E27H 4J1UB 1CE1L 3PWVB 1BM3L 3QEGH 3HRZB 3C87A 4DZ8A 4G9DB 1U8QB 2ZUWA 5DRZA 1NMAL 4I8DA 4MNQB 1JNHB 1Q72L 3RGVC 5BMFL 3GI8L 3BE1L 4KJWD 3O6FC 4NNXA 4CVZA 3MFGB 1S9KC 3MGTA 3PHQB 1RIUH 2ADIA 2BHZA 4X8JA 5J6GB 5BXFB 2EDNA 4XAWH 4Y4HB 1YY8A 3HCVA 4ZUUB 4F7CA 4N0FB 4OF7A 5E24E 1KJ2B 3H0TA 5GGUB 1NUDA 1A3RL 3DRQA 4XBPB 3SKJH 5DEFA 3WNKA 1PBYA 4X0KB 1I9IH 3KLHC 3HZVA 1CD9B 4JQVC 4KPHL 4LVHB 2X1XR 2BVQB 5F89A 4U1MA 5FYJE 5E4EC 3HG1E 3CSYB 3VFTB 1F11A 3SDAD 2IFFL 1E27B 5T33L 3SGKC 2AABH 4XP9L 3BGAA 1LDPH 3V5DA 1TCMA 4MDIB 4X98B 2VR9A 2ERJC 4EQ3A 3LD8C 4P5MB 3JVGA 4LSUH 5J0BA 1RPQA 1RUAL 3PWUB 2UY7A 4L3EE 1C5DA 5BO1L 3IXTB 4PJDB 4G6JH 4TSCH 2DQTL 3G5XA 3HE7C 1CD8A 4M7LL 1HYSC 2H41A 5FYLD 1A1MB 3BN3B 4LPUA 2PTVA 4NQDB 3HE6D 5E5UB 4MDJB 3QRGL 4HJGA 4PYHA 1JV5A 1N7MH 3CH8A 4WFGE 1AO7A 3O45B 4JVPA 2CKNA 4DGIL 3MODH 2UVFA 3DSFH 2Z93B 4PJAB 4XC3H 3TM6A 4QOKB 3UDWC 2BDNL 3FT2A 5ALCH 3WS3A 4CAGA 4HKJB 4TUKH 4G6AC 1A7PL 2YHGA 1FLTX 2W9LA 3KPMB 4K3GA 1T0NA 2WP3T 1CGTA 1A14H 5MERB 1IEHA 2BSSA 4LARL 4I2XA 4P46B 3SOBH 1YECL 4D0CB 3BJLA 1M6OA 2V2WB 1FNEA 5I9QB 2ADJA 5DJ0B 3ISWA 1WFTA 2X70B 4MHHI 4O9HH 1QBAA 1X6LA 2WUBL 4BH7A 2VITA 4DEPB 4R96B 3A6BH 2A77L 5DJ8A 3IU4H 2QKIB 5BZDA 4PTUA 2RFXA 4FMKA 4BUGA 1GGIH 3PNWA 1K4DB 4H25B 2GT9A 4LRIC 3A6OA 3VMNA 3MRGB 5EB9A 2G60H 4P4KC 2KDGA 5D7IE 4PJFB 5EBGA 4F9PA 2VQUA 3N9GL 1S8DB 4ODUA 3IAGC 5DUMH 5A1AA 2NPLX 2BCKA 1AXIB 5HYJE 5ICXA 3S4SA 4HIEB 1U95A 3UJIH 1JTPA 3VE0A 3VGBA 5JMRA 1A5FH 4WFHE 2YKLL 3FHQA 1A1OB 3TBVB 5CS7A 3S96A 3R0MA 3IJYA 2WNGA 4NT6A 2EE6A 1F3RB 4MSWA 2ADFH 3BMVA 2JELH 1EAPB 1T83C 4U2YA 2HFEA 5TQ2H 4EDWH 5F7UA 2HN7A 3CLEH 3KLAB 5E8PB 3VFNA 5MHSD 1EFXD 4YJZL 1QBML 4GRMB 3C5ZB 3L5WB 5FGCB 3HC4L 1T7YA 3BKYL 3SGDI 1ED3A 4O58L 1SEBA 5CEYA 1I8IB 5HY9A 2OTWB 2FECL 3RPIA 3TT1H 1XGTA 3BIBX 4UT7L 1FE8H 2C4FU 5ITBL 2A9MH 1LEKA 2WIMA 2YEZA 1KULA 