4YE4H

Crystal structure of neutralizing antibody hj16 in complex with hiv-1 gp120
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
227
structure length
227
Chain Sequence
MKLMQSGGVMVRPGESATLSCVASGFDFSRNGFEWLRQGPGKGLQWLATVTFESKTHVTASARGRFTISRDNSRRTVYLQMTNLQPDDTAMYFCVKDQTIFHKNGAVDFFSYFDLWGRGAPVIVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HT593.1 gp120
publication title Crystal structure of HJ16 in complex with gp120
rcsb
source organism Human immunodeficiency virus
total genus 47
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ye4H01
1E4XL 3ARFA 5A3ID 3IJSB 3VRJA 5E2JA 3GSNB 4ZSOE 1C08A 3RWIB 3PABA 4XCNB 5JR1H 1U8OB 5CP3H 4CN4A 4Z7QE 4YR6B 3C8DA 3FONA 3GSNH 3SDCD 2HJKB 1SY6L 1D5IL 1C12B 3GBNL 4GAYA 4N5ED 4HMCA 3PWLA 2OQJB 4PLJD 4QRPE 3GB7B 3WSQL 4OLXL 1UZ8A 3MRQA 3S96B 1GGCH 4Y5YA 1DVFC 3HZKB 3T09A 1DSFH 1H3PL 4FFYH 4XP9H 3QQ3A 4HK0B 2H9GA 4PRHB 4S0SD 5CEYB 1TQBB 3BPOB 5CEZE 3CFCH 4WW2A 4KPHL 1U8NB 1F4XL 5C9JA 1XAUA 2IAND 4CU6A 2NY4C 4HIIA 2DIJA 1FN4A 4OJFH 2AV1A 1CTOA 2VITA 4GW5B 4AL8L 3L3JA 1HINH 2A73A 4YO0B 4XPTH 2YMXL 4U6HA 3SOBH 5FYLE 3EUUA 2N7BA 4JFED 3EO9H 2WIIB 5FUCC 3PDGA 4NC1E 1D5XA 1PKQE 3QULB 1IGMH 1PFCA 4BH8A 5D2NA 3QJFA 1GHFL 5GXBB 2HVKA 2AV7B 4LSVH 3MRCB 4FG6C 4JFYB 1MF2L 3HNVL 5EOQL 4G42A 3GSWA 1GGUA 1HH6A 5EA0H 5D8JH 4TULL 2VDKH 1NBZB 1S7WB 3KWWB 2GJ6A 1RIUH 1QVOA 1CIDA 4LSPH 1DBML 4P2RD 3N50A 2E7LC 1LK2B 1O7SA 4L4TB 1U3HA 2VABB 1IGTA 5L8LB 2PTUA 4HPOH 4YDIL 3BJLA 1Q0XH 3SDDB 4WI2A 1RY7B 2AKRB 2YSSA 3QIWB 4KTYA 4CJ0A 1INDL 4P2OA 2VB5A 3MRDA 1LVEA 4PR5B 1AD0B 1DQJB 1A7BA 3RI5K 2Q3ZA 2AJZB 2AJYH 4PRDB 5E2WH 2YRZA 3FHAA 4WY7L 1CXLA 1QP1A 1NMBH 2EE3A 4CAGA 3DI2B 3O8XD 4MDIB 1ORSB 3U1SL 3LEXB 4H8WL 3MRKA 5DWUL 1QLFB 3GJFH 2AXHA 4NZRL 4O5LH 1FCGA 1YNKH 2MWCA 1QSFD 4HS6B 4OLUH 4LLAA 2NX5A 4HUVA 1A7RL 1Q94A 2R0KL 5L7XL 3FT2B 4J4PD 4EQ3A 4R4BA 2DBLL 1EVTC 3ZYJA 1GZPA 1EEZA 1I7ZA 3KYKH 4Q0XL 1PD6A 3IVKB 1MH5B 3QO0B 2Z91A 4L9LC 1NCWL 4LCCA 4HULB 3J8F7 5DK0A 4GW4B 5ACZA 5I66B 4HC1H 2E7BA 2EIEA 3EJZD 2AEPH 3CFKB 4JVWA 4WI4A 4BZ1L 5JHLL 2XNAB 4MJ4A 4FZEL 3UTTB 1FH5H 1KG0B 1CL7L 3SGDH 3BH9B 1IT9L 1T3FA 1YPZB 2VKXA 1V3MA 3NIDF 2V2WB 3S37H 3TCLA 2HFFA 1KFAH 2PR4L 5FECB 5LKNA 2VL5A 1DCLA 5FB8A 3OR6A 4G8GB 4KXZI 3ILQD 4M1DL 3U0TA 4HV8A 4NHCL 5SX4I 3RZCC 5AG8A 3WNLA 4OZIB 3V4VH 4PJ9C 2FX8H 4CN1A 4WW2C 2HA1A 4HWEL 4NZTH 5KTEH 1MNUH 4LVHB 4KKAD 5BO1H 2LE9A 2UUDK 3RDTA 4GT7A 4PJAA 4TRPL 2RB8A 2AJSL 2E8YA 1BWMA 1CD1B 2ICCA 3HRZB 2VXSH 4JFOB 4TUOB 1OGAA 4XTRD 4LP4A 3QUMB 1IEAB 1GIGH 5HVWA 2H3NA 4ONGL 3MBXH 4OLYL 3EO1B 4NO3A 3M1BB 3QUMH 5CGYD 4LSSH 3TEUA 5D2NC 3B2VL 3VXRB 3GO1L 2QLVB 4HUWA 1ZT4B 2P7TA 3DSNA 4IMLB 5E8PA 5E56A 1CDBA 4X5XB 3V5KA 4YUEL 4LLDB 5T5FL 5I8CB 4G9FB 1YMHA 5CAYB 1FFPB 4BQ9A 1UWXH 3ARTA 3IRZA 4GBXD 4H88L 2IANE 5ESQB 4BFEA 3JV0A 2CQVA 4UTAH 1GZQB 1IKFH 1RK0B 3P9LB 2DQEL 3VDAA 4O9HH 4GS7C 8FABB 1TCRA 5E6ZA 5L0QB 4HIXH 3FB6B 3SPVA 3R0NA 3HI6H 1JWUB 3T65A 1BQHG 4OF5A 1PG7L 3GGWB 4PY8I 5ACLA 3I84A 4JFEE 3ZKND 3QEHB 5C0BB 4BQCA 3VXNB 2L0DA 3WIFA 5KSBA 3D48R 2V7HB 1HXYB 1UM4H 4UT7H 5IGXH 2WZPD 1P53A 1A7OH 1A9BB 5HVGB 5F1OB 2BVUA 4ZOCA 5ILTL 1GSMA 4JPKH 3G9VA 1BOGA 3MLUL 2DWDA 2R1WA 1CN4A 3DROB 3BP7A 4CNIB 4OCWL 2J8UA 2HFTA 3GZKA 3VFRA 1X5GA 3NIGE 2UWEE 1NDGA 1NLBL 2Y6SC 2FGWH 2YXFA 2C3HA 4OD3H 1CK0H 4P2RE 3HN3A 5I1GL 4HH8A 1DQDH 2VTFA 5I30H 1BFSA 3RL2B 4L3EA 4G6ML 4JY5L 5EU6D 1RUQH 3MJ9L 1NLDL 4WGWB 4QF1B 4ETQB 3MV8D 4YIQB 2PNDA 1VGEL 4HKXA 4XBGB 1G7LB 3PWPA 1D6VH 2R2BB 3WDJA 3LZFH 2AJVL 5I6XC 3U7YL 1G9MC 2VXVL 4PRAB 4KJQC 4LHJB 4M7ZC 2EEBA 4FABH 4RRPA 1XR8A 4KJPC 1H5BB 4JAMA 3UROR 5D1ZB 4GFTB 3W9EB 2VLKD 3RWEB 2DQUH 4PJEF 5T3XH 4X98A 1QSFE 4DVRH 3RWCB 4KROC 3MUGA 3HC3H 3CFBB 4N0UE 3MRLB 4FQ1H 2R29H 4XMPL 2JCCA 5J6GB 4AM0A 3PDDA 3MJGX 4F15C 5GGUA 4RAVA 2BFVH 5F96L 3ZE1F 2M1KA 3LV3B 3PP4H 1CFVH 3ARBB 1HDMA 1XGTB 3S5LA 3VD5A 3T3MF 2IALA 5HGDB 5CJXA 3MREA 2BVEA 2W65A 3VXSB 1P9MA 3P0GB 2A6JB 5IQ7H 4Z76A 3T0VA 4HUXB 4J12A 3RNQB 2OK0L 3VRLE 2G60H 4M62H 3MYJB 3QIUD 5ID1B 4H0GA 5DD5L 1VHPA 3P9MB 3MLVH 2R39A 2YZ1A 3X13B 4JKPL 5FK9B 4PRBA 4XPGH 4H5SA 3BKMH 4JANB 1C8PA 1B6DA 3QYCA 2BSTB 2A9MH 3BGMB 3F6IA 3SKNA 5IFAL 1AO7D 1FVCB 4PJIE 3TBSA 3OPZL 3D39E 2JK5B 5DO2D 2CUMA 4JKKA 2BX5A 2DQCH 4NSKB 1NAML 3GBLA 3D0LA 4FTVB 1AGEA 3QAZB 2AAVA 4NGHL 4JM2B 3FQWB 4NCC1 2GW5A 4NQSA 4NQDA 3IETB 1MAJA 2VMFA 1YEFL 4FQXC 2O5XH 1T4KB 5DLML 5KS9B 1YNTA 1G7PA 5CHNB 1TVHA 1G9ML 4GSDH 3JWDH 1VFAA 3ARZA 4L8SA 1HK6A 4NOFA 3CGTA 1MCBA 1RUKL 3VXUD 2L7UA 1MI5D 5J3HC 2QADC 4PJCE 5T1MA 2VZUA 3EYQD 1NGQH 1B9ZA 3WO3B 1PSKH 4DN4L 4NQTA 1D7FA 1CXEA 3FN0L 3CC5A 4KY1H 4BSWA 5EN2B 1UJ3B 4XNZB 3W5MA 5DHYB 1C16B 1S7UA 3LQZA 4OKDA 1S8DB 4OZ4A 2NR6C 5IVXA 4GAJL 4WUUD 2A6DB 4JCLA 5EBWB 5I17A 1CZ8H 1DVFD 2VDML 4JRYE 5FHBL 3AS2A 1DN0B 5BRZD 1JHLL 3CXDL 3DLQR 5JHDA 3PHOB 1D3CA 4Z0BL 15C8H 4FP8L 5TGBA 3KPSD 2X4TB 1IAIH 5DMIL 3NCCB 2C3VA 3OJ2C 3VJ6B 5LAXB 4PRPB 2D7TL 5K93A 1P4BH 1F6AA 3WE6A 5C0JA 1FAIH 2BNQA 4O2EA 2GTWB 1FGVL 1CDGA 5IB5A 3VGGA 1I1FB 3DO3A 3QEGL 