1IBHA

X-ray 3d structure of p.leiognathi cu,zn sod mutant m41i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGIHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ibhA00
1S4IA 2Z7YA 5KBLA 1JK9A 1SDAB 2AQRA 2WZ0A 4BCYA 1BZOA 1JK9B 5CU9A 1COBA 1Z9PA 1E9PB 3GQFA 1JCVA 1TO4A 3QQDA 4A7GA 4BD4A 1RK7A 3GTVA 1YAIA 1SXBA 1EQWA 3HW7A 4OH2A 3MNDA 1CBJA 3KBFA 1YSOA 1OAJA 1U3NA 2JCWA 2WZ5A 1AZVA 2WZ6A 1HL5A 1E9QB 3CE1A 1B4LA 1UXLA 2ZOWA 1E9QA 2GBTA 1OZTG 2E47A 1SXNA 3QQDB 1P1VA 1SPDA 2WKOA 3F7LA 3RE0A 2AQTA 2Z7ZA 1N18A 2LU5A 2Z7UA 3H2PA 1PZSA 1XTMA 2APSA 1XTLA 2WYZA 4N3TA 1OZUA 4FF9A 1HL4A 1XSOA 3LTVA 2ZKXA 2AQPA 4A7VA 2XJLA 3KH4A 2WWNA 4A7QA 2VR6A 2WWOA 3KH3A 3L9YA 2AF2A 4N3UA 2WYTA 1SOSA 1CB4A 3KM2A 1IB5A 2WKOF 4MCMA 3K91A 3PU7A 1PTZA 3L9EA 1IBFA 4BCZA 2C9VA 3CQQA 3HOGA 1SXSA 3F7KA 1OALA 2C9SA 1N19A 3GZQA 3KM1A 1SXCA 2AQNA 3H2QA 1F18A 1KMGA 4A7TA 3SODB 1ESOA 1DO5A 1OEZW 3KBEA 1F1AA 4OJAA 4A7UA 1SRDA 1FUNA 1IBDA 1QUPA 4B3EA 1B4TA 3HFFA 1YAZA 5KBKA 2C9UA 2Z7WA 2K4WA 3S0PA 1IBHA 1SXAA 5KBMA 1E9OB 2AQSA 4A7GF 2Q2LA 1UXMA 2NNXA 4A7SA 2JLPA 2AEOA 3GZOA 3CQPA 2GBVA 4L05A 1PU0A 2V0AA 2ZKYA 1Z9NA 4MCNA 1BA9A 4U4IA 3ECVA 2E46A 1F1DA 2VR8A 1F1GA 3ECUA 3GZPA 1E9PA 1MFMA 1SDYA 1SXZA 3T5WA 2SODB 1Q0EA 1E9OA 2R27A 2VR7A 2AQQA 2XJKA 1IBBA 2GBUA 1L3NA 3GTTA 3MKGA 1DSWA 3ECWA 2ZKWA 1TO5A 1EJ8A
chains in the Genus database with same CATH superfamily
5C8JA 3QFJA 1S4IA 2ICWA 5CZVH 3B2DC 2ZG2A 1CGTA 1G43A 4KKQA 1DBAH 3TEZA 4F27A 1FYTE 1B0WA 2D8KA 3GTVA 1G7IB 4YBLB 1UH2A 2JJTC 1QACA 3G5WA 5DGQA 3MLYH 3SE8L 1DQIA 2BVOA 3W37A 1N6QL 1ZTXH 3II2A 3KHOA 1N7ML 1HILB 2EILB 2KQMA 3KWWB 3RFRA 5CZRA 5K9OB 4P3DA 4YOKA 2JJVA 3GXPA 5E8OA 4EI6B 5T1JA 3X1NA 4HUVB 2CUHA 2WXJA 4WEBH 4F8PA 1DP0A 5ID0B 4N90E 5EC2B 1UM6H 3ROLB 4WI6A 1XCTA 3PPSA 1J18A 2WKOA 1NBCA 1HEZA 5K9QG 4Z7VF 5AW1B 1BW8A 1N18A 3LPGA 1KCUH 2CJ3A 5DFAA 3WENA 1ZK9A 5I75C 4PJBA 5AZ2H 1YMHA 2VLMD 1E8YA 1M1XA 4FYTA 1PNDA 1MVUA 1I7TB 5C08E 2WWNA 3CVIH 4KI5E 4D8OA 1ZSDA 4OIAA 3QZWA 3NFPB 4LPCA 1ILUA 2VWEE 4CKVX 3S9DB 2Y1VA 2N7SA 5MP6H 3PWVB 3UYOD 3T3MF 1UJ3C 2KL6A 4TNVF 1GS7A 3OSKA 4XO5A 2PPCA 1V27A 4D0BA 3OJMB 4YHLH 5KSAA 2IAMC 2ZTBA 5IEHB 4ZTEA 2Y06H 5GSVA 3K71B 4KNTA 2E7CA 2ZXBA 4PRPA 4ZOBA 1UM6L 3EFDH 4AQ8A 2Y6SC 3QEUB 7PAZA 5EF1A 4IBYA 4MA8L 3BIKB 3GS4A 4P9ML 4CBZA 1OAXH 5TF0A 1G9MC 4FG6C 3NIFF 1HE8A 2CM5A 3HZVB 4PFEA 1MJ8L 3FQXA 4HWZA 4X4KA 3RWFB 1N3NB 3OAZK 4W4OA 2XWTB 3VI3F 3QIBB 2ZWZA 1SDDA 3I6SA 3T3PE 1F1DA 4R97B 4CADB 1PS3A 4ZUUB 2AVGA 4FQ2L 5F7MC 3BFOA 3BWAB 1CUOA 2YEZB 5I9QB 4FZEH 2WCPA 1BX2B 2FHBA 3A6OA 4E9LA 3UC2A 1LYQA 5EZOH 3ULUE 1CLOH 3AQXA 3RDTC 2J8UF 3HBPA 3NCJH 3FU8A 2VXQL 2BCMA 4XVJL 4LLVA 4GKNB 2B08A 2B5IB 3O2DH 1DJSA 2VAAA 1CJYA 4FCAA 4GSDL 1KB9J 3CFNA 4DOHE 4EIGB 5CD5D 2IH1B 5FECB 5HYJD 4L0YA 3WNKA 4PBWD 1PX3A 1FZJB 2A6IA 5DDHA 2VABB 4HMCA 4FC3E 3MJ8A 3R19A 1XGYH 4GXUM 1PIGA 4OU3A 5A6IA 1BM3H 1BIIA 3TEYA 3H4FA 1KJ2B 4NC1E 1V8HA 1U3HB 1UVQA 1U8KA 2DIBA 1SBBA 4HJJL 1RSYA 4X5QA 2ROXA 4MNGE 5T3ZE 3WKPA 1D5XA 1SFDA 3LB6D 1RCYA 3VMNA 5BV7C 1KYOJ 4XHJD 3ZY7A 4GG6E 2BNQD 4IOFD 4PJGF 5FM4A 5JPMA 3FOLA 3VG0H 4XP4L 3PWUB 2EIEA 4L2YA 2VW4A 3EFOB 4HSCX 4WIQA 3NQKA 4OCXL 4ONHA 1T66C 3U2JA 3MOBL 1LQBC 2BK8A 5TDNB 3UC0H 3LSOB 4BFRA 2CIIB 1K72A 4TSAH 1U8IB 1DJYA 3OZLA 3RL1B 3SDAC 3ARBC 3OAYH 4A7QA 1MFDH 1ZXKA 4DAGH 3DRTB 4HWBA 2HLFC 1BLNA 3GSOB 3BP5B 2D7OA 3EHBC 4IRJC 5C97A 2YD8A 3T4AA 5CP7A 5AVWB 5CLYA 1G7QA 4W9IC 2OMBA 1CR9H 4KV5E 2WINA 3D87B 3DOIA 5TQ2L 2ADYA 4XPFL 1VFAB 5T5NF 1UQSA 4XE5B 2JI3A 5A6LA 1U8QA 5DJCB 2OKMA 5EZLA 4L2LA 4A7UA 2O6DA 2P45B 2NNRA 3VG0L 4KQ3L 4PJIA 3U0PB 1LO3L 3SE6A 1BXAA 1U3HC 4L4TD 1YHPA 1QW8A 3FN0L 4FFYA 5D72L 3ILQC 3U6XS 3FULA 4XN7A 2A0LD 5IHHA 2R1WA 2MOGA 4ENEC 2FB4L 4H13C 5GJTH 5EIVA 2B4CL 2X44D 2ZXCA 4ZRGA 1E4XI 1SVCP 1CE1L 5DWUH 1SJEB 4HQQH 5IHZA 1PU0A 1A6TA 4F15B 1UYWH 4HS6B 5A40E 4MB3A 4BA8A 4QEGA 3M17B 5TE7H 3K1DA 2IWFA 3L95B 3ZE2E 5H8DA 3W9DA 1JS4A 4BDVA 3MUGB 2EXSA 2IDUA 4KJQC 4BGLA 3G08A 3D07A 2P80D 3ARBB 1KN2H 1ADWA 4F20A 4LSTH 3ARYA 3HI5L 3MLRL 1J8KA 3QORA 2RAMA 4H25B 4H7VA 1Z9OA 1GS8A 1IU1A 1KCSH 1XF4B 3PHSA 2OYLA 3VJ6A 2C9QA 5FAAA 5LGYA 3VRJA 2BW4A 3B1TA 4JFSA 5I6MA 4I2XA 1NCWL 3QG7L 3Q44A 1JI2A 1BMGA 1KV7A 2L7UA 3H2WA 3ARDB 3G5VB 2GTWB 4P46D 4HAGA 5FYJL 1RI8A 1ZV5A 3V8OA 2R8SH 3WD5L 1ZV9A 1OB1B 2HX7A 4MXWH 3X11A 3L1FA 1MN4A 2P5EB 5JHDE 2V17L 4AV5A 1OAUH 1CBJA 4U6HA 2WWMD 2VDNH 1RP8A 1FORH 2DAVA 2VQ1B 4XN9A 1AKJB 1AZVA 2PCPB 3E6FA 4Q6YA 4AL8L 4WCYH 2Y7QB 3QEQB 4FYRA 1RVFL 4WWID 4CN1A 5A2JH 4L18A 4DKDC 3JYCA 3UGUA 4F1SA 4X7DC 4QRRB 1NICA 1VKXA 3AITA 4KOBA 5DT1H 5BRQA 3GSVA 3DX7B 4TN9A 2BVOB 1KLUA 3CSYB 2Q76A 3R06B 4FI8A 4M29A 5AW3B 4PGZA 2X4SB 2ZAGA 5K9OA 1PNCA 4Z7NE 4HIPA 3LN5A 2XN9E 5FGBA 1YY9C 1CG9B 2HG5B 3BN9D 5IOPA 2BIMA 2AJUL 2PCYA 3T2NH 3PWLA 3QP3A 3Q2CA 3CN4A 3RVVC 1HNFA 1T1YB 4LBEB 3GRGA 4EN3B 1XCTB 4YVUA 4IU2B 3P3SA 1S9VA 1ZKAA 2A1WH 1PTZA 2ICCA 4HK3N 4XN2A 3UAAA 1EEUA 4Z7QE 2KC0A 4R96B 4XCCH 4OLZH 4GIPD 