1IBHA

X-ray 3d structure of p.leiognathi cu,zn sod mutant m41i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGIHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ibhA00
4N3UA 4U4IA 2K4WA 1SRDA 2AQQA 2VR7A 1UXLA 2AEOA 1BZOA 3L9YA 3T5WA 2GBTA 1F18A 1N18A 4A7TA 2C9UA 2SODB 1CB4A 1IBFA 1Q0EA 1YAIA 3H2PA 3CQPA 3GZQA 1OEZW 2E47A 2LU5A 1DSWA 1ESOA 2ZOWA 4L05A 4BCZA 1HL5A 2Q2LA 3LTVA 1N19A 1PZSA 3KBFA 2AQSA 4A7GA 1JK9A 4A7GF 1E9OB 1FUNA 1YAZA 3L9EA 1OZUA 3GQFA 2WZ0A 3ECVA 1B4TA 3K91A 4A7VA 4FF9A 1U3NA 4MCNA 2APSA 1OAJA 1AZVA 1CBJA 2AF2A 1EJ8A 1SXSA 4MCMA 1XSOA 3ECWA 2WZ5A 1JCVA 3GZPA 3S0PA 1EQWA 3RE0A 1SDAB 2Z7WA 2JLPA 1L3NA 3GTTA 3CQQA 3PU7A 5KBLA 3ECUA 2Z7YA 2VR6A 3F7KA 4BCYA 1UXMA 1E9PB 2WKOA 2JCWA 2C9VA 1E9OA 3KBEA 3KH3A 3H2QA 2C9SA 1F1DA 5KBMA 2NNXA 2Z7ZA 1IB5A 3GTVA 3SODB 1COBA 2GBUA 2V0AA 1DO5A 1E9QB 1S4IA 1F1AA 1Z9PA 1TO4A 4A7UA 2GBVA 2R27A 3QQDB 1XTLA 2WYTA 3GZOA 1OALA 1Z9NA 1SOSA 1IBDA 1P1VA 1PU0A 2Z7UA 2AQPA 2WZ6A 2XJKA 2AQTA 2AQNA 1YSOA 1SDYA 1KMGA 1SXAA 1F1GA 1QUPA 2E46A 2WKOF 2XJLA 1E9PA 3HOGA 1TO5A 2VR8A 3KH4A 3CE1A 1B4LA 1SPDA 1XTMA 5KBKA 1IBBA 1OZTG 1SXBA 1IBHA 2WYZA 3MNDA 2ZKWA 4B3EA 3F7LA 1MFMA 2ZKYA 1RK7A 1SXNA 1E9QA 4A7SA 1PTZA 2AQRA 3QQDA 1SXZA 3HFFA 4N3TA 3KM2A 3KM1A 2WWNA 4OJAA 5CU9A 4A7QA 1JK9B 3MKGA 2WWOA 4BD4A 1BA9A 4OH2A 1HL4A 2ZKXA 3HW7A 1SXCA
chains in the Genus database with same CATH superfamily
3NSYA 1DVFB 4DGWC 1P4BL 2Q8AH 5TH2A 3VI3F 2CCVA 2NY2C 3PPEA 4LLUA 3VWKD 2L04A 2BINA 5EUOB 1U0QA 4E42A 3UBXB 5JOPD 2F7QA 2WVTA 3E8UL 4ALAL 4G7VL 3HRZB 4UTAL 2DWSA 1Q0EA 1ZGLB 5IB3B 1XSKA 3N91A 1ZVNA 3FUJA 1KPVA 3MRPA 4ODUB 5I16B 2R4SH 1DUZA 3GMOB 4XXWC 1FP5A 1MHCA 2EKSA 4UAHA 4NN7C 2IANE 2CRIA 3S36X 3QIWB 5FA3B 5L2KD 1KCBA 1NDTA 2W9EH 1A7NH 2EE0A 2ZIDA 4H8PA 2NY5C 5JA9A 3LCYA 3QO1A 3TV3L 4LXFA 4WU5B 1OAJA 2J8OA 3BWUF 3ILQC 4MZRA 4HJGA 2V7HB 3RX8A 1B0GB 1NCWH 1QRNB 1XGUA 2EDJA 3EOBA 4PJCB 2HN7A 4NC0B 4AYGA 3DTXB 3R18A 4PI2A 2WBJD 3E1F1 4LPVA 1R3LA 3KPMB 4EBQH 3CXDH 4FFWD 3D34A 4AVHA 4WK4B 1JP5A 1XR8B 2EDRA 4QRTA 3ZHFA 3RPIA 2HLAA 5GZNA 5JIQA 2BXZA 3QDME 5LNDA 3VACA 2DLHA 3TNNA 1CYXA 3NJKA 3FQRB 4LL1A 4Y1AB 5CP7B 3UCQA 1CURA 5DYOA 5FDWB 1ROCA 2E7MA 5GGUA 2J57A 1PIFA 1PLBA 1DCLA 1CVSC 1QYGL 4CVUA 4KJWD 9CGTA 2WBKA 1NDMA 1VKXB 3LDBB 1NTDA 3TFKC 2AAVA 4AJYV 2DM3A 2EADA 5SWZE 3WFHB 1FNGB 1DCEA 4MFHA 4BFGA 4KO6A 4UOW0 1FLRL 3BOVA 3CSPA 1JDAA 2NR6D 3BH8B 1IBDA 3OKKB 1XDTT 4ZJ9A 1GW6A 1ORSA 4Y5XB 3N85L 2FHBA 4QRPE 3EJJX 4P5MB 4Z77B 3ZIYA 3NN8A 2A74B 4FTVA 1L0XA 2R2HB 1RIUH 3QULB 1UWGH 2IADA 3LHPL 2HVKA 2BVOA 3SKNA 1A65A 3LEYH 2P8PA 4JPWL 4J3BA 3WMQA 4OM1L 4UT7H 4CSZA 4I85A 4LHUD 3WIHL 2ZXAA 5KWYC 5BUAA 1GH7A 5JIDA 3C87A 3ASNB 5EBMA 4Y9BA 4YEFA 2IAND 1OT1A 5HJGA 4NJAH 4V11A 5D71L 4X5WA 4NN5C 5A6IA 1TT6A 4G71B 4XC3H 5GISL 2BPBA 3C5ZD 3DJRA 3NYKA 3S35L 4ZTEA 5FGSA 1HL4A 1KNOA 2W60A 2B1HH 4OGYL 4KNSA 3CFBB 3U7WH 2IDFA 2VE6A 3V0WH 3RNQB 4I88A 2CR3A 4MMXB 3SYOA 4ABUA 4X83A 3MRQB 5L2JA 4GB9A 5EO9A 2R7EA 4M5YH 3TJHC 3CLWA 5HDBB 2YQ3A 3OXSA 3B7YA 3HE7A 1T0NB 3K81A 2Q1EA 2Q7YB 2FEDD 5KS9F 1BCIA 3L1EA 3T77A 1I3UA 3LS4H 3ML8A 3QDMD 2CA3A 2QEJA 5FUOH 4R8WH 3NESA 3E3QE 2UZXA 4MNGE 3NSDA 2GK0A 4G6MH 4MX7B 5JOFA 5HHNA 3EHBC 4WF7A 4HGKC 3LIUA 1BMGA 5D2LB 1YEDB 2Y22A 2R8SL 3V5DA 1A3RL 3OHMB 1FVCB 3EYVB 3TESA 1F4WL 3WD5H 4JKMA 5SWZD 1ZPLA 1G6RH 1GTNA 1FL5A 3CQFA 1YEHH 1FVDB 1DJXA 4U49A 1PLGL 5HHPA 3S2CA 2BHZA 5BRZB 4JG9A 5EDXA 2XUWA 3ES6B 3RWHB 1DVQA 5FYJL 4A2DA 3NSJA 3VWJA 1XV8A 3B3BA 4LNVA 3K1KC 4TQHA 4QRPD 5HHQB 2B2XH 1XR9A 2X4NA 1LYQA 3N1GC 2XWJA 5AVRB 5DTFA 4O00A 4KAQH 5I1EL 4KZ0A 4QWWC 3HG4A 3I6LE 1QHOA 4M8QB 1KY7A 3I6GA 4OF7A 3FQXA 2Y0SA 3MVSA 3U1SH 3ARPA 4BQCA 1XIWA 2NYYD 3CUPB 3ZRCC 3GGWA 1UJTA 1OQOA 3MRCA 3ULVH 2JV6A 4XHQA 5GIRA 1Q72L 4XPHL 1JSYA 3BWAA 1IL1B 3MUGB 3VFRA 4N8VG 4ZDHA 1XL4A 2BERA 3SKJL 1P84K 1JHTA 5CJOL 5DVPA 3EKCA 4P59L 4KNTA 3U25A 5LAXB 1ZVHA 3TBCA 1LEKA 5FYKE 1VERA 1CGXA 1NFIB 2FIKA 1BXUA 4PYGA 1XF2A 1TIUA 4HUWA 1OD7A 2V9QA 1AD9A 2VQTA 5CJQH 3L54A 1HXYA 2A9AA 5ITBH 3SKOB 4GRLC 2ISDA 5BVPL 5TK4A 1BIIA 1UVQB 3D85D 5E8OB 1NZRA 1WWBX 4LPXA 4JPQA 4ZFOB 1JD9A 3EF4A 2Q10A 5JNYB 2IH1A 1RSFA 1S2EA 2NTSP 4U1JB 2YBRB 1ET7A 2GTWB 4G6AD 4N5UA 5DVLA 3SPCA 3C2AH 2A73B 1I1AA 5FA4B 4N3UA 4ODXA 4Z23A 4PJAE 4NO5B 4XBGB 2YQ2A 1GZHA 4Z3HA 3ZTDC 4KPHL 2JCCB 5MEOA 4JDVB 4YHPA 5TQ0L 1NC4A 4KKAD 5I9QC 2B15A 2V5RA 1W16A 4X98B 1SEBA 1R3IH 2Y1AA 2A9DA 3CHQA 3OKEA 4WW2C 5D1ZB 4KTGA 4HV8B 3V4PL 1HX0A 3ECBA 2OMTB 1DBKH 1XGQB 5F96H 3VXRE 4N8VA 4ONHB 1CU4L 4BJLA 1QSFA 2CXKA 2LU5A 2DYPA 4W1TA 5DJ2B 4E9QA 3BT2L 3KD4A 5FCUL 4P04A 1DVUA 5E4IA 4A7GA 1J5OL 5FC9A 4ZX5A 4LVHB 4A7GF 4KRNA 1YQ2A 2ZUQC 4R0LA 4R5XA 3S8GB 1I3GL 1LEIA 4MQTB 3I6LD 3DX0A 1D5MA 4ORGB 4KI1A 1YEEH 4MDIB 4NQCA 1F90H 4K3EH 4MYPA 4ODWA 4O2FA 5I74C 4MCYA 4DPBX 5CZKA 4FN0A 1DQKA 5DMIH 3A21A 3NCCB 2BDNH 1Q9WB 2CPCA 5AOKA 1BFVH 1E4JA 4DESA 1JCVA 3RIAF 3UH8A 4M8VA 1EO8H 3US0A 5TE6L 1JZ2A 4FADA 2BOCA 1N67A 1M2OA 5AKSA 1E4XI 2HB0A 4HK3J 