5GS1B 3DMMA 4K71C 3RTQB 3FO2B 1I85C 4P2CG 5ANMB 5TPWH 12E8L 3RBGA 3SCMC 1SBSH 3KYNA 1T83A 4HXBH 5J7CC 4X80L 4WNQA 4FQIH 4FG6D 3CAFA 3O6LL 1QNZH 3NCJL 3I50L 2VL4A 3QI9B 1UWEL 3C09B 5I76B 4CMHC 4NDMB 3BD3A 3TV3L 3GMPB 5EU6E 3OHXA 4LPCA 2FBJL 1R5WB 5JOFA 4IDJH 3MV8E 2GTZB 4JPWL 4EN3A 2BCKA 3L3OB 4ZD3L 4D8PB 1P2CA 3TT1H 4OLVH 4YEEA 5CJXC 3IFNH 1ONQB 1FYTB 3RVXD 1TQCC 4JVPA 2JJSC 2VLJE 5B38G 2B1AH 4LVOC 2BHUA 1WSST 4WGVB 4ODWB 1JNHA 5JIIA 3WUWG 3HG1D 4F7MB 3C5JB 4NKMB 3EW3B 3IRPX 4ZQKA 5F9OL 5F6HI 2BK8A 5KN5A 2D31A 2Z31D 4LBEB 3RPIB 3K8MA 1UKSA 3ZTJH 5HYJA 3QWRA 3TM6A 5C2BH 3OG6B 5AAWA 3BUYB 1CD8A 4D9LH 3FQRB 1NCCH 3GSXB 4N1CA 3H9SA 3WD5L 5AYUH 1WCBA 1A02N 2EYRA 2J88H 3S34H 1P7KB 25C8H 5GGVL 4AEIH 1KJMA 4X0KA 2VXUL 5F3BB 1AR1C 3RGHA 1AGDB 3KNBB 2YPVL 1OOAA 5GS0D 1HHJB 4XCCH 4KUCF 1OAQH 2IGFL 1MPAH 4DN3L 1IE5A 2D7QA 3K0WA 2LAAA 2V2TA 3BT2H 4FXKB 2NYYC 4XP5H 4X8JA 3NFPA 1B3JA 1OPGH 1JPTL 3VGEA 3X3GH 3ARFD 1FFOB 1ITCA 1JE6A 2NY5H 5J1AB 1NCDL 3O2DH 1OAXH 1AO7E 5J13C 1QRNE 3CDGA 2ZCLH 1KYOK 1UM5L 3FQTB 1N0XH 3QQ4A 4NWTL 4X99A 4POZC 1ZS8B 4M6OH 5EZOL 3V6BR 1MCOH 1S3KL 4L8CB 4O58H 1OWRM 4XH2B 3KS0H 3OXRB 5IMLB 3QXVA 4JPVL 3HZVB 5T3ZH 3Q2CA 4AEHL 2BVPB 5IFHH 3RZCD 1LEKB 4KK6D 4YHML 2YD8A 5I8EA 3SKUD 4DW2H 4ZUSB 5AZ2L 5JDJA 1BLNA 3QNXA 1FFNB 4PJGE 5AUMA 3GI8L 2EKSB 3VXUE 1MI5E 3FOLB 1K6QH 2XWJB 4KH2A 2ZUQC 1TITA 1EHNA 3ARDA 3MCKA 1IZJA 4MHHG 4EDXA 1MCKA 4JLRB 4F7TA 4BFBD 5M95B 3U46B 1MCCA 3CSPA 1ZANH 2KH2B 1OQOA 3TPUA 1E4WL 5DD1H 4NQEB 3U2SB 1K5NA 5F7DA 4Z8FL 5CGMA 3EYSL 5BRZE 4UT9H 1ZHBB 2P48B 3DX9A 4ORGA 1HYRC 1PZ5B 3KPSE 1FV1A 4LHUG 3BX7C 3QSKB 4TSAL 3FO0H 1J1XL 3BDBA 2AJXL 4KI5D 2Z0BA 1RURL 2CUHA 2DYPA 1T2QH 5J57B 2NNAA 3MLSH 4QRPB 2WBWB 4NNYB 1U3HD 5TDNB 1MHCB 4XNXH 4GW1A 4G6KH 4PP1C 3IJHA 3THMH 1O5DT 3SKMB 1HI6A 5I1LB 2NY1D 5HHQB 1KLUA 5CCKL 4KHXL 4MVBC 4JO1H 4W4OA 3FB5B 5F7WC 4QRRB 1DEDA 1Q1JL 1CDHA 5BMFL 5DVNA 4M03A 4OTXL 4PB0H 1W8NA 4ZYKB 2F5AL 2Y25A 3H3PH 1BHGA 3VGAC 3WHE1 3C8KA 3CXHK 4Q2ZA 1FL5B 1YNLL 2AQ1A 3C60B 5IMOA 2FJGB 1WEJH 4TUKL 4KJWC 4OZGA 4OFVA 3O9WB 4MMZC 5DMJB 2WUBL 2NX5D 4D3CL 4NPYA 3N1MC 4PFEA 1PGRB 2LV4A 1T5WA 4GMSL 5CKGA 4I2XB 4NKOB 1MWAB 5DJ2B 2ERJC 1ZGLM 5HBBA 2NY3C 3STLB 4XNYL 3VG9B 1KJ2L 4ZPTB 4NZJA 5DD3H 4MA7L 3HG1E 5ERWB 1ZHNB 2ARJB 1WIPA 3U9PL 2YN5A 1TENA 1JL8A 2H2PC 5EOCJ 5JIPA 1XGRA 1GCFA 2CKNA 4XPBL 3S9DB 3HE6A 4R0LC 4KJQD 3MUZ1 4AENB 1MJ8H 3T0DA 3WNMA 4H25B 1DQTA 1QEWB 4FXLA 3QHZH 4M93B 4MD5A 4XBPA 5ACMA 5GZOC 1LNUA 5TE6H 5JW5A 4WDIB 4MA8L 2XV6B 4YDLC 1GC1H 3N9GL 3D0VA 4KROD 1E4KC 4P9HC 2DLIA 5KJRL 5EFIA 4A6YA 4BA8A 5E24E 1G7HB 3MA9H 5ISZB 2HMIC 1TPXC 4RISH 1N4XH 3TBWA 4F3FA 1OY3B 43CAB 5DTFB 5C3LD 1KENH 4WEUD 2HH0H 1QFUL 2PXYA 2OTPA 2HT2C 4MD4B 1A4KB 3QCVL 3U4AA 3RDTD 4QHMB 1FJ1A 2DI9A 2W9DL 4W68A 5IK3A 2X4NB 4P5KA 1QFWH 4RBPK 3WJJA 2OR9L 4NRYB 1OGAD 4PGZA 4HG4K 2P1YA 1XF3A 1DDHB 3SKOB 5DRZA 4EVNA 4AK1A 2ZOKB 1JGLH 1A6AB 1YQVL 4PGEA 3UEZA 4Y2OA 4OI7A 4D0CB 2DM2A 4M6NL 1IGIH 2VZSA 1XR9B 4X9BA 3LKRA 3OAUL 1CYGA 4I3GA 1MSPA 3T2QA 3D85D 1SYVB 5HI3C 3AREC 2Q76A 1NMCB 4HWBH 2BSRB 4OZHA 3L1OL 4HXAH 3I3BA 4QXGH 4UOJA 2E6JA 3FT4B 1U8PB 1YEHH 4LU5H 1HHGA 1RUAH 2BY0A 1ZLVK 2R0ZL 3D2UA 1A4JA 3U7WL 1S5HB 3MLTA 4WU5A 4ZFZA 3NIGF 1OLLA 2UWEF 2Y5TA 4XWGL 5HHNB 5HYEA 2QADD 5DK3A 5FYKU 3ZKMD 3UJTL 4PY8J 1H0DB 4P9HL 1NAKH 5FFLA 3BE1H 5D2NE 4X7EC 4Y89A 3RP1A 4ZXBB 1VGKA 2R4SL 1KN4H 1CF8L 1ND0A 1Q0YL 4JFPB 4P4RA 3P4LA 4OD2A 1MREL 4KI5E 2DOCA 4RGMB 4CVXA 2AK1L 1T0NA 3CIQA 5CWSA 5IMKB 4TVPL 2IPKB 2GJ6E 1U91A 5HTSA 4EJ1C 4MAUH 4N8VA 5TDOB 3ZL4H 2CLVA 3VA2C 5CSZB 4KFZC 1HZHL 2IQAA 4LP5A 5I1IL 5I71C 2W91A 2AGJH 4HKBA 3LN9A 1YDPA 2ADGB 4LLVB 4ZNEA 4APQC 1AKJA 2EE2A 2Z35A 1GAFH 2ED8A 4N0RA 1C5DB 2DIBA 2L7JA 1JI1A 1Q9KB 2DQIH 5GIRA 1I7UB 1UFUA 1G1CA 1EDQA 2ATKB 2HJLB 3PWPD 4DQOH 1HQ4A 4P23A 3VFOB 4JHAL 5C0EB 1VACB 1ZT1A 1EEUA 3HE6C 2XPGB 3MO1A 1EFXD 2PW2B 4M7KH 3TF7C 3I2CH 2A74A 1KB5A 1U8HB 4KKNA 2BVQA 4JDVA 1RJYA 4KV5E 2I5YL 4OT1L 3WNPA 2NX5E 3SQOL 3LH2H 2VC2H 2ZNWA 3VRLF 4MSWA 3JVGC 5B39A 3FO9B 3LS5L 4MB4A 3CLEH 2OL3H 5GGTH 4RA3A 2FO1A 4XXDB 1RD6A 1BOYA 1NGPL 2P8LA 4WI7A 3N1FC 1MUJB 2VDRH 3G04B 5FUOH 4WHTA 5CGTA 2JJVA 1NCTA 4XNMA 3V6FB 4IRJB 1A7PL 4URTB 4MD0B 5D7IB 2H2SC 2ZNXA 3LKQA 4G80A 3CFDA 4R90H 4MLSA 3W81A 5IBLD 4R3SB 1TVDA 3AFLA 2W9EL 3JV4A 4PGDB 1EAPB 1MRFL 1NUGA 3RWFA 5DXWA 5I8OH 5IVZA 1CXIA 2IJ0C 3IF1A 4XC1L 3VE0B 1N2RB 4P59H 4H1LH 2W0FA 3VW3H 3VXMB 1JHTA 5HDQL 4PJCF 3GNML 1FC2D 2RFXB 1AR1D 1W0WA 5EORH 2XZQH 1UCBL 1Q9LA 1DANT 4HMDA 1IAIM 5HGAA 4QCIA 4PJAE 2EZ0C 5DJAA 1W8OA 1X9QA 2WUCL 2FIKB 2NYYD 1OGAE 4NM8H 3CPLA 1SJXA 2W38A 1BQLH 2YKLL 1XGUA 2QTEA 1KC5H 1CFTB 4KAQH 4JN2B 2DQHL 4DKDC 2Q8AH 1Z0MA 4JZOB 1H3GA 2I60H 3F8UB 1EJOH 5DUPH 4PG2A 2NZIA 1BBJA 4IRSB 3BD5A 5JQ6H 1MY7A 3HZMB 3GIZL 5MI0B 4Z7WF 4LDEB 4HT1L 4NUJA 2VE6B 4POZD 5ABDE 5EWIL 2P8PB 4M1GH 1KXVC 3GFUA 3VMPA 4ZAKA 1NFDB 1PEZA 5C2UB 3MGTA 2EEDA 3BZ4A 2VOTA 5EU5A 2VXTL 1LP9A 4G8EA 3UZEA 3U36B 3TO2A 4JJHA 1JGUH 3EHBC 5JHDD 3M07A 4Q6IC 5F7KC 2AVGA 4LLYB 4PJIB 3SKJL 