5D5MF

Structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
b'GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mF02
3MBXH 5D1ZD 3FCTA 3HZVA 2ZCHL 4G3YH 5CKGA 1UACL 4XP1H 3GRWH 4MCZA 5D8JH 2HVJA 3CZJA 4CNIA 3ZTNH 4MD4A 4U6YB 3S96B 1BQLL 3BKMH 5DEFB 4DW2H 2F58H 5L7XH 1QBLH 4OZIE 5ANMA 3BW9A 4KZDL 3OKOA 5D2NA 3VGHA 3ZDYF 4F37F 4FQXA 4NKMB 2F53A 2P8LB 2A83B 4G6FB 3VXRE 1OTUD 2I25N 3WE6A 4KKAC 5LG1A 3SE8L 2GSGB 2DQGH 4L29A 2R69H 3E6FA 3WNPA 1JNNL 1AGEB 1OSPL 4IJ3B 3DARA 2WSKA 2R29H 4YHKL 3LH2H 1J1OL 3PGFH 3KNBB 3GBML 1RZKL 4FZ8H 5DA0B 1UH2A 3FB6A 5EZLA 2VDKL 3DX8A 1FO0B 1T0MB 1BQHG 1JZ2A 4B50A 2Z4QB 1BM3H 2EE6A 3WUWG 1DTUA 4KWUA 4I2XB 5KS9A 4XC3L 1F4XH 2H26B 1HZHH 2OP4L 1EK3A 5J12B 1J7VR 1B6UA 1WISA 4Z7WA 3ARTA 2WWMD 4BZ1H 4PJ5A 4Z8FL 4OI8A 2B4CH 5GGQH 3EGSA 5DXWA 5DC0A 3D69A 4OQTA 2GK2A 1OQXA 4YBLC 3ARVA 3MXVL 3HE6C 5KTEL 1KSRA 4DKEH 1CD1A 2YPLA 3T65A 3OJVC 2BFVH 4PREB 3IJHA 2O5XL 1ITCA 4HKXB 4R3SA 5DO2C 4BZ2L 4FNLH 1S9YB 2ADJB 5I1JH 4P2OC 1P4BL 2ICWI 2DL9A 2HJLB 3GBNH 3VFWA 3MRNB 1GJIA 3STZA 1PJ9A 4WJ5B 3G04B 5FFLA 1NMCB 3QDME 4H1LH 3DVFA 3IGAA 4UNTA 1LD9A 5HHME 1KC5H 5INDB 2XWBB 3GSQA 3ZKMD 2Z9TA 2BZDA 3VXUA 5JPNA 2O61B 3G08A 3OKLB 5IM7B 4M43L 3W81A 4LHUG 4ZDHA 1T04A 3IKKA 1DZBA 5L9DL 3HMXL 4Z7OE 1P4LB 2CXGA 1DQJA 4X7SH 3NABL 3GMLA 4NQSA 3ZL4L 4MA1C 3HC3L 3LB6D 2DM3A 3J8F7 2QADB 2ZOLB 2HWZH 4PYGA 4RA3A 5GRJH 2PUQT 2P8MB 1EVTC 1QACA 3FHQA 6FABL 3GNML 1RUKL 3MNZA 3OKMA 5BRZB 4PJ9A 1GGBL 4FQXD 5KSAC 5KZCD 2XRAH 3T1WA 5E00A 4XNMB 1ACYH 4NFBA 1F8TH 1QVOA 3FQWA 4GW1A 3C2AL 1OLZA 2E6JA 3TJHC 1MUJB 1TCMA 3MLUH 5EA0L 1CBVH 5IVOA 3GMNB 5D7IE 4ODSH 3H9ZA 4CN1A 1TTGA 2ICWJ 1ND0B 4MB5A 2WIMA 3PWPD 5EBWB 1BZ7A 3TYGL 1ZV5A 5FV1L 1JGEB 5DGRA 2EDFA 2NW2A 5EZJA 2FH8A 2XZQH 2LU7A 3HI5H 5J57B 3W5NA 4IDLA 4PJ5D 2HG5B 1CLOH 4JQXA 4GXUN 3T09A 2E5EA 2YPLD 5IW6A 3IFNH 4HIHA 1M71A 5EOCL 1T6VN 3LCYA 3T08A 5J11B 1HE7A 5ILTL 3K2MC 1CDGA 5GGVH 5IBUG 4HS6B 5FUZH 3TPUB 3I02B 1KELH 4MJIA 3CFCH 3ARGA 4FQCH 3AREB 4LCWB 5F70A 1DANT 4M93B 2D0HA 2FLRT 4LIQH 4NBXB 3T2PA 1ORQA 4KKBC 2XFXB 5FM5O 3DSNA 3ES6A 4ZAKC 4G9FA 1VGEH 3V7AE 1T89C 3HNSL 1AQKL 3RDTC 4Y2OA 1BZQK 2YEZB 5A1AA 5H35A 5L2JA 3HC0A 3V4UH 2NYYD 4ZOAA 1G7HB 4CVWA 2BNQA 5EU4B 4JQVC 4XTRC 3VXMA 4G80B 5GPRA 2EE2A 5FO7B 3ILQC 5H94B 3B2UC 4JG1L 4OAWB 4FQJL 1RI8A 4NKDA 2YR3A 3OR7B 4EEEA 4JO3L 4LLUB 4EI6B 2RCSL 3QO0B 4U3HA 1T7XA 2E7MA 4PJ9D 1MREH 4OZFH 1MY5A 1KENL 3I6GA 1ZLWH 3QUZB 1IAKA 1K4DB 1T1WA 5HHQB 3BO8B 1BFTA 3L3KB 2WUBH 2KPNA 1KB5A 5T5FL 4F9PC 3F62A 4RISL 3RI5K 4B0MM 3B4NA 2R39A 2ICEB 5JW5A 3UTPE 4DZ8A 3O6FA 5I6XC 3RZCA 2IPUG 4LCYB 1DP0A 5AZ2H 1DSFH 1O7VA 4AMKH 4J1UA 3LN5B 2IAMC 4P2QA 4PJEF 3WIIH 3OAUH 4BZYA 4H88L 3S97C 3B5GA 4FP8H 2YHGA 1UM5H 1C16A 3TZVC 5B3JE 1T0NA 1I75A 6CGTA 3BQUB 4ZOEA 1BOGB 3QDGE 3HZYB 4GW5B 4NZRH 4F15C 3WKMH 4YGVA 2BSTB 5MENA 5INCB 4JHWL 5FO9B 1XF1A 1EAPB 1N5AB 4XWGH 1XGPA 4FFZH 3ULVH 4XP9L 4LGSB 1MJUL 1T66C 5C0RH 5HYIA 1LO4H 4BH8B 3QIUB 3FJTA 3U0PB 4F7PA 1QA9B 3RUGF 1OTSC 1YUHA 4HFWB 1JGDB 4AM0B 3HUJB 5FOJA 3LV3A 2YMXL 2WWKO 1II4E 4MJID 2DM7A 4L9LB 4UILH 3ARGD 4HLJA 3PQYA 1CGSL 5F7EL 4D0BB 4KTEH 5C0DB 2NXYC 3RWDA 3WN5C 2H41A 2M1KA 1HQRB 1PY9A 2GCYB 4G9FD 5CJQL 1A6WL 1U8IB 4ZO9A 3QFJE 1UA6H 4HPOL 1QSFA 2LAAA 2PYFB 4UV7H 3L3GA 4P4KA 2CKBA 1W8OA 4X9GA 