1IBHA

X-ray 3d structure of p.leiognathi cu,zn sod mutant m41i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGIHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ibhA00
5KBMA 1OZUA 1JCVA 1DO5A 1RK7A 3MNDA 2AQTA 1U3NA 3GZPA 3KM1A 1SDYA 2ZOWA 4MCMA 2Z7UA 4U4IA 2WZ0A 3LTVA 3CQPA 2VR6A 2WZ5A 1L3NA 1YAZA 3F7LA 5CU9A 1BZOA 2Z7YA 3H2PA 2WKOF 2VR7A 3PU7A 4BCYA 2AQSA 1IBBA 2E47A 3GZQA 1BA9A 1TO4A 2NNXA 1N19A 4A7SA 1E9PB 2C9SA 1E9OA 3KH4A 3GTTA 3KBEA 3F7KA 4BCZA 1JK9B 1S4IA 1DSWA 1UXMA 1SXBA 2WYZA 1XTMA 2Q2LA 3ECUA 3KH3A 1UXLA 4MCNA 3SODB 2GBTA 2JCWA 4A7UA 1EQWA 1COBA 3GZOA 1E9QB 2C9VA 2JLPA 1PU0A 1SRDA 1OALA 1F18A 2V0AA 2AEOA 5KBLA 1F1DA 3ECWA 3ECVA 3RE0A 3CE1A 2SODB 1HL5A 2XJLA 3GQFA 4BD4A 1YAIA 1E9QA 2APSA 1AZVA 2GBVA 2AF2A 2VR8A 2WZ6A 3KM2A 2E46A 1CBJA 4FF9A 3L9EA 1FUNA 1B4LA 1JK9A 1SXAA 3HFFA 2Z7WA 1E9OB 2GBUA 2LU5A 3L9YA 4N3TA 1B4TA 2C9UA 1OZTG 1P1VA 1F1AA 1TO5A 4A7GF 1IBHA 2AQNA 1F1GA 1YSOA 1MFMA 1HL4A 4A7GA 1OAJA 1XSOA 2WWNA 2WWOA 4N3UA 3GTVA 4A7TA 3H2QA 3QQDB 1SXCA 3T5WA 1N18A 4OJAA 1CB4A 1E9PA 3MKGA 3KBFA 3HW7A 2ZKYA 1XTLA 1EJ8A 1KMGA 1SOSA 2Z7ZA 1PTZA 3QQDA 4A7VA 1SPDA 2XJKA 1IBDA 1SXNA 2ZKWA 1ESOA 1Z9PA 4OH2A 1IB5A 2AQPA 1Q0EA 2K4WA 2ZKXA 2WKOA 3CQQA 3S0PA 5KBKA 1SDAB 3K91A 2R27A 1SXSA 1PZSA 1SXZA 1IBFA 2AQRA 4L05A 1OEZW 2WYTA 3HOGA 4A7QA 4B3EA 1QUPA 2AQQA 1Z9NA
chains in the Genus database with same CATH superfamily
1P84J 4WSJA 4S1SL 5ABDE 1P5UB 1QEWA 3QFJB 2GUOA 5KSAD 4GRWF 1KCVL 1JS4A 2FYYA 4E5XB 3P3RA 1O0VA 1ZEAH 4G9FD 4GW5A 1J9CT 1ZIAA 3HAEH 1Z0NA 4NC0B 1T2XA 4QY8B 4WK4B 1RY7B 2ZCHH 1DQDH 3O3DA 2AQSA 1RZPA 3DLQR 4PLKD 3WO4C 4LLYB 2CGYA 1LM8V 3U4BH 1EO7A 1XGTA 4WI8A 4XNQB 2Z31D 5DGRA 3SD5A 3QPXL 5BW7A 3HBGA 4WGKA 1D2PA 1RJYA 5FO7B 3OKDA 3U6XA 4AVHA 3G5ZB 4D8OA 4PJAA 3QXVA 1UXLA 2H5UA 3P54A 4YIQA 2WXIA 2YR3A 3R7RA 3A4DA 5HHVL 5DO2D 4Z0XA 3LV3B 4Z77B 3B7RL 4PP1D 5D7SL 3ZGIA 5F72S 3TBCA 4DKTA 1YEGH 4YSSA 2DL2A 4Z7AA 2ADFH 4MMXB 4IHOB 5E70A 3TPKA 3WN5A 4PRNA 5CZVH 4Q74A 2HG5A 5DMJB 3WAKA 4LVNB 5KVEE 3GXTA 5E6YA 4X99B 3C9NA 1KYOK 1J0IA 1YEHH 4NSKA 4GSRA 2V2TA 4TSAH 4GXFA 2WBWB 4PJXE 2WXRA 4R7LA 5LG1A 4D0CA 4PJCE 2NY1B 4U0QB 4XVSL 2IDFA 3BFOA 3EZ8A 3HR5A 4G80A 3WCYA 1PBYA 1NEUA 4BZYA 2Q2EB 3IFNH 2ZNWA 2UVFA 3VXSD 2ZXWB 5SWSD 1N26A 5IFAH 3D06A 3MCYA 5CN3A 1NINA 2GHWB 1UADC 2M26A 1ZMYA 3BEWA 4X80L 3FFCA 1ZEAL 4A2MA 5C8JA 3MV11 3MCG1 4LOVA 1CGSH 3VGFA 1FH2A 2APXA 1A65A 2XKNB 3AQXA 1CGTA 1XTLA 4GQZA 4QO1A 5E6IB 4HAKA 4JRXD 4LF3B 4MZRA 3QQ3A 4OFDA 4KGLA 3EH4B 4YN3A 3TO4A 4CVXB 2OLDA 3CQFA 1YUHA 2QQNL 5DJXB 4HKJA 3T4YA 2FECL 3RWJA 4I85A 2P3YA 4AKPA 5AYUL 2AQ2A 2HFEB 3MKKA 1LE9A 4YSTA 2EDNA 1PFOA 1ZLWH 3C6SB 2CBOA 2ZWYA 1A7QL 2B1OA 2P5WB 3LZLA 3MUZ1 3EFOB 3ZKSD 1N64L 1INDL 1MDTA 5I71C 5KW9L 3V6ZB 2P26A 3FCUB 3EJZD 1MXGA 1WD9A 3LSOB 5IEKB 1AHKA 2AK4B 1R3HB 3DWTA 2HT4D 4U0RC 4U6HB 2FWOA 1A2YA 1WICA 3MNDA 3E6FB 3ZL4L 2A4EA 3BN9C 2EVGA 2PW1B 2Z0BA 3CXHJ 2DMBA 1DANU 4LKCB 2BNRD 1OWRM 1RHHB 4GAYB 4NKOA 3DHJA 2CXGA 3TN0B 3V2AR 4QWWD 5BZDA 3LV3A 1NGXB 4TLUA 4I0KA 1ZXKA 3REVA 5JOPD 4F7EA 3FO9B 4A6YB 3IFNL 3LVTA 4PVBA 3G5ZA 5IM7B 1XV8A 2CPUA 4IBWA 5CAYB 3EYQC 4BFKA 2IPUG 3CUPA 3HB3C 3CFEB 3LN4A 1F13A 4FQIH 5E8PA 5L2JB 2P1YA 5AVQB 1KEGL 3O3DB 5FR3A 4U1KA 3ARDD 1MNUL 2O61B 1IKNC 4Z7UE 1IFHH 3W39B 4HPYL 4X6EA 3FZUC 5D5MF 5J1AA 3Q1EA 1G87A 3M7FB 1T5WB 5EDXA 2K45A 3S5ZA 1T4KB 3F7QA 4LVOC 4ANXA 1IKFL 1D6EA 4HXBH 1NCNA 3BUPA 3NAAL 4QKTA 3IFPB 4XMLL 5CHNB 4F7MA 3BT0A 5DRNB 2H8PB 2Q7YA 4RESB 5FAAA 3TCXA 4ETQA 4ENZA 3S37X 2BJML 1MHEA 3AS1A 1I85C 1UZ6E 1DVSA 3BD3A 4Y5VB 5ANMB 4APQC 3K46A 1INDH 4DT2A 5EDSA 5I1GH 4X5RA 3IT8D 1XCQA 2EYRA 2VLRB 2XA8L 4R7DB 3B2DC 3UZVB 3S3JA 4JMXA 5DLMH 5BQDA 1FNGA 1NC2A 3QG6A 3KYNB 4OLEA 5EEZA 4HJTA 4MNGE 1QI3A 3EOTL 5FLVA 2RTTA 5DUPL 3E7JA 4LP4A 4P4KC 4LFHG 3IDUA 4MNQB 3QNZA 4NX0A 3B4NA 5AD0B 3BCDA 5DK2A 3TFKC 3KW7A 3G9VA 2A83A 4DN4H 4JDVA 1FF5A 1JI2A 3BRDA 2ZSWA 1EEUA 4B9JA 3VGBA 1JF1B 1VKXA 3EKCA 4NI6A 2AEPH 1KGJA 1G7LB 3V5KA 2DKSA 2XZAH 3MYJA 4KK9C 3RJDA 2XA3A 1NIDA 3TO4C 2E9JA 3OKKB 1NKOA 2JKLA 3OL2A 4AQAA 3AFLA 3MMEB 3VXSA 1PY0A 1DSFH 1BIHA 1AJ7H 1NIBA 3UG5A 4BFIB 2NSMA 3C08H 1WBYA 3FUKA 2JKNA 4KFZC 2NSXA 1LNUA 2Z0UA 4X2UA 2Z8RA 2FBOJ 1MF2L 5TE6H 3L4ZA 1CO1A 1T1YA 1C12A 5AW1B 2WLLB 1W91A 4ACTA 2E9GA 1DBBL 5JQIB 4JQVC 4EE2A 4JDTL 4N2LA 4NQQA 4GG6B 1CDGA 4GS7B 4OIAA 3IJEA 3DPBB 3SKNA 1DCLA 1XF4B 1J9RA 1BVNP 4WW2C 2KZKA 5GS0D 3VO0A 1XSKA 2LOEA 4DTGL 1M2VA 4Y89A 4G7QB 3T4AA 2HVKA 4LVOB 5J8OA 4BDVB 1JTTA 1ZHBB 4X0NA 4AEIL 1RCYA 2YRZA 3B7YA 3AROA 3ZXAC 3ZDZF 4C8XA 2VXUL 3HB3D 4RBPH 3MV8E 4QOKA 5ERWB 3VWJD 4GSUA 5JIMA 2FCBA 2X4QA 1YDPB 3WGUB 3CFJB 2XWZA 4IKKA 4XVJL 1AG0A 1FG2B 1X3DA 2FT8A 5AL8A 4KHTH 3O0RL 5BZWA 1VENA 5JOEA 5DD0H 3U4EB 4DN4L 4TOYH 1UB6A 4EPSA 3UTOA 4L48A 3SY6A 1U3HA 5EWIH 2L7JA 3DGGB 1NL0H 1NGYA 3D39D 1E4JA 3QUML 2HWZH 4C56E 5HYIA 4MCZB 5JQHC 1JPFA 1TQSA 1DZ0A 3S5LG 4N9GB 5KBNC 2HZHA 3BPOB 4XGZA 5TH2B 5B7MA 5GS0C 3CJJA 3BH9A 2GC7C 1C5BL 1UM4H 4NM8L 1BIIB 