4ODTH 3D39B 3FAXA 3BMWA 3NFNB 3FFDB 4DGVL 2PW1A 5KSBE 4MB5A 2YPLA 3PL6A 3O2WH 2GEEA 5D96C 5I9QC 2XWTA 4PGBB 3K8KA 1Z3GL 3NOIA 1IILE 2BNQD 4CJ1A 2Z92B 4LRIA 4UU9B 1NEZG 3RL1A 4Z95H 5E00A 1I8MB 4U1IA 5ITFB 5KANI 5C0RH 2J8UE 5TF0A 2NW2A 3GBMH 4QNPE 4JJ5A 4XPHH 4A2LA 3IDYB 2VJXA 4QT5B 1FZMA 1EMTL 3CVHA 2HJFB 5CP7A 1KTDB 3PGCA 3W39A 1MRCH 5M7QA 1DQQA 1QR1A 5HJ3A 3MV9A 3KLSA 2FLRT 2Q20A 1FDLH 1UXSB 4CKVX 2X4UB 3QCUH 3KXFB 3WO4B 1HKLL 1P4IH 3G08B 2PYFA 4LASL 4HUUA 4L3EE 3LMJH 3KPRA 4XP4L 3GRWA 4MX7A 2IADA 4N0FA 4DTGL 5SWQA 4GQ9L 3LHPL 2K7QA 3WS6A 5DR5L 5EPMB 4EN3D 4WHDA 5JXEC 1U8IA 4N90D 5HHXH 2DKSA 3PWPE 1MRDL 2JKXA 1Z9MA 1LD9A 1AQKH 2DQGH 3DARA 4JRYB 2R56H 1HCFX 2NXZC 3PGDB 4RGOH 5CEXA 3MRGA 1CTNA 1MVUB 4U3XA 2EDDA 5DD0H 1EO8L 2IAMA 2Z4QB 2BNUB 4YHNA 5K9KB 5EZJA 3I9GH 1S78D 4ZUVA 5C8JB 1R24B 1QSEB 4TQEH 4UNVA 1FHGA 5HI5C 2V2XA 4XMKL 5HYJD 1TJHH 3DVNB 2JCCE 4PBVC 4GKOA 1BQHB 1AD9B 2HFEB 4JREC 1INQB 3AM8A 3PWUB 1IGCH 3BDYL 3W2DH 4L5FH 1A1MA 2NTFB 1JGEA 3K1KC 4KJWD 3X3FL 3BPLC 3H9SD 5JDSB 1T1WA 1KGCD 1YN6A 3NZ8B 2WBKA 1UA6L 4FXGB 3LKSB 1KYOJ 1NCAL 5F9WC 3BH8B 1S5IL 4KKBC 3HS0A 1IM9B 3ABZA 3V7AE 2RR3A 2UZIH 4PG9B 1X5LA 1N8ZB 4Q9QH 2E9BA 2W07A 1MAML 4GG8A 1HNGA 1YEJL 1C1EH 4KRPB 5J06A 3S88H 2GCYB 1OB1B 5F7FA 2E6QA 2VYRE 4U6VH 1F90H 1ZHLB 1G6RA 1BX2A 3DX8B 3PDOB 1QLRB 2EDTA 1WITA 5GZOD 4QWWC 3VFTB 4XVSL 4N9GA 3I75A 3HRPA 1EZVX 1SHMA 3FQUA 4R96B 1KV3A 4JO3L 2VLJB 1TNMA 2DD8L 1YEEL 3F7YA 4NQDE 4IMKC 5D6DC 5EZIL 1BFVH 5KG9B 4JN1L 1YECL 1I1YB 1JZ7A 4QXUL 3UTSB 2PO6A 4L4VB 1RJLB 4U33A 4HGWA 1Y6MR 5CINL 2HMID 5KVMC 4MAYA 1IKNA 1OAYL 5ITBH 5CP3A 3S36L 3GSNA 1H3TA 1U8JA 3MXWH 1RZGB 4XCNA 1EERB 4IS6B 2C4FT 2Z8VC 3SDXB 5I1EH 1U8OA 2QSQA 2CO6B 1P1ZB 4YR6A 3BKYH 1MCEA 2OLDA 1KCKA 1BVKB 4YHZH 4WO4C 1C12A 2HFGL 4LRIC 1OTSD 4HD9A 4P2QA 1BF8A 2JB6B 2W92A 1JGDA 4MXVE 4DEPC 3GB7A 4PJ7F 1WBXB 2AI0L 1YYMH 2Y23A 3AS3A 3S96A 4YEFA 3ILPA 5IVXE 3HZKA 4RFOL 4WWKB 4HK0A 4O2FB 4PRHA 3NABL 3O3AB 3W11C 5JHDE 3HFMH 3B43A 1U8NA 1EHAA 1QRNB 3LIZH 2R4RH 4HAGA 2P45B 1FPTH 3U4EB 1ZK9A 4GW5A 4YO0A 2X1QA 5GRVL 1MHPH 3DSFL 2FJHB 2BNQE 3UO1H 3DURB 2V17H 3CMGA 4U3HA 1HHKB 2WIIA 3MYZA 2BJML 4D0DA 1A6WH 3DHJA 3OKMA 4RGNC 5C0CB 2DAVA 3JBG7 4EIZC 2CGRH 3QULA 2V6HA 3O81A 5C0FB 2EDJA 3MLZH 4KKCC 3ZHDA 4XPAH 3W9DB 3UDWA 2AV7A 2DIAA 3MRCA 1NMAL 4JFYA 1X5HA 4UAOB 4YHPB 4QGTA 5FYJL 5JLZB 2PTTB 5K9JH 1TJGH 5EO1B 1KELL 1NBZA 4ZMAT 3IFPB 1HKFA 2OSLB 3KWWA 2A1WH 4PJDF 3QA3B 4YX2L 4K2UH 4I48B 1MFCH 3E2HB 1Q8MA 1L0YA 3FB8B 4MWFB 2ZPKL 1LK2A 1YUHB 4L4TA 3K81A 4N90E 4K7PH 2K3TA 2VABA 3SDAB 1KIQB 1F4WL 1MCDA 3EDKA 2HN7B 2Y5EA 3SDDA 4XHJC 3LCYA 4Z5RB 2AKRA 4APQD 1ZTXH 4JQIL 1M4KA 4EUPG 5E08H 1D9KC 1SJEB 4IHOB 4BUHA 3TCXA 4PR5A 1AD0A 2C5DC 1RUMH 3BI9X 2D2OA 1N5AA 4TSCL 4PRDA 3FRUB 5D1QC 2MMXA 2VDPH 1QFWM 5HYJE 5B8CC 4PGJA 3HE6D 1ZVHA 5HDBF 1FNGB 2CO7B 2GK0B 1QBMH 4KJYB 4MDIA 1ORSA 3LEXA 4BQ6A 3U6RB 1QLFA 5I2IB 4FOMA 4UZGA 4LNRB 2YPKB 4QRUB 1QZ1A 1OF2A 2K7PA 5MENB 3H9SE 4XCEB 1KGCE 4Y4KB 2YOCA 3FT2A 4LHQB 3OJDA 2VWEE 3NH7H 3DYPA 5F6IB 2V5YA 3EYFA 1FCCA 2KL6A 3KGRA 3B3IB 4NN6C 3S3SA 3GM8A 4NM4L 1A14L 3KLHC 4MAYC 3IVKA 5SWSB 1IKNC 1MH5A 3QO0A 1MHEA 4I0PB 4U7KA 4BUGA 5C0NC 5IM7A 1W72L 3BP6B 1A6ZB 3P0YH 5MEQB 4GW4A 3CU7A 3PIQA 2PXYD 5ENWB 5DJ8B 7FABH 5IJKA 1LEGB 3TIDB 1ZHKB 3UTTA 5F88B 1KG0A 4KUZH 4TNWK 3BH9A 1ZLSH 4QXTB 3LDBB 4OCXH 1YPZA 1EHLL 3WFBH 5IG7B 1JYNA 3ZKXB 2V2WA 4WW2F 1UQSB 2IPTL 1JZ5A 5KVDH 5FECA 4LFHD 3O4OB 2OTUB 3UBXG 4EDWH 2R2CA 4G8GA 3UTZB 5A2JH 2C1OB 4NOBA 4LDOB 3CLFL 5IR1B 4IIQB 3H7LA 4JFZH 4OZIA 4Q9RL 4W81A 3MROB 1TQBC 3BPOC 1RZ7L 2WM0A 1V7NL 5LWYH 4AG4L 3L6FB 2DI8A 3WUWB 1XGQB 1J1PH 3QHFL 1XH3B 3V52H 4TYUA 1WT5C 1JNLL 1WZ1H 4WV1B 2ESVB 2X9YA 1KOAA 2ZSWB 3DVFA 1CD1A 4JFOA 4LAQL 4TUOA 4UB0H 2EZ0D 2QKIB 2X4OB 3WV0A 1DUZB 3D2UD 3QUMA 1IEAA 1F4YH 2H1PL 1WGOA 4KI5F 3AS0A 5CJBA 5E2UH 3EO1A 4B7LA 4ZUWB 3B9KB 2OBGA 3M1BA 4ODHH 3JXAA 5GS0H 4JDTH 4YGVB 2IFFH 2XA8L 3GIVB 1TTGA 4HZLB 1WBYB 1PZUB 1ZT4A 4IMLA 4LPVA 4M6ML 3VRJB 5HSFA 4X5XA 5DMGC 4LLDA 5I8CA 3PABB 4WIQA 3KYMB 5CJ8A 4U0RB 1GZQA 1RK0A 3GUTB 3P9LA 5FA3B 5JR1L 4MNQB 5GSRB 4X9FA 3GSNL 3C5ZA 3PWLB 8FABA 1JF1B 3C87A 3O4LB 3FB6A 3TLRA 4L8DB 2XXCB 2I07B 2YN3A 1JYWA 3EHBD 2XZZA 3RKPA 1QFHA 1GGBH 3GGWA 4GRWF 1F3RB 3MRQB 4IOIB 4YH6A 4KQ4H 3T3PE 4ZS6C 5C0BA 1A8JH 3SDDC 2WWMC 2V7HA 1HXYA 4IM8A 4S0TD 5ICXB 5TQ2H 3QIWC 1GGCL 1A9BA 5CZVH 1DSFL 4J2XA 3RKDC 4FFYL 4XP9L 4KV5F 3BZFB 4JO4H 3FN3A 1FP5A 3BEVB 3CFCL 5C9JB 1HSAA 3DROA 2BVTA 4CNIA 4R97B 1FN4B 3I3DA 4Y4FA 3HPJB 4D94A 1HSBB 1WISA 5H94B 2VITB 3DOSA 2BSSB 1CICC 2A73B 4OI9A 4OJFL 1CFQB 4S1DC 3FO1B 3VMNA 3GHBH 5BW7A 1BM3H 3V0AC 3HNSH 1HINL 5FGBC 4XPTL 2J4WL 2LU3A 4OZGE 3SOBL 3T0EA 3RNKB 3OAYH 5EUOA 2I27N 4W4NA 1CE6A 3RL2A 1YEGH 3EO9L 4HFUH 2V9TA 1T7WA 4CW1B 4NQUA 4BH8B 4X6EB 2GIYA 2HVKB 3NIFE 4ETQA 2ITDB 4YIQA 1IGML 3Q6FB 4XBGA 3BP4A 4HJGB 1BREA 4G42B 1G7LA 1HH6B 5AD0B 4LSVL 5HDLA 5JXED 2R2BA 2CDEB 5FO7B 4X8XA 4MMXC 5D1XA 3IDGB 4PRAA 4ONOA 4MZ2A 2GJ6B 4BELD 5EA0L 5D8JL 1A21A 1H5BA 4TTDC 2VDKL 4OF8A 2MKLC 