3NCMA

Neural cell adhesion molecule, module 2, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
YVMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and interactions of NCAM modules 1 and 2, basic elements in neural cell adhesion
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion protein
molecule keywords PROTEIN (NEURAL CELL ADHESION MOLECULE, LARGE ISOFORM)
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1998-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncmA00
2XOTA 1J1OL 2JLLA 3SDCA 3DMMA 5DUBA 5IG7A 1II4E 4QXGL 2P7TA 4CU6A 2JIXB 4G3YH 3ALPA 3ZE1F 2J88H 3QNXA 1N4XH 5TE7L 5HDBE 1JUFA 4OD2B 2YUVA 5CZVH 4IMKC 4U1JB 3FOLA 1UACH 5JQ6H 3F7YA 5B8CC 2AJYL 2GSIA 3VXNA 4HFUH 1J5OL 1IGYB 1D5IL 1MRCL 3STBA 3GSNH 4U1MB 1XGUB 3PGCA 4JFXA 4PBXA 4GH7B 1P7QD 2V2XA 3S6CA 4DGIH 4Z7OE 4JG0H 3QNZA 1HXMB 3BUYB 3HAEG 5EH1A 4WEMB 4KPHH 5E6YA 1KXQE 2KBGA 4XVTL 4LCWA 4YXHH 2J88L 3F58L 1QZ1A 1T5XA 4NFDA 1RHFA 2UVEA 4XCYA 3QHZH 5H37G 3SCMB 3VFGL 3OXRB 2E6QA 4EZMA 4M6ML 1C12A 1UH3A 2MKLC 3NIGF 3NCYP 4LARL 3B9KD 1D3CA 1KB5B 3ZO0A 1LP9E 1J0JA 3MLUH 3PHQA 1ZA3A 2W9DH 3CXDL 3DUSA 3U36A 3NACL 4N9GA 3WO3B 4CJ0A 4GRLB 2EKJA 1XGRB 4PRIE 3IDYC 5IQ7H 4FFZH 4R8WH 5ID0B 4EUPG 5EUKB 5IESH 1AKJA 1CGXA 3RY4A 2DQDL 3HZYA 2XV6B 2ZPKH 4X7DC 5C0GB 4YBLC 1AHWC 2UY7A 1JJUA 5DD5L 1UM4H 4JR9H 1XGQB 4Z77B 2AXHA 2Z93A 1S7WB 1MWAB 3W5NA 5CD5C 5L88L 3LSOA 4MMZC 2VH5L 2HMIC 5GS3A 3FT4A 4KVNH 3O0RL 2XIDA 4YAQA 4P2OD 4F80A 1DEEA 2OXHA 2Y06L 1T1YB 3P0VH 4OUUA 2DM2A 3I3DA 4ZAKB 1X5JA 4Z7QF 5C6TL 1QG3A 4ONFL 4ONOA 2IFFH 1GPOH 2IANB 3CLEH 3VDCA 3BSZL 3D25A 4RAHA 3GO1H 5FKPA 5GGQL 3V5KB 3WS6C 1UM4L 4PLJD 3T2QA 5GRYA 5C1MB 4PRBA 4ZFFB 3EBAA 3QISA 1KG0A 1X4XA 4QY8A 1KF9B 4HPYL 3F62A 4Y1AD 2OYPA 1ACYH 3BEVA 3QZWA 1JTTA 3UYOD 3F8UB 4UILL 4MCZB 3NACH 4F7PB 5LWYH 2QTEA 4RNRB 1KEGH 4NRYB 4UT7H 2A6JB 5KANG 4JO3H 2ZSVB 4OZFA 1K2DB 3VXMA 5I1KH 2YSSB 2A1WL 1JN6A 1N2RB 3VXTA 4YDVA 1FL6B 3CK0H 3MRIB 5A43C 4RMSA 1OSPH 3VDBA 1QSEE 4KK8C 1DBJL 3B3IA 3F7QA 2EDHA 3QP3A 2YK1L 4XH2A 1CE1H 1UKSA 3FT2A 1RZ7L 1LE9B 5T1MB 3ARGD 3RA7H 1OAZL 2NY0D 3CDCA 2GTZA 5F8RC 3A67H 2PCPA 2ZPKL 1B90A 4P59H 5I1KL 1BFVL 1V05A 1RULH 4D8PB 4TVPH 4Z7VE 5B8CA 5EN2B 4AL8H 2IG2H 2AJVH 1DP0A 4JFDD 2R15A 3QDGB 2DQJH 3MLUL 3RNQA 5A40E 4OSUH 3VXPB 2WK2A 4HS8L 4FG6D 5I18L 2QKIA 1SY6H 4WFGD 3U46B 4NQCA 4PJBA 4LSTL 1NANI 3HKFA 4RMQA 4TPRL 4AMKH 4QRPA 3WV0A 3F5WB 4OCMC 4V1DE 1YA5A 4DN4H 3ULUC 5FOJA 5DEFA 4KKBD 3BT2H 4Q9QH 2Y72A 4LDEB 1OLZA 5FA3B 4JG0L 1IAIL 3ARRA 2DWDB 4MA8L 3EAKA 1X5HA 5FA4B 1IC5L 2DQCL 4B50A 2X1OA 2HRPL 1UZ8B 1KJMA 1WBZB 1CICB 1IM9D 3O9WB 4O2CA 1KCRH 4LKXB 3MRKB 1MCCA 1YMHA 1WWWX 1YEIH 4MJIA 5E99H 3CMGA 5KG9B 2EH7H 4Z9KB 5MHSE 5KS9F 2WBJD 1TETH 2GFBA 5CGYC 4HFWB 1F00I 4Y4FC 4BQBA 5TDOB 5ESQA 1MRDH 2W92A 4ZSOA 1NC2D 4Z0BL 1VENA 4KC3B 3DETD 3CD4A 5EOQH 1HEZB 1QSFA 3WYRA 4JLRB 1UXWB 5DHYA 3AM8C 4ZUWA 4IM8A 3ARZA 3RWHB 4RFEA 5B3JE 3MUJA 3PP3K 4H1LB 3V6FB 3GSWA 4KI5E 1XZ0A 1Q9OB 1XT5A 1NC4A 4OIIL 2VDPL 5LGKA 5LWYL 5TH2B 5HDQL 1G7HA 3QFJB 5FO9B 5ALBH 1B0GA 3PJSB 4YX2L 3EYQC 5GIRA 2LAAA 1P9MA 4XPFL 4Q9BA 3ETBF 1CR9H 2PR4H 3B6SB 2ZCLH 4OLXH 3QUYA 5TE6H 3MRFA 5GIRB 5HGAA 1EBPA 3SDAB 3HZVA 5KVDH 5DS8B 4CVZA 5DMKA 1DR9A 4KY1H 4LP4A 2HLAB 2W59A 1OSZB 3RWIB 1JI2A 5AWNH 5MP6L 3SJVB 5EA0H 3QUZB 4BQ6A 1Q0XL 4F8QA 4UT9L 5KS9E 2GHWB 1BWMA 1F3JB 1MREL 1U8NA 1ZVSB 2EDFA 4A6YB 3V6ZA 4FFWD 4AEIH 1SYSB 4APQC 1EAPB 2G60H 1DQMH 1GOHA 2NY6D 4I3SL 3WNLA 3S34H 4WWKA 3AREA 5KVFL 4NKIH 2Y7QA 4PJEB 2CLVB 1PSKL 3LH2H 5I9QC 4FQCL 4KK5D 1M4KA 5BXFA 1EUUA 1SBSL 1QEWB 4KU1A 3DTXB 1D5ZB 2O5YL 2VZ3A 1HILA 1YEKL 1P2CA 1LILA 2QSTA 2YN3A 5ADPL 1KJ3L 4DUXA 1YNLL 3LKOB 4JQVA 3T2NH 4RX4D 4XP6H 1JGLH 1MVUB 2QQKH 5HHOA 5D7KE 1A7BA 4GKSB 3KYMA 1PFCA 2NW2B 4L8DA 5HVHC 5CD3A 4UV7H 3ILPB 5AYUH 3NCYS 1YNTB 3HUJA 3LSOB 5TJWK 1FGNL 1DEDA 2XWBA 4JHWL 4TULL 2XZAL 5LQBL 1FFPB 3BP4B 2OTWB 4XGZB 1LWRA 3PNWB 3IF1B 4ODSL 5HPMA 1A1NA 2ZSWB 3LKSA 3UJTH 1MAMH 1AD0B 3NZ8B 5F44A 1FQ9C 5CZXC 4ZD3H 4XVSL 2RR3A 1FFOB 4H20H 4HJGB 1K9TA 1CXFA 3KYAA 5CMAB 3VG9B 1JBJA 3RTQB 3P11L 1BJ1J 4TULH 5GZOC 1RUPL 2DRUA 1X5ZA 4UDTB 2DYPD 4LNVA 5HGDB 5H94A 4K9EL 4DVBB 3SDXE 1RUML 5JQHC 3LKQA 5IB2A 1ZEAL 5L7XH 5GSRA 2B1HH 4NKIL 3GI9L 3RL2A 1U2HA 1B0RB 3EDJA 3QUXD 1S7QB 1FJ1A 4L4TD 1DJSA 3DETC 4D3CL 3K81A 4Z95L 3MJ9A 3IXAA 4MHHG 1XCTA 1F3RB 1S5HA 4X6BB 2O5YH 1EHAA 3U4BH 1OARH 3HI6H 5KSAA 2DQUL 2BY2A 2W0FB 3TA3C 3PWJB 5I30L 5EU4B 5HGHB 3TCXA 5E7FA 3NN8B 4OD3L 1OT1A 1TZIB 2OTPA 3H6JA 4PP2B 5FHBL 3L3JA 1D6EA 2IMMA 4HHAB 4PV8B 5L2KB 2VXUH 4HKZA 4YGAB 1LO4H 1NBVH 1ZXQA 4JB9H 1DBMH 1NCDL 5DI8A 2BC4A 9CGTA 3T1WA 3U2SA 1DSFL 4HW6A 5HGBA 2DQHL 3WNOA 3FT3A 3S5LA 2CJUH 1B9ZA 3MNVB 1U36A 5FUOH 3V0WL 5I8CA 1FGVH 1A6UL 2EDYA 4G9FE 3P11H 1IT9H 1VEMA 1U8LA 4S1SH 4RWYL 4WIQA 1Q8MA 5JW3L 5DC9B 1HHKA 3G6JB 4OTXH 4FNLL 2PYFA 3QBTB 2XZCH 4KRLB 3I50H 4Y5YB 4PR5B 1FL5B 2BSSA 4YIQB 3TC9A 1BOGB 1UZ8A 4KHXL 5DC0A 4CNIA 4ZNEE 1PY9A 3P2TA 5BVJA 3GSQB 5DHXB 1EGJL 1OPGH 3CU7A 1T1XA 2V7NB 5CEZD 3QQ3A 