5BV7C 2BOBA 2ZCKH 1QBBA 2WBJA 5GJTH 5GS1A 2ALWA 3UO1L 1MF2H 1YEWA 3L5JA 4Q56A 1E4HA 4HUCA 4KK8D 2BINA 2CO7B 3PWPB 3LIZL 4K55A 2ZSVB 3QO1A 3SYPA 4KXBA 6CGTA 3FKUS 3U6RB 4X4XA 4IBUA 3KYKL 3FRUA 4LE8A 1S9WB 4UNIA 5IQNA 2JXMB 4PMEA 4LSPL 1J5OH 3AT0A 3AS0A 6TAAA 4J4PD 4HWZA 5B1CA 4HSQA 1WITA 3OB8A 3Q5TA 1B4JH 4MCZA 3SE4C 3D8MA 1R5VB 4G8GA 3QFGA 3TNMA 1LO0H 4B9KC 1ZA3B 3NJXA 1OTUD 2NZIA 4JO2L 2H26A 4LHUA 3NTCH 4UT6L 3MLUL 3NFSH 4H1LA 5D6CB 3KJ4C 4OZGA 4JR9H 5F1NA 2VERN 4DGYH 5IF0B 2H0PA 3KPPA 4M29A 3TVMC 2AQQA 3R1GL 3J7HA 5DYFA 3QJRB 3A0OA 3H56A 5T8IA 3STLB 4KTDL 1MCLA 1SJXA 1A25A 3IDGA 2GJRA 4WW2A 5G2NA 2EDJA 2DEWX 3TEUA 1AZZC 5A6MA 3GDCA 4WI0B 4XNUH 1CMOA 1SDDA 4MXVE 2VMCA 3STBA 1IAKA 3H54A 2D3LA 4JW3A 5HYJA 4KO7A 1R33A 2UXVA 2XWJB 3FH5A 1BZ9A 4A66A 3FDWA 1SM3H 2W0LA 3DUUA 5AOIA 1NGZA 1VZGA 1C5BH 4AIZA 1E9PB 2J25A 5DJ2A 4Q4IA 4JL1A 3NDYE 5PCYA 5H8DA 4FA8A 2XICA 3CXHK 4PGBA 4O02B 4R2GC 3QS3A 1OQOA 3UGUA 2YA2A 3MLZL 2Q2LA 3OX8A 3WO3B 5I19H 5A7BA 3WTVA 4G70B 1QSFE 4U05A 4TTDD 1JRHH 1XH1A 3VD0A 2B08A 4OZGE 4TUKH 2Z6FA 1OB1A 3GS0A 3ARDC 3KGSA 4PI2A 1K5NA 4NYLB 1OAXL 2RBLA 3RG1C 3FSOA 3QBTB 3NACH 4KK5C 3QPKA 1EJFA 2NY3B 5IV2B 2HTKC 4NJ9L 2YAOA 3GUTB 3DK0A 4P2RD 1MG3C 2HN7A 2NQ3A 3MR9A 5I75C 4QOKB 5ERWA 1JF1A 4Y19E 3QORA 4UT7H 1RQ5A 4LAJH 4EUPA 2UZYA 2ED7A 3IVKB 3P40A 5AB9A 3TESA 3B34A 2G3NA 5D1QA 5A16B 3KDMA 1GHFL 1MG2C 3LKRB 1TQUA 3AJ7A 5E2UH 3IXTA 5CBAA 5DRXB 4NQDB 1QHOA 2K4AA 1LDPL 1PJWA 3HZYB 3U1SH 5E00A 3ARFC 4MNHA 1B0RB 1J18A 1T6WA 2OJ1A 3N1QC 4FXTA 2GEQA 1TTUA 4L8BA 5JPNA 1ETA1 3QUXD 4IIQC 1UT1A 4DW2H 5AOZA 2DYPA 2X2JA 3EOBA 3O4LB 4BHUI 1Q9WB 1F11B 5E94A 5KSAA 3CFDA 1P7QA 3IGAA 3COOA 2K6ZA 3LCYA 4FC3E 4PJGA 1PG7W 2CBPA 1N4XL 4DK3A 2RIKA 5AZEL 4XBEL 4XN4A 4UOJA 5D6DA 4J2XA 5C86A 3MRHA 2I85A 1ANUA 1F3JB 3MNWA 4KI1A 4O2FA 3GSQA 3NJNA 4W6YB 5TK2A 4Y4FB 4XC3H 3G9AB 4YH6A 2JFCA 3O3EB 1OGAA 1OAXH 4I0PD 4A38A 3J8F7 1EZSA 2BCMA 4R90H 1LP9A 5IJKA 3QUHA 3N43B 4CVUA 2ZQKA 2YPLE 2Q0ZX 1FNEA 4JFVA 4YFLI 4J3OD 1HHKA 2Y5EA 2P52A 2EXWD 4LBEB 5F7FA 2Y24A 1BZOA 4S1DC 4YPGB 5CZXD 5HJBA 3IGAB 4N8CH 1EUUA 4GIPD 4PEEA 4BZ2A 2LHAA 2FL5B 2XX1A 4P9HH 4JX0A 3A3YB 4AV0A 3TNNA 4CVZB 4ETYA 2WQSA 1FL6B 2A9DA 3B9KB 4I2XB 2WLNA 5I18H 3SQBB 1EXGA 3FQUB 3BHBB 1QLRA 5D71H 4C57C 2DIAA 1TOXA 3AY4A 3FFCD 4BQ8A 3WUZA 3BUDA 4AK1A 2TRHA 3RFZC 4JLRB 4RX4A 2YPKB 4YL4A 1IAIL 2WBJD 1OARH 1LO4L 2AVFA 2B2XL 5C0AE 4BFJA 1SOKA 3HMWL 1TITA 2KQNA 1QBLL 1TMCB 4U7SA 5IBLD 4A2LA 2BP3A 5F96H 3MVSA 3WJMA 5ADPH 1MQKH 5B7FA 3ULUF 2RD0A 3UYOD 3KVDD 5LGJB 3SKOA 3WEMA 1C5DA 4OCRL 2VISB 3E38A 3GRWH 1A6WH 4LSUL 4M03A 1J88A 4G2AA 1HOEA 2CJUH 5F7AA 4XNMA 5GGRY 5AALA 2XZQL 2OMTA 4QRPD 1A22B 1MCOL 3ARFA 4E68A 3Q48A 2VDOL 4YK4B 5DRZB 1P1VA 1ZIBA 1CFVH 4MTMA 4M7LT 3ZE1F 1E2VA 5BZDB 2IFFH 3BPOC 2EIEA 12E8L 4HGWA 1U2HA 5D1QC 2FO4B 5I1IL 1GJWA 1CXKA 2BNQB 3LMJH 2RQ8A 1BG1A 1FA4A 2IADA 1E28A 1LEIB 5TDNA 2V8MA 5AVVB 4PLOB 2MQCA 3FH8A 3FQWA 4KJPC 5LJYH 2GW5A 5D1XD 3UZEA 1UB5B 2P8PB 3H53A 1ACYL 2KZBA 4ZI8A 1FNAA 2WWKO 5IJCC 5D2NE 5DWUL 1E90A 1L7TH 2BH0A 4HUXA 1AZBA 4YLQT 4OQ1A 3LH2L 2KDYA 1RXLA 4IIQA 5IJBC 1UXSA 4QXUH 3OC8A 4YR6A 2P4AB 4OGXL 1GY1A 1BVKA 1XIWC 4FZEH 1PMYA 5EZLA 4BSVB 1LL1A 3HNVH 3TL5A 1FC2D 3AM8A 5DJ0A 5CNHA 5AKTA 1AC0A 5MERA 2NNAA 3UTSB 1M9SA 4FYSA 4M00A 4U3XA 2ZX8A 3P77B 3PXLA 2BC4A 2YWZA 4QHLA 2HCZX 3ZE2B 3HNTH 2BY3A 2ZF8A 2ICWI 3TTYA 1P9MA 1NLBL 3RP1A 4U1SA 5BJTB 1OAQH 2FX9H 3UTPD 5JHLH 2F8OA 1NCUA 3KPQB 1I7ZB 4N1HB 5KAQG 4L18A 5I6XC 1B3IA 4I2XE 4RDQF 1J87A 1FVCB 2R29A 5F7BA 3UYRH 1G9HA 2F5AL 3K8MA 4DVBB 3RNKA 4YHNA 3MRIB 4E9TA 2L3BA 4KJYA 3JWNE 2FSEA 4LLUB 2CO4A 2D7PA 3ZHKA 4L29A 4RQQB 1RIUL 1S78D 3ZR6A 4G72B 3SDYH 2A1WH 2A74C 1UXWB 3FRPA 1NPJA 1WAAA 4LGPB 3CZGA 1SRDA 2YEZB 4NHUB 3B5GA 1QWUA 4L0PB 1YNTF 3JV5A 2DWDB 2W9EH 4X4KA 3SPVA 2EYTA 5E5UB 3SBPA 4AVIA 3Q6FB 1BMZA 2IWFA 1CBJA 3LZFL 5C08D 4ELKB 2P5ED 2CHZA 3DUSB 1I7TA 3D25B 4JHWL 3TBYB 3U30B 4GRWB 3OWRA 4Q9RL 3TA3C 1AOZA 1NCCH 4ZD3H 3LZOA 4GBXB 5IB1A 5IREA 4L8DA 4AL8H 4JDZA 2Z8SA 2OULB 2GY5A 4JFXB 4DPAX 1U8KB 1G6RA 2O5ZH 1B0GA 4WU5B 4P9ML 3HE7B 4N6RA 2LLNA 5FYLE 2ZP0T 1JHTA 1E4WL 5JW5B 5BQ7A 3PGCB 4HIJB 2XQBL 5DVOA 1NLBH 2MQ0A 3QIBA 4JN1H 3FHQA 5DEFA 3PF2A 3KPSD 2VDKB 5E8DL 4Z0BL 1N18A 3LPWA 3NIGB 5A40E 2DQHH 2NPLX 1E27B 1CIDA 4X4ZA 4XRCA 3J27A 1XCTB 4D94A 1YMMD 4PJIA 4ZMVA 2ZWZA 3P69A 3N85L 3MLXH 1Y18A 4XHJD 2I26N 2ZX9A 1FIGL 5ADOH 4HHGA 3EJYC 3FULA 3UBXI 3F5WB 3TOPA 4MA3B 1M9WA 2FIRT 3POCA 1UG9A 4EDXA 3NQIA 4HPOL 4F20A 1SOXA 3T1FB 3ZZLA 4RSVA 4XBMA 5CS7A 4NDMA 5L2KB 5IVXB 5D4HA 4LCIL 1OPGH 1XBDA 3WIHH 4ENED 1NGPH 3IMWA 3SJVE 5LNGA 3CSYA 4HXAH 1KIQB 2HFGH 5IB3B 3MV8D 3S9DB 2VLKD 1MW1A 4X4YA 4ZAKC 4WUKH 1U8KA 4Q9RH 3ISYA 4U33A 2R4RL 3BUYB 3M86A 1KWGA 2Y6TE 3O6KL 3PFUA 1KTDB 3QA3A 4RFOL 1V3KA 1BQUA 4MNQA 3VXUE 4PI0A 2QLYA 3FQTA 2DQEL 2ZOKA 4MJIA 2VUKA 1A8JH 3HI5L 4OT1L 3GMNA 3FMGH 1RKRA 5DJCB 3MBXH 4PJ9B 5T3ZH 5DUBB 5E8EA 3UTTD 4Q9CA 2V0AA 1P7HL 2X6AA 4YSQA 4L3EE 5H4YA 5ANMA 5GGUB 5CF3A 1X9QA 