1IBHA

X-ray 3d structure of p.leiognathi cu,zn sod mutant m41i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGIHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ibhA00
3GZOA 2AQRA 4B3EA 4MCNA 1COBA 3T5WA 1B4TA 1KMGA 1PU0A 3CQPA 2ZKYA 2ZKWA 1F1DA 1N19A 1YAIA 2APSA 2R27A 3H2PA 4OH2A 3H2QA 3KH3A 1E9PB 1HL5A 1U3NA 1BA9A 2WYTA 1JK9B 1TO5A 1YSOA 2ZOWA 1L3NA 3K91A 1BZOA 2Z7WA 1ESOA 1EJ8A 3ECVA 2WZ0A 1PZSA 3RE0A 2C9VA 1SDYA 3GTVA 1Q0EA 1UXMA 1RK7A 1AZVA 2V0AA 1F18A 2XJKA 3ECUA 4MCMA 2WKOA 2LU5A 1IBBA 1F1AA 1SDAB 3MKGA 4A7GF 1OALA 2WWOA 1HL4A 2GBTA 2WYZA 1N18A 1SOSA 2VR8A 2WKOF 1SXZA 2NNXA 1OAJA 2WZ6A 2E46A 4BCYA 2AQTA 1E9OA 3HOGA 3HFFA 2AF2A 2VR7A 4A7UA 5CU9A 3GQFA 1FUNA 2SODB 4A7TA 2AQPA 1OZUA 1S4IA 3KH4A 4U4IA 4BD4A 1YAZA 2WWNA 3L9EA 1E9QA 2C9SA 2ZKXA 3KM1A 1IBDA 3SODB 3F7KA 1XSOA 1DO5A 1XTLA 1MFMA 3L9YA 3GZQA 4BCZA 2Z7YA 1DSWA 1E9OB 3QQDA 4FF9A 3LTVA 5KBKA 1PTZA 1CBJA 4N3UA 3ECWA 3MNDA 2AQSA 1E9PA 4N3TA 1SXAA 2GBUA 1SXCA 3PU7A 1TO4A 1E9QB 1IBFA 3CQQA 2AQQA 2E47A 2AEOA 1QUPA 3KM2A 1Z9PA 4A7QA 1IB5A 4A7VA 3S0PA 2GBVA 1EQWA 1OEZW 2Z7ZA 1SXNA 3QQDB 2Q2LA 3F7LA 2VR6A 3CE1A 4L05A 2JLPA 2AQNA 1SPDA 1F1GA 1CB4A 2JCWA 1Z9NA 1JCVA 5KBLA 3GZPA 1P1VA 3GTTA 1SXSA 1B4LA 1SXBA 2Z7UA 3HW7A 1XTMA 3KBEA 1JK9A 4A7SA 3KBFA 5KBMA 4A7GA 1IBHA 1OZTG 1UXLA 2XJLA 1SRDA 4OJAA 2C9UA 2K4WA 2WZ5A
chains in the Genus database with same CATH superfamily
3BKYH 3GZOA 4F7EA 2EIKB 1H5BB 1ETJA 3VXOB 3T3MF 3VD1A 3HPJB 4U2ZA 1T7VA 2YPKA 3LRHA 4OH2A 1W91A 1B0RA 3B9KB 3L2NA 4FQPA 3PP4H 3UZVB 1PSKH 5IGXH 2IIJA 3BP5B 5J3HD 4FP8H 3V4PL 2YKLH 3ARQA 1E2WA 3D0LA 4AJWA 3QA3A 3ZLQC 1MFEH 3L5HA 2DH2A 5C7XH 1QFOA 43C9B 2MKWA 4HK3N 4YHZH 2FQEA 4MAUL 5JIHA 5DT1H 2A6IB 2Y24A 4ZO8A 4S0TD 4LBAA 5F97E 2ICEA 5CIPA 5HHVH 25C8H 2PO6C 4I0PA 3G6AA 4RDBA 2EKSB 4LASL 5MI0B 1X6NA 3PNWB 3FNKA 4HLJA 4JL1A 4Z3IA 1T2JA 4F7PB 3LKQA 3KDMA 3CD4A 3WN5B 4R97B 4ELKA 1FNGA 1TZGL 1H8LA 3PXHA 2EVFA 1T3FA 3KNBA 4UT7L 5DEZA 3KCPA 1QFUL 5F0PB 1GKOA 2C9RA 1HHJB 1EIBA 4X8JA 4L9LB 2Z93A 1CLYL 1CICB 5GGRY 4LAJH 4NO3A 2WK2A 3N2JA 3K5SA 3HFMH 3GSNH 3ZDZB 1TJGL 1YEDB 3I75B 3GBNL 5CBEA 2WNKA 4P3CH 2NY7L 5FOBA 1ASOA 3C5JB 3HI6H 1EEQA 5EG6C 1WWAX 3TPUB 1USZA 4GI8A 2EJ1A 5D2LF 4YMPA 3LH2L 2MPAH 5IHHA 2HJFA 1L9PA 1XIWC 2Z7YA 1E3XA 2UWEB 3PGCB 4UNIA 5PAZA 4O51B 1HHHA 3I84A 1IC4L 3STLB 4G3YL 4R4ND 3QG7H 2JXMB 2PWEA 4WFGD 3PU7A 3T6ZA 5C0JB 1OXYA 2QQLH 4UIKH 5AKVA 1TJIH 3A4EA 3ZKSD 4MCYA 1IJ9A 2DDQH 1E4XH 2VZSA 3PDOB 3MXVH 1MI5E 3V55A 3Q2VA 4EI6B 4DJMA 1XL4A 3EDDA 1NIAA 1VEPA 3K1DA 3NDYE 1J48A 4K2UL 4M8UA 2Q3XA 1U8OA 2OSLB 3EJPA 5HYIA 2C3VA 5FO7B 4M5ZH 3S98A 5I76B 4IKLA 4WI8A 1QBBA 4ZMVA 4ODTL 3RX9A 5D1QA 4HIEA 1ETB1 4GG6A 1G43A 1G6VK 2Z1PA 5IVXE 2PCFB 2ZOKA 2H1XA 3O6MH 4FNUA 5IM7A 3OGCA 2L4OA 5AW5B 3QEQD 2B3RA 4ONFL 2C9UA 3EJSA 5JW3L 1JYXA 4PJ7E 1U8HA 2EIDA 3HAEG 5KSAB 4RGMC 2XY2A 2ALAA 5DJDA 3EGSB 2BOBA 3EGDA 2ZOTA 4PLJD 4O2CB 4Y19D 2AEPL 4AL8H 4HJUA 4PD4J 3MBEB 4UAHA 3TL5A 4WAFA 2BP8A 1Q1JL 4IGBD 3I6GA 4UWQB 1HHIA 5GGRA 1SVCP 4UTBH 3BEVA 5C6PB 4XPTH 3WFCH 4L4VE 2ID5A 1R3IH 4JO4H 4OI8A 5BUAA 2JB5H 1KB3A 4EBQH 1QI3A 1U58B 2PTTA 2HWZL 1L3WA 1HKFA 1TUPA 1I9JL 12E8L 6PAZA 3FO9B 2P49B 3GRWH 1UH4A 4L4TD 5BXFA 5EBLB 2IPTH 1PKQA 1ZK9A 4PIBA 1A1MB 1MRCH 2J1YA 4FLQA 4OZGF 3UX9B 2YC1B 1ZE3H 1INQB 1VA9A 1YNTA 2C34A 1FFPA 1DZ0A 4P4RB 2FO4A 2YSSA 1DCLA 5IK3A 3EXLA 3PIQA 1LNUA 2R0WL 5EU7C 3CSBA 3U9UA 2BWQA 1HHKA 2WINB 1NC2B 1G7PA 4B50A 3S4SA 3K4AA 3INUL 2AJZB 2OK0L 3HB3B 3CLEL 3ZE2E 3U7WH 2MIZA 1B2WL 2GUOB 5C09D 2VR9A 1ZSDA 4WU5B 4Y88A 5DC2A 3C09B 4Y4KC 1X5GA 1BYOA 3SODB 2HTLC 4JZOA 1L7TL 4Z95H 4L1SA 1DSYA 4PJ5A 5AOMA 5GSRA 1BOGB 1JTOA 1UM5L 4N22A 4YWGL 4GUPA 4HCRL 5ACLA 5DTFB 5MEPA 3EYFB 3HHRB 5KVEH 2QV2A 3CCHA 3BLBA 3WEMA 5DD1H 5EUOB 3IAQA 1GCYA 3IDYB 3IMWA 4ZMOA 4AEHH 2GY7B 5TFSH 3VRJA 3M88A 2JELH 5IMMB 4U1IB 3V52L 1EUUA 5KWYC 1IZJA 1IGML 5JA8B 3QIWC 3NBNA 2DH3A 4Z7VB 2X7LA 4JE0A 4GRMA 3T77B 1PZBA 3RURA 4FHBD 1J0HA 3BFWA 2VLJD 1XGUA 1DQMH 4NWUH 1KB9J 3FZUD 1CGVA 4WEMB 3RVUC 1CLOH 1JAEA 2LU3A 3GBML 1PLCA 5AOKA 4IRSA 5AW8B 4Q9RH 4G80A 3SGEI 2W0KA 1WBYA 7PCYA 2AP2A 3MJ8A 4KKQA 4JM2D 1UWXH 1KT2A 5I1LA 4L5FL 3FPXA 1T22A 5B4MD 2NXZC 3WLWD 3DVNA 4ZPTA 2R23B 1HYRC 2A9CA 3LQAH 1ET7A 5CHNA 1A6UL 2DM7A 2OI9B 3UERA 4G9FD 1DBBH 4OIIL 5E08H 1HFUA 2QQKL 3O6LH 5DD0H 4FLSA 3QDGB 2CDEB 3QYNA 2AEIT 5E8OB 1G1YA 2P3YA 1IBZA 1P4UA 2YRZA 3AREA 4MXWH 3ZZ1A 2H32A 4NQDB 3TESA 4MAYB 2ZOLA 4POZC 2MNJB 3ZBMA 4XX1E 3TN0B 2PYFA 1E9PB 1ZLDA 3ESMA 1BA9A 2WYTA 1VFMA 3Q2LA 3BXNA 4EPSA 4R7NA 3ARVA 3AY4A 3RX8A 1VFAB 3RB5A 1MFNA 3LIZL 1LO3L 1IGCL 3QWRA 5DMGC 5T3XL 5DYOA 1W72H 3AQXA 1ZANL 4QY8A 4P2OD 3RAJH 3HS0C 3AJ7A 5DD3H 3E3QC 3FO0L 5IHZA 4JDZA 3F7VB 3D39D 1RI8A 2R0LL 4U05A 5E4IA 1G7LB 2DMKA 3RA7H 2BSRB 5HGBA 2HFFA 2VWEE 1PY4A 5SX4I 2F7PA 4XXWC 4PJ8C 3UYRH 4UU9B 8CGTA 1G7IB 2ZNXA 4HJ0C 3DUHA 4NN6B 5A7EA 2TRYA 2XV3A 4PY7A 5HGAB 1FE8L 1AHWB 3L7EA 1U41A 3T0AA 5JQHC 1FH2A 2HT4C 1VKXB 3F3HA 4B60A 2I9LB 1HOCA 3CSGA 3ILQC 