2X70A 4NJ9H 3S4SB 2ICEC 5DD0L 1FZMB 4K3DL 5E51A 1IEBA 5FYKD 1L7IH 3L95A 2Q5BA 5F1KC 1VFAB 1MJ7H 3MO1B 5LBSH 1ADQL 3FUHA 3TN0D 1IB5A 3MRJB 5T1MA 3HC3H 1WGVA 4XMWA 4ZBJA 5LCVA 3HC4L 3STLA 5C8JB 1CI5A 2W38A 3WHE0 1KYFA 5F3BA 3E6FB 4AQZA 2APVA 3W39A 4B0MM 2VDPL 1GGIH 4D9LH 2F1EA 2R0LH 4F7PB 2NMSA 3UP6A 2YFOA 2ZCHH 2Y7MA 4GBXB 1Q4NX 4PVLA 5DU7A 1KLGA 4ZMPA 4DFHA 3D39B 3FFDA 1YY9D 4F9PA 1UENA 1U8HB 1KCLA 4N2IA 4U3SB 1IGFL 3WS3A 1FE8H 3OKMA 4NHCH 4DO6A 3K6NA 5DMJB 3KPNB 3ZUNC 4PTTB 4IRSB 4NUGH 3VXRD 4PWEA 1GCFA 4Q0XH 4KKZA 3L7FA 3IU4L 2GC4C 3MUZ1 2L7EA 2X4TB 4HXAH 1ZCRA 3VXSA 1L9QA 4RAHA 2D4FA 2KI6A 2CHZA 2ZT9C 4KK5D 5I8OH 1UKSA 3S88H 3HC0B 4Z0BL 2GQHA 3BI9X 4KDTA 4NO0D 1YNTB 4PJGB 1ZXKA 4W9LC 2GTZA 4RNRA 4XMVA 5ETUA 1KXTB 1LP9B 1QNZH 1BYNA 5MI0B 2Y24A 1E4XL 4X6EB 5A3ID 1YJDL 4NRXA 4XT1C 3LQZA 4M6ML 3L4YA 1N18A 2CDFB 5D70L 2PPFA 2DTMH 3DIFB 3H9YA 3DX6B 3PP4H 4OF0A 4Z3JA 3GMRA 3QZMA 4UT6L 3CVHB 1E4KA 1I85A 1OEZW 5HHXH 4YUEH 3GMNB 1HQ4B 4HPYL 1HJBC 4I9XA 3O41A 4BSJA 2QKIC 2WP3T 4GFXA 1S7SB 4FQ1L 1XSIA 3MLUL 2PTTA 3I50H 4OJCA 4X80L 4KO9A 2YPKA 4BZ1A 1YMME 3FH7A 3DO3A 2APSA 1TVDA 4LEBA 1DDHB 4R96B 2V4LA 1WT5A 3FHEA 2YSTA 3B9KB 2XWBA 5SWSE 3CSTA 2VUYA 4JO5A 4CC0A 3VTAA 2AJSH 4I3GA 4ELMF 2I9LB 2Q3ZA 1XCWA 4GRWB 2YAPA 5JPNA 4N68A 4WFEE 4WUKH 1A4JA 3MV8A 4HIIB 4P48A 1AXSA 3BGMB 3CFJB 5IB2B 3RGVC 3AT0A 5DGRA 4AM0B 3BYTA 2DPKA 1F1DA 1A22B 3BVNB 4AT6B 1WAPA 4P4KB 4WVRA 3P4MB 2Z7ZA 3BP5B 4LPTA 4EI5B 2VDLB 4RFOL 2G2NA 1TTCA 2VR5A 3DX3A 3E0GA 3TBVB 4YSSA 3OR7B 4JCWA 4OLVL 4I4WB 3VXOB 4YSTA 1BVKA 1NGZB 1VADB 2I32A 4UT9L 4XP5H 3NJLA 4RGNC 3BFOA 1G7JB 1FDLH 1UM6L 1KCVL 2H3NB 2I5YL 4G1EA 4PWFA 3W1ZA 1T6BX 3H4HA 1KN4H 4XCEA 2FRGP 3UJTH 3MLTA 4CMMA 4XP1H 4DTGL 2G5BB 3KPOA 3BWZA 3B3IA 5HHVH 3SGKC 1IFHL 2V17H 4IRJA 4HH9B 1D5IL 1MJJA 1HYRC 2WWKO 3IS1X 5ILTH 5KN5B 3ZKQD 4B95C 4K3JL 2ATPB 3BPNB 4BFIA 4KJQD 2DWEA 2OMYA 2XN2A 2ZOKB 4JPKL 4M7ZC 4C55A 2DQIH 5D7JC 4PJIB 3TFBA 1R6VA 2C3WA 1DQMH 4M6NH 1MW1A 2C3XA 2DY2A 1Z9SB 4NP4H 2FJHB 5C0EB 2YXVA 5JHDB 4LCIL 3SJVB 3OKNB 3VXMA 1YMMD 4AIZB 5CJXA 3H3KA 1P7KB 3MX0A 2YPVA 1A1OA 1QR4A 3MKKA 2XPGA 4L4TE 1VFBB 5SWSD 3PGFH 4XI5C 1J48A 3TF7C 3JQOB 2WVVB 3SD2A 4PRPB 5EC2A 3MV01 5EOTA 5DWUL 1E4WH 4M1GL 2NX5B 3EYSH 5DZJA 4TVUA 4WFED 3MRLA 4WCYH 1KTDA 2X3CA 4H44C 1HU8A 3NABH 4OCWL 2NDGA 2WWMD 5JW4R 4HC1L 4J3XA 2EYSA 1BVNT 3ARXA 1FG2A 2YD7A 4BEIA 1FL6B 1QWHA 1R5IB 5IQ7L 4TNVK 4YZFF 3VGDA 1YMHB 1VDGA 3R1GL 3RILA 3K8KA 3LMJH 1SMDA 4K3HA 2D0FA 4O2CA 1JV2A 2FYVA 5LKNA 1AZVA 1FN4B 1SOKA 2A5UA 4PLJC 5AD0A 3QUML 4Y4HC 3QORC 1J05B 3DSFL 3QAQA 3PXHA 5D7LD 4G6FD 1BBJB 3EBHA 4Y4FB 3LVTA 2GAZA 4D0CA 2X89A 2PYEB 1TKWB 2IDTA 2V7NB 5GRUH 4D9RE 4MJIE 3H9HB 3GMMA 1IJ9A 4ZFGH 4U3CA 3ZDZF 3X14B 2DMGA 5I82A 4XVTL 4YGVA 3UTQA 1NGQL 3N41B 3DYOA 5DO2D 3DC0A 1EBAA 1S9VA 3ABGA 3CN1A 2J7LA 3VFMB 1J5CA 4PGBA 1JV5A 2HH0H 4LGPB 4N8CL 1GL4B 4YHKL 4OCSL 4PLOB 3D3VA 2P52A 5AW9B 2EC9T 5HGHA 3HB3C 2XA8H 1IJNA 2PR4H 1ZE3C 3D30A 4BV1A 4X5QA 4KV5F 1UJ3B 1SY6H 1S5IL 2WYTA 2BX5A 4U1KB 1SOSA 5CZRA 2NNAB 2JFCA 3LOWA 1CXKA 4N2DA 4FDWA 5IMKA 2VR4A 3LRGA 3WJMA 4H1LH 1VPOL 4DEPC 1J0KA 1WS7A 3QQXA 1NC2D 3NJJA 4H88H 4L4TD 1FL3A 1NMBH 1IMHC 2PP7A 1ZTXH 2BOLA 1DQJA 3KYOA 2WKOF 3G5VA 1Q9LA 4DZ8B 2XQ0A 4YFLI 1UACH 1FZKB 4TULL 2Z3FA 1UYWL 3KDMA 4JFDE 3ZT6A 2WTPA 5HGBB 1Z3GH 2K78A 3FN9A 3DURB 2QQQA 5T1DH 5D1XE 3QFJA 1H3PL 3TVMD 3PFQA 4WY7L 2GCYB 5AZEH 3BAKA 2FQDA 2YEZB 5DLMH 5BV7L 4Z7UF 1FNAA 1LWJA 2ILLA 5I1CH 2ZUUA 1DSFH 5AKVA 4AQ1A 2IOIA 2TAAA 3LIZH 1TQCC 4Y9EA 4PG9B 1FVEA 1U8KA 2YXWA 2FHCA 3CN0A 4I2XE 1X5AA 3NVQA 2W65A 2VJXA 3WKMH 1ZVYA 3WYRA 4OCYH 5I15L 3C09C 1X9QA 3VYOA 4P46C 4NB7A 1VEPA 1I8AA 1ID5I 3CZFB 2H32A 4ZUTB 3SE4C 1EXUB 2IG2H 1RUKH 1D3CA 3D25B 4D9RD 4MJID 4ZODA 2IGTA 3CVIH 2Z8VC 5T5FL 2FQFA 1XD1A 3TCXA 4ZG1A 1I7TA 3LTVA 4AGQA 2WSPA 4I3SL 3QJFA 4OCMC 3QNZB 3IWUA 2BSBA 4W6XB 5AVWB 2FZ3B 3KPQB 1T4WA 1R24A 1DBML 2XZAH 1EHLH 3G3LA 4QO1B 1J88A 3TBBA 1I1FA 1OCRB 1C5CL 2F8VA 1UA7A 4FGMA 3LKSA 4JL2A 3B37A 3N9GL 2DIEA 2EIJB 1YN7A 3AB0B 3DJSA 4N2LA 3HG1B 1IBGL 2MNJB 2PYFB 3OF6D 5D7SL 1B0RA 1OPGH 3D7PA 4FFZA 4LRIA 4DNLA 1FO0L 3BUQA 1ZLEA 3ECUA 3MBEA 2IH8A 4AENA 1NLBL 4OKVA 4WI0A 5C0RL 1PD1A 2XKUA 2EIEA 4WTQA 2ADFL 4EIGB 1LO4L 4JFDD 3JT0A 3INOA 1NIDA 5HYJA 2BS8A 1OP9A 1JDCA 3EH1A 3H54A 5D1XD 1PJ9A 4XMXA 5EC1B 4J39A 3P9WB 1JUFA 1IGJA 5IVZA 2WB7A 1C9SA 1VSCA 4XPFH 4UDTA 1XX9C 3DX7B 3T65A 2P3YA 5AVXB 1AG6A 1HOCB 1DVSA 1I8IA 1Q9OB 1XGTA 2WW8A 4JVPA 4JY5H 1EXHA 4PJ5A 5A2JH 4UZUA 1RY7B 1ZT7A 5IB4A 4YX2H 3SDDA 3O4OB 2D73A 4LB8A 4N8UA 3RU8H 2UYLA 3AC0A 2MQ3A 4IRZH 5E2WL 5HI3D 3NA9H 4IGBC 3TJEL 1DHKA 3DIVA 2KUTA 4ZMXA 3KCPB 3EG9B 3IETA 3B83A 5L2KB 1OZTG 1Y07A 5ID0A 4ZOCA 3LRMA 4WWKC 4NQDB 3MROA 2E6QA 5IJKC 2QADC 4XNQA 1MUJB 4P3DB 1OP5K 3RUGF 1SXZA 4DP5X 2O6CA 4G72B 2QLVB 5LNEA 2ENSA 3HUJA 3SGEH 2BSED 3OKDA 2WBJB 2QFPA 3APNA 4ONFH 4W4OA 2BH0A 2ZSVB 4JDTL 2FD6L 3PWVB 4LLWB 1SGKA 4XCYB 2NZIA 1MELA 2CLZB 4KMLB 4YXHH 3O45A 5LBGA 3GSNH 4XP6L 3M1OA 4MHHG 