3NCMA

Neural cell adhesion molecule, module 2, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
YVMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords PROTEIN (NEURAL CELL ADHESION MOLECULE, LARGE ISOFORM)
publication title Structure and interactions of NCAM modules 1 and 2, basic elements in neural cell adhesion
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1998-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncmA00
1FFPA 2YZ1A 5C0CB 3V5DB 2QQNH 2D4DA 4P3WA 1WFUA 4X6BB 1SJHB 1T7ZA 4UT9L 2OYPA 3SE9H 3VXRE 4Y1AD 2P5WA 3GSVB 1KEMH 3OXSB 5D9SB 1TCMA 4Z5RA 3L3JB 5ICZB 2AJXL 3QO1A 4MCZA 5HTSA 1NCWH 2X7LB 3DNKA 3T8XA 3WS3A 1LMKA 4U1JA 4XWOC 2CGRL 2XQBH 4HG4J 5E99L 1RJLA 1T04B 1LE5B 2DLIA 5E8OB 3ISWA 3KPOB 2FEEI 2Z31D 1P7QA 1QSFD 1N5AB 2N1KA 2B5IC 3FO0L 3O45A 4P46B 5F21B 4CADB 5BV7B 3EYVA 5DJCB 5F9AC 2QQLH 3ARPA 5DJAA 3RTQA 2XKNA 2Q8BL 2P5WB 2WMPA 4MLSA 1QBBA 2VXTH 4FQHA 2WIIA 5GGUA 3PDGA 3MZGB 1C7TA 1AI1H 4ZSOE 1QR1A 4QXUL 2ESVE 3MLSL 5MHSD 3D87B 2EDHA 1IGJA 1RJLB 4FNLH 2O61A 2PCPB 2ITDA 4G8IA 4NZRH 1B4JL 3CFKA 3F7PC 4XNMB 3DRTB 4D0CB 2VWEE 5GGQH 1FNHA 5C0BB 2AEIT 1BZ9A 3F7YA 5HGBA 1JF5A 1UZ6E 5DD6B 2CDGA 3G5YA 5HD8C 1X3DA 1UWXH 2XNAA 2OJEB 1DQJB 3REVA 5EBMB 3CFCH 1DBMH 4GBXC 4OCMC 3EYVB 2VZSA 3CUPA 3VGAC 4NQEB 4XHJD 5TDPB 2DBLL 1JGLH 4X80H 1T5XB 4BZ1L 3RPKA 3MR9B 4P99A 4IRZH 3GSNH 5EN2B 1QR1B 4LHJB 3B3IB 4XP4H 5DFTA 2V5YA 3MCG1 3HAEH 3MRLB 4DOHB 4ZOAA 3O4OC 4JKPH 5HHMD 5HGBB 1MRDL 2EE6A 1KTKE 2GCYA 3G5YB 1ORQB 1S9XA 1YEHH 4UAOC 3MROA 3REVB 3GSUA 1A0QH 4XPFL 5MEND 5A2IH 4S10A 4YHIB 2NY6D 4K23H 1CDYA 3GSQA 2CLZA 4PJDB 4QRSB 1AGDA 4MJ5A 4L8SA 4Z95L 4OUUB 1L9MA 4U3HA 5F7HA 2G2RA 5D8JL 5TDNA 1JE6A 1JGEA 3PWUB 4O2EB 1RUKL 3CXHK 1J88A 1OQOA 4Y2OA 4PJAA 3MRNA 1IAOB 1NBZA 1FL3B 5IHBA 5BVPL 1A6ZA 3UYRH 1U8MA 4PJFA 2F53D 3M17A 2WQRA 2NY2D 2ICWA 4XRCB 1HXMA 1QRKA 4WI4A 3PQYA 2WINB 2XWJB 4ZD3H 1SY6A 2AV7A 4P2OD 3MROB 2VZUA 3C08H 5K9OB 5C0AA 2V7HA 1FFNA 5GRXG 1U95A 3CK0L 4FQXA 3ARDB 4NJ9L 1MLCA 4NFBA 3RDTB 1MWAH 3HC0A 4KKAD 3VWKD 4G5ZH 3WXWL 4ETYA 3G9VA 2HJKA 4ELME 3ARSA 4QRPB 1NCUA 1HNFA 3N50A 1J1OH 3MV01 3PP3H 5ALBL 2HFGL 1NBZB 4PV9A 2DQDH 2WBWB 1UJ3C 3QDJE 3QWQB 2Z0BA 3DO3A 4Q6IB 1U8MB 3VRLE 1YMHB 5I1CL 1AC6A 1RURL 3MQIA 4K94C 4P2RD 5AYUH 2VC2L 3FFDB 1YY8A 5IM7B 3WFZA 3QEQA 4CU8A 5D5MB 1U95B 3U7WL 3VXTA 3QIUA 4ZTPL 1XGPB 4MNQD 3RVUD 3TT1L 2LTQB 1U8NA 3W5MA 3CSGA 4GS7B 4HFWB 3JVGC 1LGVA 1BOYA 3B8YA 3QO0B 1PEWA 2HJKB 3IFPB 3MCLL 2GFBB 4JPIB 4YZFF 1BQHB 2X4QA 1C12A 1EGJH 1A9EB 1P5UA 2PETA 4PV9B 3SE3A 5JTWA 1MJ8L 5FYKE 4HC1L 1FBIH 1V3LA 3GM0A 3TFKC 5JDSA 4PTUA 1QLEH 2JJSC 3VXUB 1NMBL 2EKJA 1KLUA 2NY5L 3KWWB 1SM3H 2EDBA 3WSQH 3N1FC 3LMJL 5L7XL 1DUZB 3I75B 4A6YL 1U8NB 2VLKD 3C5SB 3KYNA 4HIHA 3U46A 1F4XH 5I1IL 2AJVH 4L4JA 2X4QB 5D7JB 2Z31A 1FZJB 4GT7A 3HB3D 1WSST 4ZG1A 2BMKB 5JDSB 4PTUB 3BH9A 1E4XL 2AJ3A 1P4IH 1TCRA 1CXEA 1MQKH 4XPGH 4Y1AB 5JW3H 4OQTL 5E2TL 2DIJA 3RKDC 5IHUL 1B3JA 1F3JA 2VZVA 4C83A 5TF1H 4M5ZL 1KF9B 4QRRE 1YEKH 2PTTA 1KCUL 1LQSR 4NWTH 4H25A 1CT8B 5ECJE 3IDIA 1I75A 1UWEH 1D6VH 1AD9B 1VEPA 5F72S 1N4XH 2RJMA 2EEAA 4JZJB 1TJGL 2ORBH 4HIIB 3NCYS 3RI5F 1QSFB 3QZWA 4PGJA 4Z76B 4LDEB 2E9BA 5FUZH 4DFIA 3WNOA 1KLGA 5LAXA 4P59L 5E1AA 1D9KA 2V7NA 4HKBA 2UZYB 3B6SB 1HEZA 1NLBH 3RY5A 1J0IA 5CJXA 2Z92B 1VGEH 1NMCB 2VH5L 1A4KB 3VDCA 3T0WA 1UENA 1J1XL 1K5NA 4LVOB 4AH2B 4OCSH 1HI6B 1OARL 2YPLD 4UMGA 1UM6L 3OG4B 1UKQA 1MELA 2AW2A 1UXSA 5TDOA 1WCBB 3WEXB 1PD6A 1H8NA 5HVFB 4QWWC 5GZOD 4QXWA 1BJMA 3DOSA 4OD3H 1T0NB 4M6OH 1DEDA 1DN0B 4YDLC 1KLGB 3CMOH 4UBDC 2O5ZH 15C8L 3MRRA 1Z3GL 5D7IF 4KJQD 2V7NB 1NDGA 3RFZC 2R2CA 4OCXH 1OT1A 3REWA 1XGUA 5F89A 2WBJC 4LHUG 1VCAA 2BVQB 4I18B 3EO1B 4WO4C 1VERA 4O51A 4MNGE 4XCNA 4E0RB 2QKIA 3WDJA 5FOJA 1I9EA 5HHMB 3M8OH 2F53A 1JI2A 1SJEA 2D9CA 4NFCA 2R15A 1MLBB 5FV2A 4E41D 5KSBB 1IC5L 2DBJA 5DJ6B 4DGIL 5ID0A 2XZZA 4P2OA 4XP1H 1WC7A 2BC4A 5MENB 1F11A 1IM3A 4KI5E 4Z7UB 1RIVL 2AXGA 2HLFD 5HVWA 4ONHA 1C08A 3HZMB 4XPHL 2UWEE 3LDBC 5KOMC 4ZO8A 3PGDA 4M7ZC 5SX4I 5ADOH 1UZ8A 1HYRC 2FH6A 2HG5B 3BO8A 5FHBL 5GISH 1NPUA 1K85A 5HI4C 1PY4A 2P49B 4MCYB 1JK8A 2V5SA 3B5TA 5IWLC 5C08E 4LBEA 4M3JA 4ZUTB 5TQ0L 4EZMA 3OB8A 4ZYKA 5CBAB 4I0CC 4P3DB 1KTDA 3QH3B 4J23A 4YFDB 1OHQA 3TO4A 2YOCA 1HOCA 1SJEB 4HBCH 3IT8D 1FNGA 2B7DT 1MCRA 1LD9A 3DUUA 3DX8B 2A9MH 2XA3A 1JV5A 2R4RL 3NZ8B 4WJ5A 4YX2H 3VWKB 4FFVD 4OZHA 3ZYZA 1EO5A 3PDOB 4J3XA 2UY6A 3D69B 3H9SE 5EB9A 4S1RH 4OBSA 2YR3A 2XFXA 1XGTB 3B9EA 3LRHA 5D2NE 3T04D 5IVOA 1RZJL 1F00I 4NNXB 3D2UD 1EO8L 1NGWA 2I60H 4W68A 3EOTH 3W9DA 3T65B 1RQ5A 3MTRA 3IJSA 4NZTH 4OM1H 3PV6B 4PJGB 3MA7A 1RZ7L 4P2RB 2D7NA 3NTCH 4LIQE 1MHCB 2D2OA 5CKAA 4F7TB 1T7VA 1RUMH 1CXKA 4MXQD 1F4AA 4IRSB 4WEMB 5IV2A 5FB8B 2IANA 1V7MH 5EBWA 5H94A 1HHKA 1MAKA 4X6CB 2NY1D 3HC4H 4MNQB 2GW5A 1BF2A 3MRQA 5DJZA 2VLKA 2YC1B 3S35X 5FGBA 3T4YB 4D0BB 2VR5A 4XBPA 3MLXL 4M1GH 5I74C 3SCMD 5FO7B 5GJTH 3DX7A 4OZIA 5BO1H 2M1KA 3WNNA 4WCYH 4JKKA 3OKEB 3WO3B 1D5BA 2RIKA 4JHWL 5EIIB 3O8XD 3A6CL 4CGTA 2H2SD 3V6OC 1ZT7A 