5D1ZA 3FKUS 4Y5VB 4F58H 1RIUL 5C6TH 3W9EA 2X1OA 3RWEA 4LSPL 4M02A 3ARGC 4P99A 5BOZG 4OI8A 3T77B 4G43B 5DS8B 2HT4D 5H8DA 3RWCA 3ARRA 1AP2A 3CFBA 4LAJH 3QUKA 3OKEA 3MRLA 2DS4A 4HX1B 4JO2H 4HPOL 4J6RH 2ZUTA 5J6GA 1F58H 2EDFA 2FX7H 1Q0XL 4P2OB 3WIIH 5HGHB 4OIAA 2P47B 3QDJD 3ARBA 4TUJB 1XGTA 4YFLI 5E8EA 3D1MC 3QFJA 2AJYL 3LD8B 3EBAA 5E2WL 4M61B 1N7MH 4HUXA 1NMBL 2ADIB 3MNVB 3MYJA 5ID1A 1B6UA 3P9MA 1KTLB 1JNJA 2FR4B 5CUSH 4O5LL 1Q94B 3X13A 5FK9A 1YNKL 2GAZA 4OLUL 2I9TB 2QR0B 1EX0A 4MQ7A 2VZ1A 1Q9WA 3P4OB 4NKQB 2BSTA 4DUWA 4QKXB 3I02B 3BGMA 1I7ZB 2EH8H 2JK5A 5L2JB 3STBA 4NSKA 4LCCB 1ZVSB 4FTVA 4R7NB 1KSRA 1CDUA 3KYKL 4QWWD 3AY4A 5DMYA 4JM2A 3FQWA 3EYOB 1E6OH 3OKLB 4X6CB 5SX5K 3IETA 1IGYB 5KSBF 4X5WB 5HHPB 4OZHE 3ALXA 1JRHI 4HC1L 5KS9A 2QSCH 1OCWH 2AEPL 4NKIH 4F7PB 3B5TA 5JMRA 5CHNA 1FH5L 4EXPX 5L0QC 2HFFB 4Y19B 2XKUA 1JCKA 2EKJA 1BZQK 4CU8A 5IB3B 2J8UF 3OR6B 3S37L 1KFAL 4S10A 3EOAB 3RUGB 4HV8B 5DJZB 2X09A 1UB5A 3L5XH 4V1DB 1EXUB 5FYJU 3HR6A 3RA7H 3NA9H 2YPLD 3PL6D 4NUGH 1NC4A 4RQQB 3QH3B 3V4VL 1ZSDB 5E70A 4XP6H 2BXYA 2FX8L 3TBTA 4WO4D 1HYSC 3PP3H 4IRZH 1EFQA 5I1JH 4NZTL 5KTEL 1FE8H 3CSGA 5E5MB 5DHYA 1C16A 1MNUL 1OTUC 1S8DA 3L9RA 5BO1L 1FVEA 2A6DA 5BW7C 5EBWA 3NVQA 1L0XA 3OJMB 3VH8G 1ZVYA 3RVUC 1WTLA 2J8HA 4E5XB 2VO5A 2IQ9H 4MNHA 2LU4A 3PHOA 3UYOD 1UKTA 3MV9D 4WJ5A 3PQYB 5H2BA 1GIGL 1S9VB 2X4TA 3BHBB 3OB0K 3VJ6A 1IC4H 3MBXL 5C07D 4PRPA 3KPRD 3IDXH 1A5FH 4ZNEE 3QUML 4LSSL 4ODXB 3BWAB 2Y06H 2GTWA 1YMHB 2G9HB 3MSPA 4M43H 1I1FA 1F3DJ 3KPNB 3OX8A 5DQ9A 4HUMB 3RTQA 1IGJB 3FB7B 3FO2A 1IRAY 1NGWB 1RMFH 2N4IA 3BPCB 4CMMB 5ANMA 4PY7B 3BGFC 4UTAL 1IKFL 3LQAH 1P5UA 2CXGA 4O9HL 3SPVB 1U3ZA 3OGOE 5DZOA 2IAMD 3UZQA 1YY8A 4HIXL 3HC4H 4YHIB 2ZJSH 3O45A 4YNYB 1P84K 3RVVC 3HI6L 3QUXB 3WIFB 1Q9OB 4HS3B 4CVZB 4NFDA 4U7SA 4HBQA 5I76A 1QKZH 2X44D 1JTOA 5L8JB 3MRRB 4NDMA 2IH3B 4HZAA 1UM4L 3GMPA 4UT7L 5IGXL 1R5WA 3GMRB 2YXMA 1A7OL 4C57C 2GTZA 1QD0A 3L3OA 4JPKL 1KCSH 5KZCB 1WCQA 3Q6GH 3RQ3A 1ONQA 1U0QA 1KIPB 3WN5A 1FYTA 4PD4J 3NN8A 4GMTH 2ZZUT 4XB8A 3K7UA 4IOFC 3IGAB 1XCTB 2FGWL 4ODWA 4OD3L 3O3EB 3BZEB 1UWXK 1BZ7A 4PRIA 1WVZA 1CK0L 2O5ZH 3C5JA 1VFUA 4AEEA 4NKMA 4F7MA 4L3EB 2YD1A 3KJ6H 4M5YH 1DQDL 1FL6B 4LBEA 3RPIA 2GHWB 5I30L 4YQXH 3MV7B 4NQXB 4OBSA 5D1QD 3BUYA 4LGSB 5IHUH 3TBVB 5I1KH 1RUQL 3FQRA 4HKXB 3JV6B 1VPOH 4KMTH 4HCRA 3DHMA 2XWBA 1KJ3H 3GSXA 5HPMB 2GK2A 3QAZC 1BEYH 4JM2C 1D6VL 1XR8B 3LZFL 4PJHB 1P7KA 2DJ4A 5F3BA 1AGDA 3JWDC 3KNBA 4XVUC 4FABL 1WUNT 3SGJA 3EJYC 4Y1AB 5J8OA 1H9VA 4M9PA 4X98B 4GG6B 3O3BB 2DQUL 4FXKA 5T3XL 4MXVF 3O2DA 2JCCB 4X9IA 4MAYD 4DVRL 4Z7VB 3HC3L 1WFUA 4ODSH 1PY9A 4AM0B 1Y6KR 3KPOB 4M9OA 4EZMA 4FQ1L 2R29L 5C0ND 5IVXF 3TPKA 1TFHA 4R26H 1REIA 2X40A 1JV5B 2XRAH 2BFVL 5IBUG 3TO4B 3S5LB 3UYPA 3BRDA 2M26A 3VFGH 3FQTA 3MREB 3PP4L 1CFVL 1DLHB 5E8NA 1UJ3C 1ZS8A 4XNZC 5J12B 2OR8A 5IQ7L 2YK1H 4XH2A 2BZDA 5ALCH 2G60L 4M62L 4JR9H 3U4BH 3DRTB 5JOPD 3HZVA 4R9HA 3MLVL 4H5SB 1T22B 2B2XH 4PRHD 3KLDA 4ZUSA 1LP9E 4XPGL 2Z8WC 5J1TC 1CGWA 4FQCH 3HB3C 3BKML 1PW3A 2DTMH 1QFOA 2CRMA 3ARSA 1U2HA 4OLEA 3TBSB 2A9ML 3FOLA 5FM4A 4FHBD 2XWJA 1TCMA 2CIIB 4JFDB 1P4LB 1JNNH 2YPLE 4WFHD 4TNVK 4UIKH 2DQCL 5IVNA 1L7TH 4JLRA 5FKAB 1NJ9A 4G8FA 4NQDB 1MJUH 3U46A 1CLOH 1WV7T 3WXVH 5GS1C 4X7TA 4OQ1A 2RGSA 3RTQC 1CBVH 3V0WH 2CLZB 4P0DA 3CJJA 2O5XL 3KPTA 2L4OA 2XFXB 4NQEA 2FSEB 2V9RA 3LRHA 2EXWC 4MQXC 2GY7B 1AC6A 1QBLH 1T0PB 3JWDL 4GSDL 3WNOA 2Q7NA 1ZHBA 5IT2H 3GJEB 3MV9E 5DMGD 3QI9C 1PZ5A 3TESA 1UJTA 3C09C 4MCYA 1TLKA 3HLAB 3RIAF 1TZIA 1JK8B 1FYHB 4ZFOB 2CKBB 3KPRE 1NGQL 3F62A 3HHRB 3NACH 3RVWC 1PSKL 4WU7B 2XG4A 3N1GC 4P4KC 4U1MB 3H9HB 4KY1L 5FYKD 4NNYA 4Z7UB 3LQZB 2Q86B 2MJWA 4L4TD 1CFBA 5TDNA 1CLZH 1OP3K 3SE3A 1MHCA 5BJTB 1MIEH 5I17B 3SKMA 5IW6A 1U8LA 3SDDD 3UMTA 4DAGH 1N26A 5I1LA 3QIWD 1CZ8L 5HHQA 5J9PA 2FECL 4FQLH 2AJUH 3VWJB 2M2DA 2P43B 5LBSH 4BSVB 5EU4B 3T2PA 4NQVA 3FB5A 15C8L 3OQ3B 4JG0H 5EZLA 4QRRA 4CRPA 4LSTH 1IAIL 2UVFA 4UIMB 4QRSB 4ZYKA 3BIBX 5L9DH 4NYLA 1P4BL 3ARVA 2EH7H 4HQQH 3VI3E 2FJGA 5IWLA 2PCPA 5IB5B 3RZWA 3ZE0F 1LE9B 3QUZC 5E94B 3DMMB 5JMOC 1K8IB 3O9WA 4WTZA 4BFGA 2CK0H 1NH6A 2ZKHH 3DWTA 4D0BA 3INUH 4I2XA 4NKOA 1MWAA 5DHXB 5DJ2A 5DUMH 5TPWL 4NT6A 4WRLA 3STLA 1SBSL 4ZPTA 3AXLB 2NY5C 3GSUB 3ZT6A 1CVSC 1ZHNA 4HXBL 2OR7A 1B88A 4FQIL 2JIXB 4B5EA 1QNZL 1S9KC 5JOFB 1KIUA 4AENA 3AVEA 2J5LC 2C7UB 2DN7A 4H25A 4IDJL 3UTTD 4YFDB 4WDIA 3AB0B 3NCFB 3TT1L 4OLVL 4YDJB 5FGSA 1NBYB 1SM3H 3V4PH 5E4IA 3HAEG 1F11B 5CMAA 4G8GD 3IAQA 2FZ3B 5D70H 1RIVH 2B1AL 1G7HA 5ISZA 5E4EB 4ZDHA 4ZQKB 1BQSA 5F1NB 2D31B 3V7AG 2HLFD 1X5IA 5DFVC 3OKOB 3S35H 5D4QA 4U1JB 43CAA 2N1KA 3O3DA 4J3OC 2ZSVB 5C2BL 5C1MB 3BIAX 5EIIB 1V3KA 4D9LL 1UACL 1OVZA 4QO1A 1A4KA 4QHMA 1ZKAA 1NCCL 4GLRH 5IP4A 3ELAT 2X4NA 1IGFH 5IHZB 3CFJB 1KF9B 5AYUL 4P2QE 4NRYA 2J88L 5F89B 3S34L 2I25N 1DDHA 3SKOA 25C8L 4AEIL 4J3TA 3NZHH 2ZOKA 2DKUA 5C0DB 3QXDA 4ZNCD 4I0KA 3V5DB 4XCCL 1FNSH 4EI5C 2R0WH 2NY7H 1OAQL 4D0CA 1MPAL 5JOPE 5I19H 1XR9A 3VXRD 3M8OH 4G6AC 3U0PB 3BT2L 4HIEB 1LEIB 4PRHE 4UOW0 4XP5L 1OPGL 3KHOA 3QDMB 3T3PF 1SYVA 4O51B 