3FYIB 4DKDC 3CN4A 3QO0B 1W72H 2C7FA 5LGHH 4J3OG 4WNSA 3TJHD 5C0JA 3ZU8A 2VDNL 3QG7H 2D03H 1MJ8L 3OXRB 4AQOA 1EXGA 1OAYH 4KRLB 2NLJB 3UBXG 4NM8H 1BQHG 4PJXB 5CIPH 5DJXA 4KH9A 4XMKH 2Y7QB 5IFJA 3L9RB 4B6ZA 1QKZL 4J2QA 2CBTA 2VN4A 2Y2YA 3BVDB 3HRPA 3JVGA 5CSZA 5H37G 2PWFA 3W81A 1OT2A 5T5NG 2OZ4H 4MTMA 5F6HJ 1KIQA 1X5HA 2YKLH 2ZXQA 5LGKA 2HLFC 1ID2A 1KIRB 1FNEB 3QQ4A 3PWPA 3BKCL 1KN2L 2IFGA 2DOCA 4Y19E 4NBYB 4CADB 3BISA 4PY8I 4C56A 5EZJA 3KVPA 2EDMA 4LHUB 4I0PD 2UXTA 2HZHA 4X0NA 2WQ8A 1GYCA 4AJ0A 2IMMA 2IANB 5F7UA 2C4XA 2C9PA 1MCSA 3D07A 1ZDSA 3IWVA 4MXWH 2YGQA 5D93C 1JYNA 1U3YA 4PR5B 3VYNA 3ULVC 2X41A 2JIXD 4G42A 3NFSL 3C5ZB 5C0CE 1DVFA 3UL4A 4GPVA 4B97A 4J3OF 1QMUA 2Q76A 2YQBA 3QDAA 4DPAX 5L4MA 5F7YC 5EUOA 1VJSA 2EP6A 5EUOF 3UBXA 1S7UB 3BVVA 3MNWB 5DMGC 3ZKNC 5BRPA 4LZKA 1BQHA 3X12B 2E9WA 3HRZA 2XDHA 3REVA 4WEMB 4EKXA 4UQAA 4XCCH 1ZGLA 1BREA 5L0QB 4Q9RL 1E0OB 1J8HA 1ZLSL 1CJYA 5B3JF 1AKJD 3QDMB 2XXGA 1ET5A 4FZ8H 1QFUL 1M71A 1KCUL 2E8YA 2QSTA 4JBSA 1CFSB 2EO7A 3IPFA 1FZOB 1TPXC 3QIWA 3R06A 5FA3A 4XNXL 2D3JA 4PP2B 2CH8A 3RTQD 2AABH 2MPAL 5BJTB 3QDJA 4JMNA 5AEAA 3UIZA 5CAYB 1BD2E 3F7LA 4NOFA 1B0GA 1QRNA 3QAZB 2W5PA 5K9KA 1PFOA 3OSVA 1G1KA 3Q2CA 5SWZB 3DTXA 3EH3B 4OFKA 3KM2A 5F72S 5GRJL 1CDCA 3C60B 3KPSE 5CMAB 4PM1A 5J06A 5J89A 4HMDA 3V4LA 1XR8A 1ORQB 4AGOA 1CQYA 3FBKA 5DC0A 5KTEL 2BRQA 3QC6X 3ZTNH 4DEUA 4EZJA 4QRPB 4KQ4H 1YYLL 2ADGB 2F54E 3CFCH 3K80A 4HJSA 4JO1H 4LO9A 4TLTA 4Y1AA 1A47A 2L4OA 3KW8A 4V2BA 4Y19D 4X50A 2AXJA 5IHWA 4L3AA 4N9GA 2IBZY 3HHSA 4NENA 1U58A 2VXVH 4BH7B 4P5TD 1VKXA 4M7JH 1G1YA 1G9HA 1NKOA 1N2RA 1KWGA 4H20H 2NY3C 3TX4A 3WFHA 1FNGA 3RL1B 3IDXH 3AAZB 1X4XA 1OARH 3BH8A 3OKKA 4PWIA 2QQNL 3O2WL 3O6LH 3ZKMD 4DK5A 4EN3C 5C0CD 4B9JA 5DJAB 4UQ3B 4WNQA 4OV5B 2VDQH 4YHOH 1TCRB 3PGDB 4M6AA 3VD2A 2A74A 3ESNA 4CBZA 2A4EA 5EA0H 5CKGA 2R2HA 1MHHB 2JQZA 3QULA 2CM5A 1YEGH 2Z65C 2D7MA 5F7LB 4C4KT 4ZXBD 1O6TA 4BSWB 4M7KH 5DEJA 2FBJL 3IFLL 4G5ZH 1NLDH 1JVOA 4KHXL 1KXVC 4X6CE 1JGUL 1TJXA 3SD5A 4MA8H 1ECYA 5FM4A 4KXCA 4FLSA 4D9QE 2VN7A 1YC8A 5BZDA 1R0AH 5BW7C 2L7QA 3EOAB 4MNGB 4YPGA 4CJ1A 4XO9A 3A4DA 4MAYD 1NCHA 3D09A 3PL6A 3OC8A 5E6RB 4PS7A 3FQTB 3LSOB 4KY1L 1OSPL 2JXMB 3H7LA 1TZOA 3CFBA 1BD2D 4A6YL 3APCA 1NAKL 2C8NA 1ZT1B 3FFCB 4KJYA 2J25A 1YCSA 3RNQA 3SB3A 5J13B 1P1ZA 3BEVA 3ILPA 4KROC 3AT9A 3BDBA 4LDCA 5E1QA 1T20B 1AACA 1CXIA 3KPSD 1EANA 4QHMA 2Q7YA 5DI8B 3TWYA 4K94L 4FG6C 3BAEL 4TM9A 3AITA 4FMVA 3D5OF 1K2DB 1IQDB 3ILDA 3GZKA 2DICA 2BNUB 2F54D 3RB5A 1HCZA 2V8LA 1N6VA 4L5FH 1OB1B 3ATEA 2P8LB 4ZW6A 3UERA 2Y7SA 3FTUA 3IJ7A 4LNRA 1PY0A 1YEDA 4G6KH 5CHNA 3CDFA 3MNDA 1FVCA 2PTVA 2CMRL 3EYVA 3HZKB 1J0IA 2OTUB 1RFDH 3WOVA 4UT6A 5KAQG 4Z3FA 5EN3A 4JM0A 1G0DA 1GGTA 1P4LB 4BD4A 2CG9X 3ES6A 4I8DA 2Z93B 3PHOA 2BVTA 2XXCB 2NUPA 4J8RB 3QQ3B 2XOTA 2Y7OA 5FUZH 43C9B 4PWGA 4HFWB 1M3IA 2H2SC 1NICA 4X9YA 2ATAA 1N6UA 5GS0L 4MJ6A 5BO1L 2G4EA 4CNIB 1MQ8A 3BQUA 4BE6A 3L08A 4NUMA 3GI9L 3L2LA 2GJZB 4ZAKC 3ZTJH 2GABA 4I77H 2A0LD 2NY1C 4YBLC 1USZA 3BQVA 3WXWL 1HEHC 4GOSA 4D9QD 3TN0B 1JPSH 1U8QB 1KFAL 5T33L 3QJZA 3TF4A 4JVUA 3ZYZA 1X7QB 1QABA 1E3FA 4EAEA 5LWYH 5IMLB 4U6XB 2CDEA 1W91A 3FOLB 4TOYL 3ZLQC 4HULB 4B50A 3WI9A 4PJAB 3UAJC 3IMRA 4DN4L 3LB6D 1RZ8B 4PJ7E 4MQXD 5KAQF 3NEXA 1DE4B 2R1XB 5E1AB 2XTLA 2ZPKH 1YEIL 2BHYA 3Q2VA 1AHMA 4P3WA 4YQXH 4HZAA 2ALAA 3SKOA 2GIMA 2Z34A 3VXRB 5IVXE 4EDWL 3U0PA 1ZY9A 4CVZB 4JM2B 1MHPH 4WEBL 4WKZB 4ELDA 4IM8A 1RLWA 5JNYA 2E5EA 2J6EH 2XWTA 2AK4A 1WHOA 3HBZA 5C0IA 1OGAE 4U1JA 4EJ1C 1CGSH 4TVPE 1IGIH 4XVJL 1HEZA 4ATWA 4JCLA 3HIZA 4NO0B 1EUUA 1SVZA 3S4SG 2VITB 5ABAA 1IM3A 1ZJAA 3K2UH 4JDVA 2JCCF 1IKNC 3PNRB 4MA1B 1SYVB 1GR7A 4LP4A 4KKBC 2EXYC 1KACB 1QOKA 2W0PA 1INDL 3QXDA 4OZ4B 1JZ5A 2DJUA 3RWJA 1LM8V 3SQOL 2IAMC 1XFPA 2NY4C 3GB7A 4Y4KC 2OMTA 1XGQA 4IJTA 5I1KH 4LU5L 3HNTH 3NQKA 2YA2A 5MENA 4Y5YB 3L2NA 2CO1A 1WZLA 3V0VB 1DP0A 3JUZA 5C0DA 5EBGA 4AKPA 3AREC 1H5BA 1T1ZA 4YSUA 2IPUK 1IBBA 4XRCB 4F57L 3O4LE 1H3VA 3CFDB 4OFIA 1J1XL 5H94B 4WV1A 1QHQA 1TYRA 2TSAA 4R7DB 4M7LL 2H8PA 4DGIL 4F92B 1JRHI 5KSAB 4JZJB 1CFBA 1MCOH 1BA9A 4L8SA 2KZWA 4L1TA 5IT2L 1OAKH 4Y89A 5KVEL 4ODVL 1KV3A 4RFEB 1DBAH 3PJSB 2ITCB 2HJLB 4ZW7A 3S4SA 1FV1B 1LO5B 4N2AA 4QKXB 4XODA 1FZMA 3VGHA 4OLYH 2YUWA 3ZQXA 5E2VH 4F9LA 1FZJB 3P40A 4QUOA 5JZ7C 3TU6A 1OW0A 5ICZB 4JL1A 1KYOK 2OCCB 3MLWL 3U36B 3IFPB 1IBYA 1IKFH 4YFDB 5C2UB 1S7XA 3C6EA 3NTCH 4W68A 4ZTOH 2B20A 1KTKE 5SX4H 4YC2C 3VYPA 1GCYA 2YQGA 3E6FA 4KJPD 1OGAD 4L1DA 4WUUE 7TAAA 4XN2A 4GW1B 4TVPD 5DUJA 3P30L 3R8BB 3WHXB 2LGNA 4TL4A 2H2PC 2JSFA 1QLRA 1FFRA 2AGJH 4AMKH 2IALB 5FF6A 3LZFL 1ND0B 1HILB 4MCNA 3DETD 4QCIB 3HN8A 1U8HA 5ACMA 1MVUB 2DB8A 4HD9A 2QHLA 3OAWA 4U3SA 1H19A 3T2NL 2R56L 1MQKH 1MW2A 1NGPH 3KWVA 3VFUA 3KLQA 5C97A 1HYSC 3KPNA 5EOQH 5JLZB 3FHAA 4PLJD 1SBSL 4IRSA 3D0LB 4Y4HD 3ZZ1A 4QJ4B 3F6IA 2ROXA 2PO6C 2B59A 3U9WA 1RQ5A 1BLNA 2E7CA 3RWCB 2X12A 2AFNA 1NCAL 1A02N 1NCNA 3BFQG 3RHWK 2X28A 2DQGH 4F8QA 3O4LD 1OAXH 4XOAA 1FNHA 4PJGF 1YNTF 4S1QH 2WLLA 2XX0A 4QRUB 1YMMB 