4K9EC 3EHBB 3LRLA 3HOGA 4X8GA 1MJUL 4H8QA 5D7IB 3RL2A 2ADFH 1AANA 1UJTA 4HZLA 3QNFA 1B3JA 1ZA6B 4WY7H 2PXYB 5AQ0A 2APVA 1CFNB 4HHAA 5E99H 2W81C 4HU2A 5DZLA 5F9JA 1XSOA 1MCOH 1LE9A 4PJBB 1OTTD 1AJ7L 3HZKA 1MZYA 2WVVA 4LDLB 3MRHA 3AWEA 2YA0A 3AG3B 4FQHA 4WHTB 3FT3B 2G2RB 1QRNB 2RA1A 3CFDA 3O11A 1DHKA 1KC5L 3QI9D 4LHQB 3MPCA 4XZUB 2PPDA 4DAGH 2BIMA 4JPKL 4YSCA 2VN7A 3GS0A 1YNKH 5T1JA 2KL6A 3QJTB 2WUCH 2YEZB 5GRVK 1GJUA 3N42B 4FJZA 4Q4IA 1QEWB 5J89A 5KAQF 1E7VA 2WLHA 2E8YA 4IU3A 2AEOA 1N6QL 3MFGB 4XCNA 3QUZB 4IRJB 2R29H 4P23A 3H3KA 3OKMB 5HGDB 2W91A 2DQ6A 2H7WA 3QQDB 3QJQB 5D70L 2BP3A 5SWSB 1I7TA 3B7SA 3KVDD 3OJVC 2C7UB 2G5BA 1NANH 2JKNA 3FU7A 5FM5O 1KIUA 3G5XB 4GG6E 2LVCA 3LJ3A 4GUOA 2VITA 3R18A 4BKLB 1H5BC 5HVHB 1BXAA 4PP1C 1A4BA 4OFPA 4X5RA 1M2OA 2OCFD 2Y06H 4OGAD 1LILA 4OCWL 3EGXA 4HWEH 4M7KL 4FQCL 3ZE0B 1J87A 2PCPA 3IKCA 3LZNA 3OAZK 3LZQA 1N26A 3RWGB 5B3JF 4PJCA 2EDXA 1SLXA 2VXTL 1AO7A 4QLRA 5DHVB 3FQUB 4X7SH 1S7TB 4A6YB 1CGSL 3KPRD 4K3DL 4JFSA 4DPAX 1ZGLB 2X42A 3KXFD 1BZOA 4JZNA 1A5FL 1WVZA 3IRPX 2YD5A 4K3EL 4OM1L 1I4FB 1WH0A 3GI9L 4FX5A 1MCNA 4M8VA 3DX6A 3QHFH 2CAKA 3QWOA 3TBWB 5E0FA 5MI0C 4FQXD 3KLAA 5K39A 4N4YB 5D5MB 3BEWA 3ZMNA 4F7MB 2VT0A 4LSSL 3WN5C 2XPGB 3CH1A 3N04A 4R97C 3GBEA 4AYDC 4WKZA 3NG5A 4MQSB 4ZFFB 5AUMA 2BCMA 3DDFA 4MJ6B 4NQCD 1S9WA 4FADA 3VXPB 2F18A 3TF7C 4O9HL 1JV2A 4L9LC 5LDUA 1A3LH 1CICC 5L4MA 4GSDH 4F5CA 2HJLB 4GKNA 3H6AA 3PV6A 3FFCD 3CU1A 2XYBA 1QSVA 1VACB 2D4FA 5DJ8B 5I9QB 1ZV5A 2SODB 2GTZA 1QSFA 1UVQA 2DEYX 2BFVL 2VDOL 3DO3A 4K94C 5DRWB 5ENWB 1JZ5A 4OCLC 1FGVL 4QXWA 1TZAA 4Y1TA 1JHLH 1XMEB 4GQZA 1U8CB 3HN3A 2J88H 4R7DB 2B59A 5A16A 5DQDH 2FBRA 1XWVA 1ZAGA 4PJ5E 2BH0A 3NFNA 2WBXA 4UQ2B 3KW7A 4C4KT 4PHXA 4MMYA 4ZT1A 3EOAB 3B8SA 4YDKL 1YUHA 5KSBB 2A99A 3H1ZA 4D3CH 3UTOA 5C86A 3ESNA 4GAYB 4AM0A 4PJIF 2X4SB 4Z7UF 1YO4A 3N1QC 3MDJA 5I8CB 4KY2A 1WA2X 2R0ZH 1N5AA 2EEFA 4LO9A 1U3JA 3PHQB 4BFNA 1OVZA 4KKLD 4PJGB 3F7LA 1NIBA 3JTBA 3NFSL 1A66A 4AM0Q 1V10A 4UV4L 4ELMA 5JPMB 2DQHH 3DDGA 4Y2DC 3EH3B 4AENA 3D4GA 5GIRB 3CFJA 4ANWA 2D31A 1K4DA 5E03A 4A1RA 2BSTA 2EEXA 3SPHA 1NDMA 2XXGA 3KPSB 3PWVA 5FLUA 4OZHB 3FHQA 3SDXF 4WVRA 3E1F1 5IREA 5JIQA 3P2TA 5KSAC 1TENA 2N0MA 3T5WA 4OW6A 3MBEC 3O6KL 5AYTA 4UM9A 3D06A 1J5DA 4D9QD 5I5IA 3CDFA 1MRFL 3CFEB 3OJDB 5D6CB 3TEZA 2IAMA 4KY1H 4G7QB 5IBUB 3ZT7A 2VMJA 1F1DA 1AP2B 2FAUA 5E7FA 4DO4A 1YPZA 1VFUA 3BX7C 3CXDL 4OF5A 5FUOL 1RZGB 5B38B 1OGTA 3ML9A 4M43L 3X13B 1B4RA 1RIVH 5J9PA 1NCIA 4LEXH 4DGVH 3CHSA 4XCEA 2VERA 3DHPA 1BMGA 3ETBF 3MLUL 3OB0K 2FE0A 3CMOH 3CBJB 3RE0A 3W9DA 2BWIA 3HRZA 3N40P 5T1LA 1B3IA 4HJSA 2OX5A 5T5FL 1P5VA 3DETD 4FE9A 4PY8I 4NZTH 2BW4A 2A83B 3W0WA 1XD0A 2K70A 4TLUA 1JTPA 3RTQB 5I30H 1QWNA 2OMZB 1QLFB 1HKLL 4KOBA 1KNOB 1OB0A 3DVFA 2X87A 1BD2B 1YEIH 3HB3C 1RL1A 3A6CL 2MNWA 3WFBL 1UD5A 2YPLB 1X5YA 1KEGH 4UQDA 1F4AA 3C09C 3BDXA 1KCUL 1T1ZA 3MRRA 2YAOA 4BH7B 3FO1A 4IOSA 5L6YL 2F8VA 2W95A 1EBPA 1J5OH 1EGJA 3CUPB 5I18H 2XA8L 2ZKXA 4LOFA 1OIOA 3RGBA 4QRQA 4ZRGA 1BREA 3IDYC 4JHVA 4Y9CA 5KOVC 5FO8B 2XQYA 2RBLA 4N8VA 5IFAH 2R2EA 4AGMA 1EMTL 5DZPA 1E67A 5DQ9B 1BLNA 15C8H 3NJXA 4HH9A 5IMLB 1UM6L 2CXGA 4D0BA 2VZTA 4UQ3A 2B14A 3E8UL 3OMZA 1AXTL 3FCTA 5DURD 4QWWD 2Y22A 4BSVA 2E59A 3BZ4B 1G94A 3CN4A 4LLUA 3UTPE 4DWHA 2FYVA 1WQVT 2I5YH 4NKIL 4D0DB 1Z9PA 3UPRA 4HC1A 1J8KA 1Q72H 4HMDA 1QHOA 3VSQA 4PBXA 4DN4H 1BMWA 3R06A 2ZG1A 5JQ6L 1NKRA 4J3SA 3EJTA 3ALXA 4H1LH 1MXGA 1D6EB 5FX3A 4W70A 5IB4B 3GXIA 5FO9B 3I2CL 1U8JB 1ZVHA 4XMWA 2FX7L 2PYEB 4KI5D 1ODAA 2E7LA 2WUBH 2VXUL 3WAJA 2WXIA 5D55A 3AG2B 3U9WA 2BP0B 4MAYC 2GSIA 2OP4L 5D7LB 4Z7IA 3ME0B 3QUKB 4ZUTA 5FKAA 3T0EB 3TN0C 2VZOA 2DI8A 4JKPL 1KIQB 2I9TB 4DT2A 3LNDA 1TYJA 1E27A 3G08B 1TJHL 5FGSA 1TZOA 1OK0A 3BQVA 4PJCE 2DYSB 2APSA 1RHHA 2Z92A 3GXUB 2VLRD 1AO7E 3Q6GH 3TZVD 3ZX1A 1PLBA 1RJZB 2ENYA 2NY4D 1P53A 1RJCA 5FW7A 4WW2A 4ODVH 2XETA 1ZTMA 5IHUL 3SOBL 1BZ8A 3QNYA 1AG0A 5I6NA 2CK2A 1MHCA 4K73A 3WFHA 2F54A 5GGQH 1QUNB 4PRPA 3EZJB 2YA1A 1RZJC 4KU1A 4KPHL 1ORSA 4P5TD 2BVYA 4UV7H 1JUFA 5DMJB 1AZVA 4ZX5A 3HZVB 4WO0A 1AYOA 4NN6C 1K85A 4JFXB 3EOYG 4LLAA 1GYAA 2TRHA 1AHWC 4HIQA 3UTZB 2ZKMX 1VCAA 2Y6TE 4JY6B 4FABL 4MA8H 3EHBC 2F7OA 4GPVA 4F7TA 3X12A 5I0DA 3WTYA 4I3RH 3EUDA 1QTYT 2MQ3A 3US1A 4F5CE 1LD9B 5FPIA 4NZFA 4C56D 3E80A 3QRGL 1LK3L 1WTGT 2PXYC 3B2XA 4I5BB 4U1SA 5D7JB 2AGJH 3JZ7A 5J13B 1L5GB 3PGDA 1S4IA 3STZB 1QSFE 1NCDL 4TUOB 3P9WB 3TXAA 1AKJA 4LHUA 2ED8A 1FYHB 3LB6C 1S7UB 3VFTB 4BKSC 4WENB 1JFQL 3QJRB 1NWPA 4FXKB 4OLUL 4LVHB 5LAXA 1WIPA 2VMEA 4GO6B 1IEAA 2WB7A 4KQ3L 3SE4A 5BZDA 3RG1C 4ZO7A 1H8NA 2C9XA 1TU2B 4NUGL 1PNCA 1YN6A 3MJWA 1SJEB 1U6AL 1JMXA 2XDHA 3QUZC 4UMSA 4IRJC 1SXAA 4ZW8A 3V9FA 1BXUA 4ZXBA 5C0NC 2DQIL 2I7SA 1PCXA 4FG6C 2LT9A 3APNA 1JPSH 3BVUA 4XGZB 4AW7A 4CMMA 4DGYH 4N2MA 3QS2A 4HISA 4ZBJA 4M3JA 3RIAF 1OGAB 2D0GA 3AACA 2G3ZA 4JBSA 1NOAA 2QGBA 1Q0YL 2EABA 3MGOA 2J8OA 1FVDB 1T1YA 5FGBA 1SBSH 4DOHB 1DFBH 1A1OB 1QAWA 2O5XH 1CR9H 2P80A 4ELME 4OB5L 1RAMA 4Q97A 3IETB 2BY0A 3I85A 1X9UA 2DAVA 2RTTA 