4YC2B 3VXOB 3X3GL 4RX4A 3SY0B 4G9FD 3W82A 2NY5L 1UEMA 2BSRA 4KU1A 1JUFB 3O2DL 1OAXL 4IJ3C 4J3XA 2VH5H 4XXCA 3UAJC 5I8KH 3FT4A 1U8PA 5HHMB 3QQ4B 4LIQL 4X4XA 2ZCLL 4WFHE 1M1SA 2DM4A 1N0XL 2ZUVA 1S5HA 4P5TA 2YWZA 4M6OL 4FFVD 4C4KT 1MCOL 1J0HA 5JORA 4HSQA 5C0BD 4JQVA 5I8EB 5KSAB 2E6PA 4OZGF 1H0DA 5T3ZL 5IFHL 4DW2L 3T8XA 4K94H 3C6LC 1HYSD 1JYXA 3NIFF 3ARDB 4JFPA 5T5NF 3RRQA 1K6QL 1R3LB 4OM1H 1Q72H 5IMKA 2IPKA 1CLYH 2HKFH 3C60C 3OKNA 4F7TB 5IWLC 5TDOA 3RVUD 3GMQB 3O9WC 3IAPA 5CSZA 5FYKE 1ZANL 3SE4A 1N5YH 4L4TE 5I1AB 2OXHA 4LLVA 3BP5B 3NMEA 2OM5A 5FV1L 2J6EA 5F8RC 4R2GB 5DDHA 4ZOEA 4M4PA 5DD1L 3PWJB 2AXFB 4UILH 3K2MC 1I7UA 4UT9L 2HJLA 2ATKA 5IW3A 4UV4H 4K3DH 3VFOA 1E6JH 1YEIH 5C0EA 4JM4H 1VACA 3G6JF 3IFOA 5CFHA 3FO0L 2DYPB 1KEMH 2V5MA 2XPGA 3NA4A 4G3YH 1GC1C 4ELMB 3OF6A 2FX9H 4M93C 5D1ZD 3U30B 5FDWB 1T2QL 3V7MA 5DEGB 1U8HA 2AQ3A 3MLSL 4NCDA 4PLNC 5C09B 3MBEB 4M7JH 4R8WL 4FFZH 1HI6B 3RVVD 5KW9H 2AK4B 4XNXL 4G6KL 3THML 4XC3H 4XMLH 4NQCB 1KTRL 2X89A 4XXDA 1KLGB 5CIPB 1OD7A 3ARBD 3B83A 2A83B 5EBLB 5MEOB 4OF0A 4JO1L 3TH2T 3KPPB 4PJ8B 1F4HA 4NC0B 2ID5A 2XIDA 3G04A 3VXSD 4Q2ZB 4PB0L 2VAAB 2NZ9D 4IRJA 4E41B 3H3PL 5D7SH 4LCIH 4MD0A 5D7IA 4Z7WB 3UTTE 1WEJL 3MLWH 3GSRB 1YPZE 4R3SA 2BVOA 5FYLL 2A9NH 2J3SA 1EAPA 5DZNA 1RZIB 3QZWG 4JY4A 3D18B 4G8GE 1CGUA 3PGFH 1KCVH 1OARH 3TN0B 3EFFB 5IROC 1NGYB 3VE0A 5DD3L 4EQ2A 4OZIE 1N2RA 4FTVD 3QNYA 1EEYB 4JM2D 3VXMA 4EUPB 3C9NB 1ODAA 1NMCC 4FQ2H 4RA0C 2RFXA 2WINB 4MD5B 4XVUD 4XBPB 4XXCC 1RI8A 5D2LF 1MJ8L 1RQ5A 4EIGB 4OQTA 3DV4B 3QHZL 8CGTA 2NY0C 3D0VB 5TE6L 3CUPA 5GHWH 2X4PB 1OAKH 1EO5A 1GC1L 4Y4HB 4ZO6A 1IL1B 4A6YB 5IB1B 4M1CD 1CFTA 4ZUTA 4JN2A 4PP2B 3FZUC 2LQRA 4JZOA 1TZHB 3BAEL 3MA9L 4A6YH 1N64H 4IRSA 3HUJA 3BEWA 3HZMA 1N4XL 2EC8A 2BRRH 3S4SG 4ZXBC 2VE6A 3KPQA 2H8PB 5CD3B 2MCPH 3VWKB 1YEKH 1KENL 2P8PA 3SDCC 2HH0L 1UWGH 5CJOH 4EOWH 5IK3B 1NFDA 2MCG1 1PLGH 1GGTA 1UH3A 2XQBH 1EGJA 5D5MB 1QFWL 1XF3B 3U36A 4NN5B 5F1KC 1VEMA 1QO3B 3DUUB 4HKJB 1S9WB 4LLYA 4UOW1 2XZAH 3EDFA 3NFNA 1JGLL 4PJ5B 4U4BA 1D5IH 3FFDA 4PRPD 3TNNA 5C0BE 2QSTA 1QA9B 2R15A 5LGHH 1IGIL 3PV6B 4PGBA 1RUPH 1EHXA 1G0XA 1ES0B 2Z92A 4UU9A 5BOPA 4LARH 2P46B 3Q5TA 1I8MA 1GH7A 5ITFA 4HWBL 1XF2B 3RTQD 1S7VB 2AQ2A 4DKEH 5T33H 3O6MH 4QT5A 4QXGL 2HJFA 4E0RB 1YEHL 3ZO0A 1KTDA 1F4XH 1GRWA 4LU5L 1RUAL 2Y5TB 4DGIH 4ISVB 3PWNA 1FLRH 2X4UA 5EUOE 3KXFA 3QI9D 3G08A 5D7JB 1R5IA 2D4FA 1ADQA 1NGZA 2CIKB 2CSPA 2Z8RA 4NO2B 2B1HH 3ULVD 1GOFA 3MGOA 5EPMA 1NAKL 5F72S 3BE1L 3FL7A 3VGDA 4RZCA 4GKZA 3R06B 3EIFA 1K3ZA 1KN4L 2GSGB 1CT8B 1FYTD 3NGBB 3PGDA 1MVUA 3BW9B 2KBGA 3EFDH 1BVZA 2Z4QA 5K9KA 4MAUL 3ZL4L 2X7LB 5C8JA 1CLCA 1R24A 1QSEA 4RMUA 2YS4A 4NJAH 2AGJL 5CS7A 1H3VA 3I6KB 1AKJB 1RJZA 2FIRT 3L5WA 4P3CH 3DVNA 5HY9A 1BQHA 1AD9A 1GAFL 3PWUA 1FL3A 1Z0NA 4P46B 4P23B 1EPFA 2DQIL 2RCSH 2NTFA 4JG1H 3QEQB 4JB9H 5JDSA 1F6FB 4DQOL 3QFJE 3NZ8A 3KJ4C 2P24B 3LKSA 1RVFH 3I6GA 2FEEI 3BH8A 2A74B 4M7KL 2Y07H 3I2CL 1IM9A 4MXQC 2P5EB 1CR9H 1DEEB 4F9LC 3HZYB 1KB5H 4PG9A 3SGKC 2NY4B 2F19H 3IXTA 4K3HA 3LH2L 2VC2L 4HPYH 2GCYA 1OB1A 4G9DB 5F9AC 2OL3L 5GGTL 5DJ6A 2HRPH 4RSVA 5F7EH 5EOCH 3DX8A 4DFHA 1KPVB 1T1YB 1BAFH 1LP9F 1QLRA 3PDOA 4IRSC 4ZOBA 5IFJB 5EIVA 3WFCH 4FTVE 4XNUH 1KBGH 5BVPH 3HC0B 4BK5A 4R96A 3UPCA 4HH9A 3HKFA 4N1EA 2VDRL 5FUOL 4O02H 3O0RH 3GM0A 2W1NA 5KG9A 4G80B 2UUDH 5KS9E 4LDLB 5F21B 5SWZB 3UTSA 4KZEH 2QHRH 1RJLA 4L4VA 3JV4B 3B9DA 4R90L 3ILQC 3RWFB 4JPIB 4F2MB 3G5ZB 4TSBH 2DDQH 4D9RD 5DFVD 4LQFH 1A6PA 3P30H 4GLRI 4KXZH 1X7QB 3QBTB 1R3KB 1RZGA 3TIEB 4IS6A 1IFHH 1F13A 3SDXA 5SX4H 1P1ZA 3BXNB 2W0FB 1BVKA 4P59L 2JB6A 2H26B 2NCMA 4ZFFA 3VW3L 3MLXH 5I0DA 1AQDA 4CU7A 1WBXA 4YHYC 4U49A 5EORL 3IDYC 2XZQL 5JA8B 4LCWB 5DJAB 4XTRC 4NQED 4WWKA 4OZFG 3OV6A 2DWEB 3S3JA 4OCSH 4O2FA 1BFOB 5EUKA 1I8IA 1W0VA 3O3AA 3B9EA 4RWHA 5CGYC 3VXPB 3WO4C 4NM8L 3VD3A 1BQLL 4GXVH 1JN6B 3BQUB 1NANH 1KC5L 4PRPE 4KAQL 3U4EA 4MZ3A 2Q8AL 3RU8L 2I60L 5D9SA 1EJOL 5DUPL 4QRPD 2FJHA 5JQ6L 1MCPH 1MFEH 3DURA 1FIGH 1WAAA 1T7ZA 4ZAKB 4NIKB 1RU9L 4M1GL 3GO1H 5C0CA 3VI3F 2HYMA 2E9JA 5ANME 4G8EB 5C0FA 2W0LA 1II4E 4YUEH 4L9LB 3W9DA 3ZKNC 1PKOA 3OKKB 4HHAB 4HJJH 3EOBB 1JGUL 4B53A 4GRMB 2ICES 4QRRD 4ODTL 4YHPA 1J0KA 2VXQL 4MYWB 5JLZA 2PTTA 1MY5A 1KXQE 3ZTNH 2EYSB 4XI5D 3IFPA 1ZLUK 2OSLA 4RAUA 5FM5O 3O2WL 2ARJQ 4I48A 3RL1B 3C60D 3ULVE 3FB8A 5E00B 4U1IB 4POUB 1MJ7H 3O9WD 2NTSP 4Z95L 5GS3A 3SDAA 1KIQA 5DVOA 5C0RL 2FJFB 1FZMB 3GBML 4L8BB 4HK3J 1FYTE 4PJ9B 3PGCB 4Z5RA 1SJEA 2DQFA 4IHOA 3CVHH 1MRCL 4PRIE 4W6YB 1RFDH 3ISWA 1IQDB 4KRPC 1FDLL 3FRUA 4MX7B 4RFEB 3QCUL 5A40E 3S8WA 1P4IL 4HBCH 5F3HB 5T1LB 2NLJB 5B39G 3MRFB 3LMJL 2APTA 1FNGA 2GK0A 1LDPH 2BXZA 4KJYA 3SDYH 3HNTH 3GRWH 3U6RA 5I2IA 2XYCA 3V4UH 4HGMA 2GSIA 4XCFH 2BERA 2YPKA 3U0WH 5HHXL 5MENA 1VCAA 1RZJH 5B22A 3MUJA 2YEZB 4XCEA 4Y4KA 4PJBB 3IS0X 2APBA 1AQKL 5CJQH 4U3CA 4OB5H 1MFBH 1E4JA 3K2UH 2R56L 3ZZ1A 4RGOL 5EZJB 2GI7A 4PUBH 4RWYH 3B3IA 4UTBH 5DD0L 3S6CA 5ISZD 1MVFA 3I9GL 3CNKA 2P8MB 2V5RA 5SWSA 5I1DB 1SYSA 4QHKI 3JWOH 4TQEL 3VFNA 4PJFB 1CFSB 4DVBA 2EIBA 4KK5C 1U36A 3GK8H 3R4DA 2EYTB 