3NZ8A 2DM2A 5T8IA 5IW1B 1WIOA 4FQCH 2UUDH 4HIXL 4XCFH 4RSVA 5I26A 2OQJB 5SWSB 3L6FB 1PDKA 3DIFA 3NCBB 1KXHA 1P2CA 3W9DB 3DX6A 1NFKA 3WTXA 4HMEA 4JHVA 1AI1H 2BIHA 2CUHA 3A67H 1S9KC 3FUKA 5SX5H 4L3CB 1HWWA 3U83A 2P46B 2NQ3A 3GMNA 4FKEA 1T7ZA 2A1WL 3G6DL 3BP6A 4HU8A 4NQXB 1S7SA 2PW2B 3D69A 1FWXA 5DD6B 5AOJA 3CV5A 4OZFB 3NJVA 3DDGA 3D4GA 4XN8A 4R96A 2G3ZA 1UADC 4NNXA 4WUUD 4UIKH 4TRPL 5JR1H 2L8AA 3PUUA 4OI7A 1QI4A 3OB0K 1VFMA 2JELL 3RWDA 2CBQA 1DEEA 4IBQA 2PWDA 3FFOA 4ZMAT 1VAHA 5I5MA 2I9LA 5C6PB 3SY6A 4GRWF 4GY4A 1XVSA 5GZNC 1JBJA 4QJ3B 4RGOH 3BGMA 1KZQA 3MLVH 3BIBX 4WO4A 2DLTA 4E9WA 4JPIB 3FO1B 1CF8H 2BIOA 4LSPL 3SBWC 4LDLB 1BZOA 4N26A 2PN5A 2A77H 3BVNA 4P4KA 2OR7A 1A0QL 4ZMLA 3TO4D 4YVNA 1QFWH 4G9DA 1DBBH 4U6HB 5HGAB 4EI5A 1MLBA 5E4EB 5HY9B 3X13A 4IHBA 3BAXA 3G6JE 1P5UC 3L3GB 4RVBA 1FO0A 1KYAA 1YA5A 4I4WA 1A6WH 1IC4H 5EBWA 2VLKE 1C5DB 1NGZA 1SJHB 1QBMH 4WLCA 3MXWH 3Q5OA 1H9VA 1G7JA 3NACH 5D4JA 1CBVL 4JFUA 1OANA 4JQIH 3TC9A 4M29A 2KLSA 2HAZA 3ETSA 1NCBH 3VFPA 3TS8A 3BPLB 1NC2B 4R5TA 4L4TB 1JYXA 4M1CC 2FH8A 5C09E 1UOVA 4A2EA 3EGXA 2VMJA 2RTTA 3BE1H 2MNWA 5KANI 4CN4A 1SUHA 4K5LA 4XP4H 2VLLB 2I07B 2APTA 5KN5A 2ZOKA 1S3RA 1TZGH 3MJ9A 5DK0B 3TVMB 3I9GL 1CLZL 25C8L 4I18C 1DUYB 2DW5A 3KYKL 3MRBB 2OYLA 5C7XH 4KK9C 3GKWH 1GZPB 1A3LL 2FJHA 3FT3B 5KG9B 3SJVA 4AIZA 4LVOB 1P7KA 1Q1PA 2AXGB 4MNQE 1Z32X 2NT0A 5T3ZL 3V9CA 2DMHA 3VU2A 4FYRA 3MRIA 4K7PH 2V8MA 1AFVL 5IY5B 3MODH 4YHNB 1X3DA 4GEJA 3VCLB 1L9TA 2WVVA 3QEHA 3P77B 2K4AA 4BH8B 5HYQB 3U9UB 3DX1A 2BZCA 2NX5A 5B8CC 1PX4A 1DJZA 4MJIB 2NY7L 1D5ZA 3ARBD 3W0WB 5F3HB 3CHOA 3MOBL 1J1OL 1JWSB 2YGVA 3H55A 2EC8A 1R5IA 3I6KB 3ULUH 5AW2B 5DD1L 5EU6E 4H4NA 4AIEA 4P3CL 3BAJA 1YMHA 2ZP9A 1QSVA 1UOWA 3UZEA 3CPLB 2ZKYA 5EN2B 4I3RH 4O02H 2VLKD 4E9TA 1QLFB 3DARA 1FIGL 3P11H 4X4YA 1PFCA 5C70A 2C1OA 1A25A 4Y4FA 2ITFA 1G1CA 2ADIB 1TKWA 1Q94A 3QDHA 3QK0A 4PSPA 4XO4A 4GXFA 1EEZB 4BZ2H 4NO3A 5CGBA 3S97C 1RZKL 3X14A 1RHHB 5C09D 5I8CB 3ZL2A 1IFRA 3N41F 4ZNEE 3GXTA 5I1DB 5F88B 4JY4B 2CLRB 3VFMA 3ASWA 1B3IA 2VXUH 2VW6A 3QEQA 3HVDA 5D1XB 1EGJA 1EAQA 1O9VA 1SOQA 5T3XL 5C08A 4O4YH 2ZWYA 1U8JA 2DDQH 3K46A 1PX3A 4PRDA 1ESOA 3QRGL 3RWEB 5B3NA 5LNGA 3LNEA 1IGYA 3VQLA 3WNMA 2FWUA 2NNAA 1LK3H 2VQ1B 5CO1A 1Z5LA 3AW5A 4MNQD 4MSWA 3MRKA 3AXIA 4FQXD 1XGPA 3MR9B 3F7YB 4K3GA 4UBDC 3BDYL 4JREC 1MI5E 1YEKL 4PGEA 2PNDA 2R1YB 3L5IA 1FZKA 4KMTH 5FFOA 4P2RA 2VDPB 1KC5H 4U6YA 4AEEA 4RCAA 3QSKB 5H37H 1JGEB 3OPZH 2MQ0A 2GCYA 3Q3GB 4Y88A 3MCYA 3UJIL 4JFFE 2COVD 1UM4L 5CZXC 3ROOB 5BQ7B 5DEFB 2KPWA 1BWWA 2FBRA 5DUML 1E5YA 4PG9A 5EU6D 5EU4B 3L7EB 1UH2A 3DOSA 2CIKA 1C16B 1F58H 1MIEH 2VIRA 2I24N 1AHWA 3ULVD 2WANA 1HHJB 1GZHC 1MLCB 4LSVH 1TJHL 4PW9A 4ZUTA 1JZ3A 1UGKA 3ARDD 2V2TB 1EXUA 2F08A 3NSCA 3NRFA 3VGAB 3IXAA 2AEQH 3ZKND 3CLFL 4GIAA 1LXMA 3EYOB 1UCBL 5LO7A 4DGVL 2F18A 1A2YB 3VFGH 1ZLVH 3C5JB 1IZJA 3CC1A 4L1HA 2X1PA 3QUYC 3QUXD 4X6DE 4LSDA 4L3EE 3DO4A 2OL3L 4R0LC 1XTMA 3CX5K 2LU4A 4PJEE 4L0YA 3NPZB 3DXAA 9PCYA 4ZS6D 2LHAA 1PPIA 4QO1A 6PAZA 2OK0H 3FU5A 3TNMB 3V0EA 1F4YH 1TETL 1WZ1H 4RX4A 2X1OA 2G0KA 1WEJH 4U3HA 3IGKA 2AMUA 2FT7A 4YDNA 4X6BB 2EO9A 5L4FA 3PRZA 3NT0A 2D3VA 5F9AC 3WNPA 3FCTA 3MV7A 5ACZB 1MI5D 3OKLA 1YEJH 4I0PB 2I9TB 4G7QB 3L3JA 1UXLA 3L9YA 1JZ7A 2GBTA 2CNYA 2Y1YA 3FYEB 1I9JH 1OD9A 3FBQA 1ACZA 4EZLA 4NSKA 2WXLA 4LCYB 3RA7H 3VGGA 4JFFD 4FYTA 1PIGA 4UZGA 3CG8A 3HN3A 4Y16A 4UTBA 3VWKA 3U6XA 1DLFH 3EIFA 2FHFA 4ES9A 4KTDL 2DQDH 5KVDL 1Q9OA 4KTYA 1WZMA 2AANA 2JKRM 2NY3D 2VQUA 5JHMA 1N5YL 2WKLA 3D9AH 5KW9L 5I66B 5DD3L 3N5AA 4NEHB 1F13A 5FYLL 3UJJH 4OGXH 4G8IB 3MJ6A 4PW4A 5IV2B 4BK5A 3UMTA 1XSOA 4MLIA 2ICCA 2VXSH 5I1JL 3RTQB 4WEEA 3IPBA 3CMOH 1BYOA 4Y2DC 2B16A 3HFMH 1KB5B 1AGBB 5AFAA 4FABH 4C57C 3VQMA 3MRDB 5IB1A 2JJUA 3RWGB 5J6HA 1VB9A 5JQHC 1DFXA 4E41A 4L3ED 2QHRL 1MRCL 1N5AB 1VEMA 3FMGL 1S46A 5LXGH 4LHUG 2ZSVA 3SKUD 1MAML 4XCYA 4GMSH 3ZQWA 1C5BL 4QOKA 3WN5C 1OHZA 4HMCA 3ZBMA 4HWEL 4DCQB 4KROD 4N9OB 2HA1A 4H25A 4Y19B 3VXQA 1EERB 4KZCA 1IEHA 2WO3B 3OXRA 1N68A 2ICWI 5CINL 1ZPUA 4RAVA 2NYKA 2DJ4A 4P5TB 4OLXL 1E4KC 4C58B 1ROWA 2VM3A 2NY5L 2XIBA 3NK3A 2NY0C 3QR1A 4OD3H 5IMMB 4JKPH 5EPMB 3N44F 6FABH 3FO9A 3BDXA 2BSCA 2NR6A 3QYMA 2WZPD 2HT4C 2XQBH 2N7BA 5C0CB 5FYKU 8FABB 2OTWB 2ZUQB 3H7BB 4ZMTA 1G9NC 2BVEA 4DP2X 1OXYA 4GS7B 2N7SA 4UDUA 2P1YA 5D1QE 1G9MH 3STZA 4JZOA 2OR9H 3RNKB 4DN3L 2MQCA 5AW6B 4ZXBB 5EMYA 1D5BB 4CADA 5LN4A 5F2FA 1OAZH 4AY0A 4KOBA 2ZOLB 1NFAA 3G5ZB 5LBVA 3D18B 4RGMC 2B8OT 3QUZD 3J7HA 3N40P 3SIKA 3EF7A 2Z6FA 3OAZH 3QUMB 4OAWB 3A47A 1HNYA 5E5UB 4NUJB 4Z76B 4MAYB 1QUNA 4XPTH 2Y7NA 4ETQA 5JHLL 4F33B 3W57A 3RWIB 3VFVB 3CVBA 4CRPA 4HA1A 1UWXH 3DROB 4PJ9C 1BD2B 3MLRL 4OLZL 2IWEA 4UQ9A 4LIQL 5F21B 2CO3A 1LE5A 4YBQC 4FA8A 1S7UA 4NUPA 2R1WB 1RUPH 2AZAA 4MA7H 5IW6A 3S3SA 4KKCC 3GMLA 3KPSB 1BPVA 1RCYA 5CZVL 2CGRL 4HBCL 4U4BA 3PQYE 3EO9H 4OI8A 4OF5A 5C0GB 4Y8DC 4QYAA 2XIIA 3FT2B 2WXPA 3QUGA 5DJDB 2H1LM 5T1KD 1VCBC 2F54B 4YLBA 4WJKB 3RVTC 2WUCH 4PP2A 3CDYA 4TLKA 2CZNA 4NKIL 5BJTA 2NZ1A 2F68X 3B43A 4A39A 