5D5MF

Structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mF02
3SJVD 3IGAA 5KS9E 1CD1B 2ICCA 5IVOA 3IF1B 3TO4C 2D0HA 2DBJA 4JHBA 1G9MH 1F90H 5CILL 1B4RA 1EXUA 3W5MA 4EIGB 3SJVB 3QUXD 3QZWG 2GJJA 3CVHB 4JPWH 3BH8B 5CINL 3V8OA 3SY0A 3RPIA 1FVDB 3GJFA 4ODSH 1NDGA 4EXKA 3CX5J 3AS1A 3E0GA 1D5IH 2WIIA 3LH2H 3P30H 4ODHH 2B4CL 3IFPB 1EFXB 1L7IH 1P7KA 3HHRB 1UYWL 1UACH 3SE8H 1IT9L 4NRYB 3ELAT 2UZIH 4ELMF 1FAIH 4JKKA 2OJEB 3ARQA 2VISB 3GRWL 1MVUA 1JGVL 3VI4E 3L3GB 1KG0B 4DQOH 1DUZA 3V5HA 1T1WB 3GBLA 5ICZB 5HYSA 1EO7A 3MJ8B 3DGGA 2B2XH 3QXUA 1MHPH 1K6QL 2F74B 1JGDB 1NFIB 3P9LA 4XCCH 3ZL4H 3HZMB 5GGSA 1OSPH 2DQHL 4I77L 4AT6B 4X80L 1JGEA 3O4LD 5DXWA 1JV5B 1I7ZA 2YXFA 5EC2B 3H3KA 5BMFL 1NDMB 3GSXB 4NQCD 5MHSD 3WO4C 1JK8A 3D69B 5HHQB 1YMHB 3S3SA 1J0JA 3QISA 2VDPH 4Z0XA 5TE6H 3S5LA 4Z0BH 4HC1A 5F21B 3O9WC 3E6FB 1T7VA 4HCRH 2YR3A 5IF0B 3O4LB 4UB0H 3B5HA 4POYA 4GRWB 5K9OB 5E56A 3O3BA 4LU5L 2EDYA 3ARXA 3AS2A 2J8HA 4PRDA 2CIIB 4DFHA 1SY6H 3SDCB 4M03A 1JE6A 1F13A 4OGYL 1TETH 5HHXL 1HYSC 1AH1A 2B39A 2VZUA 1ZLUH 5JW3H 3QDJD 2GAZB 4OLUL 3RNKA 4YPGA 4DVBB 1M7IB 1FBIL 3DYOA 2F54A 2HWZH 3GFUA 3UTPE 2VKWA 4U1KB 1YNTA 4U6XA 2FX8H 5B38A 5IFAH 1JF1B 2QR0B 4M7JL 5GPRA 1FFRA 3MRQB 4XXDA 1RIHH 5I1LB 1P5VA 1JWUA 4QHNB 4APQB 2D31B 2AXGA 4S1DC 3I6LE 4TNWK 4OIIH 1OF2B 4S1SH 4QHMB 1CFVH 3JVGA 5FM8A 5MP6H 1AGDB 2GY7B 4WTXA 4PG9B 3H42H 1KXVC 3HZYB 4RFEB 3LPFA 4ODXB 3PV7A 1CICD 5MEPB 4N0YL 3GMOA 1EIBA 3QEUA 1NSNL 1JNLH 3B9KB 3OAYH 2XYCA 1F4WH 3MC0A 3ZYZA 4FTVE 3WS6A 1RU9L 4JG1H 3BKJH 1LE5B 2C3XA 4D0DA 1FRGL 3QFDB 5IQ7L 3NCJL 3SE4C 2EDHA 4ZD3H 5L6YH 3WXWH 1XAUA 4NQVB 5D7KD 1XR9B 1WBZA 5A43C 4P0DA 1T03H 1MJUL 4MJ2A 3T4YA 3LN5A 3SGEI 1HH6B 5HYIA 4PLKD 4RBPH 3OKKA 4M7LH 4M8QA 4U1SB 5JW5A 3CDFA 4P2OA 5LJYH 4HXBL 3G04B 3LEVL 4P46C 4HLZH 3GSRA 4MXWL 5IT2H 3QQ3A 4OTXL 1H8OA 3NFSH 3QNXB 32C2A 4JFQB 4PJHB 5EO9A 3IVKA 1KJ2B 1IGTB 2MMXA 3GSNL 3RKDD 3ROOB 3SGJA 2XZQL 3TVMB 4KGJA 4BSVA 2XV6B 1DL7L 4KXZI 5DO2D 1ZOXA 1BFTA 1HSAA 4ZFGH 5BS0E 4XPFL 3IDMA 4RQQA 1DQQB 4NZDA 5JIHA 2IANA 3ARDB 3KPQB 5C0BA 2XTJC 3CH1A 4HT1L 2VH5L 4K3HA 1D5XB 1F4HA 1S78C 1T1XA 3MQIA 3ZKMD 4JHZA 1A1NB 1I7TB 4HJJL 3F58L 4RDQG 3T0DA 3WLBA 1INDH 1OAUH 1CCZA 1J0ZA 2CLRA 3C5ZD 1JGLL 4JO1L 1RPQA 5L8LB 3LEXA 1DBKH 1NC2A 4P3CH 3S96A 1QBMH 5KSAA 3BRFA 3LEYH 2NY1B 5F89B 3NIGF 1MFBH 5FV1L 4JKLA 4I9WE 1RAMA 2RCSL 4MD0A 5E2VL 4UV4H 3TGXA 4LCCC 1OD9A 3L1OL 3I3BA 3C5ZB 1FL3A 2BSTA 1AD0B 1E4XI 3ZKQD 4WI7A 5C0GB 2OQJA 2AEWA 3QJFA 5DJ6A 1RMFL 3PXHA 3Q6GH 1KTLB 5EH1A 3C09C 3MACL 1RK1B 2YD4A 4ODVL 1SVCP 3U36B 5DMJB 1A47A 4J1UB 3QDGA 4OKVA 5E8OB 1KLGB 3C87A 1UEYA 5DQJB 1G1YA 4W6WB 2ZCKL 4E5XB 4JR9L 1NGYA 1PDKA 1KV3A 1U8LA 4G5ZH 4KDVA 5H35A 2CUMA 2M2DA 1VADB 2YUVA 4UBDD 3MZTA 2HVKB 4QTHB 5IVZB 5LBSH 1OTUD 5LKNA 1FIGH 2WUBH 5I1DA 1AXTH 3QT2A 5HD8C 4NC0B 2IQAB 4PJ7A 3GDBA 1ED3B 2FEEL 5AZEL 3DRTB 1SJVA 1Q9LB 1SM3L 1N2RA 4YDLB 5ESAA 2HYMA 4YDKL 4RAVB 3FQXB 2V2XA 4KAQL 2PW2B 1K4DB 4B7IA 1D9KD 1ZTXL 5IW1B 1BM3H 2A6IB 3RY4A 5IW6B 5C0RL 5INDB 1IEAA 2AEQH 4OM0H 4ONGL 4UOW1 1PZUB 2FJFB 1T4KB 4ZO6A 1DQTA 5H2BB 2P8MB 4CMMB 3X12A 1G7IB 4GAGH 2AJXH 1N5AB 2QADD 3VFPB 4KDTC 4QRTB 1A6WH 4K3GA 5CIPB 4GRLC 5F7MC 3QUYA 1HXMB 4G7YL 4RFNC 4NRZA 4HWZA 4CGTA 3N9GL 3MUZ1 4AJ0A 2ATPB 4RFOH 3K81A 4I2XA 3MV9E 3QPQC 4M3KB 5ITFB 4DKFH 3O3AB 5MEQA 3NBNA 2HRPH 5JPNA 1E6OH 3GJEA 3EOBA 5SWSA 5JR1L 3R1GH 1MFCL 2J8UB 3IYLW 4S1RH 5MEOB 4L9LB 2QADB 3LKRA 1K8IB 1A3LL 1UXSB 3FT4B 3MBXL 5ABDE 4P49A 2IQ9H 4YFLF 2DQEH 4IRSA 1HKLH 2AJSH 2YSSA 3AM8A 2R69L 1NUNB 2D03L 1RZ7H 2YRPA 4PJDA 5B4MD 1TPXC 1QRKA 4MAYB 4LARH 3GHBH 3FQTA 5E94B 1ZLWK 2EXYD 4EN3B 2BVEA 1DBJL 1FGVH 4WHDA 2ARJA 3BJ91 3H9YA 1H3UA 3BYYA 4G6ML 4WFHE 2AAVA 4QOKE 3GNML 2C5DC 4PRAB 5DURD 3IAGC 4PJIE 4P59H 2FYYA 3NGBC 4L5FL 3MLRH 3P3YA 5AYQA 3DX8B 3LS5H 3N0PB 1VEMA 4Z7WA 3UTQB 1CZ8L 3D3VA 4FTVB 5J13C 4NJAL 1PZ5A 4LQFH 1QP1A 4PJBE 1NFDE 4D8PB 3U46B 5T3ZE 3HZKB 4AQ1B 2WQRA 4E0RA 3SO3B 4WW1B 5T3XL 2YUXA 1UXWA 1NC4D 2NNAB 5EZIH 3S36L 4UI2A 2IGFL 4MCYA 4XB8A 3BPCA 3H7BA 4HUKB 1W0YT 4ZO7A 5F8QC 1JHTA 4IMLB 1JZ4A 4U31A 2Q8AH 3WNMA 5D1XC 4Z7UB 5JDSB 4TUKH 4C83A 5BV7B 1JWMA 4U4BA 3G5ZB 1NC4B 3HB3C 4CNIA 5EBLA 1FYTE 1XZ0B 4D0BB 1RULH 3Q5OA 1JUFA 5DK0A 4GXUM 4UDUA 1C1EH 4YE4L 4D9RE 5DJ8B 1JI2A 4PJ9D 5BS0B 1W0WA 1HE7A 1RIVH 3O4OC 3UYRH 3HKFA 1NL0H 2MCPH 1HINH 4KK9C 3WNLA 1PX4A 4FABL 2P8PB 3NACH 1XGPB 3GMNB 2RBLA 5T1MB 3KPRA 2EKSB 4RNRA 1UM6L 1CQKA 4O58L 1V3MA 3QXAA 5B3JF 3CLFL 4JE4B 2FSEA 3SQBA 5DC4B 4QRRD 1F6FB 2HRLA 5I1GL 1HHHA 5IM7A 3S3JA 2V7NA 5J9PA 4XGZA 2F8XC 5K93A 5BVPL 1CFTB 4LFHD 3TN0B 5TQ0L 4JHAL 2HT3D 2C3GA 3Q5YA 2JCCF 3DNKA 4QRRB 5JOFA 1GOHA 1Q9OA 2M26A 4KKCD 4R3SB 3IKKA 5SV3A 1MLCA 4LEXL 1B0GA 5E7BA 4JM2D 1QFUL 4JG0L 1DBAL 3KWWB 4Q97A 3HC4L 3OR6A 4EBQH 1T1YB 1YYML 1QR1A 5IHUL 3KR3L 3BXNA 1S3KL 1FNEB 1SY6A 2OL3L 3UJIL 3QI9D 2PCPA 4MXVE 4G80B 4HWNA 2X4OB 5FHAL 2VLJA 4XMPL 1G7HA 4NCDA 3HE6C 4HS8L 1OHQA 4ELMA 4Z7OE 3MRPA 3H8NA 4NWTH 1R3KA 4HUWB 