4ZO6A 1WFUA 4PG9A 3PIQA 5DJ2B 4UUJB 5FO7A 1DN0B 1KF9B 2W9DL 4Z7OF 3G6AB 3PL6C 3O4LD 4PJ9B 3QDGD 3EAKA 4HUKB 4JFYA 4NWTL 5DVNA 3EOBA 3NABH 2GFBB 3U36B 1V7NL 1MCPH 3TA3D 1ZKAA 4LEOB 3GSVA 1MCHA 4OZFH 1NUNB 3S36X 4E9LA 4LHUG 2BJMH 4H1LB 5DD1H 4ZTOH 2UUDH 5EBLB 4M93C 4EIZC 5T3ZE 3HPJB 3MV9B 2JB6B 3TJHC 1FGVH 4W70A 5DEZA 4Y16D 1XGYL 3H7LA 1JF1B 4KK8D 4UILH 4N1CA 2YA2A 5FM5M 2A1WH 3NIDE 4XVSL 3L3HB 3X3FL 3TWCL 2G9HB 4Y5YA 4RDQF 4YNYA 3MLZH 1T6VN 4MCZA 4PJBB 6FABL 5HGHB 3I6GA 1IM3B 2Q8AL 4WEUD 5K9OA 1AGBA 4TYUA 5E6YA 3CSPA 5GIRB 2E9JA 2X09A 5HDOA 1H3TA 5SWZD 1CXIA 1CIUA 2CD0A 2Q7YA 5E2WL 3EZJB 5BV7B 1L0QA 4G3YH 3C60A 4PRHB 5FF6B 5GGQH 1IM9A 3IDUA 1X5KA 4HWEL 4QTHA 1X5YA 4YEEA 5DHVH 4LVNB 1CXLA 3MRDA 4PRDB 2K7QA 2YN5A 1X4ZA 3I02B 4MXWL 1EPFA 5LWYL 4BYHA 5D7SL 3CFEA 5FA4A 3RX5A 3L3GA 4XXCC 3DYOA 3KPSA 3UJJH 5FAAA 2ARJB 3IRPX 2F53B 5E99H 5EZJB 3WS6A 3TZVA 5C09A 3EOAB 1NC4D 1OT1A 5DWUL 5C0CE 3LCYA 2MCG1 2J8OA 1EEZA 4X6CF 5HGGS 3QEQB 2GK2A 3VMPA 4U1SA 5HGAA 5D1XA 4HCRA 1AR1C 2FL5A 2EH8H 1TQCB 2Q1EA 2QADD 4JG1L 1TQBC 3O3AB 2JKXA 2RIKA 5EN2B 3WKNA 2NY3B 1MAMH 4TRPL 5J6HB 2GHWB 4J6RH 4Y5XB 2QQNH 1HHGA 3STLA 2B4CH 3QUXB 3WCYA 3EDEA 4KDTA 3VRIA 4IRZH 4LHJB 4G9FB 3PHOB 4ZFOL 4EXPX 3MR9A 1JK8B 1J0IA 1NLDH 2AJUL 1WZMA 3LEYL 1XZ0A 1CE1H 2BVOA 5DUPH 1BM3H 3SQOL 4PB9L 4KH2A 3VA2C 1F02I 5IIEA 3RX7A 4DUXA 1QR1B 3DRTA 3G08A 1NMAH 1BIIB 1BJ1H 4OZGB 4P2QA 3OKDB 1Q72H 1QVOA 1BZ7B 5BMFH 5C0AB 5EO1B 1T20A 3GI8H 3BE1H 3ARVA 3CX2A 5L8KB 2J8UA 5C0EB 4OUOA 4RGMB 3T8XB 3MLXL 4BH8B 1KT2A 1IC5H 3D25A 1MQ8A 5HI5C 1TXKA 2W60B 4AQ1B 5KOMC 4EI5D 1QSEE 4ODBD 5D96C 3RBSA 1J05B 2AS5M 5ETUA 3VGAC 5EIQA 4GRLC 1IC7L 1ZA6B 1KCRL 1MCKA 3RY6C 3HE7D 3HLAB 2C9AA 1X5AA 3LQMA 1HYSD 3QULB 1VKXA 3FOLA 1N2RB 1DBJH 3LEXA 4APQC 2VR5A 1L6ZA 4TNWF 1G0DA 3I3EA 3WXWH 3HI5L 1I1FA 2H26B 5GJTL 2EEAA 4ZUSA 1YN7B 4XP9H 3RWEA 1MFEL <