4DGVL 2BNQD 4KHTH 2JKXA 3DV6A 3VXMD 1RURH 5DTFA 1E27B 1VGKA 2BOCB 4LLMA 1PLGH 3QUYC 4CVXA 4XPTH 3AMKA 2UY6A 4CJ0A 2CKNA 2AERT 2AI0H 3I6LE 4DK6A 1NEZA 4PJ8C 1N6UA 2GT9B 4QHNA 3GMMA 5BW7A 3TO4C 5D2LF 5FGBA 2PTTB 4UU9A 1ZWIB 4MXQD 1NLBH 5EBGA 1FZMA 2APFA 2A73B 2HRLA 15C8H 1X9QA 2AQ2A 3NOIA 4ODWB 3SGJC 2XY1A 5KANI 3O6FD 3RZCD 4IMLB 5E7FA 4X4YA 4N0FB 4ZFFB 3AAZB 4M6AA 3FB5B 4PJBF 4PJEA 2XKUA 3T4YB 5IVXB 5KVEH 1AD9B 4HW6A 4P2QD 1JNJA 3GRWA 5IHUL 3EOBA 1ZA6B 1KCLA 3HC4L 4Y5XC 3LQZB 2R4RL 3MYZA 3PWUA 3CK0L 4XPBH 2JTDA 4GKZA 2VOTA 5DVKA 2NLJA 3NIFF 5IQ9A 3C08H 5I66B 2W0PA 1LK3L 3C60A 2DLTA 3EW3B 4YFDB 3V7AG 1N64L 1M7IB 3MGAA 2QKIA 2VDLL 3S3PA 1RZGA 5FV2A 4TVPL 3TBWB 2AGJL 3RUGA 1WBZA 3LKPB 3L1OH 4K7FB 4JB9L 3LD8B 4KI5E 2NX5B 2YSSA 1S9KC 2GTZA 1U9KA 2O26U 4HKBA 4UBDC 3FKUS 2BSSB 2X4NA 4AEFA 1OL0A 4QT5B 1D7FA 1KB5L 4MD5A 4QHMB 3PQYD 4HUWB 4OCXH 2QQLL 5DI8A 1TQBC 3QUYB 4WI7A 1T2QL 4O2CB 5D7JC 5GS1C 4R4NC 3BDYH 3QHZL 5DJ6A 3BIKA 3JWOC 2OI9C 1KCRH 3P2TA 1LQSR 1C7TA 4EI5B 1QSFD 1B9ZA 2PXYB 1EFXA 1CD9B 3QPXH 1HI6A 3S5LA 4Y7MA 3RVWD 2VZTA 4MB3A 3U7WL 3EZ8A 3OX8A 1WEJL 1I1AA 3UC0L 5E2JA 3PWJA 3QQ9D 5I1KL 1B0GA 2DMKA 2MCG1 2EECA 5D2LA 1JK8B 4XXDB 2X9WA 4Y88A 2FX8H 2Q8AH 5J4MA 4PRPB 4GS7B 1AXIB 2R0KL 2E7LC 1VFBB 2DWDB 4YDJA 1C5CH 4JJ5A 2NCMA 1F42A 5KJRL 3N06B 4PJBA 1CR9H 2EICA 1FIGH 2XTJB 3THML 4AQ1B 1OW0A 5BVPL 5IT2H 5JMRA 4LLWA 4ISVA 4ZTPL 7FABH 2YN5A 3FRPA 1HWHB 3IXAA 1GH7A 3ARDB 1I1FB 4Q9RH 2VWEE 5KBNC 5GRUL 2WK2A 5D72L 5EFIA 5D1QC 3IFLL 4I2XE 1IQDA 2CDFB 1PZ5B 4KRPB 4XAWL 2VERN 1U92A 1WTGT 3C60D 5BZDA 5SWQB 4W81A 4MDIA 1VA9A 4XCNA 4NKIH 3ALWA 2GITA 4X83A 5I74C 3AROA 3TBVB 4N0YL 5GS1B 3WUWB 4IRZH 3O2WL 1VSCA 2Z93B 3VCLB 1K4CA 2Z92A 2DI7A 4PUBH 5JPMA 2VSDA 1AKJB 4OZHF 5DRWA 3TJEH 5B22A 1JHTA 5L6YL 2Q76A 5KSUB 3IU3A 3PL6D 5ITBH 5B38G 5FHBH 3P9MB 4MA7H 4LAQH 3OB0K 2Q3ZA 1BBJA 1FQ9C 3FAWA 3K1DA 4Z7VF 1TJHH 1WWCA 1QPPA 1CXFA 1L7TL 4PBWD 2IALB 5D1XA 1EFXD 3WS3A 5CWSB 3LN4B 1KNOB 3BSZH 5C0CE 2HFFA 5DMYA 4J12A 1TJIL 4HT1L 5JHDA 1I1AD 3C5SB 2R9HD 4TOYH 3ESUF 1KUMA 5E2VL 1HK6A 3JWOL 3VFPB 2EZ0C 4TSCH 2FECI 2JB5L 1KULA 1T3FB 4PJGB 4DKFL 5ICZB 5BRZE 3ULVF 5IEKA 3QNXA 3GK8L 1F6AB 4LHUB 4M1GH 1JGVL 4NJAH 1B3JA 3QWRA 4NZDA 2L0DA 1MEXH 3SKMB 2YWZA 4GAJL 2CRIA 3MV8B 3SGKA 5C8JA 4LF3B 4DJMA 5K9KA 1RUMH 1E28A 3ZYZA 4ODBD 4WUKH 5EZIL 1AE6L 3RVUD 3O3EA 2VISB 1MCEA 3QQ3B 3QUKB 5TDNA 2Y06H 3T0VA 1T21A 4QY8A 3FFDB 1K8DA 3F8UB 2I9TB 1RK1B 1KCUL 5ADOH 1QRNE 2F5AH 3DVNA 4TNVK 4YHZH 5C0JA 4YBHA 5EUOF 3FN0H 3V79C 2ZCLH 5F7DA 1NFKA 3BP7B 4JZJA 3WO4C 1QSEA 1KIPB 1YJDL 1Q1JL 4POZC 4OZFA 5GSVB 1G9EA 1ULVA 4QRTA 1GOFA 2NY7H 3HZMB 1NCUA 3BH9B 2DQDH 4MA8L 3GSXA 4OZHA 1O5DT 1MF2H 1QLRB 5IBTH 3MRMB 4X9BA 2FATH 5EUKA 2Q87A 3LRGA 3GSVA 4NN7B 3P3YA 4U3CA 5B39G 3VWKA 1G0XA 2ICWA 1C1EL 5DJ0A 2CMRH 2YD8A 4Z7VA 3MLWH 2R15A 32C2A 4K3EL 4LCWE 1WFUA 5DJYA 4LHQB 3HG1D 3LKQB 4RIRB 1BAFL 4YHML 4MLSA 5E5MB 4MJ6A 2FZ3A 2V2WB 1J1XL 1GVIA 5D1XD 3UJJL 5IBUB 4PJCA 5J6GB 2W60A 4JKLA 3L5HA 4PG9A 3RKPA 5E6YA 5HHOB 3LZFH 4E0RB 1EHNA 1JUFB 5JHDD 2C5DC 1YQ2A 1RJZA 2J5LB 4XVSH 3OXSA 4NNYB 3TT3H 3RWIB 3RVXC 2XKNB 2PTUA 2VLKA 3C9NA 4PJXB 5DMGD 3MMEA 4YR6A 1NKRA 1H8SA 1L0XA 4I48A 4W4OA 2IC2A 1B90A 5ACZB 1MFAH 5F97E 3NIGE 2ZPKH 4HDIB 5E2TL 1JN6A 3A6CL 3BGAA 3QWRD 1WAAE 1Q9OA 1YEJL 