3WDHA 2XZCH 3QPXH 3ZLQC 3MLPA 4OT1L 4P2CG 2NY0B 4OLXH 3S96B 5H94B 2Y7QA 4KUZH 1JYVA 1SYVA 3Q3GA 4YQXH 3TBYA 5DLML 2X4PA 4PJXE 2ARJA 3EUUA 5JA8B 3MACH 2HP4A 5CGYD 1IC7L 5FYLH 4Z18A 5IW6A 1E6OL 3U7AA 4XBPB 4DVRH 3WS6C 2DN7A 1KCSH 4IIQA 3C9NB 5I1HL 1AIFA 1MQ8A 2R69L 1HILA 4JG1H 5ACZB 3CVIL 1LDPH 4HWBL 4P5TC 3FB5A 2DQFB 4Y2DC 2FX9L 1IKFH 3W0WA 1ZT7B 4ZFFB 1LEKB 4POZC 2FX7H 3UTQA 2D9QB 2BVYA 2H1PL 5C07D 4PRPB 5DJ8B 1KJ2L 5F9OH 2J8UE 3VFWB 3FQUA 3G6JB 4GLRI 4Q9RL 5BQ7A 2ARJB 3CSYB 2VDLH 4U3XA 3C8KB 5E2WL 4JZOA 3RRQA 4PJ9D 1WWBX 1UH2A 3F7VA 4NFDA 1BIHA 1X5AA 3UTSE 4OIIH 5AD0A 2P47B 4IIQB 5SWZD 3CX5K 1C16A 2ZSWB 3VXMD 1JFQH 1CFNA 1HSBB 5DRZA 2F19H 4LF3A 2H32H 4HIXH 4P5MA 4NGHH 3D0LA 4MJ4A 1JHKL 5ISZD 1MWAA 3GUTA 3MRKA 1G6RL 1ZLUH 3C5ZA 1FAIL 3D1MC 3OG6B 4HWNA 2OZ4L 3O3UN 4R7NA 1Q72L 3RVXD 4PP2A 3UTZB 3CCHA 1P84J 1DQTA 1WZMA 5DEFB 5KZCB 1I7TB 2GSIA 5BVJB 2DJ4A 2VXVH 3FQWB 4HV8A 2EZ0C 5SX5K 2YPLB 4KMLB 4XBEL 5JR1H 3HKFA 1VEMA 3U0WL 4YHYB 3GMLB 4Y4KB 2R4SL 4PJEF 4LF3B 1GZPA 2W9LA 4OGAC 1GGCL 3MBEB 4L9DA 4X6FA 4HS3A 3TH4T 5FGCE 1T66D 2X4OA 1MFDH 4YUEH 1R5VA 3V4UL 1A2YA 3OPZH 3S35H 2NYYC 3QA3B 5D6DA 3X3FL 2ITCB 1JPFA 3LN4B 3OR6A 4W6WB 4TQEL 2JB5H 4AL8H 5IB1B 1JGUH 3EGSA 1EK3A 4LP4A 4HV8B 5HDQL 1RMFL 4LFHG 3SQOL 3NIFF 3PWLA 1SYSA 3OKOB 4UNVA 1HINL 4E41B 3V9FA 4XT1C 3T09A 2ZUYA 1GZPB 3O11A 2VDPH 4OZFH 3KR3H 1FYTE 5CP7A 5JXAL 3O2DH 5EU7C 3VGGA 2VLRD 2X4OB 3EJZC 4RFNB 3MUZ1 2X44D 1PKQA 3QCUL 4G6KH 1OWWA 3QXUA 3KDMB 1BVZA 3EGSB 4GKOA 5A2FA 1PKOA 3BXNA 4NO3A 2AEPH 1KIRA 5ITFA 1CDGA 3LS4L 1N7ML 3MSPA 5D2LB 5KVFL 3VGFA 3INUL 2AK4E 5DI8B 3O11B 1ONQB 2XG5A 5T1MB 3FO9A 3FONB 3GI9L 3ULUL 3I50H 2CDFA 4JM4H 4TPRH 5BZWA 1CF8L 4HF5L 2F58H 1BVLB 4HJGB 3X3GL 2W38A 2KDGA 4QNPE 5LGJB 3S3PA 2W0FA 3SCMA 4DEPB 1MUJA 3D2UB 3BXNB 1OWRM 3MV7E 3DYMA 4JQIL 1I1YB 1KXTB 1SEQL 4DCQA 5D7KE 1E6JL 4OLZL 1IILE 1LHZA 3MYZA 2VAJA 1FFRA 3SDDC 4M6NH 3DSFL 2MOVA 3O8XA 2OR7A 3PL6D 2YHGA 1HZHL 1JBJA 1JRHL 2Y36L 5DRWA 3K46A 2BCKB 4MAYC 3P9MA 5CZVL 3LPWA 2NY1B 4ZUUB 4YBLB 4LPWA 1J9CT 3P30L 6FABL 4JR9L 2J7LA 3X13A 3OKKB 2EDTA 4AM0A 4NQCD 4ZUVB 1GSMA 5E8NB 2MCPH 2XKSA 3GI8L 4OKVA 2IG2L 1ORSA 1HIML 1BMGA 4O00A 1T4KB 1S7UB 3FAXA 1I8IB 1Q94B 2H6PB 4LCWE 3RNKA 5IVXB 1BFVL 2R1YB 4I0PA 3ES6A 1AH1A 1CE1L 2C26A 2FH8A 1SY6L 1RHHB 2PR4H 2PO6D 5MERA 5C07A 3TBTA 5J12C 2AGJH 2XWBA 1CTOA 3PWVA 5JDJA 4JFHD 5IB5A 4MQXC 1DBJL 4KC3B 2HAZA 5T5FH 3JV4A 3X13B 3W5NA 1GGIL 4AM0B 3B5HA 4YFLF 4XCCL 3WNLA 5JHDB 1MCFA 4GRLA 1KC5H 3UXFA 1O7SA 3D39D 3AY4C 1BFOA 1Q9OB 5J56B 4WUUE 5DGQA 2XI9A 4EDWL 2XN9A 4H88H 1K8DA 1YEGL 1EO7A 1JVKA 4IM8A 4KHXH 3WFCH 3GBLA 4WHYG 5EOCH 5HGDB 3QULA 1WZ1L 2E6PA 2NZ9C 2A2QT 4YXKH 3T0EC 5IQ7L 1WT5C 2X4SB 3OGCA 5IVZA 1S7WA 3TA3B 1U92A 4BSVA 4L3CA 3UCRA 5C0EA 5JNYA 4CMMA 3B4NA 3IGAB 5C07B 4P9ML 3NABL 5BRZD 4HUXB 1U8KB 3T3PE 4G8GD 4NRYB 3PV7A 4X6EB 4EN3A 4PJ9B 4YEEA 3V0VA 1Z9OA 4LRIA 3OAYK 1KELL 5SWZB 4JFQB 3CFEA 1DQQB 1RUAL 1XCQB 1YMMD 3VXMB 1J8KA 2W9EH 4Y19D 5T1DH 4N90D 1IEAB 4M7JL 3VFTA 3IJHA 4YGVA 5ISZB 4ZFZB 3LKNA 1I3VA 1LK2A 4XP9H 4BSWA 3C6LD 1INEL 1MI5B 4N0CC 3HNTL 1A6TA 2FB4H 2D4FA 3OGCB 3TN0B 4BSVB 3QWOB 4NWUL 4CMMB 3G9AB 4LHUB 4WW2A 4BZ2L 3GMRB 4R2GC 1ODAA 4AIZA 1YECL 3O6FA 4PY7A 4AJ0A 1JNNH 1UWGH 5E7FA 1BZ7B 1I9RL 1E4WH 2F5BL 2BHZA 2Y06H 5EC1A 1MNUH 4LFHD 4U1LB 2FL5B 3VJ6B 3DX9B 5DRXB 4M7KL 4HK3J 3MRGA 1I1FA 3RTQC 4YGVB 3MGTB 4FXKA 3WFBH 2HJFA 5B3JE 1GVIA 4JFFA 4D3CL 4E5XA 5HI5C 3ZL4L 2ZUVA 1EAJA 2CKBA 3P0GB 2IH3B 1ZHKA 1UKSA 3D85D 3KNBA 1CYGA 4U1GB 4WW2B 3VD3A 2QEJA 1UZ6F 4EI5A 2BFVH 4PY7B 1ETZA 3W39B 3ARBB 2QHLA 1HXYA 4K3DL 5A2JH 5IROA 4RGNB 1YEDA 4WTWA 3ARVA 3RWIB 3KYAA 1INQB 3DHMA 4IJ3B 5GRVK 4EXPX 1U3HB 5I15L 1DSFL 3FB6B 4BSJA 4U6TA 4OCYH 3BSZL 4K8RC 2QADD 1YQVH 3PHOB 4OB5H 4RMSA 4ONFL 2VLRB 4NPYB 1DJSA 5LWYH 3IETA 1MCBA 2A6DB 5F1OB 2AJUL 3MNWA 4X6DA 3KNBB 1KXVC 3D6GA 3B43A 2C4FU 5DQDH 4APQD 2P8LB 5EFIA 3EO9H 4FFZH 4NO2A 3QXDA 4YGAB 1LK3L 2R2HB 4OZGA 1I7ZB 3VXSD 4KJYB 1KJ3H 2BOBA 3PL6A 1GJIA 1L0XA 3DV6A 4YIQB 5JIIA 5CJQL 3O41B 3ARDC 5EZIH 3HG1D 4L8SC 1D5IH 2D0HA 3TGXA 3ZYOA 4PJBF 3SKNA 1CFTB 1JUFA 4HKXB 5CUSL 4PBVC 2C3GA 5D1ZD 4YR6B 3RL1B 4DGYH 3C8DA 3TYFA 4TSBL 2WWKO 5FM4A 4PY8J 2EO9A 3C87A 4NO2B 5J1AB 4FFYL 3HLAB 5D1QB 2ZG3A 4ODSH 2BNRD 5CGTA 3BI9X 4JO3L 3N06B 2IH1B 4OZGB 2HMID 3PE9A 4OF0A 4YH6A 5DJ0B 1KN4L 4KK6C 4PG9B 2E7MA 3RI5K 5I71C 3VD4A 3QUXA 5JW5B 1VADB 3K2MC 1FVCB 1IGTB 2G75A 3DV6B 4IOIB 4JY6B 1ULVA 4YPJA 1YUHB 1QPXA 1WWAX 2PO6A 4FQXC 1X5ZA 2ZCLH 1OSPH 3SJVE 5L2KA 1T1WB 4ELMF 1CBVL 5CLTA 4GS7C 4RISL 1AE6H 1VB9A 1HHIA 2Q7YB 2DWDB 5A43C 1G7IA 2Q7NA 3RIAF 4WHDA 4NQXA 4NQCB 5T33H 2QQKL 1DBAL 1A6UL 3VFNA 1Q1JL 4FXGA 4TUOA 3TP4A 3OR7B 1QRNE 3E2HB 2XXCB 4ENEC 2QQNL 1S7QA 3H9ZA 4ZOCA 3SE9L 1KEML 4X7SH 1QVOB 1F90H 4J3UA 1FFOA 5F7FA 4I3SH 4GAYA 1DE4A 1NCWL 3QIUC 3NA9H 4RWYH 1YEFH 4TVPD 3TNNA 2GITB 2XQBL 5FA4A 5BS0B 2UVEA 2UZIH 4HGWA 4PJIF 4QRRB 3RA7H 3V6FA 3MGOA 3VFNB 3SE3C 1GL4B 4AENB 4G80A 4MDIA 4NQVA 3D39B 3IXAB 4Y19A 3O2DA 3SEPA 3I6GA 4QOKD 1G7MA 2QQLL 4EDXB 