5DJCB 3P73B 1KXTB 3KYKH 3ARFD 2FLRT 2C4FT 4PY7A 1VADB 1ZT1A 3VW3H 1W8NA 1U8HB 3VXUD 4LVOC 4K7PX 2BHZA 4JRYD 5TH2A 4U6XA 4LCUA 4W4NA 5KOMC 3WBDA 5F3BB 1YUHB 2YPLD 2D2OA 5I30H 3U9UA 5IFHH 3KGRA 5J4MA 5FOBA 3HS0B 1UCBH 3QUMH 4LPWA 1BFOB 4P99A 1CFTB 5FEBA 4OGZA 1A6VH 1KCVL 4IDJH 1HXMA 5TF1L 4OLVH 5F3BA 2FZ3A 1KSRA 2Q8BL 5CCKH 5F7KC 5D1XD 1HHGA 4AG4L 2BOBB 4M1GL 4NM8L 3SJVA 2N7AA 2AJSL 5A2KH 3MO1B 4JFEE 4LVOB 5KN5A 4GG6E 4YBQD 1VGEH 2EDWA 3HZVB 5DSCA 4UBDD 1MWAH 1N3NA 4OF3A 5KAQF 3AS2A 4JKWA 4RMRA 2YBRA 5BXFB 1XGRA 1KIPB 5F7YC 3O0RH 3KPNA 1VERA 3QIBD 2CLRA 3HB3D 3KPMA 1GIGH 4ALAL 2E9BA 3RGVA 3QUYC 2WBKA 2A0LD 3S9DB 3EGSA 2QR0B 4MA8H 4MYWB 5KSBB 3WN5B 1CU4L 2XKSA 2PNDA 3I75B 4NKOB 1MHEA 2BVYA 4M61B 3U4AA 3OV6A 3MOQA 1XGUA 3PGCB 1VSCA 3GHBH 4HWBA 5AD0A 2P8PB 4R4BB 5DK0A 4P5KB 1HSBA 1EX0A 3N1QC 4KDTC 5GGTH 3TO4A 5EFIA 4NM8H 4Y4HB 4YHIB 2EYRA 1NMBL 3QHFL 4PJIB 3K8KA 3O3DA 3O2WH 4YPJA 5I76A 4KRMB 1ZGLM 1KC5L 3UYPA 3DV4A 3K80A 2Q8BH 3HI1B 3WFHA 2JB6A 5JIKA 2BNQA 3T2OA 2R2EA 5HHVH 4E5XB 1OB1A 3GBMH 5LCVL 1NCBL 5GS0L 1ZA3B 5J3HC 3L3OA 3EJJX 1HQ4B 5E4IA 2GJ6D 1CDHA 1HH9A 1WUNT 1F8TL 4K3EL 1AGEA 1KTKE 2VABA 4R97B 4RSVA 3EYFA 1DQLH 4GAYA 3RDTC 2BSED 5KBNC 1EERB 4Y2DD 2GK0B 1ZHNA 2Y36H 3O6FA 3BPCA 2X4TB 5TGBB 5KSVA 4U0QB 3B2UD 2A0LC 3FT4B 3WFCH 3FZUC 4X4XA 3ARFC 2Z92B 3JWDH 3MBEB 5ITBH 5MEOB 1QA9A 1JZ7A 5TPWL 3I50L 1QLFA 3ZE2E 3L5IA 1EAJA 4S1DC 1IEAA 2BVEA 5BRZD 5JXEA 5EO9A 5KZCB 4AMKL 4X5LA 1IM9B 3O9WD 5IT2L 5DLML 5E2UH 4F2MA 5BOPA 4I0CC 4OCRL 3BH8A 4ZDHB 1T3FA 5CGMA 2JB5H 5CIPB 4R97C 3HFML 1WT5C 1I4FB 1NDMA 1UZ6E 4M5YH 4TTDD 5D1XB 1YYLL 2JK5B 3CH1A 1MJ7L 4BZ1H 3LZFH 1N5YL 1WGOA 3MXWH 1KCLA 3MBEC 2NNAA 4K3JL 3TV3L 3VXPA 4B7IA 3DO7A 5FGBA 1JHKH 5LGJA 3TBYA 2QKIB 3V4VL 1AGBB 1YMMB 5D1QA 1GZQA 5F88B 3GSNL 4HUNB 1ONQA 2GCYB 3B4NA 3MV8B 3NPSC 5D2LF 1UQSB 5J1TC 3MZGB 4M5ZL 3VGGA 2R4SH 3UTQB 1MIMH 4QXTA 4E42A 1RU9L 3H7LA 5JORB 4N0UE 1J0HA 1UADC 1QFOA 1ONQB 2GCYA 3MRMA 5HDBF 4QRQA 4HIIA 1D5BA 4P3CH 4YHOL 4O9HL 2XFXB 3P73A 3D48R 3BWUC 4JKLA 1P4BL 1I9JL 1KUMA 5F1SA 1LNUB 5E2TL 3MA7B 3KLSA 5DD6A 4CADA 2BSTB 2HH0H 1GC1L 4EDWL 3VD7A 3UZQA 4M7ZC 4OCWL 5EBWA 2CUIA 4KPHL 4M7LH 5EUOB 1RPQA 5DJXA 2J4WL 5FGCB 3MRRB 4N8CH 2BSTA 3JWNC 3AREC 3MV8E 3SBWC 3CLFH 4OZFB 3VXMB 3PWPA 4BJLA 3PWLA 5C6TH 1T22B 3I6LE 3EO9H 5INDB 1INQB 4EOWH 5C9KA 1H3WM 1XF3A 1FBIH 4XNYH 1QFHA 2UYLA 2IAMD 5I74C 1PKQA 3RA7L 1GC1C 4XRCB 4U6VL 2YRPA 5GGRA 3QUYD 4UV4L 1WEJH 3NFPB 3MCG1 3KR3H 4PJ9A 1WBZA 1OL0A 5DUPH 1T5XB 5CBEA 4J4PC 2N4IA 4PJFA 5B3JF 3V6ZB 3FTGB 1OD7A 1MCFA 1FCCA 5D1ZD 3IDJB 2OCFD 4WEUD 3BP6B 4JO3L 1JV5A 1IRAY 3ARTA 1K3ZA 3AREB 3S97C 2WIIA 1QBLL 4OZGF 4JJ5B 35C8H 1P7KA 2QQKL 3V0VB 4HIXL 4UQ3A 1UEYA 2F15A 3CGTA 3RIFK 3RWGB 2JJSC 3SKNA 1C7SA 2DQIH 3NCFB 1QBBA 5FXCH 5IVXE 4R0LB 5IB5A 4G7YH 4XMPH 4F9LC 1AR1C 4ZSOE 1ZK9A 1XCQA 4KKCC 1T6WA 4HJJL 5HHOB 1RZIB 5ICXA 3NCBB 1Z3GL 1MRFH 5FYKL 4S2SB 3Q6FB 3MRBB 1B0GB 4HLZH 4OCYH 5IR1A 4ZMAT 5DJ0A 1FFQA 3HLAA 4KMLB 3FJTA 3L3KA 1XF4B 3V7AE 4YFLI 3DTXA 3O2VL 4YZFF 2I9LA 1FN4A 1R5IB 3VD3A 4EI5A 5FIEA 3IU3A 5HYQA 3EFDH 3L3KB 3QNZB 5GRUH 4P2YA 2ZOKB 3PQYA 2Z91B 3SJVE 1DVFB 2IMNA 1N64L 4FQHB 1MCLA 4MZ3A 2OZ4L 4NCDA 4I77H 5EC1A 4I8DA 3IVKA 1FG2B 3KHOA 4ZUVB 2C4FU 2EIDA 1CD9B 1IZJA 4LFHG 4ZSOB 3FKUS 1KEML 2YEZB 2PXYA 2YD4A 3WFBL 1KTLA 4OBRA 1QKZL 5CKGA 3VFTB 2WW8A 5K9KA 2F53A 1QNZL 4JY4B 1BIIA 5DZLA 2EC8A 4N8VB 3VWJD 2J5LC 4N90E 1NLDH 4GLRH 3WLWD 1D6VH 4P59L 4LCWE 4JKPH 4MNQD 1NCNA 1LK3L 1NGPL 2PTVA 3BKYH 3RGVC 4PD4K 4DZ8B 2G60L 2A6JA 2XXCB 1U8JA 1LMKA 1MSPA 2WBJC 4OLEA 4DKDC 5HYSA 4M1CD 3QXAB 2CD0A 4JY6A 3OKYA 1GSMA 3VFRB 1OTTD 1MI5E 3OKDB 5KSVB 4UV7L 5I1JH 4PRDA 3FO2B 1LO0H 2R39A 3N1MC 3TPKA 3K3QA 1A6AA 2IBGA 4G9FA 3IDGA 4PP2A 1P4IL 3WMSA 5CJOL 2EEDA 3VXME 4LAJH 3ZT5A 3KHQA 4DUVA 5C07D 4L29B 3T3PF 3F7VB 5E8DH 3U7AA 1P4LB 1WISA 4L1HA 4F3FA 3CUPB 2RCSH 4GOSA 4M7KH 1FNLA 5IM7B 4XP9H 3RHWF 2QLVB 5KJRH 3HC4H 1S9WB 2JJUA 2MHAB 1W72B 1CD1B 2XT1B 3D39D 3W11C 3GMLB 4G8EB 1TVBA 4A6YL 1E0OB 4POUB 2ZUQC 1AP2A 1J1XH 3VFOB 1TCMA 3ULVL 3PE9A 3TGXA 5EDXA 5KS9A 1G84A 3HE6B 4BQ9A 4TVPL 3DECA 4U6VH 4GRMA 2X1XR 3SDDC 1A02N 3GEWB 4YNYB 2E7CA 4OT1H 5L2KD 3HNTL 1M6OA 3RGVD 3QCVL 4QNPE 3MFFA 1RMFL 3MRKA 4MNHB 4X80H 3EOBA 2Q7YB 3O41A 3U4BL 2XTJE 4ZFOB 1UXSA 5IEHA 2X4QA 1EHLH 3L7EA 4RA3A 3RZCB 3EIFA 3LEVL 4LLQB 2ADFL 1EUTA 2VN4A 3ULVC 2EZ0C 4L5FH 4OF8A 5C0RH 2QHRL 3ZYZA 4I77L 4PRIA 4QEGA 5H2BB 4OQ1A 4KI5F 4PJBF 1KJVB 3SGKC 4HK3N 2NW3A 3LH2L 4M7KL 1CXLA 1WJ3A 3FFCB 3W9EA 1FFOA 1Z0NA 4KK9D 1P7QA 3TM6A 2DLEA 4Z18A 1U8IB 2P8LB 5D7LD 4TUJA 3N9GL 3U46A 1BF2A 2OR9L 1TETL 1XGYL 2EDOA 2D3VA 1KLUB 3MNVA 2M8XA 5IMLA 4NO2B 3ARBC 5JHLH 4PJ9B 5KVDL 4WHCA 1UWEH 4U1NA 1AR1D 2OR7A 1G9EA 5K9JH 1K8DA 1IE5A 1CFTA 4LU5H 1YEEL 1X5XA 3GRWA 3NGBC 5F9DC 4HK0A 3BJLA 4BM7A 2I5YH 1NCWL 1BLNA 1HHGB 4HS6A 4NP4H 3RWDA 1CE1L 1CLZH 3KDMA 3O6MH 4LBEA 5EU5A 1EAPA 2F5BH 1PG7X 5IWLC 3GSXB 4QRPE 5KVGH 5ITFA 1GXEA 1L0QA 5HVFB 1LDSA 4LQFH 4XWOD 4J7RA 1AD9A 4MA3A 5HDLA 5FKAB 1BJ8A 1HWHB 4QTHB 1V7MH 1S7UB 