2X40A 5CZVL 2CKBB 1XEDA 4F58L 3SDAD 4K3EH 4NHCL 3ZJAA 3KMDA 4BHUA 1MCKA 4NENA 2V33A 4X6CA 4X5PA 3OSVA 1G9MH 5BJTA 1OEZW 4H1LG 1T66D 3L08A 3N40F 2OMZA 4LLQA 1R46A 2ESVE 1W91A 1N0XH 2XOTA 4EIZC 3NIDB 4IOSA 1MREL 3IDNB 1B6DA 4J12A 3HPJB 1NTDA 2PW1A 3WLBB 3KYMB 1PZ5B 3AMKA 3NJMA 2DJSA 4X4YB 5IBTL 2WCGA 3OX8A 4MQXC 1HFUA 1E7UA 4CC1A 1UFGA 3C5ZA 3L45A 4XMLL 4OT1L 3AU1A 3DIFB 3MZGB 1VB9A 1FNEB 5AWNL 5IR1B 3QPXH 1CURA 5A16A 3A67L 3Q06A 4OZGF 5TH2A 5C3LD 1F97A 1UCTA 3GTTA 1JK8B 3FFDB 4J3OH 4UAOC 3HZVA 4BJLA 1FG9C 2IAND 2ZSVA 5CD5C 1XB6A 1LILA 2CO7B 2G2RB 3LS5L 1FJ1A 4H0IA 3ZQ9A 2BHYA 5GSRB 1JBJA 5ICZA 1UZ8B 2WQSA 2YGOA 1H15A 3VQ2C 1SDDB 2WVVB 4N0UB 2GFBA 1MPAH 2VDLB 3Q1EA 4PJBF 1OARL 5A2IH 3PE9A 5IVXE 5BV7L 4XBEH 4OD1H 2GEEA 2LAGB 3VFRA 3QR2A 4GRLB 4KRLB 1DQQA 4OFPA 4U2YA 2GHZA 4WO4C 1WISA 4JN2A 3AS3A 1NUNB 3GMLA 1XGTA 1HNGA 4XRCA 4EIBA 1NMAH 4KH9A 1IC1A 5TF1L 5D1XD 5TK4A 1WBZA 1BECA 1P4LB 1E9QB 3LIZL 2C8NA 1J5CA 3DUUA 2AAVA 5E9NA 5I1EL 4NN7C 2XTLA 2EIZA 3DC0A 5TFSL 3PWVA 2IH1A 4FG6D 1LE9A 2AMUA 1NDGA 3ILQD 4J1UB 2IBBA 4PJEE 1ODAA 4PJ9C 3N1GC 4ES8A 3O6LH 1P7QB 2RFXA 1U3HD 2F8OA 3O0LA 5DURB 2MQ0A 5F0LB 1D9KB 4R26H 2R29A 3BIAX 4FHBD 4N87A 2H1PH 4UV7H 1M6UA 3ZE2B 4RAVB 1JTOA 1WIUA 4XVOA 5ETUB 1Q9WB 1XGUB 2IDSA 1E3ZA 3LY6A 4WHTA 4TVPL 2DF3A 2R4RH 5IK3B 2CRMA 2CM6A 5J0BA 3MLTA 1NCNA 1JN6A 4XVJH 3TJHD 1MFAH 4HULB 4F3FA 1ET5A 2BVTA 5IREA 4D94A 1FL5A 3L9EA 5JIDA 3GSQA 5K59E 3BUYA 4NNYB 4WW1A 5TDPB 3AS1A 3I50H 4UB0L 3AUVA 4LPTA 4LHUD 1KULA 1KGCD 2IQAB 5IQOA 4HFWB 2J8HA 2WQUA 4NHUB 5I1HL 1U8IA 1G7MB 5DC0A 1NCIA 4ODVH 1FFNA 1N4XH 2ZCKH 4J3OF 1ACXA 2CLRB 2E9IA 3UTPD 4MAUL 3U46B 5FB8A 4NQXA 2W92A 5E4EC 1JZHA 3S5YA 4ZSOE 3U9UA 9CGTA 3NFSH 4JFEB 3TYGH 3W11D 4EVNA 2A4CA 2VDQL 1JL8A 1RLWA 3TT1L 3AGVA 1KENL 3MRIA 4H40A 2ZKHL 1NEPA 4N22A 4Y8DC 3SKUD 4MA8H 3LH9A 4NKOA 3R1GH 3FDWA 5L8LB 5H35B 4WF7A 4KO5A 5I24A 1R75A 2CUMA 5EZLB 1D2PA 4NUJA 2J2ZA 4JJOA 3CX2A 3V10A 2RJMA 3VWKB 2VXQH 4NQCD 1SMDA 1BVLA 4BH8A 2CK0H 1T2QL 3DX0A 3NJLA 3TV8A 1VZIA 1XR9B 4YR6B 43CAA 1I3UA 3CH8A 4IRZA 1YEDB 1M53A 1S9XA 4ODVL 1J9SA 1MWAH 3D09A 1EJ8A 1M71A 2VJ8A 3BH8B 2WAHA 1HAUA 1ZD6A 3L4TA 4YXHH 4ODXB 1A4KB 3UTTA 4DN4L 1D5XB 1P84J 4JL1A 5CEZE 1OLZA 3KG5A 1J1XL 2W59A 5EU7C 3JZYA 3UIZA 1J0ZA 1RFDL 4PY8I 3V7AG 2XZAH 1SYSA 4M48L 2FQFA 1NDTA 3BPOC 4WGKA 3C08H 5CZXC 1SBSH 3IFNH 3O2VH 2EDEA 2X41A 3MRKA 1IQWL 3I9IA 4MD4B 4W6YB 1UWYA 5HYFA 5K1NA 1WAAF 2ZOWA 2R69L 5FGSA 3W5NA 5HGDA 3LMJH 5I6PA 4DO6A 2APTA 3V5DA 3WS3B 5FFOA 2JMRA 1HKFA 5J56B 2VISA 3VO0A 1FZKB 4OLUL 3EYQC 4DW2H 2AK4D 2EIKB 4BGDA 4B9PA 3BPNC 5IJVA 2OYPA 2H9GB 1A64A 1MNUL 2CKBH 1TZIB 5CEZD 4DUWA 2APVA 1MIML 5CMAB 3TFKC 3JWNE 1TJIH 1U6AL 1U95A 3QEQA 2KZKA 2OL3A 2FGZA 3ROOB 1OAKL 3B7UX 1Q94A 4PGCB 4IOSD 1PD6A 3SB3A 5D1QE 5ILTL 1EGJL 4FDWA 4PJIB 3ENEA 4X99A 4G8FB 2HFGH 1OT2A 2JI1A 2HFTA 2F58H 1ZJBA 3BZDA 4JFDD 4ZO8A 3MRGB 3BT2H 5KS9E 1OAQH 3DX6B 1DJHA 2AZUA 4JZOA 3U9PL 2EDDA 4D9RD 4IHOB 3GI9H 4XPGL 4ETQA 1QSFB 2X7LA 5DRZB 5GQBA 3P3UA 1ESOA 3PFQA 4WUKL 4D9RE 2H3NB 4XAWL 3M17A 4HEMA 1AFVH 3P77A 2MPAH 3J7HA 3OKYA 4C8XA 2A5UA 32C2A 1OGTA 1DQJB 3G04B 4OZ4A 4W93A 2BFGA 3ARBA 4YHMH 4WFFE 1LQSR 1PJ9A 4YLQT 4LRNH 2WP3O 1A1OA 1YMMB 1RIUH 3V0WL 4H8UA 4WV1B 4X6DE 2BP0B 5IEHA 5B4MD 1C5CL 2DD8H 2V8MA 5I8EA 5D7KE 4X6CB 2MHAB 4HT1L 3BDYH 3DXAD 5T5NG 1BIHA 2HFFB 4NGHH 1ZT4B 4R0LB 2R9HD 4MD0B 2P8PB 3QZNA 3OZ9L 1QBBA 1U58A 4L8SC 1U8OA 4Z7IA 1SM3H 3KYMA 3MCLH 1R5IB 1MRDH 4C56E 3FQRB 1KT2B 2GCYB 1J5OL 1AFVL 2MMXA 2DQGL 5CR8A 4AK1A 3ULUD 4MDRA 1HCFX 2WLKA 3CLFH 5JXEA 1BZOA 3AU1B 5CSBA 3C5ZC 4OLZL 4F9LA 2UX6A 5KVFL 1QYGL 3N04A 4KZEL 1IEHA 4BD4A 4UBDC 3CX5J 4OW6A 2L7QA 1KCVL 4LGPB 2CGYA 1DQKA 4WFEE 2RGSA 3V4PL 3DX7A 4JNXA 1ZV2A 2K3TA 4TTDC 4WJ5B 3N0PB 2J3SA 3Q6FB 2CK0L 1XZ0A 3WD5H 4KVCH 4O51A 5T3XL 3FCGA 4J4PD 2PYFB 3TXAA 4ATWA 1W0VB 3S36X 2ZX6A 2E47A 1CVRA 4Z77B 2J55A 5A3ID 4XOAA 4LBEA 4EN3A 2Q86B 5L4JA 2V5SA 2DLIA 3CC5B 4DOHB 2VQ4A 1NANI 2V2TA 1C7SA 1JDDA 1QO3A 2IXQA 1LWJA 3EYVA 2R4SH 5TE7L 2A74C 1WCQA 3V5HA 3VTTA 3VFVB 1DQMH 1XGTB 4H0GA 1TYJA 5HHXL 4BUHA 4CSTA 1W80A 3SYPA 3UDWA 1XAKA 4YZFF 3IVKB 3G6JB 1IAIH 4GLRI 2CU9A 4PJXA 4XRCB 4DN3H 1U8JA 3QNZA 1EEZB 3WTWA 2OJZH 5DURD 3V4VL 2TAAA 3AY2A 1JXKA 2NSMA 2JH2A 2Y5EA 3BXNB 3LEXB 5J13B 4S1RH 3H3PL 2C9XA 2WUCH 1NDGB 4J1UA 4F7EA 3KGUA 3L3DB 1X5GA 2VW7A 4AEHL 4GG6B 3FO1B 1L0PA 4PYGA 5KJRH 4QI3A 2NQDA 3RBGA 1ILSA 1NKOA 2JQAA 1RZKL 3AY4C 3IPFA 4WHTB 3II1A 3UBHA 4OI9A 1MCOH 3LH2H 5J9PB 1X4ZA 4ZMWA 3IGKA 1JN6B 2IQ9H 1MJJB 3QDGA 1YAZA 3UFIA 3ZPDA 4HOWA 4IIQC 1KBGH 4Z3HA 2XHNA 5PCYA 3S8FB 3CK0H 3OWEA 4RFOL 4GKZB 4ADGA 4K9EH 2UV3A 5T3ZH 3RURA 2GAZA 2CO3A 4E9XA 1DVFA 3VFGH 1P1ZA 4YWGH 2WVVA 3EO9H 3VSTA 1QRND 3IDIB 5E6IB 1ZT7B 3L7EA 4HJ1A 1CLZH 2C34A 4QTIL 5DQDH 1E8WA 2XWBB 4OBRA 5KVGH 4GH7B 4Z7UF 4NO3A 4QRAA 5DUPL 2YS4A 4KTGA 5E9AA 1KWKA 3MRIB 4UTAL 2ZCZA 1IVTA 3BSZA 4JREC 2OFQA 5H35A 1MLBA 1E4KA 3DSFL 3P4NB 4NUJB 3IJEB 5AUMA 3EXLA 1J05B 2EUVA 5JNYA 1BD2A 4NN7B 4UAOB 1KELH 3MMEB 