4YE4H

Crystal structure of neutralizing antibody hj16 in complex with hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
227
structure length
227
Chain Sequence
MKLMQSGGVMVRPGESATLSCVASGFDFSRNGFEWLRQGPGKGLQWLATVTFESKTHVTASARGRFTISRDNSRRTVYLQMTNLQPDDTAMYFCVKDQTIFHKNGAVDFFSYFDLWGRGAPVIVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HJ16 in complex with gp120
rcsb
source organism Human immunodeficiency virus
molecule tags Viral protein/immune system
molecule keywords HT593.1 gp120
total genus 47
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H01
2JLLA 3CFDB 2VR9A 1S8DA 4X6EA 5IEKB 1NCCL 3P0VL 1OAQL 1YQ2A 4KI5E 2CKBH 4QRTB 1QFHA 2Z35A 1BJMA 3AAZB 3BPLC 2H9GA 5GS1A 5A3IC 1K6QL 4GH7B 5E8OA 5D1ZD 3EJZC 4QGTA 3NIDE 4RMSA 3WUWG 2R0ZL 5B38B 3RTQA 1A1NB 3FFCB 5DVMA 2E8YA 1KTKE 3I3BA 4LFHD 4X8XA 1ZHNB 3NGBC 4P57A 3WL9B 5GGRB 4O51B 1HINL 4XMPH 1W0YT 5E2VH 1A4JA 3N1QC 4R26H 2HJKA 1U8KB 1R5VB 4HPOH 1JPFA 3N9GH 3MBXH 3MUHL 5C0DA 4YDVB 4Z7VE 1XGTA 1G7LA 1SJEB 4PJHE 2LE9A 3BGMA 3DHJA 3TESA 4K9EH 2Q7YB 3FONA 4R2GC 5BVPH 3HZKA 2OL3B 4JO3H 1WT5C 1JNHA 1QYGL 1OTTC 4QTHA 1A9EB 1R3IH 3TZVD 2EICA 1I9IH 1IL1B 4EUPG 3SDAA 5TE7H 2R2BB 2D0FA 4AQ1B 1ZV5A 2CDGB 1WVZA 4JM2C 3QEHA 4FRWA 1BZ9A 1G1YA 4PRPD 3O6LH 2Z4QA 1HNFA 1CDGA 3C5SA 4LLQA 4N8CH 2FR4B 1RJYB 1WCBB 2DQIL 3ARBB 5C3LD 3WIHA 4GFTB 3S97C 4O9HH 3VRJB 1T2XA 1ORQB 5CJOL 5CLTA 5TJWK 5I19L 3CX2A 3LKRB 1TQBC 4J3VA 4FQLL 4O2FB 1I8MA 1Q38A 5AG8A 3MA7B 5CHNA 3A67L 5C0DB 4W4NA 1XH3A 4NNXA 3GGWB 2PTUA 1SEBA 2Q7YA 2IQAA 2B1AH 4XNZC 2CIIB 1R3HB 4DEPB 2LU7A 3EYFA 3ARXA 1EJOL 4UDUA 4R9HA 2A6JB 2X44D 1VACB 1JYNA 3BN9D 3HC4L 1A6AA 3D69A 4LLUA 3QO1A 4AQOA 4C56D 1MCPH 2F53E 4FXKA 4H1LG 2Q3AA 3DSFL 3O0RH 3QULA 1OLLA 4MJIE 4MX7B 2DQUH 5J11C 3HI1B 3H7BB 2DM3A 1FFQA 1QSEA 5FM5O 2V5SA 3MRFB 1DUZB 3UZQA 4HXAH 1HHGB 4PS4H 5C0RH 2CO6B 3C8DA 2BNUA 1NFDB 3ORJA 1FGNH 3I85A 3QWQB 3TV3L 4P46D 2XZAL 3FN3A 3MXVL 2XYCA 1O0VA 3B9KB 4CNIB 5FA4A 3HRZA 5DVNA 5E6IA 6FABH 5IKCA 3UJTL 2NXYD 4AEIL 3HNVL 4OD1L 1XMWA 3FOMA 4XXCA 3L3IA 2K7QA 1BFSA 1YNKH 3BEVA 4YXLH 5KW9H 3BPNB 1GL4B 5TDNB 1FJ1B 3IT8D 1D5IH 3RUGA 4XPFH 2I9TA 2YPKB 5AD0A 2VXQL 1X6NA 1FO0H 4ZAKA 1Q9KB 5I74B 3C5JB 4PJAE 3TJEL 1IGCH 4TNWK 4FFZL 3VRLE 3ROOB 3VH8G 1PZ5A 4PJIF 4QGYA 4LIQE 1U8JA 1IMHC 2R15A 5J4MA 3IXAA 2BERA 1WJ3A 3B8SA 5HVHB 2G5BA 4OB5H 4MD0B 4S1RL 3CPLA 1OB1A 3KPSB 1HK6A 3ZSSA 3ZMRA 1PQZB 2XKSA 1HIML 3IJHB 1QQDA 1UGNA 3FB5A 1MFEH 4Y4HB 5C0BB 5J6GB 1F3JA 1HH9B 3G5VA 1QA9A 1C5CH 2UWEE 5CEZD 3T0EB 4UOW0 1SM3L 1IJ9A 1Q94B 4Y4KD 5EO0A 5IKCB 2HFFB 4CN1A 1XF3B 4TNVK 5EBLB 1HHKA 4GG6E 3D0LB 1LDPH 1WGOA 1U8OB 5HGDB 4ACPA 4Y5YC 4YH6A 1YDPA 4WDIB 4I4WA 3HC0B 1AQKH 1JZ2A 5I1DB 4YIQB 4OZHB 4AK1A 1IGYB 3V4PH 1LNUB 3H9SD 4YGAB 3B2UC 3G5YB 4GMSL 3SCMA 1IGIH 2DWDA 5DQ9B 5C0JA 3QUZD 3QDGA 3C8KA 4AT6B 3EJZD 5IMOB 1JPGA 4Q6IB 4UU9A 5IJKA 4TUOB 1OGAD 3LMJL 3SDDD 4GXUM 4JFOB 2VL5B 1JPFB 1QPXA 2A2QT 4JZJB 1RZFL 2HLFC 4JN2A 4NGHL 4JVUA 5HI5C 5FEBA 1JZ7A 5C0CA 1L6ZA 2X4NA 3MA7A 2CRMA 4LIQH 4MSWA 2RR3A 4XCYB 4JKWA 4Z6AT 4Z7WF 4I4WB 1QFWL 3PXJA 4EZMA 1H3GA 2DYPA 5AAMA 5JORA 1BREA 4NUJA 1CLZL 4KDTA 2DBJA 1AO7B 1WZKA 1CZ8L 3R1GL 1BLNB 4YAQA 3GIZL 5I8KH 3HG1D 1BPVA 2VDRL 4TSAH 1OAKH 4NT6A 1AR1D 5JW3L 1P4LB 3BUYA 5DO2C 4WTZA 3NH7L 4XX1E 3WS3A 1CVSC 1EBAA 4KKNA 3TBVA 1T89A 3SBWC 3UJJL 5EORH 12E8L 1EJ6A 2VE6A 2EDHA 3NPSB 5EO9A 4RRPG 3DX9A 1MCLA 3TLRA 3V5HA 5F3BA 4QLRA 1WTLA 4JY5L 3SGDH 4K23L 5DZOA 5HHVH 4C4KT 3EHBD 4JJHA 1B90A 1FVDA 4MJ6B 1SYVA 2DQEL 2ZCKH 3QWOA 1M1SA 2UVFA 1LILA 2NY2B 1P4IL 2OLDA 5IESL 4QF1A 4FXGA 5IV2A 2AEQH 1I8LA 5E6IB 1RZGA 3ZYJA 1KJVA 3EJYC 3Q1SH 2H41A 5JMRA 1KN2L 3ILQC 1AGEA 1MQKH 3ARBC 1K6QH 4N0RA 3GO1L 1WQVT 1RZFH 5HDQH 2Y7QB 2I9TB 3DOSA 3KDMB 1N4XL 5DWUH 5EU6E 4CADB 4PR5A 2A1WL 3CMGA 3D3VA 3X3GH 2X40A 5K59F 5FHBL 4L5FL 1MJJA 5IT2L 1PD6A 1A7OL 3JUZA 5TDOA 3FB6A 1S78C 4PRHD 5ACZB 3VXUB 4JFFA 4AEFA 1T1XA 5CLWA 4HCRA 2CK0L 3MLXL 5KSAA 4X6DF 5IP4A 2WZPD 3KS0J 5I17B 1B0WA 3HUJA 5KVDH 1H0DA 2JIXB 1C8PA 1WBYB 5D70H 1DE4B 4P2OC 5HYEA 3MRQB 5IB5A 5MEOB 1C12B 4PP1D 4D3CL 2PCPB 4XPGH 1X5IA 3HZVB 1EAPA 3IAGC 4MGXA 2VLLA 2FH6A 2Y7QA 5HVGB 5FYLH 1SM3H 1KIRB 2VXSH 3EW3B 1MF2H 5FA3B 3QXDA 2F8XC 5C1MB 1DQTA 5B39B 5IQ9B 4ZNCD 3BQUD 2VLRE 4FQ2H 4UTBL 4IHOB 5T33H 5IG7A 1II4E 1CGWA 4HUUA 1QQDB 3FB5B 2VLJD 3MV9B 1JN6B 4XC1H 5JDSA 3AREA 5HDBE 1TQCC 1EEQA 4DFIA 1T2JA 2OP4H 4KTEH 2ATKA 3DV6B 3HMWL 1RY7B 2NNAB 4QOKB 5GRYA 1JGVH 4TTDC 1VGEH 1EXUB 2XV6B 2B7DT 3DMMB 2A77H 2DQHH 1IM9B 1CLOH 1E4WL 1S9VB 4LSPH 5DUBB 5CAYB 1NANI 4FG6D 4TOYL 4MS8C 4XBPB 1G9NC 4S0SD 3IRPX 1DBAH 4QRSB 5DC0A 1CTNA 2PUQT 1ND0B 4X98B 1IAOA 3FT4B 2Z9TA 3G9AB 4NJ9H 3A6BL 3S37H 4ODXA 3OKYA 4Y5VC 4J3XA 4ZS7H 3D2UD 2VKWA 2KL6A 1QACA 4JFED 2XFXA 4TNWF 5DFVC 3ZHDA 1B0GB 5H2BA 3NTCH 1HI6A 1ORSA 3TZVC 1QLEL 1CIDA 4WHYG 3MJ7B 2WAHA 2ADIA 1RPQA 5SWSE 5ID0B 4MDJB 2X4NB 4FMKA 4P23C 25C8H 3VXNA 4LPCA 3GKWL 5DJAB 4NKIL 3U30B 3KLDA 4N0YH 3UBXI 4DKAA 1S7RB 4ZTOH 3RBGA 1KB5H 1CFBA 2AJYL 4DAGH 1VERA 2V2TA 2EDFA 3UPAA 25C8L 3HUJF 4J12A 