2HPTA 4K5NA 3QPXH 2A74A 1G7PA 2WPGA 4MS6A 3FO0H 5CGYC 3CVBA 2DQDL 3EO0A 2ZTBA 4XAKE 3VFRB 1KT2B 1CIUA 2NNFA 3ARZA 2AABH 1EHAA 4HKXA 4KXZH 3X3FH 5C2BH 3HE7D 3Q2LA 4CUCA 4ES8A 3TBTB 2W91A 4NKDA 1FNLA 3QUKB 3RWFA 4Z7WB 2YA1A 4JFPB 5EEXA 4TUJB 5INDB 3KZ8A 1T03H 3ARUA 1NDMB 1Z3RA 2JCCE 1KJ2H 2QFRA 2JKJA 4DQAA 5CJQL 4C4KT 1ZT7A 4UZSA 2OK0H 1JGDA 2VLME 3VWKC 1BSIA 1OOAA 2F6AA 5DHYB 2IADB 3L4TA 3QIWA 3QFJD 4QXTA 2EKJA 5E4AA 4PRIE 2WQUA 1NGPL 1PLCA 3RWIA 3SKUD 4AVJA 3VGAC 4H2AA 3CUPB 1YEKH 4JFED 4MD4B 3RJQB 3PWVB 3NK3A 2H1XA 1TNMA 4O00A 3B2UD 1KULA 4G6AC 4JRXB 3AQDA 5LBSH 4QTFA 4DESA 3QRFM 4HP5A 1A7NH 4JFFE 3B9VA 1PNDA 1X4ZA 4QTIL 2WXFA 1MPAH 4JHUA 5L4JA 2WO4A 2XIBA 2VJ0A 3DHPA 4PU2A 1CXHA 3VMNA 3T77A 2EICA 5IFAL 4XO5A 3GBEA 4M7JH 4FZ8L 3HIZA 1KOAA 4NENA 3UCQA 1MI5E 2ZUTA 5IROD 1BJMA 5CINL 1QA9A 4UQ2A 2F53E 4RGMB 1BYNA 2WTRA 3BSHA 1L9PA 4YDVB 4OZHE 5HYJE 1Q94B 1H3TA 5KBMA 4OZHB 2N4IA 4MDJA 3SEPA 4F9PA 3WYRA 1JN6B 1DVQA 3EDDA 1DO5A 1NFIB 2EE9A 3CPLB 2ZIDA 2OMZA 1P4IL 4PGCA 1U4FA 1AGEA 1JZ8A 3EF7A 4OKVA 3DOSA 3V52H 5ICZA 3RWHA 4ZW3A 2BNQA 1JNNH 3KWWA 4B9YA 4HGWB 5HP5A 4BZ2L 2BNRA 3B9KA 3T77B 3WFDH 1HT6A 4TQIA 1XD1A 2XWEA 5I6NA 1FZMA 5HYFA 4DSYA 4W1TA 2E47A 1MJJB 1WGVA 1NBCA 5CJQH 3H0TA 1RAMA 2HKHL 5ALBH 5I6XB 2VXTH 1AYRA 3GWJA 2CHWA 3FFCB 4XNZB 4XPBH 3CXDL 2XN1A 5EG6C 4B97A 2BCKA 3THML 1T66D 3SBQA 1A3LL 3MRGB 2A9AA 3ZYOA 2W9DH 4C54A 5AENA 4S0TD 3PWUB 3UTQB 2MH4A 3KPSA 4W81A 1EERB 1FYTD 1GVIA 1CS6A 4PVLA 3EJRA 4GW4B 4J39A 1FGNL 2AXGB 4ELMB 3ML9A 2DDQH 3B8YA 1BLNA 1A6TB 1WLHA 4GS7C 4M4PA 3TV3L 4IRJB 3IJYA 2NLJA 1S78C 1PLGH 2H3NB 3ZRSA 2TSAA 3GSVA 1HQ4A 5D1QE 3QZWA 2DH2A 2WGXA 4GG6F 5CIPB 4Y4KA 1J11A 4OZ4B 2DLHA 5E51A 1AZNA 2VN7A 4PV1C 4POZD 3QR2A 3ESOA 5AVXB 5HVFB 3SYOA 3HG2A 2I5YL 3CFBB 2P5EE 3FB7A 4WFHD 3TM6A 1VCBC 1TEGA 1UWGL 3JWOH 5E9DA 1CB4A 2AITA 1M6OB 4BK8A 2VKXA 4WDIB 1CR9L 3VCLA 4G1MB 2BX5A 3CN2A 4RNRA 3RZWA 5EIIG 2OCFD 5I1LB 1BZDA 2VW4A 1SLUA 1CDCA 4FS0A 5F88A 5F1SA 1GA2A 4H8WC 5F7DA 3CSYB 1H3PL 3MNVB 5E5LA 3VFOB 4K2UH 1IM9A 4X7TB 1OF2A 2W95A 3VD5A 4ZMAT 1I75A 5EZPA 3R7QA 3U0PA 3NPSC 3TVMD 1KBWA 5IVXA 3VQ1C 4XPAH 4K4KA 1A9BB 2ED6A 1PX8A 1YUKB 3Q44A 1YPZE 4Z76A 1CGWA 2OR9H 3K0WA 1KIPB 3NUKA 2X1XR 4O02L 3JWNH 2YAQA 3UBHA 1QHPA 1YECL 2ESVE 3EGSB 3LTVA 5DJZA 4LVEA 5D1XC 5KSUA 2P5WD 3JYCA 1G7JA 1DSFL 5ACMA 2WUBL 3DUUB 4OCXL 3B2XA 2OMXA 3IB4A 1HHGA 4FJZA 2JI1A 3WFBL 5A16A 4L3EB 5GIRB 1E27A 1VGEH 2WSPA 1B0WA 1CYXA 4MVBD 5CZRA 2VDQB 1DLHA 3W57A 3TJEL 3IJ7A 5IB4A 1J0HA 2ZUVA 4G6ML 4LSQH 4W4OA 4JDTH 3WS3B 5IUSA 1WHOA 4IGBB 3EHBC 5EOQH 4G9FE 3T0DA 1U8HB 2J72A 2AZUA 1BFSA 2F53A 4TVPH 1DN0A 2VLRE 1COBA 5DHXB 4N2BA 2AXWA 3U83A 5KJ7E 1MRCL 2H1LM 2OTUB 4FL4B 4ZW6A 4NQEE 5E0QA 4EOWH 2K8QA 3IU4H 4HA1A 2COQA 1KCWA 3IS0X 1CE1L 5HHXH 1NA8A 4MS8D 4Y4KD 2NY2B 4EKXA 5BS0B 3NZ8B 2BIHA 4XTRD 4ZO9A 4KNUA 1DJGA 5DHVB 1A14H 3BZDA 3ES6A 1CD1B 1DP0A 2EEDA 2NY0B 2OMWA 3KEHA 3RJOA 2UY7B 2EYTB 1TQWA 1T1ZB 5B39A 2Y9RT 4NZTH 1OGTA 4H88H 4HG4K 1WFUA 3IU3A 3AZUA 1MLCB 4H4NA 5JPMB 1R3KA 3MJ7B 4S1SH 2FJHB 5EIIB 3WI9A 1S7SA 3LKOA 1KCVH 4L4TD 4CC4C 2QKSA 2WVVB 4JFQA 4MA1C 3OKMA 5DS1A 3WEOA 2YIHA 3KAAA 2D7QA 3ATEA 1YECH 5LCVL 3UPCA 4L0ZA 3HBZA 4XVTL 3GHPA 4E41B 2AXHA 1M56B 3RHWK 1BFVL 4ZAKB 5FFGA 3T6WA 3OJVC 1UM4L 1WD8A 4NM8H 3L16A 1H19A 3HE7C 4OU3A 1XMWA 2B4CC 4IOFC 1UYWH 3L4WA 4Y9BA 1NUGA 4IHBA 2FB4L 5IMKB 1I7ZA 1KIRB 3GLAA 4P4KA 3CFNA 4KU1A 5I8EA 1AO7D 5ID0A 1FL5A 7FABL 5AZ2L 2G30A 1HH6A 4U3SB 3A4EA 3DVFA 1M53A 1FL5B 4UOW0 3RPIA 3EGXB 4HOMA 1T6BX 3UMTA 3MLYL 1A8ZA 3E80A 1KC5H 2BXZA 3VI3F 2NTFA 1OB0A 3BVDB 2A99A 1MCPL 2IXQA 1KXQE 3F12B 3HC3H 1S9WA 2Y36L 4OUUB 1KPUA 4JN2A 2DM7A 3VFNB 4U4IA 4D7PA 2VZVA 4JAMA 3BQUD 3DX9B 4KROB 1S9VA 1V3LA 3AACA 1KTJA 3BIAX 4IIQB 3MRNB 4X5QA 2ORBH 1D5RA 3LIUA 3L1GA 4KUZH 3ILQD 1A3RH 4NQVA 4Y8AA 2F8VA 5C0BB 4JO1L 5EO0A 5IROA 4S1DD 5CZXC 1F02I 4QJ5B 5JR1L 1DQML 4ENEC 1OOWA 3K4ZA 3BJLA 1I3VA 4G6JH 2YARA 2E4FA 2XN9E 2Y5TA 4N2IA 2QZ5A 4QRBA 3TH3T 4FP8H 1EZVX 3SGKC 5EBMB 1BFVH 1CGSL 1MCDA 2Z34A 4UU9B 4LSTH 1SEBB 1W0YT 3OPUA 1WF5A 5FB8B 3R06A 3STZA 3MLWL 1IIIA 1Z9SB 4MA1B 3MYJB 1DJSA 5GGRB 2GBVA 4ABVA 1H8SA 1G7LA 1ZLDA 1WJ3A 2VDQL 2GTQA 2E7LA 2BWQA 5IB5A 4Z95L 4P5TA 2D9CA 4YX2H 2VISA 4W9CC 1YNLL 3N43F 3QQNA 4XCNB 3QORD 3VI4A 1IGJB 4UMGA 1N0XL 1AG6A 4C55A 4CA4A 1P7KA 4NUPA 2FIKB 5DO8A 4HFUH 4EI6B 1D5IL 4JQXA 3T0WA 4YFLF 1BM7A 3QR1A 3AMKA 4GG6A 4PWGA 2X87A 4U1NA 3FTUA 1FN4A 4V11A 2W88A 3H6AA 3MUUA 3CX5J 4Z7OE 1VFOA 5JYMA 1VJSA 4J12A 3AREA 5A1AA 4JKKA 1JJUA 2N7AA 3RGHA 5JXED 3EH3B 5DZNA 3GI8L 4NRZA 2DD8H 2AV7A 2ATPA 2Q5BA 5HJ3A 4A2HA 4WFFD 5JYLA 5JR1H 1U9KA 1K3ZA 4KKCC 4HQQL 4YHIA 3WTXA 5JMRA 1HZKA 3Q3GB 1SOQA 4P46D 1SXSA 2ZJSL 3CVIL 4DFIA 1FIEA 3GBNL 4YDZA 4L8CB 4X6FB 2V3EA 1JZ2A 2AV1A 4HZLA 3G5VB 4N5UA 2Z9TA 3RKDC 2XRAL 4DPRA 1CDUA 4Y4FA 3RWGA 1F3JA 4O2FB 3HEIB 4H25B 1YYLL 2IOMA 3Q3GA 4XBEH 4ISVB 1DE4B 4ODVH 4Y5XA 4HXBL 1U95A 2V7NA 3TBBA 2VR6A 5D2LE 1T83C 3S3SA 1NC2D 3OHXC 4N0YH 1YNLH 1QTPA 1Y0LB 3REWA 