4AW4A 5TE6L 4NC1C 2WBJD 2OX5A 3LS4L 4I18A 4U6TA 1D9KA 2DJ4A 2DWDA 3F04A 1ERNA 1ZLSL 4UUJA 5KSBB 1S9XB 5FPIA 1GY1A 2V6HA 2WWMC 4GRWE 5D7JA 3T6ZA 2DYPB 1CLOL 3QULB 3KCPB 2EDRA 2YO3A 4MAZA 4XX5A 4K3DH 5F7FA 2DY2A 4W4OC 2VLKD 5AG9A 1C8PA 5HPMA 1RUQL 1ML0A 1HESA 4QRPD 2M2DA 4TLKA 4F7PB 3S5LB 1A7PH 1KXTB 3RWHB 3KYKL 3GBML 2NXYD 4JY6B 2OMUB 4JKPL 1HEHC 4FI7A 3W9EB 3WY1A 1NLDL 1KIQA 2D3NA 2IPKA 4A7VA 5A1AA 4F8QA 3GRWH 4YDMA 4N2FA 3MCG1 4M43L 3TS8A 4MBRA 2CLRA 4PUBL 1ZLVH 1LDPH 5LBSH 2TSBA 5KVFE 2VR5A 1CVSC 4M61B 4ORGA 4MJIA 4AGOA 2CUAA 1BFTA 3MROA 1NWPA 3A4FA 1OP4A 2RA1A 2VN6A 2VRQA 3QEQD 3QXTA 3CQQA 1VA9A 4FQJH 4G42B 4JRWA 4N5UA 4UV4H 5BV7H 4MLSA 2OPCA 1SUHA 1J9CT 4TVPE 4XP9L 2ITEA 4FTVB 1PAMA 1ND0A 3LQZB 3V0DA 1FC1A 2I32A 2XZAL 2R7EB 1NFDF 4F8LA 2C3GA 2BSDA 5JUEH 4I0PA 4ANXA 1DLFH 3HN5A 2V3EA 1QD0A 5CJQH 1U3ZA 4U1HA 3CVHL 3F84A 2Q87A 4DP7X 2EUXA 4JB9H 4OF6A 2QVTA 3CDGA 3OKDA 2YK1H 3D3VE 4UZSA 1S9YA 4TOYL 2KS0A 1LHZA 4WI4A 2PYEB 1AH1A 4KQ3H 5AB2A 4NJAL 5F6HI 4LNRB 3E38A 3P2TA 2R1XB 2DMCA 5DRZA 3K2UH 4HKBB 4W9JC 3ESMA 4F33B 5J6SA 3DX8A 3V0GA 1L3WA 3J27A 3SDAA 3SZKC 4FXKC 3WGVB 3HG1B 1DSFL 1GGCH 3O6MH 5CCHE 4G8IA 2ODHA 4QHLB 3ZUNC 1YUHB 4HMEA 2BXZA 4AQ1A 3EZJB 5FFLA 4GI9A 1AO7B 4YC2B 1VFUA 5KN5A 2VE6A 3WXVH 3ULAB 4X6EB 1NZRA 2BVUA 3S4SA 2HVKA 4PRDB 1TJGH 1X4XA 2J5LB 3IE9A 3ES6B 1FV1A 1UASA 5EOTA 3GO1L 3PWNA 5EO0B 4G8GD 3IDXH 3HI6L 2DQUH 3QK0A 4E41B 2XNAB 1CDGA 2K70A 3NSJA 4KH2A 3RX8A 2A9AA 3RY6C 3OKKB 4H0HB 1KC5H 4BIKA 1DFXA 1QWHA 1RZFH 3ZZ1A 1M9WA 2KT6A 1TZIA 1CLZL 4QTIH 4R0LC 2ZE0A 2R8SL 3ARWA 3AG2B 2RB8A 1U95B 3L4VA 4TSCL 3OXSB 5D1QD 1MELA 1L7IL 4B0MM 4WNSA 4XN5A 1SBSL 2VDOB 1Z3GH 3B43A 4XP9H 1GS6X 4WGVB 3P30L 1HEZB 3IEAA 4HIHB 1DUZA 4XZ4A 1A3LL 2OZ4L 4QXUL 2XXGA 3U0TB 4WJ5A 3D4CA 2DQEL 4XPBL 3LEVH 1V5JA 3KE0A 4YHNB 5KSBF 1U41A 1PD0A 4BWWA 5KEZA 2R56H 3KJ6H 1V3LA 3MV8A 5CIPB 3VXSA 3DDGA 4DH2A 3JVGC 1OSPL 3AY4A 1O9VA 1ZSDB 1MWAL 1L9NA 1W0VA 2X70A 3HC2A 3QFDB 3SE9H 5J1TC 1JGEB 3KJ4C 4Z77A 2DYSB 5DS2A 1OT4A 1DBJL 3KPSE 3PU7A 2V5RA 2IH8A 3KBHE 4RFNB 2JWYA 3TCXA 4CU6A 3JUZA 3RZWA 3CHQA 5TPWH 2YC1B 1FNHA 1R3KA 3PP3K 1U42A 1K4DA 3RI5F 5IVOA 3VA2C 2WBXA 2WP3T 3IJYB 2K6WA 4LDOB 2VMDA 1JERA 3ZDXF 3QUKB 4DP0X 5E6YA 3OR7B 2LGNA 1VEOA 1Y1UA 1H19A 2HN7A 2GC4C 3DX2A 1U58B 3N5AA 4G8GB 4IHBA 2XN9B 5EBWA 2WC7A 3ARPA 3PPEA 3AREA 1LK3L 2X88A 4MNQE 4YHOH 3BPLB 1AR2A 1OAZL 4FNLH 4NQEE 3AS0A 3RL2A 2VZSA 3E7JA 1BD2D 1CBVL 3I74A 1M9SA 3ECVA 2AJXH 3WDIA 4KKCD 4CADA 1EHLH 4N2AA 1YNKL 4KK5D 2VMFA 3BAJA 1KCRH 4LP5A 4MBOA 1IFHL 3ZDXE 5LWYL 1WD8A 5AG8A 4PV9A 2YEZA 1MFBH 1A14L 4Z0XA 2EDWA 4OIBA 5CUSH 2QHLA 4GT7A 4LAQL 4GKZA 4MX7A 2IWKA 5EIQA 2JCCE 3FOMA 4S0SD 3T3ME 2P8MA 4U1GB 4KY1H 5D1XE 5KS9A 1P1ZB 4ZS6C 4DSYA 2H32B 4QKTA 3S34H 2HUHA 2VLME 4W9LC 4CGTA 2Q86A 1A4JB 1MVYA 3LNDA 3N55A 4I77L 3QQXA 4FG4A 5FLVA 4G8GE 4OZGA 4RAUA 1XB8A 2BOBB 1GR7A 3IPBA 4JFFD 2L0DA 4YXKL 5IT2H 3V4VA 1XIWA 3LKSA 4UT7L 4WKZB 5EF3A 1BZ7A 1AHKA 3DPDA 3US1A 4PJXB 1IAIM 1AQ8A 4Q9QH 3BLKA 4Y9BA 1NM4A 3WFDH 4LQFL 5D7LA 3EBHA 4K9EC 5DHMC 5KWYC 2A0LC 4X7SL 5DSCB 1DN0A 4CVZB 3R0MA 1EK3A 2BX5A 3NRQA 4NN6B 3H7BB 4QRQB 5K39B 4UM8A 1VCAA 2FX7L 2UYLA 4R4BB 4ONHB 2BIOA 3IWUA 2VDRL 4ODSH 3ZTDC 5AALA 3RPIA 3RL1A 1XH3A 2PWHA 3P0VL 5C07B 2K0RA 4Z3JA 4M5YL 3KWUA 4ANUA 1F02I 1MAKA 5BNXD 1R33A 2YD0A 1IAIL 1QRKA 1S5HB 5E4OA 5F96L 5FXCH 1JRHH 4JY4A 5SWSD 3DROA 5AYTA 4AK2A 1I1AA 4F7PA 5CBEA 1KIPB 1JHLH 1BFVL 4HXAH 5AB9A 3GI8L 2OMXA 3H54A 3AUWB 4B3VA 5D6CA 3SGJA 5FHAL 25C8H 4DHLA 3I2CH 3OBAA 3EJYC 3T4AC 1DLHA 4Y2DB 5JDSB 3CDFA 4HF5L 2DLHA 3QYCA 1HYSD 1QAWA 1R5WB 1Q1JH 3V5KB 2E6PA 3TBCA 1D2OA 3IGLA 2VXSL 3MVSA 3OJVC 4A2EA 4ETYA 2Z8VC 1WUZA 2DOCA 3MLZH 1BZDA 4CAGA 5DVOA 2EDFA 3LB6C 2XX0A 2HRHA 1JYVA 4M03A 2ICEA 2CDFB 2GIYA 1FH5H 2EQDA 4PB9L 4L05A 4L8SB 4PGBB 4Q6IB 2XG5B 4ODTH 3ECUA 4KUZH 5FO8B 2C7FA 2A6KB 5SX4H 1VF5C 3OHXC 4WENB 2MQGA 1VEMA 3UYPB 2WXMA 3G5XA 1FVDB 3IFOB 2B8OT 3D69B 4Q2ZB 1H6FA 3WTYA 4KUCD 4U6VH 3WIIH 5F7EH 3ISRA 5D7JB 3LHAA 3WN5C 1OD7A 3ZDYB 3FQYA 1FZOA 1MQ8A 4OFVA 2ZD0A 2DIEA 3EDFA 4GKSB 4GOSA 2R0LL 2Y06L 5DC4B 3UGXA 3UAEA 4AT6A 2BIHA 3QXWA 3MJ9H 3HMXL 1G5GA 2KI6A 1DL7H 1ZLUK 4GUOA 1BPLB 3QW9A 4CC4A 2AQ2A 2P5EA 1GGBL 4NQCB 1YUHA 4HKZA 3RI5K 4AQ1B 3IFLH 4U1SB 2ISDA 1MY7A 1W72B 2HRGA 5ECGA 1RUML 1KTJA 4AQ1C 1J1PH 5EU6A 1EJOL 2IADA 3C6SB 2IPUK 3DTXA 3BKJL 3JT0A 1FV1B 5EORL 3T8VA 5T1KD 3HIZA 3AADB 4B7LA 1F8TL 3AU0A 3VXRD 2FX8H 2ICWJ 4LHUG 3MRNB 2XNAA 4PREA 5FYJE 4MA1C 4FQXC 1VKXB 3OKKA 5AD0B 4L3ED 1NGYB 3AQDA 3DRQA 5E8DL 3WNIA 5I71B 5GGUA 1T0NB 5FYJH 2PCXA 4ZMVA 4JANA 3M46A 2ZKXA 2YPKA 4GQPH 2PO6B 1KNOB 2COQA 5KJ7E 3V6OA 4UAHA 2Z35A 1F0LA 4A6YH 1OWRM 2E9GA 5IOPB 3BH9A 4KKBC 2HLEB 1MIMH 3WFBL 1ZDSA 5E6ID 2OW6A 5T33L 4W6WB 1ZPLA 3BPNB 3DSFH 3OKDB 3SKJH 5DI8A 1IBFA 3QUZC 4WU7A 3S3PA 1N68A 2CJSA 2X6CA 3OLEA 4ISVA 3OWRA 4K4KA 1N19A 1K2DA 1CU4H 5D2NC 2LLLA 3GBLA 4EBQH 1P2CB 4LLAA 1NJ9A 4UU9A 2TRHA 1PLGH 4PP2A 3LZLA 4LSRL 2OTUB 1QBAA 1TTGA 3V8CA 3F64A 4OCSL 3JVFC 