3FB7A 1OW0A 5IUSA 3V4UH 5F93C 4KGJA 2N7BA 5E94A 2BNUA 2MNUA 2HJFB 3IDMB 3T4AA 3OKMB 3O8XD 1NFIA 1LEGB 1YNKL 3TO4B 4G8GE 4HZLA 2CSPA 5I8CB 2QQQA 4FXGB 1H5BB 1N6UA 3JV5A 5CJQL 3CSGA 3LKOA 4GW5A 1AC0A 5BZDB 1A5FL 1KBGH 3ROOB 3ZKXC 3MLSH 4OQTH 2H32B 3UTOA 2BNQE 2XN9D 4FFYL 1RIHL 4MB4A 3D39B 4U1IA 1G0YR 4EKXA 4K3EH 1GC1H 4CW1A 2EYTB 3MCKB 4XBEH 3KJ4C 3DV6A 4R2GB 4AEHH 4MJ6A 3QUXC 4Y16A 1S7SB 3VGAC 3FO9A 1DVFA 4GW4B 5HJ3B 3GMPB 5DVOA 5DHVB 2D7PA 2ZOLB 1H0DA 4K94L 1B2WH 3U30C 3GMRA 4AENA 2XQBH 2WP3O 3TO4C 4CVWA 2EH8L 1ODAA 4GW1A 4QGTA 3IDIB 1I9RL 5FV1L 1J05B 3MMEA 1H5BC 4JQVC 1A4JB 1TQCC 1YJDC 3U1SH 4QYOB 5BW7C 3NIFE 5MEPA 4I1NB 1Y0LA 3RZCD 4WW1A 3ARVA 5C09E 4K7FA 1K5NB 4Y4FD 4KUCF 5GXBB 4ZS7L 3ZHDA 3QNYB 4DJMA 3D18B 3VGAB 1U58B 3SCMC 2P8PA 3IFOA 4MNQA 4R4BA 5GGSY 3U82B 4DZBB 5IB2B 1ZLVK 3NCCB 3LEYL 4XVTH 5E95B 2IADB 1DANT 3WSQH 4MMXC 1RJCA 2EYRB 1JPTL 2R9HD 3UXFA 3ET9F 1L9NA 3DLQR 5IW3A 3IFLL 5INCB 4D0CB 1WAAA 5T1DL 1J88A 5JDSA 1B4RA 5MEOA 1EGJH 1UJTA 4KK6C 3BGAA 5IV2A 1I7TB 4GRLC 3TCLA 2CXGA 3SBWA 3LDBB 1A4KA 25C8L 3BP7B 4J6RH 3HE7A 5DTFB 5I6XC 4QOKB 3NZ8A 1NCCL 4IOIA 5EU4A 1FE8L 1KIPA 5GRVK 1EO8L 1NDGA 3WFEL 3X3FH 3PQYE 3BP7A 3KPMB 1KPUB 4E41E 4LEOA 2R0KH 1I7RB 1ZANH 4IIQA 4U4BA 4ELKB 2RAMA 4KI5C 5JHDA 3OR7A 5IHBA 3Q0HA 2FR4B 3EFDL 2C1PA 4ZXBC 3F58H 5EIQA 4TRPL 4Z0XA 2DKMA 4ZAKC 4WUUD 5JXAH 5DVNA 3UPCA 1T80A 3RKDC 4R6UA 2G2RA 4L4VE 3VXRB 5AD0B 4MXQC 5TQ2L 1T5WA 2K3TA 1YN6B 4XC3H 2BSSB 3C5JB 3EFFA 2PO6B 4H26B 4YIQA 3QIWB 3HPLB 2FYYB 1VPOH 4Y4HA 3ES6A 2FB4L 1JPTH 4IMKA 1RIHH 2EDEA 1AE6L 3IDXL 4Y8AA 4ZTPH 5ALCH 1UACL 2VDKL 3SO3B 2Z35A 4MD4B 4MD5A 2K9UA 5CS7A 5DMYA 3MV8D 3O6KL 1DQQB 1KC5H 2X4QB 2ZKHH 3MJ6A 3OAUH 3DUUA 4QCIA 3PIQA 4JR9L 3CSBA 1V7ML 5F3HA 4UTBL 5IVOA 3IFNL 2AEIT 2VXVL 1PLGL 4NT6B 3F6LA 5FF6B 5I8EB 2GTWA 5C08B 2NNAB 3QYCA 4HIJB 5DLMH 2VABB 4LASL 1Z9MA 4TOYL 3Q1SH 1DFBH 4RFNB 1NMBH 4NC2B 4ZPTB 3AGVA 4NRZB 2OJEA 5JXEC 1T0NB 2H6PA 1E4XH 4UNTA 5DFVD 5SX4H 4DKFL 1SEQL 5JW4M 5IMLB 3FTGA 3BQUB 2FHFA 4QHNB 4GBXB 2F54A 3G6AB 4FZ8H 4QRTB 2P8MB 5BZWB 2PYEE 1WCQA 1AQDA 2R2BB 3O3UN 4Y5YA 4HH9A 4PJIF 1UH4A 4HIEB 4ODUA 4JFED 1WFNA 5DJ6A 2QBWA 5DC4B 3PHOB 5FYLE 2ICWA 5CIPA 4HV8B 4D8PA 5GGRY 4MDIB 2VL4A 2RB8A 3HFMH 5H37H 4KKCD 2ED9A 2CK0L 1WCBA 4K7PH 5F1IB 4FQXC 5DUML 1J1OH 4TTGA 4NNYB 4HV8A 1HQRA 5IESL 1UYWL 2APFA 2HVKB 3A6CH 3LS5H 4MVBC 4ODWA 4P3CL 3BYYA 3D6GA 2JIXD 3O2WL 5CILH 4N1EA 4JE4B 1XR8B 5GHWL 1C08B 1DBAL 1CICC 5DEZA 3O9WC 3UYRH 3H3PL 4QT5B 1GVIA 2R69H 2DYPB 2PYEB 1N59A 5FA3A 2QSVA 5LJYH 1BEYL 1KNOB 4HAGA 4XVJH 4A2LA 2VWEC 3IKKA 4Z5RA 1RZFL 5DJ0B 1C16B 2E9JA 5C0RL 3TT1H 4UQ2B 1MVUA 1UWGL 4G6MH 4YDJA 1EIBA 1QPPA 1KOAA 3V7MA 5I15H 5CJXC 2AXFB 3KLAA 4PUBL 4NOBA 3C09C 1X4YA 2PXYB 3VW3L 3HR6A 1JIBA 1T66D 4XP5L 5DJ8B 3HMWH 1OB1B 4NQDD 3SCMD 2N56A 2CQVA 2FX8L 3PDOA 1NCAH 3KPTA 4ODTH 3HUJE 4FQHA 2X4RB 5IK3B 4Y16B 4HAFA 3O3EA 5BV7L 2VZOA 2Y6SC 1A3RL 1KACB 3I85A 3VFSB 4EDWH 1YY8B 2EIEA 1QSEB 3VXRE 1OM3L 1PX3A 1DVFD 2PO6D 5DJYA 4NCC2 1JPFB 4NSKA 3S35X 3UX9B 1H8OA 3O3BA 2F19H 2GIYA 3TVMB 1RVFH 3PWLB 2FRGP 3MPCA 1MCRA 4YHOH 3SDAC 1P4IH 5IF0B 3I3BA 5F9JB 1G0DA 3BFOA 3I75A 2O61A 3KJ6H 3NIFF 1MIML 4RWHA 1CLCA 1ZEAH 3HE7C 1SM3L 3VRLF 4B0MM 2NY2B 4CVZB 3IFOB 4MNQB 2DB8A 2J7LA 3Q5OA 2R29L 2IPKA 1D5MA 4X7FC 2Z31C 1E6JL 1P4LA 4F3FB 4YDIL 3X11B 4JFYB 1CBVL 4KK8D 5ESVA 3H3KA 1G9ML 3R4DA 4HG4K 3EDEA 3DO3A 3QQ9D 2AS5M 5IJVA 2P4AB 1A6AB 3RWJB 2GSGA 4HZAA 1RURH 4I0PC 1MHCB 1RUAH 4KTEH 4JPVH 1QNZH 3NH7H 4ELKA 1FVEA 3QXTA 3MV7A 5K59F 4IOIB 1A6TB 4M48L 4M62H 2CR3A 4XP5H 5K93A 1NLDL 1GGIL 1PQZA 4NQEA 3BIKB 2VXSL 5J8OA 1ZTXL 4YK4C 4UBDC 1FZOB 2PUQT 1H3UA 1U8JB 4OBSA 2DDQH 3RVUC 2XWTA 3D0LA 1LVEA 1RK1B 2A6IA 2R0ZL 1V7NH 4G80A 2X6MA 1GZPB 3QG6A 4M43H 4Y88A 3IXAB 3AB0C 3ORJA 5D7IE 1V3MA 4PYGA 3Q3GB 5FUOL 4O2FA 5E1HB 3TF7C 2O93L 5F6HI 1G6RA 1T0MA 3QG6B 2V17L 2C3XA 2VXSH 3HE6D 1OTTC 1PZ5A 2YRZA 2CUMA 1U8LB 5IJKA 1B4JL 4NO3B 3VGHA 5GGSB 1A9BA 5EBWB 2IH1B 4WW2F 4LOUD 5C0AB 4P3WA 4JFEA 3BVNA 1S9WA 3OJDA 1JI1A 4KUZL 3PP4L 5E99L 4HUVB 3H3BC 1MFAH 3JXAA 1E27A 4PGJA 5GS0C 4LLWB 2JELL 3SHSA 5HGBB 2DQEL 2YD7A 3I6KB 2BNRB 4DFIA 4MJ4A 1XH3A 3PL6B 3DO7B 4UAOB 3LQAH 1IGFH 4ZUUA 2D03L 2NY7H 3EZJB 2VZTA 4MS8D 1T22A 5D2NB 4AQOA 1IFHL 3TO4D 1M6OB 5HHPA 5J9PB 3C5SB 3EKCA 4M8VA 2XICA 4NN6C 4Z7VA 1CZ8H 3V4PL 4X5WB 2W9LA 4NYLA 4H88L 3SE3A 1MH5A 1JHLL 1Q72H 1WFOA 4O5LL 5HDQH 3SDXF 1UM6H 4QHNA 4PB9H 3PF2A 4I2XE 1WBXA 2HKFH 5HBBA 4NQUA 4HPOL 5L2KE 1KJVA 4NRXA 1TDQA 3HNVH 3NIDF 3PL6C 4CADB 1UG9A 2RFXA 2VDRL 1HEZA 3WJJC 1RURL 2M26A 2XRAL 4W4OA 3MLTB 5D2NC 2DIAA 3S3JA 3NA4A 1BX2A 1FYHB 3MOBL 3PXHA 3FQTB 1MREH 1NCTA 1BQUA 3FQNB 1KCSL 4ODSH 3QFJD 3BWAA 3GHEH 4OGXL 4N0FA 2XN9E 5C0CE 5JO5B 4P5MB 1B6UA 5INDA 1IGTA 4XZUA 4FZEH 1DQDH 1NGYA 1DZBA 4TTDC 2IALA 2C7UA 3Q6GH 2FBJL 4JFOA 5DD3H 4MQXC 2L0DA 1T20A 3S88H 2OL3L 3BHBA 1U8KB 1HHKB 3G6JA 1KJ3H 2LAGB 4WVRA 1BOGA 4UU9B 5IMMA 5DSCB 2HFGH 5E00A 3SJVD 3KXFB 5D8JL 3X12B 5EULV 2GT9B 3LAFA 3HC0A 2G5BA 1NBZB 5SX4I 1QFWM 4NKMA 5AZEL 2YZ8A 5JPNA 2DQJL 