5D2NE 1BAFL 4M3KB 4XNMB 5EBGA 1CFSB 5EUOB 2YD9A 1A3LH 2PW2A 3G6DH 1IGMH 3ZDXE 3VFVA 1KLFA 4QF1B 4JM2B 3TIDB 3P4NA 4HXBH 5ADPL 2WQ8A 3G9VA 4GKZB 5DO2D 1JE6A 5J06A 3UTSD 1CGSH 2D9CA 1NAMB 2DMBA 1INDH 1UJ3B 4I0PC 5FFLA 2DOCA 5SV3A 1NC4D 4TUKH 5E8EA 1Y0LA 1TTFA 2YC1A 2Z31B 1OW0C 2ZCKL 2ZP0T 1ZTXH 2ZUYA 1L0YA 5TE6L 2AXHA 5HHVL 1S9WB 4NO2A 2WUCH 3JXAA 4PJHF 3EFDL 5K9KB 3DWTA 3GBMH 5D1QA 4I9WD 1H5BC 4G8FA 3D5OF 5EN2B 3V8OA 3QFJD 3GSXB 4JEGB 5HPMB 4OKVA 4MB5A 3EJYD 2WBWB 1U3HC 1X5XA 4UBDC 4WI2A 1OSPH 4HLZH 2X89D 5T3ZE 1U91B 4PJ5A 3EDFA 1JBJA 3CFIC 2DLTA 4PIRF 1QD0A 1ERNA 1QFWM 3QHTC 3RL1A 4FZ8L 5MEQA 1ED3A 1GZPB 2FBOJ 3D85A 3TPUA 3VWJD 4MNQD 1I7TA 4KQ4L 2VLLB 1FBIL 5CUSL 1B88A 5DD0H 3BE1L 4IDJL 4KK6D 1JL8A 1RJZB 4UDTA 2BFVH 5KN5A 4RMVA 3NCCB 5JHDD 1EFXA 1CXLA 5LCVH 3IAQA 2PYED 1CGTA 4RA0C 4I2XA 3ARGB 2H9GB 3L5XH 1YMMB 3IGAA 3QI9C 4I3SL 3X17A 1I8IA 3WIHL 2J6EA 5L7XL 1DP0A 1AKJA 2A6KB 2DTSA 2ZKHH 5DRWB 2F74A 5E2TH 1FL3B 1VA9A 1P9MC 3FFCE 3NCEB 3DV6A 1QLEH 2MFNA 2F5BL 4MXQC 3KPQB 2AAVA 1J0KA 3GSQA 3TYFA 5MEPA 1A2YA 4HBCH 4JFXA 4L4VD 4KRLB 5B8CB 2J8UF 1I7TB 4PJHB 4E0RA 2P49B 1FNGA 4GRMB 3MRPB 5TF0A 4QY8B 4K7FB 4WEUD 1J5OL 3KYKL 5HY9A 4TN9A 5IW6B 3KPLA 1P2CB 4LHQB 3U46A 1W72B 4LAJH 1N0LA 3WHE0 2Z4QB 4WEMB 3WFBL 4OFKA 1ROWA 1CIUA 1NH6A 1FFOA 1U8LA 4NFCA 4NQSA 2W0FA 3ALWA 1RJLA 1NMAH 3DROB 4KV5E 3NIFF 3GEWB 1KCKA 4HHAB 2WP3O 4O2FA 4Z95H 5HVFB 3MJGX 3WO4C 3VWJC 2BCKB 3FO0H 1PZ5B 1CGVA 3LZFH 3HPJB 5HDBF 1KJ2A 1I7RB 1DQDH 2FEEI 2ADGA 2V5MA 1IAKB 4KHXH 4EQ3A 3MRRA 1XCQB 2O5XH 2FJFB 3C9NB 3RWCB 1NBYA 4H26B 2VLRD 1RI8A 5KSAC 4OLYL 3SDCB 4PJIE 4CU6A 4EI6B 3WKNA 3QDGB 2YD6A 5K59E 1YEHL 1JTTA 3BE1H 4IDJH 4M9OA 5JNYA 2IH1A 5I1JH 3BP4B 5EBLA 1TITA 1GZQB 3OKEB 4TVSa 2L0DA 2NY6B 3QWRA 2FX9L 4XNYH 5CIPA 3DRQA 5GGUB 2OS7A 4QHKI 1N0XH 5HYSB 5GJSL 9CGTA 4PRAA 2HTKD 4Y16B 4QXTB 4P59H 3PWPA 3B3IB 1JWSB 1GH7A 3PL6D 1T21A 4PJDB 2WV3A 5EZOH 3SO3C 5D5MA 4XTRC 3MUY1 3GK8L 1QKZH 4YFEA 5I18L 4PJCB 4X6BA 3T0ED 3KXFE 1F4XH 1Q9OA 5EFIA 1ULVA 4HC1H 3D3VD 5CINH 1KEGH 1HKLL 5CP3H 4HJJL 1AXSB 3TJHD 3DXAB 4M5ZH 5IEHA 2ZOLB 2A73B 3QUXC 4X7FC 4K3EH 3RY4A 3HE6C 1MNUL 5D1QD 1UKQA 3OKNB 3HKFA 1T04B 3MUGA 5DJ0A 4X99B 4JG0H 2FYYA 3P9LB 5B21A 5BS0D 4L4JA 1RUPL 4L8SC 2BVTA 3MC0A 2Z8SA 1JHTB 3VI4F 5ALBL 1RQ5A 4RZCA 4UB0L 2A38A 3O2DA 1MAKA 4PJ8B 4P3WA 3BQUB 3MV7E 4MYWB 1OT1A 4LSQL 4NO2B 4IRZL 4MJ6A 3PHSA 1KC5L 4CN4A 1KLUB 1OGAB 4DAGL 4ZXBA 1KPVA 4P3CL 1A7PL 1SVCP 4Z9KB 1F8TL 2PNDA 5LWYH 1FQ9C 1HOCA 2IC2A 2BOBA 5T1KD 4PREB 3BPOB 3J8F7 3BJ91 1HCFX 4LNVA 3PWPD 3T0EE 1P7HL 1RUKH 4GXUN 3V6FA 5GGSY 2IQ9L 4RMUA 5FYKE 4S1QL 1ACZA 4BH7A 2HJLB 1MFEL 2BSTB 3H0TB 2WLYA 4NNYB 3G08A 3JWOL 4UQ2A 4WW2B 3K7UA 5GSVA 3O9WC 2P5ED 3FO1A 3FZUD 4MNHA 1J05A 1CFNB 2W07A 4PV8B 1XF2B 1KCSL 1WZLA 3RRQA 3RU8L 5HD8C 4JQXA 1HZHL 3BQUA 2Y5EA 3UYPA 1J8HA 4X4YB 5JA9A 4WTZG 3SKMB 3DYOA 5EOQH 1ZVSB 4U1NB 5T1KB 3L6FB 3B6SA 5KSAB 1EFQA 1CQYA 4XP5L 2XKNB 3MOBL 4K8RH 1MWAH 4K9EC 4MJ4A 4PREA 4HUWB 1FGVL 5D1QC 5F8QC 5CEZH 4NKOA 2DIAA 4U7SA 4W6YB 4JFFE 4JFXB 3ULSA 1C12A 2NY2C 1NPUA 3VFNB 1G7PB 4LVNB 4WFED 5C7XH 1U3HB 5E9DD 2FLRT 2C3HA 3EYUH 1TQBB 1J7VR 4N9GB 4JDVB 4IRJD 4UINL 3TBWB 3QEUB 5HY9B 4R3SB 1KJ2B 4L8DA 2ZWLT 1UWEL 2Q6WA 1T03L 4LSUL 3DV4A 1FNAA 3CH8A 4D9RE 1I1CA 5IBTL 2SEBA 5LGJA 5A16A 3TYGH 4GKOA 4JAMA 5FK9B 4M8QA 1U95A 4JM4H 1VADA 3MACH 2F53D 4K71C 2G9HA 3D9AH 3ZTNL 1DN0A 1QBMH 1UXWA 3OKEA 3MFGB 1LK3H 1E6OH 2V2WB 1UWGH 1RZKC 5LG1A 3DRQB 1R0AL 2XY2A 3MRJB 3D9AL 5IW3A 4AM0A 5HYJD 5B3NA 4LLWB 5KSUB 3IFPA 2GT9A 5I1HL 5H94B 4ODTL 2BSRA 2APXA 2HKHH 4JHAH 2DYPD 1ZHKB 3MX0A 1P5UA 2ZG3A 3GHBH 3KNBB 4JG1H 3PWNA 4HCRL 1FYTD 4HT1H 5BMFL 2J88L 2R1YA 2VDQL 3FTGA 4NQXA 3L3JA 1IGCL 2PXYA 4ODTH 4AMKL 1E0OB 5CBEA 1RU9L 1SMAA 1TVHB 3RWFB 4GRLC 3MLVH 4XPFL 5CEZL 2MWCA 2O61A 3FAWA 3CFKA 3QO1B 1MWAL 2VLKD 4Y2OA 2V9RA 5E2JA 3FRPG 2CUHA 5JOFB 3DUSB 2V2WA 4GQ9L 4LMQE 3QT2A 2OI9C 5KAQG 4KKLD 5FOBB 5I18H 4L9LB 1RUML 3SN6N 3QRGL 2VQ1A 1FZJA 1J86A 4B50A 3MRCB 4Q58C 3D18B 4PG2C 4M61B 1R3HA 4WFGD 2IAMD 1EHXA 4OZIA 1U93A 4WUUB 4YE4L 5TDOB 4DOHB 2HTLD 4MAYD 5MERA 3MRBB 4JFPA 4ZO7A 4DWHA 3GSNA 1BD2E 2X9YA 4K23H 4YGVA 1HOCB 4JPKH 4LSDA 4JFZH 4UUJB 4LLYB 4APQD 4QHNA 2R1XB 3F7VA 3VXSD 4MDIA 1HDMA 1U92B 4HG4K 3U2SB 3KYNB 5F9JA 2UV3A 3QDJB 2P7TB 3IFOA 4PRBB 1P1ZA 5GSVB 1OTSD 2B5IB 4KKAD 4KV5F 4YZFF 1UJ3C 4M1GL 3OR7B 5DHYB 1MCWM 1JZ3A 4UBDD 2JE8A 3EOAB 3CCHB 1BHGA 2IALB 4X4YA 1M7DB 3TT1H 4JPWL 5J13B 1JN6A 3VGAC 4Z7NE 3GHBL 2LVCA 4I77L 1JI1A 4Q6IC 2BOBB 2VMFA 4YXHL 2JJUA 2VXQH 1KCSH 2ZCHH 3BPNC 3HMXL 4P2OA 3B9KD 2UUDH 1F3JB 3BVNB 5AG9A 2W65A 3SDXA 2LU3A 3LKPB 1RHFA 3GBNL 4X83A 3JWOH 1NCBH 4OCRH 1N7ML 3MBEA 5D70L 1EZVY 3DO7B 3D0LA 2IQ9H 3QUYD 1FZKB 3KJ4B 4JY4A 1FYHB 4Y5XB 4NO0D 4PGDB 5HGAA 1U3HA 1MCRA 5LBSH 1QR4A 1L7TH 3CLFH 4OZ4B 3ET9F 4PJFE 4QHUA 1WSST 4ELKB 5CD5D 1UKSA 4NQDB 2OZ4A 5EG6C 3GSUB 4DOHE 3UTQA 5EZOL 3QA3A 3OXSA 3VA6A 4LPWA 4XMLL 1BP3B 3HHRB 5C08D 2C5DC 1FGVH 1I8IB 4QRUA 1F11A 5BZWB 5TF1H 3H42L 4KY1H 3WFHB 1VDGA 2YOCA 4CUCA 2XA8H 1T3FA 3O0RL 1Q94A 