4XBEL 3OR6B 3KAAA 1FFOA 3BH8B 4GKSB 2IF7A 5C71A 4LPTA 3NCYS 4KKLC 1RULL 2PYEB 3PWNB 3WYRA 4EZMA 4CVZB 2B7DT 5ACLA 3BT2H 1A9BA 1FNSL 3WDIA 2NY1B 4C83B 4HFUH 3SOBL 4APQA 5IGXH 2J2ZA 5GGRA 3SE9L 4GQ9L 1DEEA 5EUOA 2BERA 1S3KH 2VLRB 4UT7H 4HD9A 2MCPH 3T3PE 1J86A 4P57A 1UWGL 5GHWH 2V5YA 5FKAA 1S7TB 3TIDB 3OQ3B 1U95A 4GRMB 3WNKA 1A6TA 2EDHA 4M6OL 3GHBL 2YWYA 4GMTL 5JOFA 5KW9L 4WHYH 4C56B 2R4SL 2J8HA 3ME0A 4YEEA 5I75C 1N7ML 4KTDH 5CP7A 2D0FA 4IRJB 2DQIL 1M7XA 3OB8A 4NT6B 3WD5L 3F7PC 1ZA3A 3C8KB 5JOPD 2ZUTA 3L3HB 4FFVD 5HDQH 3ARZA 4BSVB 2EYSA 1F3JB 3HE7B 4OI7A 4K3GA 4XP6L 2C1OA 4P2RB 1KELL 4JRXE 3Q48A 2VL5A 3VWKD 1C5BH 1XH3A 3KXFD 4PRDA 1U8LB 1MWAL 1LO2H 2DYPB 5C0BA 3VFMA 4P99A 2YPKA 3JZ7A 2PO6B 4LIQL 5EU6E 4GSDH 4EBQH 2ZJSL 3IJYA 4PJDF 1P7KA 4L8SB 4N68A 1U8MA 5F3HA 2VXUL 1EA9C 1NKOA 2CLVA 5I76B 4N5EC 4NJ9L 3P73B 4WI3A 2X7LB 3IETB 1NFIA 2IJ0C 2L7JA 2Z8RA 4RRPG 1ZHLA 1T1XA 3NGBB 4N9OB 5B4MD 4NUGH 4LPXA 4D8PA 3K81A 1E4WH 1X5LA 5D5ME 3GUTB 1OAXL 1I3UA 3TF7C 1UCBH 2X4QB 4JO1L 3QEQB 3PXJA 3ULVD 1FZKA 4LP4A 1V3JA 5ID0A 2H6PA 2VLKD 1QRKA 1JF6A 1NCAL 4CU6A 4MHHI 5T5NF 4LVNC 1CFTA 2OL3H 3QDJA 4L3AA 3LKRA 1UH3A 4KAQH 1FN4A 4NQED 4KJYA 2DJUA 5MEOB 4KMQA 3P77B 4OZ4B 1MVFA 4K94C 4OGAD 2XY2A 4KDWA 1KT2A 5CZKA 3LKSB 3JV6A 3O4OB 4FTVB 1F90L 4KH2A 2CLRA 1HXYB 1QKZL 1X5AA 1FYTA 3NA4A 4APQD 25C8L 2ZG1A 3ZE0F 4RFNC 4FQQB 4M7KH 1SMAA 1R3HA 3BE1H 1PY4A 3ZDXF 2VMFA 1AP2B 3NN8B 4MWFB 2DRUA 4ODUA 3NAAL 2W9LA 1VACA 1H3XA 1NUFA 3O9WC 4S1QH 4OLZL 4Z18A 1AHWA 3IJSB 1D9KC 2WBJB 2K3TA 2YUVA 4RZCA 4X7FC 3U7YL 5J56B 3S37L 2BY1A 4PJ7B 3TBYB 1JPSH 2I27N 3O6KH 3RVVC 2HAZA 4WFHE 4ZXBB 3SGEI 1RUQH 5IOPB 3B6SA 1KJ2H 4PJDA 4XI5C 5C0BD 2Z8SA 3VGFA 3EOAA 3ULSA 4WFFE 4ZUVB 1PSKH 3SDCB 4NHCL 3QO1A 1EEYA 4HIIA 2WINB 1J0KA 5C6TL 4OD3H 3PHQB 3ZLQC 4QRSA 4R2GD 3B8YA 4PP1D 1G6RA 1KCKA 5FKPB 3BEWB 3O3BA 1A7NL 3VFOA 3FOMA 1JWMB 4P48A 5DR5H 3RTQB 1P84K 3MNVB 2Y5TB 2H1PL 5HPMB 5JQ6L 3SDAB 2NY2D 3DX9A 1CU4H 2AI0L 4JDTH 4PJHB 3VJ6B 4BA8A 2AP2A 5JR1L 1U8JA 3QDJD 3UO1H 4CADB 3FONB 2XWJB 4HMDA 5ICXA 4S1RL 4PRPE 3GGWB 3UYPA 2X4RA 4XCYA 4ZMAT 5AYUL 1YEHH 1DJSA 3H7BB 1HXMB 3WNLA 4I3SL 3MUY1 2WM0A 5ID1A 1SEBB 3TN0A 5GISL 1FYTD 1LE9A 5FDYA 1IAII 4JFXA 1OGAE 3L9RA 3O9WB 2QSCL 4X6DB 2NZIA 1YEFL 3BKCL 4WU5B 1RZFL 1MI5A 4TULH 1JZ6A 3DXAA 2ATPA 4KK9D 4LDLB 5DQDH 3TA3A 2I9LB 1D5ZA 1EIBA 4YPGA 5SWSB 3VD7A 4FQIH 4NO3A 2CDEB 1CD0A 4D3CL 1OARH 1Z9OA 4I5BA 3JTSB 3L1OL 3EYFA 2FGZA 1XCTA 2ARJA 2W9DL 2PW2B 4HKZA 5I16A 3B9VA 2HT4D 1YYLH 3RY4A 4H26B 1REIA 2NY3C 1MQ8A 3Q1SL 3VFTA 2ZUSA 1J87A 1A6UH 2DD8L 3MUJA 1KCSH 3MRJA 1MRCL 1K2DB 2P1YA 3WFDL 1Z0MA 5DMKB 1N59A 3QIBD 1H8NA 3IDYC 2NY0C 4F9LC 3VD9A 3BDYL 1OP3H 1ETZB 2DQUL 2CH8A 3U7AA 3L3DB 2AK4B 5FYJD 2A6KA 3CVIL 2R1YB 2WLZA 1I8LA 1CFSB 1SY6H 2FWOA 1R0AL 4K23H 3V6FB 3D5OF 5E94B 2PF6A 3QWOA 4Y4HA 2Q6WA 4UT6H 1CE1L 1YEKL 4R4FL 1T6WA 3CC5B 4WNQA 3QQ4A 2APXA 4GFTB 4NM8H 3S37X 5B38B 3V4PL 1NC2A 4A6YH 1DUYB 3HPLB 1TVBB 1A7BA 5T3XE 4PJGE 2FX8L 3OAYH 3K4AA 2IANA 4LLQB 4JZNB 4OM0H 5FM5M 2P48B 1PG7W 1XGUB 5E8EB 5ITFB 1FORH 5F9WB 4R0LC 4XPAH 3G5XA 4JY5L 3CPLB 4OLVL 1ZT1B 3MV9A 2B5IC 3ESVF 3BAEL 5A2LH 4GRLC 1RZ7L 3RWGB 4HS3A 3SDYL 1IGFL 2UYLB 4G9DA 4I3RH 2IQAA 1AGBA 4U05A 5GGSY 3TN0D 5JW5B 2C3WA 5TQ0L 3WV0A 2G9HA 4G8IB 3LKNB 2AJ3A 1AR1C 4QRRA 1FAKT 5F93C 