1GGTA 3VXSD 5MENB 5FO7B 4MX7B 2F58H 2DF3A 4XNXH 2IPTL 5D72H 3CVHL 5GRUL 1NAMB 1Y0LB 5CEZL 3JWOC 3MLRL 5D7IB 4GRLA 3BO8A 3MACL 4R2GD 1QRNB 1NAML 5LG1A 3ZT7A 2NPLX 5C0ND 2AK4D 4JO4H 3ZDZE 4M9PA 4Q9QL 2ICWI 5ILTH 4N0CD 2BXYA 3CFDB 2DI9A 3H9HA 1GRWA 2A1WH 2APBA 2A6KB 2HRPH 3UMTA 4KKBC 1EBAA 3UTSE 1S7TA 4B7LA 3WNPA 4X9BA 1FH5H 2VSDA 3G08A 3H9HB 4M9OA 5IV2B 3WFCL 3O11B 4HCRL 3CFKA 4RMTA 5BO1H 3ECBB 2EDXA 5DQDH 1MCSA 1JPGB 3KS0H 4CMHC 2EICA 3T4YA 5ANME 5E6ID 3CX2A 2HTKD 4L4TA 5ERWA 5GJTL 1S7XA 2R2EB 2V6HA 3VWKA 1FO0L 1MHCA 2CUHA 3UTTD 5IM7A 1QRNE 4ZPVA 2YEZA 3HHRB 1ZLWK 1BD2A 1S9YA 2YBRB 3VFVB 4HUUA 5F9OH 5FKAA 1W72A 2B4CH 4WENB 2WWMC 5EA0L 2A9NH 4IRSC 2AQ2A 4JM2C 1Q94B 2ARJB 3A0OA 1A7OH 4CUCA 2D7TL 5K9OB 2JJVA 4AY0A 5D5MA 2VZSA 3CZFB 1K3IA 2YK1H 4JFFE 3QHTC 4WO4C 2NR6D 3VG0H 4BFIA 4PJXF 3GK8L 1ED3A 1TTFA 2OSLA 4KRPB 3T77A 1ZS8B 1N5YH 4NWTL 2VDKH 1FZJB 3DGCR 3EO0A 3BPCB 1GZPA 4PTUA 5TGBA 4CMHB 5GJSL 4Q97A 1MCWW 3BMWA 4OZIE 2Q76B 3O4LD 1G1YA 1RK0B 2HFEB 4J3WA 4KXZH 2X7LB 1M71A 1YEJH 3B9KB 4Y7MA 3QJFB 5JQ6L 5EIVA 4J3VA 2DI7A 2BVTA 1KN2L 3P9LB 2IAMC 5B3NA 1RFDL 1UQSA 1R0AL 3UTZB 4CW1B 3KPRA 1TNMA 3L1OL 4PRPB 3VFPA 1S7SA 1EXUB 5F7FA 4U3HA 5KSBF 3O81A 1HINL 3DVIA 3T2PA 5D1ZB 4MJ5B 1RZ8B 3QWOB 3S98A 4DOHE 1I9RH 2J3SA 1TJIL 4LKCB 3FAXA 4EI5C 3EDKA 3RVXC 1RV6X 2CIIB 1S9XA 4NRZA 3T0EA 4MQXD 2Y6SD 1LO4L 5DRXA 4NP4L 4QYOA 3MACH 3IS1X 3UTTE 2W65B 1S9VB 4P2QB 2J8UA 4LRNH 4NO0A 4LSSH 3OXSB 2AJ3A 3PWVB 4LHUG 4LU5L 5BJTB 5AUMA 3IRZA 4I18B 2DJ4A 5ALBL 3RUGE 3SGDH 4MB3A 4PRPE 5KW9H 2EKSB 2DQFA 2B39A 5DURD 3AFLA 1PW3A 3KDMB 3TJHC 4WDIB 3V6OE 3CMOH 2PCPB 1WIOA 4IDJL 5JDSB 1YMHB 4LQFL 2WUCL 4OF7A 1HIMH 4DN3H 4IBLT 4AG4H 3QH3A 3BZFA 5DD6B 5CCKL 2QHLA 4YXLH 2EH8H 1CFSA 1MF2H 1EGJA 1ZT7B 4JZNA 1R5VB 2D4FA 3PHOA 1T4KB 1R5WA 1J18A 1RUPH 3T3PE 5T1LA 1XZ0B 1AE6H 4JREC 5GGVL 3GSRA 1I3VA 5GS2H 3WSQL 3PGDA 1BAFH 1T7VA 1LQSR 4IJ3B 3VRJB 4TUJB 4AEHL 4F9PC 2EXWC 5B39G 5FO9A 3EOTH 3WKMH 1E28B 1FVCA 4OCLC 3ARXA 4KK6D 1BFOA 3BXNA 2BFVH 3EYVA 1MJJA 4BFEA 5FFLA 3FRPG 2FJHB 4XRCA 5GGRB 1JL8A 4YH6A 3DVFA 4K23L 4OZHA 2A2QT 4TVPE 1U8PB 4JGMA 4LCYA 3D9AL 4JFDB 1T1WB 5JR1L 3MCKA 2NTFB 4GFTB 5CBEB 3U1SL 4LGRB 1DLHA 2V5SA 3V52L 2CJUL 4OZHB 3RWCB 4NC1E 4HIEA 4ODUB 4LKXA 4JFDA 1H3GA 4WEBH 1NFKA 2AQ1A 5KG9A 3SKMA 5I73B 5A16A 3P0YH 1KB5H 4LSDA 4IJ3C 5FO7A 1YY8A 3VRIB 5IFJB 4U2YA 1KFAH 5E2WH 2V9RA 5AAMA 3TJHD 3DUUB 1RZKH 4PTTB 4NO5B 5CP7A 1NBZA 1DE4B 1ITCA 3UBXI 2X2YA 3SKJL 3REWA 1FIGH 2ZUYA 1LD9B 3L3IA 5I74B 1MFEL 4KFZC 3MBXH 5CZKA 3I84A 5C0DA 4JO2H 5FYLD 3VI3E 2AJXH 5D7JA 3OAZH 4RA0C 4QXUH 5DJZB 3B9AA 3F65A 5EZLB 1UFUA 5I19H 4IS6B 1KNOA 4DAGL 1F4WH 2UYLB 1NGPH 3O3BB 5EU6E 3G5ZA 4OCSH 4PGDA 2DIBA 1JPST 4C56B 3LMJL 4EI5D 5DMGC 1MHPH 4LQ1A 1XIWD 2GYSA 4RGOL 3RIAK 1KCUH 4NGHL 5EBGA 4PGDB 3T0EC 4PYHA 1KELL 3QZWG 4C56A 2B1AL 3DVNA 3L5WB 4J2XA 2CLZA 4QRRE 5AZ2L 2W0LA 3RI5F 3V4UL 3GMPA 3RHWK 2YOCA 1TITA 4D9RD 4YX2H 4PGZA 4TYUA 3VH8A 5BRZA 5I17A 4YXLL 1QO3A 3MRQA 2W9EH 3IAGC 1FYTE 3I3EA 1S7VB 3HRZA 1ZLVH 4OD2A 5C0AD 4J3OC 1NGZA 5JW5B 4LPCA 1MHPL 3BEVB 5EORH 5C0BD 4NUJA 3G9AB 1FVDB 3PQYD 1U3YA 3Q6GL 4OLVL 1A5FH 4KTDH 3BDBA 2YSSA 1I7RA 3LKNB 4QXUL 3OR7B 4Y5XA 4ENED 2IF7A 2NW2A 1NAKL 2BZDA 4Q0XH 1OTUD 3QG7L 4X4YA 1RI8A 4G3YL 2FO4A 2I60H 2A6IB 3DX8A 4NWUH 3OXRA 4W6XB 3O6LH 1DQQA 2A74B 2UVFA 2E7BA 2VDMH 4LCWB 1U91A 5T3ZE 2OI9B 1QFPA 4MNHA 3FO0H 4JG1L 5HHMD 1A2YA 4PJCE 1ZT4A 4ELMA 1YY9C 4WI7A 1ZLUH 1DUZB 4KQ4H 4NJAL 4WY7H 5E9DE 2NZ9C 3VWKC 3QDGD 4XPAH 1FZKB 3D69B 1BQLL 3BN9C 4M7LT 3WFDH 4CGTA 3V4PH 1X5LA 4UTAL 1SY6L 1DN0B 3QQ9C 4OLZL 5HSFA 3QI9D 1YC7A 2B4CC 3THML 4WHYH 5LAXA 3TBWA 4Q2ZA 1J8HB 2ATPA 2ZWLT 5IFAH 1HHHB 4FA8A 3MJ7B 4XPGH 3OKLA 4X6CA 3DROA 4LSRL 1WFTA 5I1JL 2G2RB 1PD6A 2K1MA 4Q0XL 1WSST 4JAMA 3K8MA 4KMQA 2F9BT 1G7PB 3W9DA 5T33L 3BH9A 2DD8H 1F5WA 3X13B 4R7NA 5DEGA 1I7UB 2R1WA 1NBYA 1KYOJ 3L9RB 3FO2A 1YC8A 1O7VA 2BNRD 5D6CA 3VFUB 4M8QB 5J6HA 3BEWB 4G6FB 4G9FB 5C09B 5J6GA 5GGVY 5MENE 5K9QG 1JMZA 1I3GH 1UEMA 1W0YT 4JFFA 4NFBA 3TZVD 1BEYH 1FSKB 2FWOA 2HJLA 3BGMB 4PY7B 4PY8J 3ARWA 1JYVA 3PV6A 4ZUSB 1U93A 3QUMB 2GAZB 4ONGH 4AIOA 1FIGL 3PXJA 5JPMA 3FQNA 4AQ1B 2UV3A 4U6XB 1FVEB 4S1QL 1UB6A 3ZE0F 1GH7A 3P4MA 5IROC 2VLKE 5HVGB 2F19L 1OOAA 2BVPA 1QBLH 5IIEB 3MJ9H 1R5WB 5I1LA 4NHCH 3UPAA 5JNYA 5AEAA 3QXWA 3MODH 4EOWL 2MQCA 3FMGH 1XF1A 1OTUC 4HIHA 4QHUA 3MFGB 3CXHJ 2E7LA 4K55A 2EIZA 4HMEA 1WEJL 4G8IA 2CXKA 4LLUA 3L5XL 1TZHA 1X44A 1AJ7L 3MRDB 4NO0D 4P4KB 5T33H 5DRZA 1HHIA 3L5JA 1JHKL 1CF8L 2G5BB 1BVKA 1ZWIA 4PJFB 3QWRD 3RWDB 3FQUB 4P2QD 1XAUA 3RZCA 3MLVL 4U7SA 4EDXB 4W4OC 3INUH 3UROR 2HN7B 2UZXB 3P0GB 4M6NH 4FP8H 3R8BB 3RNQB 1DDHB 3IDYB 4PJCF 1AO7D 5DK2B 1AXTL 1UWXH 2CKNA 3N1FC 3SQOL 5FCSH 2JKXA 1IAKA 1JPFA 1PY4A 4HC1H 1FZMA 1L7IL 2X4RA 5IK3A 2VUYA 4OV5A 3W5MA 3KXFD 3UTSD 2XPGA 3OHXA 1N6VA 5CEZE 5M94B 2EC9T 3CCHA 3U48A 1YNLH 4LCWD 5DFWH 3WS3B 3LPFA 3D0VA 4EI6B 4KUCD 1R3IH 3O2VH 1GAFH 1MCPH 4HKJB 4X8JA 4WUUB 1MIEH 1BBDH 3D85B 3L3DA 5J89A 1NCUA 1KPRA 4JN1H 3H9SA 3PP4H 4Y4KC 2Q7NA 3GHEL 3L5WA 