1IAII 1EVUA 4LK4A 4L37A 3F2LA 2X0UA 3B7RL 1UXMA 3QRFM 4FA6A 2VE6B 1EHNA 4A2HA 3Q8EA 3ZIYA 5EOCH 5AYQA 1UUSA 3Q5YA 4GSQA 1NQBA 5JQ6H 5EZOL 3DX9A 2BXYA 4H26B 3DK0A 3P02A 4B9YA 3K2IA 1I1AD 4R97C 4ELMF 3CZGA 4KKBD 5JQIB 5A16B 3S2AA 3SDXA 4FZ8H 4G8GA 3IFPB 3EGSB 4FLOA 5GGTA 2HVBA 4JFDE 5TFSH 3FT4A 4HUUA 1OANA 2FJFA 5BRPA 2DS4A 3FUDA 3MJ6A 1YMMD 1JSYA 4ODUA 5GSRA 1B4RA 2FIRT 1D7CA 4QF1B 3VMPA 1E5YA 1BQRA 1XGRA 4WUUB 1PKOA 3BGMA 5C7ZA 1OTTC 3HG3A 3TX4A 5I1JL 3TZVD 1KWGA 4AYFA 2XFXA 5C09A 3U0TA 3UO8B 3SGDH 1FVEA 2A6JB 2C1OB 4U1JA 1V7ML 4IRZH 1E43A 3HAEB 4CVXB 1HYRC 3LKRA 5IBUB 4S0HA 2C7UB 3FOMB 5D93B 1IC0A 1CXFA 1KBGL 4S10A 5H4YA 2NYYC 1BBDH 4YQXL 5IVXB 3IPEA 3VFMA 1AY1L 4JCMA 3ZE0B 5LVEA 3CFBB 2YARA 1FE8H 3TPUA 1A4JA 5F7DB 5B39A 3QIBD 1UG9A 2IG2H 1S6NA 4PJ5B 1NFDB 3ZKND 4N1EA 1MREH 3PDOA 1MRFL 3PLYA 2BNQE 4FF9A 3CDYA 4YFDB 3LIZA 3K46A 1K4DB 4WK2B 4I1PA 3KPMA 3ERXA 3WL9A 2RCSL 4K71C 1JZ2A 1QSZA 2K1MA 3ZKSD 1KGWA 3KPSB 4KHXL 5D7LB 3O9WD 5I6KA 2DQEH 5SWZD 5I1DA 2NX5B 5FWQA 3QJXA 2ZCLL 3QO0B 4A2DA 3ZL1A 1U8LA 3WXWL 2ADFL 1DN0B 1JIBA 4CVZA 4F3FB 5KAQF 4LRIC 3SBPA 1FL5B 1ETZA 4H2CA 3WBDA 3HG4A 2AAAA 3BAWA 1KJ2L 1CF8H 5D7EA 1ZEAH 1P84K 4U7MA 3V2AR 4L1HA 1MRDL 2MRYA 4QNPE 5BVPL 1NPNA 3Q2VA 4WW2B 4LVHC 2O4EA 3D25B 3V6FA 3QWOB 1QSEE 4OR1A 2B14A 1TCRA 5LN8A 3T0DA 4LVHB 4B9JA 3S0PA 2OCFD 2GEQA 1AGFA 4A63A 1BCIA 1EXUB 1BDYA 2NXYB 3CZJA 3N40P 4PJAF 1HYSC 2G9HB 2QZQA 2WTRA 1JUFA 4BFNA 2H6UA 4P05A 3EYUH 4AE1A 4C57C 5JA9A 3CVHB 2WLZA 3IBOA 3MOAL 3PAVA 4O58H 5KS9B 4U4IA 1UT2A 2MQCA 2HPTA 4J2XA 3FO2B 3BT2L 4JGUA 3KPLB 1AD0A 1RV6X 1Q0EA 2N0KA 4OGXL 3UO1L 1JPSL 2OJEA 4LCUB 4LARH 3DHJA 4XPHH 3NZ8A 4URKA 4R7DB 1NCCL 2GITA 4EI5B 3V0VA 1XR9A 4YR6A 43CAB 3NSCA 3MRHA 2WO3B 1JJUA 5DJXA 4PIRF 3H8NA 5F9JA 3J07A 2DKMA 1ONQA 4I4WA 1AR1B 1VGEH 5F96H 3BESR 4Q6IA 5DD1H 4KROB 3L9RB 1KPVA 4X6DB 4OLYL 4N68A 2ZG3A 3CBJB 1O6SA 4UTBL 1RP9A 4HLZH 1AE6H 1RURL 4H1LB 4JFZL 4L4JA 3D4ZA 2BJMH 1ZLUH 5JYLA 3H7BA 3VXMA 4HOXA 3DURB 3GUTB 5T5FH 2KPWA 3SBRA 1VACA 4IKJA 4LEBA 1K4CB 5BQ7B 3WTVA 4NUGL 1DDTA 1OPOA 1D5BB 1UFUA 3AXLA 5E6ZA 3Q2WA 4NZTH 5GGRY 5DUBA 5C07A 1G9NH 2R0ZL 3GXIA 3L7FB 4RH4A 4DPCX 1RZJL 4NRXB 4NCC1 2FYYA 3MO1B 1QSFE 1M7IB 4FERA 4ZS6D 2VLJB 2J8OA 3C2SA 5IGXL 2ARJA 3VXPB 2H0FA 3GIVB 1FYTB 3MLUL 1HC1A 5D71L 5ESQB 3C87A 3DBSA 3NJGA 1U4EA 4G7YL 2Z4TA 1MFBL 2HT4D 4AVKA 1F90H 1SZNA 4M48H 2AFNA 5J8OA 3NJFA 3B4NA 3V5KA 2MKWA 2E76C 2Z8RA 1SOSA 5MEQA 1SGKA 5DZAA 4J3OG 5ANHA 5DZ9A 4O9HH 2E9BA 4OJFH 4PAZA 2W5PA 3ZOAA 4C55A 4AIOA 3UJJL 5AD0A 3FCTB 3VGBA 4LSSH 3FT1A 5L2JB 4P5TC 2Q7AA 4RZCA 4MDIB 1WCBB 1TQWA 3INUL 3MYJB 4X42A 3BRGC 5B1BB 5CGMA 2OXHA 3UTTE 5BW7C 3IU3B 2LE9A 2DJMA 2NDFA 3DV6A 2A83B 4AL8H 3VD9A 3B9EA 1OGTB 1TJGL 4L1LA 4OZ4B 5KBMA 3REVB 4W9CC 5JHLH 1THAA 3ZDZB 1ZTXE 4JFHE 5CGYD 4H44C 2F74A 1NLBL 2BSED 5I6XC 1NIEA 2EE9A 3S3BB 4O4YH 1S7XA 3BLPX 5I26A 2V0AA 1AE6L 1IIIA 1RURH 4XAKD 2MHAA 5JDJA 2CKNA 3FO9B 1RZFL 1I4FB 3DJRA 5GRVK 3CIQA 4DNLA 1JPST 2R0WL 4S2SA 4Y4FA 5MEND 5CLZA 1EDHA 2P5PA 2BDNH 3RAJH 1PZ3A 3QUHA 3GXMA 4OV5B 3SDCC 5L4MA 4ZPVB 5EBLA 4K7FA 4F93B 4ZFOL 3KPOA 2KDYA 1EXGA 3I3DA 1RXLA 4MMXA 1OP3H 2PTUA 3GINA 4ZMLA 3CFCL 3VVVA 2PXYD 3VW3H 3MR9A 3P30H 5IW3A 3UTSD 1D5MA 5KS9F 4LB8A 3WUWA 2DM4A 3GXUB 4W9EC 5BVJB 2BFVL 1RZGB 5EEXA 3UTZB 3MRQB 1QPKA 4LSQH 4O58L 2R56L 1AGEA 4KTDH 2XA3A 3DHPA 3C60C 1A8JH 5I1EH 3JUYA 5GGUB 4DCQB 2ED9A 4HUUB 1T21A 1HE7A 3AT8A 4P5KB 5FW7A 2EZ0D 4DUXA 2HH0H 5CWSA 4KJWD 1PIFA 2B59A 3FTYA 4R26L 3MCLL 3LVEA 4JHWH 3S96A 5IQ9B 4N6RA 2NY7H 1U9KA 3FL7A 3SE4C 1YYLH 1XGRB 4JE0A 4GW4B 3EYFA 4X6DF 1BYNA 1I31A 3BGMB 3ROLA 4H20H 2NY1C 3CHOA 2V2TB 1KGYE 3DUSB 2I25N 2X4NB 4K23H 1TZ8A 4E41D 4GLRH 1FVEB 2A6JA 2C1OA 3EOTH 4P9MH 1NSNL 4U1JB 3TIEA 3HAEA 4A55A 3GLDA 4ZS7H 5EZIH 2HP4A 2O5XH 1I3GL 5JHLL 2OYMA 1HIMH 3HLAB 3MGOA 4F7CA 3NEEA 1YNTB 2R4RL 3FZUC 4XP1L 1EHXA 5HJGA 2J25A 5KSAB 5AKVA 3BAXA 4IU3B 4RMVA 1O7DE 1KTKE 3OAUH 3US9A 1UC6A 2K8MA 2YA1A 3PJNA 3L2NA 4G9FE 4Z7VB 3FW6A 5C0DB 3KPSA 1FFTB 3Q9PA 2IFFH 1VFOA 3LKQA 5GGVY 1YPZF 1J10A 5C2BH 5IF0A 3C8KB 5KBKA 4PGEA 4RWHA 3IFPA 2JKSA 4DP5X 1RHFA 1LO4L 4HOMA 1OSPH 2AEPL 3OKMB 4ILDA 4UANA 5KW9H 2VR3A 2AXFA 4JHAH 4LCWB 1PFOA 4Y2OB 4TPRH 5IQ7H 5IFHH 3WOVA 2YR3A 3QIWB 1DVFB 1FFPB 4WW2A 1GZPA 2N7AA 3RWIA 4UQ9A 4UOW0 5IT2L 3FPXA 2TSAA 4GO6B 4DFHA 1DBML 1QI4A 4HCRL 1AGFB 2I9LA 1W0WA 3ESUF 4D9QE 2WZAA 3FXIC 1CLYH 2P5WE 2E4TA 3RTQC 2DM7A 2P42B 5K9JH 3B5GA 5EO1B 3D39A 3WJLC 4FX5A 1SHXA 4YPJA 1JZJA 2CJUL 2WCSA 5KZCB 1FFQA 4Z7QF 5K59F 4Z78A 4I9WD 3BP4A 1KJMA 3BAKA 5BRZA 4APQB 5ADOL 5C0GB 4HP5A 3B56A 5B39B 4LHUB 1N70A 1BD2B 7CGTA 5ACMA 3GI8H 3UZEA 1BYOA 4PJ5A 3D1MC 2Y7OA 4LVOB 2CLZA 3N9GH 3CVDA 4PJXE 4HF5H 5DVPA 5EZJA 2WIIA 2IAMB 1JWUA 1FE8L 4U1IA 5C92A 3KPMB 3NMEA 1HHHA 1SJXA 1IX2A 3NIFE 2D9CA 1UH3A 1CS6A 1JV5B 1PG7W 2CSPA 2VDKL 4QTFA 4JO2L 1HH9B 4KMLB 5IJCC 1OP9A 4MRBA 2XTJC 4PVMA 4OI8A 3K6IA 1KJ3L 2JXMA 3BD4A 4AYID 5J4MA 4OLXL 1MCIA 5F97E 5IB5B 2UZYB 2EABA 4NQTA 1JPFA 2Z7UA 1XGQB 4LOUC 