5EO0B 4HWUA 2DJSA 3BZEB 4O58H 2WBJD 3Q1SL 4LOUC 3W0WE 5MHSE 2R0LL 4GW1B 1DEDA 4LCWE 5I6XB 5GS2H 1EVUA 3OZ9L 2CKNA 1X5GA 5FECA 3PJSA 4PJAA 5C0AD 2UWEB 4HWEL 1BQUA 3STZA 1TZHA 3I2CL 4MZ3A 3FT2B 4OLZL 3PHOB 4PJFB 5C6WH 2IANA 2JK5A 5ALCH 5MI0B 3D0VB 4HZLA 1JFQL 3QG7H 2VZSA 2AJVH 2EE3A 4JM2F 2X1OA 1U3ZA 1BJ1J 1EHLL 2RCSH 1BIIB 3MJ8A 5K9OA 3EZJB 3CVHH 1NBVH 5B3JE 3TM6A 4GKZA 1GPOH 5HHNB 3GJFH 5FB8B 3DPBA 3WHE1 2FBJH 4TPRH 3N85H 4P23A 8CGTA 1JYVA 1IQDB 1EEUA 5I1JL 5MI0C 3DSNA 5F89B 1S7QB 1CE1H 4RBPH 1F4HA 3BGMB 3HA0A 3B4NA 2YD4A 4NHCL 4OIBA 1QTYT 3FQXA 4XNUH 1XGUB 4X4ZA 5F71A 5EZJA 5FO7B 4JPVL 4GS7C 3LN9A 2W59A 1J0HA 2WINA 3NABH 2N4IA 5DFWH 3BRDA 1HHJB 1D6VL 2E9WA 1MI5E 1M05B 3ULVC 3FOMB 4O5LH 1ITCA 3FQTA 3ISWA 5T1DL 1DLHA 1CL7H 1OARH 1Y6KR 5DUPL 1EGJL 4C54A 2VKXA 5IBUB 2GW5A 4ELME 3O6FC 2NTSP 4YXKH 2IANE 3LDBB 3TPKA 4Y88A 1D6VH 1HXMB 4LCCA 4PGZA 1ACYL 1BD2B 2Q76A 1S5IH 4L1HA 3TJHC 3UTPE 4PRAB 4Y16A 5D1XA 4X9FA 3FN0H 5EPMA 3I50H 3QUYA 4XP9H 3VD9A 4A6YL 4Y1AD 1TENA 1AC0A 5K93A 4YDKL 1AE6H 3UMTA 5F9OH 3KPPA 1IARB 3AXLA 4ETYA 5IB2A 3MCKB 2CDGA 3I75A 3VRIA 4JY6B 1NGPL 1DTUA 1D3CA 4EN3D 1RZ7H 1FO0A 2X09A 5C6TL 2W60B 3VFRA 5IQ7H 5A2IH 1AKJB 1UCBL 2A6KA 2BJML 3SE9H 3UTTA 1MCWW 2IFFL 4L4VA 5T3ZL 2G2RB 1ZHBA 5ELIA 4DKFH 1KPUA 2DD8L 1GPOL 3FT3B 3LKPA 3O6MH 2FBJL 2VWEC 3WNKA 1UM4L 3RNKA 1YPZE 4D9QE 4YHYC 2VITB 4ZFGH 3KPQA 1J0YA 4NWUH 3KLHC 1CU4H 1WBXB 1CWVA 1WWWX 1PG7W 2BK8A 3MRIB 2CLVB 2MHAA 3IAPA 3NPZB 5LVEA 3NVQA 3WLBA 2NLJB 2DQIH 3FB8A 4S1SH 2RBLA 4I18C 4JFQA 3DURA 3I2CH 4OLZH 1ZVHA 1B4RA 4KMTL 3N1MC 3PG2A 3EOTL 3SCMB 2Y6SD 1YY8B 1C16B 2FWOB 4QXUH 3TBYB 3S9DB 5EWIL 3MV9A 4AIOA 3BRFA 4XNXH 3GMQA 1DL7H 1RK1A 4Y16D 1A1NA 3FFCA 5JOPE 4IMKC 4G8GD 2UYLA 1KG0A 1BX2A 1IVLA 4OD1H 5JO5B 2NZIA 4NSKA 2H45A 3ZLQC 3ARDB 2GY7B 4HJGB 4MSWB 2YPKA 3DMMA 1IGML 2R9HD 3M1BB 5AD0B 5EBMA 2WIIB 3GBML 4FFWD 2AK4B 2MHAB 2EE6A 3RX8A 3G04B 4LVOC 2OL3A 5KSVA 2X1WL 3EHBC 2V7NB 5ACLA 1FNHA 3SKOB 1H3UA 4JPVH 2GAZA 4BQBA 3MRRB 5SWSA 1KPVB 5DYOA 5T1LB 2J3SA 3RL2B 2C1OB 2G75A 1VCAA 2P5WB 2QBWA 3TCLB 3V7AE 1KFAL 4KROB 4K94L 2ZZUT 4GAJL 4OM0L 4XAWH 1U8KA 3BRGC 1BX2B 1F3RB 4R2GB 5HXMA 1DBKH 4BH8B 2YN5A 3QZWA 5IT2H 3IVKB 3KPRE 1LEKB 2GCYA 2MMXA 5DI8B 5KANG 3EKCA 5BZDA 3FQXB 2YRPA 4MD4A 2FEEL 3S4SG 4G9DA 2WK2A 4Y4FD 3T09A 4KVCH 3DIFA 2RAMA 5ADOL 4PJ7F 3OB0H 4XNUL 1ETZA 1XAUA 4OLWL 2DD8H 1KGCD 5F7NC 1FL5B 4TSCL 4WO4D 4N0UB 4YHML 3RGVD 2AJSH 5ID0A 5GS0H 4UTAL 3OPZL 4ZPVA 2L4OA 2DQCH 3GMNB 2YBRB 4YX2L 3IXTA 3L7EB 1JHTA 3KHOA 4NQCA 4UV7L 1HQ4A 2B2XL 4K2UH 2ITCB 5FKAA 5B3JF 2CRYA 1N6QL 5I1DA 2K7PA 4NOFA 5FF6A 3BZDA 2YD5A 3WO3B 3QBTB 3EFDH 4LVHB 3BYTA 1RHHB 3U7YH 4U1HB 3MNVA 3K81A 4R96A 1OWRM 4WY7L 1MJUL 2R1WB 2J6EH 1ZHLB 2BC4A 5FA4B 5T3XL 4YWGL 2YK1L 1CQKA 1QSVA 4TUOA 1YQVL 1TVHA 5H35B 1ZAGA 4HV8B 1HXMA 4LCCB 4ZFZB 4ONGL 2O61B 3O6FD 3BGAA 4GUPA 5TE4L 3VI3F 5D7KE 4EVNA 2X70B 3OQ3B 2NY3D 4HIEB 2J8UA 3GKZA 1JGDA 4O2EA 3H7BA 5EO9B 5J11B 3CX5K 3REVB 3VFPB 4P2CG 4NRYB 1BOGB 3MRFA 4FQQA 4AEHL 1YEKH 3S35H 4YHNB 3MNWB 4DCQA 3WN5C 4ZQKB 4G7VL 2VXVH 4DFHA 5CBAB 4X5XB 3NAAH 2WWMC 1CFQB 1YMHB 4U6HB 4ERSH 3CH1B 1KV3A 4RFOL 1OTSC 2VOTA 2AEIT 4IRSD 1EO8H 1FFPA 4OKVB 1Z0MA 2CQVA 4FXGB 1DQJB 2CPCA 3QI9B 4M6AA 3KPSD 4Y19D 4F7CA 1OT2A 4OZIE 1AJ7L 5DRNA 5KVGH 3MV9D 2QJDA 4NC2B 1KG0B 3WNNA 5CD3A 2XWBA 5JIIA 3V79C 1GIGL 5ISZD 5EOCH 5LAXB 3HFMH 5F6IB 2VQ1B 4OCRL 1R5IB 4PJGF 3LN5A 5GRJH 2VXTH 3L5WB 3SE8H 3SKJH 4GRLB 5B22A 4R3SA 5E9DE 1HE7A 3F6IA 4N8VB 4U49A 3RVTD 2C1PA 3BPCB 3EDKA 3IDMB 1RULL 5D8JH 5I9QB 2BHYA 2A6DB 1T7YA 4FA8A 2I60H 5EO1B 2X4UB 4JRXD 5DD5H 2Z92A 2D4FA 4Y16C 2FCBA 3T0XA 2EYRB 3TO2B 3F58H 5E8NA 4HWNA 1J11A 2H32H 4NQEE 2HG5B 4PGEB 3MMEB 5JOEA 1M4KA 2D7TH 2PYFA 4N1CA 4Y5XA 5C8JA 1UT9A 4HPYH 2NY7L 1EFXD 2OP4L 4KTEL 4PJHA 5DHVH 4E0RB 3ARFB 4PJBF 3JVGA 4YHZH 3ZDYE 2X4QA 4IIQA 3AS0A 4KPHH 2CGRH 1CF8L 4L4TD 4NCC1 5IVOA 5JZ7D 2LAGB 1FORH 1LEGB 1JJUA 1XGYL 1A47A 4FN0A 1NANH 2EDNA 1KLGB 5GGRY 5C07A 1HYSD 3SDAD 5I75C 3GJEA 4S1QH 4NZTL 4TQEH 3TZVA 2BVUA 5HHPA 4ZYKB 5DJXB 1BFVH 1HEZB 1OTTD 1RJLB 4MHHG 2IH1B 3VWJB 2H8PB 2EDRA 5BRZE 2QTEA 1Z5LB 3HCVB 5C71A 1UJ3A 1CGYA 5T3ZH 4HJ0D 2FATH 3T65B 2P8MA 5DRZA 4ZPVB 3MV7D 3EYQC 4J3WA 1FCCA 3PE9A 4OTXH 4RFOH 1KENH 2R8SL 3QDGE 4L8BA 2FJGA 2EYSB 1BGXH 4G6KL 3V6OE 1UM6L 5JORB 1EDQA 2ZUUA 1QBLL 1WFTA 4IHOA 4G7VH 3D0VA 3NCFB 3LN4B 5CP7B 1BQHB 1I85C 4JRWA 1F11B 4X0KA 5BZWA 3IDNA 5LXGH 4OD2B 2EEAA 1T7VA 4IM8A 4KJWD 1EHAA 1GAFH 2HKHL 3S5LA 1MFCH 2DQDL 3W9DB 2A73A 5GPRA 3VXOB 2VH5L 1MVUA 3R0MA 3BFOA 5CEYB 4ONFL 3VXQA 3OWEA 3QIUA 2B1HL 3SO3B 1KYOK 1J8KA 2GUOA 3S7GA 3VXRB 3MJ7A 4HIEA 4ALAH 1FE8L 1FH5L 1F45A 5F3BB 2IG2H 3CFJA 1PKQA 4HZAA 5DJYB 3CZFA 4HJJH 5GRXG 4WUUD 3WUWB 4IJ3C 4I0KA 1HKLH 2BVOA 3BYYA 3FT2A 5D5MB 3KPNB 5EOQL 3NZHL 3U7YL 3I02B 5F6HJ 4HZLB 4FQHA 3IDIA 1JWUA 4MAUH 4X6BB 3E0GA 1KN4L 4F7TB 1KIQB 4XPBL 1MCBA 3F8UB 3BO8B 3QUKB 4MCYA 1YN7A 4Y2DA 5IFJA 4JQIL 4TVPL 2XXMB 3DTXB 4LDLB 4L3EB 4LCYB 3ARGD 2H3NA 3HZYA 4M9PA 4EKXA 4F7CB 4KRPD 1MJ8H 3VE0A 3WE6A 5I15H 3HMWH 5C7XL 8FABB 