4OGXH 3P4NB 3ZKSD 4YO0B 4K07A 1FRGH 3M1BA 3QIWD 3SE4C 2YPLB 1I8KA 3ULVE 1QSFB 2XZQH 3QDJE 1HCFX 3K2UL 4NQVA 5FUCE 1SY6A 2H2PC 1FG2A 4ZUVA 2G9HA 3BUTA 1ADQL 4Z7UA 5IT2H 3BISA 4UOW0 1AD9B 2YPLA 1I8MB 2H8PA 1G9NH 2LV4A 5C9JA 5IJKC 3T77B 2R1YB 1F4AA 2NX5B 4Z7UB 35C8L 2F8VA 7FABL 5F71A 4G7VL 3OB0H 3JWDL 1YZZA 3J8F7 4I2XA 4L8CB 1IM3A 1FORH 2FGWL 3QRGH 5EOTB 3W0WE 4Z76B 4TUOA 2VMFA 5MERA 2VQTA 4LLVB 3TV3H 1NUNB 2GY5A 4JRWA 1MWAA 2NCMA 4X9HA 3QI9C 4Y8DC 3VCLB 4L3CA 3L3HA 4QHMA 2X4PA 2VC2H 3SN6N 4M62L 1FFNB 1ZAGA 5DYOA 4X9FA 2ED8A 4XI5C 5J1SC 5F7WC 1MQKH 3RVTC 3BGFC 3C5ZA 5GS1B 1HXYB 1OWWA 4KQ3H 2OP4L 4RISH 3ULUD 4X6DA 2J2ZA 1WF5A 1S7XB 2CR6A 2E6JA 2X89D 4FFZL 2XTJD 4RIRB 1UWGH 5A2IH 5FKPB 3V5KA 1RIUL 2AABL 3E3QE 4JO2L 3MV11 3VGEA 2Q6WB 3KLHC 2CMRH 4ZFFA 5F9OL 1RQ5A 2HVJB 4GAGL 3RAJH 5BO1L 4FTVE 2J8UB 4NO0B 5SX5H 1H3PH 4PV8A 3C8HA 4LCCA 2AJ3B 1A6TA 1IAIH 4JFHE 2OXGA 5BV7C 4G6JH 3BIKA 2XQYK 3LV3B 3QHFH 1I1AA 4HGWB 2O26U 5IB1A 3CVHB 4XTRD 5J0BA 3GRWH 1CZ8L 3R1GL 4NC0B 4UT6H 3WEXB 4OFYD 3MGAA 5FM8A 1AKJB 3LKRA 2W65A 2VLJE 1G6VK 5D96B 3BX7C 3C2SA 1MH5B 2PO6A 5T3ZL 4OF5A 4AM0B 4F7EB 5D2NA 1CYGA 1H3PL 3GK8H 1F3DH 3MV9E 3DVGB 2WBWB 3WJJA 3WCYA 3WD5H 2YD2A 4QWWD 1JPGA 1ND0B 4PRPA 3VFPB 4LLYB 2OZ4A 3IU4H 3UO1L 4F7EA 5DDHA 1JGUH 5FGRA 2C3VA 2VAAB 5D1ZA 3QJHA 1R3HB 2E27H 5L9DH 3ZT6A 2XZQL 2DMKA 1J11A 2JJWA 1WZ1L 2DBLL 5IGXH 4G8FA 4JFQA 4M6OH 3E6FA 4YJZL 5D72L 3D25B 1AD0A 4U1SA 2WZPD 2P48B 5C0AA 3DRTB 1Q1JL 1CG9A 1RZ7H 1VEPA 3L5HA 4KZEH 4NZRL 4N8PA 3VXUE 4BFIB 3EYVB 1S9VA 4PS4L 4JPWL 3AUVA 2DIJA 1PAMA 2NY5L 4ORZC 1ZS8A 1A3QA 4JANB 4D0DB 3OF6D 4CU7A 5KAQG 3JV0A 2UUDK 2B8OT 1R3IL 5JXAL 5KZCD 4HG4J 3PWPD 4U1JA 3UP1A 4XBGA 1YMMA 3FOLB 3CJJA 3MRDA 4MHHI 2V2TB 4U1NB 5ISZA 3P30L 1IARB 4LVNB 4EN3A 2P44B 4IDLA 4LEXL 5EO1A 5B38A 1PJ9A 4YGVB 2CDFA 2X10A 1HYRC 5T5NG 1J87A 4K94H 4R96B 3QPXL 1A14H 1XGTA 4PJ7A 3QDJA 4OD3H 1MCEA 4BSVB 1GPOL 3GSXA 4KJQC 4PLNC 5H35B 3STZB 1LNUA 4QCIB 4EN3C 5IHUL 4OV5B 3GMQB 3TBVB 2Y23A 2AJYH 4OCRH 1NCAL 4GJTB 2YKLL 4LEXH 4X6FB 1NFDF 4X99B 1OQXA 3RWFA 1X3DA 4MZ2A 5EZLA 5CUSH 3VFSA 1JE6A 2MQ3A 4GBXC 1Z2KA 2AI0L 1IBGH 1Q9KB 3MLYH 4QHKJ 4D9QE 1U6AH 3MRLB 1A47A 4LF3B 1QRNA 4W6WB 2VRAA 5E2VL 5I1AB 4MSWA 2R1XA 1IGTB 4JO1L 5C0GA 1R5IA 2NY1B 2CO7B 5F9WB 4NZJA 1P7HL 1I3GL 1U8OB 2F54B 3G6AA 5EU7C 1QYGL 4I0KA 4PJHF 4P46D 3OKKA 4I0PA 4OCXH 3X14A 5ICZA 2DQHH 2PYFB 3VH8B 5IMMB 4XP1H 3ECBA 3HG1D 4QO1A 3IVKB 2AABH 3HC0B 4PJHB 4TVPD 1E4XI 5T3XE 4TNWK 2GJZB 4U05A 5DUMH 2Q87A 5I1CH 1NCWH 1X5AA 2P7TB 2H1PL 4WWKB 5J11B 2Z8VC 3RVWD 1Z5LA 2HT4C 1VPOL 4KV5E 1I8MA 2FSEB 1YQ2A 5TDNB 3T0AA 1E28A 4GKZB 5EIIB 1NFDB 1PZUB 1TLKA 1J1PL 3DPBA 2PTTA 4S1RL 2X7LA 4OF6A 2C1OB 1J8HD 3VA2C 5MEQA 1VA9A 3VFRA 3BAEL 4GQPH 4NNPH 5DYOB 3IU3B 1CDUA 5HHME 2SEBA 3C5ZB 5GS1A 2WANA 4U1MA 3AVEA 4NQSB 1MFBL 3QDGE 1XF2A 3QUML 4NGHH 2KUTA 4O58H 4H8WC 1RMFH 4OFKA 3QEGL 1G7IA 4O2FB 5GRXG 1P84J 3NA9H 4K71B 1SYVB 1UH2A 1EHLL 3SDDA 2FX7H 1P5UA 4S0SD 4NO5A 1DN0A 2FIRT 1VGKA 3VFTA 3TN0B 3TZVB 2EXYC 2GY7B 1OGAE 1SJEB 1QOKA 4F33A 1D9KD 4K3DH 3PHQB 3ARYA 1I8IA 3FQRA 4G6ML 1MHEB 4NQEB 1IQDB 1EO7A 1GGYA 4XNUL 5IHZA 4P46A 5AUMB 3SY0B 4AIZA 4H8WL 1FNEA 5IF0A 2XZCL 3W0WA 2XWTB 3SOBL 3KYNA 4RBPH 3F12A 4GRMB 2W9EL 1SJHA 1A1OA 1EEYB 4WTXA 3AXLA 3VXRD 1FNEB 3LQAL 3I9GH 1AFVL 1KPVB 1QFWL 3GIZL 3MFFB 1QQDA 1A9EB 1TJHH 4HKXA 4RAVB 2J6EH 1OM3H 2LTQB 3QIWA 3FFDB 4Y19E 2BVQB 2IPKB 4E5XA 1KCUL 4XX1G 2UWEA 3WJLC 5DHVH 3UJIL 5DMIH 3VU2A 3QPQD 5GGSA 1B0WA 4ZFGL 3CDFA 2JB6B 8FABB 3UZVB 4DAGH 4NCC1 4X4ZA 4Q9RL 5C3LD 3EOAB 1AO7B 3QUKB 4NWUL 4I3SH 4RGNB 6CGTA 3G5XB 5ACZB 4JANA 4D0DA 1OTSC 2AK4A 2GAZA 2DQCH 2X4TA 3DRTA 1VFBB 4OZIF 2BC4B 3HS0A 4RBPK 4YFLF 1BZ9A 2VLMD 1S8DB 2AKRA 3KPSB 4KTDL 2Z92A 1AH1A 4J3XA 4LL9A 4I3GA 4X98B 4OD1L 1R3LB 3MNWB 4OLXL 2AKRB 2AVGA 5ABDE 5EZOL 5T1KA 3D39E 5FYLH 4DEPC 4P2OA 4Q6YA 4J23A 3EOYG 3HC4L 4KKLC 3QWRA 3ARGB 4M48H 1R3KB 4ELMF 3OR6B 1ZVHA 5GHWH 4CNIB 4M7JH 3OGCB 1CDBA 4QRRA 1Y18B 4IRJC 2AK4E 1IGJA 5C2BL 3OMZA 2DOCA 1OAQL 2ED7A 3OGCA 3P9WB 2P5WD 2GT9A 1UB6B 4RGOH 2AEPL 1ZE3C 3MV7E 5CP7B 3DI3B 1S9KC 1N7ML 2NX5D 3MNZA 2HJFA 5EZJA 3LS4H 4UOJA 2ENSA 1BVLA 4X99A 5E6IA 4PP1C 1Z9LA 5DFTA 3GKWH 1A6WL 1GGBH 5JORA 3FMGL 3FOMA 3G04B 4FABH 1N0XL 4LASH 4IIQC 5C86A 1IKFH 2X4NB 3FT3B 4EIZC 2GUOB 3IDUA 2NZ9D 3LVEA 1KTRL 1FP5A 2VE6B 3QCUL 1V8HA 5AZ2H 3NCEB 1PKOA 1BQHA 2IANE 3N1PC 2VB5A 3RUGF 3NFNB 4Y1AA 1KJMB 3LD8C 4WTZA 2DDQL 3FAWA 2BK8A 2ZCKH 5ENWA 3WFHB 4KZEL 3HE7D 4QRRD 3IFNH 3MRRA 3RDTB 4LLDB 2VXVH 4O2EB 3GSQA 1AXTH 4HDIA 4U1KA 5ESAA 1CS6A 4ZOCA 2NLJA 3ILQC 2EE2A 3DOSA 1A7NL 2NTSP 3BSZH 4MAUH 5LGHH 1CFVL 1HSAB 1QVOA 4JKPL 1CGVA 4K23H 3V6FA 1ZLUK 5MI0C 5ANMB 5L88H 4XB7A 2BY3A 1MFDH 5TFSH 4JRYA 2OLDA 2P5WE 1D9KC 4X4YB 1JRHH 2FHCA 3RVTD 5HYSB 4L3EB 4HBCL 1A14L 4Y5XB 1PKQB 1SM3H 1FNGA 4M1DH 1Q0YL 3P77B 2XTJC 1AHWA 4FMFA 4OLZH 3WHXA 1EA9C 1C1EL 2BP3A 1KV3A 3AU1B 1LGVA 4PRHE 3TCLB 4WCYH 5ITBL 1P84K 2JCCA 4K7PL 5MI0B 3L1OH 1NLBH 5IJVB 4DQOH 1MOEA 3SPVA 2BOCA 4FQLH 2Y4SA 4PGCA 5FGBC 43C9A 4G42B 4M4PA 