3APCA 2A9MH 3FBQA 3JWOC 4FZ8L 4WU5B 2I26N 1WTGT 3B2UC 4RMWA 2AQPA 2R0KH 3ATDA 2IPUG 3LS4H 3IMBA 5E8PB 1IAOB 3MLXH 1BQLH 2ALWA 4JEGB 5D1ZB 1IC7H 4AMKL 3TURA 3ARGB 4N3UA 3L7FA 3IJ7A 3KM2A 4JPQA 4Y7OC 5L2KB 4G3YL 4Z7OE 2BVYA 3HHRB 2OMWA 1ICTA 2VDMH 4HPHA 3MROB 2VSMB 4ELMB 1Q9KB 4QDGA 4JO4H 4GJTB 1OOAA 2FT8A 1NCDL 4JG1L 3DJZA 2FGWH 2B1OA 2ADFH 3RWCB 1Z66A 3QXDA 4GAYB 4PJHB 4UQ3B 3RZCB 4JGNA 4GIOA 4GYBA 3OKLB 2AVFA 1LE5A 1RZQA 5IB1A 3M88A 3UPCA 4U1NA 1Z5HA 4M5TA 4ZO7A 3P4OB 2DLTA 3O3AA 5AOMA 3MUUA 2GITB 4L3CA 1Q72H 2XXFA 3QS2A 1G6VK 2R1WB 5HJDA 4ZK8A 4RX4A 4FRWA 3MRHB 3QZMA 3RVUC 2SEBA 2AZAA 1G6RB 1F4YH 1F5WA 1I82A 5DJXB 2DQHH 4NKMB 4AJ0A 3ZHNA 3SGKA 2DQFB 5DO2C 3IJHB 3VI4B 1OVZA 4XMPL 7FABH 4HKBA 1W16A 4BUQA 4V11A 1B9ZA 3EOBB 3GUFA 4AGMA 2YEVB 2SODB 5FKAB 4CILA 4DP1X 1YPZB 1YQVL 1P4IH 3GSWB 5KZCD 3BZFB 5KUKA 3DSNA 4P2QD 1PL3A 1AS6A 1CTOA 1NCDH 3E2HC 4G11A 3QYMA 4HCRA 1KB3A 2HT4C 3W0WB 4KKNA 1WVZA 2YRZA 5F93C 5JIQA 4W9ZA 1NM9A 2Y0SA 4G6JL 2X10A 5BQ7A 1VERA 1B6UA 1DSYA 2FEJA 5K33A 4PRNA 4KKAC 3ES6A 3RGVA 4A2FA 4WUUD 1I9RL 4AG4H 2R15A 5EN2A 3PWNB 2QADD 2YRBA 3BCFA 3QIUA 3LOWA 1NMCC 1GYCA 1W15A 3LS5H 1AZRA 4TSBL 4P99A 1JGLH 3SYCA 4A1RA 4WEMB 2XLLA 2GJZA 3RILA 5I0DA 2HWZH 4MWFB 3LV3B 1NGXB 5I23A 5AB0A 4YHLL 5I0XA 4U0RC 1OWWA 3ZDZE 4XVSH 4XPAL 2E7DA 3W0WD 4LKCA 1KXVC 4L8BA 3D4YA 5I8OL 5MEQB 3PREA 5BVJA 3MV8E 1Q9LB 3N2JA 4YX2H 4J8RB 3WIHH 5DZOA 2I07B 1UACH 2QKIA 3EH2A 3JQOB 2DQUL 1OZUA 1FRGL 2W9EH 4YSUA 3MJ9L 1XSOA 3VFPB 2X2IA 5CU5A 2E56A 3BOVA 4ZFGL 2ZOKB 3JVGA 3FB7B 5IBTH 1MAMH 3NVQA 2Y6TE 3IFLL 4JHZA 3VRIA 1PYWB 2CO2A 5HTSA 1CZ8H 1IGJB 4RMRA 3DV6B 3VWKC 4DKFL 3RFZB 3D51A 4X4XB 1B4JL 1CGWA 1T1YA 1ZGLA 2VTFA 4IU2A 3IE4A 4G8AC 3EGXB 2FK9A 4K07A 3O8XD 4BINA 4OLYH 3VGAB 4GQRA 1X5LA 1RPKA 2BZ7A 2ZXGA 4XB8A 3VAEA 2BHFA 4FEIA 1U36A 4M3KB 3UROR 4UIMA 2BSTB 1MOEA 4HXBL 3FHQA 5JW4R 1OGAD 1HINH 4OGYL 2VLLB 3TTSA 3F5WA 4IBVA 3DTDA 3IDNA 2OR8A 1CFTA 3GHPA 1YNTA 2GPZA 4X5WB 4XBEL 3U4KA 4K3DL 1T7ZA 5DMJB 1PJWA 4N0UE 3SOBL 2XI9A 2F54D 2X9YA 2FZ3A 3C5ZB 2A3TA 1MCWW 5CEXA 1SHSA 2K7QA 2WXKA 5HJBA 4UYQA 5C0DA 2N56A 2IPTL 1RZGA 3NP4A 4F8TA 2FIKA 2WO4A 2VR7A 2R27A 4OFDA 4S1DC 1TJIL 1MWAB 1WBYA 1BVNP 2EYSA 4N8CL 5EEWA 4N28A 4HGWB 1J0JA 2FJHA 3FFDA 4YBQC 1UEYA 1AMXA 2R23A 4N0CD 4Z7AA 4JR9H 4G6KH 1BJ8A 4JREB 1DVZA 2FSEA 1UWGL 1VGKA 3UL4A 4GKLA 2NLJB 2EYTA 5AVYB 4RAHA 4IBWA 2ATKB 3Q05A 3WNJA 4ZD3L 4PTTA 2NYYD 3IXAB 3NJJA 3FUJA 3SDDB 1ROWA 2Y9RT 4FNPA 4V1DA 4JN2B 4RESB 3QJQB 3TIEB 5C6TL 5JW3L 3BQVA 5KANG 5IUCA 2NZ9C 2JIXB 1BQSA 2DKUA 4GSXA 1I1RA 1OSZA 4MNGA 2H2PD 3VD1A 4GRLC 1OAXL 1KGXA 3I6LE 1KJVA 4OD3L 4FN0A 4M93C 4NIKB 4K9EL 3WFEH 3BDBA 1IFGA 3D0LA 3EJQA 1I1FB 2VAJA 4NRYA 1G7HB 2OXGB 1MCNA 2HH0L 1F3JA 1PAZA 3DX4A 2VZ1A 2CLZB 2J88L 5ALCH 5IMOB 3QUXC 3RWEB 4E0RA 4Z7UE 3KH4A 4NQDE 2DH2A 4XNBA 5E2TH 4YXKH 1BXVA 4WQOA 5E7BA 1AG6A 4KWUA 1XH3B 3G5ZB 4LVEA 5DJ0A 3VUAA 2XBDA 3LKOB 3RGBA 1T04B 2JXMB 2KDGA 3BVVA 5IFJB 1THCA 1CCZA 2YWYA 1A7RL 3DNKA 1BBDL 1XF1A 5KVDH 5DRWB 3QJVB 4N26A 2WXLA 5GIRB 5LBGA 4EO5A 1MZYA 1YRKA 4HLEA 1EFXD 3K3QA 4KTDL 2GT9A 3BSZL 3ME0B 4G6ML 4U31A 5KAQG 2G5BA 4MDJA 3BZEA 3D30A 4JKKA 4Y2DA 5JDSA 2ZPKH 3L3KB 5IW6B 4P49A 4QRUA 1ORQA 4GW1A 4XNYH 1HOCB 3PJSA 3Q8AA 4HA1A 2VDPH 3BX7C 4YIQB 1ZT1A 2B1HH 2Q2LA 1IL1A 2ICEB 3K6OA 3RJDA 4UTBA 4NFCA 1UATA 4XXDB 4CW1A 4LASL 1EJFA 3RPBA 4PR5A 3LKPB 1MFAL 4PGBA 1DCLA 3GZPA 3VTAA 1N9PA 4XH2A 2GJ6E 4W1TA 3MX0A 5IB2B 5H94B 1NEZA 1WSST 4NQED 5JHAA 4Y4HA 4R90L 1AR1D 2AQQA 1DN2A 1O6VA 5F3HB 3MZTA 4XN1A 2YQBA 2AJ3A 3RBSA 2KZBA 2UZIH 1G6RA 2OCCB 2SEBB 3ARFC 4PV8A 2PWFA 3D69A 5G5DA 2R51A 1DSFH 5I2IA 1G7LB 1E65A 1HHKA 1V3JA 2R2CA 3RYMA 3VWJA 1OHZA 5B7EA 4HWEL 1L7TH 3UTTB 3UBXB 1JPTH 4GKSA 3V4UL 2WPGA 4DPRA 1WZ1L 3FRUA 1SEQL 3GYRA 4QYOA 2NQCA 2Q7YB 4BYHA 4YZWA 2X0WA 5L9DL 4AM0Q 1S3RA 1HSAB 3PDDA 4ZOEA 5DVKA 4AXWB 3ZVVA 4C4KO 3FU6A 1WBXB 2VLRA 3LRMA 3C6SA 3RGVB 3DTXB 2V5YA 3OMNB 2GBTA 5CGYC 2M8XA 1YDPA 3O6KH 4XOBA 1JZFA 2WGNB 4GSUA 3BEVA 1TR7A 1JWSB 4V1DE 1LO2L 4WNQA 1ZWIA 2EDHA 3HE6A 3ARFA 3ASNB 4WK4B 1L7IH 2HVJA 3LZOA 1Y0LB 3FU7B 1GMIA 1PLGL 1X7SA 3EJPA 1T0NA 3ML8A 2P52A 4LLMB 5FYLE 3FQTA 4HCGA 4EMZA 5F9AC 4OF0A 1I9EA 3C12A 4YUEL 2F0CA 3EUUA 4IBTA 4HJTA 4KJYB 3K72B 2CBMA 5DK0A 1MFNA 4L8BB 4CJ0A 3DDFA 2L8AA 2Z8SA 3BH9B 3CSFA 4G8FA 5BQDA 2DBJA 5B38G 3IDXL 1W6LA 3MPCA 3X2QB 4AIZA 2ID5A 1Z2KA 4NKMA 3VSQA 4BE5A 3OPUA 2ZJSL 2O30A 3NCYP 4KZDH 1QSFA 2X7LB 5FF6A 1UWXK 4HKJA 2OI9B 3V6ZA 4Y5VB 1UCBH 3X3GH 5CXPA 2EDYA 3KCWA 5G55A 1M2VB 1ZJAA 1NJ9B 1AQMA 4UU9B 3WLWC 3CHXA 5CCKL 2XY2A 1KBVA 3NCEB 1T03H 4YE4L 3GKWH 3UX9B 4Z7QB 4WHYG 4XCFH 4WI0B 5F7KC 1L9SA 2R0LH 4ZW5A 2GUOB 5HHNB 1MCWM 2WMPB 3E2HB 3MNVA 4PJIF 4M93B 1OGAA 4NOFA 1NANH 1UEMA 4GXVH 5IB4A 5I8EB 2YUVA 2ZCLH 4YGVA 5I19H 2Z31B 3SY0B 1KCUL 4ENZA 1E9PA 1XGZA 1SXZA 3WTUA 3EOTL 1RPUA 2Y5QA 3KGRA 4ADJA 2APBA 3U0WL 2BP5M 5F2FA 4C83B 4N8UA 3QIUD 4A38A 4IMLA 4QRSB 4M6AA 4ZW8A 2V3FA 4YHZL 4R8WH 4MMZB 3LV3A 1ZDQA 2PUQT 5L6YL 3RJQB 1KBWA 1OE2A 