2BDNL 3O45B 4EUPH 4OLVL 1J8RA 4I9WE 3CVCA 1BQHG 4UT6A 1K8DA 3NIGF 4MJ5A 3CVIH 3C8HA 5B1JA 3UG5A 4KGJA 5L2JB 1DJXA 1F8TL 3QR0A 4YHMH 4ZQKB 4EDXB 4U1NB 3C5ZD 4OUOA 3GXNA 5BS0A 3QJSB 5L7XH 1EUTA 4EQ2A 1XGRA 1OP5H 2VDML 5K1JA 4ZAKD 4F9LC 1YPZE 3TV3L 4FQJL 4FXTA 2F53D 2A6KA 3NAAL 1ID2A 4YIQB 4EXPX 1D6VL 2XQBH 4F8PA 5ADOL 1KJ2B 1H9DA 5MERA 3CVHH 2J1XA 3ZO0A 4GW4B 4ODHL 4M61B 2GG1A 4DP4X 1NCWH 4ALAL 4JL2A 4E9WA 5IUSA 3RWCB 5IT2H 2P8MA 5FS5A 3QRFM 1OTUD 2UXVA 3M1OA 1S5IL 2WLIB 3QH3A 1F1AA 3FN0L 4PB0L 3VH8B 3W0WE 3OPUA 3D2UA 2HCZX 4FZ8H 5DEFB 2VABA 1IC7L 1S3KH 4Z77B 4P5MB 2HKHL 5DRXB 5I9QC 1DJWA 3VDCA 2DQFB 3IFPB 4N6RB 1MDAA 3H9SB 4N5EC 4OLXH 2HJKB 3P0YL 1PAMA 1BECA 3IM1A 2ITEA 1WFNA 3BOVA 1FFTB 1J5IA 1WWCA 1ZWIB 5E6SB 3ILPB 1WK0A 3W11C 4EN3D 1LO0L 4YZWA 1CBVH 3QUXB 1MLCA 3HVDA 1PEWA 3P11H 4U1GB 2BOLA 3MJ9H 4RWYL 5IROD 1VFBA 2B16A 1YYMH 2ZP9A 4YNYA 5F6IB 1AGBA 2Y2TA 1NEZG 3BUYA 4FQ1H 1PLAA 2MWCA 3QFDB 4QHLB 4AQ8C 1YYLH 3UMNA 4AXWB 2XZAH 3MCLH 2A4ZA 3IGAA 4N3TA 3EH1A 3ARFA 5E6ID 1RERA 3EYQD 4HEPA 2FJFA 3NDZE 1UASA 1QRKA 1SJXA 3IBEA 6FABL 3WKMH 1M1XB 2SEBB 5JPMC 2CRIA 1URZA 4HG4K 5C6TH 4QLWA 2CO4A 1QFWL 3IDUA 1S5HB 2X6CA 1MVFA 1T7WA 4NKOB 1QQDA 4RDQF 5BOJA 1HXYA 1P2CA 1USQA 2NZ9D 1XF2B 1I82A 1CTNA 1DN0B 2VDQL 1YMHB 5E1IA 5HDRA 1XXDC 3VFSA 4QRAA 2CD0A 4DH2A 5KEZA 3T71A 1P7KB 4YDIL 4MJ4A 5JYLA 1XAUA 2M83A 3N43B 5CGTA 2GPZA 3O3DB 5E2TL 5C07B 3B8YA 3CPLA 3BJLA 3QJOA 1KGIA 4BUQA 4HQQL 1J1OL 4X80L 1OOAA 4JDEB 2AVFA 2D7TH 2YD1A 3P69A 5D7HA 3MLWL 3RI5F 3UC0H 1W80A 4PJFA 4B3EA 4OGZA 5E1AA 1H3GA 1Z66A 1ZEAL 4AY0A 2QV4A 1BZ9B 1EDYA 1KGCD 1V7ML 2BFGA 3L3DA 5B3NA 4W93A 3VU1A 3OX8A 1A7OL 4GINA 4G70B 2CBPA 5IB2A 3L1FA 1A6WL 3DSFH 4JLRA 5IG7B 3LPFA 4N0UA 2WZPD 3BI9X 5A2LH 5L8JB 2PO6A 1S78D 3PWUB 1M6UA 3L5JA 2F54E 4L1TA 3J8F7 2QSVA 4PRPE 3VI4F 4DPRA 1SOKA 3UGUA 1A7PH 1MJ8L 4WDIA 1LDPL 5TTRA 4JR9L 5CD5C 5FYJH 4RMBA 3UBHA 5E2VH 1LMKA 3VM5A 4MCZA 1NPUA 5DZVA 2GJ6A 3L3KB 4XHJC 3S35X 1JF1B 5H94A 1Z2KA 2EO1A 3IYLW 1CT8B 5HJGA 2GBAA 1JD9A 1KIRA 2ERJB 3J07A 4GEJA 2LU4A 4I89A 4ABVA 5E5LA 5EA0H 5ADPL 5LCVH 4RIRB 4TN9A 5CCHE 4OUUB 1FWXA 1MWAH 2NR6D 2P5EB 1YEFL 4IU2A 1XIWA 3GMPB 3QDJB 5TH2A 2HN7A 1JRHL 1CDIA 3UMTA 5C0CA 1T03L 4AKOA 2VQTA 4HT1H 4S10A 2J71A 2KBGA 2R69L 2QDWA 4AYBA 4CAGA 2AERT 2B8OT 2UZXA 4KJYA 4XVJL 5EO9B 2OMVB 1QNZL 3LXAA 3JV6A 3EJZD 1Z6JT 4ZOCA 5KYXA 3ES6A 4LCIH 3N1PC 2GBUA 4ENED 2NNRA 5FFLA 2WWKT 4XN4A 1YNTF 3L5XH 2NZ1A 3FYIB 2EZ0C 5FGCB 1ZS8B 1XB6A 2AJVH 3MYJB 3VFVA 3OKYA 4Z7OB 1U92B 1UA6H 4QXGL 1E50A 3BUPA 4I0PD 3EW3B 2OMTA 5E5UB 2F58L 1EVUA 4WWPA 1ZLVH 1BF2A 2Q0ZX 5AW3B 1HESA 3TA3B 3L4ZA 4PLOB 3BMVA 5HY9A 3ZSTA 3T0EC 4GRWH 2IMNA 5C92A 4WKXA 1CL7I 3VFNA 2P24B 1F4YH 1XF4A 2AQ1A 2XLLA 4M7ZB 4PFEA 3Q44A 4WHYH 3V0EA 4BHUA 1IAII 1CLVA 3HTLX 4A2GA 3CFCL 1KV3A 3H3PL 1FFOB 4WTWA 5BCAA 1MQKL 3P9LB 4LEEA 4HS6B 1SLVA 4QJ5B 2A9ML 3B43A 5AL8A 2IWGA 3DV4A 4HCGA 2COVD 3V4PH 5KZCD 4Y89A 5BS0E 3T2LA 1CWVA 4KHTL 1URLA 3E6FB 4ZTEA 3Q06A 2CNYA 4NCDA 4MAUH 4N2BA 3ULUE 4RGNB 1MFUA 1KXTA 2V37A 1IE4A 2MH4A 4M48L 5C0GA 3X11B 2VJ8A 2NX5D 4LASH 3QORD 3PE9A 1NCTA 2P8PA 3V79C 1NCOA 2NYYC 5CWSA 3QYMA 4H25B 3PPEA 4K3GA 3K4ZA 1TZGH 1C5DB 4MJID 3TO4A 1KJVB 4UT7H 3QXDB 2CA3A 1QFUH 1VCBC 1J8HD 4YBQC 5EZOL 3ZIYA 4BGDA 1QA9A 1E0OB 4W9LC 1CLYH 1OSZB 1RD6A 3EO9L 5D7JC 3BKJL 5INCA 2GT9A 2H6UA 3JQOB 1TJGH 5DJXA 3GBNH 5J13C 5D1QD 3PREA 4KWUA 2H1PL 4AQAA 4ZFGL 2ZX9A 2NY7H 1U3HD 3OGOE 3V6BR 5JHDD 2YRPA 3TT3L 1CF8L 2DQCL 3LH2H 4EUPG 2N59A 4Z8FL 3WMPA 1KJMB 4FXKC 4HWZA 4LVHC 3SZ6A 3MXWL 3PHOA 4QRFA 1N6UA 1FN4A 1I9EA 1IC4H 2CGZA 3F12A 4G3YH 1UOKA 5E9AA 2Q87A 4D8PB 4F24A 1I75A 3DIVA 4HS3A 4JK0D 3EOTL 2ETWA 2BIIA 2IANA 4I48A 4N9OB 1MAKA 5DK0A 5H37H 3TU6A 4FQQA 1LEIB 4FF9A 3QIWA 1AGDA 3BSGA 4B9ZA 4APQA 4P07A 3CSTA 1I1YB 5GS2H 2IC2A 3BSHA 5HDWA 2L7EA 3IU3A 3GSOB 2X05A 4K2UH 5DHEA 4MJHA 5LLIC 2WQSA 2Y6SD 3U0TA 1BF8A 5CZRA 2EKJA 1KYDA 1PD0A 1EFXB 1TTUA 1QYGL 4ODTH 2XTJD 3BPOB 4BYHA 2ZUUA 4H26B 5CCJA 1UWGL 2CO3A 2Y3NA 3BAEL 3GYRA 5HHOA 1OCZB 4AEEA 5C0IA 1BX2B 1PS3A 1DJZA 1HEZB 1S7XA 3VACA 4QHUA 1X4ZA 3GJFA 4LEBA 2R0KL 3SYPA 4ONFH 1LLAA 1RIHL 1P0SE 3S5YA 1B4LA 5JW3H 3S97C 2VDPL 3ZDYE 1EO8L 4HIXL 4ZMYA 4IEFB 2UXGA 4X8XA 3VJ6A 2I07B 2D8KA 5E51A 2X4QA 5L8LB 1BFOA 4KDVA 1SRDA 4WI0B 2CG9X 3GBDA 5JORB 1Q1JH 4PJ9D 5JXED 4PI0A 4AV0A 1N0LB 1FQ9C 1UGNA 1U8NA 4PJFE 3TOPA 1NDGB 3L4VA 5KVMC 1EZUA 4P59L 1G0YR 2PPFA 4PJDF 5DVKA 5C0BB 2R27A 3V6FA 3TBVA 1Q94A 2VM9A 4J3XA 1PF3A 3HS0A 1PZDA 3DYMA 2KZBA 1I9JH 12E8H 2OR7A 1MXDA 5EB9A 5JOPD 1ESOA 4N0UE 4HC1L 3BWUF 1PZSA 4XXCC 1MCFA 3BVNB 5DD5L 4XXWA 2WMPB 1Q0EA 4M4RB 4PJAB 4PJ8A 1ZLUH 3DO7A 3VWJB 1FVEA 3ZGIA 3DX9A 1TEFA 4ZODA 3ULVD 4MXVE 2R0WH 4BEIA 4J2QA 3V0IA 1A9EB 3QFJA 1VEOA 3INUH 2GJ6E 2OK0H 1ZVYA 3QZPA 4JFOB 2VDKB 3CLEH 3O4LB 3ZDXE 1OPGL 4EQ3A 1B2WH 1NPJA 3FT2B 3MV7D 4MLSA 4ZFZA 4E5XB 2E6JA 1BCIA 2A9NL 1B6DA 1L7TH 3EJYD 3QT2A 3QUXC 5CBAA 5IW6B 2FGWL 4O02B 3CXHK 2UZIL 2VLME 4PRDB 3WIFB 4YWGH 4U1GC 1UM5H 4HCRH 3OTTA 2DIEA 