2XQBL 1OTTD 3O0RH 3QI9B 5IKCB 2EYTB 1XIWD 5JIKA 3ZHDA 5ECJE 4NO2B 3C2SA 2VQTA 1LDPL 1U8JA 4X98B 4LRIA 3BEWA 1JRHI 2PXYD 2ZNXA 5CSZA 4NFDA 3HRZA 5IB3A 4ZPTB 4A6YL 2H6PB 2ICWJ 4U3CA 4XNYL 1A3RH 4ZFZA 3FT3A 3SGEH 3RZCC 3JWDC 3CFEB 3F7VA 1HH9A 1A6VH 4G3YH 3H9SE 1RUQH 4K8RC 1F11B 3JWOC 1FZMB 3I3EA 1WWCA 1JZ8A 2PXYB 2VDQL 3KYMA 4NQSA 4OIBA 3C60C 1A6TB 1ZA6B 4ZYKB 4OFYA 3BPNB 5IB1A 3OKOA 3MV8E 2R9HD 3RWJB 4JN2A 2Y36L 3BDXA 4QT5B 1X6NA 3GSOB 3P0YL 3C6LC 4KXZH 4PD4K 4GRWF 3EJZC 3EZJB 1DN0B 4L8BA 5CJXA 1VGEH 1NJ9A 2HFEA 3CVHH 4Y1AD 1J11A 1S7UB 4JREC 5IOPA 4Y16C 1MFNA 1NEZA 5A16B 3FKUS 1S7XB 5HI4D 3M17A 5F7EH 4L4TE 4BQBA 2B20A 3DO7B 1AXIB 5I17B 2V5TA 1A1MA 4X7TB 4X7SL 3S8WA 2UUDK 1B6UA 5IR1B 1UC6A 4KK8C 5LGKA 2YRZA 1E6JL 1A4JA 5I30H 3KXFD 5K9KB 3L3HA 4YZFE 3IU4L 3ZTJH 3U9PL 5DMGD 4NC1C 4YDVB 1BAFL 3B2VH 3DUSB 4L3AA 5KVFL 3BGFB 4O4YH 4LGPB 3S35L 2A9ML 2VLMD 1E4XH 2VXQL 2YPKA 2ZG1A 3L95A 4BH8B 1CFQB 3BWUC 4LLWB 3KXFB 5HDQH 4CVXB 4RISL 3GKWL 3EO1B 2O5ZH 4NKDA 1AJ7L 1NFDB 4PJBB 5E08L 2VKXA 1MI5A 4HDIB 4YAQA 2DWEA 1T83C 5L88L 2JKXA 3GMLB 4OF0A 1IM9B 2R2BB 2G60L 4HKBA 1ZSDA 1BBJA 2Q8BL 2EDDA 4XC1H 4YHOL 1EJOL 4QRUA 3B6SA 5BZWA 3BHBA 4OD2B 4XWGL 1A3QA 2JJTC 3WN5C 3LKQB 2GI7A 3UDWA 2ZUQC 1PY4A 3LDBB 1IC5H 3HC0B 1K5NB 3BP4B 4JHWH 3OKLB 4P5KA 1K9TA 3FO2B 4XNXL 5IB4A 3DVGA 5IEKA 2APTA 3B3IA 3U0TA 3NH7H 3MNZB 4MGXA 1OAXH 2V5SA 1F4XL 4MA7L 1GHFL 4I3SH 1W72B 4KJWD 3ARZA 4PJHF 4M1DH 4PD4J 3CUPB 1WWBX 4KRLB 3GSWB 3PQYD 4JLRA 4J3SA 4B50A 3SO5A 3ULVE 4YO0A 4X6FB 4HX1A 3BZEA 3DWTA 4FMFA 3MYJA 5F96L 1A9EB 4ETQA 3BP7B 4EDXB 1IAIM 1LK3L 3FB6A 5J89A 1AKJB 4K7PY 2LU4A 3PABB 2CGRL 2VC2L 3GMRA 2HJKA 3QDMD 5FAAA 3MRMA 2P49B 1INEL 5DUPH 3EYSH 4PJCE 2GYSA 4G7VL 5IW3A 5C2BH 5IHZB 4HS3B 5EOCJ 4NNPH 1OGTA 3VD7A 1WZLA 3RX5A 4XVTH 2I9TA 2DMBA 4OCSH 2R4SL 3RWHA 2BNRE 2X4SB 3FQRB 5ALCL 4U0RC 3BD5A 5I1HH 1S9YA 4G8EA 5FCUH 3ZE0F 4ERSL 4X6DB 3T0AA 5A40E 2Y7QA 3PWVA 3KPSE 5CMAA 5T5NF 3X17A 3WIIH 5IHLB 1NUGA 4IJ3C 2NYYD 5C9KA 4MNHA 4J6RH 1Q1JL 4KC3B 2W38A 3GMQB 4DW2L 4N5ED 4PRIE 1KEML 3MJ9L 4QXWA 2FL5B 4FXKB 1XGQA 3L7FB 3MBEC 3S34H 1ORSA 3VXUD 4F8TA 1J88A 3VFNA 4IIQC 2BVTA 4PREB 1OW0A 1I85C 1RZFL 3BSZL 3I85A 5L2KA 5ISZD 4ZNEA 1DLFL 5FK9B 3TA3A 3O3DA 2A83A 3GHEH 2YD7A 4TRPL 4R4FH 1Q8MA 2HFTA 4GKSB 4EI5A 1CDIA 3VI4F 3S37L 3Q1SL 1NCTA 5T5FH 1OTSD 1UWXK 4OLEA 1CWVA 4I48B 1QD0A 2JB6A 5D93B 4PJEA 4DCQB 5HDOA 3RWGB 4FQIH 4YJZL 4QXTA 4XPGH 3DROA 5F7DB 1AQKL 4JY4B 5TE7L 3EO9L 1YEEL 3PGCB 4H26B 4K7FA 3CFIC 4BFBD 1R3LA 4PFEA 4UT9H 1BMGA 1CLZH 5DD6A 2ZCLL 1KJVA 3H9HB 3UTSE 4ALAL 3BKMH 2R2EA 1C5CH 1RZ8B 1CU4H 4P3DA 4KI5E 3MV8B 3JWNC 3DURB 5TF0A 4ZXBD 2LV4A 1U0QA 2P5WD 3WHE1 1KBGL 2LVEA 5JLZB 4UT7L 1F3DH 2UVFA 2ERJB 4V2CB 4GAYA 3X14B 3OXSA 1F4YH 1DUYA 1TZGH 1UVQA 3FFCD 4LIQE 4PY8J 5FYJL 5ICYA 3X3GL 5SWQB 4R26H 3CMGA 1FV1A 4MXQD 1ZHKA 4ZXBB 2R1WA 4JRXE 5T1KA 2P5WB 1ZEAL 4TUOB 1GPOH 1GOGA 1T5XB 4HWEL 1O7VA 1NKOA 4XBPB 3TWCH 1MLBA 2FWOA 3T8XA 2Y23A 2AI0H 2J8UF 3D39A 2F8OA 2C1PB 3HA0A 4KTEH 1GC1C 4OI8A 5I1JL 4PJ5D 3TBTB 2RGSA 1VFUA 5TDPB 3PL6A 5F6IC 1HHKA 1ERNA 3PWPE 4HEPG 3MLZH 4QCIB 2EDWA 1F58H 3TBYB 3QJHA 3VMOA 2Q76A 3RU8H 4NKIH 5F70A 4YHLL 4XB7A 4PV9A 3QHFH 3LHPL 1OP3H 2Y5TB 2JELH 2IBZY 3QIWD 2ZPKH 3G6DL 4PJ5B 2AP2A 3CDCA 3P73B 2HLAA 2MPAL 3MRDB 4YDJA 2EE9A 4FNLH 4WI5A 3T04D 4EOWH 1MJJB 3O6KH 1CGXA 4KKAC 2R0WL 4Z95H 1HSBA 2CO7B 3CJJA 1IGJA 4HJGB 3QIWB 1I1AC 3QNYA 3H3PH 5DR5L 1U93B 1C08A 3V6BR 5AYUH 4QRQB 4ZUVB 3SDXE 1FN4A 5DJXA 4JN1L 4NZRH 3HUJE 3NCMA 5I66B 1CFNB 3FCTB 1FL5B 2C3VB 4IRZL 1TQCC 5C9JB 4CADA 1XCTA 2JLLA 3ECBB 1CBVH 1FHGA 1RZJH 3G6AB 4Q6IC 1KEGL 5J1SC 3V6OC 4WUUD 1JRHH 5CBAB 2K7PA 4KUZH 3E8UH 2LU7A 4Z7UF 4UAOC 4WHTA 4F58L 4XP4L 2BY0A 4XBEL 1M7DA 1N7ML 4Y5YB 5HYJE 4ORZC 1KGCD 4EVNA 4NQDE 2FJGA 5F1IA 4OM1L 3QRGL 1KYOK 4ZOBA 4JQIH 2BJML 4WUUB 3R0MA 5F8RC 4R0LB 3UTZA 5LGJA 2VZVA 4UQ3A 1MVFA 3EJYC 5C0FB 1QSFD 2B5IB 5KVEL 5DQDH 1A6AB 2XA8L 5T3XD 3AC0A 3MREB 3O6FA 5HGHA 1Q0YL 3TBVA 3A6BH 3RBGA 5MEND 3VXOA 1NBZA 1I1CA 3QO0B 2X4PB 4M43L 3DMMA 4HIIA 2CRIA 3W9DB 5CAYB 3QEQD 3HPLA 1XF3B 4PJCB 5LVEA 2R0LL 3HNSH 1LEKB 1YQVH 3PGDA 5EIVA 3RGVD 1QA9A 5F7YC 3QXDB 3VFVB 4Z7VA 2FR4B 1N4XL 3KPSD 1Z3GL 3IXAA 1KIPB 1TTGA 5MENB 3QULA 3F6LA 4NIKB 4PG2A 1OP5K 1TFHA 5FO8B 3FT2B 3SBWC 1J1XL 1UJ3B 4Y4HD 5GGVH 1CD1A 2WBWB 5FYKE 2CLVB 2X9YA 3IF1A 1VPOH 2JCCA 2FX9L 2A9NH 2FLRT 2AK4D 1NAMH 2OTPA 3KPSB 4P9MH 2VSCA 3BH9A 3BP6B 5KOMC 3SJVA 1NCWH 4PRIB 4XP5L 4Y4HB 3WJJA 4A2LA 3PWNA 1VACA 3VRJB 2C4XA 3CVHA 1ITCA 1YDPB 4RMQA 4FQCH 4X0KA 5KZCD 4ZUTB 1BP3B 2PYFB 4FHBD 3W11C 4YXLH 2GTWB 4CU8A 3QUXA 3PNWB 1MFDL 2VO5A 3VXTA 3NTCH 2IPKB 5GRJL 4YQXL 4NRYA 4U1IA 4WVRA 2OJEA 4YIQB 2VLLB 4LPWA 3T09A 4PLJD 4KVNH 5K9JL 3DUHA 1ZLSL 1KCSL 2V17H 2HH0L 3GBML 1SHMA 3ALWA 1KG0A 4G6KL 1MHCB 4JZJB 3OB0K 4X4ME 3KJ4B 5FGCE 1DLHB 1EAJA 1YN6B 2MQ0A 4PUBL 3MJ8A 3CFJA 2Y9RT 3O6LL 4U6YB 1JGDA 1NFIA 3FAWA 3L3OB 3UTSB 3ARRA 3PWJB 5D7LE 3WKML 1TTFA 3GSXA 1IAMA 2D4FA 5CJ8A 4POUB 1L4IA 3D69A 