1JK9A 5CEZH 2AJYH 3V52H 4UOW1 2L7EA 2P48B 5INCB 4AC2A 4NN5B 1MNUH 1FGNL 4XXCA 3G6AA 2XETA 3DGGB 4RIRA 5HGBB 5KVGE 4JM4L 1XZWA 2BO0A 4DWHA 1HILA 3KWWA 5C09B 4CKQA 4N0FA 4HGWA 1WFMA 3D4GA 5EIIA 2NNAB 3GXNA 4PWGA 3K81A 4BSVA 2JNZA 3FUEA 3ISYA 1DQLL 5B38A 3NTCH 2FX7H 3RFZA 4ACTA 3B7SA 4PTTB 4WCYL 1O7VA 3D85D 5C0AD 1R3HB 4XCEA 3VD0A 4OT1H 4P48A 2DBLH 1T5XA 2B4CC 4MAYC 4AJVA 4D0DB 2Q5BA 4CMMB 4G43A 5E70A 1M2OA 4O2EB 5K9KA 3R8BB 5DMIL 3A6BL 1G84A 1SNRA 5MEPB 1HZKA 3AM8C 5D1QA 2B5IC 3L1EA 1OQOA 1W9XA 4JHWL 4GS7B 2VXQA 4WI3A 2H4EA 3ZKMC 4QWWC 2CBPA 3HVDA 1KYUA 3ASOB 5I18L 3NACL 4JRXD 1KMGA 4U49A 4JY5L 2K6ZA 3IXTB 4UNVA 3F62A 3U1SH 3U6RB 2VXVH 4M9PA 4BSWB 1YNLL 5CKGA 5EUOB 4WY7H 5CJXA 2ZQKA 4ZW3A 3FSZA 5M7QA 5E03A 1IE5A 4AOFA 4JZJC 2UXFA 5IV2A 2J8UE 3QDGB 5L6YH 1RIVL 1ES0A 1PY9A 1TCRB 1J8SA 2VDKB 4ZQKA 2WQ8A 4BUGA 3NJVA 3FQXB 4HWZB 4ZNEA 2WTRB 4MJ6A 4ACPA 4XE0A 2IFFL 1N8ZA 4GMTL 4ZMZA 3EJUA 1NGZB 3Q5OA 2LTQC 1I75A 4XR8C 5DVMA 3CVHA 3H3PH 1UJ3B 2A73B 2CIKA 2WXNA 3ZYOA 4L23A 3FJTA 2I7OA 4X80L 5IW6A 4FABL 1IAKB 4M1GL 3TZVC 4OZIB 3LEVL 1MAML 2XN0A 2EINB 2H3XC 4PS4L 3CMOH 1PZUB 2FUQA 3ARBD 5FC9A 3QWRD 3T0WA 1G9NL 2R0ZH 2V8LA 3QAZC 3NZUA 4M02A 3RTLA 1SJVA 2EDNA 3OKNB 1WP6A 3Q43A 3GC3A 8CGTA 1P7QD 2J1ZA 3D0LB 3TYGL 2FD6H 3HE6D 5I73B 4XHJC 4JFTA 1Z9LA 3UACA 4TUJB 5I75B 1GOHA 3BT0A 1UWGH 4HJGA 1JXDA 2DWDB 4ZG1A 3Q3GB 2ZCKL 4O02H 5IMOA 3T0BA 1QLFA 1U3HA 1UVQB 2ZPKL 1KYDA 3RWEA 2UXTA 1NBZB 4F7KA 3L1OH 1GJIA 3QJZA 3U2IA 3ZW3A 4O5LL 1KB9K 5F1SA 5H4ZA 4EDXA 1PBYA 2VSDA 4NX0A 5DFWH 1YYMH 3PQYE 4XMKH 1I7RA 2UY6A 3MXWL 4TL5A 4WUKH 3KVPA 4HJJH 4LDLB 4JG1H 3C09B 1LNUB 3QIWD 2VLJA 4DETA 4J3WA 5TDNA 3D33A 4X0NA 4Y1SA 1JFQL 4Y4FD 1C8QA 1X5YA 1T5WA 3TCTA 2WW8A 5AVRB 4JY6A 2D2CC 3T0EE 2WWOA 4HETA 4M5SA 3LPWA 4UV7L 4WWNA 5ALCL 4X5LA 2J6EA 3TBYB 1K3IA 1NCHA 2YGVA 2Q8AH 2XG4A 4TTGA 7FABL 1VJSA 5CSGA 2BMKA 5FGCE 4G42A 2D03L 3SDCB 2DWEB 3RIFF 2QV2A 5BMFH 3ASWA 3B9KA 1DQVA 5D2NE 2J44A 2KHAA 3KW7A 5JIHA 1CLYL 1PDKA 4QHKI 1KZQA 5EF0A 4XH2B 3MRDA 4R7LA 5IB2A 2VH5L 2CDEB 3CUPA 4NWUL 1JZEA 3OKEB 1BP3B 4WWOA 2FGWL 2ADGA 1OE1A 5A7EA 1E2ZA 4M4RA 4W70A 3QJFB 1XSJA 2PNDA 2FX9H 4PV8B 4BBWA 4ELDA 1AACA 3SDXF 1NOAA 3SDDD 4NC0B 3GSNA 2NPLX 3G7TA 4N8VB 4KDWA 4P5SA 2E46A 5IJKC 3C8DA 3C6EA 5EUOF 4Z3FA 1A3RH 4HSAC 3SPCA 1U2HA 2DKSA 3DOSB 4XMZA 1BWWA 2ENQA 1WFOA 4WI0A 3RA7H 4XVSL 4K7FB 3ZTCC 3QWQB 4NERA 1TQTA 5KN5B 2BZCA 1QR4A 4APQC 3VFTB 5JUEL 1FGVH 3HNVH 1AJ7L 4RISH 2YA2A 2AGJH 1MFCH 4F2MA 1BFOA 5HSFA 1NFKA 3IMRA 3TA4D 4BQ8A 1YN6A 2Y36L 5HVGB 4F9LC 3WTXA 5EO0A 1WFTA 3S36H 1YEHH 4JZNB 4TOYH 1KLGA 1TU2A 4NHCH 3MRQA 1G7PB 3ARFB 3T3PB 4TPRL 4U6HB 1TT6A 5HHVH 3MRJA 4MMZA 3QG6A 4PB0L 3IGFA 3QNYA 3CIAA 3ZT6A 1JPGA 3GBNH 4KJYA 1XCXA 4FTVD 2IC2A 1BZEA 4GRWH 1NDMB 5IIEB 2KZWA 3GT6A 2XACC 5GS0C 3DLQR 4PCYA 4E9VA 2XV6B 1NOFA 3BAEL 4Y1AB 5AFAA 3LNEA 1MG2C 1IO4C 1NCGA 2R69H 2NY0B 2WZPD 5FM5O 2WBJA 1PZ2A 3CXDL 1DLFL 2HKAA 1E42A 3DX3A 2W0PA 3EUDA 3FUHA 2B9BA 1RZKC 1AD9B 4EOWH 4HKJB 2EIMB 2W81C 2WGXA 1L6XA 3P2DA 3PWLB 2I9TA 5EU6D 3T71A 2OZNA 2YD3A 4OM1H 5D7IA 3QHTC 1GSKA 4JCLA 2HJLA 3B8SA 2PW2B 3FQUB 3I75B 3SBWC 2KQNA 4MCMA 4KNQA 2ZWSA 4RBPH 4F7CB 4UQ2A 4O5LH 1V7NH 4NAJA 4HUXA 1Z0MA 2NNFA 3C5SB 2CZNA 3LEYL 4X6CF 3ESPA 2XY1A 4YE4H 1U93A 1JVKA 3B6SB 4TNVK 4G43B 4I1NB 3IJYA 1CDIA 2XVLA 1GGIH 2Y2YA 5MEPA 4M8RA 2ZSWB 3CFCH 3X1BA 3HPJA 1AZUA 1H6EA 2X87A 3B9DA 1HSBA 1FAIH 1KEML 5F9WB 1EJ6A 4JG9A 4Y4KD 1WF5A 1G9NC 4Z0BH 3U7WL 1FH2A 2R83A 1VLXA 3D85A 4LF3A 1IEBA 3WY4A 3GJEA 2PLTA 4XP1H 2ITFA 5C0AA 3ULSA 5IB3A 4GUPA 3ARQA 3PWJA 4QY8A 1BM3L 1GZPB 3RWIB 4OUOA 1B0RA 3GB7A 2MOQA 2DMGA 1MCJA 1U0QA 1MCFA 5EN3A 1RIHH 4KOCA 2FL5B 43C9B 2R2EA 4WEBL 5F88A 2YD5A 4PJDA 2Z0UA 2WQVA 1JHTB 1YCSA 1MCOL 3LH2L 1T2XA 1SLWA 4K23L 4IBLT 2OULB 1Q4NX 4M7LT 1DDHA 5C0JB 4PRIB 1IMHC 3S37L 5C0BD 2NY3D 3EG9A 4YFLF 4BE6A 5A3IC 1MW1A 3IK2A 4KK5C 2E0PA 4PSRA 4WFHE 1URZA 5E99L 4KKCC 2CCLA 2YMOA 5DFVD 4ODWB 4OZGB 1ZGLP 2BWQA 4MJJA 4IJ3C 4TUUA 3RIAF 4J3SA 3VNYA 3C5JA 1XIWB 3LKSB 1WBZB 2WIIB 1QI3A 3DUUB 4Z7OB 2EC8A 3N06B 4N5ED 1MAJA 5IGXH 4JDVB 2H1PL 4MD5A 5BO1H 3L3HB 2G2NA 5DD3H 4UBDD 3QJRB 1FCGA 4QXVA 1ZSHA 2ORBH 1XBDA 4NBXB 3O6FC 5T1DL 2V2XB 4PRID 3QEGH 3QDJE 5F44A 3NFNB 2BC4A 4G2AA 1JPFB 3T3PF 4HJGB 2CHWA 2PP8A 1Y18A 2J7LA 1QLEL 1XGUA 4HS3B 4NM8L 4MSWA 5D9SA 5GRUH 3RFZC 1MCEA 3J8F7 2AEQH 4R4FH 3NIFB 1NBZA 2VR6A 4X7TA 4LLUB 2ADJA 4IBSA 5DD6A 1PKQE 3EO0A 3I6LD 4NZRL 5DJYA 2ILLA 1ZY9A 5KJRL 4H88H 4A6YB 1F6AB 5IZ7A 1FCCA 4ZUTA 1ES0B 2XZQL 4TSCH 4ZQKB 4K7PX 3BQUB 3AWEA 5JOPD 1YZZA 3RDTB 3VI3E 2DDQL 4AIEA 3EDJA 2EYRA 1N8ZB 3NEXA 3GSUB 4X6FB 2DTML 3EJSA 4F2FA 1CYGA 1T5WB 5EC1B 4PLKC 3RVWD 4UM9B 4NYLA 2J8UB 3QDGE 1Z5YD 2AK4A 3B37A 5IQMA 2BH0A 2A9ML 1FYHB 1WK0A 3CFEB 1KPRA 3O2DL 2JIXD 4UDUB 1BQKA 2AV1A 2P5WB 3IRCA 2DMHA 3DMMB 2J1KA 4U1NB 4Z5RA 1GC1H 1WGVA 3INUH 5CP3H 3QWNA 3OKOA 3CPLB 5JIPA 2HKHL 2P24A 4P06A 3VACA 3IMSA 2BMKB 3MRFA 3H42H 2BNUB 1DL7L 2NNCA 4LO9A 4FI6A 2JFCA 1JE6A 4FTDA 2JTDA 2V3DA 1EJOH 3BZ4A 