5HBBA 1AGCB 3I50L 1MI5D 5FYJL 5IVZB 2EKSA 3QEHB 1OP5K 4BH7A 3DXAD 1VEPA 3L6FB 4O2EB 3SKNB 1G6RL 5DJDB 2I07A 2H32B 2MTPA 4LVHC 2HMIC 3TA3D 4LCUA 4FFYH 1FFRA 3UX9B 3U4BH 2IH1B 1FVCA 1X5FA 4PB9H 5JLZB 4GAGH 4P23B 2XQBH 4WFEE 4YFEA 4OLYL 5F96H 2NY0B 5JORB 1EHLH 2AJSL 1S9XA 5CEZE 5I9QC 3U2SB 3G5YB 4XNYL 3DUUA 1U8QA 5DT1L 3VG0H 1I4FB 3WHE1 5FAAA 5ICYB 4Y19B 2SEBA 1NC4B 2EIBA 4Q9BA 3DO7B 2YZ1A 5GS2D 5B8CA 3MRQA 3WHXB 5M95B 1FDLH 1BFOB 1RZJH 4ZSOB 5T33L 2Q86B 2APBA 4N9GB 4DN3L 1UVQB 3S36H 4JFOB 1W8NA 5C1MB 5JXEA 4IOFD 4OUUA 1KIRA 4R9HA 3T2OA 5D1ZB 3ROLB 1JGLH 5GGSB 1NCBH 4C57C 2CLZA 2JCCB 1NEZG 2VLMD 4XC1H 4Y4HD 4X0KB 4CDHA 5IW1B 5DVLA 1IC4H 4ZUUB 4HUUB 1NC2D 2A38A 3KVQA 4B53A 3V5DB 1J1PL 5F89A 2C1PA 4LQFH 1ZLUK 4YHLL 3SGDH 4OTXH 4ODHH 4PJXE 4NRXA 1CGYA 2IAND 2X4PB 5C0AE 3MLTB 4ZD3L 3S35L 1PDKA 3ZKMC 5AYQA 3VXPA 1PKQE 1CTOA 3U46B 5C0NC 4HV8A 2R2BB 4NWTH 4TSBL 1L0QA 3VD5A 4KDTC 3MV9D 5EO9B 4BKLB 3NZ8B 5E1AA 2PYEE 3G6JB 3X13B 2VZSA 4PLOB 1AI1L 1QEWA 3VH8A 2X4SB 3DIFA 3GI9L 1TXKA 1DDHB 5FGCB 4GOSA 4OJFH 4LCCA 4QRRD 5FHAH 5CZXD 1UYWH 2VLRE 2XZAH 3P0GB 3SQOH 1U3HC 2Z91A 5GS0L 3IFPA 4JM2F 5F7WC 1WLHA 4TUOA 5GGTL 2CQVA 3ZKND 1S7QB 3MOBL 3DETD 3MUGB 3ET9F 1Q0XL 5C08B 3HPJA 4MSWA 1YEGL 3TEUA 4MA3A 5BCAA 2OL3A 5I15H 1KIUA 5GGUA 4YX2H 5AWNL 3VXOA 1MIEH 3BHBA 1HEZB 5BVJB 2ZKHH 1D5IH 4I4WB 4CGTA 3IVKA 3WSQH 4G7YH 4XHJD 3C5ZA 3PP4H 5CINH 3SJVA 4X4MA 2EH8H 1A47A 4LSTL 3KYNB 4JANB 3WXWL 3S8WA 4O00A 1CZ8H 4DEPC 3PGCB 3REWA 3WO3B 3K0WA 4NWUL 1S5HB 4H8WL 1OHQA 5FEBA 1JMXA 3JXAA 5JXED 1VEMA 2FL5A 3AB0C 2F54E 3FCTB 1LVEA 4ORZC 4DGIL 3HZVB 3MGTA 1DQDL 4ONFH 3U1SH 4Y5VA 1P9MC 2DQJH 1JHLH 4MCZB 2VR5A 2HVJB 4CNIB 1FO0H 4MD4B 5TPWH 4C54A 3QEQE 3SKJL 1NL0H 3G9AB 4PY8J 2OR9H 4U6VL 5ANMB 1EBAA 3BW9B 3SPVA 5DJ8A 1UENA 3OKOB 4JR9H 2OX5A 1FZJA 5D2NB 4Z7QE 3ZHDA 1N2RA 4PRHA 2J4WL 4FQXB 1HSBA 2F53B 1QBAA 1KJ2A 5KZCB 3B9KC 2VQTA 4K71B 2DKMA 3WE6B 3MREA 4L29B 5EIIA 2E27H 1BBDH 4QXGH 2JJTC 4BQ8A 5IJKC 1HKLL 4DFHA 3CH1A 4TTDC 5EWIH 4JN1L 1IKNA 4Z0BL 3FB6B 5EZLB 1Q9LA 1JNLH 3CDCA 3DX8B 4JM2A 1UKQA 5MEPA 2OR7A 1EO8H 2NZ9D 5TF1H 2XG5A 1CD8A 5D7SL 1MCJA 2WNGA 3C5JA 4D0CA 4PIRF 4M9OA 4FQPA 5KS9B 4J23A 4KZEH 3S35X 1HSAA 3QHFH 1EJOL 4JHAL 3PP3K 4MGXA 4O4YH 1IGMH 4Z7WB 4KTDL 4AK1A 4PJ5B 2CR6A 3JWNC 3VFRA 4BQCA 3HA0A 3EGSB 4B41A 5EU5A 4U1JA 2CGRH 3D69B 3B8SA 5F7MC 4G6MH 4LVOC 2FECL 5HHXH 1CD1B 2KUTA 2YPLB 3T65B 3MBEC 1S9VA 1A4JA 3C5ZD 4PPTA 3A0OA 3IJHB 5F7KC 1TETL 3SJVD 1H0DA 4R3SB 1HOCA 3CX5J 1P4IH 1FC2D 5IW3A 3IF1B 3U0WH 2FSEB 5K9JL 3VFWB 3QXWA 3H9SA 4YHPA 2APWA 3STZB 4AT6A 5GJTL 2B0SL 4L1HA 1FRGH 4ONOA 1SBSH 3IGAB 4JO4L 1LD9B 3FO1A 4XMPH 3GSQB 3VXUB 2ZUYA 5JPNB 5FYLE 3G08B 4J4PA 1ZK9A 3UDWA 1L6ZA 3D48R 4ZDHB 1T04B 2CK0L 5DD3H 3CFIC 1RHFA 2IBBA 1BFSA 3DI3B 5DVOA 2YKLH 1DQJB 3VFSA 3GMLB 4NQSB 1E4JA 2X10A 2BNUA 3EYOA 1UXSA 5HVGB 1FGVH 2YC1A 1TZIA 1EAJA 1G9NC 3MNZB 3OKMB 4FRWA 4PJ9B 2LV4A 3MA7A 5E00B 5FYKL 1GAFH 4NQDA 3SO3C 3JUYA 3RA7H 1QVOB 2FO4A 3FQWB 3NFPA 4GW1B 4PS4H 4KJWC 1MIML 4FFWD 3OWEA 2KQMA 2AJVH 4HF5H 1MHHA 1SY6A 1OSZA 4MQTB 4JM2D 5IMKA 1GGIH 4X6DE 4RGND 1WK0A 2A9ML 4LVOB 2HJFA 3CCHA 1BZ7B 4I18A 4MXQC 2HT2D 2R2EA 5TH2A 3DTXA 1BJ8A 2IQ9L 4HXBL 2BHYA 3B9AA 4EOWH 2NW2B 5EZJB 4W4NA 4MJ2A 1GPOL 1BIHA 3ELAT 1HDMA 4LSSL 3ZYIA 5F44A 1Z9SA 3S4SG 2X44D 5CFHA 