4F9PA 1A6ZA 5MEQA 3OMZA 1CE1H 1AHWC 4GS7B 1TJHL 2YD5A 1VB9A 2D4DA 5ENWA 4XNQB 2APWA 5EG6C 5CBEB 1LEGA 3TIDA 1U42A 2XTJE 1ZHKA 5F88A 4OV6F 4HW6A 3S98A 4QRQB 4QXTA 1OM3H 1YN6B 1IGCL 5IG7A 3W2DL 4L5FL 1UQSA 1LMKA 3VD9A 3QIUC 2OTUA 4OGAC 4LLWA 5F44A 3ZDXE 4MA3A 5K9QI 4WW1B 2PYEB 3UTZA 2E9WA 2C1OA 2A77H 4KK9D 4WCYH 5IR1A 4IIQA 3MROA 3KPLB 5F9JB 2UZIL 4GRWB 1JPSH 1AGBB 5B38A 2E8ZA 4Q9QL 2QQNH 3H7BB 3WUWA 1XGQA 4LCUA 1C1EL 2CLRB 4RX4D 4D9RE 3S88L 4I3SH 1G6RB 4OIIH 1BX2B 1HHIB 4PLOB 4U6VL 4WV1A 1F90L 1B4JH 2ESVA 4L4JA 3EOYG 1UB6B 1G6RH 4JDZA 1MHHB 1X5KA 1MCNA 5C08A 2X4OA 2Q87A 1NAMB 1G7MB 1XF1A 4ZTPH 4Z0XB 4AIZB 2PO6B 3CX2A 4ZUWA 3B9KA 4ACPA 4DWHA 3K3QA 1BFVL 4JVUA 4MJ5B 5E7BA 4HGWB 4YGVA 5J6HB 3ULUD 3GIVA 4M3KB 2WWKO 4HZLA 4OFYA 5F9DC 5FO8A 1WBYA 3OKDB 4NQEE 1EBPA 5GISH 4F57H 4YHLH 3WYRA 2SEBB 1BPVA 4M7ZB 1U8JB 2EDQA 5TDPA 2IPUG 3EYQC 5ITBL 4ZXBD 4UAOC 2CMRH 2IFGA 3GSQB 3VXQB 1E4XI 3KYMA 1JF5A 1KPUB 3MXWL 5JW4Q 3GUTA 2JJTA 5FA3A 1VKXB 5I1EL 4MNQA 4P2QB 5GSRA 3SJVA 3QQ9D 1JF1A 3BRFA 1JGDB 4YHZL 3O4LA 1VEOA 4A2MA 4L8DA 5E8OA 2I07A 2Y7QB 5EO9B 3SDAC 5IBUB 3WBDA 1XGYH 4F15B 3FHQA 4IOIA 1UEYA 3WDHA 1I7RB 3ILPB 4U1SB 4JHBA 2BY1A 5ICXA 3V6OA 3C2SA 1YYML 2IMMA 4X6DB 3KLAB 3ZKSD 5EOTB 3BZFA 3RAJH 3BEVA 1F45A 3DX7B 3PE9A 1J0JA 3HFML 1L9NA 3AU1A 4QRRE 1OSPH 1F02I 3HPJA 1HSBA 3LIZL 2ZUSA 1YJDH 5H94A 2BSSA 2R4RL 1CDYA 2FGZA 4ZG1A 1FPTL 1CFQA 3FO1A 5C70A 3OF6D 1MHPL 4D0DB 5AWNH 3IKCB 3UO1L 3RNKA 3OKMB 3NCBB 2V17L 3HR5A 3HMXA 2FB4H 4CUCA 4CW1A 2NY6B 1A6WL 2OP4H 5F6IC 3TJHD 4X6EA 2NW3B 1WFOA 2CGRL 2EIZB 4LLQB 1BQUA 4I2XE 2ITDA 3V6ZA 3MLZL 1YPZF 2X89D 1R3JB 4AQ1B 1SVCP 1WF5A 3Q6FA 4XPAL 2A6IA 2QL1A 4HJGA 2ZUXA 5HVFB 5AD0A 3ORJA 1J0YA 4I0PC 2ED9A 2CDEA 5AG9A 4FQXB 4JFFA 5FO7A 4F9PC 5A2LH 1IAMA 4OD1L 4FMFA 3IDGA 4G7YH 2D0FA 5K9JL 1TJGL 3V0VA 1LHZA 4IRJD 5E8DH 2A1WL 4Y5VA 4OZIF 1P7QB 4LHUA 4K2UL 3LDBC 4J7RA 1MFCL 3ZKXC 3L3KB 1CIUA 3RVXC 3T77A 4G43A 5DS8A 5FYKH 4K7PL 2XI9A 1AGFB 2FATH 2FBJH 3O4OC 1X44A 3IFLH 4WVRA 3T0XA 4HX1A 1M7XA 5HGHA 1RAMA 2R69H 1ZTXL 5DD6B 1ZLWK 3P4MB 4MJ6B 2Z31C 3DTXA 1KULA 5ISZE 1N5AB 4XAKE 4TUJA 3RX7A 1D5ZB 2H32B 5F7YC 3VXMD 2AW2A 4UUJA 2VDPL 4M61A 3T2OA 1D6EA 4QHUB 2ADIA 3MNVA 3CX5K 4WV1C 1QBML 1KTLA 2H41A 4U7MA 5E03A 1OF2B 2FR4A 5DUBA 1ZV5A 5ID0B 4MXQD 2I9TA 1AXIB 3OJDB 2VSCA 5GS0C 2QR0A 1GL4B 3H8NA 1S9YA 3P4OA 3EYFB 5T1KB 3NH7L 5CJ5A 3I02A 3QP3A 4GQPH 3T04D 4P9MH 1I9EA 5L2JA 3ARFC 1MHEB 3UJJH 1ZVSA 4R7NA 4LSQH 4ZUUB 5IM7B 4IRSD 4RMTA 3QUYA 3L3GB 3QQNA 3EYOA 1SQ2N 1QQDB 3PIQB 1FZOA 2MTPA 3OKLA 3P0YL 4X6CA 3SCMB 1IGYA 2BDNH 4F80A 4X5WA 1IAKA 5HHPA 4Z77A 5AZEH 3ARUA 7FABL 1VFMA 4Z7OF 4F7PA 1FNLA 4KUZL 4Y19A 4OCXL 3MRHB 2WP3O 3WFBL 1CGYA 1CL7I 1F3JB 2OJEB 2FLBT 5IB3A 3DGCR 4FQHB 5KVDL 3EOAA 4YBQC 1H3WM 3REWB 4Y5YC 1MIMH 3RUGA 5DJZA 3D39D 4EDWL 2MKWA 4KK6C 4V1DA 1EXUA 4UQ2B 2VUYA 1JZ8A 4EEEA 3GKZA 4CL7A 3ULUE 3BIKB 4JFZL 4RQQA 3QH3A 1ZSDA 4KQ3H 1UM6H 4LQ1A 5EO0A 1R3IH 4NBYB 1AXSB 1TQCB 4KDWA 3WDIA 5LWYL 4U6YB 3TA3A 4GRLA 5E5MA 3ROLB 3A0OA 1J1PL 3F5WB 2OZ4A 3V52L 5IMMB 1QSVA 3DVIA 4LOUD 3VG0H 3ZSSA 1SEQH 1WZ1L 3H6JA 2VDQH 4LGPB 5TQ0H 3LPWA 3ZYZA 4E5XA 3AROA 4UB0L 4MJ2A 5CBAB 1I8KA 5JIKA 1FNFA 1NANI 5E1HB 3PQYA 1F4YL 1S9VA 3BHBA 3KXFD 4G6JH 2DLFH 5E2UL 4ODBD 1LQSR 3RY4A 4ODHL 4I3RH 4JDTL 4ODXA 4WUKH 5GS0L 3BWAA 2IFFL 2R9HC 3TH4T 5L88H 2G9HA 2ICEB 4KI5C 2RBLA 2YD4A 2Q7YB 4XAWH 3KPNA 4XBEH 1VADB 1IGJA 3FB7A 5H37H 4NRXB 1NGWA 4CMMA 3BPCA 4JRYD 3C5ZB 4PY7A 4J3VA 4Y5VC 3KYOA 4U1GB 1U3HC 1J11A 2CDGA 4ZSOA 5A1AA 4YHIA 5I16B 1YEDA 4NBXB 4YNYA 4UI2A 1QSED 3ME0A 5F70A 1G7IB 3QUXA 4ODVH 1Q9OA 4HS3A 1MLCB 4F37F 1GGBL 4CVZA 2NY1C 5J13B 4OF6A 4KQ4L 3RPKA 3MRRA 4YDVB 4L1HA 4P2OC 2IH3A 4OBRA 5TQ2L 4MJIA 2I9LA 2APXA 3GMRA 3DUSB 3OAZK 3ESVF 4QYOB 1S9XB 1HSAB 4IOSD 5DC4B 5IESH 4JO4L 4Y4FB 5D7LB 3LD8C 1J1OH 1P5VA 3GI9H 1SMOA 3KPMB 1KIPA 3L7EB 1XF4B 1H8OA 3IGAA 1XCTA 1VFBB 2YRPA 3GHBL 4EBQH 1BM3L 3O3EA 4S2SB 3T0EB 1BVLB 3BZEA 3HNSL 5EUOB 5D7IE 2F54B 1IM9D 2QBWA 4K3JH 1CE6B 3IAGC 4JM2F 2X41A 5JPNB 2D0HA 3QJHB 1FL6A 2R2EB 3VFVB 4LKXB 3MV7A 1DR9A 3L3HA 4KRPD 4NQXA 1YEGL 4HFUL 5KS9F 2HTLC 3TBVA 3MTRA 3LN5A 5JTWA 3JV6A 3BP4B 3UJIH 1U2CA 1ZA3B 4LCCC 1KJ2B 5HPMA 5D1XB 1ZA6B 2CR3A 4PJHA 2VLJD 3RX5A 3RJDA 3VXME 1F8TH 3EO0A 5ESAB 5IV2B 4O4YH 3V9FA 5HI4D 4Y1AA 2GJZB 3R1GH 4F58L 2EO9A 4GG6A 3O3BA 3UTSD 3N1PC 5C6TL 4L4VD 5EBMB 1AP2B 3QUKB 2UYLB 3OKEB 1X5JA 5DFTA 4Z7VA 3B9AA 3IDJB 3KPOA 4KK5D 4BK4A 4JO2L 4J6RL 5FGRA 2AEQH 2GY5A 1FGNH 1F58L 5CSGA 5FAAA 2FX7L 1JV5A 3WIIL 1OAZH 2APFA 5D93B 1FG9C 1J5OH 3TO4A 5E8EB 2JTDA 3QFJB 1WWCA 3LS4H 1DLHA 3HUJE 4Y5XA 3RDTC 1E27B 5F1IB 4OGAD 4WI8A 1KN2H 1N7ML 1B90A 4N8PA 5J4MA 3DRTA 1NFDE 3ARQA 3TJEH 2GAZB 4B7IA 1FO0A 4WWKD 5CUSL 1T22A 5KVEH 4MQ7B 1U3JA 1Q9WB 3VA6A 5IOPB 1ZLVH 3SEPA 4X6BB 4M8VA 4F7CB 5ECJE 1IAOB 1QRND 1T7YA 1UGNA 5H35B 3ULSB 2CIIA 3GSOA 3TNMB 4DJMA 4JFDA 1P4LA 2EH8L 5HGBA 2EDOA 2OCFD 5FKAA 3LQAC 4NCC2 2G75B 5HXMA 2ERJB 1E6OL 3OJVC 2NY3B 2VSDA 2CLZA 35C8H 5BCAA 4Q97A 5C0CD 3FAWA 3ULVF 2QSCL 2XFXA 1OCWL 2FSEA 1T89A 4NKIL 