1OM3H 4NZDA 4GG6A 3C6LA 2VXTL 3GHEH 3F7QA 3VFUA 4G9DB 3T0VA 1S9VB 1AI1L 3BISA 3FQNA 1DE4B 1K6QH 2HVKA 5FFLA 3AAZB 4N8VG 2CJUH 4FNLL 5BRZB 4NZRL 4G8GB 1HN1A 5B38G 4XCYA 3P11H 5FA4B 4LVNC 5GGQL 4KDWA 3VCLB 3B9KD 1JZ4A 4NUJA 2Z31C 1CCZA 1KBGH 4G8EB 1YMMB 1YNKH 4G80B 1RZKH 1URLA 1YZZA 4R3SB 3CFCL 1DBML 3LPGA 3NCJH 4M4RA 1IC4H 2N4IA 1JGLL 4X80L 3KPMA 1NFDF 3L3DB 4P4KA 2QHRH 1XF3A 4ZUWB 4IRZL 3GSNL 1JJUA 1T1YB 5IR1A 1WIPA 1I4FA 4XNYH 4M6MH 2VDKH 3PP4H 1I9JH 4XP4L 3NCYP 4JVUA 5CJBA 3BDBA 1G7QB 4MD5A 1CI5A 5KSVB 5KSUA 5BZDB 4JKPL 1KIPB 4JFED 4UINH 5EZLB 1NC2D 4OFIA 4WWKB 3QFDA 4NUJB 5FCUH 1QOKA 4KK9D 5J6GA 5F88A 1C5DA 3PABA 4MNGB 1YEHL 4GW5A 2BY1A 3UMTA 2QL1A 3HCVA 1A0QL 2P5ED 2D31B 4YXLH 4XHJC 1D9KC 3TBWB 3BEVB 3ULVH 1JHLH 4K23L 1MFBH 1TZIA 3KPMB 4O5LH 1PQZB 5CJXC 2PYFA 5F9WB 2YD7A 3DRQB 3LH2H 3L9RB 5C0FB 3D85B 4HJJH 5LGHH 5DUBA 3NPSB 3LN9A 4APQA 2WBKA 3OAZK 5FKAA 1AR1D 1QD0A 4GMTH 3UYRL 1JPGB 1PAMA 4LCUB 1UKTA 3BZDA 4NBXB 3VXSA 5EU4A 4ZD3L 5J6GB 3WO4B 1FG2B 3ULUE 3U4AA 4LL9A 3C08L 1NC4D 4PJHF 2NY6C 2V5TA 1NGQH 4MDJA 3HG1A 3O9WB 1MWAL 1ND0A 4G5ZL 4WFFE 1MOEA 4UDUA 2PYFB 2RR3A 5D1ZA 5J13C 3FRPG 1J1OL 3SKMA 1EERB 4M93B 4XNUH 4APQB 2DQDL 3IXTA 1VACB 4KROB 1JZ3A 4QHMA 2NY2C 1TNMA 5FF6A 4ZS6C 2F54B 3DUSB 4F37K 3SE4A 4MS8D 5AYUL 4P2OC 1TNNA 1R3HA 4OCRH 4UNUA 4GKNA 5I1DB 2A73A 3CPLB 5I1JH 3W9EB 4GRWH 5IJVA 2HFFA 1YYLH 3LEXA 1VGKB 2ICCA 3MUGB 3BRFA 4AT6B 4JDVB 4MVBD 3O4LB 1PYWB 3UTTE 4P5KB 1EGJL 5JW4N 2XV6B 5IB2A 5EUOF 4CRPA 4HLZH 3QEUA 5C92A 3KS0J 1R24B 1OAKH 1FBIL 3TO4C 1QLEL 1S9YB 4U1NB 2BNRB 3LKQB 1XCTA 3KS0H 4TOYH 2CRZA 4GW4B 4CW1A 3QB7C 3MRFA 5B8CB 1SM3L 2EDJA 3WSQL 3EJYD 3RVUC 4KDTA 1EFQA 3MJ7B 1L7TH 2BRRH 1DVFB 4QTHA 3OKMA 1F4XL 1FG9C 2AJVL 5J6HB 2AJZB 4Q2ZA 4J3VA 3HZKA 5C9JB 4JO4H 5K9JH 2PF6A 3BHBB 5EBGA 5FIEA 3HMWH 2VDMH 3P9LA 4QOKA 1P4IL 1XCTB 5SWSE 1MQKL 1VFAB 4RCAA 4XPGL 2UUDK 4MA1C 5DWUH 3JWOH 4HHAB 5JW3L 3L3IA 4U31A 4KKLD 3LKRA 3R0MA 4S11A 4CW1B 3BDXA 2EKSB 3CXHJ 5GJSH 5TF1L 5F7EH 5C2UB 1OTUD 4LOUD 4DUWA 3UYOD 1YEKL 2BNUB 4NWTL 1M71A 2YZ8A 1YNLH 3IAPA 4L4TD 3ZSTA 5FGBC 5BOZG 1UWEL 1D6VL 5L0QB 1N4XL 3MA9H 3UJJH 2ORBL 3HB3C 2EDXA 2R29H 4W70A 5FUZL 2H9GA 1J0JA 3P9LB 3OF6A 1KT2B 4OCWH 2R39A 1IBGH 1NLBL 5J1TC 4G8FA 4LLYA 1NLDH 1KTLA 1ZSDB 3O6LH 4AIXA 1VGEL 3CDGB 1HQRB 4Y5VB 5EU3A 3U83A 5F7NC 1F02I 1WCQA 5HHOE 4CMHB 4YHKH 4OCSL 1TENA 3JZ7A 4IIQC 5JPNA 2P45B 3B9KB 4LEOA 4RDQF 4Z0XA 4ZOBA 1OAXH 4OD3L 4M6OL 1E28A 3CMOL 3MRBA 4DVBA 3BN9D 2O5ZL 1HCFX 2F9BT 4PRHA 4ZFOL 2J8UF 4W4OA 4R97B 5HHPA 3IVKA 3VFRA 3UEZA 2J5LB 1CXIA 4OCXL 2HRPH 4UT6H 3S6CA 2PTVA 5CSZA 5KTEH 1ZA6A 4WV1A 4X0KA 5GS0H 1BVKA 2BXYA 5FO9A 5GS1B 1IAKB 1CDJA 3RZWA 3SY0A 4EVNB 3IDGA 1HHHA 4JFEB 3QJFB 4Y16D 3M8OL 5FUCE 1NC2B 5ERWA 5DJXA 2IAMB 3C60B 4G7YH 4ODWB 1G9MH 4XP1L 2VLJE 4F58H 2P5EB 5JO5A 3L3OB 1LNUA 4JKMA 2IMMA 3C5ZC 4KJQC 3TJEH 1T5WB 1IGFH 5KBNC 5JXED 5ADOL 5DVOA 2X40A 2VIRB 4MGXA 2LVEA 4PJ7F 5GISL 2XZAH 5L6YH 1SJXA 4WV1B 3MX0A 3AUVA 1JTOA 3FOMB 2DLTA 5KSAD 3H3KA 1DQMH 3VXOA 1LP9B 4KH2A 4V1DD 5D7IA 1W72B 2ZKHH 3MOBH 4HBCL 4YE4H 4N0UB 4POYA 3FFCD 4EQ3A 1K3IA 4Y88A 4OFYA 2ADGA 1R5WA 1NC4B 2V2TB 2HLFC 2A9ML 3CFBA 2GJJA 2ICEA 2BVPB 3OXRB 4YX2L 3U9UA 5IHZB 5D6DC 1BGXH 1OF2A 2A77H 1JRHI 1Q9WA 4OD2B 4S1RL 4Z7WE 1V5JA 3VXNB 4C58B 2NXZD 3T77A 3IKCA 2I60L 1S9KC 3EOTL 5T3XD 2Z4QB 1MIMH 4NZTL 4OM1L 1TQBB 5ESVA 3NTCL 1OTTD 1RUML 4OKDA 1K4CB 5CBEA 2CIIB 4WGVB 3IFOA 4ORGA 1V7ML 2NZIA 3HC4L 4MNHA 1F8TH 1OTSD 3KPQA 5E8PA 4JRYE 2ICWI 4TULH 4RA0C 5D72H 1DUYA 2OLDA 4DEPC 4M1GL 3FTGA 2Y4SA 1JPSH 5GJTL 5LKNA 5FYJD 5BO1L 5SV3A 1K4DB 3KYOA 1HHJA 4WCYL 2YD6A 1R3KB 4DKAA 1P1ZA 3ZTJH 4NQDA 1NKOA 5IHLB 4L9LB 2XZCL 3CVHB 3QPXL 2I24N 5I1EH 5J8OA 5DJDB 3IF1A 4OLXL 4KUZL 3UBXA 5F7DA 4GOSA 4YQXL 2OQJB 3I84A 1X44A 1FE8H 3MACL 1W8OA 5FYLL 2R2EB 1UB5B 3TIDB 4NKOA 2D7TH 3Q0HA 4DVRL 5HDBE 1CLZH 1KCSL 2JIXD 3SCMC 1RU9H 1TZHA 4XP6H 3CC5A 4JG1L 1ED3B 3LN5A 3QNYA 4RAUA 2NY3C 4XBGA 1LDPL 5IBUG 3O8XC 1O7VA 4PTTB 2H2SC 3QEGH 1IKFL 1XAUA 5F7LB 3GSWA 1Q9LA 5ID1A 1QHOA 3I2CH 2FX7L 2O5XH 1T6WA 5F9OL 4L29A 4N8VB 3DBXB 3U0PB 2VDLL 4L4TB 3MLWH 4LPXA 5B38B 3P73B 1JL8A 4OIIL 5D7LB 1GC1H 4RAHA 3V7AE 2UYLA 1JP5A 1TZHB 2W60A 1JFQL 3D0VA 3CC5B 2F19L 4WDIA 4HIXL 4NGHL 3WIHA 1NDMA 5BMFH 4RMWA 4MXVF 4I0PC 4N1EA 2ZCKH 4U4BA 1A02N 1NFIB 1U58A 3GSWB 1Q9LB 1UM4H 2R9HD 5DJ2B 2DQUH 4OF7A 3U6RA 3NFPB 2HYMA 5I1AA 4HWZB 2VXVL 1T0MA 1DBKH 4C57C 3PF2A 5CIPA 4R4BA 5IBLC 2JELH 1P4LB 5FUOH 5HYSA 4Y16A 5JR1L 1T22A 2XTJE 3TZVB 1XFPA 4GRLC 1S9WA 1EHNA 3L3GA 2BNQD 5DQ9B 4CVWA 1NJ9A 4Z7OF 4TTDD 2VISB 1WFOA 3MO1A 4YUEL 1MFDL 1TLKA 2DRUA 3K74B 5JXEA 3LD8B 3HE6D 3OPZL 3QG7H 3S35L 3T3PF 2ZPKH 3SDXB 3IRPX 1A6PA 3M1BA 1QLRA 3FRPA 2JB5L 1LE9B 1J8HE 4AL8L 5KSAA 4GKSA 4PJCE 1JGUL 2XACC 3MFFA 3DO7B 1T6VN 2HN7B 3BP6B 4EN3C 1BWMA 4I2XB 4V1DA 4D2NA 3GB7A 4LRIC 2HT2D 1FJ1B 2DDQH 3ZTNH 3FFCA 2HJLB 2VDPL 4JPVH 3KR3L 4PBWD 4Q7DA 4S2SA 3O2DL 4K7PY 1T66C 1A7QH 4X99B 1QEWB 3PGFH 4J1UA 5C2BH 2X1XR 2NW3B 1U93A 2CSPA 3W11D 1WFNA 4HK0A 3H42H 3H9HA 4WW2C 