1KLFB 3JWOH 2AJYH 2V33A 2ZF9A 4NAMA 4O58L 5IVNA 2PABA 4G82A 5ICUA 1FC1A 5I30H 1K4CB 3V0AC 4AH2B 4JRLA 1C08B 4YHYB 2DH2A 3GJFA 3CHRA 2WXJA 2UZIH 1C1EH 1JPGB 1MZYA 1ORQA 2BNRE 3LPOA 4PJHA 1IBZA 3TBTB 4XWOC 3CFEA 2DWDA 3LYRA 3S8FB 2NNXA 4QRPA 2F7RA 3QFDB 4PGZA 3QIUB 3GC3A 4KVNH 1THCA 3N0PB 5BV7B 1QFWM 2DBLL 5KVGL 2OMUB 4LEXH 1QBBA 2IQ9L 3QRFM 4N20A 2XFGB 1ZSDA 4OCXL 3FUEA 1JF1B 15C8L 3WBDA 1O7DC 4X6CB 3DBXB 1HIMH 1QFOA 2A6IA 3ZZLA 4ADIA 1M4KA 1I31A 2IWKA 4RMUA 3RL1A 4AEIL 4KKPA 3MFGB 3AAZA 4Y4KD 5ITFB 4AK1A 3U4AA 1RPUA 2ZUWA 2C4FU 1ZWIB 1URIA 1MPAL 2CE6A 3EYQD 2N59A 2K7PA 4KO5A 4OU3A 1B4LA 5AZ2L 5DJAA 3ESUF 4LLAA 4OV5A 1BDYA 2ZUVA 3PGDA 3K4AA 3MJ8B 1FAKT 5FEBA 2Z31B 3VA6A 4WHTB 2OJZL 3H3BC 3O2VH 3KAAA 2OMXA 5B21A 1T22A 4QD2E 4DKFH 4PJ6A 5FM8A 5E5RB 1CDBA 35C8H 2WQXA 5DD5H 1N7ML 3TT3L 3M8OH 4U1IA 3PQYD 1JG9A 3WTUA 2NXYC 1BVNP 1DQLL 1OGTA 1PG7X 3LNFA 3WUZA 2OCFD 1BJ8A 1S7VB 5CILH 4QXGH 3VXUA 2PP9A 2LOEA 4HETA 1M3JA 5AVUB 3KHOA 3P4OB 3EOAA 3D85A 2K4WA 3I3BA 5JW5A 3BUIA 2WJ5A 3KHQA 4HUVB 3TXAA 1ZA3B 5KOMC 2FLMA 2M2DA 5MP6L 3VUAA 3ZTCC 5JZ7D 1OCWH 2P48B 2PXYC 4MDRA 4XNUH 2J44A 1KY6A 4OSUL 4PJFE 3N06B 1G7MA 2CRMA 2BNRD 2CHXA 1HXMA 3O0RL 2AVFA 3HAEG 4UU9B 4RETB 1K5NA 1K2DA 3NJGA 4HT1L 2ERJB 4OFPA 4OM0H 2H2PD 1AHKA 3GI8H 5AW7B 4NS0A 1G7QA 2FCBA 4GXVH 4IYKA 1M05B 4TSCL 1T5WA 1KBVA 3KR3H 2P8LA 3VH8B 4LOEA 2C1PB 3RY4A 3CVHH 1LO2H 3RZCC 5JXAH 4HKZA 43CAB 1HYSD 3HZKA 2OTUA 4UM9D 4C59B 3DX8A 4HPOH 1X7TA 1RJYB 4YDIL 2CHWA 4M02A 1S7QB 2V9UA 4WAFA 2ED6A 1P4LA 2PO6D 2WCPA 5D8JH 5HXMA 5JPMA 2I85A 2ZAIA 3DHMA 3S34H 3T1FA 1FFOB 4J8RA 3QQ3A 1X44A 3HMXL 43C9A 3MN8A 1UM5H 4AX3A 3EJSA 5I8KL 4WNJA 2CDGA 3QG6B 2JB5L 3MRNB 4H13C 1UCTA 1E9QB 4NDMB 1BJ1J 2GJZA 3UZVA 2IO5A 5AB0A 4GRWH 4NPJA 2R0ZL 5GGQL 3T8VA 4GW5A 3T2PA 1XCQB 4B0MB 4O5LH 2X0WA 2X44D 1WVZA 2GBAA 3HAEA 3TN0A 2KKQA 5IVXB 4CW1A 3V79C 1TEGA 5DUBB 2HPOA 1E2ZA 2GITB 5CEYB 4N0CC 5C6TH 4F3FB 2HJKB 1OGAB 4RRPM 4XX5A 5GZOA 5IMLA 4XNBA 1NCOA 3M17A 2BJML 3QW9A 4F7EA 2BNQA 3UBHA 2VMFA 4XR8C 2VDNB 3LKOB 1T3FA 3LQAL 4NT6B 5J1SC 3QUKB 2R59A 1RZ8A 1WWAX 4BYHA 5I19L 3DVIA 4D7BA 3CXHK 4HUXA 1HKFA 2HYMA 3HFFA 5CBEA 3HPJB 5AENA 3K7UA 2NXZD 5CU9A 3U1QA 4S0HA 4ZO8A 4KZEH 3MNMA 3HBPA 2XN0A 2ZKHL 4RH4A 4DP4X 2VXTH 4CVZA 4LRIC 2EEFA 4JM2F 5DWPA 5ERWA 2P5WA 4KX7A 5CD3A 2H6UA 4TXVB 1DVYA 3O11B 4PAZA 1BV8A 3TIDA 5LN8A 4YPJA 3O4LB 4L37B 3WXVH 4NO0A 2F1BA 1S7TB 1AIZA 5D6CB 4X5XB 1U3HB 2Y25A 4APQD 1W8NA 3BIKB 4MRCA 1FORH 4BSVA 4AEHL 5L9DL 3CPUA 3VG0L 3M07A 1J5IA 1UKTA 5KANG 2QGEA 3GBNH 4LKXA 2VUKA 4PD4K 1KYDA 1ES0B 4Y5YA 3K6DA 2GUOB 3FULA 4I5BA 1Q0YL 3PWJB 4RWHA 1J1PL 3V0VA 4XNDA 1A4AA 4H8UA 2R39A 4K23H 1U30A 1ZLWK 4X0KB 1TQBB 1A21A 3VX1A 5L4IA 1OLLA 1WC7A 2YA0A 2RCSL 4JKLA 5BMFL 1BXVA 4LBAA 1JIBA 2R0KL 3FU7A 4JRFA 4FP8L 1KENH 1AGFB 4JQVA 4WHYG 3WE6A 1JZFA 2WQRA 1MSPA 3BKMH 3P9MA 1AS7A 1LL1A 4MB3A 3OZ9L 3GFUA 2EDXA 3TA3D 5AW8B 4DOHB 4W9FC 3PJSA 4ADGA 2ITCA 3ZZQA 2E8ZA 2ARJQ 1FV1A 3SYAA 1I7UB 1XH2A 4GSDL 4N1HB 2CA4A 4ZI8A 4GG8B 5CN2A 3MNVB 2YRLA 4HEME 1WBZA 3A6CH 2CHDA 1NDGA 2J3SA 2FGWH 2PMZA 3QGVA 4TUOB 5I23A 5ICZA 1BEYH 1F00I 1EZVY 3ULUC 2QSQA 2HFEA 3TO4B 2R15A 1JGVH 1N8ZA 4HXBH 3MBXH 2OI9C 5C3LD 2CAKA 1ACYL 3ARFD 1EHKB 4DPRA 4X8CA 4Y5VC 3WHXA 4EZKA 4Z78B 4LLDB 2LE9A 2BFVH 1PZDA 1T83C 1IGCH 3BUTA 2IALA 1FIEA 3JVGC 4Q14A 1SFDA 1WFIA 1N6QH 2ADJB 5JW4Q 1U8IA 1F3JB 1RK7A 1XSJA 4G6JL 4P07A 2RQEA 3VSUA 4NQTA 2P7TB 3INUH 5AAWA 4OH2A 1U8OA 4A2GA 3ALPA 1KTLA 5GSRA 4MA3B 3QI9A 4C4UA 3ZVVA 5MERA 4PMFA 2W8CA 3RWCA 4DVBB 3KS0H 3HR6A 3S3BB 1KF9B 3K6FA 2Z91A 3EO0A 4DVRH 4WRLA 4U05A 1DO6A 4RMVA 3WFCL 5J11B 2CD0A 1U2CA 3C9NB 2FQGA 1U8MA 4FFTA 4QRUA 1DVFC 1YMMA 4J3OC 5BOJA 3P2BA 5K39B 2VRAA 1GKOA 2VLRB 2I26N 5SWSA 2WNXA 4L05A 4FL4B 4MVBD 3KGTA 2EIBA 3W9DA 4EQ3A 1R33A 3HRZC 1AR1B 2DD8L 1ZS2A 4ZMVA 1RJZB 4LOUD 1NKRA 2W1NA 3GHEH 2XNAB 4K2UL 4X6FA 5IHHA 3RX9A 4PN6A 4X7SL 1YNKL 3GEFA 3EGSA 4JNXA 3ARBB 4XBPB 4YSCA 1E5CA 4BIKA 5EZOH 4FEMA 1TVBB 4R26H 3QIWC 4NQXA 2HVJA 4C47A 4AW7A 3WIIH 5HI5D 1A6ZB 3KLKA 4HZLB 4KITB 1MWAL 3II1A 2A3TA 1WF5A 2BRRL 2X4RB 1RU9L 3G6JB 5CEZL 4OBSA 3SZ6A 5EIIG 3KNBA 3NCJH 1OVZA 4PP1D 2VLKB 1GMEA 2P80A 2F58H 4PYHA 1N64H 5D7LA 4G8AC 5CZXD 1S9YA 4E5XA 3LV3B 4EVNB 1FYTA 4J4PA 4K0OA 5KUMA 3UTOA 4KOCA 1KPUA 4M1DL 5D5ME 3TCLA 4UYQA 4OD1H 4JRYB 5AYUH 4NQEA 4JPIA 1EA9C 5C09B 3PPSA 3X3GH 1TO4A 3AQYA 4FNSA 3TWCL 1WA1X 1AIFB 4XPAL 1D6EB 3JWDH 5IHLB 4OCRL 4RISH 5FCSH 5C0AE 3RL2A 2R69H 3LDBC 5E6ID 3L3GA 2AQNA 2RR3A 2HPTA 1KMGA 2WLNA 4H26A 4MD0B 2B0SL 4N0FA 3P73A 5C3TA 5I71B 1AZZC 1CLYL 3U2SA 3VI4A 3DGDA 2IXQB 4IBYA 3W9EB 4Y5XC 2IFFL 4AQAA 4MNQB 4XNMA 5HD8C 1UA6L 1XWVA 1CC3A 3QCTH 2A74C 4FQXB 4L4TA 1UUSA 2AEPH 1KT2B 3CZJA 1YYML 3EFOA 4YDJB 2MCAA 5EIIA 1KFGA 5EG6C 2I07A 2IWGA 5GGSY 5IR1B 1AE6H 1QBLL 4M61B 4QHLB 4F5CA 4N6QA 2AJZB 3BAWA 3JV6B 3MRBA 2E3VA 5B1CA 1ETJA 1SM3L 4Z95H 3EUDA 1GZPA 1LO0L 2WD0A 1F4AA 4JJ5B 3AY4A 3NJFA 1I8KA 5EULV 1F18A 3GLEA 5EU6B 2YLHA 3ARRA 5FLVA 1FRGH 4PTUA 3BLBA 4PJBE 