1MFAH 4Z9KB 5MP6H 4C56B 3STZB 3QUXC 4R0LB 1UB5B 3GJEA 1M6OB 1WFNA 4GKSB 2BSED 3HLAA 3ZKMC 5K9OB 4XZUB 2WLZA 2VZOA 3RWJB 3KXFE 4MGXA 3L5XL 1NC4B 1JK8A 3RA7L 4ZFOA 2CKBA 3NA9L 4NWUH 3PNWA 4WU7A 4NUGL 3TBTB 2LABA 2M8XA 1RHHA 3LPGA 1FQ9C 4U1MA 4XP6L 3H9HA 4OGYH 3LY6A 1LO0H 2Q86A 4Z7UA 4IRZL 3G6DH 4WEBH 5I1JL 3L9RB 4AEFA 5BJTA 1FE8L 3SDAD 1J8HA 1FVEB 3IS1X 3S4SB 1TTFA 1TPXB 3TYGH 4KHTH 1NL0H 3QEUA 5C7XH 4OCRH 2E7CA 4MNHB 1ERNA 3VWJA 5LQBH 2R4SH 3L7FB 4M7LH 2IQ9L 1M71A 4WJ5B 3VGFA 3LKPB 5H2BB 4S1RH 5EU4A 4BSVA 2BRQA 2P5WB 1QSEE 1RZFH 4TVPH 4QLRA 4UIMA 1IC4L 3ZLQC 3SO5A 4QRSA 5DVMA 1A5FL 3I85A 1X5ZA 1PX4A 1LE9A 2Y06L 5E94A 3LKOB 1K8IA 5MHSD 3OX8B 5DQ9B 3R8BB 4M43L 5MEND 5J1SC 1EH9A 3K4ZA 4Y4KD 1FORH 1RMFL 4XX1G 1D5BB 3PP3K 1NEZA 1T04B 3UC0H 3LQAL 1YY8B 1S7TB 2XN9B 3O45B 3AXLA 4UV7H 1BIHA 3GSUA 3AREB 4N8CH 4ONFH 4K55A 3HC4L 2ZJSL 5SWSD 2B7DT 1CGTA 5ESVB 2OI9C 4G5ZH 4I0PD 2JIXA 2DQDH 1I3VA 1QKZL 3QIBB 1NCBH 4QHKJ 2C7UA 3ZMRA 4E42B 3TO4C 4X7CC 3ZYOA 3ULVH 3QDGB 3MRBB 1KCSL 1P9MC 3BN3B 3WN5B 1I1AB 3MXVH 4YDJA 1ACYH 4JEGB 3Q6GL 3NN8B 3E6HB 3ZT7A 1NBYA 5J12C 3MV11 4UT6H 1F11A 5HYQB 3RIFF 2ADJA 3OGCB 4GMTL 1BZ7B 4NN7B 4PRIB 1QYGH 2FZ3A 5IBLC 3F65A 4HGKC 3UTSE 5F1NA 4L4VE 2O5ZL 3WFZA 4KVNH 5JA9A 3KJ6L 3SO3B 3OKOA 1YY9D 1L7IH 4M5YL 2V9QA 5DVKA 4ZS7H 4U1JA 1BMGA 3IXAA 4YQXL 1VEPA 2ZSVA 5D6CB 5EIIA 4DZBB 3A6BH 5I1KL 5IHUL 1NFIB 3WL9A 4OGZA 2XWBB 1JPFB 1MCSA 1VPOL 4KMTL 2ESVD 3LPFA 3SDXE 3WFHB 2EC9T 3IDIB 4GKNB 3X17A 1KJ3L 5IHZA 4HCRH 3CFJA 1BEYL 5JW4N 2EDNA 4ZO7A 5F89A 2MNUA 4Z7QF 3VI4E 5C0DA 5A43C 4JRXB 5CLTA 3V5DA 3B9KD 5ELIA 1CXKA 1T89C 4L8SC 3MLYH 4OFYD 3P73B 1FNEA 2YZ8A 3U0PA 4HIEA 1LEIA 3QDMA 1RZKH 4O51A 4ODSL 3VXOA 2D7NA 2ED7A 3SY0A 2XTJB 1AE6H 4Q58C 1B0RB 3QPQC 2HTKC 4PGCB 4LRNH 2DJSA 1JUFA 1OGTB 1J86A 4R26L 4KKLD 3CCHB 3MRMA 2XRAL 1WBZB 4MNQD 3N85H 5E8NB 3VFGL 3O4LD 3D87B 3VGBA 3WLWC 1DANU 1WAAE 4YBQD 1YN7B 3WLBB 2KZWA 2YK1L 4U6XA 1LILA 5C0CE 5ALCL 1NSNH 4JR9L 3U4BL 5KSAA 4HFWB 4QTHB 5HYFA 4CADB 4HJ0C 2B2XL 2C26A 2IBBA 3RY5A 2HG5B 4EI6B 5A16B 4FQCL 2DTML 4DFIA 1MQKH 5JW4R 1QOKA 4BQBA 5GGVY 1R3LA 4KTDH 2QV2A 3B5GA 1RIHH 1NJ9B 4G8FB 5E2TH 1JNNL 1J05B 4UIKL 3DMMC 4X7TB 3GMQA 1L7TL 4YXKL 1MJUL 3WXVL 1CLOL 1RPQA 4M8QA 5I1HH 5I1AA 1BGXH 5ICZB 3LEVH 3H9YA 3V0WL 1DUYA 5BV7B 3BP5A 1T83C 3D25B 1JVKA 4NP4H 4Y88A 3PWJA 4AIOA 3SQBA 2AXFA 3D6GA 5BV7H 2Y36H 1V3LA 3NCYP 2R9HD 1QBLL 2Y9RT 1G7JA 4MCYB 5IT2L 3MOBH 1TZIB 5IHLB 1ULVA 1X6NA 2GJ6D 3F7RA 1D5MB 4EN3C 1T66D 3D3VB 4ELMA 5FDWA 1F3DH 1N6QH 5DEGA 4FNLH 5C09A 3W5NA 3MBEA 3V2AR 5MHSE 1LO5B 2XG5A 3CX5J 1CLZL 5MENE 5IW6B 1HWGB 1MIEL 1U8LB 3PF2A 4I18A 2AK4A 5DMKB 3O2VH 3BSZH 4NZUH 1S78C 5GQBA 5J9PB 4NQCA 5BZWA 4P2OD 1C5CH 4DAGL 5E4EC 1PVHA 4FQLL 2AJUL 2OTWB 4NQVB 1JGVH 2IG2H 5EZLB 3VXTB 3ZTJG 1KLGA 2UZYB 5I74C 4GBXA 5CIPA 5LBSL 2A83A 4PLKC 5EBLA 5MEOA 1EV2E 5SWSE 3KPPA 3L5HA 4PJ8A 4JG0L 4NYLB 4LSTL 4JQXA 2VAAA 4KDTA 1BECA 1OTTC 1B0WA 5L9DL 4R4FH 4E41A 2PCPB 2EH7L 4HQQL 1JTTA 4Q6IB 4XP1H 4Z7WA 5L6YH 4YHKH 2VWEC 3GSRA 1YC8A 2CK0L 4MDJB 2RIKA 4D0BB 4YHOH 5AEAA 1RZIA 1ZWIA 2ZKHL 3CMOH 3D18A 3N0PB 4M5ZH 5D96B 4NT6B 1FFQA 2K9UA 5TJWK 4HMEA 1H15B 2BOBB 3INUL 4YAQB 2HTLD 3EFFA 3TN0A 3JV5A 5DUML 1MWAH 1NEUA 4CDGC 1NGYA 4HUNB 3ROOB 1QRKA 5KAQF 4KTEH 4DOHB 2E7HA 5HYIA 3IDNB 1EEYA 4YC2C 3UXFA 4EUPA 3DV6B 3C9NA 1CQKA 3IB4A 3P11H 4J1UB 2WINA 3ULUF 4DCQB 5BXFB 3CH1B 4WFFD 3MA7B 3DV4A 2UV3A 2ESVE 2O5YH 3T0WA 5DHVB 3VFPB 3QDHA 4Y19D 2GFBB 2X4PA 5C08E 4JY6B 5CMAB 4LLUA 3V4PL 1SM3L 4Y4HA 2IMNA 1IL1A 5IB1A 4K94C 4V1DD 1X4ZA 4ZDHB 4PP2A 5D70L 1RIVL 3OB8A 3WKNA 3DETD 1TZHA 5IIEB 1DL7H 3VU2A 3WS3B 3WEXB 2VLRB 1YMMB 4LPWA 3O3DB 5KVFH 1V7MH 2QQKH 5INDB 3S35L 2NXZB 3S7GA 3TA3D 2B5IB 2H8PA 5CD3A 3VWKA 4NO5A 3ARDC 1CFNB 1IC1A 2VDOH 2VLKA 4PJXB 5EC2B 1JBJA 5CINH 1OTSC 1A64A 2XQYG 3VD7A 4MNQE 5D5MA 3GDBA 1RV6X 3SJVE 1IGFL 1N3NB 3O4LE 1QO3A 4EXKA 3DUUA 3QXDB 4HKJA 1S9WA 3PQYD 1JWMB 3NZHL 2R2HB 4PJ5A 4TNWF 1FNSL 3H0TB 5I73B 2NY7L 1QA9A 5FXCH 3F7VB 3UBXA 3V6OE 4QTIH 3PV6A 4Z78B 5I19L 1HWHB 2VN4A 1I9IH 3M8OL 1XFPA 1ES0A 1G1YA 1K4DB 2O26U 3RIAK 5F9WB 2C4FU 4D2NA 2DI7A 4UBDD 1XF2A 1S7VA 2AERT 4ESKA 4X4XB 3NABH 2EECA 4I5BB 2VH5L 3U30C 5I8KL 3ZE1E 4OGXH 4E0RA 4P5TB 4U1LB 4X7SH 1IC5H 3S36X 2VISB 5JORB 4ISVA 3CDCA 3DO7A 3QUXD 3FFCB 5B3JE 1I8LA 2BY2A 5TF1L 1K4CA 5D7JA 3SN6N 3RGVB 4PV9A 2CIKA 3C08H 3T8XB 4NO2A 4W4OC 1DN2A 3ULUH 4JZNB 1MCFA 1IEBB 5KZCD 4PJ8C 1A2YB 3DXAB 3R06A 1O0VA 4JFFE 4JQXC 3S3PA 2GSGA 1CT8A 3HE7B 3ECBB 3PXJA 2VUOA 3OKNB 1K8DB 3BW9A 4OM1L 1Q72L 5LXGH 1CLYL 2HKFL 5GJSH 3ZKQD 1U9KA 2W9LA 5FYJH 2X7LA 1JWSB 3OTTA 4L3ED 1N5YL 3I6KA 5FF6B 3MV7D 5DDHB 4K7FB 2G2RB 1MEXH 2HVJA 1WICA 5IEKB 2X4QB 2J6EH 1I9JH 2HKHH 4P46A 4UILL 1G9NH 5IB4A 3QEQA 1OP9A 2QHLA 3IFOB 1GJIA 3EZJB 4WUUA 4UV4L 4K3DL 5DSCB 2GUOA 1E6JL 1YEIL 2P24A 4JM4L 2IBGA 6CGTA 4ZO8A 2X70A 1KEML 1OP5K 4G3YL 4Y1AD 2Q6WA 5KVGH 2FX9L 5INCB 2B4CC 2VLME 5M94B 2P5EA 4J23A 1DEEA 3HZYA 1Y18A 4M7JL 4PJ7A 4FFZL 1A7NH 4LSUH 3IYLW 2ZUWA 5KW9L 3K4AA 4G9DA 1H3UA 2JELH 4XC3L 5DJ0B 1JF6A 4XMLL 2BC4B 