3QEQD 2J8UB 3CVHL 2XACC 3JVGC 2ARJQ 1MFAH 5EOTB 1I8MB 4IS6B 3P9LA 2FYYB 4ZG1A 1NAMA 3HZVA 3ARVA 5C2BH 3VXRA 4HW6A 3WS6A 5I1EL 3QH3B 3SQOH 5D1XB 4M4PA 1BFVL 3HI1A 4OZ4A 3I6KA 3OR6B 1DQDL 3T3ME 1KC5H 3M45A 2YD8A 2Z31A 5T5FH 4MCZA 4MJ5B 5I71B 4ODVH 1T0NB 3SKNA 5CZXD 5DSCA 4LQFL 4OUOA 4RMTA 3FQTB 1LK3L 3ULVF 4P5MB 3HRZB 2VR5A 1OP3H 5FM4A 5BV7H 1LO2L 1TVBB 4LIQL 3QNYA 3HAEG 5SX5H 2LTQB 1T0MA 4ZSOA 4CVXB 4NUGH 2EH8L 1JI2A 4U1IB 4KJPC 3MRIA 4EUPA 5L2JB 2CK0H 1GZPA 2XTJC 2NY6C 2DTMH 1UWEH 1SY6L 1JK8A 4G6KH 3W5MA 3QP3A 3MLUL 3IFNL 4WCYH 4LVNC 4LPUA 3NZHH 4JY6A 1RFDH 1BFTA 1MFDH 3GFUA 5IGXL 3DV4B 2E27L 4H26A 2DBLL 2W60A 4H1LA 3VFRB 4JGUA 3RWJB 2FDBP 3PWVA 2I27N 2IG2L 4FS0A 5D1QB 4DQOL 4KJQC 4NYLB 4GKNA 1EV2E 1JPTH 4PG2A 3ARBA 2AP2A 5IB4B 3KPTA 2GJ6E 4MJ2A 4G6FB 3CGTA 4OF3A 3KXFB 5M7QA 1ORSB 1HI6B 3G6AB 2V9TA 1FSKB 4NKOB 3QNYB 3BWUC 1Z5LA 2HTLC 4ZSOB 2NXYB 3L3KB 4R8WL 3MV9E 3JTTA 2CDEB 1Q72L 3RDTC 5KTEL 4TSBL 4J4PC 3IXAB 2EEDA 1YYLL 3V6ZB 5E99H 4M4RA 3MOAL 3VXPB 3BH8A 1AGDB 3RVXC 4M7KH 5F1KC 1AO7E 3VXUD 3LRGA 4I48A 1FG9C 2WWKO 3O3EA 3P11L 3DX6A 4KK9C 5FYKD 1TCRA 3CLEL 1ZA6A 4PJIB 4DW2H 4OFVA 4F37K 4JO1L 4P9MH 1FVCA 2F53A 3GM0A 4N90D 4D0CA 5JO5A 3KPMA 1OF2B 1U8OA 3ZDZF 2WSKA 5FHAL 2W0FB 1E4JA 2XZAH 1YPZB 4NCC2 1N5YL 3LV3B 4HFWA 2WLZA 4L3CB 5EU4A 2XA3A 2VABB 1MVFA 4MB4A 3L3DB 4HX1B 5GS0C 1XZ0B 5B8CA 3ZDZE 2EO1A 2XWJB 3O4LD 3JWDC 4XBGA 5I8CB 1IEAB 3EFFA 1RVFL 1C7SA 3P77B 1I7RA 3IDIB 1OY3B 4U1MA 4YHZL 1RIHH 4RGMC 1G84A 2MPAH 2VO5A 3HAEH 3SGKA 3SY0B 2VDOL 4YZFE 4LCUB 5CJXA 1RZ8A 3ARED 2HP4A 4NO3A 3BP7B 3NCYS 4GQ9H 5KSBF 3KYOB 3PNWB 3UAJC 4OQTL 4QOKD 1WF5A 3RNKB 5DHXB 4KH2A 1ZHNA 1FJ1A 4XWOC 5ICYB 4WUUE 3QIUB 4URTB 1CDYA 1HDMB 1U92A 4PJFF 3WFEL 3P3YA 5IHLB 2P5EE 2VDPH 2NZ9D 4HS6A 2X4RA 5C0NC 1G0XA 2YBRA 5CJ5A 1U8NA 1EPFA 1U8JB 4P2QB 2NW3A 1LO4H 3CXDL 5CEXA 5MP6L 3MR9B 1F00I 3KLSA 5INCA 1MHEB 2W0PA 1FNEB 2BMKA 3G6JB 4OCYH 5DQJB 1UM6H 4LARH 2XKUA 4YHKH 1IAIL 5C0BA 4YDJB 4G80B 2IBZY 2E9IA 2EDKA 4M6NL 1Y18A 4POZC 4JFDA 3SGEH 3RI5F 3V0WL 4BUGA 1FL5A 5HGGS 1QR1B 4LLYA 3OHXB 4WNQA 1MCNA 4WTWA 4WWKD 4IRSA 3S88H 4APQB 4WY7H 3QDAA 4ZFZA 1VHPA 3TT3H 1XCTB 3GMOB 3BD4A 4ETQB 2E7LC 1NAMH 2D4DA 4PJ8C 1UWXH 3SO5A 3X12A 3O2DH 4PGCB 2RCSL 4K94H 4XP6L 1DVFD 1VFAA 3P40A 1SJXA 1UH3A 3T04D 2Q8AH 4UV4H 5B38G 4R7DB 1FIGH 4I0PA 3OB0K 1CXFA 4LCWA 1S5HB 1WEJL 3KPLB 3BKMH 2AI0L 1FFNA 4RNRA 3FOLA 4HDIA 4ZS6C 1CDBA 2FGZA 4DGYL 2AJSL 1V7NL 2IFGA 5EU5B 1TVBA 4R4NC 4CU7A 2XWTA 4HGWB 4X6FA 2VLKB 2OQJA 4JO3L 5IVXA 4PJGE 4GSDH 1TFHA 4GW5A 3GMRB 1I85A 5GXBB 3GDBA 5F3HA 4EUPB 3WDIA 5JUEH 1EAPB 4QHMB 5J6HA 3WUZA 5TF1L 5E4EC 4PJ8A 4X7SL 1IAIM 2MNUA 4OT1H 3MXWH 1X5FA 2DYPB 2MQ0A 5E24E 5BJTA 4KTDL 2YSSB 3I3DA 4TTDD 1X5HA 3WIIH 1H8NA 1PZUB 3IDMA 3C08L 2NMSA 1S5HA 1E6JL 2DQUL 4TSBH 5FCUH 3N0PB 3FRPA 1CI5A 4OM0H 1QNZH 5IHZA 1ZEAH 5D7SH 5E2UL 1QFOA 5I1IL 1ZA6B 2EC9U 5F7EH 2FR4A 1GHFH 3VXMB 4TUKL 3IRZA 1ZT1B 1IT9L 2DQTL 1ZA3A 1WZ1H 5L88H 1NFDE 2YUVA 4HLJA 1IAIH 1D5ZA 4HFWB 4YDLB 3AS2A 1EO8L 3SDAC 4E5XA 3OBAA 3VU2A 3QXAB 3L5WA 5DUBA 4YUEL 3L9RA 5CHNB 3GB7B 3PWUA 5C0IA 3BP5A 4LQ1A 1IEAA 4J3TA 3GRWH 3P30H 1XCQA 3QJHB 1RZ7L 1YMMD 3BIKB 4PBXA 4HWZB 3MLUH 3U83A 1LEGA 5DR5H 4LHUA 3GRWA 4PJ5E 3CPLB 3EYFB 2LV4A 2X4UA 4P4RA 3JV6A 3T3MF 1I1FA 4KKBD 3DI3B 4PRPE 3QUZB 4JANB 5DT1H 4NCDA 1CLYL 1NSNL 1RMFH 2G60L 4M43L 3V5DB 1KIPA 2P24B 4EVNB 3QJFA 3EAKA 4Q0XL 3QUYC 5FYJL 4Z7VA 3HR5B 3FCTB 5D7KD 4YHLL 3OJDA 3QDMA 4KMTH 3O6FB 3D3VE 4L4TE 4PRID 5DJAA 2VQTA 3MRGB 4L4VE 3RVVD 1X44A 4HUNB 2EYSA 1CICA 4HMDA 5D7LA 2Q8AL 4X98A 2IALA 3WIFA 1IGTA 1YUHA 2YD3A 4HMEA 3EYOA 3PWUB 5C0IB 4ZFFB 4JAMB 4K2UL 5FK9A 5HGBA 3S34H 1T1XB 3VCLA 2FRGP 2BNUB 4D94A 5I16B 2CUMA 4M1CD 1FO0B 1ZGLA 1UJTA 5ESQA 3O6ML 3MBXL 2ESVB 2JKXA 1I1FB 4NRZA 1QR1A 4DUWA 2XZQL 5KOMC 5D5ME 1A6UH 3PQYA 3ZE2F 4HH9A 4WWKA 1G7HA 4IMLB 4UOW1 4R7NB 4OLVH 5TDNA 3W39B 4NQCD 5I8KL 3MRMB 4ESKA 1BZ7A 4GBXD 3RDTA 4XPTL 3MYJA 5C0CE 3T4AA 1U8QB 2ZCLH 5JPNB 3EOTH 2R56L 3LEXB 4PFEA 5HYJE 3LQMA 5EBWA 15C8L 1BQHA 2Q7NA 1F58L 3QG7L 3EYOB 4ZFFA 4NP4H 1ZVSA 5ALCL 3CFBA 4ORGB 2EYTA 4KRNA 5EULV 1E4XI 5E99L 1JGEA 1D5BA 4P46B 4EI5A 5ISZB 4WW1A 4BUHA 4UUJA 4G6AC 4QCIA 4WGVB 3VXSB 1MUJB 3A6CL 2UWEF 1WV7T 1A9BB 3ABZA 3DX9B 2VN4A 5DMIH 1ES0A 3OJ2C 1CR9L 2P43B 3DETD 4JZOA 5DD1L 4ISVB 3ZKND 1RVFH 2IANB 2NY4B 4N9GA 4Y1AA 4PRDA 5D7IA 3IJYB 4F2MB 1RIHL 2PXYD 1P4BL 4HWBL 3ZE2E 5IB3B 3LIZH 4WO4C 3QIBC 4I5BB 3V6BR 1EFXB 1Z3GH 3FQWA 5D2NB 4FFYH 5CZKA 2EIZB 1A1OA 1AD9A 4RAUB 4PV9B 4FABL 1MCHA 1OQOA 2Y5TB 4UNTA 4Y19A 1ACYH 3MXWL 5F9AC 2Y25A 1U6AH 1HEZA 2G75B 3JUYA 3JBG7 3VE0B 4GW5B 4BELD 4YXKL 3OX8A 3MJ6A 4U1KB 1U91A 2ADFH 1KPRB 4YR6A 2XIDA 1RJCA 4NSKB 2X5PA 4LVOB 5DRZB 3M17A 1FL6A 4OB5L 1YMME 4JPIB 2H2SC 3NA4A 3IVKA 4PGDA 5C0CB 5A2JH 4NBXB 1NDMB 1NGXB 2HWZL 5KTEH 1TZIA 2X4OB 2R69H 1YYLH 3CZJA 1H3PL 1KNOA 4PLJD 1WICA 1N8ZB 3OV6A 3SE3C 4P2OB 2X4PA 2JB6A 1RUQL 4JY5H 4TVPH 1RIUH 3V4UL 1BF8A 2V6HA 4PY7B 4RIRB 4LGPB 4HIHB 1MELA 4NT6B 2IH3A 3NCYP 4N0UA 4G6ML 2BHUA 4AEIH 4JO1H 5AZEH 2GSGB 5DA4A 1XGPA 