4RA0C 1FO0A 1GZPB 5CEZD 3ECBA 3DBXA 3HNVL 3DI2B 3L9YA 3HC0A 5C0CE 3V52H 1IGMH 1NPNA 2BSEA 3NJFA 1E5AA 3FOLB 5CD3B 4Y2OA 1HQRA 1BVLA 2JKLA 2P5WA 4R7VA 4XMUA 1RK1A 3QXAA 2WAHA 3UGXA 1OM3L 2ZP0T 3FN9A 3O41A 4G8FA 4NQVB 2X4TB 1QPXA 4IJ3B 2X1OA 3NIDE 3GBMH 3GO1L 4IDJL 5DCCA 5ESAA 3MX0A 1GGCL 3OHXA 4ZUVA 2DBLL 3UXFA 3FB7B 1AGCA 2XICA 3LN4A 3E6HB 4L5FH 4JRFA 4ECNA 3CE1A 4TQ8A 1LE5A 2NSQA 5DD6B 3RIFF 3ZKMD 1A6UH 1QLEL 4OIIH 1T7ZA 1H5BA 2QQKH 3SDCC 3VXOA 1P6FA 1CIUA 1QNIA 3S37X 4CN1A 4L3EB 4XNMB 2PABA 3NCXA 3UZVA 4J3OH 4NI6A 1A14L 3JWOC 4KZ0A 1JN6A 2WSPA 2WCGA 4JAMA 2H0JA 4Y7OC 1AC6A 4RRPM 4PJXF 1PMYA 3QO0B 4HKZB 1CQKA 1I7ZB 2WXHA 3FB8B 3SCMB 43C9A 3LIZH 1Q38A 1LO3H 1IGCH 3ZYOA 3BAXA 5T3XH 3B2UD 1ZANH 3UIZA 4C4UA 4QXUL 2F74B 3B2VH 4ORZC 1N5YL 2EKSA 4AV4A 1U9KA 3GSUB 1QO3B 3FO0H 3DECA 3PNWA 4CADA 4G8EB 2R0LH 4ELMF 1F3DJ 4PRNB 3WN5A 3VFRA 5MHSE 4UOQA 2XRAL 5I1DB 2NSXA 4JN1L 5D1XD 5JDSB 2RCSL 5C0EB 5HDBB 1UEMA 1XDTT 2B39A 1OTSC 1M4KA 4L9LA 1CICA 1FE8H 3ARUA 2ZSVB 2FCBA 4NRZB 3OAUL 2HP4A 5E94A 1IVTA 2ERJC 1YEDA 3PGFL 3ZO9A 2DWEA 4XC3L 4FMFA 1MJUH 4DEUA 5CXPA 3CLFL 2CR3A 2ZX7A 3TPUA 3LN9A 4UT6L 3LYRA 2E46A 3GS4A 3V8OA 1XH3B 2IPKB 3PGCA 2XY1A 4GIAA 5EIIA 1YPZF 4MHHI 1AJ7H 2ALWA 3STLA 3ZXAC 4Y19B 2JMRA 1G4RA 5GGUB 2JXMA 2E75C 2I85A 5I23A 4IGBB 1KC5H 5ERWB 5C0JA 3MV8E 3QP3A 4JPKH 3ULUL 1KXVA 3G3LA 1KYOK 1YQVL 4Q6YA 4HALA 1LL1A 1VSCA 1YMMD 2FHFA 3KPNB 3SPIA 4EI6A 2IANE 2ZPKL 4AUJA 4Z7AA 1N6QH 2HT3C 3GXFA 1XT5A 2DLTA 2OSLA 5GSVB 3NOIA 4WI3A 2WD0A 4MS8D 3VXMA 2HYMA 5FO7A 1G5AA 2GK0B 5I76A 4XR8C 5IEKA 1IEBB 3CX5J 4PN6A 4WNSA 2O1AA 4L4TB 5D70H 2FIRT 1U3ZA 1IM9B 3AXHA 4JN2A 4ZW6A 3I6LD 3NTCL 5D9SB 4Y2DA 3B9VA 4GYBA 5E2JA 4EVNB 5H8DA 3TA3C 1O9WA 3C6EA 4EDWL 3VI3B 1VF5C 3CZNA 5HHOE 5FUZL 2PETA 1RY7B 3AWGA 1JXJA 1W0WB 1Z9NA 2OV0A 4POYA 5KSAA 3HVNA 1YJDC 2Z3FA 5M95B 4PP2A 4MA7L 2HT2D 4OCWH 4W9DC 4G6FB 4BQBA 4M7KH 5I66B 4OD2A 4FQCH 3US9A 4F91B 4S1SL 4X6DA 1MREL 1OQOA 1N70A 4HUKB 1G6RA 4K23L 5ICYB 2GFBA 3AB0B 1FDLL 3GMNA 3HBQA 3T4YB 2VXTH 4FQIL 5L4FA 2H3NA 1QSFD 2BM3A 4OGXL 1CGSH 4K3DH 4ADIA 2IGTA 2AXFB 1CFTB 3H0TA 2JI3A 4CSTA 1U58A 1AMYA 1PX4A 2NT0A 4K3EH 3VA6A 5KJRL 1Q9WA 2IPUG 4OM1H 4RGNC 3NP3A 3GI9H 3FUDA 4WFED 5J0BA 4J8QA 2CHDA 3LSOA 3QXUA 5CN3A 2UY7B 5EBLA 4TL4A 3ABLB 1A1MA 4U1HA 4QTHB 2B4CC 4LSSH 3E3QE 1IILE 2YC1A 5I1IL 3K2MC 5LHDA 3GTNA 4P4RA 4HKXB 4UOW0 2WINA 4M1DH 4O9HH 3ZYZA 3SQBB 3D2TA 1IARB 2PP7A 5GGSB 4M4PA 3VGAB 1J0ZA 4JM2B 5I8EB 4I9XA 6CGTA 2YD3A 2AZUA 4WU5A 1BMZA 1A9BB 3QFJE 1NQBA 2BFVH 2VDOH 3QZWB 1YVLA 1FGVH 1UWYA 4UT9A 4P06A 5DTFA 1BAFL 1JF6A 3DK2A 2IG2L 2K6WA 5EUOA 5KOMC 3TS8A 1JZ7A 4N2AA 2AJYL 4AUUA 4LL9A 4XMPL 1PL3A 3APMA 4YSQA 32C2B 3VWKD 5IMMA 1JG9A 3ZKQD 2ESVD 4YDKH 1S9XA 3BWZA 4HLEA 4ZFQA 4GKLA 4XWGL 1E6OL 3VTMA 4Z7VA 3T77A 1GGIL 2QSCL 4R5XA 1SEQL 3FYEB 4YR6A 4OCNC 4G5AA 4P2OB 1F45A 1XH0A 2XZZA 2Z0BA 3NRPA 3OR7B 4QPEA 3VM7A 5G5DA 2BIPA 1O75A 2P5WE 1FSKB 3C08L 3D39B 4HUMB 4FHJA 4GSQA 4H8PA 1UENA 3NFSH 1FP5A 4UV4H 4L8BA 4JZJC 4NUMA 1DVQA 5CF3A 1WIOA 1OEZW 2CPUA 1R19A 2JSFA 3HLAB 4MBOA 3UL4A 5EOCJ 3QDGA 2CDEA 4PLKD 2QVKA 5E8OA 3VFPA 4YVUA 4NQDA 2WAQA 4MAYA 2D3JA 3NT0A 1SXSA 1QATA 3O6KH 3TN0A 4ZS7L 5IVNA 3FCSB 3PAZA 5MP6L 1MRFH 1FNAA 3BKCL 3FU5A 3CSYB 2OR8A 5FB8B 7TAAA 4HZAA 3GUTB 1EZVX 2ZCZA 1RQ5A 4IOSD 4TSBL 2XWRA 1NUDA 2Y7LA 3CXDH 5FUOH 2VJXA 4FI8A 3QI9B 1CXLA 2JQZA 4M43H 5BRZD 1LXMA 5E6UB 4KMLB 5LBGA 1COBA 1XBDA 2C1PB 2VM3A 4HOXA 4AYEC 4AJ0A 2OTWB 3MLUH 2ZP8A 1HJBC 3A21A 3L08A 1G7LA 1NKOA 5FDYA 2BSRA 5AB9A 3IDIB 2ICWA 5T5FH 4YSSA 3FQYA 2Q76B 1S6NA 3VVVA 4UU9A 1G7IA 3VWJC 3OF6D 3RNQB 1JV5B 5HGAA 3V7AG 1CDHA 4UANA 1VKXA 1HKLH 3HI5L 2C9VA 2JB6B 3HG5A 2R9HD 1KLFA 2FBJH 4WJKB 1FFQA 2QADD 3C6LB 2ENPA 2Y7QB 2I60L 3A6CH 2ZWSA 5L2KB 3WFBH 5EPMA 1ZA6A 2PXYA 3OKKB 3PWPD 4XXDB 1CFNA 3VX1A 1KCUH 2M26A 3I74A 5A2BA 3WTUA 1FJ1B 2CUMA 5L6YH 4PJBA 1MY5A 4HPOL 4TUUA 1OB1B 4KXDA 4JHUA 4HK0A 2A4EA 2XA8H 3FT3A 3Q13A 4O4YL 1JFHA 3UTTB 2X09A 3ILEA 5J3HC 5FAAA 1OE1A 2CMRL 1EMTH 2YEZA 4X2UA 2CKBA 2XFGB 5J1AA 4J3OG 3MRDA 4KXZH 3MRNB 3OKNB 3FUNA 2R2BB 3FQRB 3KR3L 1UM6H 3MRFA 4LARL 4JMXA 5EU4B 4X99A 3E8UH 4XODA 1AXTH 1D9KB 1XGYL 1G7JA 4IRJA 3F04A 1YC7A 2FRGP 2OW6A 5CIPH 3OKMA 5HGDA 5A6MA 2YD4A 1N4XL 4LPYA 3QQDA 4IJ3C 2O6CA 1JOIA 1PTZA 4NKIH 5SWSA 4LOUD 3GHPA 1WLHA 5SWZB 3SDDD 1Q8MA 1NEPA 2DQEL 4RFOL 3ZTEA 2C7UA 3B5TA 1Y0LB 1MPAL 3VXME 5MEQB 4JUTA 1WFMA 5JQ6H 5KSUA 1KOAA 2ZAHA 3ZHDA 2R4SL 2J20A 4A7QA 4JREB 3S0PA 3I2CH 3QQXA 4BK8A 2QQNL 4J6RL 5CFAA 3D6GA 2FX7H 3M7FB 4M7LL 5KANG 2VXUH 3QEHB 4MWFB 2RHEA 3CC5B 3DK0A 1FRGL 3IDNB 5LGHH 4Y4HB 1FHGA 3RWGA 5JLZB 2OP4H 3HAEA 2LQRA 5DHVA 4JKPH 2CZNA 1S7TA 3HG3A 4NO2B 2VGLM 4AE1A 5C8JA 2DEXX 3VD5A 3D50A 4RX4A 1FYTD 4IBSA 1TJHH 2WKGA 4X6DE 3MQIA 4R4NC 2VM4A 3BHBA 2VNCA 4E9QA 3LD8B 4HFUL 4ETYA 4G8GA 2H8PB 3C5SB 2JJUA 5IHUH 3TBWA 3SOBH 4ACTA 2ZKYA 3HA0A 4KK9D 2J4WL 2LV4A 5D5MA 1RZ8A 3N44B 2YD8A 1EO5A 1HL5A 4KPHH 5E2UL 4MJ6A 4NJAL 3VXPA 3IF1B 5F88B 1WFTA 4IQHA 4YOKA 3D1MC 4M29A 4QRUA 