2YRLA 1A3QA 3NPZB 4PV8A 1KPVA 1T1YA 3TO4D 1T6WA 5IFJA 4U1KB 5IKCA 2VLLB 4RGNB 3HC0A 2PXYC 4PJIF 1JMXA 4JKMA 1ZAGA 3MJ6A 4K3EH 4X6CE 3BKJH 4FZ8L 2AP2A 5E5RB 5D7SL 3WJJC 1M7DB 4LCIL 3E8UH 5SWZA 2PN5A 4WFFE 3W0WB 1U8KB 2BVOB 1X5XA 3MLWL 1T1XA 4Y19E 4B0MM 4JY4B 4NO0B 4JPIA 2HLAB 4F2MA 3G5ZA 2A9NL 2XY2A 1R0AH 3RUGE 1X7QA 2YHGA 1R3KA 3TIEA 3PGFL 1KCVL 1OARL 4V1DE 1A1NB 1I7TB 4C83B 4ELKB 4JFDD 3BXNA 3QNYB 2EEAA 1CGSH 4OV5B 5JXAL 4P57B 1JPGB 2H26A 4NQDD 1JI2A 4JGJA 5DEFB 2DB8A 1T2XA 4FQ2L 4X6FB 4PJDA 1JMZA 1D9KB 5DGQA 5MERA 4XPFH 4LCWA 3CUPB 3CD4A 5DC0A 2DWEA 4LVNB 4OQTH 1FVDA 4LF3B 1MCHA 1BFOA 5DF0A 5B8CB 2H6PB 4NHUA 3VXPA 4ZUTB 1DE4A 4BZ2H 3G5VA 3PQYE 2WMPA 1JN6A 3BQUA 1P6FA 4G6FB 3QPQD 2HTKD 3MACH 3HMWH 1WK0A 3HUJB 3BEWB 2IH1B 5D7KD 1EO7A 4A6YL 1N64L 4ENED 3KPQB 2DLEA 2V5SA 1ZOXA 3KHQA 5HYSG 2BRRL 1UKQA 4KRLB 5IJVB 2MCPL 4NN6B 3WLWD 1YEKL 2E27H 2VQUA 3NGBC 1UWGL 5CJOL 3TWCH 4EOWL 3NCYS 2C3XA 1PLGL 4YFLF 4L9LA 2XQBL 3VWJD 1JFQH 5FUZH 1WJ3A 1FZKB 1EGJH 3OKKA 4HHAA 1X5YA 4HJ0D 3EOBA 4GRMA 3Q1SH 1KEGH 4DUXA 5ICYB 2GQHA 1F4AA 3TNNB 2BMKB 2XZAL 3PJSB 3GMNB 1ZT7A 2EYSA 1A7QH 1DBJH 4MJIE 1U6AH 5LGHL 1R5VA 4P23C 4P46C 3NCMA 1RUPL 5FGCB 3DMMD 2O61B 1QG3A 4LARL 1VDGA 2FJFA 3RZCA 4L8BA 4DKEL 4PJ9A 5T33L 3O6ML 5KOMC 1FNAA 4CDHA 4H8WC 3PWNB 1U41A 4DGIL 5IQ9B 1IQDA 3WFDH 2NXYB 4N68A 3Q3GB 3VH8A 1FLRL 1T21B 1R5IB 2JIXD 4RFEA 1NGZB 2CD0A 3MV7E 5T1LA 5F3HA 5JNYB 2NLJA 3MRFA 2EDYA 1JJUA 2J4WH 3MGOB 4S11A 5ADPH 3MJ9A 1ADQH 3MNWB 4RZCB 4GKZB 5GGQH 2B1HL 4LGRB 5JIHA 2XY1A 4ERSH 5HD8D 1T20B 2NY2B 2YEZA 1NPUA 2RJMA 4PJBA 4PJHE 2Y4SA 5DYOA 3WUZA 2LAGB 5F7UA 3SDXF 5L2KB 5FHAH 4AZ8A 4QXWA 3EFDL 2HT4C 1OT2A 4K07A 4BFIB 5GZNC 5JPMB 4Y1AE 5EU3B 4G7VH 4GG6E 2P8MA 4FQQB 4LSRH 3VI4F 3EOTH 5I1DA 3QWRD 1RJZB 3L5WB 4PJFA 4HS8L 5D72H 1CFSA 4NJAL 4HDIB 3HI1B 4PLKD 3WKMH 5HY9B 4Z7VE 2EYTA 3LEYH 4O00A 4P3CL 5F6HJ 5BQ7B 4XNQA 5CBEA 3RJQB 1FL3B 1OTTD 4YBLB 1K3IA 4H1LG 4C55A 1NBVH 5TH2A 4QRQA 4CN6A 2DBJA 4ZTOH 2EE6A 3T4YB 2WK2A 2R23B 4LCYB 2RCSL 4JG1L 4NKDA 4JB9L 3QFDB 2N7AA 2XT1B 1F2XK 3I6GB 4CBPA 1H3XA 1XIWB 2C1PB 5CD5C 4WW1A 2PYEA 5SX5H 3TYFB 1RVFL 3GSVA 3B4NA 1S7QB 5C3TA 2DQJH 3G6AA 3KDMA 4L1DA 3ZE2E 1AI1H 5EH1A 2Y07L 2B0SH 5F93C 3IXTB 3IKKA 3GJFB 3KPLA 5DA0B 3GEWB 1AIFA 1CR9L 4HK3N 5F9JA 1WAAF 1AGBA 1KB5L 4NRZB 2F19L 3H7BA 3QDMD 1CICB 2VDLH 1NC2B 1YA5A 1FAKT 3WXWH 1HH9B 2CLRA 4HPYL 5DJ6B 3BQUC 3O11A 3OXSB 4I13B 4LLMB 4PG2C 1HHIA 2HRPL 5F7EL 2F15A 3FOMB 4PJGF 5EOCL 5HHMD 4F8QA 4OCYH 1UB6A 4HEPG 1BAFL 1JZ2A 1EA9C 4JFDE 1MHHA 1OD9A 4HH9B 1NAMA 3MRJA 4YZFE 1G7MA 5D71H 3WFCL 4XNUL 1KBGL 5BVPL 3IDMB 4ZAKC 1DQLH 1DTUA 4Z0XA 4AIZA 4O02L 2HT3C 3O0RL 4MJ5A 5J6HA 1JRHH 1LGVA 4KZEL 3OKDA 3X12A 5KSAD 2QHRL 2OMBA 2X4RB 2SEBA 4HF5H 4Y16B 3DUHA 4TSBL 2DDQL 3M45A 3SE9H 3TFKC 3PL6C 1WWBX 3GSQA 4LQFL 3VXQA 1KCRH 5DI8B 3P30L 5E9DB 3ARDD 3OB0H 1KPUA 3ARGB 3QRGH 1IFHL 1VKXA 5D7KE 1RHFA 4ZFFB 1WC7B 2Y7QA 2Q8BH 1AQDB 5EO9A 4Z7UE 1ZGLB 3L3IB 1MJJA 3MLXL 1I7RA 4U1SA 1J8HE 4KI1A 1XEDA 4LPUA 1RSFA 1HEZB 1QSZA 4R2GD 4X6DA 5EUKB 3KLAA 3G5YA 2CRZA 1I8IB 1W0VB 1I3GH 2IBZY 3QCTH 5EOTA 4OCSL 4ZFGH 3QNZA 4PRNA 3DX7A 4KMQA 4YPGB 3GHEH 4FQPA 4GXVL 3FQNB 2FHFA 1CDCA 5LGJB 2DYPD 3WS6C 5TE4H 1OL0A 4XGZB 5D9SB 1RZJC 3LOWA 5F8QC 3AS1A 1J88A 3S37X 5TFSH 4OLWH 1DBAH 4K8RH 1OWWA 3HTLX 3CXHJ 5C09D 1E28A 3MBED 3IKCA 1MCPL 1MFEL 4WTWA 2E7MA 1FIGL 1LE5B 2AK4D 2IAMC 4WHYG 1FSKC 2NW3A 3JWOC 2EIZA 4LLQA 4NQCD 4TNVF 3D85A 1R3JA 4PREB 3RWGA 3KAAA 1ETZB 2ZUUA 4HJJL 2BNRB 4OF7A 4FQXA 1UC6A 4PJ8D 3OZ9H 3ZYIA 4RAUB 4PTUB 3AM8C 3ZTNL 2W0KA 4E41D 4ZO9A 1P7QA 2X05A 4MXWL 3L3KA 4XWOC 4W6WB 3VRIB 3FTGB 1MJ7L 4N0YH 5GRVK 5IBTH 3Q48A 3QWOB 1AGFA 4ONHB 4XVJL 1J87A 3C6SB 1FRGH 2XXMB 2DQFB 1IVLA 1JZ4A 4WI5A 3RWHB 3TN0D 1EAJA 1KCUH 5DD6A 3ALWA 3P4MA 4HAFA 4MJ6A 43C9B 4J3SA 3CVHL 3SE8H 3MRPB 1T03H 5IUSA 1KCLA 1RFDL 1D5ZA 2H32A 3MMEB 1BFTA 1QR4A 3T4AB 1AFVH 1TMCB 1ZE3C 1A9EB 3TVMB 2HP4A 3QPXH 4HBCL 1HHHA 3NPSB 4QHUA 3IDUA 3SDYL 1LDPL 2GSIB 2IPUK 3HNTL 3GRWL 1I9RH 1PQZB 3T08A 5ID0A 2P4AB 3V4UL 4DK6A 2IWGA 4XCFL 3U0WL 2AS5M 5F97E 1RZJL 1Y0LB 4MA1C 4Y4HD 4HKZB 5T1KA 2PO6C 5CJQL 4OB5L 1MFBL 4UDTA 3K2UL 4HG4J 3U7AA 4KRNA 4PUBL 4RWYL 4UTBL 1RZ8B 1SYSB 3GKWH 1IBGH 3VFNB 3EGSB 4DVBB 1U93A 2DICA 4ZUUA 1P69B 2Y72A 3L3GA 3JWOL 1I85A 1EFXA 1CVRA 1QQDA 3BGFB 3GK8L 3QDME 3KR3H 3VWKD 3SCMA 1CE1L 5I18H 1AY1H 2HWZH 4H26B 2R1YB 4I77H 5GSVB 2EDEA 1AJ7H 5HHME 3MRHA 1OM3L 3FJTA 1F3JA 1V5JA 2OJEA 4LLWB 2ZCKH 4WI9A 4MA3B 2YUWA 4FQHA 1OLZA 5DURB 3VFMB 3REWA 5JZ7D 4PJ5D 4UQ2A 2A77L 4WCYL 1KT2B 3DBXA 1I3RB 1VA9A 3BIKA 5B38B 3HAEA 3P2TA 4B41A 2MPAH 1YJDC 4JCMA 4LCUB 5B3JF 1AXSA 1JPSL 3BPNB 4U6YA 5L8KB 2QQNL 2JJSA 4XCYB 3ROLA 1A0QH 5DEZA 4O2CB 3F5WA 4I3SL 4X4MA 5IMMA 4OIIL 1A3LH 2FYYB 1CD9B 4JDZB 1BJ8A 5C08B 1B4JL 1G6RL 4FA8A 3N06B 1FZJB 5CBAA 2Z8SA 3QG7H 1OP3H 2NY6C 4ZPVB 4ZTPL 4C4KO 3FRPG 5JW4M 5FO8B 1L6XA 3L95B 5D7JD 3UDWC 1FC1A 2WBJB 3F12A 3MJ7B 4MCZB 1YYLH 5GISL 5TDPB 4UDUB 4F57L 4YHLL 2ICEA 3F58H 2Q7YA 4RFNB 3P77B 1VADA 1TZGH 2CMRL 3RHWK 3V5HB 4NRXA 3SJVB 2VAJA