5HGAB 3ULVE 5CILH 1OAZL 1T20B 2I60L 3U48A 3DUUB 1S7UA 4NC1E 3MGAA 4NQUA 2VDLL 4EXKA 4YHYB 1WFOA 5D96C 1I3GL 5D1ZB 1R3LA 2Z35B 1LD9B 2NR6D 1KSRA 4OZIF 1RUAL 3NGBB 2HVJB 4LEXH 3C9NA 4NUGL 4U1GC 4G8IB 4P9HC 2W0KA 3ARPA 2C3VA 3L1OH 1ETZB 4LU5L 4ZDHA 4XTRD 1MCEA 3HMXH 2DLFL 3BDYL 2IPTH 1OF2A 4L9LC 2NNAA 4QOKA 4PJBB 3VFSA 3QUML 4XCEB 4QWWD 5I8EB 3GBLA 2GSIB 4JDTH 4X6DB 3DXAE 3ETBF 5ANMA 3ES6B 1T0PB 1JYWA 2ADGB 1KB9K 2BNRB 3VFPA 1F2XK 5ENWA 5IROA 3EO1A 3QEGH 4IBLT 1WCQA 3U1SL 5E1AA 4X4XB 1SYVB 3VI3E 4GAYA 1IGIL 4D9RD 4YK4C 5TH2A 4G8EA 4QRRB 4PJAF 4ZOAA 4C59B 1IGFL 3T4YA 3QFJB 3MO1B 4M1CC 4AH2A 1TCMA 2WP3T 4OBRA 1XIWB 4FG6C 1T5XB 1C1EH 1FPTH 1RIUL 1SVZA 3QB7C 1AQKL 5TE4H 2FH8A 1J12A 3U2SA 3K2UL 1MIML 5L2KE 4GKSA 1C5DA 1F3DH 1VFBB 3O3AB 4XPHL 4TPRL 1NMCC 4TULH 5JW4Q 2UZYB 2M1KA 1CF8H 2DAVA 2DM4A 2JCCF 4KPHL 3LSOA 3TV3H 1KIRA 4PRDB 4NZUL 2QSTA 4IRJB 1BWMA 5INDB 2Z31D 5C9JB 4H1LH 4JCMA 4MWFB 1I8KB 2VDKH 1FZMA 2I24N 4P46C 3SQOL 2AEPH 3TFKC 5I1CL 1DVFC 3NBNA 4E41A 3CVHB 3VFVB 1F5WA 3B5GA 1PEZA 4ONFH 1MFAL 5D7JA 3V4VH 4JRYE 4R0LB 2AEWA 5CMAB 2HYMA 2NX5D 4QXWA 4BSWA 4FFZH 1MFCL 2EH7L 4FXKB 3TO4D 4P57B 1KOAA 2IMMA 2D7TL 1OSZA 1SBSH 5IMKA 1D9KD 1U8IB 3FB7A 2W9EH 5I1CH 1WAAA 5KSBE 1T1YA 3V6OC 4ZAKB 2AK4E 4QXGL 2IF7A 3G5XA 4Y5YA 4D9QD 1DUZA 1PG7L 2IAMA 2ZUSA 1DLFL 5DUML 2AJUH 3D2UB 4YBQD 2UZIL 1FAIL 1S7XA 2B1AL 1XGRA 1OQXA 3LEVL 5GJTL 1IAOB 3FT4A 5DRXB 1IEBA 2X10A 3FMGL 3X13A 1BZ9B 1RFDL 5EIIA 4IOIB 3LQZA 2X6MA 1MCSA 5I71C 4KK8C 2VLKA 4D0CB 4HBCL 1U8PA 5DJXA 2A83B 3WJJA 3U9UB 2W0LA 5KVFH 5DJ2B 2KKQA 1KB5B 4J2XA 3MLYH 4XCCL 3WEXB 1GHFL 3TVMD 2GSGA 1Z6JT 1Q9KA 4R6UA 2ZKHL 3FONB 3LKNA 35C8L 3PWPB 1G9MC 3T65A 3VFNA 1QVOA 1U58A 1TIUA 1OAXH 3OKMA 3U0PA 4PJDE 2P8LA 2MQ3A 3JZ7A 1QLRB 1YEFH 4KROC 5C0EA 5F6IC 4M1GH 5GGVL 4C55A 2JJTC 2Y06L 1YMMA 2YPLA 5DD0L 5CCKL 4E41E 1FBIH 5CUSH 4G3YH 2DB8A 4FTVE 4FQIH 4FZEH 4D8PA 5E2VL 1G7IB 4RDQG 2ADIB 4LSTH 3NFNB 3WXVH 1ZS8A 1ZWIA 2ZJSL 3P4OB 1DDHB 1I9JL 3VMOA 2R0WL 4POUB 1I3UA 5IOPB 5DGQA 5J7CC 4DTGH 5JLZA 4S1DD 2SEBB 3ZKXC 2NXZD 3CVIL 1A6WH 2WUBL 3T3PF 1S9XB 2CKBB 4PTTB 1GOGA 5DMGD 2P8LB 5DC4B 2VDKL 2NX5A 3JV4A 3I75B 3TBTB 1K3ZA 5E00A 4WUKL 1T22B 3RVVC 4QRRD 1GC1L 1C7TA 4JFDB 4ZUUA 3WFDH 2F54D 2J4WL 2R4SL 4FHBD 2MSPA 4PBWD 4GMTL 5I73C 1GGTA 2OR7A 3HC4H 1DZBA 4M02A 4NKDB 2V5RA 2Q76B 1JPSL 3D1MC 5GZNC 3SEPA 3WFCH 4XX1G 5HHXH 3GMMB 1MREL 4TTGA 1ZT7A 5AUMA 5F7DB 4XCYA 1XGTB 2NLJA 1CLZH 4C58B 1YEKL 3U0TA 5T5NF 4QRPD 3BUTA 2W9LA 4UIKL 1SYSB 1D7FA 4N5ED 4YPGA 1S7TB 1IL1A 1ZLSL 3I6GA 2VWEE 5AAWA 5F9DC 4ODHH 3VWKB 3IU3A 5KS9B 4L3EA 1HNGA 5JPMB 3BP4A 2B39A 1F97A 2PTTA 3BT2L 2BNQA 4P3DA 5CINL 3WO4B 2VE6B 5HYJB 1ORQA 1UWGL 1RK0A 3RVUD 3QDMB 4LASL 3HB3C 3QHFL 1QBML 2GFBB 1CCZA 3PGCA 3L3OA 5F7YC 1TXKA 4EIGB 3MV8A 4S1DC 2EXYC 3ULUE 1TZGH 4PJCA 5E08L 1EH9A 4MCZB 4R90H 4Q9QL 4Z77B 5DYOB 4YHOL 1DANU 2ARJA 3TZVB 1SEQH 3UXFA 5ACZA 4OIIH 3MCG1 2Y4SA 1CE1L 5EU3B 2XQBH 4QHNB 3EDDA 1GGIH 2PW1A 2PXYC 3BIBX 1H0DB 1CDIA 1N5YH 4KHTH 4KC3B 3RIFF 2OJEA 3PXHA 2HJFA 4RMQA 4M3JA 2JCCB 5C9KA 4KRPB 2PO6C 3S8WA 1JK8B 3UYRH 1R5IA 1QSED 1NLDH 2P45B 4HG4J 1TJGL 3DGCR 1UQSA 2FB4H 4HF5H 4MAYB 3V0VA 3P11H 3MNWA 1IGJA 2AJ3B 4XWOD 1S8DB 2D7PA 2DICA 1N6QH 1VGKA 1IAKA 2E7MA 2I5YL 1YPZF 3HPLB 4KXZH 5GJSH 3PIQA 4DGIH 1JPGB 4Q6IA 4C56A 1FFPB 4P2RA 4Y1AE 2B0SL 5D2LF 2JELH 4JO2L 4FP8L 4HIXH 3RWFA 2OSLA 1WTGT 3HI6H 3V0WH 2NY1C 4YDLC 3WXWH 2FHBA 1VESA 4JFYB 5E8DL 3UJTH 4MAYC 3HE7D 4MLIA 5D93B 43CAA 3WUWA 2HJFB 3LRSB 1UM4H 3LQAL 4JPIA 1G9EA 1OAYH 3LEYH 2JJWA 3IDJA 4KUZH 4QXTA 1LO5A 2IFFH 3MGOA 1A7PH 2OCFD 5F8RC 4F15B 5FF6B 2Z8VC 1H5BB 3NACH 3RZCB 3UDWA 2ITDB 3IF1A 2R2HA 1FNFA 3UX9B 2GEEA 1EIBA 1OAYL 3LEYL 3ZKSD 2F5BH 1ZGLB 3FZUC 4BFIA 1FVCB 2F53B 4P2RB 1YN6B 2VDNL 4MXWH 5HHNA 4Y4KB 1A8JH 1ZS8B 4K8RC 4HIHA 3QO0A 2OX5A 5D2LB 1XR8B 3VXSE 4YFLF 1OW0A 3V8CA 3VH8A 2DF3A 4ZUVA 1L6XA 4JFDE 4QTHB 2BFVL 4PB0L 3D39D 1A3LL 1NLBL 4U1GB 1BIHA 1OD9A 2EDLA 1RURL 2YD7A 3H9YA 2FB4L 4M6ML 4GW4B 5DMGC 1ZANH 3QUXB 5F88B 1MRDL 4XVJH 4NRXA 1MFBH 1BBDH 3Q6GH 1T22A 4J8RB 3CFBB 4JDZB 4YDJA 4K3DH 5F7LB 2PW2B 1G7JA 4XH2A 2ZPKL 4K94C 7FABH 4Q9CA 3U30C 3NA9L 5CD5C 5KG9A 1SJHB 4I13B 3HI6L 2P42B 4CMHB 2FX7L 2H32B 3TWCL 3NIDF 4O02L 2DQJL 5E2WL 4ONOA 3ROLA 1UZ8A 4PRIB 3VDCA 5GZND 1ES0B 2HT4D 4LMQI 4WGWB 1CG9B 4KJYA 1MSPA 5LQBL 3RDTD 3MOQA 1S7SB 3TO4A 7FABL 2DQFB 2NW3B 4P2QA 4YDKH 4AZ8A 2VYRE 3SHSA 2VJXA 1J05B 3K0WA 5D2NA 5IBUG 5EZIH 2B4CH 3ULUH 2AXGB 3W9EA 2C1PB 3BPCA 4Z7WB 1QLFB 3PWNB 4GW4A 3QRGH 4UQ3B 1MCDA 3MLZH 1KJ2L 3LRHA 4FZ8H 5SWZA 3OXRB 5EU5A 5DD6B 4F33A 5GGSB 1U3HD 5C0AA 4MA7H 4U1JA 3VG0L 3IFLL 3EOBA 5DVKA 4DKFL 1C5DB 2G60H 3WSQL 4MA3A 3C60C 5KSBB 3ES6A 2MCG1 3OKDB 3O2VH 4AIXA 2W9DL 1VFAB 3WDJA 3HC3L 1AGDA 1I3RA 2MPAL 3I6KB 3K1DA 4JKLA 3UC0L 3O3BB 5L8KB 4FQXA 5I1LA 3U4EA 3RTQD 3GUTB 5CEZE 1D5XB 2ARJB 4MWFA 4NQVB 1A6ZA 4JHBA 5F1IB 4UTBH 5MERB 1JYXA 5FDWA 5C0BE 1G9NH 4Z8FH 1N7MH 2BRRH 1KTDA 2CIKA 5E5MA 4LCYA 5E70A 1AR1C 1RK1B 1NGZA 4WI7A 2QR0B 1VFBA 4GG6B 3QIWA 5I1KH 4U1JB 2FGWH 3CC5B 2X4SB 5EOTA 3QFJE 