4MMXC 2WAHA 2OYKA 3VSTA 1MFAH 1JXFA 4YHNA 5AB9A 5ESQB 2R0WL 3VCLA 1FJ1A 4HWNA 3ZL4H 4AG4H 3P77A 4JRXE 3PDDA 2XZCL 3Q6FA 4LKCA 3T0EE 1ED3B 3ARDB 4BH8A 3IJYA 1BQKA 2O93L 4ZUSA 1P0SE 4EKJA 1GSMA 4F2ME 3LNDA 4NQVB 4BGLA 4QXUL 5BNXD 1T0PB 3GQFA 5AW3B 1LTXA 5F3HA 4LVEA 5DJCA 1JWSA 2P26A 3E2HB 3U79A 5F7BA 4ADJA 2C7UB 1JVLA 1ZHNB 3RKPA 1EJ8A 3QUXB 4XXWA 3IKCA 3UYRH 1SXSA 4IDLA 5CLZA 5C0AD 1ZANL 1NGYB 3BKJH 2PKDA 3VXPB 5EN2A 3QEUB 2JLPA 1MCNA 3EFDH 1ZLUK 1QLFA 4Y2DD 1BYPA 3FO2A 4AUYA 3D8MA 4JN1H 4NIYE 4HGWA 2ADIA 1TTRA 1E67A 3B4NA 1M7DB 3QH3B 3OF6A 4LMQI 5IJVB 5DFTA 2AXFA 4ZPTB 1GC1H 3T8MA 2Y9RT 4Q9CA 1G7LB 5DFVC 1RHHA 5DGQA 5I8CA 3PJNA 2W9EL 1OTSC 3PFUA 3BP7B 1MI5B 2DQTH 4GG6A 4WJ5B 3BO8B 5DXWA 4L29A 1QD0A 1RP8A 4ODHL 3ZO9A 2O5ZH 4MJHA 1L7TH 3NIGE 4JFDA 2PCPA 1WGOA 1W2KT 3SPVA 5D1XA 1JYVA 4H0LC 1MDAA 1B6UA 4DP8X 4JQXA 4JFFB 1U91B 4G3YH 1X7SA 4HLZG 5AOMA 2LVEA 2HX8A 3F6LA 1E27A 1WBXB 2NY0D 5DMKB 2APWA 3PIQB 4I2XA 4LEOB 2C3GA 5JHLA 2G9HA 2GI7A 5EEYA 3AS2A 3ESVF 3F7YA 3CC5A 2Y7LA 2FTAA 3CDGA 3CCHA 4JRXD 1UASA 2R1YA 3MDJA 3T0ED 1H9DA 1RULL 3QNFA 5HVFB 2KZKA 2UXGA 3BRFA 3Q0HA 4KXZH 4UV7L 3ZGHA 3K4ZA 3KGSA 2DQCL 3NCXA 3Q3GA 1L9RA 3DMMD 3GPSA 3H4FA 3FRPB 3AM8A 3PWLA 5DEFA 4LCCB 1XBDA 3VFWB 5GS1B 1TFPA 2VWEE 1H6UA 1ULVA 4XB7A 4X6DB 4XN1A 3GF8A 5EU4A 3L7EA 1TJGL 4L3EB 3Q8AA 4WI9A 1MCPH 2BSEA 3EW3B 4PJEB 1C16A 2HT3C 3DPBB 1N8OE 1RIUL 3OGOE 4AVJA 5IZ7A 1HHHB 1CB4A 1HHJA 3UPRA 1K9TA 4JGUA 3U4BL 1B2WH 1BZEA 3X1NA 1DFBL 1UC6A 4JO8A 4PRAB 2QV2A 1YYCA 4RAUA 1OGSA 4YBQD 4PS4L 1YZZA 4HIEB 5EZIH 5FFGA 5D1ZC 2QTVA 3T8XB 3ZYIA 4NJAL 4D8OA 1E3XA 1S9WA 1A2YA 1YNLH 2IDQA 4KY2A 3C5JA 1D6VH 1K72A 3JWOC 5JDSB 5K9JL 2CIIB 4J6RH 4BBWA 4JFZH 4YWGH 3W37A 4JO3L 4U1HB 3TBWB 3H6JA 2QMKA 5DA4A 1H15B 4IEFA 4LVHC 2BP8B 2AXWA 4B5ZA 3FB8A 4LSUL 5F0JB 3GRWL 3S36L 1MG2C 1T03H 1NAMH 3UPCA 3P4NA 2FL5B 3C6SA 3GTTA 2FR4A 4BWTA 2OSWA 4U1GB 2NSXA 2IPTH 2XRAL 1EAPA 1PKQE 4TSAH 1A6UH 3NOIA 4WHCA 1SEQH 2FIRT 3IJEA 2AJ3B 4G6ML 3HI5L 3TTSA 1F6FB 2EO1A 2F5AL 4I0PA 4LAJH 4BFKA 2NTFA 4GQ9L 1OHQA 1AXTH 3FU9A 3QUZB 4XPBH 3X1FA 4XE0A 4F9LC 2GBVA 1EJ6A 2R29A 3MBWA 4ZNCD 3N0AA 1IO4C 1Z9NA 2JIXA 3RGBA 5IHZB 2EE2A 4M4PA 1YEHL 4WEUD 3IDUA 1D2PA 5LB1A 3T6XA 2HFTA 2CLVB 4GAJL 3GMPA 3ZE1E 3EJZC 3IMVA 3LEVL 5FUCC 4QY8B 5I66A 2D4DA 5AWNH 4GBXC 1GHFL 4LCVA 5EU7C 4NKOB 1R34A 3QDGE 1CLVA 3VXTB 1DDTA 2NYZA 1AKJA 1RPQA 4KAQL 4LSTH 4G8IA 2AW2A 3PGCA 5DZLA 4YHMH 4F8OA 1Y7VA 3GSXA 5I1GL 1QI3A 5IV2A 1C12A 2OXGB 3UTTE 4Y2OA 1S5HA 1JNLL 2FB4H 5I28A 4IRSC 3V4VH 2MIZA 4GXUN 1KB5A 1AGBA 1RV6X 3SY0B 4ENED 1H8NA 2QSCH 2EDNA 5F1SA 2HTLD 3RWGA 2XQYK 3T0BA 4BUHA 5I73B 1XEDA 2VR7A 4PGDA 1NPNA 4GRLA 5I1HH 3KGRA 2ITDB 3K6SB 4HJJL 4HQQH 2ED7A 2DQMA 4XNYH 5I1IL 3DX9B 3E80A 2SODB 4JLRB 4H8WL 5MI0C 3GJEA 2ZAHA 4FXGB 1OAUL 2DEXX 5D1QB 4DCQA 1ICTA 1G7HA 1X5FA 3W2DH 4Y19A 2WQWA 1W8EA 3NFPB 5IG7A 1L9OA 1LNUB 4W4NA 4M5SA 3JSSA 3ARVA 3EBAA 2WMPB 4WW2A 5FYKH 4JKWA 4NZTL 5JW3H 4YSRA 3GXNA 3FT9A 4P9MH 1HNFA 5C0CA 2X0VA 3TH3T 4NPYB 5B1BB 3PAZA 1Q1JL 2WBXA 3CBJB 4N2NA 1OF2A 2R2EB 4Z1PA 1T6WA 3FNKA 2PF6A 3B9KC 3HMWL 3SDYH 3ZTEA 3RNKA 1BF8A 3NFNB 2E7DA 2VSMB 1DBKL 1CIDA 4EI6B 3I75A 3KH3A 1SHMA 3PQYB 4UQ2B 4XMLH 4MAUL 4RMRA 4L9LB 3REWB 3RKDD 2XC8A 4UILH 2OXHB 4S1DC 3TH4T 4ONGH 2G75A 4OAWA 3UTTD 5LG6A 4MAYA 1YEEL 3KXFE 1M7IA 4XO5A 1F90L 3EOTL 1KXQE 4P4KC 2WIMA 4D0BB 4EI5C 4QRSB 4IBTA 4PRIA 4W9CC 3ZHDA 3BSGA 1T7XA 1RZGB 1LD9A 2R1WA 2HFGH 4R4FH 3BAIA 3KPSA 3VA2C 1DZ0A 2H4EA 5EZLB 2KQNA 2BNRB 1UZGA 1S9XB 4N0CD 4JFQB 4N0UE 1L7IL 4X5LA 4Z7AA 4X5RA 2VL5B 3SCMD 4ZQKB 5LBSL 1L0YA 3WKPA 3O2DH 3QJSB 3QQDA 4PBVC 4HS6B 1I9RH 3HC3L 4JKKA 3F5WA 2BW4A 5TFSH 2Y1VA 3TEXA 1DBJH 5I6XB 1P4BH 1I1RA 3BPNC 1U6AL 4YH6A 5IWLA 2OSXA 3RVVC 4N86A 2EXWD 5F7DB 2XA3A 4D9LL 2X7LB 2VLJE 4WHDA 1II4E 3ULUE 1C08A 2EVHA 3AXLA 5EU5B 4G7VH 4ALAH 4C4KO 1T0MB 4HH8A 5ESAA 4UTAH 3GHPA 4DPCX 2VABB 3FUDA 3FSOA 1OTTD 5C9KA 4N2FA 5BZZA 4ZX6A 1XMWA 4WENB 4APXB 5DRXA 4NO2A 3ARTA 1IE4A 4EO5A 4EMZA 3EOYG 2EVIA 1ZVSB 1JZGA 2OMUA 1ZK9A 3GZQA 3KS0J 3OJVC 5H4ZA 4D3CL 1ML0A 4Q0XL 4CSTA 1EFXA 2WKGA 4WI6A 5E5MA 5E56A 3TV3H 4X6CA 5CF3A 2WINB 4X6CF 1GOFA 4POZC 4HXAL 2PUQT 1RUMH 3VFOA 1DQDH 2CO7B 4OD2A 3RRQA 4BFJA 4U1LA 1LMIA 2YMXH 5LJYH 3MPCA 3VJ6B 5ITFA 2E27L 2H6OA 2CKBL 4OJYA 3KXFD 3A4AA 3DHJA 2O5XL 2UVFA 4YSPA 4IOFC 1IIIA 1VACB 3NIFE 1JL8A 2BSSA 1P7QA 1AGCB 3MJ8A 3UYPB 3X17A 4F1ZA 2KERA 2ATKB 2QKIA 2Z7WA 3VH8G 2UXVA 2DTML 5DURD 3PP4L 4PJFB 2A4ZA 2DLEA 2BZDA 4Y4FC 4U6VL 2QVMA 1LWHA 1QYGH 1UB5A 2NXZB 4JR9H 4UNTA 4YUEL 1KIUB 4WKXA 4J3VA 5AW4B 4G1MA 4IKKA 4PHXA 4YAQA 2BW5A 5FOBA 4KRPD 1RHFA 2G3XA 1AG0A 3P4OA 3Q2WA 3TYGL 2AZUA 4KWUA 4ZPVB 5IK3A 1FLRH 1SYSB 4RA0C 1A7RL 1KJ2L 4HK0A 1UEYA 3GD1C 2MMXA 1S4IA 3I50L 3MRMA 1ZA3A 4P49A 3GRBA 3TBYA 8CGTA 2F7IA 5E00A 2WC7A 1GYUA 1S7RB 4MCZB 3ME0A 5DK2B 3AWGA 4M48L 1JI2A 3RGVA 1M7UA 1ASOA 3IAQA 2VLJD 3ULUD 3LHPH 3QCUL 1UJ3C 1BAGA 4APQB 4NCC2 2KMWA 4JPWH 1WS8A 3VU1A 3WIHH 3KPPA 1WISA 5CJ8A 2VMDA 1TQTA 4PJCE 5KYUA 1K6QH 1VA9A 