3RL2A 1INDL 1TPXC 3WFCH 4UI2A 3NZHL 5IW6B 5CGMA 3S88L 4HIHB 1GZQA 1M71B 4OD1H 5F1NA 2JK5A 3T04D 3QCVH 3ROOA 4MYWB 2WP3T 4OCRL 3DWTA 1BGXL 3NCFB 5DC9B 1JP5A 5FA4A 4MJIB 1UJ3A 3FN3A 3PDOA 2VXTH 3H9SD 3ARGB 3EIFA 5LBSL 3MR9A 1ITBB 2DWEA 1SEQL 2AABL 3KPSA 3KYOA 4M9PA 4OFPA 2Y4SA 1Y18A 1UWXH 1ORQB 4R4BA 4JVUA 2BDNL 3ES6B 4G9FB 3FO2A 1D6VH 5KOVC 4J4PD 5H35B 3DSFH 5L2JB 3HC0B 3B9EA 2BP3A 2X40A 5K59F 1BMGA 4IRSA 2BNQB 3AVEA 1KLUA 2DQHL 3NTCH 3VXMB 1WZMA 4WV1C 2FHBA 3CXHJ 4Q6IC 2X4OA 4UTBL 2VDPL 1FG2A 1VPOL 4HUKB 4LSUH 1WBXA 35C8H 1VKXA 3KGRA 4NBYB 4K9EC 5CJOH 1OCWH 1TQCC 2BJMH 2QBWA 4M61A 3I6GB 4PRNA 1T1WB 5F7FA 5H2BA 4KJQD 3D3VA 4NQDD 3VXTA 1KB5B 4LOUD 4CRPA 1N5YL 1AO7D 5JNYA 4LPYA 4DZ8B 2D03L 1YMHA 3O6FB 3QQ9C 3RZCB 4ELMF 4ZFOA 1BFVH 1G9NL 2Y36L 2VLJA 4Z77A 4J1UB 1JGUL 5FCUH 4P2QB 4PB0H 5BW7C 4KHXH 1TPXB 1A02N 4Y4FC 3CMOH 2Z35A 3W2DH 3IDXL 2A77H 3PUCA 5DMIH 4RMSA 4U0RC 4OLUL 3U82B 5JIIA 1C16B 3U30C 2KH2B 3DHJA 1T0NB 2A1WH 2ZG3A 5DZOA 1TZGL 4XRCA 1U8KA 4YGVB 3U4AA 3ARBC 5MENB 1YC8A 4KXZI 1ZLSH 2BXZA 1D5MA 4R90L 1OAUH 1CFVL 1XGPB 3AMLA 4UV4H 4G5ZL 5H37H 4JPVH 3EJYC 2EH7L 3D2UA 4YWGH 4F57H 1CDBA 5GZND 4F7PB 5J1TC 1JTPA 3VU2A 1YUHB 4EN3A 3CFEA 2V2TA 5J13B 5FGSA 1CIUA 4J6RH 1HCFX 3LV3B 5D70H 5HYSG 3V0AC 3ILPA 5T3ZE 1AC0A 1NANH 1QLEL 1FZOA 3PQYB 3U9PH 5FDWA 2EDYA 3RWDB 4FXLA 3RGVA 2DKUA 5E6IC 4M1DL 2AJYH 4JGJA 2NR6D 3D87B 1QSFB 5MHSD 4PTUA 1AIFA 3L3GB 4P4KB 1SQ2N 2CKBB 3KWWA 2VUOA 4IRSD 3ZE1F 2IGFL 1T4KA 3DV6B 4OB5H 3MV7B 1CL7H 5DTFB 4LLMB 1SJXA 1VGKB 5CGYC 3PL6C 3INUH 4OLXH 4RFOL 5HHVL 5E5RB 3UBXA 4QXWA 4CVXB 4P5MA 1KEML 3W0WA 1ZLWK 4BUHA 5GJSL 3VG9C 5D96B 1W0VA 1NEZB 3RBSA 4BFGA 4QHNB 3GMMB 3WFEL 2B4CC 3D3VD 4ELMA 4UU9B 5L0QB 4KY1H 1IKFH 4HBCH 1JI2A 1FZMB 1I1AC 3S34H 4X4YB 5BXFA 4PRIA 4PJEB 4XPGH 3STBA 1MAML 2VLJD 3SE3A 1U42A 5FGCE 3QXVA 1FYHB 1QP1A 4Q0XL 2BY0A 4ZNEE 3FQTA 1T20A 2GEEA 5F88A 5LQBH 2R1WA 1MCCA 4UT9L 1WTLA 3NIDF 4GT7A 4R26H 4V1DA 3TVMA 1U2HA 2IADA 3UTSA 4JFFA 2VC2H 2XQYK 4W6YB 2NLJB 4IOSD 5IQ9B 3DRQA 3EO9H 3MLYL 3C60B 4RQQA 2ERJC 3QXAA 1BEYL 1VB9A 2GIYA 2QKIB 4KJPC 5I17B 1XF3A 1RZGB 1FVEB 3RUGB 1WBZB 5DLML 4JRYA 1I9IH 3D2UD 4CMHB 5IFJA 1PG7H 1UADC 3DVIA 2YSSB 3H42L 1EVUA 2GTZB 4EN3D 4HKBB 4XX1E 2DM4A 1CICC 4P9MH 4KQ4H 2X4NB 5TJWK 3V52L 1MFCH 3HNVH 2VAAA 3EYUL 3NA9L 3W9DA 1FL3A 1UM6L 4MD5B 1RFDL 3EYSH 5D71L 1P6AB 2D9CA 3LEXA 5DI8B 4RDQG 2PTVA 3RGVD 5DJ6B 3FMGH 3BIKB 3PF2A 1G9MH 5B3NA 1S9WA 1J0YA 1IAIL 3MC0A 1EFXB 3S5LB 1HI6B 2FGWL 2HLFC 3GJFK 4YK4B 4FXGA 4AQOA 2E7HA 3OX8B 3RRQA 3CSBA 5D93C 1NPUA 2IBZY 4Y2DA 3PWJB 1XCQA 1A3LL 4GBXC 3RKDD 3W0WD 4N8VA 5ANME 5KANG 1B0GB 2B39A 5TE6H 5D2LB 3A6OA 5TFSL 5I18H 4L4TB 1UM4L 2B1HL 4YDJB 4JJ5B 2FEDC 2BSED 1S7WA 4PJBB 4DQOL 2QQNL 4LLWB 1CYGA 2MQCA 5I0ZA 4EDXA 4PRID 4ISVB 2HTKD 3BWUC 1GIGL 3CXDL 3NCEB 3IXAB 3I9GH 4JM4H 4R8WL 4FHBD 2DI9A 2X9YA 3PWPE 5LGJA 5EFIB 1Q9WA 3O2DH 5EBWA 2V9RA 1IQDB 3SGKC 3TVMD 3TWCH 3UTSD 3GFUA 4JFFD 1U92B 1B4JH 5MEQA 2LQRA 2KL6A 5GGVY 3X17A 4U6XA 5BZDB 2P45B 5A2KH 4MDIB 4XCNB 4P5TC 3RX8A 4ZFGL 1VFAB 2GITB 3VWJA 2X41A 4JRYD 1Z5LA 2BCKA 1K4CB 2Z92B 1MCRA 1YQVL 2MPAL 5JPMB 1F97A 2E7BA 5DRWB 1JHTB 2Q76B 4YXHH 4KROB 3IU3B 4YNYA 5FYKE 2WIIA 1CGVA 4JEGB 3UZQA 3QIWC 4GXVH 1BBJB 4UZGA 3KJ4B 4FFVC 5K33A 5D1XB 2E9BA 1A7OL 1Z9LA 2CO6B 1WT5C 4P3CL 3WS3B 