1F4YL 3EUUA 4YLQT 2IJ0C 5HVWA 1Q9LA 2HT4C 1A7BA 4WUKH 1RZJH 4DVBA 3ULUC 5I8OH 3R06A 3BN9C 4WFFE 1F58H 4EDXB 2P8PA 4I1NB 3TBWA 1BFOA 1DEEB 4LHJB 5D7SL 5E2UH 5EZLB 3OR7A 2IPUG 5DHYA 5MP6H 1AP2A 1OHQA 3MRLB 5J0BA 5GHWH 4PRHA 3K46A 4NDMA 4RFEB 4K3JL 1I8LC 3SOBL 2C3VB 5LQBH 4WFHD 1NMBL 5JIPA 3DARA 4Y4FA 2ICEB 4OGAC 2JIXA 1NJ9A 1IZKA 3NA9H 4K3GA 2R0KL 1JCKA 2A9ML 2AEPL 1VFOA 2VIRA 5HI3C 3QZWG 4DZ8A 5DZNA 2YMXL 5DF0A 2P48B 3JTSB 5FCSH 3UTZB 1U8NB 1MQKL 5J56B 3JSSA 2X1XR 1R24A 4U1SB 3SDXE 4F58H 1N5AB 2BOCB 1QRNA 2OXHA 3DXAD 3O6KH 1FNEA 2BMKB 3HPJA 4NO5B 2Z8RA 2X1PA 1UB5A 3E1F1 4HWZA 1FYTB 3BH8B 1ZLWH 3UO1H 1P2CA 5IQ9A 4WCYL 5B39A 1WEJH 1Z9SA 4ZS6D 4DTGL 5TE6H 5F1NB 5M95B 4NKQB 3QFJA 1K4DB 2G5RA 1EMTH 3QPXL 2CRZA 3OAYH 4KJWC 2VH5H 3RGVB 1G7MA 3MLVL 1T5XA 1U8LB 2FECL 1RZKH 1IM3B 1P4LA 3BUYB 2N56A 3G6AA 2FX8H 4P9ML 2WBJA 2ATKB 1NFIA 1P84J 3PQYB 4PJXF 3CAFA 12E8H 3DUSA 1RIVL 5HTSA 3QAZB 3TT1L 1CXIA 4WRLA 2FZ3A 3U1SH 1PSKL 5DMKB 3KPOB 1JNJA 2M2DA 4RDQF 1CICD 5JXEC 4JHZA 3QIWC 5TPWL 1NL0H 2XN9B 5IFAL 5JLZB 4JDTL 3TH2T 4NQTA 3MOAH 3EFFB 3OKOB 2UUDK 2ICWB 3G6JE 1AXTH 1FYTA 2AK1H 4JLRB 4Z7WA 1NBYB 1AKJD 3LOWA 1I1YA 1KB5L 3SJVD 3RWGA 2NW2A 5E5UB 1QEWB 3GI9H 4NN5C 3H3PH 5FOJA 3MJ8B 5D7JB 1G7IA 5TGBA 5IEHB 4NBYB 1KCUL 4BFGA 3S3PA 3H8NA 3T0AA 4HH9B 4MDIB 3ZTJG 3PP3H 3ZKQD 4N5EC 1C5BH 2X70A 1MUJA 1PDKA 4PYGA 4YHPA 5SX5K 4XNZB 5SWSD 3TO4B 3DO7A 4DGIL 2DLHA 2BVPB 1TTUA 5IR1B 3HS0A 4F58L 3U4AA 4OZFA 1HN1A 2HT2C 1NBQA 3Q5YA 2NTFA 2WQRA 4KDVA 2VISA 5IHZB 4Y8DC 1I3VA 2KZWA 1TJIL 5HGHB 4ORGA 2VRAA 4XB8A 4G80A 4XCNB 1WIUA 1FL3A 2ZOLA 2QHLA 4M8VA 5KAQF 4QRUB 3RFZC 4EN3A 2ZUQC 2HRPL 1DLHB 1JRHI 3VMNA 4AMKH 1KJ3H 1RZIB 1EUUA 3OAYK 4APQA 3WXVL 5IMLB 5FHAH 1GGUA 2HJKB 3GHEL 4WV1C 2V7HB 4LKXA 4NRYA 4CN6A 2J88H 5FECB 2DJ4A 4JHAL 4HKBA 5K9JH 4GXVL 4H20H 5FUZH 4M48H 4J3UA 4BZ1H 3BIKA 1CFNA 2DM2A 1FG2B 2AXFA 4OFIA 4OQTA 3SJVA 2I9LA 3G6JA 1QSZA 1KXQE 1S7WB 1QRND 4XI5C 4Q9RL 2ARWA 4KAQH 5JA8B 1F13A 4N8PA 5ID1B 1MCIA 2D9QB 4M00A 2Y5TA 4RAHA 1MLBA 1TCRB 3VGAB 3B9DA 5AZ2H 3AREB 3B8YA 2EIBA 1V05A 3CLFL 4XPHH 5EUKB 4FQJL 2HMIC 3KS0H 4DZBB 1T1WA 5I74C 3HR5A 2ED9A 1T5WA 3AC0A 4GAJH 4PJ9A 4OSUH 5L6YL 1ZLUH 3WJJC 3HNVH 1ZLSH 2R29L 2HLAA 1KIUA 2YA0A 3PP3K 3ARFA 2ITCA 5FKAB 5GRUL 1ZLUK 4H8WH 4WV1B 1TPXB 4HKBB 1XR9A 2WBJC 4LSUH 1F8TH 4LOUD 1A3RH 4F9PC 1WBZA 3QQNA 4JRXE 3RWCA 3SJVB 3DX7A 1NGQH 2NY3C 1AXTL 2YPLE 4IRZH 1EK3A 1I9RL 1ZLWK 5EU3A 1U95B 1XIWC 5ANME 1PX4A 3FQRA 3DGGA 5KS9E 4MA7L 3OKKB 2FD6L 4NQED 4JJ5A 3M07A 1YEJH 4EEEA 3D69B 3D85D 2WMPA 4LLUB 4Q2ZA 3VWJA 1KJ2H 3ZE1E 4CVZB 3JTSA 1ZT4B 3RZCC 5A2FA 5DJ0B 5BW7C 5I30L 3RDTB 3AS3A 1ONQB 3ILPA 2AKRA 1G7PA 2NXZB 4C56E 3C2AH 5BOZG 5D1XC 1D6EA 2HKFH 2PN5A 2BOCA 3KPOA 4LEXL 3PHQA 2OK0H 1J8HD 5EPMB 3OF6A 1LP9B 4FQCH 3NIFE 3AY4C 4HH8A 4GBXB 4XVUC 3MODH 4YPJA 1AI1L 2DQCL 2EO9A 3E2HC 1BGXL 4LPYA 2ICWA 4X5LA 4NO3B 3F5WB 4YQXH 3UO1L 2CD0A 2R9HC 1SBBA 4OD2A 1A4KA 1FN4B 3L3JB 4Z18A 2CMRH 3MA9H 3MJ9L 2M26A 3GMLA 1S7VB 1A6VL 2FGWL 1FFOB 4OLYH 2ADFL 3BJLA 1V3LA 3DI2B 4TULL 3QO0B 5EB9A 1HILB 5D2LA 1IILE 4H8WC 4GKSB 2D31A 1T7WA 3FO2B 2FJGB 4FNLH 4W81A 2CJUH 5DTFB 4K7PX 3RHWF 2BJMH 2GT9B 5D7IB 5C0ND 3PABB 1CICC 3GB7A 3I3EA 3IU4H 2QL1A 3X3FH 5C86A 5HYSG 1ADQL 3GMPA 3P2TA 4Q9BA 4PLNC 5KJRL 1AQDA 2R69L 4NUJB 4OZIB 3ZL4H 1AGBB 4NQDD 3ZKMD 4CDGC 2HWZH 5KBNC 2PXYB 2VLJE 1H8SA 4CJ0A 4POZD 4XAWL 2I07A 4ODSH 4MNGB 1HH9A 3SGJA 2PW1B 1A7NL 5J8OA 2EYRA 2F58L 3GMQB 3PDOA 2D03L 4RMWA 3BEVB 3NN8B 4WO4A 2P47B 3WFBH 5JZ7C 4KROD 4ETQA 3M17B 3F7VB 2QHRL 4UQ2B 1BBJB 3RAJL 5CSZA 4KVNL 4Q7DA 3AUVA 4J23A 4MJIB 1H9VA 4YWGH 4PGBB 1XFPA 4PG9A 3Q48A 5E8EB 3ZE0E 4PJ7E 3SDDB 3VGHA 1LK2B 5IF0A 1UM5H 2C7UB 3MRCA 4OFYD 4YUEH 1QSEE 4HIJB 4H8WL 3S5LG 4P4KC 2BVQA 3TA3D 4P59L 4RNRB 1VGKB 3V5KB 3C09C 4F3FA 1YY8A 4PY8I 4HUKB 1AFVL 3CCHA 1IGYA 3SDXF 3F7YA 1QSFE 5J1TC 1YN7B 4Y2DB 4LSRL 1MRCL 4QO1A 4HULB 1ITBB 3UC0H 1VENA 1LVEA 4RX4A 1VADB 2Y72A 1N0XL 4RQQB 4U1LA 4O9HL 1D9KB 1F4WH 4MQXD 4NRZB 3C8KB 1RUQH 4X7TA 3OPZH 3K80A 3BGFC 3QWRD 2H2PC 1K3IA 4OLUH 1K2DB 4XP4H 5EWIH 4OCWL 1IFHH 5BV7L 3NN8A 4WO4B 5AZEL 2UY7A 5JTWA 5F1SA 3IFOB 1BEYL 4MMZC 5ESAB 4KTDH 3U9PL 1EGJA 1LO5B 4PJ9D 4KMLB 3QAZC 1QBAA 1DQLL 3O4OB 2GK0B 4MXVE 3D2UA 4WV1A 32C2A 4GXVH 4H20L 4P5TD 5F97E 5FUZL 4HIJA 1TJGH 3C5ZA 1XF4B 1H3PH 2DDQL 3UPRB 4UT9H 5BVJB 2OR9L 5C0EB 5GS0D 3VXUA 5EC2A 3K8MA 1UEMA 5GS1B 4ZUWB 4NHUA 2W65B 3SDXB 4GLRI 4B41A 1I7UA 2R0ZH 1WFUA 3WKML 4NM8H 4KFZC 4CVXA 3SE9L 4OCNC 4MA3B 4GG6A 3M8OH 1C1EL 5IVNA 5I8EA 3QJFB 4YHOH 4Z7VB 3RWEA 3D48R 4OIIL 5FV1L 1TZGL 5E08H 1LO0H 3TVMA 2YKLH 4WW2A 4P99A 4R2GD 4K7FA 1ZSDA 5GIRB 5DD1H 2A74A 1BVLB 3NFSL 4LCWD 3V95A 3O11A 2PKDA 5IEKA 1FGNL 4MNGE 3TH4T 2EIZA 2M8XA 4HGKC 3O3EB 4FFYL 4XP1H 5FYLL 3FQRB 5GRZA 5IB4A 4YBHA 5IFJB 5HPOA 2APVA 3E6FA 1JZ6A 4YGVB 2HA1A 5BQ7B 2VAAB 3IJSA 2JJVA 1F6AA 2XKNA 5L2KD 2CLZA 1G6VK 3MTRA 5H35A 5J1SC 2HFGH 3VGDA 4NKDA 1BAFH 4DVBB 1IQDA 2PYFB 3MBEC 3LSOB 4HAGA 1MI5A 4MXWL 4PRPA 4X6DE 4PJ9C 2CXKA 1NCAH 4PR5B 5I1AB 4RGNC 4GBXA 4NO5A 1R6VA 3BKJH 3RGVC 