1RK0B 2FEEI 4PJFE 3OZ9H 3BX7C 1YMHA 3P11H 2DDQH 2OL3B 2AEIT 1UA6H 3KNBB 4TSBL 1P4LA 5DD1L 3O4LA 4W81A 4H0HB 4NQCA 5K9OA 5L0QB 4JRXB 4HIJA 4OZHE 1B6DA 2DD8L 1FNSH 2CIIA 2G75A 4OCWL 1ZS8A 3BYTA 4OQ1A 1YN7A 4MJ6B 5F9OL 3OF6D 3RWFA 2BC4B 5A3IC 1KENL 3M1BB 2VMFA 4JO3H 3D25B 1L7TH 4MDIB 1T2XA 4JQVC 1UZ8A 4KGLA 5JHDD 4G6FD 3OKDB 1KJMB 3PWPB 3CIQA 2KL6A 3EDKA 2VQ1A 3KPMA 5C07E 4XI5C 4XWOD 5ILTH 2QR0A 3BKCL 4MS8C 4KY1H 1RZKH 1S9KC 2EEDA 1U6AL 1W2KT 4WCYH 4APQA 5I1LA 2D31A 4YK4B 2O61A 3QDJA 4Z77A 1IKNA 1OF2A 4QHMA 4NKOB 1BQHA 1R5IB 2HTKC 1F5WA 2WINB 4PG9A 1LE9B 4XBGA 1WBXB 4N1HB 1I4FB 4P99A 2J12B 3HZYA 1OQXA 4RFEA 5CILH 1FAKT 1IAOA 3RTQC 4YBQC 1ND0B 3VMPA 2W92A 1FSKC 3BGAA 3U6RB 4CJ1A 1NLBL 2Z8RA 3LV3B 4PJBF 3LD8B 3SDXB 5I1KL 4QRSB 4L8DB 1NGZB 5CINH 4X7CC 1LE5A 1WAAE 4WWID 1L0XA 1U8PB 4M9OA 3OJVC 4PJ8C 1CICA 1RUML 4NQVA 1XR9A 4KKBC 2B4CH 2YD6A 3NZ8B 1UYWH 5C08D 2BVPB 4GAJL 1IT9H 4PGEA 1HH6A 4WWKB 2VZSA 3S6CA 5C0DB 1TIUA 5GJSL 1UENA 3G04A 5HYJB 2EICA 3GRWH 5I15L 5IBTL 1JGVH 3FQWA 3KPPB 3DIFB 4RMWA 3HR5B 1LHZA 4WI9A 5C08B 1TNMA 2V7HB 4PJHA 3MMEB 1IGTA 5JPMB 4LCWE 1K6QH 3ROOA 3VGAB 2J5LC 4QHKJ 1IILE 2FH8A 4LSSL 3MA9L 1YEJL 1VEPA 1AGCB 1I9IL 2DQHH 4I77H 4X80H 3VWJC 2FLBT 4XPTL 2IAMD 5BMFH 1DQQA 4KROC 5FYKD 3KPQA 2AQ3A 5J1AB 4TTDC 4FA8A 1XMWA 2ADIB 1D5XA 3BESR 3MX0A 1A1NA 4NHCL 1I7TA 1X5XA 2CXKA 3TO4D 2AXJA 4J4PC 2PUQT 4O5LL 4JDZB 1F6AB 5JIPA 1RIUL 1ZT1B 1R3JB 4LU5H 3LIZL 3T3PF 1BVLA 4CMHC 5I18L 3U79A 1S9WB 5JZ7C 1BEYH 2R0ZL 4K3JL 4O02L 1WIPA 4U1HB 3TO4B 1A0QL 1KCVL 3MLPA 2ADFL 3AB0C 4RGOL 3JWDL 4OGYH 1VESA 4JRWA 5HHXH 3ARFC 4QXGL 5E99L 1IQWL 4K8RL 1Z5LB 4X6DF 3C5ZA 2VABA 2D7NA 1GYAA 4OLUH 3LRSB 2Y1VA 1FBIH 5IJKC 1N5YL 3RWCA 1KTLA 2AQ2A 4LOUC 4M7JH 3VXRE 3FN0H 5IJVB 1BIIA 2F9BT 3UTOA 2WBJC 4J1UA 1M6OB 4ONOA 4Z7OF 4R7DA 4RGNE 5KN5B 1TCRB 1V05A 3OKMB 5IMKB 4JFED 4U1GC 3FO1A 3C5JB 4J12A 5KVMC 5ANME 4DVRL 2X10A 4OZFG 4E5XA 2R1YB 1DTUA 2LU3A 2DRUA 3CDYA 5FGCB 4N0YH 1LGVA 1NSNH 3FMGL 3VA2C 5SX4I 2HVKA 5IVZA 2OCFD 1RV6X 3OKNB 1RU9H 5KBNC 4MZ3A 1FRGH 3MXVL 5IQ7H 1ED3A 3NCJH 3O9WD 3DRTA 1Q9LA 5E6IB 2QEJA 1BLNB 4HWBL 4Q9QL 3RDTB 4KHXL 1MJUH 1KACB 4JB9L 2P24B 1ES0A 5GZNC 5D1ZC 5I1AB 3TZVC 2IH3B 5HPOA 3FQXA 2GHWB 4HXBH 1WCBA 2R56L 3T0VA 3LEVH 4PJXA 1N0LA 5IW1A 5KTEL 5ICXB 4MXWH 2VXUL 3HCVA 4OTXH 4GUPA 4OZHB 4F80A 1EAPB 5I2IA 5H2BA 1QRNE 3O45B 2CDGB 1N5AA 4O2CB 3GSNH 5FGBA 2XZQH 2Y4SA 3B2UC 1D9KA 1DL7H 2P47B 2ATPA 4PRHD 1IVLA 2OSLB 1AGFB 2R0KL 3PE9A 2J8UA 4S1DD 1X7QA 5EULV 1UZ6E 3BIKB 3FT4A 4FRWA 1T66C 4HT1H 2VH5H 4RMRA 1H3WM 3V52L 4TVPD 1FE8H 4XAKD 5TDOB 1OW0C 5DVMA 4HJJH 3F58H 4PRHB 4N0UE 5FOBB 1URLA 1KN2L 3FONA 1B3JA 1CXFA 3LRHA 4U1NA 3ARYA 4MAYA 5FYJD 1JGLH 4JO1H 1XH3B 4LLDB 5E94A 2WAHA 4XH2A 4ENEC 1T7XA 4HHAB 1SEBA 1CDJA 2F15A 3WE6B 2EDTA 1IE5A 3ARBB 1QSEE 1HHIB 2QKIB 4OJFH 1U2CA 5KANI 2RCSH 5E2VH 4NT6A 1AO7E 2DYPB 3L1OH 2ORBL 4UQ2B 2YZ1A 5F71A 4PRPD 3UTQA 2NY6C 4TVSa 4F3FA 4M1CC 3IXTB 2ILLA 1J8HD 1RMFH 2ZOKB 3T0WA 1FVEA 3U46A 4DGVL 3IDNA 1A6UL 3MACH 4RCAA 4D2NA 2C1OB 4WW1A 1NAMA 2MQCA 4P46D 2E8YA 5F3HB 5I8CB 4ODVH 4PRPB 4N9GA 4OD3H 4FQLL 1RZGA 3UBXB 5B8CC 5ADPL 2DQIL 2Z8VC 3DI2B 4Q58C 1J8HB 3V5KB 4Z7UA 5JDSA 3BT2L 5E1HB 2ZCKH 4JR9H 3G5ZA 1NC4A 1N64L 1XZ0A 4D0BA 4WGVB 3DV4B 4LCWB 2LFGA 4OF8A 4NPYB 4MMZC 2NY3C 5DJ8A 1HDMA 1EMTL 2XTJD 1S78D 3SE3C 5I73B 3ULVF 2ID5A 5AZEH 3A0OA 5AG9A 2XOTA 1SM3H 1VB9A 1RY7B 1F45A 4P57B 2YK1L 1YPZE 3UZQA 3G6JE 4YUEL 1RURL 2P8PA 5K33A 2ATKA 1QLRB 4YDKH 3BMVA 4JRYE 2XIDA 1YEDB 4KAQH 4PJ9A 5EOCL 4NFCA 3ZTNL 2Z35B 3BOVA 1ZTXH 4PJCF 2E27L 4JZNB 3HZVB 5C0RH 4N1EA 4ONGH 5DLML 5SX5K 2YPLE 1EO5A 2ZUVA 1TJIL 4GQPH 1WZ1H 4NRXB 1JFQL 2XNAA 1Q72L 1CFTA 2J4WH 4G7YH 2YA2A 2NX5E 4Y4KC 3KG5A 3EBAA 3N9GH 4QRRA 5TDNA 3JV4B 1CGVA 1UB5A 1NMAL 4CVZB 4DWHA 1FGNL 4M3JA 5JR1H 1MFCH 3KWWA 8CGTA 3NPSC 3FN3A 1X4XA 5GIRB 1NBYA 1A3LH 3MBXH 4L1DA 1QO3B 3IFLL 1FNEA 2ZJSL 2WWMC 5I76B 3GMMB 2R69H 4HIHB 2D03H 3IDUA 4JM2A 1JWSB 3E6HA 3BRDA 1IAIL 1UM4H 1ULVA 2E9IA 3MRGA 4X6EB 4YDIL 1DBJH 5ANMB 4HUWA 1J10A 3QI9A 5IKCA 2EYTA 4G6MH 4OGXL 4MB5A 4FZ8L 5HD8D 1CLCA 4HBQA 5F7HA 4L5FH 3KPOB 2P48B 3V7AE 2YWYA 3ZT6A 4X98A 4JGUA 2D9CA 3ES6A 4MNGA 4GSDL 1EJ6A 4NJAH 2VR4A 1TZIB 1U8KB 2H6PA 1OB1A 4GOSA 5CEXA 4D94A 1BZ9B 5T3XH 2IPTL 4LGSB 4DKDC 4NZTL 1DDHB 3QHTC 3S36H 1F11A 4AIXA 1FZMA 3RY5A 2IGFH 2PXYA 3MFGB 3ALXA 3GJFK 3ULSB 1A6TA 1ZA6A 3MRNA 4LSUL 3HG1D 3OR7B 1GJIA 5EU4A 4Y2DC 4F7PA 4YNYB 4JY6A 1IBGL 5INCB 3BGMA 3GSOA 1PAMA 2VZ3A 2XPGB 3QPQD 5T1DL 2QL1A 1DN0A 1RZIB 3VH8B 4OZ4A 4Y4FC 3HG1B 4GRLB 4FG6C 4RFNB 3AFLA 5AG8A 1P1ZA 4E41D 1T0NB 3EGSB 2BVOB 3GRWA 1JPGB 1MCCA 3GBNL 3U4EB 5FO9A 4FABH 4ZO9A 5I71C 15C8L 4Y1AA 1HKFA 2A6JB 4OUUB 1UM6H 4N0UB 3OQ3B 4O58H 4E41B 1QSZA 3HMXL 5IR1A 4JY5L 3CLFH 3ESVF 4JDVB 2PYED 2EECA 3UBXI 3GEWB 3QHZL 5JOPE 5IBUG 5I1GH 1G0YR 1TPXB 5BVPH 1QSEB 4P23C 4YBHA 3W9EB 5KSBF 3BZDA 4YHNB 2QQKL 5TQ0H 4JHAH 5C09D 2GUOB 2PYEB 3K74B 4F7TB 4LEXH 3KXFA 4HUVB 1QFUH 4CVXA 2DM7A 4JG0H 1DBAH 3HC4H 