1P2CA 4G6KL 1F97A 5FK9A 3KPTA 3O6FC 3RIAK 2AEPL 4JAMB 3GB7B 5I2IB 2HTKD 4L4VD 2OP4H 3L6FA 5DO2D 1OGTA 4L3EE 5HY9B 3R4DA 1MHHA 2DYPA 2APTA 2OTUA 2RFXA 4PRID 3FFCB 2I27N 1K2DB 1BF8A 1RFDH 3MV8E 5KN5A 3UAJD 5E4IA 3NFSH 1FL6A 3RNQA 3D25B 2X09A 4QHNB 2V2WA 3KG5A 3LCYA 3I50L 1HH6B 4U1IB 4TPRL 4JM4L 4Y4FD 3VFMB 2Q87A 2YA0A 3CX5J 4PJEB 2F58L 5DK0B 1KB5A 1TIUA 4EI5C 2NXZB 4OFPA 2P8MB 3GSRB 1U6AH 8FABB 3MRDB 5IROC 1OGTB 4PRDB 4MJ6B 4R9HA 1N2RB 1MHHB 5C3TA 2DB8A 3BP7A 4M6NL 2VXQH 3EZ8A 5EC2B 3D3VD 3V5KB 2ZNWA 3VD5A 5D4QA 3MLTB 2NXYB 4JFXB 3TEUA 4WI3A 3NN8A 4PP1C 4HXBH 4IOFD 2R8SH 4RRPG 2R56H 5E8DH 1C5BH 1V3KA 2R1XB 2VMFA 2MCG1 3KPSD 4YC2C 2E8YA 4KKBC 2PW1B 5JZ7D 2IALA 5CHNA 5SX5H 1ITCA 1OLZA 2MCPL 3QAZC 2JIXA 1B2WH 2WP3T 5EPMB 5GGVH 1OP9A 3QXAA 4AK1A 4OM0H 3RWCB 1LO2H 2Q76B 4LSSH 3SO3C 3PL6C 1NKRA 1QSEE 1CG9A 2IQAB 2E27H 2QJDA 5FM5M 3T0AA 3S88H 2ZG1A 3PHQB 1TETH 2PR4L 5ANME 5ILTH 4HIJB 2EE9A 4ODUA 4AEHH 2AGJL 1U91A 5HSFA 3KPRE 3BPNB 5T5FL 4UV7H 4L5FH 2ZUTA 2DQTH 3MRMA 4HUKB 3VFSB 2JIXB 5C3LD 1VKXB 3BZEB 1XF4B 1KC5L 3U0TB 3GSXB 4H88L 5F7WC 4RMTA 4KHXL 3WFCL 5EOCL 4MJIE 1FO0H 3QUXC 4QXTA 3EOYG 1FRGH 4YXKL 3ARQA 1CDIA 1WIUA 2PO6C 4GJTB 3GMPB 4M61A 1RJYA 5D96C 4HJ0D 2LFGA 4LVHC 2VZ1A 2CH8A 3RWHA 2H26A 1FZKA 1GXEA 5BCAA 3S36X 4OZ4B 4JVPA 5I9QC 3KLHC 4X5LA 1YNTB 2BNQA 2KPNA 2W9EL 4XTRD 5T1DL 3VI4E 1X6LA 3LRGA 3P40A 4MZ3A 3RUGE 4XP9L 5L2JA 4D0DB 2NY4D 5BXFA 3I9GH 5A2KH 4MX7B 1M6OA 4XMKH 2FB4L 1CGXA 3CDFA 1TTFA 3K8KA 1FVDA 4M61B 1ZHNA 1PSKH 3RWHB 1JNNL 1UWGL 2IADA 3LQMA 1E4WL 5K33A 2Y06L 5KVMC 1MNUL 2FJHA 1EZVX 3JV6B 4C54A 4QF1B 2BNQB 5FO8B 3JV5A 4NN5B 4YDJA 5E94A 3WFBL 3C6LC 3C09B 1RZ8B 1M6OB 2GK0B 5FYKD 3HE6B 4YXHH 3KXFD 3HC3H 2PXYD 1U8HA 1AHWA 3VXRA 1PZ5B 2OCFD 3HMXH 4X9HA 5AAWA 1EAPA 2BFVL 3QQ4B 3OAUH 5C0IB 4JANB 4UT7H 2KZWA 3QDMB 4HS8H 2Z8VC 4GRMB 1EHLH 3QI9A 1H3WM 3T4AB 4NKQB 4F7EA 5D6CA 43C9A 1OPGH 1XIWD 4EUPG 3EDKA 5IW1B 2ICES 4K71C 4OCYL 1FC2D 1L6ZA 1YQVL 4Y89A 4OB5L 4P4KC 1AQDA 1ZWIA 5E9DE 2OL3B 1T83A 4GXUM 4I1NB 3LV3A 5LWYL 3MRPB 3GK8H 1OQXA 5IOPB 3EDJA 1U8HB 4W4NA 1HH9A 3EHBD 5GGSA 1I8MA 4U1HA 4Y5YB 1K9TA 1TVDA 2GTWB 1BD2D 5DQDL 3RZCD 2VR9A 5CEZE 3EO9L 4FFZL 4LIQH 5I1LB 4ZSOA 5C6TH 1A3RH 4L4VB 2VL5A 3SPVA 2ESVA 4HCRH 3JSSA 3U4EA 1XZ0B 4PRIB 1XR8B 1KTRL 5I76A 43C9B 1KJ3L 3D3VA 4HKZB 2A6KA 1JNHA 3VH8G 2QADC 3ARED 1QHPA 1KCKA 4LMQE 5EZIL 1A1MB 1WBYA 3UO1H 1D5IL 3ZO0A 1X6NA 4Y4FB 5TGBB 4TVSa 3S36H 1ZT1B 2FJGB 4DGYL 4H0GA 2ENSA 1HH9B 3D9AH 4N5UA 1UB6A 4U1HB 4APQC 2E7LC 3OAYH 2IPUG 1BX2B 5FGRA 3TC9A 4RGOH 3GDBA 2BP3A 3ULUF 4ODSL 3VFPB 3U4EB 4KDVA 1QP1A 3EFFB 3G5ZB 2E5EA 5HD8D 2OBGA 1MCDA 4IRJD 2HKHH 3BDYH 4J4PA 4KJPC 1TXKA 1LDSA 2ZCLL 1OSPL 1S7RB 5MEQA 2OX5A 3G6AA 5ESAB 1AE6L 3KPSB 1NCCH 4QHUA 5D1ZC 5KS9E 1FNLA 35C8H 1Q9KA 3UPRB 5GGRA 5T33L 3CSBA 2PW2B 3SKJH 5JOPD 4WFHD 3LRSB 4JG0H 3ZDXE 1PJ9A 2YD8A 1IQWH 5ENWB 3QG6A 3FB7A 5F96H 3IDXH 1ROWA 3SE4C 5I1GH 5IBUB 1S8DA 2BK8A 4X7SL 5IFJA 1F90L 4RNRA 5HYJD 5DK3A 4I3SL 2HKFH 5CZKA 2IGFH 2IPUK 4FZ8H 3NA9L 4RWYL 1YEFL 2J4WH 4IMLB 1JMXA 2C3HA 4MJ2A 4EJ1C 5DQJB 2Q1EA 4FABH 2RB8A 2UZIL 3RA7L 1QO3B 4F80A 4WFEE 3BPCB 4XXDB 4ZPTA 4NCDA 4PPTA 5IMOB 1VENA 3JTTB 1ES0A 4JM2A 4NRZB 4NZUH 4LLMA 3LQZA 3PWJB 5JIKA 4ELMA 1MAJA 1OM3L 4E42A 3LHPL 4NKDB 4PJBB 3MNVB 2EIEA 3GHEL 3IDMB 1H8OA 3TIEA 3NBNA 3QDJA 5INDB 2Y25A 1R0AH 5KVEH 3EYSH 4L8BA 1K6QL 4KDTC 3I6KA 4C56E 3TBSA 4M7LH 1U3JA 3B9VA 2CJUL 3MRCA 3RWGA 3V6BR 5IBTH 5GS2H 1B4RA 3P11L 4M7LT 5CP3H 3WIIH 3LKOB 5L0QC 4N8CH 3AC0A 1RZIA 3L95B 4RFEB 3QSKB 4ORZC 1KBGL 5HHNA 2VQ1B 1YNKL 3C5JA 1RZKL 2C1OB 4HEME 4XGZA 5M94B 3MLYH 1U2HA 4UIKH 3WFHA 3NCJL 5CAYB 1IC4L 3BEWB 3PJSB 4D9LH 2QHRL 3FQXA 4FTVE 3BAEH 5IQ9A 4PJIA 2OTWB 2EDEA 2PXYA 4NYLB 3DGCR 1GH7A 4LHQB 4XNYL 4M6ML 2VDKL 2M26A 3PP4L 4L8BB 1I9JL 2D7QA 2EYTB 3ZKXC 5F8QC 3MRCB 4I13B 4QGYA 5B39G 1DLFH 1T0PB 3B9KC 4UINL 1BIIA 2M2DA 5FCUL 5HHNB 4LLWA 1T20A 3RKPA 5E5MB 1XIWA 1C5CH 2DF3A 3MYJB 5IT2H 4YXLL 1T1ZA 1I3GH 3ULVL 1JHLL 3FRUA 1MFBL 4X7FC 2BZDA 3JUYA 4U6XB 1XF1A 4O5LL 1S7VB 3MBXH 4PJIB 5GIRA 4Q0XH 1EJ6A 1RZFH 2FECL 3KXFB 2B20A 2CLRB 2PXYB 2HWZH 1JCKA 3LH2L 4HJJL 3VXQA 5LGHL 1AD0A 3HTLX 1M7IB 5EO1A 3U30B 1OGAE 3RZCA 4M5YH 1R3LA 3RWDA 4N9OB 4XPTH 1A1OA 1JHTB 4GMTL 3B9DA 5HGAB 4I5BB 4KK9C 1A6AB 2ZOLA 2PYEE 3R1GH 4PLJD 1NAMB 3QHTC 3AREA 3OKLA 1NGQL 3QXWA 4NBZB 3TCLB 1EVUA 3HN3A 3S7GA 1FAKT 2FSEA 3R06A 5IB3A 4NN6C 1KGCE 4WV1C 4F9LA 2BSTA 3RKDD 4GH7B 5E6YA 1JTPA 3AS2A 1OSZA 3WD5H 4XNUL 1BD2B 4U7KA 5EO1B 1MREH 1D5XB 1ADQH 1IFHH 1I1AD 2COQA 2LU7A 4Z7WB 4NN7C 1CGVA 1FO0A 1NFDB 5C0CE 4MHHI 2FJFB 1VSCA 4YO0A 2DQEH 3GIZH 4OCRL 4TTGA 3AREB 4MSWA 4HDIA 4IRJA 3UTSD 5I1JL 4DGVH 1WWCA 1A7NH 2B5IB 4X98B 4ACPA 1YYLL 3K2UH 3E3QC 4XVTH 2OTPA 4P4RA 4K55A 2APXA 1VFBB 3CVHH 1NCAH 5HGHB 2CUIA 4XH2A 1G7JB 1OAKL 4QYOA 1J7VR 4TOYL 4MS8C 1PBYA 1QFWM 4IHOB 4JN2B 1LO5B 2P5WE 1YC8A 1F3RB 5A16A 2DD8H 1KG0B 5HYJA 4PGCA 2OJZH 4IRJB 2L7JA 3PGCA 2NX5B 4M1DH 4RQQB 4R0LA 3KPNA 1DBBH 2DQCH 1L7TL 2BRRL 3RX8A 3VGAB 3L7FA 4MVBC 3HR6A 4HH8A 5I6XC 