4DN3H 3WTTA 4BCYA 2I9LA 3GB7B 1TJXA 2NY3C 3BAWA 2Q3ZA 3ATDA 1FI8C 2CIIB 4ZFOB 1U8OB 1J8HD 3MOQA 4APXB 3K6NA 1MHEB 1UJ3C 4E9QA 1CLZH 4N2KA 3WKMH 2GSGA 3FH7A 4N22A 3MLVH 3ULVD 1RPQA 5JOPE 2MQ3A 3NZUA 4ZFQA 2WO2B 1UD3A 2IH1B 1TKWB 3FN0L 4HX1B 1E9QB 3IXTB 5D7LB 2JKSA 1JRHI 2IPKB 3I2CL 4BSWB 2P5WA 3DVGA 4X6DA 2XTJD 3HB3B 2H32A 2BW5A 1JZIA 4I5BA 4JFTA 4C56D 3L48A 3UXFA 1FORL 4OJCA 3MNMA 2GIXA 4AM0B 1UWXH 2AS5M 3QORB 1MVUB 2K9FB 4XNXH 1EO8H 1OE3A 4AQOA 3QJFA 5AVUB 3WUWA 1MFCL 3INUH 4NXSA 3L3JB 3TO4B 1M1SA 4IYKA 2Z35B 2Q86B 1TTRA 1V27A 4J3XA 3CBRA 3Q5YA 4I88A 3HPLA 5FM5M 3WFZA 4WW1B 4OJDH 3FU7B 5J0BA 3ALWA 4AQEB 3HG5A 2WINB 1MVYA 1H3XA 4QHUA 2AC0A 1HILB 3H8NA 4DZBA 4KJWC 3GRWL 5AB2A 5EF1A 4BUQA 4B53A 3CN3A 4YSDA 3VFMA 1ZVSA 1JPEA 2FO1A 1YYLH 2HJFA 2HKAA 2IPTL 4GG8A 1JI1A 1W16A 3RIFF 4M56A 5TQ0L 3P4MA 3D48R 3C60C 3S98A 3C60D 5T5FL 1A4JA 3VXOA 7PCYA 3GHEL 4G7VL 1CFVL 2X05A 1JF5A 1G5GA 4OZHA 4KK6C 4OD3H 3VRIB 3UP6A 2Y1YA 5KW9H 1AIFA 1IGCL 4HC1A 4JM2B 1KJ2A 1IAKB 4XXCA 3C6SA 2K3HA 2YGVA 1JNHA 3MBEC 2ENYA 1G9MH 1F0LA 1OHZA 2JSFA 3PGFH 3BQUB 3MV7A 3P73B 4QRQA 3CZEA 4OGZA 4OLWH 2WB7A 1EAOA 2NNRA 3FU9A 4XB8A 5TK4A 4A7QA 3ORJA 1T1WB 5GSVB 4CC1A 4HWBA 3T0VA 4LKXA 4O2EB 4FMFA 1JL8A 1LEGA 1N67A 3IRPX 3OAYK 3GMPB 1MFUA 4YIQB 4OSUH 2OJZL 4UAHA 4FQLH 1AE6L 1U3NA 2HLAA 4M43H 2W60B 3V6OE 4JE4B 3GSOA 5ESAB 4WV1C 4AMKL 5E24E 2V2WA 4FQJH 5DC9B 2H26B 2J1XA 2XDHA 2JCCF 3QUMH 5KS9A 3RHWF 3S5YA 3DTUB 1SN2A 3JV6A 4FMKA 2Y0SA 4CSTA 3UTTB 1MH5B 1P7BA 2R9HD 3QZOA 1YPZB 5JHAA 2JXMA 3KYMA 1MNUH 2UVEA 4Y4HA 2X89D 5E2VL 4DP9X 5I1HL 4Z7NF 2DWSA 1XSIA 1KN2L 2Y7LA 3L45A 2L7QA 2WTOA 2IPTH 1L3WA 2CSPA 4JVWA 1DBAH 1TJHL 1YNKL 5TQ0H 3E6HB 2BSEA 1JZDC 2E6QA 2F9BT 3NAAH 5E2WL 4YHML 3UYRL 1IGMH 1SEQH 2L4OA 2O26U 2J44A 4OCSL 2GIMA 4N2MA 5JPNC 3QZPA 4Z23A 4ODWB 4OD3L 2YD2A 2ARWA 2VMEA 4TRPH 1HL5A 2AZAA 3PUCA 4AC2A 1N8OE 4G8IA 4N8VA 4QXWA 3FXIC 4KXDA 2OQJA 2CCLA 1AQDB 2XZCH 1RJYB 1J48A 2YS4A 1U8IB 4PCKA 5FO7A 1U3HB 3GMOA 4RIRA 5SWSB 1E5AA 4X98A 4H8QA 4KKRA 4OLWL 1MREL 2VM3A 3BP7B 1QLEH 2W9EL 4BGLA 3FOMB 5LO7A 5LKNA 1F1AA 1TO5A 4HMCA 3V0DA 1GGBL 1IM3D 3BUQA 3PJNA 4FQLL 3FUNA 3DSNB 1MI5B 3QZBA 3GTVA 2AEPL 4TF4A 4XMUA 5BXFA 2XZAL 3LZPA 3QVAA 4XXCC 1UGKA 1ZHKB 2YLKA 4WFGD 3UPRA 3L7EB 1F4WH 1R3JB 4NDMB 1LD9A 3OGOE 2YJLA 3F7YB 3QAZC 1SF5A 3PHQB 4LL9A 5L2KA 4L3ED 3TFBA 2HXAA 2K7QA 1XF1A 2VJXA 3RA7H 4AQ1C 2G75B 3IS1X 1YNTA 1N2RB 5FGSA 3T2LA 4EXKA 2QTVA 5DJZB 4M3KB 5F6IB 1SDAB 4HJIA 3PP4H 4OIBA 3NCMA 4POZC 5GJSL 5HD8C 2KH2B 1D5MA 3MRFB 5L6YL 5KYUB 3MBWA 3ROOA 1CL7H 3ECQA 5KVFL 4TUKL 5AVWB 3UTZA 4MAYC 5FWQA 3N85H 2PETA 2X4UB 2Y6SC 5CILH 2OQJB 1MFEH 3BFWA 3NACL 3U0PB 3GJFK 3VTMA 4Z7WF 3RTLA 3FOLB 2EDWA 2CQVA 4TM9A 4U1JA 4JFDB 2Z92A 3RVWC 4X8JB 1EXUB 1YAZA 3FBQA 4HPOH 1KG0A 3NIDF 5KSVA 2EDXA 4FQXB 3DC0A 2PO6A 3PU7A 4MLSA 4PRPA 1IGFH 4LGSB 3HKZA 1I8LA 1OP4A 5FO2A 1IO4C 1MDAA 4GKSA 3GZQA 1OK8A 3DARA 1GHFH 1NICA 4XPHL 5IVZB 4N0UB 3QHZL 3Q0HA 1CF1A 3TT1H 1MRFL 1RERA 3C5JB 3W0WA 4WHCA 4A2DA 1JZJA 3IFOA 4C83A 3S3CB 4PJHB 3UTTA 2EYRB 2EEAA 4E9XA 4NRYB 2YUWA 4RGOL 5JW4N 5D7LE 4TLSA 2ZT9C 2VLKA 4UTBH 2MIZA 1B9KA 1KCKA 4DGWC 1PCXA 1DTUA 1KLUA 2OSLB 1U2CA 3NSXA 5FDWA 2PR4H 1I3GH 3GIZL 4CU6A 4N2OA 1KGXA 4BZ1A 1BLNB 3KM2A 4XWGL 1FZKA 4MCYA 1BGXL 1I1AC 2XYBA 1BBJA 4I48B 1N4XH 5DJDA 1JCKA 3MBXL 4CMHC 3LIZH 2NXYB 2EEFA 3AWFA 1TVHB 1ZSDA 4N25A 4PJCA 4QHKJ 4X6EB 4A1RA 4CBZA 4HCGA 2IFGA 2YD7A 4P99A 4FEMA 4Y2OB 5DHVH 4QT5A 5ISZB 4M4RB 1GGIH 1AY1L 1QSEA 1GMIA 5FGRA 4U1SB 3UBXA 4IOFD 1WAAF 2WWNA 1VACA 3NESA 3PXJA 1SBBA 5EZOL 4F3FB 1QX1A 2ROXA 1MKFA 1QQDA 5AVTB 3CHOA 2KT6A 3V0WH 4EN3A 2QSCH 4F7EB 2LGNA 2UYLB 2VLMD 4DGYL 4X9GA 3P9WB 5T3XD 1BFOB 5DJAA 3NJVA 4PRID 5TE4L 4PCYA 4FXGC 3RGBA 1M7DA 1OV8A 2E9IA 5D71L 5T1LD 3BVXA 2ODHA 5EZLB 1U36A 3F7VB 4J3TA 3F05A 4GRMB 1BZQK 3MV7B 3P73A 5C0FA 1S8DA 4N5ED 5HHQA 3UZEC 4OKVB 4P2OB 2EDBA 4X5PA 4U6XA 1LQSR 2GJ6E 2VN5A 2ZNXA 3PWJA 1QRND 4LQ1A 2FWOB 2X2HA 3QPQD 5EIVA 5C09B 1RZKH 3HPLB 4HJ0D 1XX9C 4FQXD 1WS8A 3LPPA 3KCWA 1EUTA 2IJ0C 2VAAA 3LPFA 1WK0A 2GJ6B 1DQLH 2ZP9A 4W9DC 3MGAA 1XIWA 3T0XA 5CEZL 3EJJX 1H15A 4PREB 5I23A 4LP5A 1HDMB 5HI5D 3GNMH 2EECA 3PABB 4HAGA 5D7IB 2CIKB 3DVNB 3DNKA 5E9NA 3IDYB 2ZG3A 5F7UA 4M62L 2XZQH 3CXFA 4Q9QL 5J6GA 2FUTA 1NPUA 4HBQA 4CVXA 4ZUVA 1JWSB 1ZTXL 2QV4A 4L5FL 5LLIC 3WEAA 3L3IA 5F7EH 3WJJA 3RIAF 3VFPA 5FYKH 3MRBA 3RVXD 1AR1D 1FG9C 1UH4A 1LP9F 2MTPA 2VDLB 3TV8A 4PHZA 3NGBC 4XO3A 1AY1H 2XG4A 3KPMB 4BZ2H 1F90H 1ZWIA 1GC1L 3SODB 2DQFA 4NUGL 4P49A 1J8HB 1B9ZA 3IMBA 4LHQB 5LQBH 2QSCL 4HU2A 1NDMA 4KRLB 2Y1ZA 5E0FA 2DQ6A 2V5TA 4NERA 1L7TL 2GJPA 1A7OH 2BNQE 3JQOB 1E9QA 1F58H 2HA1A 4QXUL 3TBTA 4NC1E 3QRGL 4P4RB 3RL1A 1IVLA 4LDCA 5FHAH 43C9A 1LDPH 3G6JF 4NQCA 3LQAH 4AG4H 4ZX6A 2HG5B 2Y06H 3ULUH 1TTAA 3QZMA 3U2SA 2NY6C 3GEWB 4Q0XH 4UDUA 5F1IA 4ZTEA 2QBWA 4GUQA 3HA0A 5AKVA 2MCPL 1X7QB 2OZNA 1Q90A 2ZUWA 4IMKC 4B7LA 1ZGLM 5DD1H 2Q76A 5I1JH 3MA9L 3OR7B 5HYSG 4MAYA 5EZJA 3CH1A 4NKMA 1S5IH 1ADQL 1X5ZA 2DDQL 3P30L 1NLDL 2P7TA 