3HNSH 3CH1B 2J1YA 5FKAA 1WRFA 4RDQG 1SHWA 3BZFA 1M7DB 3MV9E 2GBUA 1L3NA 4XGZB 5C0BA 3SN6N 1YG9A 2PYEE 2XKUA 3LYRA 4Y9GA 2F5AL 2J12B 1WAAE 3DJ9A 1BGXL 1HOEA 2GK2A 3G9VA 1Y6KR 3AWFA 1JGDA 1ZXQA 1MW2A 5D8JH 2MNJB 5KBLA 1CIUA 3CVHH 3W38A 5BCAA 2DLFH 4EIUA 1JCVA 2YRLA 2HKHH 2Z92A 4XPGH 1J0IA 3U36B 3WDJA 1J87A 1N0LB 4ZFGH 4YHYC 1EQWA 2WO2B 3BVXA 3N1QC 2EEBA 3BGFC 4J3BA 1SHMA 1PZBA 4UQCA 4XMKL 1J1XH 2X4QB 4MWFA 1CL7H 3ZQWA 3W81A 1N5YH 2DEYX 4MQTB 3IRZA 4PJAE 4F2MB 4L8DB 3I02B 1DVTA 5L9DH 5LG1A 4J5VA 2A77H 4TNEA 5ABAA 4JFPB 4AH2B 4JUSA 3THML 3LXUX 3FQ1A 2N7BA 3H9HB 2QKIB 2HLAA 3PV6A 1L7TL 3HZ3A 1GTNA 1WC7A 2DWEA 5AL8A 3QRBA 2ED7A 4ORZC 3HJ0A 1LJMA 3ARGC 1ZA3A 3FB7A 2JELL 1N10A 1MHPL 1KNOA 2PO6A 2XPZA 3JV0A 4NUQA 4PHXA 5FYKU 2GIXA 3V7AE 1JRHI 3LKNA 5F0JB 4HS8L 2OR9L 2Z34A 4EZMA 5B8CB 2WNKA 15C8H 1JNLH 1ZGLB 1S7WA 3N1PC 4FD0A 8PAZA 2J6WA 2FAUA 4OZIF 3HHMA 5FDYA 4MAYD 5KYYB 2H3NA 4PJFF 3JWNG 3QI9C 5F6HJ 4KJPD 1OL0A 2GKIA 1QUPA 1QLEH 1INEL 1MCQA 4YHZH 5D7IB 4L4VE 1J8HB 1ZHNB 3QUMH 5C71A 4QTHB 5DJDA 4EPSA 3TF7C 3S2CA 5DVNA 4JQIA 2XCMC 4NQEA 4MKTA 4NQVB 3E6HA 3NDYE 1ZVHA 1GVIA 1VHPA 4WKXA 3VFTA 2V7NA 4ZX6A 1RUQH 4IKIA 1IBZA 4YDLC 5E00A 3CSTA 2H1XA 1HXYA 3FONA 1NC2D 5EFIA 1BFOB 2FZ3B 5I6OA 2HJFB 4L4VB 5ERWB 3S4SG 1CDYA 1RJLB 1BFVH 4HXAL 3TJHC 2AV7B 4JZNA 1AGBA 4MMXC 5C7XL 2PXYB 1KOAA 2GK0A 3WFZA 1ASPA 1DFBH 1F6FB 2J1XA 5DMKA 3SQOH 4IGBB 3UTSB 4TQEH 2WLIA 2VLKB 2IGLA 5BS0A 4MS8C 1LO0H 2GHWB 3HRZA 3UTQA 5KBPA 2BNQB 1NA8A 4F24A 2VN7A 2FJHB 2PWEA 2YXMA 2QELA 3E3QE 1QABA 4YSTA 5IWLA 4A39A 4LSRH 2R23B 2VXUL 3SJVE 2AJSL 1IEBB 1F4WH 2BINA 1MWOA 4FP8L 3VFNB 1FNSL 5AVTB 1AZNA 4GUPB 4NI3A 3QZLA 1AYRA 4QF1A 3UADA 3VGAC 4NJ9H 2OL3L 5FYKD 5I1AB 3A24A 1FBIH 4C56A 3F7VA 5JR1L 2CCVA 4MXVE 1RZKH 2FL5A 3GLEA 3IXAA 2IDFA 4F91B 2F9BT 1T0MB 2EH7L 3DYMA 4NUMA 5C86A 4Q7DA 3ZZSA 1ZTMA 4OZFA 5J3HC 2JCCA 5EWIH 3V9EA 5C7XH 5JIMA 2C7UA 2R4SL 4HJ0C 2EC9T 5I8KL 5EU6E 1LP9E 1Y7VA 2NZIA 3L5XL 3L8QA 1TVBB 4Z7UA 2DEXX 3VA6A 4E42A 1ULVA 4DP6X 5DJ2B 2PW2A 4OZHA 1XWVA 1L0QA 2JKXA 5T3ZL 3ZX1A 3K4ZA 5C0CA 5AVUB 2BZDA 3EH4B 3QRGL 4DGVL 3TCLA 1T22B 1VIWA 3NIDF 4P2RB 4XB7A 4OM1L 2X1OA 2C3VA 2WYZA 1A7NL 3GJFA 4M7KL 4N3TA 2Y07H 1X6NA 1JZ4A 4LDEB 2R39A 2MCAA 4NKIH 2YIHA 3I3BA 5J06A 3ZDXB 4FTVE 5JHLA 3W1ZA 2OZ4H 4QXUH 3CVBA 3MLUH 3UG5A 1J8RA 4Q52A 5LNDA 3ZIMA 5T1KA 2VSCA 3H9SE 2X0VA 3CLFL 2EKJA 4EOWL 3VFSB 3K5SA 4L1TA 3PQYA 3PHQA 1Y6MR 2JJUA 2C9VA 4V33A 5GS2H 1H6UA 3FO1A 1PZAA 1OTUD 1L9MA 3M1OA 1Y18B 4Z76B 2QQKH 5CKAA 2WUCL 3V4PH 4XBMA 4JGMA 3SBWA 3GGWB 4D3CL 4ZPTB 1F1AA 3Q1SL 1DJIA 5HHMD 3EKCA 1DQDH 3D25A 4U6VL 1TVHA 3WJLA 3Q2NA 3AT9A 2EDMA 2ERJB 4PJDF 1JYWA 3C60B 3UZQB 3T0AA 4D9QD 1ZT1B 1MJUH 1NWOA 2RTTA 4IMKA 2O5YL 1FG2B 3PUUA 4PG2C 4C59B 2EVHA 2D7TL 2GSIB 2QSTA 3FU9A 1BVOA 3PGDA 1V54B 4FFYL 4XXDA 3SKJL 2WWKT 5JXEC 2VT0A 1QSED 4UM9A 3UYRH 4N8PA 2Y2TA 4N2NA 4X6CE 1JNJA 4JDTH 1I7UB 5IHLB 1NMAL 2OI9C 3CFEA 5D70L 2XWBA 4H8HA 2EXTA 5GGRB 1CGYA 2H0PA 4NQDA 3X3FL 5GGVH 1VFBB 2DI9A 3D3VD 2G3MA 3MKGA 4MKMA 4EI5A 4WW2F 2AITA 2UX7A 1P5VA 3D7PA 3HBZA 3ZSSA 1C16A 3L17A 3MAWA 4I0PC 3QCTL 3UZEC 4OLUH 5F9JB 2G4EA 2X4RB 3SZ6A 3TO4B 1GKEA 4MS8D 3PGFL 3L3HA 4ZNEE 1J11A 3IDJA 1F56A 3PGCA 4J23A 4OCWL 1IGCL 3VXMD 3M1CA 5JORA 2D4FA 3V79C 4U1MB 5I6XB 4JQXA 3O3EA 4HALA 4PS3A 3RP1A 3BUIA 1TSHA 2LAAA 3RKPA 5I8OH 3BWSA 1BMZA 4O9HL 4RMSA 4RQQB 4KZ0A 3L5JA 5IBUG 1K4CA 1SF5A 1HL5A 2OMTA 5E8NB 5KJ4A 4Y8AA 1CGSH 4NO5A 2YJQA 5DUBB 1JNNH 4RA3A 2HWZL 3MSPA 4U1KA 4OGAD 5CGTA 3B83A 3OL2A 4Q6IC 1HK6A 3QCVH 4KK9D 4P4KD 1CI3M 3KVDD 4NRXA 4OI7A 4LHJB 3KPPB 1M7IA 3HE6B 4YDIH 1B0GB 2GJ6A 5E2WL 2WXGA 3TZVA 2JTYA 5KG9A 2ARJB 3VXPA 2G3NA 1P7KA 4FA8A 3MCKA 1AZBA 4BA0A 1NAMH 1NFDE 4QR7A 1DBMH 3L1GA 5AAWC 2P47B 3FTGB 3HR5A 3ZE0E 4O02A 5T1LB 5IQLA 4P2AA 3ZYIA 1B88A 2F19H 3P1VA 1UJTA 4MJIB 4NC2B 4N9OB 4HJUA 4JFPA 3NESA 5LB1A 1CICB 1UTDA 1IM3D 1XD0A 4OD2B 4UQIM 3K80A 1JZ7A 1FFRA 2E7LA 1AY1H 2XXCB 1ZIBA 4PIBA 5GGTH 5C0CE 2CALA 2GJ6D 3V6ZB 2VDNL 2PCFB 4XMUA 2XKNB 2WLMA 2N4IA 2I5YH 4BK4A 5AVZB 5DS8B 3WELA 4G80B 1ORSA 4KVPA 4YEFA 3GTNA 4YH6A 1JGIA 3HZYA 4KKRA 2WVTA 2WXQA 5BOJA 3HS0B 1JGDB 1P6WA 2CLVA 5E4EB 4BFIA 2RR3A 1NAMB 4PJ5E 3R4DA 35C8H 3ZL2A 3I6KA 5TE4L 2MCPH 3QDJD 3TVMD 2NMSA 3EHBD 2DM2A 3MNWA 1RZ7H 4IRJD 4P4RA 4PVLA 1JGVL 1YEWA 4S2SB 4Y4FB 4F5CA 3GMPB 3QNFA 4QTHA 4U6YA 2VZUA 3NPSB 3EJZD 4ZPVA 1Q38A 2YRPA 2QADB 5AOLA 4B0MB 5HGGS 5LBSL 1E4XH 4PRDA 1MI5B 5EA0H 1HVXA 4JM2C 1I7ZB 3NSXA 2QVFB 4EKJA 2YSSB 3PRZA 3T2QA 4KQ0A 4KRPC 4DGIH 5DA4A 4Z1PA 5E5RB 5KOVC 3QO1B 4S1DD 3WUWB 1CN4A 5CD3A 1RK7A 3AW5A 2NY3B 2HTKC 5IVZB 5TDOA 2D2OA 3R7QA 4U0QB 5HGBA 1YJDL 2HLAB 1AGEB 3PV6B 3TVMB 3EJCA 1T4KB 1URIA 4ABVA 4U1LB 1HWWA 4L4TB 1FL3A 4KI1A 1LD9B 4L9LA 1WUNT 2NSQA 4N24A 4BSVB 3V4LA 2Z1PA 2VDRB 4BSJA 4XCNB 5C09D 1R3JA 1FIGH 4BFKA 1INQA 3ZKQD 5L0QB 2WVSA 2GTZA 4JRLA 1S7QA 4PD4J 4PWFA 1IUZA 4FJ6A 1EXHA 2JELH 4DQOL 3KXFD 3V55A 1BJ1H 5F9WC 2VL4A 4YBLC 3KPRB 1Z3GL 3GMRA 2F7RA 2NY1B 2K6YA 1ETA1 3Q8BA 2FWOA 3FMGH 