4XNQB 2UWEA 1MCCA 4XH2B 4J3TA 5C0BE 2WBJD 3WIFA 4PJHB 3G5VA 4JO4L 5K9JL 1NMAH 5GRUH 4JFPB 3HMWL 2VDML 1JYWA 2EO1A 5F9JA 5FA3A 1MPAH 5DWUL 3JWOL 1A5FH 4NQEE 5AAMA 4OJFH 1ZVSA 5GJSL 5A16B 3STLA 5HYJB 2IPTH 5F7EL 3O3AB 5ADPH 3LEYH 3IRZA 4UAOB 1YQ2A 4FS0A 2VDQH 3A6OA 5IMMA 1YNLL 5HHVH 4I4WA 5I8OH 1FYTD 1E0OB 3V0WH 1AFVH 4DOHE 3RGVA 1X5KA 4HXAH 3MA9L 1MFEH 3UJJL 2R29L 3R0NA 5F7UA 1TZGH 2AKRA 3VW3H 3FO2A 1F5WA 4XCEA 1UM5H 5DMJB 5EU6B 2HLAA 5F1IB 4CVXB 5M95B 3EJJX 3U1SH 5D2NA 1DTUA 3QFJD 4KKLC 1IRAY 3KPLA 4OCWL 4X9IA 3S5LG 2G5BA 1IBGL 1OTUC 1UXWB 2W9DH 1NLDL 4LOUC 4PJDE 5DHYA 3O6LL 3SGKA 2LABA 5EUOB 2IEPA 1ZGLB 4RSVA 5K93A 5GSRA 43CAA 4CU6A 3S3SA 2Q3ZA 2FO4A 2JJWA 4TNWF 3QNXB 3BZFB 1CN4A 4YHKL 1CGUA 4D8PB 2VKWA 3DROB 4J3SA 4XMPH 3HR5A 3BWAA 1AKJB 3BE1H 2VE6B 4QY8B 5C71A 2BOCB 1OAXL 1U8QB 3TH3T 4Q9QH 2MQCA 5FECB 1G7LB 4TNVK 5F3HB 3MFGB 1BQUA 1RV6X 3NAAH 3TWCH 1UJ3B 2Z8WC 1WBXA 4KY1H 3RY4A 3C2SA 4GXVH 4UT6L 1D5ZB 2HRPL 2VL4A 5KTEL 5D7KD 2Z35B 5L8JB 1N59B 5GS0L 3WXVH 1IEHA 2FO4B 4JCMA 4QRPE 1MRFH 3LQAC 3FOLA 3HE7D 4HH9A 5D1XA 3IDJB 3MCKA 2DQGH 1J0YA 3HUJB 1RK1A 3VG9C 4G7YL 2XWTA 2YN5A 1G9ML 4EUPB 1H0DB 3F62A 4F58L 3BN9C 3TESA 1QKZH 3QUMH 3WL9A 2IPKA 3TJEL 2HTLD 4MB5A 1IGFL 5D5ME 3DV4B 4RMQA 1DEEA 5DS8A 4LCWD 2XZAL 5L6YL 3EW3B 2KUTA 1DQML 2ERJB 1MH5B 1I1AA 3PHSA 4Y16C 4OV6F 2ZKHL 3MOBL 3MODH 4YE4L 2J8UA 4LCCA 1EIBA 2DL2A 3TT3H 2H8PA 6CGTA 2ZWLT 3VXUE 2XWTB 3V7MA 1EEYA 3VE0A 1FV1A 4BH8A 4F2MB 3VH8B 3UTSA 4P49A 4Z7VF 4EOWH 3P0VH 4MA3A 1R3JB 2P24B 5JXEC 2J2ZA 4WU5B 3UPCA 1BGXL 1G9NC 4H1LH 4WUUD 5E1HB 2A77L 5TH2B 3VU2A 3DSNA 1CD1A 1A1NB 4JFDD 4BA8A 4TSCH 5KSAC 5L8LB 1KIQB 5T1KB 4POZD 3AU1B 2F74A 5DD3H 4MD0B 3P4NB 4LSVH 5C09D 1MIML 5GRYA 2EECA 3MRHB 3X17A 4DZBA 5IMLB 1Y6MR 2DJSA 1DN2A 2H8PB 3HZVA 3DLQR 2X4NB 4Y1AE 1FL5A 1SMAA 2AXFA 2B4CH 3DECA 5I0ZA 4MA3B 4BFIB 4XAWH 1SBSH 4KWUA 2WIMA 1F8TL 2DKMA 4TULL 3VDAA 3LB6D 5D72L 2DAVA 5GZNC 3T1FA 4U3CA 5H2BA 4AIOA 4TYUA 2BXZA 2NXZC 4NDMB 4WTZA 3RQ3A 1G0YR 1FNEB 3QHFH 4AZ8A 3RHWK 1JPSL 2F74B 3JWOC 4U05A 1NH6A 1QSFE 2EC9T 5E56A 5IF0B 2ATKA 2FWOB 2FGZA 4PJ7B 4BH7A 4Z78B 1EEZB 4S0SD 2P8PB 3QDGD 4WU7B 1BBJB 5I1EL 4KFZC 1IEBB 2ZG2A 4UOJA 4YDLB 4QO1A 1ZHLB 4ODBD 3N9GH 1FE8L 4R90H 2E7CA 3MRIA 4M6AA 1FYTA 2EIBA 2D7TL 5TFSH 2OK0H 1CLZL 3NCMA 4PRAA 4DZ8B 5CGMA 5JORA 4K3JH 1RU9L 1WZKA 4XP6L 2WBJB 2ZOKA 3HRZA 5F8RC 2DS4A 3G04B 3MJ8A 4WO4B 4HMEA 4CVUA 5I8KH 3I3EA 5HHQA 5ICYA 3QFJA 2ADJB 3EDDA 5ESQB 3QEGL 1WTGT 1TMCB 3OJDA 3I2CL 4YAQB 3IJYA 5LCVL 2O5XL 3BP4B 5E95B 4HUWB 2AK4A 3MLWL 5B39A 3EJZD 3LDBB 1JZ2A 3VFOA 4M7ZB 4L8CB 1GC1L 2VLLB 4YHPA 5HHME 1YJDH 3C6SB 4HC1A 3HRZB 5DK2A 5KSBE 5BMFL 4U1KA 1I9IH 3TNMA 2ZCKL 2SEBB 5CMAA 3WLBB 2YPKA 5MENE 4KV5F 3H9YA 2X5PA 4LSTH 4Z7UE 3MV7A 1UM4L 5GS0C 2DQUL 2X1OA 4S1QH 1EXUA 5EUKB 3BIKB 3LIZH 4HUUA 1RK0B 5CILH 1VDGA 1CFQB 5KG9A 4A6YA 1ADQA 1WTLA 1XGQA 4PR5A 1DBKL 1F4YH 4JRXD 5B39B 3I02B 2JELL 1YPZB 2C3VA 3HE7A 5FUOL 3TJHC 5CSBA 1I8KB 3MLRH 4V2BA 2Z91B 4O2CA 5C70A 1XH3A 3T2PA 1LILA 2F53E 3FJTA 4KTDH 3ILPB 1U3YA 2Q3AA 1J05B 1S78D 4PV8B 2HFEA 1FZOB 5A40E 2R9HC 2YBRB 3QG7L 2ZPKL 2Q8AH 3SDDD 5K9QI 1G7PA 4LCWA 1OAYH 1X5YA 2X70A 3ZE2F 4IEFB 5KG9B 2A74B 1Y18A 1CU4H 1RVFH 4X5XA 2C3VB 4PREB 4X8JA 3SJVD 2DDQL 5I66B 3ZTNL 3RUGF 1F6AB 2I07A 4NN5C 2R1WA 4PJGE 4P2RE 1I3RA 4JPVL 4JFYA 5I74B 3C09C 3RPIA 4G6MH 3WN5A 1P7KB 1WBZA 1A7QL 2V9TA 4PJ8A 1QRND 3PGFL 1ZS8A 5C2BL 4X6CE 2QLVB 4WUUA 3HPJA 3PXHA 4MNQE 3X14A 3BJ91 4GG8A 3H42L 5DTFB 2APBA 2YD9A 2VTFA 3MJGX 2Y72A 4HUNB 1FLTX 4KXZH 5HI3D 2HT2C 1OL0A 4W81A 4FA8A 5EBLB 3OL2A 4MQXD 2OP4L 5MEOA 4X9BA 1J10A 3RWEB 5J9PA 1MIEH 1RFDL 4HKJA 3NFSL 4KKCD 2A6IA 1TVHB 1N6UA 4N1HB 1N8ZA 1WAAF 5ETUA 4MLIA 5DMYA 4HX1A 3W11C 4QGTA 1RIHH 4P5TB 4K7FB 3HI5H 3X14B 1AHWC 1IC1A 3PDDA 2X41A 4JFDB 3T0ED 4Z77B 3OZ9H 2P7TB 1F6LL 4YEFA 5FV1L 1W2KT 4BKLB 4HW6A 1U6AL 2HTKC 4UQ3A 1RAMA 5C09B 3QI9C 3ZZ1A 3PG2A 4X7DC 3DURA 3G08B 4HS6B 2VXQL 3NIGE 3UAJC 1FGNH 4U6VH 3K7UA 3JWNC 2YD2A 3ARRA 1D6EA 4H8WH 1R5IA 4HXBL 2R8SL 1T83C 2MQ3A 4NBYB 2R56L 5E8DL 4Y4FC 1C5BL 2OR8A 5DYOB 3ROOB 4PRPE 1U8IA 3G6JE 5K59E 3CDCA 3V0AC 4ZS7H 1B2WL 1KNOA 3U36B 4HBQA 5GGVL 2C1PA 4OM0L 4R2GD 2N7AA 1LO2L 4MD4A 4XX1E 4YPGB 4LSSL 5DZOA 1V3MA 5JOFA 1DR9A 2VWEC 5IB4A 1WF5A 1P7QD 3QDGB 3E6FA 3ZT5A 2E27L 2NTFB 3S88L 3O3DA 1AC0A 1MRCH 4IOFC 1TETL 3L3KA 3SDCD 3BGFC 3WE6A 5ILTL 2YEZA 3RAJH 1H5BA 2ATPA 4AEHL 3DXAB 5IEHA 1LO0H 4NO5A 1U8JB 1GC1C 2CO6B 1U8OA 2GT9A 5JZ7C 4HUVB 4UV7L 4L5FL 5SX4H 1AO7B 2DQTL 4Q6YA 4J8RB 1CR9H 3EYFB 3FHQA 2YPLE 4D9RD 5BJTA 3ETBF 4CUCA 3QUMA 2ZJSH 4Z8FH 1IT9H 1KIUA 1X5LA 1MEXH 1FO0L 4J3WA 5JOFB 4J3OC 1FRGL 2MKWA 3F8UB 3S5LB 3E6FB 4J4PC 1GIGH 1EX0A 2NLJB 2GTZB 2VXSH 4K8RD 3ULUD 2FATH 1FFQA 1J5OH 3ZDXF 1SEBB 1T7XA 1WV7T 2HVJB 2CIKA 1QTYT 5EO0A 4GW1B 1OD9A 1XR9A 3GMMB 1SBBA 3MV11 4CKVX 1UJTA 3UBXI 2RQ8A 4WGWB 5AZ2H 2QV2A 4K7PH 4E41E 1KACB 4ZXBA 1F42A 1MCJA 2WAHA 2AEWA 1AXSB 5DSCA 1JNJA 4JY4A 2XYCA 4H1LA 1TPXC 3GNMH 2X05A 3I9GL 4XMKL 2R2BB 2DI9A 4F3FA 1F3DH 5MP6H 4OGXH 3T2QA 3BZ4B 3VD9A 