3MQIA 4IIZA 4JO3L 5L9DL 3Q8EA 1L0YA 2BERA 4MJIB 3D3VA 3DX7B 3GC3A 2ZAIA 3C5SA 4HUVA 1TQBC 2OMYA 3QEHB 3RWEA 3R4DA 1B3JA 3HZVA 4HETA 2EC8A 3OM3B 4R0LC 4CMMA 4MZIA 5IUCA 1ONQB 1KDJA 5JORB 1UM5H 4XPFL 1OT4A 1FN4B 4M7ZB 1U8JB 1AKJA 5HDBE 5F7EL 2FR4A 4JZNB 3L4UA 4IEFA 3WBDA 4DF9A 1QYGH 1C5CH 3HRZA 3UPAA 2XN9B 3IMVA 1INQB 4JFDE 3QQ9C 4HH8A 3KHOA 4NQDD 2NW3A 2ATPB 3LXCA 4X9IA 4KI5C 3V7AE 2QKIB 4N6QA 1JZ4A 4M1GH 4DP2X 2H45A 3TU6A 5AVSB 5EOTA 4P9HL 1RLWA 2QPDB 4FNPA 4NM4H 1QR1B 3ENEA 2VDOB 4FXGB 3ZMEA 2XX0A 3CLFH 3K6DA 4XC1L 5HGHA 2APVA 1VFAB 3L08A 1CFTB 1JZ5A 2B77A 4FTVD 1B0RA 4XX1E 5IMOA 1GJUA 3LQAL 1HYRC 1H6UA 3UAJD 2NY4D 5C0NC 4Q0XL 1SY6H 4QJ3B 3QZNA 4F7TB 1QVOB 1FBIH 2AEQH 2R0KL 3OAZK 4E9WA 1NGQH 4ZUWA 3BKML 5JIKA 1AHWC 1NSNL 4LCYB 2GI7A 4G71B 3MRMA 3JWDL 2DQUH 1T04A 2XTJB 3BKYH 3F7KA 3KBPA 4LK4A 1MQKL 4AEHL 4F15C 1J0ZA 3LXAA 3QRLA 5JW5A 1GTFA 3BDYH 4ZUUA 1T0OA 3MRKB 1VGKA 5J11B 1JPGA 2WJ5A 2CJUL 2EDLA 3D69B 4R7NA 1Z9MA 3ASWA 4H5SA 4FNQA 4X5WB 4OZGF 5FM5O 1KBGH 2C9QA 2DQHL 3BGFB 4BQCA 5CBEB 4ZSOA 1NBVH 5IQMA 3GRWA 2YAEA 4LOUD 3WY3A 1RULH 5IIEB 4LSQL 2VLJA 4IS6B 4KQ4H 2YUVA 3QZWG 4K9EC 3WDJA 3ARRA 4HCFA 2J2ZA 2VLRD 1JV2B 3BP6B 4LIQL 5FYKD 1XGPA 3H55A 4AUYA 3KXFB 5ID1A 4G7SB 1QO3A 3ZTNL 1SXAA 1B6UA 3QFJE 5TQ2L 5FO8B 3EIFA 2OXGB 3BZFB 2OYKA 3CBKB 4YDLB 4ZMQA 4I4WB 1OM3H 1I1AA 1A14L 1QBML 3PHAA 2BIOA 2KPNA 2WM0A 5TFSH 3AWGA 4PRIB 5AUMA 5J6HA 1JGEA 2HFGL 4HIXL 1XF3B 4P46B 3T0ED 4LO9A 2YFNA 1QSFA 2VR3A 4PHXA 3B2UC 4PJAE 1IGTA 1VA9A 3ARDB 4H88L 2CRIA 3HFMH 2R4RH 3VE0A 1AS7A 3GHBH 1HZLA 5FX3A 3Q06A 3GLDA 1HS6A 1AZRA 4ZPVA 1DLFL 3KPQA 1EBPA 5F7KC 2DQUL 2WIIA 3ZKNC 5BJTA 1Z9PA 3PGDA 1A1OA 4NZ8A 1NFAA 1E2WA 1OTSD 2WKOA 1IFGA 3D85A 2R7EB 2W65B 3GXPA 4QEGA 1NM9A 5I74C 1PQZA 4EIZC 1T89A 4XN8A 3IU3B 2AQRA 5ID0B 1FPTL 3VWKA 4OT1H 1SUJA 5CEXB 1EAQA 5F6IC 5DJYB 4YWGH 5B8CB 2CUAA 4D0BA 3R19A 1CC3A 3BP6A 4JKMA 5JW4R 3TASA 5EORL 5DHVA 4ZAKA 4WY7L 4X4XB 5GRUH 4BE6A 4PGJA 1BVLB 2WZ0A 3FUDA 4LPVA 3ZR5A 5KVGH 4Q2ZB 5BS0D 2V2XB 3O9WB 3H2WA 1JZ7A 1KFAL 3ARBB 2P28B 3F7LA 4F2EA 1W72A 1TPXC 2F8XC 4DUXA 5GGQL 2BIQA 3CHXA 1NOFA 2WKOF 2CRZA 2DQTH 2X4PB 4XP5L 4R7NB 2A1WL 1DBJL 3CVCA 3BUBA 5C08A 3BLPX 5J5EA 1FLRL 3GTTA 4P59H 1U8QB 2C1PA 3MACH 3CTTA 1LWRA 2P80D 3T8VA 4JG0H 1PCSA 4G6AD 4D3CH 3KPSE 5TDNB 1AQHA 1CUOA 4OZIE 2G5BA 2J2ZB 2C9XA 4OJEH 4X50A 1MIEL 1RUQL 4AYFA 3CHRA 1TMQA 1QVOA 3TZVD 4DAGL 5IIEA 3IYLW 5DUJA 5I75B 1FCGA 1U92A 1R17A 1H8LA 1HTYA 3FUHA 4AYID 2QVTA 2X28A 2X70B 4KKBC 2AJZB 5J1SC 5A6LA 3BIKB 2YQBA 3DK2A 4H1LG 4Y4KC 2YC1A 4I3SH 4FP8L 1YC7A 3LKSB 2MMXA 3PQYB 4QGYA 3RNQB 2WANA 3J07A 1J8RA 2FGWL 1L9MA 1BQSA 3B3IB 5JXEA 1ZHBA 5I16A 1FFPA 4JN1L 5E8DH 4Z0BH 4WKZA 1C08A 4PJ5E 5CJXA 3PDGA 1RJZB 2OTWB 2BVPA 2GYSA 4YWGL 1IQWH 4OIIL 2D4FA 5LBSA 1Q72H 1MCWM 3HNSH 3S88H 1HINL 4EDWL 3QP3A 4YX2L 2K3TA 5CCJA 4MAUH 4B96A 3IPFA 5SV4A 4K5OA 1ZJBA 1JNNL 2H0JA 2J8UF 1ZSHA 2XIIA 3PL6D 4GKOA 5E8OA 4ZSOE 2O6CA 5GGQH 3WEBA 2EUZA 4JQIL 4X9YA 2IMNA 3QUZC 1BXAA 4GUCA 3WS6C 1WWAX 3HR6A 4Z76B 3RUGB 3MLSL 4YHLH 3D18B 4UZUA 3ESUF 5F0PB 3QJUB 1EAPA 4PV9B 4JM4H 2NY1C 2HRPH 4JZJB 1RUPL 3SBWC 2LV4A 1OPGL 2VXTL 2ZOUA 3WTSA 1Y6MR 1UM6L 4GQ9L 4OB5H 2VTFA 4ZAKD 3G5YA 3DVIA 2A0LD 1AD9B 2P42B 3T8XB 1S7TA 3VRLF 2VN4A 2NX5D 4X6BA 5DFAA 3CN1A 4JKPL 3VD4A 3OHXB 3IJYB 4OCYH 5JQ6L 32C2B 4GG6E 4HALA 5M7QA 1NCHA 3ARBD 1BQLL 2J6EA 4L9LB 4NQXB 1BP3B 3W9DA 1WC7B 3R4RA 2HSIA 4GW4A 4NO0A 1R1CA 4X80H 2WY3B 3M1OA 4KKLD 5AVZB 3ZYIA 1FGNH 1WBZB 1E6OH 3N1GC 2DJUA 3VFSA 4I9WD 1XCXA 2FATH 3SDCA 5HGDA 5FW6A 1P7QB 2NZ9D 4YHYB 3S8WA 3RFZB 5I15H 3MO1B 1K4DA 1SLXA 1RZGA 2R0WH 4TNGA 3FCGA 2QADC 3HTLX 1W0VB 3QUMB 5CFHA 1N59B 1A7BA 5I76B 1IQWL 3BPNB 2J8HA 2J4WL 3M1BB 2XFXA 1HINH 4NO2B 1KV3A 3APFA 1EHLH 4GEJA 1HEJC 5D5ME 2D0HA 3VFPB 4LLAA 3LS5L 3HJEA 5JOFA 4HUNB 1U3JA 2ARJA 1HXMB 3V4VH 4GKLA 1DUYA 1G84A 4IW4C 4J8RA 4RZCA 5FA4B 1A5FH 4XI5C 4GKZB 4X42A 3C75A 4YHLL 3T2NL 1GYUA 1HX0A 4XOBA 3DOIA 4JQVA 5DVNA 2OK0L 3PNWB 4B27A 5L2JA 3BAEH 5DR5L 1RPUA 2HN7B 3BWUC 3WLWC 5ICXB 2WV3A 1IBZA 4JZJC 4GUPA 4POUB 4P5MA 4NYLA 3EYOB 1FORH 3ZO0A 2MKLC 2CBTA 3B1TA 1JZ6A 1HCZA 4ZMZA 2F7IA 2PNDA 3BPCA 3EGDA 2OI9C 5JW3L 1A7NL 4OCNC 5K1NA 1I85A 4GRMA 1JXFA 2XN2A 3A23A 3ESPA 3DXAD 5F97E 1ZA6A 2ZWNA 1E40A 2OMVA 1SXCA 2PW1A 2WMPA 2NY1D 2XVBA 1XIWB 2UYLA 2Y7SA 1VFUA 5F6HJ 4IKIA 3KBFA 3EOYG 4K23H 3EFFB 4I1RA 4N0RA 1QASA 2G9HB 2BY1A 2FQFA 3ARGD 4X7SH 1GR7A 4KO6A 1IKFH 5GGTH 4ZFFA 4AYMC 4J5VA 4KI5E 3WELA 4MJIE 2LU7A 3K91A 5F93C 1SJEB 2VQTA 5EOQL 5BRZA 3MCKB 2NUTA 4TVPL 1UJ3B 2YWYA 4PRHE 4PJ5A 4HEMA 1MRCH 3PFQA 4JUSA 3BEVA 5I1GL 2X2YA 5F0MB 2RR3A 3V4VB 1KZYA 1PD6A 1HQRA 1KT2A 4F2MB 3ELAT 3PGFL 5TPWH 3M1BA 3A67H 5LCVA 5FDWB 3PL6A 3ZRCC 1CN4A 3NJIA 1XXDC 5ICYB 3THMH 2D2OA 4Y2OA 2WUCL 2R1YB 4YC2C 4XCCH 3C8HA 4G1EB 1LK2A 5DURB 1UA3A 3LQZA 5CIPH 5D7KD 5D1ZC 3WFEH 1JGIA 2EIKB 5DT1H 4S0HA 2E7BA 1J8HE 1DQIA 2DQJL 2BXYA 2EZ0C 1M4KA 5DMYA 5DK3A 3MRPB 4PN6A 2NQDA 4X99A 4W93A 5CCKL 1UACH 3ILDA 5DFWH 1G1KA 3WL9B 5JNYA 