3G5ZA 3JV4B 1KEGL 1GOHA 1YNLL 4OFYA 5LGJB 4OTXL 3P0YH 1DJSA 5L9DL 1EA9C 3FFDB 3U36A 4R4BB 5F7HA 3VWKA 3MV8E 4U6XA 1C08A 1I4FB 2VAAA 2COQA 4OGZA 4ODWA 4KUCF 2FECI 1L9MA 1QRKA 3W39A 4X8JB 5F9JB 2CRIA 4N8VG 2WUCL 4H0IA 1U8HB 4HEME 3MV11 4X80H 5DQDL 1JHKL 2P8MB 1OM3H 3UTSB 3ZYIA 3NTCL 4L8BB 4ZO6A 1LK2A 3GSNH 4FP8H 4HIXL 3VA2C 2J6EL 3IFPB 2OTPA 3UBXB 4QRPA 3O6LL 3ILQD 2VSCA 4Z7UE 3CDCA 5I1LB 4Z5RA 1OGAE 2NY1D 3CSBA 2BVYA 4FTVD 2I26N 3U4BH 4EN3C 1DVFA 4K9EL 4PJ8D 2J2ZA 3O4LB 1HHJA 3VRIB 3RNQB 3LKQA 3LB6C 3VFMA 1TTGA 3H6JA 2ZJSH 4PLOB 3OKLB 4BQCA 2CLRB 4LSTL 4MHHI 4WFHE 2BNQD 3FAXA 4G3YL 2XG4A 4ZXBD 4JO4L 5DJ6A 4NOBA 4BH7B 1R3KB 2OXGA 2FD6H 1Q0YH 4FFVD 5I0ZA 3UROR 4MMXC 3NIGE 3MBED 1CZ8H 3R1GH 4CW1A 1OTUD 3ARWA 1DQML 3TEUA 4X6EB 3LKOA 2NXZC 1RV6X 3KPPB 3SJVE 2NY0B 3L3GA 2RQ8A 3TH3T 3DYPA 4LL9A 5JDJA 4PP1C 4KDTC 1RSFA 1EEZA 3LKSB 4Z76A 1OB1B 1NGYB 3T08A 3Q3GB 4KQ3H 2EC8A 2RFXB 5F96H 1KPRA 1K85A 5D7LE 3MV7A 1AIFB 3ARTA 4AG4H 3BQUC 4Z7UA 1YECH 3A0OA 1R3KA 4KKLC 1T20A 1X4YA 3QISA 2X9XA 2XWJA 3L3HA 4QRSA 3HC0A 1OL0A 3IDJB 3N50A 5AWNL 2NTFB 5MENA 3HTLX 3VMPA 4LSPL 5ICXA 3HE6A 1E6JH 4LP5A 1UB6A 2HH0L 2ZCLL 1IKNA 3MNZB 2A77L 2DQHL 4LAQH 2X4PB 3C09B 3TN0C 3RX7A 4DK3A 3HR6A 2C1OA 4OI9A 1KN2H 4MS8D 4ZDHB 3T1WA 2A1WH 3VXMA 3KWWB 1CD8A 4KVNH 2B5IC 3UJIH 4ODVL 3PGFH 3RBSA 3ULVH 2HRPH 3HNSL 3E8UL 5D96B 4R90L 3RIAK 5EBMB 4Q9QH 1N26A 3V7MA 3LS5L 3G5XB 3ULUL 4PRPB 4ZO9A 5DFVD 5CEXB 4NWTL 4ENEC 3PL6B 1CK0L 1S7WA 4NZJA 4GAYB 4Y4FC 2ERJC 3G5YA 5IHUH 2AI0H 5DRXA 1YEIL 1WWBX 3CFCH 1A0QH 5F7FA 3FFCD 4UTAH 4NC0B 3TIDA 2NY3B 5DEGB 5GS0L 2C4XA 4JDZA 2IWGA 4TSAL 5DK2A 4MA8L 4M43H 4TSCH 1I4FA 5SV4A 2BP3A 3HNTH 4PPTA 3MLXH 1JPST 1NBVL 4HHAA 1AFVH 3UTOA 5F21B 3CFJB 5DJYA 3X12B 2PO6D 4G8GB 4U31A 5CWSA 1BBDL 2PR4H 3DRTB 1TNMA 1VB9A 4XBEL 5C0AE 1GVIA 5T33L 1W8OA 1HKFA 3HG1A 5DK0A 3BZFA 4JHWL 4OI8A 3QXUA 1FRGL 3OTTA 3WJLC 2DLGA 5GSRB 2H26B 1AO7A 2ESVD 4OAWA 4PJEA 3BKJL 4FQCL 4GBXC 3TBYA 1A6TA 3VXMD 2F9BT 2DWEA 3QXVA 4Z7QE 4GG8A 4KI5D 4WI8A 3ESVF 4LFHG 4X5WA 1RZGB 5KG9B 2YUWA 2VDPL 4L8SA 3TNMA 5C08E 2EDYA 4PJ5B 4JR9L 5FB8A 4YDIL 2BXZA 1Q8MA 1ZWIB 5H8DA 1MEXL 4P2RD 5ACMA 5KJRH 1P7KB 4ZODA 2QADC 3ZKXB 5IBTH 5KSBA 1AHWB 4G42A 3C60A 4TVPE 1QZ1A 5CP3A 1BZQK 4DKEH 5GGQL 3CSGA 2Z8WC 3VFTA 4ENED 4DN4H 5HJ3B 4GG6F 5EBWB 1JHLL 1JF6A 4K71B 3SKNB 3NCJH 4YK4B 4G6MH 4UDUB 3J7HA 4Z7OF 1JZ5A 1A6TB 1I1AD 1KULA 1VACA 2X2YA 1NDGB 3QRFM 3DO3A 4L8CA 4WI6A 2V5YA 3GBNH 4P4KD 3TA3C 4FQXC 4K8RD 5E9DB 4PRHE 1XT5A 1CXHA 1L0QA 1NGZB 2Q1EA 1JV5A 1LO2H 2L7UA 3S96A 5E8PA 3QULB 4FFVC 1LHZA 3RGHA 4XNQB 1BD2A 2YUXA 1NCDL 3V4VL 4ZUTB 5BMFH 3PDGA 5T5FL 5SWSB 3TJEH 3U4EB 3KGRA 5MENB 4MNQA 3GIVB 1DUYB 4A2MA 1MHPL 1J1OL 4QNPF 3RQ3A 5I17A 5I8OL 3MJ9A 2BRQA 5SWZE 1TETL 1IKFH 3QCVH 3QI9A 2A83A 1V3KA 4JFDD 1WUNT 4KK8D 5DDHB 3C6SA 2VL5A 3QHZH 3KWWA 4HK3N 5BS0E 4KKCC 1AY1H 3O4OC 4XZUB 5FIEA 1NJ9B 4UNUA 4XPGL 1L4IA 4LNRA 1ONQA 1XCTA 1Q9LB 2CDEA 1S9YB 2B20A 2BNRE 5ICZB 3K2UH 3RI5K 3PJSB 2R2CA 4XVSH 3IYLW 4LARL 4YHKL 1R24B 3KJ4C 3H42H 1MHCA 3OGCB 1MH5A 4KY1L 5EIQA 5GGTL 3QXWA 1NEUA 4XPBH 1JWSA 3BW9B 4WWKC 2LAAA 4ZNEE 3MRLA 4EDWL 2XNAA 1UQSB 1S9XA 3MXVH 1UCTA 3I50L 3ESUF 1A7QH 4D9LL 2HKFL 3ARZA 5F72S 4J4PD 1KUMA 3ARYA 5HVHC 1JNLL 3QCTL 3WD5L 5DJZB 2VZUA 3D6GA 3ARBD 4PJGA 5DS8A 1PAMA 2GI7A 3P4OA 4QOKE 1J87A 1NFIB 2ZNWA 1S7SA 2YEZB 3BSZL 2DI8A 4U1SA 3L7FA 3RA7H 3AGVA 4EOWL 2XOTA 5CJQL 3RWHB 3M1BA 2WNGA 2ADJA 4MB3A 5I1GL 5B39G 2VZ1A 5C09B 4MAYA 5GIRA 3BWAB 5HHOE 2Z93A 2ZSVA 3BOVA 2Q6WB 1QBLH 4M1DH 4DN3H 5BVJA 1N8ZA 1EEYA 3KR3L 1EJOH 5C07B 3O4LE 3VG9C 4S11A 1AGFB 4OCSH 4OGXH 1D5IL 2A6JA 2ENYA 4HAFA 1I3GH 3Q0HA 1KCVH 1L0XA 3O2WL 4MA1C 4Q6YA 3DHMA 4WIQA 4JM2A 4RGND 1YNTB 2NY4C 5T3XH 2JJSC 3QIBD 1BQLL 2YZ8A 1AY1L 2PTTB 4FQJH 1Q0XL 3ARUA 2X7LB 4Y4KA 4ZO8A 4PJBA 2P5EB 3P4LA 4OV5B 5EORL 5F7DA 1TPXC 3TNNB 5F9WC 4XPAH 1M6OB 2CMRL 4LLWA 5KSUA 1I3RB 4FFWC 4GAGH 4ZUVB 1P9MA 4RZCB 1P6AB 3QEGL 2Q20A 3L7FB 1ZKAA 1WK0A 2HMID 3MV8B 3U6RA 5FUCC 4YX2H 1H5BA 2H26A 4HXAL 3SGDI 1F6FB 1MRFL 4WHCA 1WIOA 2YWYA 3N1PC 5C0FB 1ZK9A 1EEYB 4EUPH 4NRXB 5JIHA 3IDUA 3P4NB 4R8WH 1KCUH 3L6FA 4YJZL 1MEXH 1GGCH 4LPVA 1KJ3L 2OQJB 4NO0B 1I1AB 4HGMA 3SDDC 3RY5A 4P4KA 4HMCA 2VL4A 3HNSH 1Q9WA 4B7IA 3TBVB 5D72H 1B4JL 4ONHB 1HINH 2B4CC 1TJIH 3ZSTA 5FOBA 4QRQB 5IJVA 4KK6C 5ENWB 4W70A 5GQBA 1LMKA 1AP2B 2VDLH 2VXVL 2X4QB 3FO9A 4RGOL 5IK3B 5C0RL 4OKDA 2DMCA 4ZSOE 1IGJB 2AJ3A 4L8DB 1MQ8A 2EXWD 5CS7A 4OCXL 1KNOB 1A7QL 5DJCB 3RZCD 2R2EA 1LE5B 4JB9L 5CZXC 5EC2B 3F65A 3PIQB 2ORBL 4RX4D 2VC2L 5CJOH 2ZUXA 3G5VB 4Y4FB 3SE8L 5I1HH 1F90L 3EO9H 4DJMA 4PY7A 1MAJA 4KI1A 1AGCB 1RUKL 3WN5A 1EMTL 1CR9H 1UXWB 3QPXH 4LLMB 1WBXA 4PJBE 1U8HA 4PJCE 5DJ6B 3WHXB 1YEIH 4LNRB 1NBZA 1AJ7H 5KVGL 5C0CD 3ARSA 4AG4L 5GS2D 3VD7A 4P48A 2VZOA 3MYJB 2C3WA 1CT8A 2GJ6A 2ZG2A 2PYEB 1KT2A 2UZIH 5C9JA 4BQ8A 3WV0A 3O3BA 1E4XH 4AEHH 4UV7H 1N59A 5JIKA 1DANT 2YKLL 3LQZB 2H6PA 4PJ7B 2V2XB 2CLRA 2IBBA 4NYLA 1DBJL 2BY2A 4IRJC 3KJ6L 4NZRH 3I6LD 4JFYA 4HKZB 1DQJA 4WWID 4JFZL 1W2KT 4NM8L 1AD0B 1OCWH 4FABH 4OI7A 1E28B 