1QTYT 1BM3H 3KPPA 4HGWA 3MLSL 3NBNA 4KH2A 3JZ7A 1CD1A 4Y5XC 2V7HA 1PVHA 5GRJH 1OP9A 5JHDB 3QDJD 3W0WB 3N06B 4N68A 2H32H 3U2SB 4TUOB 4WW1B 1IQDA 4LAQL 3BPOB 4XCCH 2Q76A 1RZJL 2M1KA 2DQDH 1IKNC 4LGPB 1BHGA 5CZVL 5B38G 5DQ9B 1JNHB 5HHVL 3NAAL 3B2VL 3P4LA 1M7IA 3CPLA 2YPKA 4M8QA 5DDHB 2P24A 1XGYH 5AG8A 3LKSB 4RRPG 3P4NA 1JNHA 1UZ6F 4M7ZB 2EIBA 1FORL 1ITBB 1NMCC 2FGWH 3QRGL 4JFFB 1T1YA 3EUUA 1QBAA 5GGTL 4WCYL 1MLBB 4WO4B 5DQJB 3WE6A 3WDIA 4C55A 2X9XA 5ADOH 1S78D 1PG7W 4ONHB 3QUKA 3QHZL 2X4OA 4KVCH 3ZE2F 1BECA 1S9XB 1UA6L 1N8ZA 2ZCHL 2CK0H 2DLGA 1U8MB 4DGIL 3LS4L 2ILLA 5I1HH 2VZVA 3NMEA 5IBLC 1PYWA 4OZIA 3FN0L 2V2WA 3QEQE 3S4SA 4UOW1 1Q9LB 5IVZA 1FRGL 1J8HA 2VNCA 3BOVA 3WEXA 4WI8A 4P2RA 1J5OH 1NKOA 5D1QB 5F88A 5FK9A 2VLRB 4M93B 1ZKAA 3WKML 4FQ1L 3RDTD 2GK0A 5GSRB 3QQ4A 4DW2L 2DAVA 3PP3H 1AXSA 4E42B 2DQFB 5T3ZH 2HT2C 3GM8A 5DEGB 3CXDH 4AEFA 3CVIH 1UM6L 3UTZA 4G9DA 4C56D 3NIDE 5GS0H 2P1YA 2QADC 3UDWC 3QDHA 3C08L 4L4VA 4KAQH 5IMOB 5AYQA 3GMQA 3TBVA 3JV6B 4LBEB 4PV9B 3V0AC 5D6DA 3E2HC 1O7SA 4LCIH 1CGUA 1N3NB 1PEZA 4G8FB 2CDFB 1AIFA 2MHAA 1CFSB 4ELME 3RX8A 4ZDHA 2QQNL 1MI5B 2VDML 5TF1H 1AP2B 2W9DL 1T04A 3K74B 5IB5B 4D2NA 4RFOL 1UJ3A 1M7DA 2D7MA 4WWKD 1R6VA 3VDAA 3OTTA 1KCSH 4LRNL 4O02L 1T04B 4C4KO 4I48B 1FNFA 2PF6A 4LSUL 4APQA 4NQCB 4PJBB 3RWFB 4XC1H 3MA9H 4M61A 3GM0A 2V2TA 2A9ML 3E6HB 4GXUN 5EOCJ 1UCTA 3EYSH 4CVUA 4RGND 3VRLE 3KWWB 4A6YH 2JB5L 1TCRA 4D9RE 4WFGE 3U9PL 4YHNB 1JWSB 1CL7I 3UTQA 3D39A 5JUEH 1RIVL 1EFQA 3TLRA 1XGTB 4PJ7B 4R8WL 4WW2C 3P4OB 2OL3A 5D2LB 1G7MB 4X7TA 3LIZH 1JZ3A 2XKUA 1FH5L 2RQ8A 5BVJB 4MDIA 5ADOL 2B1AH 4FQPA 2QADD 5IEKB 5F1NA 4I9WD 1YEGH 1LO5A 1RUKH 2YA0A 4C56E 3D3VB 3O2DH 4C54A 7CGTA 4FQIL 1ZT1B 5T1LB 3MXVL 4C59B 2R8SH 2IBZY 4LLDA 4O2EA 3VWKD 4HEPG 4KJQD 3QO1B 1LEKA 2ZUUA 4L5FL 5IHLB 5MEPB 2NY7L 4ZOBA 2JIXA 3UC0L 1C08A 1JWUB 2AV1B 1DBBL 3JBG7 1FC1A 4ZTOH 4HUXB 2DQGL 4J8RB 5BS0A 5H8DA 5T3ZD 4JDVA 3MO1A 3RL1B 1T83A 1U3HD 4XNYL 5K59E 3HR5B 5E8PA 3RU8H 3ZSTA 3ARQA 1GGUA 3JV4B 2ZOKA 3PQYB 5I8KH 1OF2B 1WC7A 3TH3T 1C5CH 1AGFA 4L9LB 3FQWA 4OCXL 3ZE0E 4HK0B 1CDCA 2DL9A 1U95B 3O45B 1FDLH 2YHGA 1QLEL 4P2OC 3WDJA 1MELA 5CHNB 1H8NA 4XWGH 3KPRE 4KZDL 2G9HB 4YUEH 3RNKB 5E6ZA 1INEH 3CFCL 3QSKB 1OHQA 3TEUA 1I9JH 2VN7A 4PGEA 3U6RB 3TH4T 3DIFA 3SDDB 3UAJD 4YEFA 5K9OA 5KANI 1HE7A 4JZJC 4R4ND 4U1GC 2WUCH 1X5GA 1CTOA 1XIWA 3QCVH 4FQXA 2BNUB 3T0XA 1IM3B 5I19L 5F9JA 3I2CH 5DUPL 4PREA 4Q58C 5DO2D 3VXQB 5IKCB 4KY1L 1S7RB 4M5ZH 1BF8A 1MRFL 3ME0A 1NCDH 2SEBB 2Y25A 3BIBX 4FXKA 5BS0D 3FO1A 3TYGH 3ZLQC 2VR9A 4F9LA 1JF5A 3AS3A 1FO0B 1QSED 4CDGC 5B39A 5DK0B 2WUBH 4WFFE 5EC2B 1BD2E 5JXED 4UDUB 3MV9D 3L7EB 1OP5K 3O6FD 3GI8L 1UT9A 3FFCE 2XKNA 4H88H 5L8JB 5EU6D 4GW1B 4JZJA 4G8GB 4GKNB 4MWFB 3RJQB 4XXCA 3DSFL 2ZOLA 5BCAA 3OJDB 3GSUB 3TIEB 2D03H 4QRSB 4KDWA 3CDYA 3U0WH 4PJ9C 5I75B 3CFEB 1TVBB 1Y6MR 1C5DB 3DYOA 3IDNB 5F7DA 1BQHG 4X6CF 4PJ5D 1XGPB 4PJ8A 5FK9B 2QL1A 2EH7L 1KELH 1I1AB 4X6CB 5IB1B 4F7CA 4OCYL 4K2UL 1FL3B 1X9QA 4KJPD 1ETZB 3DWTA 3ARGA 2AJZB 3ALWA 1QQDB 3BKYL 1EHNA 1BJMA 4OLWH 2XQYG 4L8SC 3RL2B 3T04D 3PGFL 1DQLL 1I8LC 2WUBL 4NN7C 1CLOH 1F6FB 3T0EE 5EORL 4ZFOA 5IEHB 3L6FB 3FB6A 4PJ5A 3MGTB 4YBQC 2FBOJ 4DKEH 3T0DA 3BP6A 2VSCA 1YPZF 5DJ6B 1RZFH 4FOMA 1KB9K 5DT1L 1F45A 1F58L 2R29H 2VLKA 1E6JH 3E6FB 2DQIL 2Z31A 5D9SB 1W8OA 1V7NL 1QYGH 3G6JE 3MLTA 4L8BA 5EZJB 4Y19D 4D94A 5B8CB 1M05A 1UM5H 3U0WL 1WWBX 4XAKE 3P40A 6FABH 3QDAA 1MLCA 2HP4A 3GFUA 3GSNB 3GSRB 1K4CB 4L8SB 2ICES 4XNUH 4GG6F 2LVCA 4NN7B 2KDGA 3LEVH 4QRPB 4QHUB 5D7SH 4HZLB 4KHTH 3KJ4B 2ERJC 4YE4H 1L6XA 4DGYH 5E1AB 5ISZB 4Y1AB 5I8KL 1G0XA 2Y5TB 3BRGC 1N5AB 3VXRA 4IOSD 4Z5RB 3HNTH 3U30B 5KVFH 4XVSH 4PJAE 1RJLB 4MAYD 3TH2T 1CLOL 2LFGA 2X4NA 3C60C 3MLWL 1IC7H 1VACA 2XWJB 3FO9B 4LVEA 5L2JB 3S37H 1U92A 2FX7L 3EJZC 1EVUA 3C9NB 5EC1B 2Z35B 1J12A 2FWOB 1KIRA 3VRIA 2OL3B 4GG6B 3WFBH 3D85D 1TVHA 3WIFA 4IOFC 3OWEA 3GMRB 4HEME 4PRIB 2B1HL 4WV1A 1U0QA 2ZJSL 2DL2A 3QULA 4C83A 3VJ6B 2BJML 2PTUA 1J1PH 1T89A 3T0WA 4U3CA 1KT2A 4CJ1A 4OI8A 5C0DB 2VISB 2Z8WC 4GRLD 5C0AE 3PABB 4X5XB 3ZTNL 3BWAB 1TJGH 2NLJB 2C3GA 3UTSA 5J12B 1YPZB 4XPBH 2J12B 1X7QA 12E8L 4YHPB 3ULVF 2P43B 1DUYB 5HGAB 3P0VL 5CP3A 4Q6IA 2ZUVA 3O4LA 2NY5C 3D85A 4UINH 2NY5H 3B2UC 4Y4FA 2ICWJ 2VLKD 1MHHA 1NMAH 4NKDB 1AKJD 1YPZA 4XXCC 3LMJH 1HDMB 3WUWG 2DWEB 2NX5E 4QF1A 3EJYC 3IDJA 3CFKB 1TTUA 1ZGLB 3G5VA 2D7QA 5C2UB 5HYIA 1VESA 5I8OL 5HHQA 4HXAH 3SKNB 1WZMA 2E3VA 2E9IA 2VLJA 4G43A 3TA3D 1EK3A 1Q9WA 4RZCB 5CLWA 4PJ7F 4YLQT 1B6DA 1JV5B 3S96A 2DBJA 3QQNA 4PGBA 4ODWB 3ARED 3K4AA 4BH7A 1FYTA 2HWZL 4HPOH 4KDTA 1MFCL 1D7FA 1NUGA 4JQIL 4NNYA 5D7IA 3TZVA 4U7MA 4Z95H 4NHUB 4XCNA 3U0PB 5IW6B 1BZ7A 1YJDH 3H9SD 5C6WH 2CIKA 4KRNA 4X7SH 4JRXE 5DQ9A 3FQRB 3MRJA 5EZIH 5HHOD 1M7XA 4M1GH 5JA8B 5LXGH 2YKLH 1CU4H 5HY9A 3OKMA 4JEGB 1FGVL 3TPUB 2AXFA 3KLAB 5FYKD 3VCLA 3L3HB 5B39B 3MLYL 4ZNCD 4PIRF 3VXQA 2AEWA 3O8XA 3ZKNC 4PRAB 1MEXL 4DVRL 3EO1B 2UWEF 5M95B 4FXKB 1MLBA 4NQSA 5IOPB 1BPVA 1I3RA 1IQWH 4XCEB 1HSBB 3HAEH 2ICEA 2FIKA 3MGOB 3ARBA 1JPSH 4JY4A 5D7JC 4R90L 