2X6UA 3MRLB 3D34A 5JW4Q 4TNVF 5FM8A 3TV3H 1IFRA 1AR1B 4JMNA 1O6VA 4PTUA 3OPZL 3WFCH 1Y6KR 1UYWL 4BIKA 1M7IA 2NDFA 4WTQA 5IB3A 4WUUB 5TE6L 2NZ1A 1WA1X 3B3BA 4PJFB 1AZVA 4LDLB 1F2XK 1Q0YH 4WAFA 1UGNA 2W07B 4U1MB 5HGBB 1LVEA 3KWTA 4CKQA 4S1RH 1TLMA 2JIXD 5DUMH 5KVEL 1JPSL 2L7EA 4MNGB 4IU3B 3D33A 4KKZA 2UWEE 3D39B 4L37B 4JPSA 5EO9B 4QYOB 5IW1A 3QK0A 4Z7VF 5FM4A 2IDCA 3U9UB 3ZBMA 2DYRB 4H44C 2P80A 2X9WA 3GUFA 4IRZH 4JY6B 4AZ8B 3AU1B 4JZOA 2XXMB 2P43B 1I1RA 3OG6B 4WHYH 3BP5A 5MP6H 4NN5B 2DTML 2ID5A 3DGCR 5AW3B 4K94C 1FRGL 3TO4D 1EEZB 2F5BH 4Y4FC 1JWUA 1TFPA 4PH8A 3A67L 5JA8B 1MREH 2FYYB 3ZHFA 1J5CA 4S11A 1J05A 1FH5L 4I18A 2NY5H 5DRWA 4WUUE 3I6KA 5CWSA 3QEQB 1RV6X 5K1JA 3TH2T 3SDCD 5BV7B 2A9MH 2YXVA 3WFEL 4DOHB 1JXDA 5D7EA 1TETL 1NL0L 4QOKE 1QFHA 1TCRB 3BIKA 4F92B 4QTHA 4MJHA 3BLBA 1MRDH 2VN6A 1LHZA 3K1DA 1ZVHA 3AU1A 4JZOB 4OBSA 1RJLA 3BVTA 3AREC 3P3YA 3V0IA 1F4WL 1KJVB 3BP4A 1WZLA 2YD0A 3EJPA 2EIZA 2NY4B 2WUBH 4OCXH 5ISZD 5GJTL 3SHSA 1CK0L 4MWFA 3WFBH 4ADJA 1VFMA 5E1AB 1Z6JT 3IXAB 5DEFB 1ZCRA 3MRJA 3X2QB 3WNOA 1TLKA 1R19A 2QPUA 3DSNA 1J7VR 1W0WB 5BUAA 4DP6X 2I69A 2O6FA 2E6PA 5E4EC 3NPZB 2NT1A 2G2NA 3FZUD 3PNRB 1O7DE 5CILL 4OF6A 3VW3H 4OV5A 4YZFE 3NK4A 3QXDB 2L7UA 4JPQA 3VG9C 5AW5B 1C16A 4K7PL 4DUWA 1U3HD 2EACA 1LO2L 3HZ3A 1EV2E 3MA7B 5SWZD 4KTGA 4PWJA 4F33A 4MHHG 4UT6H 1XTMA 5CZVL 4KWUA 4PRHA 4XB7A 2WP3O 1B2WL 2FO8A 3Q05A 4QLRA 3OLEA 4Z78A 2M2DA 1ZK5A 5F6HI 3TX4A 4CADB 1T21B 5FK9A 3KW8A 1GYVA 4Y5VA 3MUJA 1KJ3L 4IBSA 1U3YA 5CN1A 4NZTL 1Z9LA 4ETQB 2AF2A 3IFPA 1HQRB 1TT6A 2VITA 3VXRB 5MERB 2PPAA 4XX5A 3WFHB 4NN6B 1QW8A 4UB0L 3S2AA 4N87A 1X5HA 5GSVA 3S34H 1TJIL 3HC4H 3GSUB 3MCKA 3SE3C 5JIQA 2DM3A 1MH5A 1U3ZA 1EK3A 1I3GL 1XL4A 3SE9H 5CLYA 3GK8H 1V7NL 4AX3A 2FB4H 3HMXL 4ZFFB 3O81A 2UZXA 2WWOA 3D2UA 4HS8L 4M48H 5T3XL 2OXHA 4U1HB 2WQAA 1A1NA 1NC4D 3LJ3A 3BO8B 1PX4A 3PY9A 2BNUA 3Q6GL 3ME0B 2E7MA 2X1WL 1I4FB 1XGPB 3EH5B 3KPRB 3N42B 4IOSD 2A6IA 4R4BB 5DJ8B 5KYYB 2BOCA 1DQJB 1ZXQA 2W0FB 4LPUA 4LLWA 3T2OA 4WEEA 1A0QH 4NNPH 2AHIA 4W9LC 2OL3B 1CGUA 4DZBB 4RAUB 3TP4A 5F7HA 5DRZA 3CMOL 1XGUB 2CE6A 1IEBB 3QUXB 1B2WH 5C0BD 4YGVA 5HBBA 1Q9KB 3FN0H 3FSZA 4NQEB 4XXDB 4CL7A 4R5VA 1WA0X 4J3OG 3DBSA 2VABB 3QCTL 4P2QE 4XNDA 4XN1A 3M88A 4UQBA 1A3RL 2XNAA 5FECB 2VDML 4QAMB 4FCAA 2GJ6D 2DI9A 2FVNA 4GKZA 2HJFB 4TSCL 3BH8A 1ZLVH 3RY4A 2GAZA 4PS4L 3HN5A 4R0LB 2Y7NA 1A4KA 3O11A 4P3DB 1HXMA 4TQHA 2QR0A 4FHBD 3VRJB 2AXJA 2XKNA 1UCBH 4UV4L 5JXAL 5DO2C 4IGBD 4QRTB 3GK8L 1WFNA 3TYGL 2V17H 5IEHB 5I17A 3RY6C 2NXYD 5F9DC 3MLWH 4OCMC 2CDEA 1QLRB 5AZEH 3BISA 3FU5A 2KQMA 2E27L 4MJ6B 5CSBA 1ZTXH 3GZOA 4L5FH 1X5JA 1UVQA 2BZDA 1NMAL 4Z95H 2AAVA 4JCMA 1OALA 1EZUA 1N10A 4UTAA 4XBGA 1A4AA 2NY7L 3I74A 3TWCH 1D6VL 2CMRL 2IPKA 4PJ9D 2Y5QA 3U0WL 2YZ1A 4AV5A 4BKLA 4FABH 4XMXA 4HFUL 1V05A 1BZ7B 4HCRA 3EDFA 1IC0A 4U2YA 1AQKH 1S9XB 4PJEB 4NQUA 3LNDA 3CCHB 1TJGH 1T7WA 5T1JA 3M17B 5EU4B 3WUWG 1RD6A 1U0QA 3G5VA 1V7ML 2Z7WA 1ACCA 2GBUA 3N55A 1SVBA 4L4VA 1A7OL 4JG1L 2FL5A 4NAMA 1M1XB 5C70A 4R96A 1N7ML 4TUUA 4HIHA 2VDMH 3L3DB 3HI6H 1M1XA 3L3HB 4MAYB 5EZJB 3O3AA 3HMWH 2PCPB 4IBVA 4N86A 4ZXBC 3K3QA 3VI4F 2CDGA 4ALAC 3RUGA 3K74B 2VLLB 3EJZC 4W70A 4Y16A 3DIFB 3GMMA 1IL1B 3DKHA 3QI9A 4DP0X 35C8H 2B3RA 3LKQA 4BHUA 2NX5B 4P0DA 3TS8A 2X40A 3IMTA 1SN5A 4QY8A 4YZFF 4R97B 4JHBA 1Y7VA 4B50A 1KTBA 1AGFA 2V17L 3QNYA 2WLIA 1E4XI 1ET8A 1IQDB 2YUXA 4OD1L 3VFGH 4TMPA 3KPRE 5G4MA 2GKIA 3QEGH 4FHJA 2W9LA 4JFYB 2E27H 2X4TA 1MLBA 2EIJB 5E2WH 1KENL 4PS8A 4X8CA 3RBSA 1VPOH 1H9VA 3OJDA 1MHPL 5KSAB 4EUPB 2NY7H 4WNQB 5DI8A 1QATA 4YSEA 2D7MA 1RZJL 4MBOA 2XACC 4OGQC 4LCWB 3FFCE 4L8BB 4Y5VC 2FECI 3L3GA 4N2AA 3K71B 4AEIH 1ROCA 2A2QT 1X44A 2X70A 3HVDA 2OYPA 3UAJA 2GK0B 3MJ8A 2EC9U 1AQKL 2AXFA 5JA9A 4YDIH 3ULSB 1E8XA 3G5WA 2J56A 4HUWA 2J1KA 3ZT7A 3M1CA 4XC1H 4PP2B 2IAMC 3KLAB 4HJEA 4XVOA 2E7CA 4O02A 3Q5OA 5CSZB 5AOKA 1N12A 5HGAA 4TOYL 1SJHB 1FYTA 3R0MA 3P9LB 4ECNA 1KWKA 2QMJA 4YK4C 3VX0A 5EWIL 4W9FC 3S97C 2YA0A 4EI0A 3INUL 3QWRA 4M7KL 3BKMH 2YD8A 3N5AA 4PP1C 2GJZB 5H37A 4NC2B 1Z32X 4U3HA 1E5ZA 1XB8A 1XGQA 5I5MA 5B4MC 3HNTL 2OJEB 3EDKA 2UY6A 2B1AL 3RA7L 4PRAA 2XQYK 4PV8A 4YAQA 3VD1A 1IM3B 1IUZA 1LO5A 1PSKH 1QFWH 5BUGA 1KPUB 3GXMA 3UO1H 4UIMB 4N8VG 4AOFA 2A6IB 4R4BA 3SPIA 4OAWB 1BFOA 4HGMA 2CA4A 2WK2A 5GJSH 4E36A 1LE5B 4MXWH 1OO2A 3QQ4B 3EO1A 2V5YA 3BGAA 4G8GD 3U7AA 4Y9FA 5KVFH 2WXJA 3BO8A 1EHKB 1PYWB 1SYVA 1EANA 1VPOL 3SQRA 2VRKA 1ZS8A 2ED9A 2XWJA 3ZOAA 1SBSH 1AQMA 1FVEA 1OY3B 5HVWA 4JO2H 3QQDB 5HDLA 5E6ID 2LE9A 3HLAB 4JN2B 4FQXC 3F6JA 4OF3A 1M71B 3TBSA 4L2YA 1U8NB 3BD4A 4U1GB 4X0KB 1PDKA 1MAML 4Y7OC 2IDSA 3IEAA 1XF3A 4I13B 5DJDB 3L5WA 3R1GH 4F7CB 2BY0A 2O4EA 3L9RA 4HH9A 4FHKA 1DBMH 4IOIA 2IVFC 3LD8B 5KSBE 1S7SB 1UC6A 2O5XL 4HIXH 2AK1L 5HVGB 5C6PB 2LAAA 3GJEA 6PAZA 1F97A 4ZRGA 1ET7A 4I4WA 1AO7B 3O4OC 3VQLA 4ZZFA 3TF4A 3P4LA 4L05A 1QTYT 3NFNB 3L5IA 2ADIA 5KUKA 3OJ2C 1IEHA 5DVLA 4K71B 3FYEB 5C0EA 5IFHL 1AHWB 1WTLA 1T22A 4Z78B 4NC1C 1CXIA 1HFUA 2MRYA 4YFDB 3X1FA 4DP8X 2ICES 1OAUL 2B1AH 3E9TA 