3BN9D 3QUXC 5DVMA 3V6ZA 4ZYKA 1I7UA 1NFDF 3KYKH 1G7MB 2HFFB 3BN3B 2LTQC 5JHDB 4Y2DD 4G80A 2VLLA 3LQAL 1YNTA 4IMKC 3QEGL 2HRPH 3VXQA 5IEKB 2D31A 3QNXB 1N0XH 3BDBA 1S8DA 1K4DA 3O0RL 4C59B 1OY3B 4UNVA 4UTAL 5C8JB 5K9KB 4S1SL 2V9QA 1URLA 3EHBC 3O3EB 4HIJA 4W4OC 2O5YL 5TDNB 2X6MA 5JW3L 1H5BC 4F2MA 1T21B 4QY8B 5IVXF 2VO5A 1K8DB 3DVNB 4NDMA 3K46A 5C07A 5C0JB 3V0WH 1EGJL 5F3BA 1OGTA 4JZJB 1QSEB 1CGWA 5IESL 5D7LE 4DCQA 4OZFB 3HZYA 3VWJD 4QRTB 1MFDH 2DJ4A 3GSXB 1LWRA 1IGJA 3MLXL 4OZHB 5LXGH 1KG0A 1QFWI 1FC1A 4KPHL 1FH5L 5EUKB 5CUSH 3VMNA 3GSVB 4RA0C 1RK0A 1IM3A 1GGCH 4O9HH 3VWKB 2ICWB 4RGMB 5DJ0B 4Z7VB 1ADQL 1QHPA 2XA8H 32C2B 5GGRY 3MJGX 5DJYB 1HINH 2VDRL 1PX4A 4MJ6B 2FZ3B 1NFDA 4G9FE 2PETA 1U0QA 3T0EC 5ALCL 3ALPA 3MZTA 2QQQA 5EOQH 3FTGB 4PJCB 2W60B 1MCOH 4PG9B 2NW3A 1QYGH 4K7PL 3VXME 5DD1H 1S7VA 1RJZB 3RJDA 3AS1A 1UEYA 3GKWH 3H3PH 4B7LA 3OXSB 1FE8H 3LDBB 4HWZA 4U1GB 2VLKB 3C9NB 5DD6A 3MMEB 4YR6B 5F9JA 3ZKXC 4I48B 5TE4H 4LSPL 4EDWL 1PD6A 1NBYA 4P2YA 2XG4A 4WTZA 1JN6B 1XF2A 1OPGL 1AXTL 3QUZD 1Q9OB 5E8PA 3CVHH 4ODTL 1FFOB 4U3XA 4G8FA 2NY2C 1U8PA 4L3EE 3LIZH 4ZOCA 1A9BB 1JF1B 1I85A 3SEPA 5HSFA 4P2QE 4APQB 4ODVH 3DYMA 5GGRB 5EUOB 1DEEB 3TLRA 4YE4L 7CGTA 2EIDA 5DGQA 5DSCA 4P57B 4X6BA 5C07D 4M7ZB 5FKAB 1TZHA 4XVTL 4HC1L 1DQML 1HHIA 3PE9A 5J3HC 1U95B 5C2BL 1ZHKA 3AS2A 1A6TB 2V6HA 3VI4F 2BVUA 5JOFB 4NRYA 3QP3A 4ENEC 2PCPA 1CFQA 4WHDA 4IIQA 3BZDA 3M1BA 1F11A 1Q38A 5CP7B 4Q9QL 1NMAL 4LU5L 1CXHA 3OSKA 1U8HA 1ZA3B 2Q20A 4GMSH 4TUKH 4JAMB 5I1AA 1EUUA 1IAOA 2DMCA 1W72A 3QA3A 1ZVYA 3QIUD 2EYSB 4MAUL 3TH3T 2C1OB 1HNFA 2VL5B 1UWEL 1XH3B 4PRDB 3PIQA 3QG7H 4QT5A 4Y1AE 3P11L 2YPKB 1AHWC 1CVSC 2YD6A 4WW2F 4HUWA 4NM4L 4LSRL 3IJYB 2R56L 1P7KB 1U8MB 4JKMA 5F3HB 3W11D 4Z7NF 3GI8H 2CLVB 5BJTA 1KTLA 1CXIA 5LAXA 5J9PA 1Z2KA 2CUIA 3ZKXB 1NFIB 4MQXD 1JRHI 5HYJE 4R2GB 5C3TA 1ZHLB 1T1XB 1OVZA 4MMXC 4YXKH 1QO3A 3QR2A 2GFBA 4D8PB 1KN2H 4M6NH 4XT1C 2COQA 3C6LA 3QIBC 1RUPH 3RIAK 3R4DA 5I1CH 2UVFA 1FZKB 4NQCA 2AEWA 2NY2B 5ID0B 2H6PB 4DAGL 5FA3A 1IGCL 1NCCH 5FECA 2BJML 1CFTB 4B5EA 3QDJB 3LKRB 1I1YA 1RV6X 4Y5YC 2G5RA 2UZIL 5AZEH 5D6DA 1FN4B 4KJYB 1T03H 5I8KL 4ZQKA 1T7YA 3JWDH 3BGFB 3HHRB 1QFWH 4XMKL 5JW4M 4AIOA 4NGHL 3PV6A 1KT2B 1JWSA 1KPVA 3JV6B 4UUJA 3RU8H 4K7PX 1KJ3L 2CLRB 4OCYH 4L4VA 2VXVL 1FYTB 2XPGA 4K2UH 4URTB 1W2KT 4NZTL 1TFHA 3MXWL 2CJUH 4YZFF 2UVEA 1FV1A 3EYVA 1KXVC 3HTLX 1MNUH 4H20L 3VRLF 5A3ID 1R3HB 2QQKL 5CCKL 4X6EA 2P5EA 4UB0H 4NFCA 4BELD 3F12A 2PR4L 4ODUB 3GIZL 1VACB 4A2LA 4JVWA 4M62L 1BQHA 5MERA 4XMLH 4WDIA 4RZCB 4LPVA 3KS0J 3MZGB 4X5WA 3WNOA 5TQ2L 1IEHA 3NACH 2NX5D 1HWGB 1OAQL 1WFOA 4P9HL 1AY1H 1NGQL 4WW2A 5ABDE 1MRDL 4KRMB 1EXUA 3B6SB 4PJDB 4I8DA 2F5BL 4HS8H 3EOAB 3ULSB 3FN9A 1A3RL 1S5IH 2VDOH 2EXYC 4HIXL 4UAOC 3QO1B 1EEYB 1NBQA 1IRAY 1S78C 3O2DA 1NCDH 2W38A 4HIIB 3V2AR 1X5JA 1F5WA 4QRSB 9CGTA 1DQLH 3HNTL 4LASL 1G6RB 4PLJC 5IB5A 3ULUL 2BVEA 3O3BB 5I1IH 3VFOB 3FOMB 4D2NA 1GC1H 3QCTL 3WFBL 3C6LD 4E5XA 3A67L 1HH6A 1MCNA 4OZIF 4NQCD 4NC0B 4WVRA 1MRFL 3DX9B 4IOFC 2X1QA 4JRWA 3P0YH 5MI0C 5D2LE 2XICA 3I2CL 1U8JB 2R0LL 1DVFB 5HYEA 1YN6A 5ICXB 2R0WH 3MJ7A 5GZOD 4LP5A 2X4RB 4XCYB 3SY0A 5T1KA 3FO9A 1W72L 4JFEA 1QFOA 2IWGA 2XTJD 4KKNA 4Z6AT 1RAMA 1WFTA 2P46B 1CN4A 1FG9C 5EO1A 3MRCA 4QCIA 1LEIA 1ACZA 5DHVH 5J6HA 1F4WH 3H6JA 3Q6FA 5ID1B 3ARPA 1MLCA 