2UUDH 2W07A 3LZFL 3C2AH 4NSKB 3CIQA 3T09A 4KXZI 4I5BB 1MFEH 1T83C 4OFVA 2Q8AL 4G8GA 5LCVH 1E4XL 4NT6A 2DM7A 2EO1A 2IPUK 2D7OA 1XF5B 4U6TA 3BQUC 4POZD 2PW2A 4BK5A 3SKUD 3TFKC 4JY5L 1A3LL 1S3KH 4F7CB 4KKAC 4NZUH 1IGFL 5E4EC 5GS1C 2B5IB 1HI6A 4PD4J 4MQ7B 1JNLL 2BMKB 4ONGL 2NXZC 4QOKD 1T5WB 4PLOB 3ARSA 3DBXA 1A7PL 1L0XA 3C5JA 4H26A 4PJXE 5JOFB 1V3JA 2Q86B 1ND0A 1XCTB 1FBIL 4G9FD 3ZL4H 2ITDA 2NXYD 2O5XH 1QLFB 5I8OH 4KRPD 1RIUH 5D71L 1D5MB 1CFBA 5KVEL 1A7QL 4NIKB 1C7TA 5EU5B 1NH6A 3NAAH 4FZ8L 5BV7B 2I9TA 4L8BB 1IM9A 3HZMA 4P5TA 2R2HB 5T1DH 4QY8B 5GZNC 5DI8B 3QZWB 3MTRA 1TZIA 4JDTL 4HUWB 1IQWL 1UA6H 1KCKA 5C0EA 4DTGL 4MNQE 3LY6A 3FQTA 1M05B 3MV9B 3B8YA 3BD3A 5J3HD 2DLTA 3I9GL 1YJDL 5EU6B 4NBYB 1G7LB 5JO5A 4P9ML 4APQD 3HNSL 1MI5D 3OF6A 1MCHA 1UJ3C 2QSQA 1JWSA 2QEJA 3HG1E 5GSVB 3QB7C 1OD9A 5DEFB 4JCLA 2WINB 1MVFA 2R4SL 5EO1B 4OKVA 2P8MA 3QEQD 3JUYA 1A9BB 1QP1A 4R96A 2HFTA 5DJ8A 1A64A 2HT3D 3UZEA 4BSWB 3OAYK 1AY1H 3DX6B 5E03A 5IGXL 2DI8A 2GJ6A 3QH3B 4R90H 1DDHA 5JW4Q 3JWOH 4Z7WA 2MOVA 2CRIA 2VXTL 5C71A 1UJ3B 3U7WH 4HJ0C 2BNRA 2GK2A 2EXYD 3M45A 2AJSH 1RJYA 3QULB 2Z8RA 2NY2C 4XNQA 2HG5B 4J3SA 3C6SB 1Q9OA 1H15B 4OLYL 4XBPA 5FCUL 1X5KA 2FATH 4TRPH 3MJ9L 3BP5A 1K4DB 4QNPF 4EN3B 3K8LA 3RI5K 7FABH 1G7QA 4IEFB 3RVVC 2KQMA 3RWEA 4MJIB 3ZKMD 1OQOA 2W0KA 1MFDL 5TFSL 3H42L 2CMRL 1Z9SA 4XCFL 3G6DL 3B2VH 1MQ8A 3FB7B 1MI5A 2ARWA 3C5ZD 4N9GB 5DTFA 4HK3J 2JCCB 4FQJH 1P7KB 3V0VA 3DX9A 5DUBB 1F90H 1NC4B 1LK3H 2GJJA 5F9WC 1JGEA 3TT3L 2BRRL 2VZUA 5CINH 5CSZA 4UB0L 4PGEB 3U6RA 4MJIE 4ERSH 4L8CA 1CGSL 1NFDA 4LPUA 1JYNA 3ISWA 2FEEI 4NHUA 4XCNB 5KJRL 2NMSA 2B2XL 4RMVA 3FFCD 4GRWB 4H1LH 4WNQA 2DM3A 3MUGA 1PG7L 3GKZA 1F4XL 5J06A 1CCZA 5D7LB 4QHMB 5E8EB 2XKNB 4CMMA 4GW5B 1YN6A 5BZDA 5D4QA 1ACYL 4NJ9L 4WWKC 3S36L 3OJMB 3V8OA 1R3JB 3UTPE 4LFHD 1TJHL 3HUJB 1JWMA 4FG6C 4YDJB 4MQTB 1QFUH 3U7YL 3KPRB 1FO0A 4N9OB 1I9IH 3VA6A 4RQQA 3HZKB 4Z7NF 1WZLA 5GGQH 2IBBA 2B2XH 1T1ZB 2UZIH 4MDJB 4PG2A 3SGJC 2IQ9H 1RZ8A 2YUZA 4RNRA 1H0DB 1FFRA 3X3GH 3MZTA 4JPKH 4XCYB 3SCMA 1BWWA 1QEWA 4GKNA 3PGFH 2FO1A 4YDVB 3MROB 1J05A 1ZHNB 3O6FB 3PHSA 5I8EA 1FNSH 4NFCA 5DWUH 4KJPC 3C5ZC 4XVJL 1HI6B 5HYJB 2NY4B 5D7IF 1CXKA 4PJEF 4YXKL 4QRSA 2DQGH 2FB4H 4G8GD 5JTWA 5E8OA 3IXTB 1Q9LA 4CAGA 2UZIL 4X8XA 2CKBB 1W2KT 5JOPE 2QJDA 5HYJA 3K46A 5D6DC 1SQ2N 3IS0X 4P2RB 3W9DB 2V5MA 4JPWH 4AK1A 4K71C 1WITA 3F6IA 1DEEB 5EU7E 2P42B 1CIUA 4J4PD 5FECB 1ETZA 3BP4A 1PSKH 2UZYB 1AQDB 2R2BA 1I4FA 4L4JA 5I2IB 4MXWL 2KZ1B 1I85A 5CJOH 2OZ4H 4P3DB 5TQ0L 1BVZA 5GGTA 4PJDA 4OUOA 1PKQE 2CDEB 4X9IA 3IYLW 3D69A 1ZT7A 4FN0A 1YEHH 1L6ZA 4HUWA 5C0EB 2X89A 4FFVC 4XP1L 1S8DA 3LPGA 4JPVL 3MV8A 4W81A 1DTUA 5IBUG 5C07E 4ODXB 2OJZL 5F1KC 4LVHB 2FR4A 3RBGA 3KYNB 3GSNA 3P9LA 3L7FB 3QFDB 4JKMA 2C7UB 3DJ9A 5E2TH 3V5DB 1RJLA 3FT2B 1CBVH 1T2JA 3OQ3B 1HHIB 1Q38A 4G7YL 2GTZB 1BREA 1F4XH 1FLRH 4D0BB 3VXOB 3P4OA 1U92B 3S4SG 1MCWM 3ZKND 5E1AA 4YGVA 1NSNH 2FYYA 3MGTA 1YEKH 1CGTA 5C3TA 3HI5H 5T1MA 3P0YL 1KGCD 1FL5A 2XFXA 5FDWB 2XTLA 5EUOA 1RULL 1IKNA 5DO2C 1QBMH 3RU8L 5JA9A 3EYSL 3EYUL 5T3XD 3N0PB 5EOQL 3IKCA 3MA7A 4X5XA 4ZUTA 1WTLA 4M3JA 1ES0A 3X3GL 1JK8A 1WAAE 4RDQF 3PG2A 2NW3B 3DI2B 5SWZB 3WKNA 3NFSH 1E6OH 4HQQL 4DKAA 2GTWB 2NY6C 4XXDA 5AWNL 3B9EA 5MP6H 3NA9L 3RPKA 4Y4HC 4ZPTA 3W11D 4UNVA 4U1HB 5M7QA 4XPFH 4PJDF 3H2WA 4WHYG 2FX8H 4F7MA 4HCRA 3FN0H 4HX1A 3T2NL 2X1WL 3PDGA 1KEMH 2IPUG 2NR6C 3WUZA 2XZZA 3KWWA 1U2CA 1AR2A 4JDVB 1VFAA 4HH8A 4GUPB 5I66A 2QQNH 5E2JA 3KNBB 5DS8A 3RUGA 4ZAKD 4O4YH 4JZOA 2HLAA 4OZGE 4NQEE 4EQ3A 5KSBE 3SO5A 1ZLSH 3A6BL 1RVFL 5B4MD 2X42A 4XNZC 3CSYA 4NBXB 4XMKL 5CWSB 5HHQB 1S9YB 3FCTA 3VFVA 1NGQL 2J8UE 4HT1H 4MX7A 2DLIA 4OSUL 4JHAL 3UTTA 2D31A 1QPXA 2HT2D 3AY4C 4GAJL 3D3VA 5BVPL 3EOTL 3V5HB 3C60A 2VQ1A 1JYWA 5HY9B 4BQ8A 4HWBL 1UKTA 2DN7A 3EHBD 3IRPX 2WP3T 5F72S 4N90D 3PJSA 2D0FA 4RX4A 3UPRB 4YDIH 3VMOA 5HXMA 5IW6A 3VD9A 5L6YH 3KYOA 4WHDA 4OZGB 1NGYB 3GBNH 4UILH 3SKMB 5HYQB 4RCAA 3H9SB 4OV6F 3FO1B 1S78C 3DXAE 4O58L 5JZ7D 1ZVYA 2ENYA 5I18H 3WLBA 4DOHB 4YAQB 1LP9F 1YEGL 1F02I 1U95A 3WXWH 4NZUL 3C9NA 3QEHB 4FQ2H 3SDAA 4A6YA 4PJIA 4M00A 2FHBA 3KPSE 4WFHD 1R0AH 3REVA 1VGKB 4RQQB 5J13B 1I1RA 3WIHA 5JPNB 3VXUB 4GMTH 1EH9A 1OAKH 3H9YA 3IDNA 5F7DB 4YWGL 2YXFA 2FGZA 4IHOA 5I16A 5FYKU 5I71B 4NQED 2CPCA 2E6PA 4CN6A 3B83A 2EYSA 1I3UA 2DKSA 4WU7B 3MLWH 2WWKO 1JRHL 1FJ1B 1Q0XH 5MERB 1EEZB 2R0LH 3TVMD 2X4SB 3IU4L 5FYJE 5DR5L 1ZSDB 4POYA 3R8QA 3E8UL 5TE7H 1H3VA 3IDXH 4ZTPL 3DUHA 2A9NL 3R0MA 1GAFL 3ZSSA 5J13C 4LSTH 2LU3A 5FM5O 1J1XL 5DJAB 4XGZA 3WNKA 3MJGX 5B4MC 5C70A 1VB9A 4FRWA 4JREB 3ZKMC 5KVMC 1HNFA 4OI7A 3TWCH 1RHHB 5KVGL 5FYKE 4NPYA 5EUOE 3VFWA 3GSVA 3T8XB 12E8H 25C8H 4NZTL 4WGWB 3SPVB 4BFGA 3BPOC 4JQIH 3VH8G 3PNWA 2H2PD 3H0TB 3VFOA 3ARDD 1W0VA 3RVVD 1ADQH 4ZYKA 5FYJU 4HUUB 1S7VA 3KAAA 3HRZB 1CLYL 2BY1A 4FP8L 4PRHD 4DK6A 3CFEA 8CGTA 1RY7B 4XAKD 3D0LB 1ZHKA 2OMBA 4IOFD 2YUWA 1KPUA 5GSVA 1JYXA 4L9DA 3KPSD 4WFHE 5JNYB 1NL0H 3TESA 1RUQL 3C8DA 3IETB 2YWYA 2F54E 4NOFA 4U6HA 3ZKQD 4IMLA 4JFOB 1G7LA 1A7PH 4GAFB 4AH2B 4LLQA 1DLHB 5DD5H 