3O3BB 4HJ0C 5GSVB 1PSKL 4JRXB 3G5XA 2FECI 1ZVYA 3SJVA 1S7TA 5E2VH 3LEVH 4G42A 4JM2C 4XTRC 2VN7A 5D2LE 2CO7B 2I9TB 2IF7A 1HWHB 1KXQE 3EO0B 3UTTD 5C0GB 2NY4C 3FB8A 1KJVB 1QRNA 2AK1H 2BHYA 2EIZA 5DMGC 3F12B 4YXHL 5EIVA 5JUEH 4KK6D 3HC3L 3SDDB 4WW1B 1NAMH 2ZSVB 4PRBA 3HMXL 4FQXD 1NBVH 5F1SA 4MAYB 2W91A 3OAUL 3BQUA 4AY0A 4DKFH 4ISVB 1IAMA 2Q86A 3G5XB 1NGYB 4UT7L 2V2XA 4HS8L 4DN4H 1EHLL 1OB1A 5AUMB 2Z93B 1OPGL 4RMVA 1YEEH 3DGGB 4ENED 5EU5A 1X5GA 1PZUB 2W65A 2A83A 1YY9D 3FO1B 2C9AA 5TPWH 2PXYC 2OZ4A 4HSQA 3GK8L 4I48A 5DFWH 2NNAA 4L8DA 2R23A 4UTBH 5C0DA 1KJ2B 4PLKD 4LQFH 3CD4A 2R0WH 4GLRH 4LIQL 2Q86B 4QTIH 5C6TL 1A3RL 2A9NH 2KH2B 4HCRL 1S5HA 1D5MA 1MJ7H 2XPGA 1XIWC 4X7TB 3VXPB 1KSRA 3KYKH 4W6XB 2BSED 4G43B 2QR0A 3V5HB 5E8EB 2OSLA 1RSFA 1CE6A 3Q6GH 1G6RB 5HGGS 4D9QD 3L7EA 3P4OB 2DQHH 1HE7A 2PN5A 4K3HA 3UO1L 3FQRA 1A3QA 4X9GA 1SVCP 5I17A 3S36L 1IGIH 3EHBC 3T0EB 5TJWK 1KCVH 4ZFGH 3D9AL 5SWQB 3RZCC 2C4XA 3KYMB 5JHDE 3L5WB 4RGOL 2WQ8A 4ZDHB 4P57A 5DA0B 5FGSA 1NSNH 1S5HB 4LARH 3GGWA 4H5SB 1D5MB 5FOBB 1ZLVH 4QHLB 4LCYB 3H2WA 5DHVH 3TYGH 3AREC 1FFPB 2B39A 3QIWD 1Z9LA 2HKHL 3BDYL 4LRNH 3V7AG 3WMSA 4HG4K 3O3EA 3SDCA 3P4LA 3QEHA 2Y23A 2L0DA 3ULSA 1PX3A 5C07E 1NCCL 5I17B 1CICD 3GJFH 35C8L 4JFZH 4Z5RB 4Z7NE 1MFNA 3HAEG 1XF5A 3QO1B 1NCNA 3NA4A 4MCZB 3SKJL 1ZHBA 3RWJA 3T8XB 3WS3B 4U1JB 4JG0L 4WY7H 3CLEH 1IQWL 5SWZE 1OLLA 2C7UA 3VXME 3ARGD 3CAFA 5TQ2H 3FMGH 4R2GB 5F96L 3IDXL 4OGYH 5I1GL 3KVQA 2MQ0A 4P23A 5ISZE 5ELIA 3IS0X 4IRJC 2ZUQC 1P7QB 4OUOA 2HKFL 3S9DB 2IGFL 2JF1A 1MI5E 2CD0A 3VWJD 4FZ8L 3MOQA 3O45B 3O3EB 5A1AA 2J4WL 5DJAB 3RTQB 2XKNB 3QXVA 1J12A 1D9KD 3EBAA 1A4JA 2VLJD 4FQHB 1CD0A 2WIIB 1BBDH 5GGUB 3NFNA 4FABL 2DIAA 3T3ME 1XF5B 4CJ1A 1CIDA 4KI1A 5EO9A 2DLGA 5T5NG 2X89D 4NZUL 1ZA3A 1IGJB 5GRVL 2O61B 5DD1H 2ITDB 4G8IB 3CFKB 4Z7QF 2AP2A 2E6JA 5H37G 3MLVH 1U8LA 4NM4H 4XXCA 4AEFA 4UIMA 1BZ9B 3F7YB 3HFMH 3PWNA 2CDGB 2WP3O 3H7BA 2IJ0C 2VUYA 3ROLA 2XNAB 3V8CA 5KVEL 1R0AL 3EYSL 1P6FA 4R0LC 3CUPB 4M7LL 2GI7A 5IBTL 5IK3A 3WIIL 4N8CL 1I7RA 2DICA 5IEKA 4PRNA 3DWTA 2NPLX 4XPBH 4RGNE 2BVTA 3MLYL 4UIKL 3JTSA 3FL7A 3BW9A 3QIBD 3UTTA 1CFSA 4D9LL 4K9EC 4ZS6D 3BAEL 2GCYB 3SE8H 3H7BB 1S9XB 2VLRE 1X5FA 3GSUB 2E7HA 3ZKQD 2VAAA 4EUPH 4F7CA 3NCBB 4YK4B 4RGMC 2EC8A 3BKYH 3GSQB 1DLFL 2CLZB 2WWMD 5IK3B 2AS5M 1AGDB 4MJ5B 4L8SB 1RJZA 3RGVC 1BEYH 2G2RB 1Y6KR 5TDNB 1JGEB 1I7RB 2Q6WA 4JRYD 1Q0XH 4PJAB 3MRNB 5J06A 1C5CL 5IT2L 3BW9B 1I3GL 2EDRA 4PJDF 1A6ZB 5E7BA 4H0HB 4CBPA 4PJFB 2FBOJ 3M17B 4X8XA 3TO4D 2ICWB 3SGJA 3MBXL 2EYRA 3PP3K 1HXMB 3PQYB 3SGKC 2AV7B 2FD6H 4Q0XL 1RZFL 2HWZL 4OQ1A 5I71B 5SWSA 2H45A 5F1NA 3ZDZE 5C0AB 3MJ9H 4HWEH 2V7HB 1FFNB 4IMKA 4HQQH 1IGMH 4FQXB 4KZDH 4M5YL 1MLCB 4KJWC 4XPTL 3HC0B 4KMQA 1OW0A 4YFLI 4C55A 3R1GL 2AJYH 3D18A 1VHPA 5CEYA 4OZGE 4Q9CA 4S1DC 1CGTA 5J1SC 3DHJA 4JLRA 1Y0LA 3MRJA 1QSVA 4WEUD 4M9PA 2A6JA 4CNIA 4NJAH 1U8PA 4FP8H 3AXLA 1HSAA 1YY8B 2IAND 3QEQB 3WD5L 2ERJC 4NQCE 3EOAA 3VXTB 3QIUB 1I3UA 1MREL 4M4PA 1ADQL 1IFHL 5D1XC 1LEGA 3T2NH 2PUQT 3H3PH 4MAUH 2N56A 4PLJC 3DTXA 1FN4A 2P1YA 5HHOA 1C12B 1FIGH 1PY9A 3DMMD 5D5MF 4F7PA 2DQEL 1RUQH 3GIZL 3QIWA 4DGVL 1A7NL 3K2UL 5I19H 2GAZA 4XVTL 3RJDA 1CICA 4LGSB 2EDFA 4JFHE 5DJYA 3AXLB 1IGYA 1KLUB 5BS0E 3CVHL 1NCAL 4HULB 4ZPVA 5SV4A 3EOAB 1I1AC 4KK5D 1E4JA 2JCCF 3GZKA 3ARGA 4MMXC 3D39E 3KYNB 4HIHB 4LCCC 3U46B 2VITA 4LVNB 4JVWA 2EDKA 1W0VA 4KZEH 4X83A 1OAUH 2CUHA 5DD5H 2H3NA 2FIKA 2Z31B 3ECBA 2DD8L 3QIWB 4PGEA 2OJZL 2JKXA 2XTJD 3VWJA 4LSRH 2W0LA 3IDNA 2AJ3B 3BH9B 4EIGB 1DBBL 1DLHA 1TCRB 2DQCL 5FXCH 2VLJA 1BOGA 1CIUA 1N0XH 3BIBX 3W0WD 4TUJA 2X4TA 5BRZE 4G8GE 5D93B 1F3JB 4C83B 1N3NA 4ZPVB 5JPMA 2PTTB 2WUBH 2X89A 1AGBA 3MPCA 4HAFA 1V7NH 1NMAL 4H25B 5GRUL 3IDIB 1CZ8H 1YMME 1J1PH 1IMHC 4N90E 5E24E 3C2AH 5B22A 1MPAL 3MXWH 1A5FL 4OJFL 2H3NB 4GG6E 3QZWB 2IPTL 4PGEB 1QYGH 1RUPH 4ESKA 1HKLH 5ADPL 32C2A 3GIVA 3LEYL 5C0JA 4XZUA 5LAXB 4F15C 2VDQL 3QQ3A 3LOWA 5E1AB 2FEDC 1NGXA 3QT2A 5DUPH 5FM8A 5HHVL 1D9KB 3C5ZD 4HKBB 2DTMH 5I8OL 1HEZB 2X4TB 4QHKI 1ZMYA 3V0WL 1AFVL 3AGVA 4HXAL 1MFEL 1JWSA 1ZT4A 1DQDH 1UADC 1TZGL 4FQPA 3VW3L 4PGBA 1UM5L 1K5NB 2B2XH 1C8PA 3KPPA 3QIBA 3U1SL 4B41A 3CZJA 1UXSB 5TDOB 1JN6A 1V8HA 3QNZA 1H3TA 1N64H 1G0DA 3STZA 1N5YL 2AJSH 2W9DL 4L3ED 3HNVH 4ELKA 5J3HC 1LVEA 3ZDYE 2NY6B 1FH5H 3MRRB 4LLUA 1NDGB 2QSQA 3MREA 4XMPL 3QUZA 5IKCA 3REWB 2VKXA 4YNYA 1MFAH 3BE1L 1XGUB 5F89B 5HXMA 2DM3A 3ALWA 4C59B 5J13B 4JRYA 1FSKB 1T21A 5I30H 4Q9QL 2PTUA 3DYOA 3CGTA 4PGBB 4O51B 5DT1H 3RU8H 4XCNB 3NAAL 2QKIB 3TWCL 4FFWC 3GRWH 1JWMA 2F53B 1JZ6A 2NY2B 1JN6B 4X7EC 4KY1L 3QNZB 3K4ZA 1YN7A 4GXVL 4RFOH 5ID0B 4MMZC 3BGAA 4P2OB 3VMPA 1TJIH 3IDYC 1J0HA 1WC7B 2BC4B 1F11B 1PGRB 1IM3B 3WXVL 2YWYA 2AXGB 2GSGA 4ONHB 1C08B 1MRFL 4ONGH 3PGDB 4MHHG 5L8KB 2CK0H 4HZLA 5KSBF 1UZ8B 5DHVA 3BO8B 4JDZA 1QBAA 1HQ4A 2DQGL 3S37X 1JK8B 2F54E 4CU7A 5I73C 5I16A 4LBEB 3EIFA 2K1MA 4ZYKB 1MJJA 1DFBH 4M43H 1QKZL 3QUML 1KTDB 3TO4B 3GJFA 1HOCB 2NY5C 1FNGB 1LD9B 3DUUB 1UG9A 5CEZH 2PKDA 1QFPA 4XAKE 1JV5B 3ULVF 2VRAA 2BY2A 1FC1A 3EDEA 3O4LE 3OTTA 