2R2CA 3ZHLA 5AAWA 2IALA 1YYMH 5IHUH 3KR3H 3RVUC 3HTLX 1S3KH 4PRNB 2ADJB 2DKSA 3SKUD 4KZEL 2OL3H 3UJIH 4BH7B 5D1XD 3SDXF 4AIZA 5DVNA 2HTLD 4G9DA 2DIAA 3GMLA 3I6GA 3EYFA 3HB3D 2R2BA 1CFSB 5FHAH 4XMPH 5HHOD 3GSQB 3T1FA 3NMEA 4WY7L 3BD3A 4HS8H 1EBAA 4PLNC 2DQDH 4FFVC 2K7QA 2XQBH 3LKQA 3LKSB 5F88B 5D1XB 3MLWL 3REWB 3CZFB 1K5NA 5FA3B 5SX4H 2NY4C 4NN6C 1IM3A 2J6EL 5EBWA 2PTTB 3MRKB 3GK8H 5HHOB 1LDPH 1C12B 4ODTL 3MNZA 4KK9D 4WI3A 3T65B 1VENA 1NGQL 4XNYH 4A6YH 4CDGC 2GT9A 3CUPA 4XXCA 2Y07L 1L9NA 1FC2D 2CK0L 3FFDB 5D5MA 4Q7DA 5D7JC 1YPZB 2VDOL 3O4OB 1FPTL 4JANB 4H0IA 3BP7A 3OG6B 2EDBA 2VDQH 4RMTA 2F54E 4EDXA 5I74B 3DI3B 5K59E 1AKJA 3L3JB 3AVEA 5ID1A 3PABA 5DJYB 3STLA 2OS7A 3UPAA 3BQUC 4NM8L 3PQYA 2FATL 4O9HH 5HVWA 2Y25A 2Y36H 3IDYB 2YPLB 3FQNB 4M5YL 1FQ9C 3P0YH 4IHOB 3MXWL 1DVFC 4XAWL 1Y6NR 3THML 5IHZA 3BJLA 5TQ2L 4WO4B 2R4RL 3KYNB 1OAKL 4YHPB 1FFNB 5DS8B 1U58A 5FYKU 3EOAB 3QDMA 2OI9B 2A2QT 2X4SA 4CAGA 2EDNA 2YUWA 4RSVA 5C6WH 4GRMA 2X4QB 1LILA 4X6DA 1BVKB 5HVHB 3HE6D 5H8DA 4IBLT 4X7SH 3IU3B 2A74B 4H1LB 5HDBE 2HVJB 4FXKA 1E6JH 1YEIL 3A6CL 2AV1B 3MYZA 1ZHNB 4N90E 1A7PL 2MQ3A 3IU4H 4PREA 5BO1L 2O5YL 3HE6B 1BAFH 1IGML 4HZLA 1P7QD 5FK9A 5KVFH 2ZSWB 3S35H 2A9MH 2P4AB 1SYSA 2VXQH 4GKSA 3OB8A 2DLTA 3RZCD 4MA3A 3VXUA 2Z9TA 1EH9A 3RWDB 4JFPB 4RISH 4K8RD 3RWGA 2VLKD 4PLOB 5F7DA 5ISZA 1AJ7H 5E08H 3PGCA 4H26A 3C60D 1FNLA 3NCBB 3VWKC 4AY0A 8FABB 1I9RL 2V9RA 2VE6A 5FCSH 1FFOB 1XF2B 3H9HA 2G60H 3R0NA 4WFFD 2IANE 2Q8BH 4YHOH 4EEEA 3KJ6L 1EJOH 2WUCL 4QY8B 2V5YA 3C6LD 4XCNB 4S1QL 3EJZD 5A1AA 4XWGH 3DURA 3G5XB 4RAUB 4NNXB 1QYGH 3WDIA 1WIUA 4XMLL 4X99B 2ADGB 3IGAB 5F9DC 1D3CA 2QLVB 1CIUA 4Y16D 1ETZA 3UP1A 1BGXL 1OGAD 2MKLC 4G42B 5CBEA 1H8SA 3GM0A 4XZUB 4OZHF 5SWQA 1F4XH 3QIUC 4MA7H 1GHFH 5D9SB 3HFML 4ZXBA 1MCRA 3J8F7 1Y6KR 2P5WA 4BELD 1HZHL 4JREB 4F9LC 2BHUA 4KK8D 4UMGA 4LEOA 1NEUA 5DYOB 1T5XA 3FFCA 3QUZC 5F96H 4WI6A 3VXSD 2WK2A 3MGTB 2DQFA 1LK3H 4OB5H 3S98A 4IM8A 3GJFB 1NDGB 2C1PA 2FGZA 2CGRH 2VC2H 4HPYL 3TBTA 3K80A 1INEH 1X44A 1X5JA 1KCRL 3QDGE 3VI3F 4BZ1L 2R2HB 1RJYA 1IGYB 4QCIA 3NAAL 2NXYB 5F6HJ 5EBMB 4HD9A 5CP3H 5E5RB 4PJ5A 2R4SH 1DUZB 1HQRA 5ALCH 1L9MA 2DJUA 3DLQR 5HGBB 4ERSH 3DGGB 1MJJA 3MO1B 4X5WA 3BZFA 3P9LB 2OXHA 1HOCB 5GGSB 1ZMYA 1ACYL 4ZUSB 1Q1JH 4DW2H 3QIWA 1JGEB 4PJ7E 1KEMH 3MJ9H 3X3FL 1I7ZB 4M7ZC 4QRQA 1JK8B 4I18A 5I66A 1CFNA 1FL5A 2ZOLB 5F7FA 4EUPH 2X41A 5C9JA 2EDLA 4YGVB 1RZFH 3BSZH 3P0VL 3E2HB 1DLFH 2E7CA 3GI9L 3G6AA 3WN5B 5CBAA 1CE1L 1BJ1H 1I3RA 3S37H 2FDBP 3Q1SH 4Y5YA 5FGBC 5E03A 4Y5VC 1KTDA 1LO2L 1ZK9A 4K94C 3JTTB 5JHLL 5TE7H 1AQKH 3EO9H 1YEEH 1CYGA 2GSGA 4WUUA 4I2XE 3LMJL 4XCYA 5SWSE 5CEZL 2ZCLH 1A6AA 2F54B 2H9GA 4ALAH 3MREA 4OBSA 1OLZA 5B38B 4Y0GA 2NY2C 5BQ7B 2X4PA 3OAUL 4TVPH 2GFBA 2XWBA 1NGXB 1JWUB 5CS7A 3VD4A 4LQ1A 1KBGH 1QSFA 4LHUD 4UT7H 4PJDE 5ESVA 3QXDA 3LOWA 1E4WL 2FBJL 5GS1C 5E2TL 1KIPA 3DX9A 4MAUL 3ZYJA 5FYJH 5MENA 4GW4A 3PP4L 3X3GH 5FO8A 3FT2A 3HR6A 1YJDL 1UJ3A 1J9CT 2V5RA 2Z31C 4J8RB 3QEQA 5CJ5A 3CGTA 4L4JA 3GMOB 4LHUB 2R8SL 1K3ZA 1ZEAH 2WZPD 1LQSR 2WBKA 3CFCL 3KPSA 2FJHA 4HWEH 1KB9K 1T2QL 4GBXC 4Z7WE 5IWLC 1QBAA 3RHWK 5L9DL 3BP6A 5E5MB 4Y4HA 4NN5C 1G7MB 1OP9A 1YEGH 2X4NB 4IJ3B 1I8KA 3VRJA 1X5AA 5I1JH 1YY8B 3F7RA 4ZUTA 1WBZB 1SBSL 2AK4A 1WTLA 3T4YB 5EOQL 3LN5B 3MBEB 1D5ZB 2GTWA 1BREA 4P2OB 4IIQB 4WEBH 1C5DB 1LWRA 4YHLH 2IPKA 2RAMA 3LHPH 5F7NC 2UZYB 4WENB 3VDBA 5BOPA 4G9FE 3X11B 3G6DH 4NQUA 2ARWA 2H32B 1P4IL 2YUZA 1QTYT 2MPAH 3GO1H 4Y8DC 4YIQA 2EEAA 1CXKA 4WDIA 4NNYA 5EO9B 4GXUN 3IVKB 2CDEB 2F53D 4WTZG 2PO6C 1S7SA 1F42A 1DLHA 1QFOA 2ICWI 5DR5H 1G6RL 4RQQB 2ZNWA 1MELA 5DUBA 2XFXA 3L3OA 3UTSA 4JN1H 4TUJB 3GB7B 4HBCL 4IRZH 1NBQA 5A2IH 1FLTX 4LKCA 5C70A 3KPRE 4MNQD 2NY0C 5AUMA 3WLBB 3OV6A 1RK0A 1WV7T 1MCIA 1ZLUK 2CLRB 2OL3A 1QR4A 3KNBA 4F58H 2E9JA 4M62L 4XP4H 5FB8B 4XBEH 1N7MH 1GAFL 1NC2B 5HI5C 3W81A 3CFBA 5GSRA 5DI8B 4OM1H 5KSAB 4MX7B 1AC0A 5E2UL 3O3UN 4MD0B 4F7EB 3QRGH 5IESL 3DUUA 2BJMH 1JHLL 1AGBA 1E4KA 3GM8A 1BHGA 4Z7NE 4KZDL 4MJ6A 4Q0XH 1JNHA 4XHQA 5KVEH 3FAXA 4YLQT 2XA8H 3RY6C 3QJFB 2HT3C 1U8IA 5DJ6B 5T33L 3C8DA 1Q0YH 5FYLL 3AREC 5D2NC 1ITBB 5ID0A 1UB6A 1KB9J 4HW6A 4IMKA 4M43H 4DK6A 3OKDA 1KJMA 1U95A 2F5BH 4N8CL 2R0LH 3SGKA 3QDGB 4OKVB 4I3RL 1NANI 5F6IB 2VLJE 1DCLA 1N4XH 1Z3GH 1T6VN 4ELME 1S9XA 3BZ4A 5DHVH 1A7RL 4KUCF 5EU7C 4V1DD 4KKAD 5KSBA 1J1XH 3IS0X 3D1MC 5JHDA 5GRUH 4NKOA 3TC9A 3M07A 1R5IA 1I1AD 3ULUC 5HHPB 1CD9B 2FX9H 2WINA 5CZKA 2M1KA 1I4FA 3JSSA 1ZLVK 2R1XB 2DICA 5FHBL 1T2JA 1D6EB 1XIWC 1FNFA 1ND0A 2I07B 4XP5H 1WIOA 5DRWB 3U6RA 4ZFOL 3LV3A 1I1AB 1KLUA 3SDXA 4QRSA 4L8DA 2I5YH 3S4SG 3WNOA 5ACMA 1U8PA 1CF8L 2E8ZA 3C2AL 3GGWB 1CK0L 1XGUB 4Y2OA 2V2XB 1MFDH 1G1CA 1U8OB 2Q7YA 4L4VD 4YQXH 5GRJH 3VFMA 2BVPA 3SKNB 4LVOC 1IEAB 4U6HB 4HFWB 4WWKA 1JGUL 5C0DA 3ZDZE 2HJFA 3X12B 4MB3A 2YHGA 5K9JH 2FHCA 3KPPA 5E8NA 1ZLSH 1KCSH 2HH0H 3GBMH 4HIEB 5FDWA 2R9HC 4G6KH 4NRZB 43C9B 4WHYH 5C08A 1UCBL 3H9ZA 2BK8A 2V7HA 4GS7B 1H5BA 4I2XB 2AGJL 5LGHL 4PUBH 4Q9BA 5MEQB 5JPMA 5JPNB 