2XVLA 2HJLA 3QK0A 2AMUA 1QPPA 4FABH 2VKXA 2NY6B 5DQJA 4RAUB 1SN0A 1VACA 2WQWA 1QG3A 3ORJA 4MNGA 4LE8A 1EA9C 5AOIA 5DJ8A 5DHYB 1CF1A 3HHSB 3SDAB 4DO5A 1JYWA 3QRGH 1LK3H 5ENWA 3WTWA 2Y25A 4WSJA 3RU8L 1S7SB 1ZHBB 2BVPB 2P80D 1U8CA 3ARGD 4JFPB 2R15A 4LIQE 3KEDA 2X0UA 4PLJC 1NCDH 4PB9L 4UQ2A 3RUGB 1NCBL 2ZCKL 3L4XA 3IGUA 1I8IA 4IGBC 4Z5RB 2AF2A 3EOAA 1V3LA 4JFQA 3UJIL 2QQQA 4IMKC 5KSBA 3IJHB 1JFQH 2DJUA 2GEEA 1ETZB 1B0GB 4GAYA 4OLUH 2XN9D 2Z8VC 1NCCL 1UOWA 3GC3A 4KQ3H 1UD8A 4H0LC 4JS7A 4AQ8A 1JNNL 1YA5A 1S9VB 5DDHB 3QW9A 4NUGH 4MDJB 5F0MB 3LOWA 4L37B 5I8CA 1V7NL 2EC9T 1U6AH 4Y9FA 5F72S 4Z7VE 5HHPA 1AE6L 1F13A 2IEPA 2DQIH 4RZCA 3FPYA 1CGYA 4PJGA 5SWQB 5ILTL 4YHNB 1XCTB 1V3KA 1Q0YH 2TSAA 5JPMA 2QVIA 1DANU 4G8AC 1WFOA 5GIRA 3T4AB 2J8UB 4IYKA 3OKEB 1DVYA 4TXVB 3V2AR 1JYNA 4PGDA 5FM8A 3TYFA 4K9EL 3KPSA 5HYJB 5I0ZA 4OB5H 1FC2D 3S7GA 1FG2A 1J5HA 2BDNH 1I1AD 1S8DA 4OLVH 3QDGE 4DSYA 3D2UD 3TGXA 3JWNH 1UD6A 4YPGB 2OYPA 3CFEA 2YBRA 5D6CA 1W8EA 3AB0C 5D7EA 4RMSA 4NQDE 4Z7WF 4CILA 4DK3A 1F8TH 2K7PA 2Q10A 1H8OA 1TITA 1RZGA 2IWEA 1TSHA 3K0WA 3X13A 5B38A 4JY5L 1FO0L 2CDFA 2WQRA 4TRPL 2HRPL 4NI3A 2VDMH 2I32A 2MQGA 2D0HA 1AS7A 3TV3H 3UPAA 1DVFD 4FQJH 3NIDF 3F83A 3NAAH 1N68A 1D6VH 2OZ4A 3FSWA 5ADOH 2VC2L 4CGTA 2B1OA 1W16A 1WYJA 3AXIA 2I27N 4FCHA 5DURB 2A83A 3FZUC 2WQVA 4P57B 5AOZA 3UAEA 5ETUA 2OMZA 3NJGA 1QLFA 4ODHH 3UROR 5ACMA 2UY6B 1KNOA 3RGVD 4ALAH 1RJLB 1RUKL 2AEWA 1BD2A 4GI9A 1S5IH 2XI9A 4PB0H 3FN0H 4TYUA 4WSKA 2KDYA 4JM2C 3OXRB 3Q1EA 1N59B 5CJQL 2YPLA 1KXQA 2UXTA 2OCCB 5L88L 3FT4A 2DBJA 2WWMD 1IC7H 1HE8A 1NCJA 1WS8A 3OQRA 3QUYB 4KROD 3VQLA 2HKHH 4Z3FA 5B1BB 5T5NG 2E0PA 1XZWA 3ZK0A 2Q8AL 1VERA 4JFED 5TPWL 4B96A 3FTGB 1EPFA 3CUPA 3P0YH 4XO5A 4JGUA 3MCKB 3N50A 4RRPA 5DRNB 4QUOA 4WUUD 3ZRSA 4AMKL 3U6RB 3WTTA 2YAPA 3G04B 4AGPA 5FO8A 2X40A 1BJ8A 5GS2D 3FUJA 5FYKD 4PJBE 4QXTA 1KBPA 1LO0H 1J1PL 2ARJB 2OMYB 4FNLL 2ZIDA 5DQ9A 3TT1L 4RWYH 4GXFA 3TCXA 2X12A 1UWXK 5IMLA 3BDYL 1MUJB 1G1CA 2ZXQA 4BWWA 1LK2A 3ZJAA 1ZV2A 2VSMB 4P2OC 4HJTA 2H6OA 3KPPA 1F0LA 4GG8A 2KMWA 3SN6N 1FSKC 4KRPB 4MYWB 1HI6A 3WY3A 6FABH 4P5TB 4EI5B 3RKPA 4WWKB 3SGDI 4XVUD 5SWSE 2XWEA 2VLKD 1B88A 5FO9A 2YQGA 1QFWH 1T20B 1E5BA 3N85L 1EFQA 3EJJX 3VYPA 3MHZA 2PYEA 5FA3B 4JFYA 2D7OA 4PBDA 4S2SB 2EUXA 2X2HA 3MRLA 4XE0A 2R1WB 3ENEA 4H4NA 4PG9B 2VW6A 1LTXA 3RKDC 4YDIH 3RTLA 2BP0A 5FYLD 1TQUA 2YRLA 3HJEA 4JVUA 4KKBC 5E2TH 4HK3J 3QUKA 5HVFB 3T0EA 3DJSA 4PREB 3STBA 3KE0A 4C56B 2O6EA 2I9TA 4HQQH 4I4WA 8PAZA 1MH5B 4AW4A 1J1OH 3ZE0E 4X80H 3G08A 4PVLA 4DK6A 3HKZA 4MX7A 1Z9SB 4FKKA 3MLWH 5G4MA 5IMKA 4M1GL 4XX1G 3II1A 3QI9C 3T6VA 1ZEAH 4KMQA 3POHA 4QHPA 2IBGA 1V7MH 1ZTXE 3GGWB 5C08D 3KWVA 3FSOA 3ARXA 1A7OH 3D05A 2IQAB 4QCIB 5B1KA 1CFQB 4U6HB 1GOFA 1A6WH 3L4YA 4G8GE 4L1DA 4MNQD 4PCKA 2CNZA 2DQJL 3HZVA 4YHKL 2BPBA 1BFVL 4JFXA 4JKNA 5D5ME 1LJMA 1SDDB 4XN5A 2NT1A 4LFHD 1AXSB 3UTZA 3K3QA 1TO5A 1WZMA 4Z7NB 2FJSA 1MJ8H 4E9VA 3AADB 4JY6A 1LDPH 2BZ7A 2V5TA 4JR9H 3WMSA 1JDCA 5T3ZE 4NQED 1S9YA 4IBTA 1I8UA 5KVDE 1ZJAA 5HI5D 3FQTB 5BVJB 1LD9A 5LN8A 3WO4B 1UOVA 1EAOA 3DXAA 3FB5B 4I5BA 2B0SL 3LKOB 1X4XA 4LKXA 1DDHB 4JDVA 2A74B 1XCQA 4MNGE 1L5GA 4OGAC 4PRHB 3TBSB 2WWOA 3STZA 1AZRA 5C2BL 5ADPH 2EDKA 4TUOA 1A22B 5CEYB 5TE6L 1DYZA 2VR8A 5CLTA 2WKOF 4HLZG 3VGHA 4YHOL 1G6RL 5KS9A 1S7UA 3VFTA 3T8VA 1YEFH 5I1HL 5ESQA 1AZNA 1JL8A 5JIIA 4FXKA 4KC3B 3IFOA 1MHEB 4TUJB 1JRHH 2EIEA 3SBRA 3C6SA 3IN2A 1IFHL 4GKOA 2OTUB 3D51A 1WF5A 5EO1B 1T03H 1SEBB 2ZONA 1TU2A 1LWHA 4MKTA 1D9KC 1SJEA 2R69H 3UZQB 4PPTA 3MRGB 3IDMB 4NUQA 2OULB 4XVJH 4XGZA 3FF7A 1QNZH 5E6YA 3M45A 3PL6A 4Q74A 2F53B 1OGAA 1RURL 3OKLB 2J1ZA 1AQKL 4J3BA 4H88L 4Y4FD 1FVDA 1VJSA 3GSNB 1R9FA 4DKEH 4TNWF 4PJGE 1A1OA 4Y8AA 3ETSA 4A2EA 3MNDA 1Y07A 4OSUH 4QXGH 3VTTA 4GAGL 2J6EA 4DGIL 3IETA 4LHJB 1NMAL 4YGVB 5TDOB 3VXUA 5SX5K 2F58H 5DUML 1ZV9A 3O45A 3EJUA 5E6RB 2R1XB 1SJHB 5IBLD 1CVSC 1SVBA 3KPSE 4Y4HC 4LIQL 3IN0A 1P1ZA 3RJQB 1D5BA 3L4CA 4B95C 5L2JA 4LVEA 1FNLA 4EDXA 4ZQKA 4AQ1B 2AK1L 3DVIA 3U2SB 4NT6B 5FK9B 2C4XA 1WAAE 1IAIM 3CFCH 3H3PH 5LAPA 3T3PB 1MQKH 1MY7A 2H47C 3B5GA 4NNYB 4R6UA 3LRMA 1XTMA 3CU7A 4NGHL 1ERNA 1MZZA 1U93B 1Z9LA 2BX5A 3K8MA 4Y4KD 1GS7A 1U8KB 5F7EL 5AVSB 3RWFB 2VN4A 3DARA 3KPLA 4NYLB 4KHTH 4CKVX 4OGQC 5I75B 5EO0B 1VEMA 3P3RA 4OZIA 1T2QL 2CO6B 4KNUA 4M61A 4M48H 3RWCA 3TM6A 5E2WL 4KKLC 4NPYA 3VH8A 5AW2B 1BPVA 4N24A 4GH7B 5I24A 5KYWB 1U0QA 1KGJA 3CMGA 3FC8A 3R4RA 3OMNB 5EOQL 1BD2E 5LVEA 4NSKB 4P5MA 4RMTA 5DRXA 5EZOH 3CNKA 3SDAC 2FEEL 1SHWA 3N1FC 2DQFA 3IFPA 1LWJA 3P2BA 4N6RA 4X98B 3H9SA 2LOEA 3EO9H 3BKJH 2YPLE 1XVSA 2YXMA 1K8IB 1MFAL 5CM1A 1KXQE 3FHAA 4MJJA 2EIMB 2XVBA 2XWTB 2H1PH 4ZFGH 1ZWIA 3TURA 1YN7B 3ILPA 1GTNA 3TFKC 2NXZD 5E70A 3QUXA 3TT3H 1CF8H 2DQCH 1XR8B 1ULVA 2IFFL 3K2UL 4J4PD 4Z8FH 2COQA 4R0LB 4TNFA 3MXWH 3RDTA 4LBEB 1E8XA 4M8RA 3EOTH 1P6AB 2R83A 3V6OE 4Z0BL 4X7TA 1RJYA 4MSWB 2NDGA 1Q0XL 3KH4A 3OR6A 4M7JL 1YAZA 5EHFA 3DYPA 4XAKD 1KZQA 1RZJL 4G8IB 4N2EA 3HE6D 1Z3RA 2SEBA 2RB8A 3DETC 2MHAB 2EDFA 2DLHA 4W9GC 1C16B 