3HE7C 4NOBA 4WJ5B 4FQQA 3ZT6A 4OZHB 2A38A 5ABDE 5C8JA 4WNQA 2ED9A 1TTUA 3MODL 5IGXH 2FEEL 4RIRA 4HMDA 3TT3L 1QQDA 2XFXB 2BNRE 2OXHA 3DMMA 4F33A 4YWGH 1NGWB 4J6RH 1IQDA 3W9DB 4EOWL 2HTLC 3IJSB 3P0VL 4M9OA 4EI6A 2NY3D 4KQ3H 3TF7C 1FQ9C 3GSNA 3MA7B 3VGHA 4DKDC 4I8DA 4MA1B 5E4EB 4XB8A 4PGDA 5I8EA 5IV2B 4TSCL 4Y4HD 3HAEA 2IANB 1UQSA 1H15A 5EBWB 1HHKB 3SDAD 1H3VA 2IMNA 4NHUA 5DD3L 3MRQB 5DJZB 2VABA 2VLKB 4LSVL 4WTXA 4R96A 3OX8A 5TE7H 1RHFA 3ZE1F 5EH1A 3DVFA 2GY7B 3PNWA 2B4CL 2XT1B 3WN5C 4B0MM 3DX7B 4OZIB 4X6CF 1JWUA 4AMKH 4PJ8C 4ZODA 1MVFA 4XAWL 1SBSL 4ZUSA 2X4RA 1D5BB 2AAVA 4I0PD 2CLVA 1M7DA 2ZCHH 4YHMH 1CLCA 5MEPA 4LCIH 2Y7QB 4GRWF 1SYVB 3Q3GB 3QHFL 3TBYB 2X4PB 3BD4A 3F5WA 4Z7VA 5F3BA 4LLDA 3X11A 5IW6B 3M07A 4PJCA 5IBLD 2BRQA 2E9JA 4BFBD 1T7YA 1AIFB 4GRLD 5CSGA 3PNWB 5GRZA 1HILB 1KPRA 2ADIA 4WWID 1QBMH 4UQ2A 3V79C 4JPKH 2XN9D 1P7HL 3N9GL 4YZFE 3LB6C 4LLAA 4LLQA 1X5HA 3FB5B 1FPTH 4I77H 5C6WH 1ZXQA 4OLWH 5CKGA 1UH3A 3W0WB 5TFSL 2OK0L 5IFHH 1E27A 1Z9SA 3AFLA 1INDH 4O4YH 4K3JL 4XVSH 3S37H 3PWPD 3UTQB 1ZLUK 3FQUB 3GMOA 3F5WB 5BQ7B 3S4SA 4JZOB 4EN3D 2C5DC 4YJZL 5DMIH 5I8KL 1T2QH 2WUCH 1GYAA 3F7VB 5AD0B 3QBTB 3CX2A 1C16B 4OZFG 1WGOA 1CFNB 4HD9A 2FYYA 5DRZB 3MJ9A 1FDLH 5E6ID 4L3EA 2FX8H 4JY5H 1EBPA 4P5MB 3D0LB 1J86A 2EDDA 5ICXA 4WFGE 5K59F 2W0PA 2K7QA 1MWAB 3AMLA 3GUTB 2P42B 3MRKB 3DVGA 3MV8A 3OWEA 4F7MA 3C5ZB 4MQTB 3OKNA 2YRZA 1OP5K 4M1CC 2Y5TA 1MY7A 4R7NB 1EGJA 1J0ZA 3BYYA 2KKQA 3VRJA 5JA9A 1WUNT 4JFEE 4PP2B 1A14H 1YJDL 3CCHB 1KCRH 5E08H 2F8OA 4UOW0 3GMOB 4LKXA 1NUFA 2GSIB 3O6FD 4LPYA 1I9IL 1G9EA 3AS1A 3U9PH 5FDWA 5HJ3A 2P5EE 8CGTA 4LSTL 3CFJA 3U2SA 1NGPH 3Q6FA 1J87A 2X4UA 4S1QL 4GUPA 1IL1A 3LIZL 3THMH 1H5BC 1NANH 5CILL 3P2TA 4X6FB 3M45A 4HS3B 3FT2A 4JFFD 4LGRB 1F4YL 1R5VB 5FKPA 2FGWH 1ERNA 3VFGH 5F7YC 1A2YB 1LP9E 2X9WA 3HI1A 1RZJC 2FR4A 3PIQA 3MLRL 1WWWX 3ZYIA 1JPFB 3OR6B 4KTDL 4BM7A 2VJXA 4N0UE 2V5RA 4EI5D 1G1YA 5EOTA 3ZE0E 4OF5A 1U42A 3JWDH 5F9DC 5KVGH 3BUYA 1U41A 2IQ9H 1DCLA 4UU9A 5E2UH 3PWLB 1SYSB 3Q6FB 4BQ8A 3NMEA 2Q8AL 4BELD 5F70A 1OAYL 4D94A 5CP7B 3BRDA 2P46B 1QSEA 5TE4H 5FYLD 1CU4L 1RVFL 4PP1D 5IG7A 5FKPB 4KK8C 2FLBT 5ANMA 2EXWD 1PKQB 4FQJH 4P2YA 4DAGH 2FR4B 1QFUH 4KKBD 3KPRA 3OB0K 4ZXBC 3RVTD 5D70H 1FIEA 4NO3B 4G6ML 4WI2A 1KIRB 4QT5A 5ITFB 1S78C 7FABH 1BFSA 2OI9C 3BUYB 3VRIA 1TJHH 2DLFH 5FHAH 4NKIH 3IFNH 5J89A 4Y4HA 2AQ2A 4MJIA 3SDAA 3FO9B 1YEIH 5CINH 3O2VH 1I7UA 4U0QB 3L3HA 2CDFB 5D2LF 5BZWB 2B4CC 1MIEL 2BSRA 1H3PH 2GJZA 2MPAH 3LZFH 3SCMB 2W0FB 2VB5A 2PNDA 2Z9TA 1MUJB 4WEBH 4WHCA 5HYIA 2CPCA 4DCQB 2NY3B 1MCEA 3QQNA 4ZFOA 1RIHL 3IU3A 3O8XB 2CRIA 3HI5L 3QUXD 2KZ1B 3RUGA 3DX6A 3OZ9L 3TCXA 1S7SA 5DRWB 2HA1A 3P9MB 5HI3C 5L2KD 3BQUC 3TVMD 4Y0GA 5BV7H 4OV5A 2VUOA 1I7UB 4HGKC 2IBZY 1FGNL 1UACH 4U6VL 4OKVB 3OBAA 2YKLH 4KKCC 2YXFA 3KLHD 5J57B 1H9VA 1N6QH 1ORSB 4H8WL 2W1NA 2ZUWA 3RNKB 3P4MA 3NGBC 4NSKA 4X7CC 2ED7A 4I0PB 1KJMA 1L6XA 3ES6B 1ACZA 1UGNA 4PB0H 2W0KA 2YMXH 3ZT7A 1CGSH 1TVBA 3DX6B 4G7VH 4L4TE 4ZS7L 3WBDA 1IAIH 4CVZA 1F13A 3PWPA 3E6HA 5MERB 3ZKMC 3TBTB 4KMTH 5D7LE 4U6HA 2XWBB 3PWVB 5IB5B 5IVXF 3VG0H 4NKMA 1Z5LA 3JV4B 3K0WA 1WAAA 1UFUA 3TM6A 5A3ID 1AGCA 2IC2A 4GRLB 4LU5H 2CRYA 5T1LD 3P0YH 1VA9A 1MRCL 5E6IA 1BFOB 3RAJL 2XN9B 1K8DB 1LO0L 4OTXH 4PYGA 3BD5A 1X7QA 3QULB 3RWFA 1P9MA 5I1KH 3HNSH 3IB4A 1CR9L 5IVZB 5E5RB 1S7WB 1NEZA 1U92B 2VDRH 5E9DA 4L3CB 3H8NA 4LDOB 4AEIH 5C0EB 5JNYB 1YDPA 4JJ5A 3X12A 2ZJSL 1PW3A 4Z8FL 4JHAH 4K8RH 1IT9L 4EN3B 4ODXA 3RBGA 3V0VB 1MEXL 4FRWA 5K9QG 5H35A 3N1MC 3WS6A 4HT1H 3CFEB 3O2WH 1M05A 2VZTA 1GIGL 4G6JH 3SDCC 3WUWA 5GGTH 4Z7NF 3VFTB 3IJHB 2VXSL 2PYED 3SDXE 1JF1A 3ET9F 3LKNB 1LK2B 5DDHA 5C7XH 2FATL 4BSWB 1WEJH 1J5OL 4NHCH 4P4KD 1MCKA 2J6EH 1A6TB 2VLMD 4NQSA 4I2XE 5HHXH 5DC0A 4LLVA 2JTDA 5CS7A 2R0LH 4QRTA 5AZ2L 4K7PL 1S3KH 4AIZB 4HEPG 3O6FB 3TBVA 4CJ0A 1F58H 3TPUA 4P23C 1Z2KA 4YDVA 3GNML 5EC1B 4QXGH 4GQ9H 5H35B 3HZYA 1BQLH 1DP0A 1IM9A 1YN6A 2IG2H 4OGXL 3CZFA 5C0CD 5MP6L 3MRGB 1I1FB 3T3MF 3ULUC 4FXKB 2HJFB 2ICWJ 2GK2A 1MVUA 3B83A 4JFFB 4E5XB 1DDHA 5H8DA 5D71H 4YHOH 3OJMB 4NRXA 2Y07H 3STBA 1CL7H 1YEJH 2CKBB 2ZUSA 5E2VL 3LEVL 5F1KC 1ZHKB 3BP5A 1QACA 3I3DA 4QRTB 2NY7H 5KS9A 2G9HA 3FFCE 4EI5B 4U1SA 1ETZB 4XXCC 2BDNH 4YBHA 1EJOH 1HXYB 1QFWH 1G7HA 2AK1L 2X10A 1YEDB 5JUEL 3QHZH 1NAML 1YN6B 3LSOA 4G9FD 4P46D 4YK4C 5JLZA 1ZV5A 4JFOA 4PJEE 1PG7X 4KJPD 1NBVL 4JO1H 3DVNA 4DKFL 1BQSA 4RZCA 4DK3A 4NRXB 2J8HA 1KV3A 3IETB 5EZJA 4DN4L 4YC2B 4F9PA 4ZAKA 3BP5B 1H3GA 5D7SH 1PFCA 3MNWB 5T3XE 2VDNH 4X6DB 2H32A 1S5IH 3ALPA 3QAZB 3V52H 4NIKB 1YEEL 1XF2A 2VZOA 5EFIB 1QFHA 4YHNA 1CLOH 3QXDB 5HYQA 1GGYA 1OAQH 5C0BD 4J7RA 5TPWL 1JGDA 5F7KC 2ZP0T 5T3ZH 2BOBB 3PL6B 3SO3B 3LSOB 4M48H 3MLZH 4UTBL 4JM2F 1RZGA 4LQFL 4UDTA 2R0WL 1E4XI 2X9YA 3FT4A 3TVMA 3QYCA 1FGVH 1KEGH 4QTIL 5HPMA 1ZLWK 4IS6A 2A9NL 3SKNB 1JUFB 4NNYA 2BVOA 4C56A 5C0ND 4UUJA 1MJ7L 1ZLSH 3VRLF 3KYKL 4LNRA 3TYFB 1JNLH 4JDTH 3B8SA 3Q6GL 1T1XA 1YY9C 4KRMB 3SGJC 2DQHL 2DM7A 3DI2B 3ZDZF 4U1MA 1WLHA 2JK5A 5ALCH 2MTPA 2RCSH 1IGIL 1CQKA 1U2CA 3QUXB 5DHXB 4PLKC 2G75B 