3GJEB 3O6LH 4RIRA 3WIHA 1ZT7A 1M71A 3JZ7A 3LKRB 3FHAA 4RA0C 3WKMH 1YPZF 1KPVB 2YN5A 3F7QA 2NLJB 4IRSB 5IK3A 2YSSB 1MFEH 4N8PA 2OMNA 2X4TB 1A9BA 3S36X 1CLOL 4U33A 2VJXA 1KSRA 5J1AA 4J3OC 1OPGL 1J12A 2ADIA 2H1PL 5DTFA 5IVXF 5IMOB 1NCUA 1I8LA 3FQTB 4TSBH 3FQUB 5DA0B 4U3XA 5DD1H 4JDZA 2IAMA 1F6AA 1UM5L 5HGAA 5JW4Q 1ZT1A 1R3JA 4X4ZA 1CVRA 2EYRB 2DD8H 1S9WA 2FYYB 1YMMD 4OCWH 4MD5A 1RJLB 3TO4A 2WQ8A 1P84K 3PHOA 35C8L 3JXAA 3W11D 1H3TA 5F9OH 3R4DA 5IIEB 3HE7C 1KENH 4QNPE 1U9KA 3LZFL 3RVTC 3OBAA 1MI5E 1QNZL 4Q9CA 1UXWB 1CLYL 4OF6A 3BO8A 3CD4A 7CGTA 3BPCB 3H7BB 5DC0A 1F00I 1FLRL 1JHTB 1KTKE 3BKCH 3UX9B 5IJVA 4YPJA 2X05A 2EDEA 3GKZA 1M6OA 1JWMB 4G9FB 2BFVL 4XVUC 1TVHA 5IMKA 3MGOA 5AWNL 3C5JA 1IAII 1EEYB 1JUFB 4GXVL 5DK0B 5J0BA 3G08B 1MCSA 3DHJA 3FHQA 1NLBH 1F4AA 3P40A 4JFEA 5I1KH 5CP3A 1O0VA 4PY7A 3DPBA 3QNZB 2MFNA 4S11A 1CD0A 1RUMH 4C54A 1BLNA 2IC2A 2B7DT 1AE6L 4LLQB 2V2TB 1TJHL 4GAJH 2P24A 1BQUA 1QBLL 1NGPL 5I1AA 1C16B 2FGWL 3MJ9A 5IM7B 4RRPG 5J9PB 1H3VA 4XGZB 5I15H 1ZGLP 5IBTH 3O9WA 1V7ML 1X5YA 5J3HC 4PY8I 4XHJC 5A3ID 4LSRH 2D3VA 1AHWC 2YEZA 5JOFB 1FIEA 5I75C 1YYLL 1Q9OB 3O45A 4O2CA 2BDNL 3NIGE 1B0GB 5F7KC 5ERWB 4LSSH 4J23A 3MA9H 5GHWL 1YEJH 3SDAC 4XI5D 1I9IH 3BXNB 1P84J 1TENA 2VWEC 4MS8D 4TOYL 1AGFA 4XPTH 4J7RA 4QLRA 5D7IE 3B83A 1PGRB 4X7EC 2PCPB 4KJYA 3C5SA 4ZQKB 5F1OB 4LK4A 2XN9E 4G43A 5J8OA 2VLJB 5GGSY 2HTKD 5TDOA 1T0MB 1G7HB 1RI8A 2NYYC 4NBXB 4PRHA 3MRPB 1KUMA 4O5LH 4JQXC 5L2KE 2YBRA 3RTQD 1RIUH 5IB2A 1X3DA 4LLDA 5FF6B 5FM4A 1NMCC 2R0ZH 4HHAA 4K3JH 4O02H 3WE6A 3LKPA 1KNOB 3MOAH 1A0QH 1KCVH 3KLHC 2ADFH 1AY1L 4RGOH 3JWDH 4KWUA 4PJEE 2H3NA 4PJ8D 5F9AC 1AR1C 5E99H 1C5BL 1IQWH 4K8RH 3RTQB 4N5UA 1JZ7A 1CG9B 4KKBD 25C8L 2GTZA 5DK2A 1FSKB 2Z4QA 4AG4H 1WWAX 1XF5B 1BZQK 1EK3A 3BD4A 3IXTA 2C3HA 1N5YH 4NQSB 3I3DA 1QPXA 4PJ8B 1TJGL 1B90A 3SE4A 5F3HA 3DETC 5IB1B 3OKOB 3PIQB 1U3ZA 4PRPA 2NW2B 4JN2B 3L3DB 3REVB 1H0DB 3UBXA 4CKVX 4LCUB 1BFVL 3VH8G 4LASL 5DFTA 1KIRA 1J8HA 4BFIA 5HPMA 4GW1B 5FO7B 3QCTL 2BHZA 1F6LL 4BSWA 4DVRH 4L8BB 3P9MB 4P46A 3VU2A 4WW2C 2HFEB 4Y5XC 2AK1L 3VWJD 3CC5A 4OSUL 3D6GA 1NEZB 2XXCB 3DV4A 4KROD 3MRBA 2J7LA 1R3HB 3QH3A 1DQJB 5DDHA 4TTDD 2J5LB 3SDYL 3MXVH 4W4OC 4J4PD 3VWJB 3D39E 4HWBH 5K59F 1A5FL 4Q9QH 5I1CL 4KHXH 2CPCA 1EX0A 4JB9H 4KROB 1A4JB 3UYOD 1QLRA 3JUYA 2D7OA 4FQQA 3I02A 1H3XA 5JZ7D 3EYOA 3L3HB 2R56H 2Z35A 5DGRA 4GH7B 1IMHC 4HF5L 5KTEH 4JZNA 3DO3A 3L5XL 1MHEA 4X8JB 3U7WL 4HC1L 2VXUH 2DN7A 3ARFD 3FN9A 4G8IA 4M4RA 2YPKB 1DEEA 1MAMH 2EDOA 2QHLA 4NSKA 4CMHB 5EOTA 3UC0L 4GW5B 5FUCC 4LSTL 4RRPA 3AB0B 3WBDA 2PETA 1MI5B 4LOUD 1D5BA 3ARFB 4CVZA 4LCCA 2R0KH 1NANH 4YAQB 2DWEB 2WBJD 1N6QL 4DEPB 5AEAA 1LNUB 2JE8A 4X6CA 2YD3A 1V5JA 2V6HA 5B21A 3RBSA 3V52H 1IC1A 4QRUB 3KHOA 4O00A 3BHBB 3ZYIA 1KN2H 2CJUL 1JWSA 2I25N 3WIFB 4WRLA 2WBJB 5BXFB 4X6EA 1L0QA 4RMVA 3QXTA 1BVZA 1WGOA 2EH7L 5ANMA 1T89C 3L5WB 5IEKB 1AIFB 4JDTH 3B3IB 5C0NC 1SJXA 4U1GB 2EZ0C 3BE1L 2Z8SA 3IFNL 4JFZL 4PTUB 2DF3A 4CVWA 3NA9L 2VQUA 1U91A 5HYFA 4M00A 1CDBA 4MQXC 5DHVA 2PTUA 3RJQB 1AP2B 1NCBL 4YO0B 5BRZD 3MJ7A 3MRLB 3MYJB 5D1ZD 3VGGA 4ETQB 4DGVH 1A6UH 1A8JH 5BW7C 1NCCL 2ESVD 2YMXL 2CKBL 1DDHA 4RGMC 3GMRB 4LRNH 2HJKB 3CPLB 5SV4A 3MRMB 4FQLH 2EXWC 5B3JE 3IDXL 5BRZB 5ADPH 2DQIH 1E27A 5D1ZB 3ULSA 3TZVB 1KOAA 3OR7A 5E9DD 3BT2H 4Z7VE 1X5ZA 1DSFL 1N3NB 3B2UD 1QHPA 2X4UA 4R8WL 3LS4L 4YNYA 4YHIB 5C0CD 1NMBL 3SPVB 1N64H 2XPGA 3RGVC 2KQNA 3S37X 5EZLB 1KFAL 2XN9D 2JCCE 1S9YB 4KDTA 2IEPA 3HG1A 5E9DB 1T66D 2Y7QB 1EMTH 1KTRL 3PWVB 5TE4L 2ARJQ 2BVOA 2GJ6D 3A67L 2DQCL 4PJAA 5FIEA 1FZOB 4MNHB 4OV5B 3SJVE 4P2RD 5D7IB 3S3PA 1NGWB 2YK1H 2I9LB 1EHAA 3U4EA 2OTWB 4NM4L 2XN9B 1RURH 4YUEH 1XGQB 2UUDH 1A14L 1AD9B 1ORSB 2A6JA 1I75A 4MHHG 3O6ML 4ENED 2H32H 2QV2A 3ORJA 3VFNB 5EOCH 3ZTNH 4E41A 3V7AG 1JF5A 2W1NA 5L2KB 2E27H 3DGCR 4MWFA 4BQ9A 4X6BB 1GOFA 1NCDL 2IFFL 3MRFB 4K23L 3TA3B 5JDJA 5DLMH 2GJZB 4EI5B 2W59A 1TJIH 1NCAL 2JB5H 1JFQH 2NY6D 4TQEL 3W9EA 2VYRE 1Q72H 1NQBA 3DYMA 2JB6B 3IDIA 4PJEB 4M1CD 1GGIL 2GUOA 4OCRL 4QXTB 3QIBC 2PYEA 4GG8A 2VIRA 4FXGA 4F7TA 4XVSL 5DA4A 3PDGA 2HJLB 1PX3A 1NMAH 2H2PC 1XGRB 3MR9A 4M6ML 4HFUL 5FYLD 3MLUH 2VDML 3G5VB 1KJVB 3IFLH 1WICA 2P8LB 2ADJA 2BXZA 5C09A 2ZJSH 1UKQA 4BH7A 4P3DB 3LN4B 1NH6A 1G7LB 3O8XC 5EU5A 1BJMA 4P2QD 1CFSA 1IAIH 4FFYL 4AEIL 3GSQA 4DJMA 1CT8B 4GAYB 3OXSB 2B1AL 2NY3D 1UVQB 3LKSA 3OJMB 5LCVL 1ONQB 5D1XA 3REWA 5ICYB 3O4LE 4OGXH 4FZ8H 2ZUUA 1ZHKB 4NQCE 3MNVB 2XKSA 3NIDF 2PTTA 5MHSE 3MRKA 5DRZA 5HHOA 4L8SA 1C12A 4J3UA 3P4MA 4ZSOB 4GSDH 5EORL 4AQOA 3O2DL 1GC1H 5C0JA 4ONFL 5CUSL 4QHKI 1MLBB 3J7HA 3T8XB 3RIFF 3F7PC 1YNKL 2IPTH 2QSQA 4NZTH 3TM6A 3L3KB 2HT4C 4HEME 5JORB 3QRFM 4TYUA 1FP5A 1INQA 4LSUH 5IVXA 5C0IA 3ESUF 1HNFA 2QSCL 3WDHA 4Y4KD 4C57C 1E4JA 4WUKL 5HYSG 1IBGH 3FQNA 3QDJE 4NZJA 1J0IA 4IHOA 4LVHB 1TITA 4LHJB 5DJDB 5HYQB 1EHNA 2HLAB 5T1DH 5E1AA 2I27N 5I16A 2Q3AA 3KYNA 1A2YB 3K1DA 2B0SL 4M7KL 3EOAA 3L9RB 4Y4KB 4KJPC 3MRCA 1HSBB 4XC3L 3QCVL 3W82A 4F9PC 1WFUA 1BVKA 1N26A 3S5LG 3GBNH 1HNGA 3NPSB 