2DB8A 4L4VD 3TN0B 2ORBL 4G43A 3NPSC 1LE9B 3ARDD 4L8DA 4JFXB 4X80H 4F7EA 3L9RB 3U83A 5E08L 1IM9A 1IAMA 4O02H 2WMPA 2M8XA 5L8JB 4R26L 1MI5B 1U3YA 3GSWA 4FQ2L 2I9TA 4YBQC 3DXAB 4AEHH 2ATPB 2B2XH 4LPUA 2OK0H 4HLZG 1JRHH 4NNPL 2RGSA 3TA3B 4HSQA 1FAIH 2XXCB 1D5ZB 4YPGB 2AQ1A 1HKFA 3HS0A 4NO3B 4I9WE 4KMTL 4I5BB 1CWVA 3KR3L 4L4JA 3WIHL 3EYFB 1XCTB 2ARJB 3SKOA 5CZXC 1V3MA 4HKZB 1WCBB 3QJHA 3ZSTA 5I16B 3MLRH 5HPOA 5F7HA 2QTEA 3KS0H 3IU4L 1FNAA 5ESVA 1NGZA 4K3HA 3ZKNC 4HK3J 3BPNC 3PHSA 3DETC 5CD5D 1WIOA 3VFTB 5JDJA 3MRJB 5F72S 1RIHL 4G6KH 5FYKU 3C09C 2HKHH 4PP2A 5IK3A 1N59B 1QLFA 2CSPA 2M2DA 2EYRA 5LCVL 3FHAA 2DQEH 3VGAC 1M6OA 3HG1E 1MCSA 1VEOA 2AJZB 3AFLA 1XGTA 4YQXH 3R1GH 4XH2A 5E5MA 2A6KB 4FQLL 2FWOB 4S11A 3ZE2F 1Y6NR 4OZIA 3QWOB 4Y4HB 2X42A 2Q6WB 3QG6A 1SJVA 4O51A 3GMOB 4WNQB 2ZCHH 4Z7OF 1XGRA 3QQ4B 2EDWA 1UACH 1NC2B 3H0TA 3B3IA 4P46A 4WO4A 1BQLH 3WFHA 4N0CD 3VXRA 2IANB 5C3LD 4CL7A 4JREC 4W6WB 2NMSA 1G0DA 4LHUD 5T1KD 4JFED 4KZDH 3G5XB 1DFBL 2DLGA 4OI9A 3MV9B 4QRQA 4HS3B 3TESA 3MV8D 2Q7YA 3DNKA 4G9DB 5D7IF 4OGYL 2GAZA 3SE8H 2IQAB 1AGBB 1JNNH 1OSPH 4HUXA 4NZJA 5DUBA 4YHKH 4LAJH 2G9HB 1J1OH 3GSOA 1IM9D 3CFJA 2AJ3B 3GBMH 5F9OL 1RZKH 1B6DA 4ZUTA 2VDKH 2EKSB 4BH7B 4BFBD 4ZS6D 5DK2A 5K93A 5BMFL 3BPNB 2I07B 2VE6A 3L3OA 4LCUB 4XC3H 3KYMA 4QLRA 2OP4H 3RFZC 5HYQA 1YY9D 1SYVA 3C09B 3CLFL 3SE4C 4QO1A 1K9TA 1F58L 2DICA 1PQZA 4Z8FH 5JOPE 4OZHE 3VMOA 4PBXA 2GQHA 3CVHA 1QTYT 4U1HA 5CJXA 1S9XB 3Q6GL 1RIUL 4YDLC 3MXVH 5KTEH 3DUUB 1U8QB 1FFPA 2SEBB 4BSVA 3HE7A 5B8CB 3MRQB 1OP3K 4NQUA 2O5XH 5EOCJ 1SBBA 3GHEL 3QDMA 3KXFE 4BZ2H 3WBDA 1GCFA 4ZO8A 5GRWA 1F2QA 2VDQL 1G0YR 5ALBL 3WDJA 1P4BH 4O58L 2IMMA 2PO6A 4CKVX 1C5DA 4OUUB 1KIRB 3T3ME 5I1DA 1JYNA 4AENA 1Z3GL 4KKCD 1RZIA 4WCYL 3BYTA 4CJ1A 2H9GA 4N1CA 2CLZB 4JREB 4JKPL 3U6RB 3KJ6L 1V7NL 5DRXA 3OAYK 4WI5A 3Q3GA 4RBPH 3IXTA 5HD8D 5KSBF 1XR9A 4M43H 3ULVE 4P46D 1X3DA 3Q5YA 5DVNA 5F89B 2C1PB 1IBGL 1MCIA 1OF2A 4AIZB 5L9DH 3HMXH 4NRXB 3NABH 3ZL4H 5IB1A 2Z31A 2BVPA 3HC3H 1XIWA 2YA1A 3VXPB 4NQEE 3UXFA 2VIRA 4PJHF 6FABH 3GNMH 4HV8B 1RUKH 2Y07L 5D7IA 1GGBH 3P77A 4OZ4A 3EDKA 1CDJA 1EV2E 1I9JL 4QWWD 4S1DD 5E1AB 1FFNA 4RGOL 5LJYH 2VITA 4HWNA 4NN6C 3DX6A 1QEWB 3VH8B 3C2AH 3DIFB 4M1CD 5IJVA 5EA0H 1LO0L 4LCCB 5ESAA 3LY6A 5EUOE 1Q9KA 3O4LE 3TO2A 2Z91B 3IFPB 5FUOL 4TUOB 1WBYA 1ZHBA 3LS4L 5B3JF 1WITA 4JFDE 1H3GA 4NBZB 3TYGH 4Y4KA 4YGAB 3HPJB 4MSWB 2EDEA 4MA3B 2OL3B 4NYLA 5GGUB 4I3GA 1KTDA 3VXOB 3BHBB 4TTGA 3N1QC 5DJXA 3N85L 4RGNC 3U79A 2W92A 3IVKB 5EORL 4O2FA 4JY6B 5E4IA 1T0PB 4LMQE 3C5ZB 3T0EE 3WJLA 2CRMA 4C55A 1KXTB 2NY6C 3F7VA 3HE7D 5EOCH 5E4EC 3DMMA 1MHPL 3QDMD 4N1EA 5ILTH 4FQHA 3REWB 3HKFA 5C0BE 4E9LA 5HHMD 3BD3A 1WZKA 2DYPD 4XCFL 43CAA 2PO6D 2FL5B 3TCLA 4N8VG 5ETUA 3S7GA 4BK4A 3K1KC 3MGTB 4LNRA 1A6VL 1V3KA 5E1HB 3L3JA 4Y5VB 1T7ZA 4MNQB 5KSBA 4AG4L 2RR3A 4WGWB 1I1RA 3HNSH 1AQKH 5JW4N 1PX3A 2R8SL 3MV11 3OF6A 3GO1L 3D39E 4MQ7A 1EMTL 4J3TA 3FT4A 2DM2A 3BMVA 4HGWB 4PJHA 3SDDC 3SPVB 4JG1H 2Z31D 3GMPA 5DJ8B 1XIWD 4FQJH 1FZJB 4LSVL 1N2RB 4JO3H 4PRHB 2RCSH 4J4PC 1HSBB 2GY7B 1KV3A 1HHHA 1KJ2B 3WLBA 5L8KB 5HVHB 2MMXA 4DN4L 3UPRA 3MREB 2X70A 3AM8C 4Z9KB 1KENH 4U1NA 2J3SA 5EIIB 3LEYL 3TM6A 3BMWA 5T5FH 4UDTA 4RISH 3BPCA 4JVPA 3CH1B 1X5IA 1FYTE 1I7ZA 1FBIL 3X3GL 1Q9LB 4JM2B 5MEPB 3WNMA 1F13A 1I8MA 4RGNB 3D0VA 3MRHA 