4CMMA 5K9KB 3QFDA 1GYVA 2BOCA 2JI2A 4U3XA 5EO9A 3Q01A 1UD5A 3IU4L 1FL6A 5GRWA 5IESL 5E5LA 2IWGA 3MODH 4O4YL 4FKHA 3GBNL 5HYIA 4LE8A 5KYXB 3JV5A 5MENA 1IC7L 4F92B 4G6AC 2AP2A 4NSKA 2PPAA 2GVYA 3K0YA 4HS8H 4WO4A 1NCCH 4BHUI 5DVLA 2G75A 2WSDA 3BVUA 3CLEL 5D2LA 1JHKL 1G87A 1NEZG 2JKIS 2WLNA 5AL0A 1J7VR 4J3VA 1R3IL 2VIRA 3SYAA 2WLIB 1T80A 3LZRA 5ADOH 5FDWB 4X8GA 1TOXA 1FGNH 5ESVA 3NSYA 1F8TH 2AJVH 4DVRH 2F19L 4WI8A 2R1YA 4QHKJ 5DEGA 5ILTH 5HYJB 1KPUA 5LAXA 5E99H 1Z9NA 1QFPA 4M56A 1BFSA 1T4WA 3GGWA 1YECL 5JTWA 2Q3ZA 4XVUD 5D7KD 3SYOA 1U8NB 4WO4D 3FF7A 3UBXI 5I8CA 4HCFA 3OC5A 5GGTL 2E8ZA 5I1GH 1VZHA 2WLLB 1T0MA 1SMOA 5L7XH 4L1BA 1HHJA 3BHBA 2VITB 1E6OL 2GJPA 4OZFB 4BQBA 3N43F 3PGDB 1PMYA 5I1KL 2P8LA 5H2BA 5L4IA 3ZUCA 2QQNL 1GL4B 4MJ2A 5CU9A 4JPIB 3IFNL 1LO4H 3O2VL 1KJMB 3G6JF 4KK9C 2FT7A 4M7LL 5BRZB 5E1IA 2WYHA 1IGYA 3I6GB 4LZKA 3UXFA 4LSPL 4PCKA 4WSKA 1RJYB 4RAUB 2MCMA 4GAGL 4WKZA 3RNKB 1G0DA 2JCWA 3Q3GA 1Q1JL 4F80A 3O9WB 1JWUB 4NGHL 5KSAD 2UVFA 4K94C 4XX1G 3HZMA 5FUOH 1OTSC 3EBGA 2P7TA 3BCDA 3DVFA 1JV5A 1ACYH 2HTKD 4R6UA 3TGXA 3V0AC 4EDXB 3QQDB 3G5YB 1JXFA 2AQTA 1I7RB 2UY6B 2NY4C 3BN3B 1ITCA 1XTMA 5D7IF 3OVUB 5I1KH 1XTLA 1JHKH 3IF1B 4JRFA 3VFWA 4JM2D 1RSFA 2F58L 4IW4C 4XBGA 2VO8A 2WUBL 3BKCL 2ICWI 3A4DA 3X3FH 4JFOA 4ABWA 3SO3C 1U92A 4RSYA 1YEIL 1X5JA 5IFAL 2KZ1B 3U30C 1TVHB 5L2KA 1HNYA 3VH8B 4KNSA 3S88L 3K2UL 1RHHA 2P5EE 5D8JL 2CDGB 3X12B 4MHHI 5JHDB 1YECH 4LCYA 2AJYL 3V52L 5DHEA 4P57A 1UKQA 1LLAA 5DU7A 2UY7B 2NY5C 5IP4A 5KYWA 3AC0A 3BAEH 4HIJB 4HIEA 4L3EA 4O02B 5DUJA 1FUNA 1KDIA 5A2FA 1IQWH 1K8DA 3WFCL 5F71A 2ZF9A 2I85A 1CICA 3HC4L 2IEPA 3CN0A 4OD2A 3NSFA 2F7QA 4AUYA 3MDJA 5BZZA 1JAEA 4NM4L 2DQFA 2P5ED 4JKWA 1ADQA 2DTSA 2QPEB 3QHFL 5I1LA 4PB9H 5GXBB 4G80A 5D5MA 4L1DA 3ULVL 4QJ4B 4WV1C 1PY4A 4GRWF 2UZPA 3ILPA 4BRJA 4M1CD 3HI1A 4ZXBC 3N1MC 1SF3A 2ZKWA 3EOYG 1DEEB 1E27B 4KRMB 4YAQB 3T2OA 2J56A 3U2SB 4WFGD 5IG7B 2A9NH 4N86A 3FN0H 5I73C 3RWJA 4WNJA 2HXAA 1UB5B 1QBLH 3GQFA 5D1ZC 2OM5A 2YKLH 25C8L 3UIYA 2HX9A 5B7FA 1CFSB 3GXFA 2IGFH 4RGMB 5D2NA 3FB5A 3RWGA 4FAAB 3PXJA 4P23B 3ALXA 1EAPB 3F6LA 4UMGA 3TZVB 5KG9B 2VW6A 2Z3FA 3RNQB 4LCCB 1CD1B 1A4AA 1JRHL 1AC0A 1UGNA 1W2KT 2AJXL 2W07B 4LSVH 1TTUA 5C0FB 3QFJB 1P4IL 5E2VL 3H6AA 2ZUQB 4P3WA 5E5MA 5T1LA 4MLIA 1EEQA 2PR4H 2VXTH 4ENED 4JM2B 3RX9A 3UMTA 2ZKHH 5CD3B 3SDXE 2W91A 3WN6A 1ASOA 2LVCA 4MNHA 3IS1X 4Y7MA 2UZXB 3CCHA 4ZXBA 1TPXB 2A74A 2O6EA 3FU3A 3TVMA 3MFFA 4KDTC 3SCMB 4PJ5D 2YPKB 5KOMC 1DANU 4ZMPA 1FL3B 1N59B 1NL0H 2Z35B 1UD3A 4WJKB 4UQEA 1DANT 4RETB 3FSVA 5CLXA 3T9WA 1IGTB 2ZYHA 4HOZA 2J88H 5J1SC 5CAYB 1IB5A 3W39B 5DS8A 1M7UA 2ENPA 3PS6A 2WNGA 4V2BA 1S7QB 1LEKA 3E8UL 3KGSA 3NZHL 3IDYB 4ISVB 2XC8A 1WH0A 4XX1E 4R7NB 4DZ8B 4CU7A 1YMHB 5J6GB 5B3NA 4KXZI 2UXVA 4Z7WF 4WO0A 1J0KA 4Z95H 4ZT1A 1P2CA 1U3YA 3L3OB 1PQZB 2F6AA 3ILEA 3S97C 2AI0H 1AANA 3MV7E 5L2KE 2OTUA 1SVBA 1IGFL 3ZQXA 1R1CA 2DYRB 2ZSWA 5I18H 4BFOA 5T3XH 4AW7A 2X09A 4I5BA 3GDCA 3CZNA 3QI9D 4TVUA 4K5MA 1D3CA 3HEIB 5GSVB 1UH4A 4MB1A 5FYJU 3T6VA 5F89A 15C8L 3DX9B 4H26A 4OFYD 5HVHB 5E8DH 5C0AB 5CHNB 4ZUSA 3QEUA 3T5WA 3O4OB 3PWJB 2Q3XA 5KSUB 2PKDA 4G5AA 1DO6A 3BIKA 5IVZA 2M26A 1TZHB 5TDOB 5I6LA 3LNIA 3HE6C 1K9TA 1HDMA 5JMRA 5KBDA 1TKWB 2R2EB 3UTOA 1TETL 5ID1A 4AITA 1JD9A 3VXUD 5LAXB 3TOPA 5E8OB 2C9AA 4PJEB 1DDHB 5DMYA 2NLJA 4XO4A 4ZTPL 4B5EA 1QFUL 4EE2A 3PABA 5CZKA 1A7BA 4Z3GA 3JXAA 1JF5A 3OGCB 4I0KA 4OH2A 1J0HA 1NUDA 3GRWA 3MNDA 4K5LA 4NLHA 1DBKH 3SJVA 2ZUXA 2O6PA 1IC4H 4JFYB 2EDKA 4GRWB 5BRZD 2JIXA 4Z23A 5J12B 4MQSB 2E8YA 4GKNA 5F0PB 3IETA 3MV9B 2J21A 2W1NA 2VDQB 2WJ7A 4HCRH 4XCCL 2ZX9A 4GQ9L 4PTUB 4FQCL 1TUPA 4EI5D 1FL6B 2IANA 2VLJD 1BPVA 1P1VA 5J1AA 2FX9L 5HHPB 3CVIL 5DDHB 1G7JA 3QZWG 4XXWC 4NFDA 3AWGA 4ZJ9A 5IQ7L 3OMZA 2APSA 4I9XA 3D0VA 2JF1A 5ALBL 4WO4B 5DA0B 1HCVA 1U8KB 4I77H 2EDOA 5AKSA 3W0WE 4LP8A 5EIIG 3ZKMD 4UTCA 4P5TA 5F21B 1WO2A 1T7YA 1DBKL 3MJ7B 5D1XA 1MZZA 1U6AH 2C9PA 3QHZL 5FDWA 2P1YA 1IBGH 1CD8A 4N2IA 1EFXA 2YN3A 4OJDH 4PWKA 1CYXA 1EZSA 1IARB 2EP6A 5C3IA 5M94B 5GS2D 4YL4A 4GQ9H 3TASA 1S7SA 3HAEG 5HYJA 2XWTA 1KYOK 1IGCH 1W8NA 1EDQA 2UVEA 2VM4A 1JGUH 3ME0A 3H0TB 2ENYA 4AL8C 1U92B 1IKNC 1UD6A 1A7OH 1SJMA 2APXA 2ZCHH 5LXVA 1MI5D 2XA8H 1CLCA 3P3YA 1ORQB 3OAUL 4GW1B 3DMMA 3TNNA 3VH8A 3UG4A 1H5BA 4BH7B 2VDNB 3F8UB 3AABA 4D9LH 2VH5H 2KKQA 4M00A 1OHQA 1R3IH 1EZVX 2GSGA 5I5IA 1V7MH 4IRZL 1U8QB 4GNKB 3FB8A 5ISZB 3S8WA 2OJEB 1FZJA 1A7QL 5PAZA 1OAKH 3M8OL 2XPGB 2YQ3A 3Q1SH 1YPZE 1DBBH 1RZJC 3V9FA 3P73B 3ARGD 3MODL 2KLTA 1ONQB 2VC2H 4KX8A 1RZIB 2CGRH 4MAUH 2XTSA 1IKNA 2BWDA 5F7BA 5F9OH 1L6ZA 1BVZA 2CPUA 4WFHD 2XWJB 4XNYL 1RU9H 2ZYIA 2L7JA 5ISZE 2QSQA 3A6CL 3GZKA 1I8KA 3CG8A 4QRPA 5HI4D 3O3UN 3G08B 3LEYH 2IFGA 4AQAA 1IZJA 3PWUA 3IM1A 4NOBA 1T6WA 1AVAA 2Q7YA 1VACB 1YSOA 3IF1A 4HWBH 4JG5A 2O6FA 4NDMA 3WCYA 5LBVA 2BCKB 2X4QA 1GTFA 3OLIA 2FWLB 1XIWD 1UXLA 1YEEH 3HCVB 5EC2A 3VU2A 1FDLH 4L8DA 3BP5A 4PG2A 4RFOH 5HI3D 1BYPA 2FYYB 3MO1A 3VXME 4B9FA 2WXPA 1YVLA 3INOA 4AGQA 1JWSA 1SQ2N 3EJRA 1AXSA 4BXSV 3D18A