4B53A 1Q94A 15C8H 1FN4B 3G5YB 2IF7A 4HAFA 4H1LA 5KJRL 5C0AD 3HMXH 4JY5H 4CADB 1XCTB 3F5WB 1K8DB 5JQHC 2NXZD 1RUAL 2AV1A 2UVEA 3IDJB 3QUML 3QHZH 1ZHNA 1CFBA 3HE6A 2FZ3B 2IBZX 4XP1L 5DD0L 1R6VA 5FKAB 3GSUB 2QQKH 3UTTD 4EVNB 2RQ8A 2FJGB 3CXHK 5D7KE 5DMIH 4Z7QE 2GSIA 4OQTL 5LGJB 1Q9KB 3RWDA 4PJHE 3IJYB 2G9HB 5B38G 4FQHB 1P7QA 2FNBA 3UTTB 5D8JH 3QCUL 5HGHB 2AS5M 4G6AD 4LP4A 8FABA 4PR5A 4Y19D 3RZCA 3MPCA 2FD6L 4Y2DD 3SDCC 3P77B 3DMMB 1FFOA 1XF2A 1OL0A 2VLKA 1A64A 3PGDB 4WY7H 4QY8A 3KDMA 4XCNA 2CH8A 3C60A 4Z7VB 2IBGA 4Y4FD 3MLWH 4NNXA 3RIAF 4X99A 2ADGA 1WK0A 4FG6D 4Y19B 4Y2DB 5BJTA 4ISVB 1WJ3A 3K0WA 2J6EH 4O2EB 1YUHB 4QGTA 4DGYL 3MCKA 3CU1A 4G42A 2IPUK 4NO0D 2JCCB 1R24B 3C8KB 4ODTH 3C6LA 4XZUA 2XWJB 1D5MA 3SGDI 5E24E 5DMKA 3LVEA 4N0FB 3LH2L 5D9SA 4NO3B 1L7IL 1NGQH 1NUFA 3V95A 4Y4FB 2N4IA 3ZE0E 3VE0B 3CZJA 4Z7NF 3BH9B 2Y07H 5H37G 4OCMC 4DKAA 4Y16A 3PWNB 3OGCB 1VACB 1OGAA 2LQRA 2Z8WC 2ICWA 2BVUA 2VDOH 5DYOA 1FPTH 3K4AA 2KZWA 2W0LA 2OP4L 3L6FB 4X0KB 3KS0H 3MGTA 1G7QB 3IDGB 1S7WA 1I9EA 4K2UL 4EQ2A 3QFJD 2YXMA 3B9KC 2ZG2A 4P23D 3QUXB 4K71C 4NM8H 4I0PC 3VXTB 3ZKNC 2FATH 1R0AL 4M5YH 2R2HA 3VXSA 3MXWH 3D5OF 3OHXB 1IGYA 4U1IB 4XAWH 3THMH 4HWBA 5TQ2H 3QFJB 2R4RH 1OAKH 5EBMA 3RVUD 1K85A 4HMDA 4LMQI 5HGBA 1OARL 2AABL 3TCXA 5TE6L 3CFJB 2CD0A 4KH2A 1H9VA 3MO1A 5FGRA 3CXHJ 5I8KL 3U7YL 1HOCA 1ZE3C 4CN1A 1PYWB 4OF5A 4ZUSA 4FFVD 4MJID 4CU7A 4PP2B 1F3DJ 1T83A 3OGOE 4XCFL 4OUOA 4R90L 1V3JA 1YEIH 3A6CH 2NY4D 1WLHA 4BFEA 2ZOLA 2RHEA 2VR5A 1S7TB 1A7PH 5CJQH 4WV1C 5BO1H 1PKQB 1CGYA 2O5YH 4YGVA 1DQML 1IGMH 2P1YA 1P4LB 4MJIB 3T0EC 1BF8A 2JJTA 2X9WA 4PJXE 3ARDC 3WN5A 2XT1B 3ZDZF 4JKPL 3H7LA 4NQCB 4F7CB 3BKYL 2C26A 4HIJB 5EIIB 4BK4A 3DRQB 1BQLL 5D7JD 2G75B 1ZS8B 4NOBA 5I19L 3JTTA 1YN7B 4JFFD 1RIHL 3DYPA 3RWFB 4KRPC 4MDJA 2D7TL 4GKNA 1I9RH 4HZAA 3BQUD 4WIQA 4DTGL 2J8UE 1UZ8B 2AW2A 2NY1C 3LAFA 3CMOH 1SVZA 1EGJA 2VQ1B 3KPMB 1DVFD 3KJ6H 2WUCH 4LAQL 3E3QE 4S1QH 2WV3A 3LSOA 3KLAB 5BQ7A 1LD9B 1NGXA 5D96C 2OLDA 3O11B 4OCXL 4XMLH 1MREL 2W0PA 2O61B 3QDJB 4Z77B 5E70A 1JTPA 3CU7A 1OP5H 1BQHB 1BGXH 3ARGC 3T0XA 1AR2A 2GQHA 4LAJH 4YXHL 1NCNA 3KYKL 1DVFB 1BECA 5IMLB 4XBGB 4XPBL 4FP8L 4I0KA 1FORL 1IAOB 4J8RA 2HAZA 3QP3A 3EYQC 3FRUA 3LQAC 4PJGB 1HZHH 4LHUA 5J57B 1UWEL 1F3JA 1FCGA 4QNPF 4JPKL 4MLIA 3VW3L 3ARVA 5DJ0B 2IWGA 5E5MA 2NMSA 3IETA 4KV5E 3KPTA 1G7MA 1JMZA 2X4NA 4U7KA 4BQ8A 3L3IB 5GGTL 1UEMA 3VG0L 1CICB 4HPYH 2E9BA 1YY8A 4UUJB 3C9NB 5HVGB 4PGEB 1KCRH 3MBEA 1D5ZA 2O26U 4NGHL 1EUUA 4IIQA 4K9EC 3NAAH 1C5DA 3FB5B 4FQJL 4YWGL 1QQDA 3WUWA 4Z7UE 1I85A 3FQWB 1DN2A 1OWRM 4YDLC 3MUGB 4EDWL 4LNVA 3X11A 4CBPA 2H32A 3VWKD 5CEYB 3FB7A 2CDEA 1J05B 1EEZA 1QOKA 3JTSA 3EDJA 1MCDA 2YRLA 1JZ5A 3V6ZA 3O41A 1ACYH 2MTPA 3X3FH 3VWKB 4UT6H 5DJZA 2ED9A 5HSFA 1FCCA 5DQ9A 2F53A 4U2YA 4TUJA 4PBVC 4P3CL 1UFUA 1H3PL 2G5RA 3GB7A 4NDMA 2X44D 2ZUYA 5DUML 5B39B 5IEHB 4ZTPL 1YZZA 2W9DL 2D7MA 3P0VH 3QIUD 2VXTL 4L9LC 5KAQG 3KLSA 2APFA 3VFTA 5K9QG 1BVLB 4ZS6C 2CMRL 3LRGA 1FO0L 3WFCL 5FB8A 4NBZB 1LO2H 3IJHA 3QUZD 3CVIL 4MNQA 4NYLB 5DI8A 5JHLH 3VMNA 3QIUB 1CDUA 4MX7A 4LLYA 4JO4L 4F7EA 4UTBL 3N50A 4QRRE 4Q2ZA 3LMJH 4EN3C 2VXSL 4LGRB 4J3WA 2VABB 4QHUB 2QJDA 5CEZH 1S8DA 4BQ6A 5D7IF 4M4PA 3RWCB 3A6OA 1JPFB 1MCOL 4OI9A 1U3JA 3WNKA 3OAUH 1BIIB 4FMKA 1WBYB 1U8NA 3BEVA 4R7DB 3BWAA 2EYSA 2WUBL 3MLVL 1E4WH 1CXEA 2FBJH 1EERB 2OXGA 5E2TH 3FO1B 3PP4H 4M93C 3OWEA 4KK5C 3VGHA 3WS3B 1MUJA 3B5GA 4DGIL 5HHPA 3V0VB 2R8SH 4PJEF 1I8IB 2BSSA 3CFCH 5BV7C 2R1XA 1T2QH 2L0DA 4MNGE 5E00B 4GMTH 1D6EA 3SDDC 5L9DH 2I07A 4V1DA 5DRWA 4KKLC 5J11B 4CVUA 1I1AA 1BJ8A 4Q74A 4R96A 1SBSH 4M7ZB 4TTGA 4WFGE 2HG5A 1EUTA 2X70A 1XFPA 1ES0B 3GGWA 1XGUA 3QBTB 1FDLL 1U8OA 1WCBB 5C3TA 4Y7MA 4PJXB 3SKNA 4U6HA 4HFWA 3HCVB 4F37K 4U7MA 4GUPB 4Q6IA 3V6OA 5I2IB 1YY9C 1P4IH 3HMXA 4DOHB 3DJ9A 3HLAB 2VDLL 1M4KA 2DQJL 4HIEA 1RQ5A 1D9KB 43C9A 4L4VA 2GKIA 1OT2A 1WZMA 5GGQL 2NY2D 3MUHL 3HI6L 4F33B 3GIVB 3GHBL 1TMCB 1G6RH 1J1OL 3TN0C 1X7QB 3HS0B 4HBCH 5DEZA 1KPVA 4Y1AE 2NLJA 3TO2A 3MRRA 4XRCA 4QRPD 4PGJA 4R97B 2X4TA 4JKMA 5DC9B 3FONB 2WLZA 2Z31D 1WEJH 1SYVB 1KIQA 4U1NB 3SGDH 5IMOA 5FXCH 4N8VA 1IRAY 4M62H 4XH2B 3FQUA 4HSQA 1SEBB 2XA3A 2ED8A 5C6TL 5GS1B 1GAFH 1ZHBB 4GBXD 1M05A 3AU1B 5EN2B 4QRPB 2EYRA 3SBWA 3WFHB 3PV6B 5E2UH 5EIQA 1FZKA 5IESH 4NT6B 4UDTB 1JHLH 2GITA 1RJLA 3TCLA 2P45B 1B4JL 3KXFE 3D85D 4KZDH 5IIEA 2J6EA 4F3FB 1IGCL 3EDEA 4GBXB 5T33H 1FVEB 5FYLH 2OZ4L 3IDNB 4XPAL 4GT7A 4NN5B 1NAMB 5DURB 2VLME 1FZJB 3DSFL 3DX6A 4N8CH 4QYOA 5IB5B 3D85B 4I3RH 2HMIC 4N9GB 3I2CL 1RZGB 1MQ8A 1A7RH 4M1GL 2PO6D 1NEZG 2HTLC 1NL0L 1BD2E 1GZQB 4G9FA 2AJVL 4HLZG 2EH8L 1PD6A 4L8SC 3EOYG 3MA7B 1G0DA 1EEYA 2W65B 1KB5L 5GGUA 1VERA 5EO1A 4Y8AA 1X6LA 4NCC2 3QUYD 3PJSB 5FHBH 4NP4L 5DZLA 1HDMB 3G08A 4HGMA 1QFPA 5CKAA 1NPUA 3JV6B 4P2CG 3NA4A 2NY0D 4ZPVA 1KT2B 5D5ME 3ZMRA 4OCYL 1V3LA 3C2AH 1CF8H 2ATKB 2XY2A 3QNZA 5IROC 1CK0H 1J87A 1JF6A 5BVJA 3WNPA 1HXYB 5I1IL 4PJ9B 5HI5D 2XICA 4LLQA 2V2TA 5CJOL 3PQYE 2APXA 1OVZA 1JGUH 4Z7VF 1C16A 2MKWA 