1IIKA 2ZWKA 3AT8A 4L2LA 2A9CA 1OK8A 2ZNXA 2GIXA 4IK7A 1A6VH 1JMZA 1HSAA 4JHUA 3WEXA 3VH8A 1PZ2A 1DQTA 5GISH 2C1PA 2VW4A 4OGYH 3ZSTA 4LFHD 4AXWA 43CAA 3KDPB 1YN6B 2LFGA 1U2HA 3GHBH 2NUTA 1EO7A 4WDIA 4BKTC 3CSFA 1S7QA 3RTLA 3CJJA 1IEAA 2DAVA 3KE0A 1ZT4A 3OV6A 2A6KA 4OZFH 3BMVA 1OSYA 1TMCB 4GKNB 5D7JA 3TO2B 5EO0B 1EEQA 4CN1A 1RZQA 3TA3B 4JFXB 4LL4A 1X9RA 4LE8A 1BWMA 1FFQA 3U7YH 1H3TA 3ISWA 4PJ7A 5BXFA 4NDMA 4PJ7F 2HJFB 1RURH 1HQRA 3V6OC 5I17B 5I6KA 5AYQA 2R8SH 2WSDA 1XCQA 2DLIA 1MFEL 2ZCKL 1A3RH 2XCMC 3ARQA 3M1CA 5EO1A 1MNNA 1F4WH 1OK0A 2VXQL 3B2UD 2XYCA 3FZUD 5IVXA 1GRWA 5IVXF 5GRYA 3JWNE 2KDYA 2YK1L 4UI2A 4L4VE 5C2BL 1PLGH 3SSGA 1RZPA 2GITA 3QZPA 1KEML 4K5OA 5CEYA 4F3FA 1OSZA 4P2QE 1OGAA 3FCGA 1IU1A 5FYJH 3ARFB 5TDNB 3RDTD 2MJWA 1E8WA 1LO3L 4XBEL 4NT6A 4FJ6A 4PB0L 5JMRA 1O5PA 1E40A 2V3FA 2ZP0T 3MCLH 3MACL 4JANA 3WG7B 1ITCA 3X11B 2CO6A 3AB0C 1IAOA 3O3EB 3O3DB 2W91A 5HYEA 3SBRA 4Y4HA 3QXUA 3QORA 1JERA 3JWDC 4LDOB 5HDBE 5BVJB 1TEFA 1IC7L 2W07B 4HS3A 3P0GB 1FNLA 1BQSA 3GSNB 1JFQH 2N1KA 1MY7A 2V37A 2BWIA 3A24A 1W72B 4LOVA 4E9XA 1Q72H 2EEBA 3O11A 4PREA 4L0ZA 1I82A 3CBRA 3ZO0A 5A43C 4LCWE 2EIZB 3O4LA 1O6SA 5CJOH 1IGMH 4P59H 3AWEA 4KX8A 3IJ9A 3MJ7B 5DRWB 2F6AA 5H2BA 2BFGA 4N4YB 5CIPB 1QZNA 3BIKA 5D2LE 1KTBA 3NJNA 5E23A 4FFYA 4FX5A 1MEXL 4M3HA 4XP9H 4XTRC 3HOGA 1WIPA 4ZFGL 3IDNB 2FJSA 1XZ0B 2O6PA 5BVPH 1ES0A 2Y36L 1U33A 2GUOA 2IPKB 3P4LA 2GK2A 3O4OC 3PWJA 3AABA 1NINA 4J7RA 2WXOA 3VTTA 3ULSA 1QA9A 5E8DL 5DJYA 2WQVA 4HCRA 5EF3A 2X9WA 1EEUA 5L8JB 2E4TA 4JFTA 2Q6WB 1S3KL 1SMOA 2OX5B 4DP7X 32C2A 1SY6L 1WCBB 3CH1A 5IMOB 1ZOXA 4L4VD 5TQ0H 4YHLH 1UTDA 3HW7A 1RUQL 2ICWB 1LDPL 4JHAH 2GSIB 4P2QD 4WUUA 4AL8C 3K71B 2N01B 1N4XL 3T2OA 2HTKD 2W0KA 4HUCA 4WI3A 1RUAL 3ZUCA 3P69A 2WBJC 3V4PH 2X6MA 3I6SA 4FFWC 3BP4A 1CU4H 3JYCA 5F71A 3BT2H 3IJSA 1I7UA 1UACL 3S5LB 5FCUH 1HHGA 3S96B 1J5OH 1CICB 5TGBA 1Z3GL 4ZW3A 1I3GH 3L5HA 1JWMB 3DV6B 4A63A 1WP6A 4FG4A 5LLIC 1OM9A 4L8BB 1PKOA 3D08A 1GJIA 3SHSA 2YXMA 3TO4A 3RHWF 3O9WD 3IGAA 3PV7A 4ZO7A 4NN6B 5INCB 5FK9A 2DYRB 1XCTB 3WNOA 4KJWC 5E6IB 3UBGA 1X5JA 1AAJA 4WI5A 4LLDA 3EJUA 3RG1C 5TE6H 3GSUA 3VG9B 4ANUA 2X09A 5HJBA 2GJJA 5HYFA 1FFNA 3HKZA 3QWRA 4J1UB 3H85A 3CZKA 3JTSA 1I7RA 1PCXA 4FQQA 1GC1C 3W11D 2ZD0A 4XVOA 1JAEA 5DQ9B 4OFYD 3V0HA 3CVIL 3UFIA 2ZE0A 3QNXB 1G5GA 5M94B 2P7TA 1ADQH 2GG1A 4WWPA 4M4RA 2AKRB 3IDIA 4MMYA 3HC4H 2VSDA 4QAWA 4DVBA 5B39G 4U1NB 4FQLL 2VDPH 5DFVD 3TYFB 4NZRH 1KCRL 4BHUA 1R5WB 4JKNA 4NOBA 1OTSD 2XTJE 3OVUB 4UNUA 4LP8A 2QGDA 1JGLL 5E8PB 5C0NC 1CGTA 3C5ZC 3TCTA 4CDHA 5IQMA 3R4DA 3FUNA 4OIIH 3HI6L 4O2EB 4XOBA 1WWCA 3T0DA 5KYXB 3C6LB 1BX2A 3MGOA 4X4XA 5E6ZA 5DJZB 5K39A 1T1XB 2UVEA 5K1JA 4W6YB 5DR5L 1R3KB 1BAFH 2EDEA 1DJHA 1QG3A 2BCKA 2X6CA 3CWGA 1F0LA 1RJZA 5L0QC 3OSKA 1XF5B 4N2EA 4NKDB 2BVQB 1NUFA 1XD0A 3IU4H 3OLEA 4F7MA 3O3UN 5D5MB 3ARBA 4GW4A 4U7MA 1FGVL 4HG4K 2YN3A 3GK8L 3LN5B 4PRNB 2XICA 2NNRA 1MIMH 5CXPA 1ASQA 3HZYA 1CD1B 1U8PB 3DV4B 4XPFL 4OZGE 3GXMA 5C0AB 2X4RA 4JO4L 3G6JA 3T0XA 1MFDL 4S10A 3U30B 3G6JF 1E4XH 2OSYA 1URZA 3K0YA 3QAZC 5DHYB 1YJDH 3DUUB 4GH7B 4OCNC 4DK3A 1LGVA 4M6MH 5B39A 3C8DA 3C60C 1T5XA 4BWWA 5DEGB 3LS5H 5IJKA 3RIFK 1UXSA 3LV3A 4JFYB 4EVNA 5CLTA 1VGKB 2C9UA 5JW4N 1BVLB 2G3NA 1KGCE 4HPYH 3H2PA 2MCMA 2DI8A 3FSVA 2WAQA 4FQ1H 1AIFA 3MLUH 4XVUC 1QEWA 4JFSA 3SKMB 4X80H 3WN5B 3L3HA 3VRIB 1UKQA 3UADA 4GAYB 5D1ZD 2FK9A 4CVWA 5IKCA 1AZNA 1P84J 5E8EB 3J07A 2NYYC 4OF8A 2XTJD 4KKRA 1OWWA 3WTWA 2CBOA 3QZWB 3W9EA 3ZX1A 2FUTA 2O6FA 3Q05A 3B6SA 4YXHL 2Y5TB 5IQLA 1G6RA 4PJBB 5J4MA 2HMID 3IGFA 4L8DA 3FRUB 3T0AA 4JHZA 1CDYA 4C8XA 5LGHL 4YDJA 5F97E 4X9HA 3QEGH 4JRXB 1KJVB 3FXIC 3T0EB 3VD7A 4HJEA 2HVBA 5ESVA 2UY7B 4F2MB 1T7YA 5D4IA 3BH9A 1T1YB 4N2MA 4QHLA 3DHUA 3L3KB 2AJZA 5GGRB 3DMMB 5FO9B 4OLVH 3E3QC 1KG0B 1JTPA 4UT9H 3Q8BA 1U92A 2LVCA 4JJ5A 3BZFB 2OZ4L 2QR0A 3CFUA 1H3WM 2R27A 2YKLL 3ZQ9A 3B56A 5J13C 1CIUA 2VGLM 3ROLB 4U0QB 4G6AC 5GGRY 3ZIMA 2FX8L 2HUEA 4DTGH 1E7UA 2HX9A 3FQUB 3IE9A 5ESQA 5GRVL 4E36A 3ULVF 2QPUA 1PF3A 2BP0A 1EK3A 5GHWL 3TJPA 3V6FB 12E8H 3IDYB 3CK0L 1NPUA 4KKAC 4XCNB 3T9WA 3SEPA 2X4UA 4CGTA 1FPTL 1KTRL 2BVPB 1HWHB 5I6OA 2WGNB 4JPKH 1OP3K 5IESH 3OPUA 5FW7A 4UIMA 3ZKXB 4MXWL 1KGCD 2J71A 1HI6A 4MB1A 5LG1A 3G08B 1MJUH 3PXJA 1LE9A 2C7UA 4ZNEA 3O81A 3QUXA 3MC0A 4LCIH 3NIGB 1J12A 5JQIB 1I9RL 2ZJSH 3GSWB 4U1MB 2ZXCA 1TSRA 4LQFL 3IXTA 3L3IB 4ANVA 2PPAA 3BVWA 4FI7A 4XVSL 3QE5A 4U2YA 2HKHH 4EIZC 3P0YL 2G9KA 5KJRL 5DWUH 4M1GH 4NFCA 1M7DA 2YC1B 5IJVA 4ZPTA 3VX0A 3FRPG 1G7LA 2EQDA 4P2AA 4N2GA 5DS1A 1JXDA 1BOGA 3DIDA 4OCWH 1ZHBA 4YDKL 4HC1H 1MI5A 2QPDB 3A6BL 4R4BB 4WJ5A 3ZXAC 3CFNA 2F53A 1RLBA 2JK5A 2ZWLT 3F7VB 4MD4A 1H6TA 3KWUA 5C0FB 5IQ7H 3A22A 3N42B 4HAGA 4TNEA 1A7QL 1H3GA 2YAFA 3R1GH 1ZEAH 3LPFA 2MCPL 5EEWA 1R17A 2G2RB 2BCMA 4JFFA 4BDVB 4Q52A 3QUMH 2BXYA 4HUNB 4P5KB 3DSFH 4RA3A 2M83A 1O9WA 4TL5A 1NCCH 1WBXA 2BSDA 3ZTNL 3BPCA 4LEOA 3UX9B 3CFCL 4JO1L 3AZUA 1G4RA 4IIQB 1EMTL 4EN3A 3US1A 4XVTH 3NG5A 1NGQH 4GKOA 3O8XB 1HS6A 3AG3B 3GSVB 1DJSA 1TZHB 