1GAFL 4FTVD 5DMGD 1TQCB 3RIKA 2ZUVA 1F11B 4NKOA 3IJ8A 4LDCA 3MNZA 1PIFA 4LU5L 4FC3E 1L0PA 1XF2A 1QYGH 4BZ1A 1LDSA 4L0YA 5BRQA 4H2CA 4XHQA 1UWGH 3NCMA 4CL7A 4FNTA 1IBFA 3KWTA 3WE1A 5FW6A 4WNQB 1XSIA 2PYEE 3O3DA 5C07A 4JPSA 4WNJA 3BP7A 3FQXB 1QHQA 3SDCA 2R0KH 4IOIB 1EXUB 1RIHH 4MNHB 2B9AA 4FLRA 4BFBD 3EBGA 4LVNB 2VDPH 1EO8H 4HIXH 5GJSL 4JDEA 4PLNC 4N5UA 4W9FC 2ITFA 2GQHA 4CRPA 3H9HA 2DWDB 4M9PA 2EVIA 3EBHA 3I9PA 4I1RA 5GQBA 3NJLA 4GQ9L 1BZ9A 1FV1B 3DX3A 2CKBL 2X3BA 2HMID 5I73B 4OFVA 1KPUB 1PZCA 5LGJB 5IG7A 2GEQA 4HUWA 1HT6A 3BO8B 4P59H 3BSZA 4NZUL 3NSYA 1DVTA 2PTUA 4QWWC 3K74B 4S11A 2FX8L 3F64A 2Y5TA 2L8AA 4UTAA 4LGRB 1I1FA 2F2HA 2HUEA 3OSKA 4HC1H 1IBYA 4JHBA 2NQ3A 5EN2A 1BGXL 3LEXA 3SKMB 2Q1EA 3AGVA 5DD5H 5EIQA 2BY3A 1AR1D 1O6VA 1KJ3L 3WCYA 2QZQA 2PKDA 3GB7A 1UKQA 3MTXA 3CZLA 4JFWA 4KI5C 3QULB 2OS7A 2LFEA 3DOHA 2V2WB 5IB3B 2J73A 4RIRA 1F18A 1OPGH 1PQZB 2OXGB 3DXAE 4M03A 4X6DF 1SVZA 2EVGA 5K59E 4MTMA 1W72B 2DJ4A 2A9NH 2A9BA 3QDJA 4XVTL 4J12A 2FGWH 2UZIH 5HHNB 2F7RA 4MDRA 1O7SA 1ZDQA 2B5IB 1ZTXL 2E7HA 4GMSL 4PP1D 5KS9E 5ISZD 2DQTL 2DMGA 1KCKA 2OMXB 4YFLI 3ZL1A 2IF7A 3B9EA 3KS0J 2VB5A 3QDHA 4KUZL 5IWLA 3GEFA 5EO9A 3B9KD 3IDJB 1KBVA 2OMVA 4BV1A 2YXWA 2IGLA 4M5TA 3HNVH 4AYGA 4F8QA 1CE6B 3F85A 5IFHL 4X0KB 4U0RB 3I9IA 5ES4B 4KRPC 4OD3L 4ZUWB 4P5TC 3L5WB 4WV1A 4EI5C 5DLML 4WWKC 4BUHA 1ZS8A 1OGAE 1XTLA 3KGRA 2DZEA 4LCWB 5T3ZL 1OM3H 5KVDL 2YOAA 4YPJA 2NX5B 1U92A 3QORB 1P69B 3GO1H 4IDJH 4J3UA 1GGCH 4IBQA 1TNMA 3UAFA 2DBLH 4DOHE 4QYOA 4M93B 2GIYA 4U1KB 3TA3A 2EDWA 5AVQB 3OSVA 1X3DA 2YLKA 4HJ1A 4BQ6A 1HOEA 2PNDA 1QLEH 3VXUE 4LCVA 2Z8SA 1IAKB 5J6GB 3E9UA 1OGSA 4TNVK 4BELD 2OSXA 4OLWL 4LRIA 1FFOA 1ILUA 4TQHA 4XWOC 1U3HB 3P9LA 4APXB 3K6SB 1ZHKB 4HS6A 5AVVB 3WHE1 1A14H 2WLLB 2EXTA 4AT6B 5JHDB 5G2NA 3WMQA 2FATL 4S1DD 1JZ4A 2JE8A 4X5WB 3EO0A 1Z0MA 4ZUUB 1E4HA 3E6FA 2OJEB 1CDBA 1U8QB 4A2LA 1DJYA 4ENZA 3AVEA 4ZMPA 5I1AA 5JNYB 4QXUH 3FK3A 4HX1B 1U8IB 1N5YH 2N7AA 3LMJL 5HPOA 1NGXB 4OZIE 3ZR6A 3CZGA 3P4NA 4H25A 1PGRB 3KYNB 2XRAH 4JN1H 4U1JB 1KCSL 2RCSH 3LZRA 3DROB 5HTSA 3WO4C 3MGAA 3MRQA 1OSZA 3GXDA 2GIXA 2GSGB 1YEWA 1HIML 1OOWA 3W38A 3OAUH 3BAJA 4XX5A 1R5WB 2A74C 1T5XB 1DQJB 3PGFH 3E2HB 4XC3H 4HMEA 1JHTA 2Q7AA 2OMUB 4G1MB 4JY4B 3RX7A 4XCYA 4NAQA 4QRRD 3CLFH 5I5JA 4ZI8A 3H9SE 4PGCB 2NXYD 4UT6H 5B7FA 1TYEB 2G2NA 1GGBL 2XWBB 4OJYA 4OKVA 1DL7L 4OU3A 4NPJA 2UZPA 1VZIA 5BW7C 4DF9A 3UAJD 1BQKA 3N9GL 3C5ZC 3B1UA 4D8PA 4E9TA 3NN8B 2QMJA 3B4NA 3MBED 1UG9A 5HDQL 1LEIA 1NC4B 4ZAKC 4QHMB 2L7JA 4GXUN 4UIMB 2V2XB 1YQVH 4I2XB 2WZAA 3QIBD 4L2YA 1OHQA 1WBZB 4XB8A 3UEZA 1I1YA 1SHXA 2OZ4L 2DI9A 1MAJA 3GSOA 3IWVA 4JRLA 4N0RA 2F7QA 4PV8B 5M7QA 2ZPKH 2UVEA 2ED7A 3NJHA 4AJYV 5EWIL 2X6VA 2D3LA 1OT2A 1EFXA 1WAPA 2BZDA 3DIFA 1XGTA 3P4OB 4WO4A 4DGWC 1OTUC 4H26A 5ALCL 2L3BA 3NTCH 2IOMA 4JZJA 2BINA 2BRRL 1BX2A 1OP5K 4WU7B 5J11B 2X89A 5EZIL 1ZOXA 3EOBB 4W9CC 4F37F 4EDWH 5HYEA 5FUZH 4N20A 4IEFA 1QBAA 1NC2D 1DQKA 1DJGA 1EZLA 5C07E 4AQ1C 2G0KA 4MA7H 4ZMNA 3MACL 4A68A 4WI0A 1MCWM 5JORA 4S1SH 5ANHA 4IHOB 1DR9A 1MREH 2D7QA 4XVOA 5DHDA 4K23H 4EN3C 4HVBA 1N0LA 4O58L 1FDLH 1OSPL 4TOYL 4FQIH 1WV7T 3GDCA 4OGXH 2EE0A 5IROC 2A5UA 5C0BA 3VFWA 1VRSA 3U4KA 1YEJL 2X2UA 5I75C 5KJRH 1NFDA 5DS8A 3FBQA 3D33A 1UXLA 1JF5A 5E6IC 1SN5A 2J1KA 3BVNA 5I1CL 1Y7VA 3CSPA 2WMPA 1E43A 3CFNA 4PJAA 2DW5A 3VWJA 5I1IH 4LLVB 1WC7B 5DHMC 1A6AB 2GK2A 2WM0A 3C2AL 3BVTA 1L3NA 4NQTA 3B6SB 2IQ9L 1INDL 1MCDA 1NGQH 4OLZL 3W9EB 4L8DA 3O4LA 1KDJA 1QEXA 2LAGB 4X8CA 5EIVA 3U48A 2EICA 4P0DA 4F33B 3PLYA 1TVBA 1Y1UA 1RK7A 2ED9A 3LKRB 4E5XA 3S35L 2K45A 1JXDA 3B3BA 3MNWB 1KFGA 3WIFA 4PRDA 2XSKA 4XBGB 1T0PB 4R0LC 1BAFH 2IG2H 3G5ZA 4HCFA 3KD4A 3DWTA 3BN9D 4LSUL 4EEEA 3HHMA 3WTVA 1XF1A 3QDJE 1GZPA 1JWSB 2AJYH 4XMPH 1UQSB 2ZYRA 2G5UA 5I0XA 3W5MA 3TN0D 1FH5L 4U31A 2XQYG 1QVOB 4GSXA 4N8VG 4XWGH 3T65B 1E6OH 1FPTL 2Z6FA 3FFDB 3FOLA 4E9XA 1G7QB 1GGIH 5CD3A 2QSCH 5IUCA 1AYRA 1U2CA 1SEQH 1TETL 2Z31B 5GRVL 3EO1B 1O5DT 4NQVA 4E42B 1S78C 1HXMA 3AS1A 4WUKL 4X6BA 4D94A 2WOBA 1C5CL 3C08H 5FGCE 1BVZA 3F00A 3LRSB 3FB7A 1EANA 3VXSB 5D1XB 5GZND 3E6HA 4Z7OE 4N90E 3B2MA 5DD6A 2P45B 4JO3L 4QF1B 4F8NA 2VO8A 3ATFA 4Z3JA 4MD5B 4HZ1A 4ACPA 1HYSD 4LDOB 3PJLA 4LVNC 2LTQB 4XNMA 3UBXI 5DS2A 4HGMA 3QJZA 2F19L 1I7UB 1JBJA 2BMKB 3NK4A 2Q2LA 3F58L 4ZS7H 2NR6C 2FUTA 1KY7A 1NLDL 3LVEA 4GRLD 5AVYB 3SEPA 1BEXA 5MP6H 4JRXB 3QO1B 1YG9A 3FB8A 5I73C 4BSWB 4C8XA 5I17A 5K1NA 5EF3A 4TSBH 2J2ZB 4R84A 5DUJA 4X5XB 2F74A 2CA4A 5CZXD 5DJ2A 2FR4B 4F27A 5KYUA 1QRND 5E4OA 4H1LB 1AGFA 3Q6FA 1ACZA 1OZTG 2OXHB 2GITB 3EJZC 3LQAC 4M3HA 1UA3A 1YMMB 2ZOOA 1MJ7L 4ENEC 3EBIA 4Y16B 5JDSA 4DO6A 4WWID 1XSJA 5C0EA 4HG4J 1W8OA 4HS8L 3QUZD 3O6FB 5C0ND 3HI5H 2ZSVA 4MMXA 4FG6D 4GBXD 2J6EL 2DOCA 2QBWA 3TCLB 1F3JB 3VQ2C 3DGGA 2I60H 4N2CA 3L7FA 4AGLA 1WAAF 5DFAA 3QEQA 3P30L 3SBQA 2QLYA 5FDWA 1F90L 1XD1A 5I19L 4RMRA 1XH3A 2NYZA 1ZKAA 1BQLL 4DKAA 2XXFA 2B5IC 4HPOH 4Y19A 4AQEB 3GIZL 3LKPB 4MD0A 4O4YH 2OQJA 2DWSA 4IGBA 5ERWA 3SGKC 2EDBA 3IPEA 4IMKA 3BRGC 2QVTA 2J57A 3HZYB 