2ZSVA 3VCLB 1ADQL 1AI1L 1P6AB 1MIML 3T3PE 3D0LA 2XNAB 1LO3H 1KLFA 3U30B 2CKNA 1UCBH 4ZMAT 1UH3A 3ARED 5TDNB 1UB5B 3MLSL 4H8WL 2AGJH 2E7MA 3JBG7 3QDME 4HCRA 4WI2A 1WISA 5LGHH 1GRWA 5ERWA 2YPVH 2AV7A 2BNQD 3V6FA 5E2JA 4X6DE 4DK3A 1NBYB 3NCEB 4Z78B 4F7MB 5D2NB 2VWEE 4LPCA 4ZQKA 1P7HL 1QPPA 1CLOH 4JQVA 4JM2B 3E6HB 5IFHL 4JFDD 1OPGH 2BNQB 3WD5L 2H1PH 4OLZL 3ULUD 1T0MA 2D7PA 3TIEA 3MRGB 4HGWB 4ZAKC 2F58H 1UM5H 2EO1A 5KW9L 2AERT 1I3UA 5HHVL 3BFOA 4DKEL 5FF6A 3HAEH 5F6HI 4JFDB 1KELL 1BF2A 1KNOA 4W6XB 4WFGD 3SQOH 2EDFA 2LTQC 3VXUE 35C8H 3LY6A 3ES6B 3LDBC 4MNGB 1V3KA 2EDKA 3ISWA 1OB1B 5ISZE 3RTQA 4TSCL 3LZFH 4XNMA 1S5HA 1XIWB 5DJ2A 5CEXB 1CG9A 4OCNC 1QNZH 1CLYH 1XF5A 2LVCA 3RRQA 3CVHL 3N1FC 1FLRH 4HV8B 4PJ8A 1MOEA 2B1HL 3MRNB 3PIQA 5EU4B 3CSBA 2FO4A 2NW2A 2VNCA 4NFBA 2BFVH 4X9GA 2W0FA 3L3DA 3REVA 4F7PB 1H0DA 4HULB 4LVOB 4LCUA 1YEKL 4JY6B 5EPMB 3BGMB 5FKPA 5JA9A 4F57L 3GSVA 5AWNH 4GW1A 2P7TA 5FO7A 4XP9L 1CI5A 4GXVH 5CGMA 5JMRA 4FFWC 2HFGH 1A7NL 3P9MA 5ELIA 1KCKA 4YBLC 3V8CA 4HK3N 4OZ4B 2JJVA 1HIML 5HGDA 2X1OA 5AZ2L 1P1ZB 5EBGA 5FM5O 1VFBA 2P5WE 3GUTB 3D48R 2N7AA 1R3HA 5EB9A 1DQJA 5IP4A 5FO9B 3FFCE 3RJDA 4HGKC 4Y1AB 2QTEA 2L7UA 3VWJA 5FV2A 1VDGA 3K7UA 1AXSB 3KYOB 1JCKA 1AE6H 4YC2B 1TJHH 3BUYB 1P4BL 1QBLH 1NGPH 1TVDA 2FGWH 4O51B 3V5DB 2CIKA 4LVNC 1DR9A 3MRIB 4J4PA 4XPHH 3STBA 4X8JA 3KYAA 1V7MH 3HE7D 5DEGB 4L3ED 4FQXC 1IL1B 3RVTD 1KPUB 4PJ5E 1YYLH 1JPTL 4W68A 2BDNH 1A7OL 4YXKL 4CJ0A 5A2KH 4PV8A 3MJGX 4GW5A 4OFIA 2X4RB 3UYPA 4PJGF 5GHWH 2IALB 4WU5A 3HE7B 3ARFA 4FFZL 1FVCB 4TOYH 4Z6AT 4HUNB 4JHWL 1BD2D 4AIZB 2VAJA 2X1WL 5MERB 1LNUA 1I9JH 1LEGA 4G9DB 4HPOL 1C8PA 3U4BL 3I6GB 1MCJA 3EYFB 3NH7L 4XVUD 4NHUA 4UINL 5IJKA 2YWZA 3T1FB 3IKCB 2NQCA 1BD2B 3WIFA 4MQ7A 2WBJA 2VDNL 4R4NC 5BXFA 3FO0L 4XP6L 1IM3B 5EBWB 3QWRA 1SJEA 3L5WA 2BOBA 2A0LC 1AIFA 2Z91B 3M8OL 3U0WL 1AY1H 2VUOA 2GCYA 4RZCB 4Z7QF 3SHSA 3WL9A 3NABL 4ZOEA 4FZEL 4NQXB 4PTUA 3Q6FA 1C5BH 2VLRE 2GT9B 3AS3A 2QSTA 3RI5F 2YKLL 25C8H 1AP2A 4WUUE 5D5MB 5DRXB 1GGCL 3MRLA 3GMPB 5ENWA 3RA7L 1KGCE 3LPGA 3ROLB 4UZGA 1TJGH 4DZ8A 5ID1B 3STLB 1I7RA 2HN7A 5J3HD 3PQYB 2IADA 4OLYL 4AZ8A 4C56D 3ET9F 4XHJD 3CPLA 5BRZA 1BFVH 3EKCA 1OAZL 4LASH 1QSFE 5D1ZA 3TZVA 1GGBL 3R06A 5T3XE 3B43A 3QCTH 1N3NA 2ESVA 4JPVL 3SDAD 5MENE 4YHIA 3FRPA 2AK1H 1U58B 3SPVA 2Y6SC 4EZMA 1A7QL 1P69B 3RVWC 5I0DA 3QDMB 3QEQE 4OSUH 3KPNB 4KJQC 3BPLC 4W4NA 5EZLA 2H8PB 5I8OL 1VGKB 4GRMB 1MIEL 2EC9U 1PW3A 2QSVA 5E9DA 1KJ2L 3SDYH 1EPFA 1QZ1A 5C0CA 1FZOA 4OV5A 5D7IA 4HG4K 1VFAB 1NGWA 1UWGL 3GSNB 2XQYG 1A5FH 4N0CD 2I9LA 5I1CH 2OTWA 3RAJL 2XN9A 1AD9A 4FQIL 4XVJL 2AK4E 2GJ6A 3KLHD 4HF5H 1ZGLM 1FC1A 4P2RA 3L5XH 4HZLB 4X6BA 3U7WH 3MRFA 4G8GD 1AR1D 3V0AC 3P4NA 1SYSB 3PGFL 2GJZA 4X8XA 2XRAL 4GLRI 3BKML 4MA3B 2GY5A 3VXUB 3UC0H 2LE9A 1X5HA 2W60B 3EFFB 3BMWA 4AM0A 4LSTH 2NTSP 5ISZB 4G8GB 3TF7C 2HJLA 1FO0B 1XGRA 3DETD 1S7RB 3WO3B 1N6QH 2VE6B 4K7PL 3G5VA 5TH2A 2VL5A 2P8LA 3DX7B 5EZJA 5FUZL 1T80A 1NBVL 4R0LC 3ULVC 3LN4A 2DQUL 3GZKA 1G7LA 2CJUH 5F1NB 4KMTL 3NN8A 2BCKB 5J6HA 2A6DA 1YEFL 1TCMA 1BPVA 2YD1A 4KQ3L 5GRXG 1CT8A 1DANU 1ETZB 1MSPA 5EZOH 4KVCL 4PJXF 5HBBA 5B8CA 4UTAL 3LQAL 3Q5TA 4PRBA 5CBEB 1ONQA 3UJJL 2JIXD 3IFNH 4JFZH 3MNVA 4WW2B 4Y5XB 5E8EB 4P2QA 4RAHA 3DXAD 3NA9H 1A21A 4JJ5B 2DKMA 4LPXA 5CCKL 2HFFA 3TP4A 1NCBH 4ZSOA 4OGAC 4LEOB 3QQNA 3FFCB 4NKIL 1M1SA 1G7JA 2JIXB 3RWIA 4UOW0 5JXEC 2DQFB 3SE3A 3LCYA 1NCCH 2YMXH 1R5WA 5GSVB 2CKBH 4R7NA 3V7MA 1CIDA 3L3KA 4K9EL 5JORA 4U1JB 3IDXH 3O6KL 4URTB 3RUGF 5H37H 4GQ9L 1RJYB 1EBPA 4WI8A 3FL7A 5KSVA 1DSFH 1M7XA 4R8WH 5GGRA 3LS4H 5A2FA 5FUOH 1NMBH 4U2ZA 3RPKA 1X4ZA 5KSBE 5HHNB 5JHDE 5HYQA 5DJDA 1CDYA 2YD8A 2CQVA 1HQRB 1KFAH 1E0OB 2J8OA 1L6ZA 2DM3A 1A2YA 2EIZA 4X5WB 5TE4H 3BZFB 4JFYB 1JNNL 3L9RA 2YS4A 4Y4KA 2DQCH 3UJTL 3QQ4B 4IRJC 3U82B 1OCWH 2AJUL 4KV5F 1W8OA 1RUKL 4M61A 4NM4H 3TH3T 3V9FA 3G5YA 4I18B 3MRHA 1A14H 4JZJC 3MLYL 3O6MH 3KJ4C 2CUHA 1ZWIA 5C0ND 1OD7A 3F5WA 1K8DA 3GIZL 2EZ0D 4OD1H 2VLRD 1Y0LA 1YC8A 1QEWB 2IFFH 1NCDH 3IDJA 2D0GA 4K23H 2XG5A 4LCIL 4K94H 1ZKAA 4JGJA 1I3RB 1MWAL 5DVOA 1NCAH 2OMBA 2FZ3A 4KI5C 4MQXD 5LXGL 4TQEH 4J3VA 4XX1E 5FKAA 1KTDB 3GSUA 5C0AA 5TGBB 5C8JB 1GGIH 3N1MC 1GL4B 4OCRH 5D71L 2VLRB 4XVSH 4YX2L 1IARB 4XNZB 2E7HA 5C08E 3CXDL 2GSGB 1Q9KA 3QWOA 3IJYA 2FIKB 4M6MH 2G9HA 4HFUH 4XCYB 4FQHA 2VDMH 4X9FA 4JZOA 1QSVA 2EXWD 5L0QC 3HAEA 2H9GB 3LN9A 4NZUL 3UTTA 5E6ZA 5J56B 3VXME 2V9TA 1GH7A 1ZT4B 5JNYB 4LCYB 2W0KA 4F15B 1HILB 1BQHG 3P77A 3W0WD 2GFBB 2XWBB 4FFYH 4AEIH 1LP9B 4RGMB 1QSFB 1CTOA 5ESVB 4PGBB 5MI0C 2B1AH 3DX9B 2APWA 4JFXA 5LCVH 4GW4B 4JGMA 5GS2D 1B9ZA 4Y19A 5CFHA 4Y2DA 2X1QA 4ISVA 3QWQB 5BV7L 3TBWB 5DSCB 4O2EA 1YUHA 3QEQB 1JL8A 2RJMA 1XEDA 5JO5B 4K3DL 2E6JA 1R24A 3C8KA 3RGVB 3PWUA 2OM5A 4H88L 2XWJA 4N0FA 4ZDHA 5EORH 4YK4C 3O2DH 2FJHB 1ZA3A 4NO3A 5I9QC 4ONFH 4Y4FA 5CUSH 1WFOA 5D1QC 3CAFA 3VE0A 4UIKL 5EUKA 3WXVL 3DARA 4AEHL 1KB5B 3OGCA 4X4XA 1I8KB 1YNKH 3D2UD 1I3VA 5CWSB 3L6FA 4NUGL 3L5HA 2AK4B 1G7QA 4HKJB 1BOGA 3IDGA 3UAJC 5IHBA 