1IVLA 3OX8A 4N0RA 2XG4A 2QQLL 3E6HA 4IMLB 3JUZA 5HYJD 4YBLB 5DJCA 1F6AA 2OR9H 1J10A 2X4UA 5DQDL 1MIEL 1UXSB 4BH8B 2I9TB 2HN7A 4P2QE 4R4FH 4UINL 3STZA 2AEQH 4L4VD 1JZ5A 4QHLA 5C0CA 4AT6B 3RY6C 4MD5B 3SE9L 1IAMA 1MFCH 2GFBB 4LLWA 1M7DB 2PW1A 3L3IB 2ADIB 1UGNA 4W6YB 3NN8A 3LB6D 2YC1B 5IW1B 5IVNA 1NBVL 3H8NA 1U8IA 2P8LA 5IVZB 1DUYA 3VG0L 2DKUA 3BZDA 4U1LA 4N1HB 4Y2DB 5LAXB 2VERN 1A6ZA 1LO3L 5EBLA 4X5WA 4HFUL 3BN3B 4QF1B 2OJEB 4YHLH 2DBLH 1NEZG 3TBTB 2H6PB 3LEYH 4PLJC 1CE6A 2VKXA 1JGDA 2NTFA 1UKQA 5GRJL 2ZNXA 3ARDA 1KTDA 3AS1A 1TZGL 3VFMA 1QKZH 1U93B 4LOUC 3VGBA 5CEXA 5JHDE 4PJHA 2QSCL 2CRMA 3HZMB 3RBSA 3WXVH 4GG6A 2CLRB 3LRSA 2X09A 3GSOB 4RZCA 4GRWF 4OI9A 1BBJB 3RGVB 3RRQA 5CSZB 3OKEA 1QR4A 3C87A 1TPXC 2ARJA 3FZUD 2CK2A 4UIKL 1F3DJ 3RTQD 3T0VA 4ODVH 5F6IB 4KMTL 1IGIH 4CDHA 3V5HA 4HUXA 1FLRL 3NH7L 3VRJA 4ZO8A 1W0WB 4U7KA 1BGXH 4CMMB 4K94C 1P2CB 2VR5A 3QCTH 4OLUH 2OI9C 4K8RC 1NFDE 3B9VA 3MUHL 2MPAH 2X40A 2DQTL 3P77A 1AGFB 2WBJA 2YD9A 4L9LA 4GW4A 5KN5B 2OTUA 5CEYA 2H2SC 4KQ3L 4QXGH 1A7OL 5J56B 4LSVL 4O00A 1YECL 5A1AA 5CD5D 3IAPA 3SGDI 4BUHA 4N8VG 4X7TB 1A2YB 3S3PA 4X6EA 3SDYL 1HQ4A 4JFPB 3F7RA 1KB5L 1FFPA 3UJIH 4GKOA 2IJ0C 1HH6A 4Z7WB 5DHVA 4WEBL 4F33B 1WFUA 1AGEB 3PDOB 4QWWC 1AQKL 2NXYC 4RMUA 3KPQB 1XCQB 4U6YA 2J8UF 3LN5B 3T65A 3L3OB 5DVMA 2CIIA 1OT2A 4I5BA 3D0VB 5IHZB 1XIWB 1FVDA 3W82A 1CL7L 2R0ZH 3AM8A 3QIUD 2AV7B 2FJFA 1A6PA 4QLRA 4OLYH 4P2QA 1U58A 1JWUA 1T7WA 2AV1A 1IJ9A 3S8WA 2IH3B 3FQXA 3DBXB 1S7WA 1K5NA 3WNNA 4KTYA 2V9QA 2ZUWA 3D87B 1XR9B 4ZS6D 5F21B 1B0RA 3NPZB 5EO0B 1JTPA 2BVQA 5CAYB 4KDVA 1HCVA 3BEWA 5BV7H 2K7PA 2A74A 1I1AD 4NPYB 5CP3H 1CK0L 3L95B 5CIPH 2A77H 4MNGB 4XCFH 1X6LA 4HJJH 4D0CA 4JZJB 5JIIA 3QJHB 3MBXL 2NY0C 4X4ME 1BBDL 2Y5EA 3HMWL 1V3KA 1DQTA 3HPJB 3DVNB 1TVDA 5HYEA 3MUZ1 4LPVA 3BAEH 3DX9B 5LBSH 1AQKH 3FONA 1QR1B 2H8PB 4PRID 3JTTB 3H7BB 2J8OA 3QUZC 3U7YH 4RRPA 3T1FB 4AIXA 2R4RH 4P4KC 5E5MB 4XHJD 4KAQL 4N0UA 4QXWA 3SKOA 1GGIH 4UB0H 1IFHH 4NUJB 1ED3B 2OSLB 3AMKA 1N64H 3H3PH 1TQBC 1J0IA 1FDLL 4WFEE 3RGHA 2VLRD 2WINA 5CJBA 3FB8A 2I5YL 3X17A 5I0DA 2NY0B 1D5BB 3NVQA 3D2UD 4DTGH 1G9MH 3LRGA 3MRIA 2I25N 3TP4A 1NAKH 1QLRA 3H42H 1VEOA 4LSUH 1GJIA 3DX8B 1T3FB 1I1YB 3F7VA 1BAFL 1F2QA 2IQ9L 2ADJB 4QGYA 4LSPL 4ZUSA 4FQJL 5EN2A 1U91B 2XZAH 5IB3A 1I1AC 2A6DB 2Q6WA 1DBKL 2E7LC 5DF0A 1MCNA 2D7NA 4N5ED 4V1DA 4KQ4L 3VFNB 4WY7L 2AI0H 5EBLB 3SDAD 5DA0B 3ZKXB 1BZ9B 1HN1A 5E2VH 2YWZA 1LE5B 3CNKA 3GJEB 2FL5A 3OAYH 4PJHE 3MLPA 2XACC 2VITA 1UB5B 4HIHB 4HKJA 5CBAA 4RAUA 1FCGA 4U1LB 1NKRA 2EIZB 3QUXB 4EUPB 4HS3A 1JCKA 4Z7UF 5ACLA 1LE5A 4LLYA 3GJEA 4ODTL 2OM5A 4D0BA 1X7QB 1UYWH 3A6CL 4BZ2L 2VTFA 2HFFB 4GRWH 1MJ7H 4BZ1L 5KTEH 3VGDA 4QRQB 2AXGA 4PRHB 4EIGB 5CGTA 4EUPA 4LSSL 4NKQB 1A8JH 2MFNA 5HI3D 1WZ1H 4HWBH 5I2IA 1SMOA 1WCBB 1DQJB 5F1IA 1X6NA 4YXKH 4ZTOL 5C0JB 1EHXA 5GISL 4ZNEA 3KPOB 4LPXA 1J9CT 3BKMH 2J8HA 2ICCA 2VLKB 5DK2A 4JN2B 3ZL4L 1YYLH 5J57B 3HI6L 4RFEB 3D3VD 4FQIH 2HJLB 3BGMA 3WD5L 3GSOA 3Q6FA 1QACA 4XWGL 2FEDC 3KPNB 1BVLB 4O9HH 1QLEH 4YDLC 2YRLA 3V7AG 3BGFB 5DJXB 3KLHD 3HCVB 3C60B 3TFKD 5IR1B 4J8RA 4JFXB 5IMKB 1RU9H 3DURA 4JRXA 2PYED 4NZRH 4H25B 2P5WB 1LO2H 5F9AC 5C08D 4L1DA 4P9MH 3BKCL 1DL7L 4JRXB 2AXJA 2PETA 5LQBH 4S1DD 3N85H 1MCKA 1KENL 3DXAB 4JJ5A 3HTLX 4ZQKB 4QRUB 2HH0L 4YHYB 4E41B 5DR5H 3RNKA 4JVPA 5J12C 3DUSB 3U36B 2AP2A 2OP4H 1CR9L 2PR4L 3MROA 2FJGA 4MQSB 2K7QA 4Y16D 3ZYJA 3EYOB 4M02A 4C83B 3MRLA 4LF3A 4E41A 1Z6JT 1IC5H 1RSFA 5DGRA 5D96C 1F4YH 1SYSA 3DNKA 1YQVL 5DA4A 1X5YA 3MRNB 1T6VN 5CILL 2CKBH 2WAHA 3QA3B 4YQXL 3EYOA 1TJIH 5DRNB 4HD9A 2ZG1A 4ORGB 5IKCA 2VL5A 1MCOH 4LNRB 1LP9A 4OB5H 5BMFH 3U9PH 1OAXH 4ZFOL 3X14B 1DQML 2IH3A 4Z0BH 1KEGL 4PRAA 4PJ8D 1DANU 3MRBA 4HS8H 4L3CB 4YHYC 3CAFA 4XNMB 4U1IB 3QNYA 1CDYA 4WI4A 2E7HA 2BMKA 4P49A 1U8OA 5DWUL 1LP9B 4NQDE 4K8RH 3OAUL 3O11A 5HTSA 1MPAH 2RGSA 4BK4A 2NYYC 4B41A 5C07A 2W91A 5DFVC 3TNMB 2HT3C 3T4YB 4TNWF 3OB0K 4F2MB 2NZIA 3LQZA 2G75A 4PB0L 1MAJA 2DMBA 2FEDD 3GSVB 1RZGA 1MJ8H 4NNXA 4GAYB 2X05A 4Y2OA 1BZ7B 4TPRH 1QR1A 5GS2D 4NQDB 4YE4L 5HYFA 5C0BB 4PJIE 3L7FA 4A2MA 2JCCF 2X4SA 4YHMH 3D18A 1QBML 1OLLA 3V8CA 2FD6H 1VCAA 3KVQA 3TO2B 4WW2A 2NY3C 4F58H 2XI9A 2AJZA 3DX7A 4LCIL 5JOFA 4AM0A 4PJGB 4DCQB 1TIUA 4GO6B 3GBNL 3FHQA 4LCCC 2ID5A 3QIUB 5FAAA 3JV6A 5FYJD 1ORSB 3PWJA 2YA1A 1IKFL 4I4WA 3UJJL 4ONHA 3O6ML 5JLZA 1EO5A 2EC9U 1IC1A 4OZFG 4XNXL 2YD1A 5E4EB 5D9SA 5H2BA 4XC1L 5F96H 4OQTL 4U49A 2NYYD 2NY1C 4HKZB 1CFQA 1X4ZA 4ENEC 1N7MH 1P7QB 4DVRH 5BOZG 1URLA 3MREA 1I8IB 1Q9KA 2GITB 3ZDYF 3A6BH 4LCCB 3JWDC 5EUOF 3KXFE 4HHAA 1C5BL 4HIJA 4ODXA 4PG2C 5FGCE 3BT2L 3BH9B 3C09B 4PJ8C 1IEHA 4U6HB 1MNUH 1QD0A 1FO0H 5EU3B 4F58L 3WIIH 1TMCB 2Y5TA 4OKVB 1CICA 3FL7A 3MOAH 4BELD 3OKKB 5ICYB 3QUXA 4LLAA 4Y16C 4PR5A 2ZUSA 5J11C 1MCQA 4RAVA 3WFEH 1WIPA 2ITDB 4NYLB 4GAGH 4HLJA 3RAJL 2WQ8A 2A73B 2X1PA 2AXGB 4PRHA 5BZWA 5DRWA 4JY5H 5DJ2A 4M1CC 2QHRH 3RX7A 4YEEA 5FDWA 5A2LH 4AT6A 3Q48A 3TVMC 1U9KA 4R7DA 1JF1B 3FFCA 5FF6A 3MSPA 3BZFB 4HXAL 2D7TH 1A7NH 1FGNH 3FCTB 4OGAC 3QO1A 3CK0L 1IL1A 4U1SB 5T5NF 2CO6B 1IAOA