1KCVL 4IMKC 4ZFGL 5IMKA 3VI3E 1RZGB 2WLZA 5JMRA 5CJOH 2PO6B 4FTVA 5DRNA 5L2KB 3TVMB 1KPVA 1HHIB 1OW0C 5HPMB 1G7IB 5D96B 1NSNL 4XNZC 4LVHB 4LARL 4NQXB 1S7XA 3TYGL 4FXGB 2ZUXA 3NIDE 4TUOB 5I9QB 4OZFA 2VQUA 5T1LA 5EORH 3IYLW 4LRNL 5K9KA 1CLYH 1EEQA 1S7QB 5BW7A 2GUOA 1UVQA 3QUKA 3MV9D 4LNVA 4CAGA 4JFZL 2YK1H 1FFOB 4MQSB 2NQCA 3UBXG 4GAYB 1CQYA 1H3UA 3TNNB 4WY7L 1X9QA 2WV3A 3CLEL 5F7MC 1UEMA 3UC0H 1EEUA 5TQ2L 3QR2A 1QG3A 3FMGL 5GS3A 4OGYL 4HGWB 3V6FB 3MGOB 4QRPD 1OGAA 4RBPH 3DI3B 3QIWC 3VGDA 1CXHA 3OJ2C 5T1LB 4MDIB 3DIFA 4NQVB 4Y19B 5K9KB 3I6GB 2XZQH 2PYEA 1G7MB 1PG7H 2HT3D 1B0GA 1UVQB 3OF6D 2DWEA 1CICC 3C6LB 4GG6B 1BBDL 3VFUB 2HH0H 3EOBA 5D93C 3HRPA 4OAWA 5GRWA 3FQNB 2E3VA 2HVKB 1T3FA 3ARGC 5DD1L 5INCA 4XCYB 3MLVL 2BNQE 1UH4A 5IIEA 1K3ZA 1XGRA 3BT2H 3ORJA 3HHRB 4NM4L 3DPBA 4MB4A 3HFML 2XTLA 4J2XA 3FCTA 5FUCC 1EBAA 3VWJC 2GY5A 4JKLA 5DZLA 3V5DA 5C0CA 2EEDA 4X6BA 4K71B 1SJHA 4NOFA 4LAQH 3HA0A 3VXUD 2GJ6D 2NCMA 3GSVA 4P4KB 2JB6A 1XF3B 4PRHD 5D9SA 5IR1B 4OAWB 3L3JA 5ICZA 1I4FB 3UZEA 5ACLA 4RAVA 2X7LA 3J8F7 4LPCA 1T3FB 3QDME 4XPBL 1T7WA 3GKWH 4R7DA 4I0KA 4MD5B 5KSUB 1T04A 1LE5A 5HYSG 2UVFA 5E8OA 4AQOA 3BKCH 3D48R 4Y7MA 2LE9A 3KPOA 3QFDB 3SE8L 4NP4H 5F88B 4JREC 3FCTB 1AJ7H 1C5DB 3PABB 4GW5B 1N5AA 3HCVB 4G9FA 4P46A 2VERN 2OMNA 4CADA 1MCOH 5HVGB 5EA0H 2QADB 5DJCA 2BJMH 4DUVA 3UDWA 3BKYL 3OGOE 1TZIB 4X9FA 2JB6B 1BEYL 2HRLA 4HLZG 4RAVB 1FSKC 4L4VE 2EH7H 2VZ3A 1Q0XL 5DUBB 4R7DB 4PRIE 2PCPA 3QIBC 1AR2A 5FKAB 4XNMA 3DRTA 4D0CA 4UILH 5C0BA 2FHBA 1ZOXA 4KI5F 3VXSB 1WICA 3EYQD 5EU4B 5DD6A 3ZDYF 2FD6L 2UWEF 4OFYD 2R0ZH 2OJEA 1DQJA 4EIZC 4G9FB 5EBMA 3MJ9L 4HWEL 3WKMH 4HQQL 2WWMC 4MDJB 4NQEA 1IGML 3HG1B 2I9LA 5TDPA 4FZEH 4KZDL 1T5XA 4GFTB 2N7BA 3QUZC 3MR9A 1ND0B 2JJUA 4UDUB 5EN2A 4KHTH 4K2UH 5D1ZB 3B3IA 4PJ5D 2AJYL 3SKMB 3MRLA 1WZLA 3IXTB 4FQ1H 1EPFA 4K3EH 3D3VE 2C3XA 4QHMB 5FF6B 1NCTA 2FHCA 1HYSD 4NJAL 5GHWH 4FP8L 4JQVA 1ORQA 4J12A 4XX1G 2MSPA 1R3HB 3KPSE 4GKNB 5F6IC 2A73B 4ODHH 3ELAT 4YHIA 5CFHA 5IJVB 4HPYH 2I9LB 2HFFB 4FQCH 4PJDA 3LEXB 4QRSA 3T2NL 4OUUA 3H3PL 3L5XH 4MAUL 4NM8H 3PWUA 4O2EA 1FIGL 5GGTA 5I18H 5IB2B 3ARFD 1RD6A 1JMZA 1IAOA 1RUQL 3QEUB 1FL3A 2WW8A 5KVDH 3WHE0 3V6ZA 2J6EA 4NQDD 5I19L 4XRCA 1NFKA 5E4EC 3MV9A 1B0WA 2WINA 2XWJA 3W2DH 3BD3A 3MRFB 4XCFH 3NCEB 4JHBA 5K9OA 3UYPA 4R6UA 3ARDA 4YBQC 4JGMA 3RDTA 1B0RA 1VFOA 1CD8A 4QTHB 4LAJH 3WFDH 2P43B 3OKMB 3SKOA 5J11C 1REIA 4KRLB 3NH7H 4KZEL 3DMMC 4QRPA 1DL7H 1OAUL 3OSKA 5DD5L 4Q2ZB 1M7XA 3HZKB 4PJBE 1ZKAA 3ULVD 4NQUA 4LSRL 3SDYH 4Q6IA 4QOKB 1YMHA 2AQ3A 3V6ZB 5H37H 3MV9B 3L3IB 1N0XL 2NW2A 3FFDA 3LKRB 4PJXF 5IM7A 4DTGH 1KN2H 4KVNH 5D5MA 4KK5C 2WUBL 3SQBA 3ZKXB 5F44A 1V7NL 1M71B 1IGCH 1XGPA 1CZ8L 1B0RB 1J1PL 3CDYA 4HFWA 3SKOB 4FQIH 3BMVA 3C2AL 3MXWL 3QO0A 4FG6D 2GQHA 3IFPA 2GFBA 4JPIA 1BQHA 4WIQA 2XTJC 3S34H 1A9EA 1QYGL 1RUPL 1HKLL 5E70A 2H9GB 4OIBA 1G6VK 1NEUA 5DUPL 2JCCA 3VXUA 2GJ6A 2DTML 3BGMA 2NW2B 4TN9A 4G8FB 4LLYB 5JHLH 1KTLB 4IRSD 3KWWA 1DQDL 4QRUA 5EU3B 1DUZA 3I75A 4MA7H 4K07A 2B2XL 3K81A 4Q74A 3C5SA 1JF6A 5JPNB 3RX5A 2YPVH 4LEOB 4Z0XB 2VO5A 1N64L 5D7JA 2AJSL 1FZJA 1C7SA 1IJ9A 3HNVL 4PJIE 1E28B 5E2JA 1GRWA 1AY1H 2BMKA 3MRBB 4DVBB 3KXFE 2QBWA 3F7RA 4ALAH 2JCCB 1FH5L 2GJ6B 4Y1AA 1A22B 2QSVA 3BGMB 4PRHB 5HHPB 3IVKB 2ZNXA 3VFRB 2YA1A 4I9WE 1MFAL 5CSZB 1UT9A 2NY0D 1DANT 1ZA6B 4NN6B 4X0KB 1MCPH 4QRUB 4IDLA 1BVKB 4CDHA 5I30L 3T1WA 3N85H 5FO9B 4JHZA 1CT8A 4KVCH 5DT1L 1EHAA 3RU8L 3SY0B 3IDGB 1ZGLM 1HHHB 3GRWL 1AD9A 4NN7B 5ERWB 5DJXB 4AQ1B 2FIRT 4JZJA 4RFOL 4HIIA 1QSFA 4YDKH 4Z76A 1GOFA 1TJIL 5JO5B 1LNUB 4A2LA 4XPAH 4ONGL 3B6SA 1ZEAH 2CK0L 3TH2T 1BD2E 3VD7A 1CDBA 3CXDH 3IDUA 5GZND 1HWGB 4FN0A 3MXVH 2YUVA 2Z92A 1NFDE 4PJ5A 3EAKA 4PRPD 1A4KA 4KXZI 3VXOB 4HPOH 4KKNA 25C8H 1DFBL 4M43L 3ZTJG 4AH2A 5D7IB 1HI6A 3OKDA 2NTSP 3WEXA 1WCBA 2QSCH 2ADFH 2DYPD 3U48A 3I6LD 1T0NA 3FQTA 2ADGB 1DN0A 5CEZL 4ERSH 5BOPA 1R5WB 3CFBB 1LP9F 1U0QA 4OBRA 2VXUH 2ICEB 5CJ8A 1II4E 2EDQA 1SHMA 3U9UB 2F8XC 1OF2B 3V95A 1OAZH 3JV0A 1Q9WB 3ZE0F 5IGXL 1I1RA 4LSQH 4PBXA 4PJ5B 2BVQA 5I6XB 3ARFA 4I18A 5KZCD 4YWGL 3EO1A 3T77B 3IKCB 5MI0C 4J6RL 4E0RA 3OKDB 4KQ3L 1HCVA 2DQIH 2NX5E 4P2QD 1MLBA 5ESVB 4Y4KD 3QPQD 1A7BA 5KSBA 5DC4B 5DJ6A 5AWNH 3FQTB 5CBEB 3IFOB 5B21A 3MBED 5GGSY 4ORGB 5MENA 4GXUN 2K9UA 4U0RC 4Z7UA 3HZMA 5JOPE 4MNHB 3KPQB 4WFHE 5E8PB 3LAFA 4GO6B 4QNPF 2B0SH 4PJHE 1DUYB 2HG5A 1VPOH 5TE7L 4MCYA 2MHAA 3ARFB 3FTGB 4ZUTA 4CDGC 2W92A 5CBAA 4P3DA 5L88H 4AMKL 3KYOB 1HHJB 5HYJE 3QH3A 3EYUH 5KAQF 1WFTA 1P1ZB 3T0BA 3ZHDA 4NQDB 2ZCHL 4YHML 3T08A 2XA8H 1EHXA 4Y4HC 3DX8A 5JQ6H 5IVNA 1SQ2N 5GS0D 4LCIL 3IF1B 4FQLH 1VFUA 2EEBA 5F7DB 3SDAC 2AQ1A 3QUYD 4RWHA 1HHGA 3UBXB 2GHWB 4MB3A 3NZ8A 3VWKA 3PDOA 4NKOB 3D69A 5EU6E 3TJHD 4S1SH 5ACMA 1XGTA 2MHAB 3AB0B 4NNXA 3W81A 1QBML 3LN5B 3QNYB 4HZAA 4RAUB 2C3WA 3T65A 4BUGA 4JPKL 4XBGB 3JXAA 4GAGH 5EUOE 3PV6A 4PJGA 1FPTL 4I77L 4P2RA 3UPAA 1AGFA 4OLWL 1MHCA 4F7TA 5ID1B 5IFHL 5GGRY 3K1DA 1XEDA 2RGSA 4IRSA 5FB8A 1INDL 4O4YL 4XVSL 3S37L 1HHGB 3ZKNC 4L29B 4X6CA 3WJLA 4MNQA 2YC1A 5DMIL 1T2QL 2WUCL 3T4YA