2OTUB 5HY9B 4JM2F 4NKQB 3LD8C 2VB5A 2QSCH 1QHOA 3CX5K 4WUKH 3QIBD 1BX2A 4F2MA 5KZCB 3OHXA 2YZ8A 2ZUTA 1U8HA 2H2PD 4MVBD 4WDIB 2HKFL 4NNYB 3QFJA 3G9AB 4P23A 1N59A 2B0SH 4M7KH 1CTNA 1S7SB 3ULUF 4XC3H 3QCVH 3FO9B 2AEPL 4NC2B 3O8XD 3QG7L 3BRGC 5DUBB 2XFXB 2IMNA 5GJTL 4JFEE 1KYOJ 3O6FD 1PYWA 2XTLA 1Z0NA 1U42A 4YHML 5TPWL 4LKCB 4PP2A 5KJRH 4NKMA 2MNUA 3TIDA 3I6KB 4UNTA 5AUMB 1RUAH 3QUMH 1FFQA 2CLZB 1S7TA 5EUOA 4BK5A 2BY2A 1PKQA 1T3FB 2Q87A 5JXAL 4XP1H 4MJIA 5T5NG 3CFBB 5GSRB 5I1EL 1EV2E 2BMKA 4F7CA 5EIIA 1MJ8L 4M8VA 2ZZUT 4OQTH 3DRQA 2CDFB 3EDFA 3DUUB 3NFNA 1AGBB 2E7LC 5CD5C 1KJ3H 5GS0C 2HT4D 3OMZA 4RX4D 1JNHB 4X9BA 2DKUA 4YHYB 1PBYA 1OY3B 1U8IB 3QCUH 2QQNL 2GEEA 2XZCL 1VFMA 5ID0B 1UB6B 2FD6H 5D7JA 1U95B 2IPUG 4A6YB 4WFED 1TTUA 5E5UB 3RFZC 4JFFA 1FYHB 2DJ4A 3KLAA 1LD9A 2PW1A 3VI3E 1EFXD 3F8UB 3VG9B 1S9XB 3ULUH 4PRHE 4F37F 3BZ4B 3BQUA 3O11A 4NQED 1T22A 3NFPA 5KSBB 4KJPD 5JHDB 4G6FB 4DGYH 2P42B 1LO4L 5F9JB 1DVFA 5IMLA 2JJSC 4UNVA 5IG7A 4TVPE 5C2UB 2RB8A 4XAKE 2UYLA 1Z9SA 4PJGA 4NQEB 3QA3B 3BAEL 4EXPX 5FYJE 1KLUB 2OP4H 4ONHA 5DJ0A 4O2FB 1T04B 1F2XK 5C7XL 4K2UH 4YR6A 4D9QD 1U3HC 3HMWL 3L3IA 3UMTA 2Q7YB 1BJ1J 4GLRH 4UUJA 3B9AA 3VFMB 4L9DA 1R0AH 3C9NA 1RHFA 2AKRB 4PRPE 1GGUA 4HKZB 5E6IC 2HJFB 4JM4L 3FB5A 1J8HE 4YFLI 3SN6N 5E8NB 3RDTC 3MUGA 5FDWB 4LLAA 3VXMD 3PHQA 4AIOA 3MOQA 4QWWC 4LVEA 1H5BB 5CEYA 1OARH 2AABH 2UWEF 3SDCD 1J05A 5ADOL 4RIRB 5I8KH 1RSFA 2HP4A 3U7YH 2VUYA 1ZT7B 1M71B 1I1YB 5D6DC 2X89D 4PS4L 1UADC 5D5MF 3VXMB 1IQDA 3F6IA 3LQZB 5T3ZL 3VWKA 3RWEB 1U92B 1LVEA 5IK3B 5HI3C 1BEYL 4P5TC 4XCFH 4EI6B 4R90H 1A9BB 5FEBA 3WHXB 1CDCA 1T21B 5B39A 5DTFB 3MCLL 5IEHA 4LPTA 4JO2L 2WLYA 4BKLA 2XTJE 1DQMH 4APQD 3MLTB 2IAMB 5HGAB 5KVDL 1WUNT 4JKPH 3TPKA 2UY6A 5EU6D 1I7UA 3BKYH 4BZ2L 1II4E 2H26A 1BQLH 1NUDA 3DBXA 1FH5L 3K4DA 4MD5B 4U49A 5I19H 3PHOB 4NYLA 3FN0L 3QIUA 5FA4B 2FO1A 3HI5L 3OAZK 3PWLB 3TLRA 2WSKA 1W72L 1TQBC 2D7TH 3B9KD 5EU6B 4I0PD 4QHUA 1Z6JT 4F9LA 1JN6B 3ARBC 3ZKND 4DTGH 5EU3B 3BO8B 3QUZA 5JUEL 4X6CE 1WF5A 1JPFA 2DLFL 2VSDA 4LAQH 4NCC1 2DI7A 5KVGL 3WLWC 1BFSA 3PP3H 2FBOJ 1WBYA 5GRZA 4K71B 4OCXH 4I0PB 3ILPA 1MREH 1RJCA 4BUHA 2XACC 3ZDXE 1A1OB 3NIFE 1TVHB 2CKBA 4YXHH 3KYKH 5F1SA 5JMOC 1A4KA 3MGOB 2KPNA 4L3CB 2F19L 1LEIA 1TVBA 3CK0L 4XPBH 4FP8H 3B9DA 1FORH 2Q7NA 3WS3A 3QZWA 1ZLVH 3EO0A 3V0VA 2KQMA 4HXAL 1I8IA 1UWEH 2DJSA 1YJDC 3TVMD 1IJ9A 4JPKH 4JFEB 3VW3H 4JVUA 4PY7B 4KKNA 5E00A 2XZAL 4OZGA 3AY4C 4PGDA 5HDLA 3IAPA 4KRMB 4KTDL 3WDJA 5GGTH 3VG0H 3D87B 1MCBA 3T0ED 3ARDD 3TEUA 4HUUB 1QLEL 1RVFL 3WO4B 3UO1L 5I73C 4NGHH 4Z5RB 5D6CB 1FJ1A 3TFKC 4WV1B 1CGWA 1SMOA 4FQJH 4ODWB 4YWGH 3O9WB 4R2GC 5IBLC 3T0EB 4KRPD 4EDWH 4EUPB 1Z9OA 2YEZB 4FQ2L 1CS6A 5AAMA 4IOFC 3B9EA 3I75B 1FE8L 2BVQA 3HLAA 4OIAA 1N6VA 4LFHG 3RVXC 1X4YA 4WJ5A 4WW2F 1IAKB 4Y5VA 2NY1D 3N1PC 1D6VL 2X7LB 3HG1E 3WHE0 1U3YA 2I26N 5KS9B 2NY7L 4KRPB 2J88L 1WSST 4XPFH 4F33A 3GIVA 3WCYA 4PJAE 1MNUL 3QEHA 4LSQL 2NR6C 4KJYB 3C5SB 3HS0A 1H3PH 2XWTB 4G43B 3OJ2C 3ARGD 5DUMH 4OJFL 4ZTPH 2WM0A 2W9DH 2G2RA 3CFKB 3RUGA 4LLUB 4G6JL 3IFOB 4E41E 2VXTH 4I4WB 4B0MM 1SYVA 2YBRB 5D96B 4YHKL 5CJBA 3EYQD 2DBLL 4PGCA 5IB2B 4TSAL 2CMRH 3WFCH 1FO0H 1HWHB 3ARGB 3E1F1 3LKPB 5GS1A 3UPCA 1ZHBA 3CVIH 3AU1A 3EOTL 4QRPA 5EN2A 2WIMA 4RGNC 3WFHA 2H3NB 3PV6A 4JO4H 1J1PL 2HKHL 2Z31A 4UTBH 2PYEE 4OD3L 4UDTA 2VXSH 5GZOC 3SKJL 2GTZB 5DK2B 2Z4QB 2K9UA 3FB8A 4XMKL 4GBXA 3T77B 5IWLA 2FX7L 1MCOH 5J12C 5C09E 9CGTA 3AAZA 1FZJA 3O2DA 2IG2L 2IMMA 4DAGL 3Q3GA 1J8KA 1MCLA 5IB5A 3D85A 1HHJA 1UT9A 2BOCB 3S7GA 3MLVH 4UV7L 5E8DL 2DOCA 3TPUB 3TBSA 1KIRB 2P44B 4BFIB 5HPMB 4LF3A 5AD0B 4BSWB 2H2SC 1GZQA 4P46B 1P9MC 4GKZB 4DGIH 3CC5B 3MA7A 2W65A 4MQSB 4ZOCA 5HHOE 1QLFB 4ZODA 4D9LL 3MRBB 3PJSA 1WFNA 3QH3B 3VFOA 5DDHB 2DAVA 2PO6A 3VXPA 3NOIA 4BJLA 4MA1C 3JV6A 1KT2A 4M5ZL 1WZ1L 3UTPD 1XGTB 4Y89A 4WGWB 3OXRA 2R23A 43CAA 4C59B 2J4WL 4B41A 5J4MA 4FQQB 4ZS6D 3I02B 3EYOB 2XTJB 5DEFB 1HXYA 3EJJX 4M6NL 3PF2A 1FDLH 3I6LD 1CE6A 1LP9F 5IVXE 2A6KA 4UILL 4JCMA 2DLEA 1MHEB 4MAYD 1F8TL 5CZXC 4G8IB 4EN3D 1DEEB 3VCLA 4NSKB 5TFSL 2VDLH 5EOTB 2DQJH 3RVVD 3QUMA 4IOSD 3QDAA 4P5MB 1DFBL 5F9WC 1MWAB 5GGQH 4ZG1A 1CXIA 1UM4L 2RR3A 1D5BB 4TPRL 3HI6H 5CLWA 4LCCB 1J1OH 4FTVD 2O93L 5F7UA 3ULVL 3P4OA 4X6CB 5EWIL 4OQTA 4Z78A 4MSWA 3RY6A 1A22B 1I8MB 4F7MA 4QHLB 3AREA 5D2NA 1BIHA 3C09B 2OK0L 1XCQB 3H2WA 4KK5D 1HEZB 2BNQA 1MF2L 2BP3A 4HGWA 4FXLA 5C6TH 4P4KC 3VFRB 1CN4A 4FN0A 1BBDL 3SDDD 2NXZC 3B9VA 3GNMH 3WFEL 4M93B 4JFDA 4KKLD 1EZVY 1U91B 2SEBB 1B4JH 2YD9A 5DHVB 3TT3L 2H41A 1CZ8H 3MJ7B 1IGCH 1T1ZB 5BS0D 2OZ4H 4XPAH 3SDDB 1XIWA 1I3GL 3BPOC 1HHGB 1QG3A 3T2NL 1JYNA 3KAAA 3OTTA 2JJWA 3DSFH 1MH5A 2W07A 4NOFA 4HWUA 3I2CH 1TZHA 3W39A 1YY9D 4HV8A 2VXVL 2VLKE 3EIFA 5D7SL 2XY1A 1DBML 1E27B 3EDDA 3SCMC 4OZFB 4JPIA 5DHYA 4G6AC 2NY5C 4M1GH 2QHRL 3HRPA 2X4UB 2AJVH 5DGQA 2EH8H 5EPMA 3VFWA 5I74C 4IS6B 4KFZC 2Z93A 5GS2H 4WFFE 1KB5H 4BUGA 4FOMA 4KQ4L 3TN0D 2N7BA 4I9WD 2V2WA 1EVTC 3O2VL 4NP4H 4U1LA 5CP7A 4YE4H 3IDYC 3JV5A 4PJAB 3GUTA 2M8X