5HP5A 2CMRH 4XP1L 5EUKB 1BIIA 3KPNA 3NFPA 4U0RC 4LHUG 5J1TC 1IQDB 4JCLA 4LARH 3KR3H 2PR9A 3CFKB 1XGYH 5GSVA 2OL3L 4ZW7A 4XNAA 1CG9B 2GK0A 3ZTJG 5GISL 1N4XH 1IEBA 4L4TA 3QORC 2CU9A 1JWMB 4UQBA 1TFPA 1B0WA 4RH4A 2DQEH 4RFOH 4JRYD 1MPAH 4M93C 4M6NL 1HE7A 4TUKL 5HYQB 4EVNA 1ADQA 2YGOA 3TIEB 2FECI 2R4SH 5LB1A 5TF1L 5IB1B 3L3JA 1X5HA 2VQUA 2QQNH 4J6RH 4ERSL 1UUNA 1W0WA 3MUGB 3ULSB 3ZE1E 3ZHKA 2K78A 1G7HA 1KIPB 4M7LH 2JK5B 3MNVB 3DJ9A 3NSJA 3QXWA 5C09A 1FRGH 1DFXA 3U9PL 4LSQH 4EIUA 1U3HC 2CHNA 1HQ4A 2EECA 3QC6X 1PJWA 2X0VA 5ICYA 2IH1B 1TR7A 3LPPA 1D7BA 4LLDB 5F1IB 1QW8A 3BUDA 3MU3A 2V2TB 2FYYA 2AXFA 4N5ED 3REVB 3JUYA 4R5TA 3RWEB 2HVJB 3I6KA 3LKNB 1NOLA 1KZYA 3FUHA 4HFUH 3VWKB 2W5PA 3GMRB 3CV5A 4O5LL 2PN5A 4NIYE 4OF7A 5C0BE 1ZY9A 3W11D 2UY7A 3IDXL 5GS0D 2EE6A 3LNGA 3LDBB 1KYFA 2XWJA 2J4WH 4FRWA 1NFDE 5IR1A 3ZQXA 5JPNB 3TF4A 2CJTA 2DYPB 5TDPA 4I8DA 4P4KB 2V7NA 4N2DA 3KL3A 5JHMA 2Y6SC 4NXKA 5E2UH 4I77L 2XIIA 4QRPD 1MIEL 3FO2B 4HKXA 4NJAH 2IMMA 1B6UA 2XUWA 4BK4A 4KVCL 3OL2A 4PJAE 3SQBA 2G9KA 4BZ1L 4O00A 2XC8A 5EZLA 3V4VB 1NLBL 1BZ7A 4JM2A 5I8EA 4BZYA 3E2HC 1DLHB 3T3MB 1ZLSL 4AV5A 2ISDA 2IH9A 3WIHA 4HOMA 3K6NA 3GJFH 1ZLWK 3W37A 4KJPD 4AQOA 3O4LE 1SDYA 4QOKB 3QZWA 1MIML 3RU8H 2NNAA 2MCG1 3WGUB 2IWFA 3ZMRA 1L6XA 4BRVA 3MROA 5DC4B 1O6TA 1NCBH 1X9LA 2ZCKH 32C2A 2W94A 1J12A 3C60B 5D2NB 3UJIH 4Y7MA 4FNPA 3ZHNA 3GFUA 1MELA 3EH5B 3LEYL 2HLFD 5IKCB 3E38A 1NCCH 2W38A 3H53A 3MRCB 4R83A 3UEQA 4BCYA 3RVTD 1JNNH 4R2GD 1K5WA 1UB6B 4J1UB 5BRZB 4P2OA 1V7NH 2X0WA 2B1HL 2ZT9C 3DOSA 3WIIL 1TYRA 1CZ8L 1AE6H 5D4QA 4UTAL 1M3IA 3D39A 1QI5A 5ILTH 4X4ZA 4EIZC 2W60B 4L0PB 4LOEA 5JO5A 4N2NA 2OSYA 4KZCA 4YLBA 4HEPG 4XPFL 4YK4B 3TX4A 3ULVC 1C5BL 3FRUB 2QGEA 3ZL2A 3RTQD 5K59F 2ZG3A 2E6PA 2IDTA 2QGDA 1P4LB 4K9EH 2A7BA 5KVFE 4KDTC 1MCEA 5D2LB 3N3EA 2DLIA 1A1NA 1BD2D 5LJYH 1BQRA 3G9VA 3KLKA 4AIZA 4B7IA 4Q2ZB 1YCSA 4L9DA 1UKSA 5KS9F 5SV4A 5EU6D 1BQ5A 2VMCA 4TPRL 3FCSA 3MRJB 3PWPB 4X5LA 5MEOA 1ORQB 3D4CA 1FIEA 1XR9B 3S37L 3SY0A 4Y9EA 5F1SA 1R47A 1A4CA 3QEGL 4OJDH 4U4BA 1ZLUK 5FB8A 3GUTA 3V4LA 2FIKB 3QI9A 4JY5H 2UZYB 1FO0H 2Y07L 2C1PA 3QG6A 4TRPH 1YNLL 3DPBB 4ZFOB 4C83A 4XBPB 4NCC1 2BVQB 3HW7A 1M05A 2FB4L 4WFGE 5JR1L 5E5MA 1JZ8A 2Q76A 2M2DA 2VC2H 4I87A 3ZT5A 4YVNA 1JV5A 4JHAL 1CDYA 1HH6A 2ZG2A 2I7OA 3AXLB 3KG5A 3O0RL 2JB6A 2W8CA 2NY1B 3QQ3B 1RUKH 1MCKA 4GB9A 5E00A 3SDDB 4BIKA 3RLSA 5L4IA 2ZKWA 5HYSB 2VH5L 2C26A 5L2KA 3KDPB 2HFTA 4PBVC 4A2FA 5DMIL 3QNZA 3QZLA 5DLLA 3WUWB 5CFHA 3FSZA 5L88H 2W9EL 3BUIA 3ZKMC 3OKKA 4XXDA 1MHHB 3UBXB 2ZF9A 2B2XL 1FJ1A 3L3HB 3MVSA 2Q8AH 1YJDL 3KVPA 2APBA 3A5VA 4HIJA 1Z9MA 4PV9B 4YDMA 5TPWH 1TQBB 1GOGA 3QEQE 4G1EB 4AMKH 1Z5LA 3U1QA 3VRLE 1CD9B 2NDFA 4HA1A 4W6WB 5D7LD 3FUFA 1G7MB 1J1PH 2VSKB 4Y19E 4FNLH 3KPRA 3T0ED 2WYZA 4PRBB 3TT1H 1FYTB 1WUNT 1BAGA 3MRNA 3C9NB 1A3QA 3C2SA 3FQRA 3BDYH 1FIGL 3KXFA 5K9QI 4OZIF 4Z3GA 1FI8C 5IMOB 1JI2A 3QC5X 1D9KA 5IFJA 5C0FB 3B2UC 3H56A 4KKAD 4OZGB 4E2OA 3DHJA 5H2BB 3P4MA 1CK0L 4FQXA 3T2PA 5SWZA 2QL1A 4LFHG 2B4CL 1JHKL 1RZ7L 1EZSA 5MEQA 1Y0LA 2F68X 4QKTA 5AD0A 2A73B 1A4JB 1U91B 5D1XC 1LM8V 4P46B 4NO5B 4Q0XL 4ONOA 2JTYA 4L4TE 1N64L 2CGYA 4IDLA 2R39A 4LNVA 1C8PA 1TOXA 2GHWB 5ANMB 3N85H 1JCKA 2X4NA 1M2VB 1MWAB 1L0YA 2LTQC 3FFCA 3QEHA 3CC5A 1M3JA 3SDYL 2JTDA 4Y4HA 5JLZA 4D9RD 2QZ5A 1RK0B 3H54A 4YBQD 4YSPA 4B0MB 3CXHJ 4YHIA 4KVNL 5C09E 5K9QG 5D7JD 3ARGB 3KBHE 3OAYH 2DV6A 1IT9L 4KXBA 3OPZL 4M1GH 3EDFA 3V6ZB 3FBKA 1JCVA 3BD4A 1OWRM 4JQIA 2H0FA 5LUMA 5A3ID 3GTTA 4C4BA 4KNTA 4Y9BA 2NSMA 2XN9B 3T8XB 2WXJA 3NQIA 3PCYA 4BFEA 1FVCB 3MLSL 4ONHB 1OW0C 2DQJH 2YUWA 3BWAB 4YHKH 5I71B 4X7FC 4MS8C 4ZSOA 5IHWA 5JYMA 1BFVH 3L48A 4MLIA 1QSEB 1W2KT 1ZT4B 2IDCA 4JKLA 1PDKB 7PAZA 3REWA 1UWEL 4QMEA 1MLBA 6PCYA 3LV3B 3MMEB 3VCLB 3D69B 3HHSA 5DHYA 3F2LA 2NY0B 2B0SH 5J6SA 4G2AA 1CYXA 1S7SA 2BVPA 4JFPA 1DQLL 3W39A 2HT2C 2EEBA 4HV8B 4U3CA 5CSZA 5C2BH 3KLLA 4PM1A 2WSDA 4YBHA 1OP3H 3RUGA 4NZRL 3SJVD 5TE6H 2KLSA 3CDZB 4JCMA 5F7UA 4YHOH 1G6RH 1FZOB 5I1HH 3IJHA 1HZLA 1O0VA 4LNRB 5JIDA 1ETZA 3MLXL 1P4IL 1B0GA 1OALA 3MI6A 3PAYA 4BSJA 1HL4A 3J7HA 1EK3A 1IFHH 3DPDA 1N6VA 1S9VA 3BPNB 4PWGA 3NCYS 1FZMB 3K2IA 4FI6A 3TNNA 3BGAA 1CGWA 2QHLA 4P2RB 4N2HA 4Z18A 1ES0B 2OM5A 1G0DA 1X7QA 2H3KA 1NSNL 1XCTA 2R51A 3DUSB 1RURH 1AQKH 4H88H 1RUML 5HJ3B 3VNYA 4WF7A 4BD4A 5E9NA 3D39E 1IQWL 1MCCA 2PMZA 4OFYD 3LPWA 3OKEA 3RGVB 3LKSB 1SFDA 3KCWA 5INDB 3VYNA 1G9ML 4GAGH 4U3HA 4DGIH 2JKJA 4AWJC 1NMAH 2VDKL 3BIAX 1LEKB 4ZMWA 4XT1C 5HGHB 1TNNA 5DUMH 2ADGB 4PWHA 4YQXL 2EDQA 4LIQH 5DVMA 1UD3A 3QCUL 3CQQA 2I25N 4OR1A 1I8KB 3BH4A 4PGBB 4OI7A 3H9SD 2AK1H 2APWA 3IMVA 4G7RB 4FYRA 4WUUB 1AMXA 4PJEA 4LL1A 1Q9LA 4HKBB 2YXFA 5EH1A 5EEXA 3VWKC 5EC2B 4ADJA 4NGHH 4MASA 1KYOJ 4UBDC 1R5IB 5F7EH 1BP3B 2BSDA 3LAFA 1CFVL 3FU0A 4PSRA 4KKNA 4P4KC 5F2FA 4B27A 1SYVB 4P57A 1T2QH 4P9HC 2AAAA 3U4EB 4KTEL 3H85A 5E2WH 1Y18A 2V8MA 4QIRA 1UA7A 4N28A 4CVZB 1K2DA 3OXRA 5KVFL 2J56A 4NDMB 1SGKA 2GC7C 2VLKB 5EOQH 5C0DA 3UTQB 3DMMB 2OBGA 4CDGC 3PS6A 4N25A 4NN7B 4MDIA 5L2KE 