1AO7A 4HIEB 5E2VH 4Z7QB 2XU9A 1SJMA 1DQQB 4Y9CA 4I0CC 2LQRA 1JFQH 5AW9B 5GGVH 4I87A 4JHAL 2E59A 1RZ7H 4JJ5A 1FFQA 5I30L 4PG2A 4K5LA 5DD6B 1UKSA 2CKBB 1GIGH 5EORH 2IQAA 2BSSA 1SEQL 1U8HA 4JFDD 3R8BB 2WZPD 5EEWA 4EUPG 1FL3A 5LGHL 4L4VD 4WK0B 1FYTB 3VB9A 1AH1A 4N2FA 2L04A 3WLBB 4TQEH 5BMFH 5HPMA 1KFAH 4G8EA 3HC0B 4PJFE 5FA3A 1DLHB 4BUHA 5JDSA 1VZIA 4AJYV 1G4RA 2LABA 3ILEA 4G43B 4GRLB 1XF5B 4NN7C 5EZOH 5L2KE 2I24N 2BS71 4FXKC 2J20A 2E3VA 4FKHA 3P4OB 5HY9B 5GISH 3NZHL 4BD4A 2H0EA 1X7SA 4KO9A 5CGMA 4XR8C 1F8TH 5D7LD 3VSVA 1DBML 4ICXA 3I6GB 5FGBC 5HGHB 5E7FA 2CUHA 1CLOH 2VDKL 4I1PA 1YQ2A 1TYRA 4NGHL 1P4LA 3PHQA 4JGJA 3TN0D 2DMCA 3ISRA 2R0ZH 5CJ8A 1Z5YD 3QEQE 4O5LH 2G2PA 2QKIA 3I6KB 1XGQB 5CWSB 4N2GA 1NJ9B 2PPDA 2Z3FA 4CBPA 2HUHA 1ITCA 1ZK9A 2HAZA 3D4ZA 4XP9H 4X7FC 2CKNA 3MTRA 2IANE 2I32A 2ZOOA 4JO8A 1DQLL 3SO3B 2F54E 1AGFB 2DB8A 3QNYB 5CEZH 1AXTH 1WUZA 1DVXA 3UOAB 4BEIA 3I6LD 5KWYC 3GNML 1EBAA 4HJJH 3HI5H 5A3ID 1GZPA 3D0LA 1GCFA 4GBXD 3PRZA 5IB2A 3WV0A 5DK2B 3GSWB 3N41B 3S8GB 1DL7H 3BP7A 1J5IA 2ZKYA 4GO6B 1Q72L 1WBYB 1L9TA 1A9BA 3D39E 5IG7A 4DHLA 2NRDA 2HJLA 4PJIE 4YSRA 1MEXH 3QG6B 3QEQD 3MV7E 5ITBL 4O58L 1PZAA 3S0PA 2XYCA 2YO3A 4PJFA 5KBKA 3K71A 4F2FA 2YPLB 5A2IH 5JIPA 1S9KC 2OKMA 1BZ8A 3NGBB 2Z8WC 5B38G 4JPVH 1JWMB 3W11D 4JDVB 4YHYC 1OK0A 4NFDA 2DPKA 4TUOA 2VKWA 3FT2A 4PGEA 1EXHA 1I8KB 2I07B 4IDJL 1PZDA 2HRPL 3HN8A 1CU4L 5I2IA 5FIEA 1XWVA 4TULL 1UM6H 1AXSA 1FZOB 4P4RA 3W37A 5I1DB 1IT9L 1Q38A 3O8XB 5ISZE 1J1PL 3EYVA 2WZ5A 1UUSA 5BS0E 1FP5A 5E5RB 4PGDA 4NGHH 1LO4H 3CVDA 3QNXA 3QAQA 4OZIF 5LBSL 4Y4KB 1QBLH 3DRQA 3LNIA 3GMMB 4P3CH 4TS6A 1T2QH 1Z5HA 1VADB 4LSRL 5GZND 5ESAA 3PREA 3F8UB 5EU7C 1NLDH 4F7MB 5IBUB 1RUKH 2AXGA 4ELMA 2EDOA 3QAZB 4XWGH 1NAMA 2BWIA 1YG9A 2R2EB 2G4GA 2E56A 1BMGA 5JZ7C 4GP4B 3SDXE 5ICZB 4E41D 2QSQA 5KYNA 1EHLL 4GT0A 2X44D 4CN1A 2IFFL 5HGGS 3LS5H 4ZDHA 3GSXA 3T65A 1ZOXA 1P5VA 2GEEA 2Y22A 5I1IH 2YQGA 1FVDB 2X7LB 5E56A 3CDGB 3T3PE 1H9DA 1JG9A 1PS3A 1T3FB 2R9HC 2X53A 3R18A 4JY4B 4HCRL 2FJGB 2YKKA 3BZ4A 5IJDC 5B1KA 2HRHA 3I75B 3U7WH 5JW4M 2H6PA 4KDTC 1QA9B 3O45B 2Z8VC 4ZG1A 3T9WA 2V7HA 3FO1B 1G7QB 4UQEA 1M05A 2BIPA 1AS8A 4TLTA 3NA9L 2CDFB 5GRXG 3DX2A 5FCUH 3KS0J 1YYCA 3DI3B 4PY7A 2DIJA 1EWHA 3BQUC 3NEXA 2EXYD 3ROLB 3IDXL 2C26A 5D1XB 4AW4A 4QRSB 2WN2A 5C3IA 2DW5A 2XJKA 1T2QL 3QZLA 2VE6A 3O6ML 4TNWK 4LSRH 3MLTB 3CHSA 4Z7QE 3VYOA 2N7BA 1X5FA 2VZOA 5J9PB 2R27A 2X4NB 4BJLA 4MDIA 5DJXA 3UTTE 2H32B 1EA9C 4FXLA 4HHAA 4DGUA 1KBGL 5D7JC 3FAXA 1BMWA 1NAMB 4Y1AD 1A47A 4YGVB 2DOCA 1A1MA 2GK2A 3KM1A 3PWVA 3LPOA 3LRSB 2D7TH 2JQZA 7TAAA 1WZKA 2VQ1B 2VDNH 2XPGB 1L3NA 4KKPA 4KJWD 2NXYC 2BSRB 5DJ8A 4TL5A 5CMAA 3SDYL 2ADJA 4N85A 4W4OC 4L3CA 1U8CA 3TT3H 1XR9B 1HHIA 1QHQA 1U2YA 1E6JL 1OM3L 3FQTB 3C12A 4NFBA 1O5DT 3HKFA 3D0VB 5E23A 4N0UA 1L6XA 1NMBH 2ZZUT 4LDEB 5AW0B 1CGYA 4JFFB 4GJTB 2J7LA 3N1FC 1EQWA 2ARJQ 3U9PL 1I9EA 3BUYA 2DQCL 4IHOA 2NQCA 3OAYH 3QIUC 1DFBH 4GMTH 3RE0A 3FL7A 1W0WA 1F4AA 4X83A 4RZKA 5DQDH 2PYFB 4CNIA 2DQIL 4KH2A 5F1OB 1I8AA 2FNWA 2OFQA 3FOLA 3UJTL 4ZFOL 3BW9A 4P9MH 2SEBB 4UI2A 3O4OB 4L3AA 4JO3H 5L9DH 4M5YL 4Z5RA 4CW1B 5FFLA 2EQDA 2X4UA 2PTUA 1CTNA 1TU2B 1JK9A 3O4LE 3ZQWA 5DTFA 2N59A 2WGNB 3DO3A 1FPTH 3UAAA 3ZHNA 3BVNB 2VDLH 3DX4A 3LQAC 4DKEH 5FYJU 4H8UA 1NCJA 1Q0YL 3GGWB 2G4EA 2VZ3A 2FX8L 4UQIM 4Q52A 4XPFH 4I9XA 4G6MH 1I9IH 4GW5B 5GRUL 5K9OA 3MX0A 3BSZL 3CFCH 1TTGA 1UFGA 4B7IA 1QYGL 3ZZ1A 4GEIA 3DXAE 4MJ5A 4AYSA 2VH5H 4R5TA 1R4XA 3BXNA 1TPXB 5A2KH 5C7ZA 1ZHKA 5I16B 2NZ9C 4KROC 3BXNB 4R7XA 3MI6A 1EH9A 3JTTA 3ULUE 5MP6L 4URKA 5JPMC 5DC4B 1G7MA 5B38A 2VLJE 4BWWA 4R97C 4LXFA 4BXSV 1GZQA 3GSRA 1SMAA 3GT6A 4J6IA 1XF2B 4LCWE 3L2LA 1IC4H 1LEKB 5GZNA 4AZ8A 4JHVA 1U8MB 4YDKH 2FYVA 5EC1A 4V1DD 3WU1A 1IGYB 4DEPC 3HUJA 5GS0H 1DFBL 2EXSA 4P5SA 1UH3A 5EEUA 1TETH 2EUWA 2B3IA 4RFOH 3FK3A 4HMEA 3OKNA 1N0LB 3JWDH 5GZOA 4JY5H 4A39A 1RMFH 4WI5A 1YEEL 4ODSH 2FEJA 4NZFA 2IBZX 1JFHA 4HGKC 5EC2B 4N6RB 2DQEH 2NXZB 4M5YH 4Y8DC 4KV5E 2NX5E 2X38A 2LTQC 4OD2B 4RMTA 4ZJ9A 3U4AA 3ZTDC 4FYQA 1VESA 3M8OH 3CHPA 3MOBH 3FMGL 1TZGL 4KQ3L 4MBRA 4DKEL 2JH2A 4N0CC 1R3IL 5EU3A 1WT5C 4OFQA 3HNSL 2JI2A 4I77L 3RVVC 3S88L 5FC9A 4BH7A 3RNKB 4M7ZC 4WF7A 2RA1A 2NTFB 2XBZA 2D2CC 3VXUB 1Y1DA 4HUKB 3KWXA 1YY9C 3A24A 4DETA 5C92A 5IMMB 4K7PH 1RZJC 1F1DA 3BVNA 3QDHA 1MCJA 3LB6C 2Y36H 4OM1L 4Y5XC 2XJLA 1KJ2L 2LLGA 1KB5H 3NPSB 3H7LA 1BJ1J 2E46A 4QHLB 3DBXB 3MRQA 5I8EB 4KMTH 2FHCA 2ICWJ 2FHFA 4ZPVB 2VRQA 5CJXC 2FEEI 1LEGB 1RK0B 4OFIA 3RZCD 4NAQA 1QKZH 4DO5A 1KJ3H 1JHLH 1P1ZB 2CNZA 4KGJA 5DWPA 5IVXE 3WN5C 3QDMD 3ZUNC 2X4RB 1UHVA 3HFML 3CNKA 5JHDE 5FF6B 5HI3D 4KJQD 1JGEB 2Y3NA 2OSXA 2BRQA 2A9BA 4A7GA 4NLHA 2VE6B 1PKQE 4TVPE 4UNVA 1LDSA 1KNOB 1CFQB 4NP9A 1NC4A 2VZSA 1PVHA 1NIFA 3E0GA 3QXUA 4KDTA 3DIVA 4NZJA 3D4CA 2F1BA 4MZ3A 2MPVA 1HHJB 4ZNCD 5C6TL 3SO3C 4RFEA 2ZCHL 3LNEA 3O2VH 2AKRB 3E8UH 2BSTB 3PAZA 5C0JB 1QRKA 3ES6B 1R3IH 1HXYB 3UIZA 1FYTE 4HS3A 2K4WA 3PL6B 2GFBB 3CK0L 2AJ3A 4XBPB 1AI1L 3LRSA 5EN2B 3EGDB 3SBRA 2NY6B 3LN5B 4WEMB 5D2LA 