3HZMA 4YHZL 1YY9C 4XMTA 4M7JL 4YHKH 3B9KD 4OCSH 4YNYB 4H20L 5ANHA 1JZ6A 3FT0A 1FSKB 3QVAA 1OARL 4YL4A 2I7SA 4PRPE 3FRPA 4S1RH 3PAVA 4JM2C 4XMPL 4EUPB 1FLTX 4J5VA 4AC2A 4G8FA 2VDQL 4S1DD 5DZAA 4X6DF 1Z7JA 4L3EA 5LBSA 4KK5C 1LILA 4OZIA 1VPOH 4IBZA 4PJEF 5BW7A 3HS9A 4P9HL 1W0VB 3MTXA 3KL3A 1YEGL 1HHHA 2VMEA 1DN0A 4GKZA 4N8PA 3K1DA 1U3JA 3BWSA 4YSDA 2APXA 4MA1C 1J9RA 2XVKA 4W93A 4YBHA 5T1JA 1FAIL 1KBPA 4MQ7B 2ZQKA 4PH8A 3WEOA 1UYWH 4HJ0D 3S37X 5A3IC 1QUPA 1PKQB 2WN2A 1J0JA 4JG1L 4UQIM 1CDJA 5BQDA 3T8XA 1H3PH 5D9SB 3VVVA 1R0AL 4WY7H 1Z5HA 5DJ8A 3RZWA 4H2CA 4JFPA 2RIKA 1M42A 4Y5YC 5BV7H 1IZKA 1QNIA 4JN2A 2F8OA 4NZUH 4YDZA 3TBWA 1UD8A 1CQKA 1SXNA 1H15A 2IBGA 2MQGA 4NI6A 1SN2A 3U48A 2OS7A 1DJIA 4IDJL 2WZPA 3GBLA 1T1WA 3VRLE 4P57B 2EVGA 1JZJA 5CLWA 2DKSA 1HH6A 5I15H 5BZWB 2EDLA 4ATTA 2WVSA 4GAAA 1JN6B 4WSGA 1QFPA 5KSAC 1XXFC 4JZJC 2RFXA 5JO5A 3ZE1B 2CK0L 4WTWA 1IAII 2AEOA 3D2TA 5HVGB 4ZUUA 5T5FH 2D7TH 1D9KD 1Q9KB 3D2UA 3DGGA 4FCHA 1D7BA 2BMKB 3QDGB 5JHDD 1ETZA 2HUHA 1BG9A 3QUZA 2X2HA 4G6KL 2A2QT 4I3SH 1UT9A 4W9IC 2E47A 2F61A 4YMPA 2JI3A 1JZIA 1CXEA 3P9LA 2OMZB 3QIBB 4OJEH 5IM7B 3WMPA 1JK9A 1DBMH 1G7PA 1L5GB 3F58H 4NRYB 4ZAKA 4PRPD 4K5PA 4PRBB 3DRQA 2EEXA 1B4TA 1JGIA 4POUB 3RPKA 1EDYA 1KV7A 3V6ZB 5FUZL 4BZ1L 1DN2A 1G9NL 5EUKB 1IBGH 3R8QA 4ZO9A 1V55B 4EI0A 1E6OH 5D7SH 4WFGE 1WRFA 2EYRB 2X2UA 5L6YH 1NLBH 5C0RH 2FWOA 3EJRA 3RE0A 2ADFH 4GSUA 5T1KA 3TONA 1NQBA 3G7TA 3RGHA 2OXGA 4R97B 3SCMB 3BUYA 4NBZB 3WLBA 3UAJA 2GFBA 3K4DA 3K72A 2O72A 3SY0A 3LZOA 5LWYL 4KJQC 4LARH 3D0VA 5DUPH 2E7BA 1J9CT 2ZNWA 3WGVB 1BMZA 4N6RA 2M8XA 5EIQA 4Z8FL 3KL0A 1IAIL 2H3XC 4JLRA 1PU0A 3DSNA 3QJQB 4L48A 5JHBA 2WXKA 1NFDA 2ED8A 3MLSH 4NXSA 3VD3A 2J72A 5IQOA 4Z0XB 3TL5A 2Y07L 3TJEH 5IHBA 3ENEA 3I3DA 5DZPA 3QHTC 1KGXA 2XETA 4RQQB 5DO8A 4YO0B 4G43B 3WIFB 1TF4A 1IKNA 2BC4A 5I75B 4MD5A 5FFLA 1MHPL 3V7AG 4J27A 3GSQB 3OR6B 2ZX5A 2J6EL 3QPKA 1MCWM 5M7QA 1IGIL 1NBCA 1S8DB 3E9UA 2Y3NA 4Y4KA 3SE3A 1D2OA 2WWMC 4KDWA 4IS6B 5AVVB 1NIFA 1P5VA 3KXFB 4JDTH 2VERA 1CXFA 2NY6D 3BW9B 1U95A 3L4WA 1CTOA 1BGXL 5EBLA 3F3HA 2VQ4A 2AQ2A 2XYBA 3NPSB 4GI6A 5FLUA 4XP6H 5HPMA 3ZYJA 5J9PB 1JFHA 4TVPH 2YPVL 4HKJA 5I1KL 3VRJA 1F6AA 3L8QA 1IAMA 2VDNH 3PQYA 1MJ8H 3V9EA 1LEGB 3L5JA 5LGJA 3REWA 3I2CL 2DQFA 1QTYT 2OXHA 2E7LC 3V4UL 3K2MC 4KRPB 4Y9FA 1UZ6E 4LASL 4IBSA 4LHQB 3MA9L 3V8OA 2I27N 5IUSA 2P24B 1QKZH 3GNMH 1KPRB 1ONQB 4Q2ZA 1QEXA 1M7XA 1PZ5A 2DRUA 3HE7D 3O3AB 4QRSA 4Y1TA 4CILA 2X9XA 5GRVK 4FE9A 5E4EC 3CFTA 1RZFL 4XC1H 4YDVB 3B7RL 1BZQK 2E56A 3IDGB 2VLJB 4H1LG 3BKCH 1KN2H 3PHAA 1DBAL 2ZXEB 3MCKB 3OKOA 2BNRA 3SE6A 2D7OA 1S9XA 4ODBD 1PZUB 5IEHB 1U93B 4JFQA 4HWZB 4P0DA 5K33A 5I0VA 2XTSA 4O02B 4FMFA 3TPUB 5EEUA 5DHEA 3RJDA 1TNMA 1YUKB 3OGCB 4FJZA 2WQSA 3LEXA 4B9IA 5J6GB 3ZN6A 2JVUA 5K59E 1T04B 1MVFA 1G43A 2J1WA 4YHIA 3NFSH 4FFVD 4NFDA 4K8RL 4PUBL 2RJMA 3MGTB 5F8RC 5E9NA 4JEGB 1K85A 1V3JA 4P2OB 1I1YB 4UM9A 4PLNC 3TVMC 5F7DA 2NT1A 2VRKA 2EUXA 2X7LA 1A5FH 5EU5A 1MCWW 4CMHB 2AGJL 2X4SB 4PJDA 5GSVB 2PO6A 3Q2NA 3WUWG 4AMKL 4PV9B 2VABA 4DFIA 4DF9A 4Q9RH 1Y18B 3SGJC 4DERA 3NIFB 1ZLSH 4LVOC 2FJFB 3HKFA 4PJXE 4PW3A 3RWFA 3SBPA 4APXA 5CGTA 4BFFA 1BM3H 2P47B 4HUKB 3AY2A 1MQKL 4A2HA 5E0QA 1SY6A 1YQVL 4AZUA 2N0MA 4XNXH 2YRPA 4KKLD 5AUMB 5HJDA 5ICXB 5F9JB 2MPAH 3JTTB 3VI3A 1F1GA 1Q8MA 1XIWD 4H1LA 4HGMA 3LH8A 2WLIB 4IOIB 5IROD 4R3SB 1YPZE 2D7PA 3EDDA 3L3OB 4QRQB 4XTRD 3OLGA 1QFWI 4OQ1A 5GRJH 5PAZA 1SLVA 1JWUA 4S1QL 1ZDQA 1J10A 3WNKA 4JHWL 5HVHB 3RDTB 4GUQA 4OJAA 2WJ7A 3UYPA 3W5MA 1J9TA 3FTGB 5E9DE 5DJ0B 1E5UI 1YYLH 4U1SA 3G9VA 4PFEA 2BOBB 2QVIA 4FQJL 1YEFL 1CFNB 4CJ0A 3LIZA 2FYYA 2E86A 4NQDD 3BVUA 4PJFA 4IIZA 1JPFA 2ZUXA 3ELAT 4PJFF 5TDOB 3SZKC 3A67L 4PCKA 3WUWA 1NJ9B 5KYYA 3BPOB 1X5ZA 4QHUA 1ZTMA 1WBYA 4ZPVA 1I1AD 1XB3A 4DP1X 2QQNH 3O2WH 2MKLC 1UG9A 3KBFA 4MCZA 4XZUB 4M5TA 3GSRA 5DK2A 3SBWA 2ZXGA 1N10A 5D1XC 3CLEL 3WFDH 1I8LA 5PCYA 3GSOA 1PL3A 4AYSA 3CDZA 1MXGA 2KBGA 4JQXC 3Q7JA 2FBJH 3IFLH 5DRZA 5GGTH 1SJEA 5KJ4A 2DYPD 2L7JA 3OB0H 3C8KB 1J5DA 4BZYA 1JGUH 1P5UA 4FQIL 4RGOL 1AR2A 2C9AA 3VXSE 4KUZL 3MLVL 1RJLA 2HFFA 4LSQL 1F3DH 2TSBA 3D12B 3H56A 3MRFB 3QCVL 3RB7A 3DVNB 3ABZA 4BK8A 1DEDA 4YE4L 1QFWL 4XGZB 3X1BA 2EAEA 4FFZL 4MZIA 4KY1H 5HI3C 1OSPH 2YAMA 3QXAB 4A6YH 1L4IA 2OMNA 1YN6A 3KBEA 4L8CB 1IC4L 2PP8A 5ISZE 1G9EA 1PMYA 1X5KA 3Q1EA 4L4VB 3NACL 3AM8C 4X7CC 2BSRB 4Z7QE 4P2QB 4S1SL 5AOZA 2WV3A 3BAEH 4X8JB 3U46B 3VFNA 1NCBL 2ZOTA 3F7PC 4I18A 4JZNB 4F2EA 5E9DD 1EPFA 5DQDL 1KLUB 1GGCH 4ISVB 5C0ND 2BIPA 1ACXA 3HS0B 5CU5A 3K5SA 3NBNA 3UTSE 5I17A 3VGAC 3PNWB 3QWOB 2FEEI 4Q6IB 3MLXL 4C83B 1Q90A 4OTXL 1KIPB 5JUEL 2BWDA 4IRZA 2ETWA 1NOAA 3O9WB 4LBEB 5F1IA 5B8CA 4ILDA 5KS9A 4L1LA 3D1MC 1DZBA 2EIDA 3LNIA 4HIHA 3ARFA 3KBPA 4LHJB 4H0IA 3APMA 4HVBA 1V5JA 3MV8E 4K7PL 3UG3A 3OQ3B 3Q48A 4R6UA 4LCWB 4MHHI 1TYEB 5BO1H 1NCTA 3QYNA 1JGDA 2VDRL 2L0DA 4WZ9A 6CGTA 3GINA 2DWXA 3WV0A 3X11A 2B1AL 3DO7B 4LSSH 3FFCE 1ADWA 5DFWH 3BEWB 1BFSA 5GGVL 3NIDB 3UBXI 1ZIAA 1PNDA 3EZ8A 4I1PA 3WXWH 3QQNA 4HIPA 1NEPA 4UM8A