4ABQA 4BDVB 1MFAH 3U6RA 3L1EA 3RVVC 3BD5A 2XG5A 3SE3A 1AQDB 2XWCA 5GRWA 2DTSA 2LLNA 4KAQL 1OP4A 2ODHA 4HKJB 3C60C 3PWJA 5C07D 3UTSD 4GW5B 5D2NC 5DFWH 2PUQT 3RIAK 1JS4A 2IFFH 3K2UH 3LPOA 5TQ2L 1PZAA 1NBYB 3GPEA 1JVKA 5IV2B 3WL9A 2VLRA 3TZVA 1FL5B 2OFQA 2X4RB 3KPRE 2CIKB 4Z0BH 1SXZA 1A6PA 1Q0XH 4ATWA 2ARJQ 1K4CB 3IXTB 4AIEA 5C08B 3KXFE 4M7JH 1EDQA 1WE5A 3ATEA 3M1BB 1XHHA 3VW3L 4OCRL 1RZJH 3ZYIA 4P5TA 5TGBB 5KW9L 4NBZB 3NIFF 3FSVA 4WWKA 4BFFA 1J86A 3FOMB 3TJEL 1NINA 1GAFH 3S96A 2CIIB 2YLHA 5SWZE 4XVSL 1QLRA 4YK4C 5BNXD 2FLBT 4ABUA 2F7IA 1P5UB 5FA3A 4LU5H 3V0WL 3ZRFC 2XWZA 3HE7B 2EUWA 2RACA 2R9HC 4NQCE 2KZKA 5G4NA 4I13B 3NK3A 1GMEA 4G43A 2X70B 1KB5A 2WN2A 1E9OB 1FBIL 1CL7L 4CC1A 3KLQA 2MQCA 1NWOA 5BJTB 4C56A 4PREA 1IAIL 4J3VA 4TVPD 3FFCE 4GOSA 3EG9B 1MH5A 5GHWL 4G7YL 2AJXL 2WXOA 5GJSH 4JE4B 4YHLL 3ATBA 1Z9SA 1H6UA 1SY6A 5EBMB 5CILL 1XGQA 3KBPA 3CHXA 1CFSB 4GQ9H 1HDMB 4PJIB 3WJJC 4WI2A 4Z7UB 1HCZA 3GGWA 4H5SB 5ITBL 4MD4A 2P5ED 4W4NA 2CKBH 2IQAA 1MFBL 1T4WA 3T2NL 4U6HA 1MVUB 4DFHA 3SOTA 2RGSA 4DQAA 2J1WA 5C7ZA 3S9DB 4A67A 2DL9A 2ATKA 1EBAA 4NZUH 4DP1X 3FRPB 3PHSA 4G6AC 3GSRA 4XOEA 3CZSA 3QAZB 2FX8H 1H0DB 1YHPA 1SDDA 2G75B 2VISB 4OIFA 1G1OA 1Z5HA 1ILSA 4LOUC 2CK0L 4D0CB 2NY1C 3SDDC 3TH4T 3V5KB 2X5PA 3FH5A 3ZE1F 2OMWA 4Y4FB 4ZSOE 1PEZA 3FONB 3SQOL 5BVJA 3FQTA 3SDXB 2VXSL 2HT3D 1DVSA 1KJ3H 3K81A 1THAA 3HR6A 2FJGB 3FB5A 3NCWA 3LKOA 4G9DB 2YKKA 3DHMA 4PW4A 2A74A 3SPVA 3TBBA 2ZXDA 4PRHA 3TBSA 2OJ1A 3PHAA 2GUYA 3SO3B 5CMAA 5CEYA 4LL4A 2EVHA 1DJSA 3FKUS 3WNJA 5KN5B 1LVEA 3HAEH 1BVNP 4JO2L 1MFCL 3T2OA 1CXFA 3NJVA 1BOYA 4XVTH 2G5RA 5BW7A 5BUGA 3RUGE 2EEAA 4OCSL 3D5OF 3CZFB 3C5ZA 2OTUA 1ZTXH 4D9QE 1SEBA 5D6DC 1INEL 1NFDF 3EF4A 1AGEB 2DQTH 4ATTA 3UZQA 2PPEA 3SYAA 3MRGA 2EEDA 3IDMA 4KUZH 4ZO9A 5LNDA 1PYWB 4ZAKA 1KLGB 3RWIA 4XNZB 5TD4A 5C9JB 5I1EL 3WKNA 1CXKA 2F53A 2XKSA 5IFHH 3EYSL 3OKLA 5B39B 4CC4C 1SM3L 2KS0A 4YL4A 4MQTB 3VG9B 5ID0A 3IVKB 4OD3H 4WWOA 3SIKA 3P40A 4P5KB 5T1DL 5DLMH 4NAJA 3FH7A 4X42A 5T3ZH 1RIUL 3AZUA 4XPGL 5GS1B 5KVDH 2LABA 4RGND 5E24E 2IFGA 5EEVA 5I6OA 2UXFA 2D4DA 1MWOA 3MV9B 4MB1A 4OTXH 3RI5K 2R1XA 4OIAA 1SJHA 1RPQA 2MRYA 4H0GA 5ABZA 1UFGA 1H3XA 5ELIA 1WTLA 3BIBX 1K5NA 3QZBA 4FKHA 2P7TB 4KJQC 2YFNA 3ARGC 4M6AA 4NT6A 3TP4A 1E9QB 1RZIA 4OLWH 4HBCL 4FJ6A 2GJRA 5GRYA 4EN3A 3UJJL 2JKIS 2PW2A 3KPMB 2FATH 5ID1A 3RWFA 3V0FA 3B34A 5IROA 4NYLA 4PJEE 1CE1L 3CN1A 1GXEA 1X44A 5JHLA 5F7AA 1ICTA 3WEXB 2CO6A 3QJUB 4IK6A 3Q8EA 4F2MA 3X2QB 3NQKA 5I71C 5CN2A 3TEYA 2NQCA 3G7TA 5E6IA 3LMJH 5CLZA 1BZDA 2Q8BL 1S7RA 2X28A 5KYWA 2XJLA 3OWRA 4IBVA 4FTVB 1KCSH 4L3CB 4WW1A 4NSKA 1LHZA 1JWUB 5EU5B 4D9LL 1D7FA 2NY0C 3MLYL 4YZFF 3NZ8B 1PW3A 4V1DD 4Z76B 1HIMH 1K8IA 5IHBA 3ABMB 2GI7A 1WAEA 2HH0L 4WK0B 1YN7A 4KI5E 3LH9A 4WJ5B 1LEGB 1O6SB 2NLJA 1GGBH 3QDMD 4Z0XA 1DL7H 2KUTA 1J9SA 1FZKB 3GMQB 1J05A 4NLAA 4R0LA 3R1GL 3DTUB 3GRWA 4KX9A 3K72B 4LBEA 4DZ8A 3N9GH 1QMUA 4BQCA 3BPNC 3W56A 1EAPB 4MSWA 1BG1A 1SYSB 2FJHB 3MV11 1HH9A 4ODWB 5HDQH 3VAEA 5F7DB 1ACXA 2LHAA 3L3OB 5AB2A 1T4KB 1DVFC 2VLRE 1FORL 3L13A 4G8IA 3MRIB 4HD5A 2WZPA 2OZ4H 5LG6A 1T21B 1YY9D 1C16A 4GLRI 3SGEH 1TSRA 1R4XA 1F11A 3GSQB 1EEZB 2H26B 3R8QA 3RGVC 4Y5VA 5K9KB 3HR5B 3GSXA 1T04B 4MA1B 5ALCH 2VDOB 2UX7A 4WNQA 1HINL 2BRRH 3UG4A 1HZKA 4YUEL 1L4IA 3WY4A 2WWMC 3FQXA 5EZIH 5HXMA 2DIJA 4AMXA 3U7AA 3G6JF 4MNHA 2C3GA 5DJYA 2BNRD 1S46A 4S0SD 1KLUA 1U8PB 4WI4A 4C56E 3BQUB 1BV8A 1ZA3B 2DWDA 4Y1AD 2QDVA 1U4EA 4AI7A 3MACH 2NR6A 1CDJA 3NZUA 4ZDHB 2GW5A 2JCCF 2LR4A 4O58H 1OSPH 2YEVB 1NGYB 3M8OL 4QT5A 4TOYH 3TBCA 4XO3A 1KPUA 3D34A 4YDJB 5IQ7L 2HVKA 4UM8B 3O0LA 5HVWA 5ISZB 1YEJH 4LB8A 3KHQA 4YGAB 5D4HA 2ITCB 43CAA 3OKOB 4G5ZL 5SX4H 4NHUB 5DUBB 1AACA 1JK8B 2VN3A 3SKMA 4N2IA 4OM0L 3NRQA 3C75A 3QFGA 1YQ2A 1FNHA 5KBMA 1H3PL 1KPVB 5A6LA 1IUZA 4LKCB 4XVUC 3UOAB 2D7MA 3DX8B 5BV7B 1JGDA 1ZPLA 2G9HA 3DMMC 3R19A 3C2AH 4NENB 4L0ZA 4F3FB 2D2CC 5D4JA 2O5NA 1DCEA 2CHZA 4NN7C 5JIKA 4UNVA 2IQ9H 1INDH 5IB3A 1LWRA 4MFHA 3KWWB 3NIGB 4OLZH 4TLSA 4LPTA 1PQZA 2OXGA 4W4OC 2GY5A 3S35H 2XPYA 4ZMQA 3ZTCC 1HWWA 1ZVSB 5HHNA 4X4XB 5K69A 3S3DB 3U7YL 1BWMA 1FNEB 1REIA 4GNKB 3RNKB 1S7WB 5DJ6B 3ROLB 3DX0A 1RVFL 1NGZB 4L3ED 4LSUH 4LLMA 3GMOB 3SGKA 5L9DL 2ZF8A 1TTFA 3D4YA 3IDJA 3U1SL 4B9GA 4JQIL 2VL4A 1R3KA 2X6MA 3DUUB 1FH5H 1YY8B 1OE3A 3P3SA 1FPTH 4ZUWA 4P2YA 3L5WA 3SCMD 1TETH 4ORGA 3UG3A 4KJWD 2F53E 3OXSB 3CG8A 3PDDA 2NX5A 3CDGB 1HU8A 3QORA 4OQTL 1P5UC 4WUKH 3R0MA 1CI3M 4N2KA 4X9BA 3V4UL 1C5CH 5JDJA 3HE7C 3MTRA 4MJIA 3FU6A 1B90A 4AVIA 2YN3A 3IEAA 1H8SA 3UP1A 5FYKU 1J8HA 35C8L 4A2MA 1SHMA 5HI5C 2R4RL 3ASOB 4QEGA 4KV5F 4XMLL 4JO3H 1KTDB 4OJEH 1IAKA 4NBYB 4BWUA 4JKKA 1D2PA 2Q7YA 4UTCA 3BRFA 1MFVA 1CMOA 1OKEA 1NL0L 1BVNT 4Z3EA 3PUCA 4QRRB 1U3HA 1JE6A 2F19H 4I1NB 4APXA 3K6SA 4YO0A 3BISA 2NXYB 5JHDA 3F58H 3L4WA 2JIXD 1NLDH 3EADA 3OAZH 2C8NA 2L04A 5ACZB 2KPNA 2W92A 3AAZA 1N2RA 3G6AB 2VERN 3NRFA 4GXUM 5HGGS 2IDUA 1AQ8A 4FA7B 4GIPD 1U8QA 3LKQB 3KDMB 3U0WL 4M3KB 1FFNB 2E9BA 1DE4B 3QAZC 4DCQB 1T3FB 5EDXA 1U8IA 1F97A 1NGXA