1NC4A 4WTXA 5CIPH 1K8IB 1DBJH 2CO7B 3F58L 3KYMB 3LS4L 4KDWA 4GO6B 5E7BA 5CGYD 4I18A 1OAUH 2YD1A 3BW9A 3MRGA 3QQ9D 1MIEL 2RGSA 3BHBB 1B6UA 3MCLL 3SE4C 4P49A 5I76A 4XP6H 2VDML 3NCJL 4XNMA 3FQWB 3DX7B 5DMIL 3RWGB 3GM8A 3QUXA 3GSWB 1T4KA 6CGTA 1H3XA 3DIFB 4HUUB 1MJ7H 4M93C 3P9MB 1XIWA 4G7YL 2IMNA 2RFXA 4IRSC 3QHFH 2W38A 3LD8B 2AJZB 2BX5A 1OP9A 3O81A 4PJ5D 1A4KB 3O9WA 5A1AA 3FN9A 1ZOXA 2OI9B 1MVUB 4D3CH 1U8MA 2E7LA 4JN2B 4WJ5A 2PTVA 4CDHA 3HAEA 1RU9H 4R7NA 4U05A 5JOPD 1INQB 4PP2B 1R5VA 1U58B 1VEMA 2VDQH 1HCVA 2GTWB 1U9KA 1HSBB 1S9VA 5FCUL 2QLVB 4GQPH 3I84A 3WNLA 2NQCA 2C3GA 1U93B 4WUUA 5F88A 2CKBA 3DVFA 4PTTA 2CUIA 3BKCH 4L9DA 4MJ5A 3VGBA 3QI9D 5C0FA 3TBSB 3DBXA 4JHWH 4EI6A 5TPWH 1FC2D 2QQLL 5IV2B 4K3HA 4Y0GA 1DQQA 2MQCA 1OP5H 2VN7A 3NFNA 1TLKA 1JNNH 3GO1H 1RZKL 5IMLA 2HN7A 2H8PA 1T80A 1IAMA 3TPUB 5FGSA 4YFDB 1IE5A 5CZVH 1UC6A 3JWDL 1JGDB 1T1YB 2GKIA 2WIMA 4GOSA 1KXTB 1CN4A 5CWSB 4PG9B 1V7MH 4GAFB 2X4RB 43C9B 4QRPE 3B43A 4M6OL 3FO9B 1H15B 2Y36H 2QSCL 2DI7A 1WFNA 1BJ1H 3MNVB 5C08B 2E5EA 1GYAA 2DQJH 3C08H 4NQDA 5E2WH 2LTQC 1ZLVK 4LLQB 3VXRE 1VGEL 3FKUS 2X4TA 4J3SA 4ZXBB 3PNWA 1CLYH 2FHFA 3L95B 2CIKB 3VWKD 4DW2L 5DJ2A 4OGYH 1PYWB 3S88L 1A64A 2NR6C 3PWLA 1UXSB 1A9BA 4M7ZC 1YJDH 4E42A 1T7ZA 5FO8B 3INUH 3D39B 3STBA 3L3HB 3TGXA 5DK0B 4PJAB 1MF2L 4HIIA 3QSKB 4FTVA 4I5BA 2BZDA 4F37F 4XVUD 4AIZB 4F3FB 5IG7B 3OAZH 3H7LA 2OK0L 1B2WH 4Z77A 1JMZA 5KZCD 2YPLB 1Y6MR 1IAII 2DWEB 1X4ZA 4EOWH 4LLVB 4PJIA 3FQUB 4X7TB 1KXVC 1CFVL 5BRZB 1CTOA 5FM5M 4AENB 3U82B 3ELAT 3O2DL 1MOEA 4HKZA 3EYSH 4HUWA 1V5JA 1CDHA 5LAXA 2ED7A 5DMYA 1IBGH 1G7QA 3QDJE 2BRRL 4G5ZH 1BECA 3D85B 5H37H 3PL6A 5IGXH 4JFQB 1GXEA 4OJFL 3LY6A 4LKCA 1A1MA 2X1QA 2WW8A 3F5WA 5ITFB 4PLKD 3DX6B 3SY0A 1DBAL 4AIZA 4XRCB 2MKLC 5JDSB 3S6CA 1WAAF 1QSFA 3JWDH 3T2QA 1N3NB 4CGTA 5D6CA 5IVXE 2F58H 1QA9B 1F4AA 4QT5A 3VG9B 1EHNA 1WIPA 4RIRA 5E9DA 2ICCA 4XHJC 3ARGC 5GGUA 2X89A 4CKVX 2YXMA 4OZGE 4HXBL 5HI3D 2RJMA 4PGJA 4WI5A 5F89A 1CDCA 4WW2F 1E27A 1PFCA 3T0DA 4F9LA 3P73B 1R5WB 4NP4L 4AM0B 4HS6B 1ZMYA 1R3JB 1DL7L 4XP1L 1ZSDB 1JGUH 4X7CC 3PWJA 4PBVC 2R4RH 1XEDA 3C5ZD 5E7FA 3NACL 1JFQH 5D9SB 2YPVL 4G9FA 1FG2A 5BV7C 3R0NA 5HBBA 4KUZL 4ZPTB 3RVUC 1AXSA 4DK6A 1W0VB 4H5SA 3RGVA 4U6YB 2NPLX 2AJZA 2OR8A 3ZT5A 4S1SL 4X4MA 1OAKL 4XZUA 3OHXA 2A6IA 4BZ2L 1A6UL 4PUBL 3H9HB 5TFSH 1BBJA 3P9WB 4LF3A 4X80L 3RVTC 3UP1A 4PJ9B 2B0SH 4Q2ZB 1J1XL 5KS9F 2Y23A 2NCMA 5C07E 5KVDL 1HSBA 2YEZA 4Z0BH 4KTYA 3B9EA 1QVOB 2VLKE 2NY6D 4XB7A 4DQOH 3OJDB 1NCNA 1R3JA 4M6MH 4U7MA 3LVEA 3OKOA 4XAKE 1X7QA 3LN4A 4MAUL 5CP7A 3RA7L 1L9NA 1MIEH 1WBZB 4F7TA 1SHMA 4MA1B 4GS7B 2OZ4L 4JZNB 3MODL 3FTGB 4NQXB 1YYML 4KJQD 1AE6L 4R4BA 1HWHB 1EGJH 4ALAL 3H9SA 3SDCA 1T7XA 2AGJH 4ZAKD 1L7IH 2W91A 5CMAA 4BSWB 4D0DA 4PTUA 3W0WA 3QNZA 3MLTA 4H88H 1HYSC 3O6FA 2BVPA 3GI9L 2A9NH 3ROOA 4FZEL 2O5ZH 4ODUA 3KPNA 5EU6B 1HSAB 1PJ9A 5T1DH 4S10A 3K4DA 4CW1B 5ETUB 3E3QE 1FAKT 4OJFH 3WIFB 4EBQL 5JPNA 3ZYZA 3KPSA 4U1MB 2AXGA 3W9EB 1NGQL 3HPLA 2X4TB 1JZ4A 1YEFL 3W5NA 3P4MB 3TIEB 1MLBB 1MCFA 3MPCA 5CILL 1EX0A 1K8DB 3RAJH 3FQUA 3MLRH 4HK0B 2F54A 2I07B 1W0WB 3ZTNH 4HK3J 1PX3A 2Z31C 3CLEH 1IC7H 1NC2B 2DLIA 5HGDA 4BK4A 3RIAF 3DNKA 1CYGA 2V17H 3LQAC 4K7PL 2C9AA 2EDOA 4ODHL 5EA0L 3WLWD 1BZ7B 1A6WL 2WUBH 5A40E 4I3SH 3QDMD 1PVHA 4JB9H 3QEUA 3OAZK 4CADA 4OGXL 4QRQA 4PRNA 5IJVB 4F80A 4P2OD 3BP5B 4CVWA 3UPCA 3L3GB 3BDBA 4OT1L 4QKXB 3X3FL 2AJXL 1M7DA 5DA0B 1D9KC 1MREH 4JFEA 4H25B 4CMHC 1DLFH 4HPYL 4IIQC 4ZTPL 4TOYH 4LLDB 3IU3B 5K9JL 1BM3L 3FL7A 3KYAA 3BMVA 3MV7B 3HZMB 1K8DA 4JKPL 4L29A 4Y5XC 4J6RL 1T5WB 3WCYA 3VXSA 1G6RB 4GMTH 4HSQA 4M7ZB 3RP1A 3WHXA 4TRPL 1RK0B 1IFHL 3OG4B 5DD5L 2E3VA 4LGRB 2EDJA 5T3ZD 1DBBH 3P73A 1CD9B 3CSYA 5I1AA 1CXKA 1FP5A 1U42A 2VXUH 2HVKB 1I7ZB 5B4MD 4BM7A 5IOPA 1IQWL 3CMOL 3HMXA 3QXDB 1A5FH 2XI9A 2HH0H 5DURB 1NCCH 2R2EB 3VFUA 1A7RH 4U2ZA 2O26U 2VB5A 1D5MB 3ARFD 4XP9L 3F7YB 5L6YH 2LABA 4PJXB 4XVSL 1I9JH 1XGQB 1QFWI 4JR9H 4LSSH 1UM5L 1BJ8A 5I30H 2AERT 3HG1E 4GRWB 5KOVC 1I7UB 2A6IB 2H1PL 3HZMA 4L29B 4LDOB 4QHKJ 1LO3H 2AKRB 5BCAA 5C09D 2HG5A 1FAIH 3MRMA 2GQHA 2ZOKB 3T0VA 3PABA 1TZHB 2BDNH 2NXYC 2GITB 2OMBA 4ZUSB 1T21B 2VC2H 4PJDA 5SWZD 4DUXA 4ZTOL 2YWZA 1RUPH 2CDFB 4N0YL 5EZJB 2WWKT 4OCXH 3TBTA 4L3ED 1DQMH 1P5VA 4P23D 4O2CA 3HC3H 3OG6B 2JCCE 2RIKA 4M8QB 4L4TA 5ESQB 5FO9A 5HHPB 2EC9T 1AGEB 1A6AB 2OSLB 5TDPB 3T77B 3T0BA 2CJUL 4P23B 4JO4H 2CLZB 4NN5B 5FGBA 1P1ZB 3RWEB 1P7KA 1GGCL 4AJ0A 1BOGA 2EDEA 5AYUH 2R4SH 4FQQB 5E0QA 4ISVA 4N0FB 4F7EA 1RUMH 2AJUL 5FO7A 5IB3A 3MR9A 5GGTH 2K1MA 5D7JC 5E1HB 5F1IA 1X6LA 5HJ3A 2GHWB 3DX8B 4YE4H 1T03H 4EJ1C 4QRRA 2XFXB 1M05A 1JGEB 5JXAH 4L4TB 4TNVF 3PDOB 5EO1A 4QCIB 1F6LL 4YEEA 4WNQB 4D0DB 4G43A 4UT6L 3DSFH 1HHIA 2D0HA 3H3PL 3CC5A 3VDBA 3KLHD 4PP2A 5CKGA 4FQIL 5IVXF 1W8NA 4HC1A 1NEZG 4NNYA 4NKMA 3R06B 4PGCA 3V4UH 2JCCA 2Y06H 5ADOH 2IAND 2XN9A 5C8JB 1UADC 5C6PB 5IB1B 5E5RB 4UT7L 43C9A 1P84K 1HHGA 1NGWB 3E3QC 2JJTA 5KANI 5GGVH 1PSKH 3MCKA 4OCLC 5TQ0H 4LCWB 1TZIB 4Z95L 3R8QA 4M1DL 3SKMA 4DN3L 4PRIE 5FYJD 1LEIB 5J6GA 3FJTA 3RNQA 5D7IE 1YY9D 2BDNL 1GC1C