3ARPA 2VDPH 4RISL 4U7MA 5T1KB 5CBEA 5PAZA 4HUXB 4XN2A 4ZUTB 2IWKA 1BWWA 4FULA 5HHME 1E4KC 1OZUA 3B2VL 2DS4A 3U6XS 1CD0A 1O7VA 1DBJH 1VGKB 1OE1A 1PAMA 3QJFB 3MV8B 3SY0B 3PNWA 4GRWE 2CUMA 4YHOH 5F89A 3ZKND 3GSNB 4D3CL 1AS6A 1THAA 2G2RA 3BAEL 5DR5H 3V79C 3L6FA 2FO4A 2DIBA 1I3RB 3D30A 3AXLB 4W9EC 3SGDI 2R4SL 5L2KD 2X09A 5DMGD 4Z9KB 3FQNA 1GZHA 3HPJA 4MJJA 3RZCC 3MGOA 3EAKA 4W68A 5ALCL 2A4ZA 4K7PX 2DD8L 2CCWA 2R29H 4APQA 1VFAA 3FUJA 1O7SA 1YA5A 5KJ4A 4B5EA 3OKEA 2WD0A 2EXTA 1ZTXE 3FONB 5LAPA 1U8OA 1AVAA 3BHBA 3T4AC 4APXA 3BWAB 3VXTA 4I3SL 1TFHA 1Z0MA 4JFZH 1S7VA 5H4ZA 4Y1AA 5TGBA 3Q1SH 3RFZA 4M3HA 5AW2B 3AITA 4PD4K 2RAMA 3F83A 3I75A 5C6TH 2E0PA 1F4YL 1DVFC 4LBEA 3C8KB 5DJ6B 2V7NB 5JZ7D 2W5PA 3NRQA 4HDIA 4OIIH 4GMSH 3DETD 3EBIA 5IHWA 1MI5D 3CK0H 1FHGA 2FT6A 5TTRA 5I26A 4XPTL 3MLRL 2FR4B 1EPFA 2DH3A 4PIRF 5BOPA 1EMTH 4DN3L 2EO7A 2QTEA 1F4HA 3DIFA 5D1ZA 2LU5A 4D2NA 3W5MA 1UWGH 3JWOL 5I1AA 4KY2A 1OZTG 1E43A 3U0WH 3SDDA 3V7MA 5C07A 1CR9H 3QDME 3DX7A 1PEZA 3PQYD 3IJHB 3KYOA 4YDMA 4RWHA 1RPKA 4KJQC 4OFYD 2C5DC 3BWZA 4JM4L 3CH1B 2A6KB 5TPWL 3DHUA 1FO0A 1O7DC 4XZ4A 5IMLA 4RSYA 2OAAA 4GQ9H 3H1ZA 3AREB 1T1XB 2X1QA 4NZUL 4K2UL 2GUYA 4XCCL 1GZPB 1I31A 3CCHA 4ZNEA 1E5YA 2BHUA 4OCYL 5JQ6H 2A3TA 4LLMA 5CLZA 3X3GH 3UABA 2E8YA 1P7QD 1MUJA 3MZTA 1ADQA 1UD6A 5H94B 1HJBC 4BFBD 3N40F 3QSKB 1RP8A 2JE8A 5CBAB 4ADIA 4FI6A 1HYSC 2A9NL 1DDHB 1E67A 2Q8AH 3P2BA 4L9LA 4NQXA 8CGTA 4KNTA 5I0VA 5J4MA 5C0BE 1I8KA 2FATL 4U6VL 1E3XA 1IFHL 1VHPA 1UA7A 3WFCL 3ILPA 3IDJA 5IBTH 3RVVD 4LRIA 4AITA 4QF1B 3MR9B 1T1XA 1KYFA 2QL1A 2ZKHL 4XNYH 3QULB 3QEGL 1OD7A 4APQB 4DIXA 3QS2A 4E9SA 2J4WH 1CQYA 5TF1L 1U58B 5AWNH 4M02A 4HJGA 2DYPD 2OA9A 3C2AH 4R8WH 3DGDA 1H5BB 4JM2F 3HPJB 4ERSH 3DDGA 4BRVA 1CFNA 1J9SA 1HSAB 2H2PD 5AAPA 2UXTA 2B5IB 2GBAA 3BPLB 3MRCA 3BH8B 3PIQB 3FB8A 3KWWB 4GOSA 1IGCH 1Z2KA 4LBAA 1MIMH 4OLUH 3O6LH 4J3WA 4BFRA 3IU4L 3HC0A 3GSNA 2XA8H 3OMZA 4UM9D 4GO9A 3B43A 2C1PB 3MJ9L 5L4MA 2PXYA 1N5AA 1ZHNA 3EOTH 3IN2A 3S4SG 1GY2A 1GMEA 1E8YA 1F6AB 3C8KA 5DD3H 1ILUA 5HI3C 2Y7QA 2P49B 5KBDA 3CE1A 4FLOA 3A6OA 1QLEB 1T66C 1V3JA 1CJYA 3KYAA 1AE6H 3O9WA 4X5XB 3S35L 3HCVB 4JG5A 1AACA 1KPRB 4XODA 3ESVF 4Y9EA 2QPEB 3DI2B 2JJUA 5F3FA 2WNWA 4DEWA 1HKFA 5JLZB 4N2HA 4BQBA 1H6FA 1OQXA 3JV4A 3BE1L 2DKMA 1U92B 4IRSA 4FFWC 5K9QG 4RLDA 3EGXA 1UATA 5EUKB 3O6FB 5D6CA 3FQNB 5I1HH 1X9RA 1G9NC 1K9TA 2F54D 1FYHB 4LPWA 1YY9D 3RWIB 4G5AA 1KN2H 2AERT 1OGPA 5ACZA 3SJVA 5HPMB 5TF1H 4DUVA 3EJSA 4K8RL 2B15A 2CGZA 3CC5A 4AY0A 5E8NB 4BE5A 2NNCA 5DZAA 3RTQB 4BFEA 3BUTA 4R83A 2R39A 5F2FA 3ABMB 2XPZA 1QSFB 1CT8B 1WV7T 4LCCC 3QQDA 1HNFA 2W0KA 4EEEA 1TZHB 2VN3A 2Z93A 4GBXC 4BFNA 5HI5C 3V10A 3VGDA 1FNSL 3RFRA 4N90E 5DU7A 1WAEA 2WAHA 3JTSB 4F2ME 3ABGA 5F7MC 3FFDB 3IDMA 5HTSA 3RY6A 3BZFA 3KPRD 5ITFB 3ZTEA 4FNLH 3B6SA 1YC8A 4JJOA 5TH2A 4PJ9A 1PZBA 2X3BA 1T1ZA 4MD5A 5C71A 3SGKA 2ORBL 3NABL 3VWKB 2O5XH 1AOHA 2XSKA 2ZOKB 2J6WA 4LCVA 1RZFH 2WOYA 2XOTA 3FFDA 4G9DA 4HEPA 3SPGA 3ZO9A 1KELH 3TTSA 3D85B 4UCFA 3BYYA 3QHTC 5AW7B 1BBDH 4R4NC 3GDBA 2DBLH 3QXDA 3AB0C 5IHUL 3V5HB 4QRRA 3L9RB 3IDIA 4XPGL 4UB0H 5D2NB 5I6OA 1RUMH 1XAKA 1TJIH 1CG9B 3GI9H 3LKNA 1U8NA 4Z8FH 1W6LA 5EUOE 3SE9L 2PXYB 1I9RL 5I9QC 3MXVL 2R2BA 1E2ZA 3RPBA 3CC5B 3TEXA 4P46A 4KPHL 2GTWA 5DMKA 1T04B 1WWBX 4G7YL 3ABLB 3DBXA 3MRQB 4UIKH 4PP2A 4BDVA 3RIFK 4D9QE 5CGYD 1CD9B 4PJDA 5I30H 1JPSH 4DK5A 1HHGB 3P02A 3VDAA 3WIAA 1CFNB 3KYKH 1A7RL 4W9JC 2H41A 3ZT6A 1A6PA 5FWRA 1K8DA 4LSPH 4ZUSB 4F8TA 2O5NA 4JJHA 5KYUA 4K9JA 1N0XH 5IMOB 5KSUB 1Z3GL 4TQEL 1KY6A 2WVSA 3FT1A 3NIDB 1QO3B 4IRZL 4MYPA 4Q6KA 1FNSH 2OMBA 2QQKH 2YK1H 2O1AA 1DVFB 1GPOH 2EH8L 3VXPA 2FWSA 3EOAA 3KHQA 3FS9A 5EOTB 3JBG7 5CEYA 2AJVH 1BQKA 3K2KA 4FG0A 4NPJA 1E9OB 4XHQA 3OXRB 2Y7QB 1FH5H 4ZSOB 1B4TA 4XNZC 2C34A 3IMSA 4XPHH 2Q10A 2IAMD 2X3AA 3V4UL 3NABH 2H2SD 3ECBA 4UOZA 3IGKA 1CLOL 2XWDA 1ZV5A 3TT1L 3W2DL 5F88B 2A9ML 4P2YA 3X11B 5BV7H 1XBRA 4HOXA 4IEFB 5EU6E 2B8OT 3SKJH 4LEEA 1PX3A 1HIML 1LILA 1B0GB 2UUDH 2FJFA 4JB9H 4AIXA 3GGWA 2DKUA 4JFXA 4QAWA 1EFXA 4HIQA 4XNUL 3C5ZC 1BBDL 4H0IA 2QGCA 4WDIA 3MRMB 4XPGH 4N2EA 3PJSA 1PW3A 3IDYC 3AAZA 1G1YA 2CDGB 2MOGA 4V1DB 3VYPA 4DH2A 3CC1A 4BZ1L 3DUSA 2JJTC 2PR4L 2P7TB 2Q8BL 3UZVA 1DYZA 1KN4L 2D7OA 1FFRA 2CK2A 4G8IB 5IW6A 4AQ8C 2OPCA 4ODVL 2EE6A 4ODWA 1ZLUK 1BEYH 4OI9A 4OQTA 4AXWA 3TEWA 3N0PB 1CQKA 1TYEB 2P45B 5E95B 3F3HA 1W6WA 1K3IA 4IRJA 5EU4A 1I7UB 4JVUA 1GH7A 1FGVH 3OMAB 3E6HA 5C0AD 3VFTA 5ITBH 5HD8D 3VW3L 3E3QE 2FLBT 5E7BA 1D6VH 2CMRH 1ZE3H 2EIBA 3GLZA 5E99L 3V4PL 2AQTA 4UDTA 3US1A 3G04B 3D0VA 3P0YH 1S7QA 3V9FA 3S37H 2VYRE 3FFOA 3CQPA 2QQKL 5IHZB 2B59B 3KYNA 5DJ6A 3G08B 3OGCB 4KRPB 1WH0A 3EO9L 2VSMB 4BBWA 3A5VA 3CZFA 4WVRA 3II3A 4Z3HA 4QUOA 5HDWA 1YMMA 1TJGL 3TWYA 2AJVL 1V7MH 2C7UB 5DD5H 1P9MC 1GSMA 3MJWA 3T3PB 3TA3D 3AGVA 3I2CH 5IBLC 1MHCB 3VFVA 1DZBA 3DV6A 4ZYKA 1NGWA 2CR0A 4GP5B 3L3KB 4HKZA 4UTAH 2YUZA 3DX8B 3GSOB 2JELH 2KLSA 3L3HA 4F2MA 5JHLA 1YHPA 4QRTA 1QUNA 3EFDH 3H0TB 3SDXB 4JB9L 3BN9D 4MJID 3U2IA 3TPUB 3VWJB 1KGWA 4Q97A