3C5JB 2GKIA 4D0CB 4KJQC 3QDGA 4XZUA 3QJFA 2G5BA 1IC5L 4LOUC 2HJKA 1HSAB 3L95A 4XNZB 4H88H 4Y4KD 1MCHA 5EO0A 1TNNA 1SJHA 3VFRB 3WNNA 5EU5B 4U1JB 3C8HA 4OGZA 4BFIA 5IB4A 1E4KC 1S9VB 1A4JB 4I18C 4G8GE 1S7XA 4RFEA 2XWTB 1H0DB 1HOCB 4XP9H 1HQ4A 1LO5A 5DHVA 1MJUH 1MHEA 3DMMD 4NP4L 4PJDE 2AXGA 3P9WB 1U58A 1NAML 3H9SB 4L5FL 2H2SC 4YHPB 4XNQA 2YMXH 5DMKA 3HRPA 4AT6B 1CGSH 1WIPA 5F7EH 4W68A 1U93A 1SHMA 3FO1B 5FUCE 5CEXA 3QPQD 3MRIA 2OXGA 2HKFL 5CJQH 4I0PA 1A6WH 3QNYA 3DHMA 4Y89A 4HPOH 3RTQD 4Z0XA 4NIKB 4E42A 3VFSB 3SCMA 4DGVH 3GM8A 2IEPA 1KLFA 4WWKA 2BNUB 5CIPH 1UXSB 1UQSA 1X6NA 2YC1B 2FD6L 1C08A 1OAYL 5TE7L 1TZIB 2HH0L 4NOFA 3HI6L 4YHIA 3BRGC 2G60L 4K3JL 1MHCA 4BYHA 2IMNA 3MA7B 3SN6N 3EJZC 4JE4B 4NQDB 3AY4A 2AXJA 4TNWK 2FO4B 3M45A 3NFPB 3ZE0E 4BQ6A 3BDXA 4OCWL 4MS8C 1MHHB 5BV7C 1OSZB 2ICCA 3KDMA 5IMKB 4IHOA 4KUCF 1RZJC 1LILA 2FHFA 3UYRL 1CLZL 2IPKA 2HJFB 1G1YA 3CCHB 1QR1A 3QDGD 4I18B 5IHUH 2R2EB 3EO1A 5TH2B 5JZ7D 3DTXB 4QGTA 4LPCA 3HC4H 3MCLL 4O2EA 2R4RH 1HDMB 3CK0H 4U49A 1H3TA 3DRTA 5SWSD 3ZDZE 4MJ4A 3RL2B 2XNAA 1A6ZA 2GK0A 3OGOE 2H8PA 2I24N 1LK3H 1GZQB 1N64H 2V9TA 4TRPL 2VDLH 5F1NB 4OLWL 4TVPH 2AGJH 1QNZL 2JK5B 3ROOB 1FPTL 4JB9H 5C0IA 3EJJX 4GW4A 5FA4B 1UJ3B 3P9LA 3PDOB 3CAFA 4UIKL 3MR9B 1AQDA 2X2YA 2DWEB 3RHWK 3KPSB 1KB5H 4JFOA 3KYOB 5BS0A 1Y18B 2QQLH 1WVZA 3KLDA 4R4BB 1BVZA 2Y7QA 3FO2B 1T2QH 4KI5C 4FG6D 5EU7E 5CLWA 3QHZH 2VLME 3KPLA 1WIUA 4I0PD 2APVA 2YZ8A 5B39A 4IRSB 4WTZG 4NCC2 1KLUB 1MJ7L 3I6LD 4MLIA 1FL5A 3IT8D 3U7WH 1UZ6E 2J8UF 4WWKD 3FOLB 3UYOD 4WW1A 2X4OB 2VXSL 2VRAA 1WEJH 4WHCA 4GG6F 3UC0H 4RAUA 3RGVC 1FG2B 2IANE 1WBXB 1F4YL 4FS0A 1VKXB 5I1KH 3QI9A 2V7HA 4M61B 4PRNB 5HI3D 3N9GL 5H2BB 3D3VB 3VXTB 5CSZA 1KLGA 1R24A 1D5BA 4P3DA 2R0KH 4Y16A 4Q9CA 5JNYB 5KJRH 1YMHB 5F71A 4ORGA 2X4UA 4ZFOB 3THMH 3MRBB 5BVPH 3LRHA 3N0PB 2VLJB 4Q2ZA 4Z77B 3O45A 4G42A 5I8CA 4DGYL 3X14A 4ZTPH 1F6FB 4QRRE 4JFHE 2DMBA 1A1OA 3LMJL 4HMEA 5GRUH 3ARFA 2VKWA 5D72H 1IAIM 1L0YA 3HMXA 3IFLH 3TPKA 4ETYA 1EH9A 4IJ3C 5HDOA 1T7VA 1DBJL 4XAWH 3SE3C 5BV7L 4Z7UF 4XRCB 5EZOL 1U8KB 4QHUA 3BKJL 4TQEL 4QOKE 3ZYJA 3TFKC 2B8OT 1D5MB 4PR5A 1KJVA 3WXVL 2VWEC 5IIEA 3D2UB 4F33A 2XACC 2BNRE 4N0YH 2DBLL 3O2WH 4EN3B 1NC4D 3CFEB 5J12C 2V2TB 3SDXE 4YDKL 3ILPB 5JXAL 1FZOB 1JPGA 4YFLF 5L6YH 1JMZA 5FDWB 4EUPG 5C0CA 2YRZA 5BS0D 1LK2A 3RGVB 2EDKA 4RWYL 1OAZL 5HI4C 4PTUB 3VA6A 1AIFB 1L7TH 2J8UA 5F1OB 3KWWB 1T4KB 1S7RA 4P59L 3GSNL 4GG6A 3UAJD 2ZCKL 2AS5M 3UBXB 1TTFA 4P5MB 2CUHA 3G6AA 1TJIH 3W0WB 1MFBL 4HT1H 1YNKL 4M7LT 1NMCC 5E2VH 3QI9D 1W0VB 3JWOH 2VDNL 2JB5H 3NIGF 1UZ8A 3RY6C 2J12B 4RRPA 4DKFH 1WAAF 3UCRA 4MVBD 4ELMB 1JPFA 3BD4A 3OKKA 3GK8H 4Y16D 5ELIA 1JGVH 2A0LD 5BXFB 3HE6A 4PRIB 4KUCD 2YRPA 4GAJH 3K4DA 2QADC 1WZLA 1Y6KR 1QRNA 3QXDA 5EZIH 4RX4A 1AE6H 1MPAL 1PKOA 3T3PF 4P2OA 3FQTB 1T20B 5F88B 2R1WB 2V5SA 5AEAA 4HMCA 3LHPL 1ROWA 3ARFD 5EDXA 3BRFA 4Z7UA 4N0UA 4V1DB 3TVMB 2IADB 3UTSB 4JFFB 3L3IA 1KCUH 3DRQB 5C08D 5T3XH 2F8VA 4RQQB 3QXAB 3RL1A 4HWUA 1XF3B 3UEZA 1YJDH 4GJTB 1Q1JH 4JRYB 4PLKD 5CKAA 5IFJB 3VRIA 2G2RA 3ZO0A 5CLTA 4FABL 3SJVE 4MA8H 1PFCA 4X4ME 3GDBA 4JKKA 4OFKA 4PLNC 2J7LA 1FGNL 2GW5A 2VAAB 5KG9A 3W9DB 5ECJE 1NLDL 3IF1A 1FL3B 1ZOXA 2J1KA 2FSEA 2AVGA 2YA2A 3LEXB 3VWJC 3KPQB 5C0CD 5KSAA 3LN9A 1C1EH 2A9NL 4K3EH 1NEUA 4WGVB 1QFUL 5EIVA 1I8IA 1S9WB 4KKAD 4AYFA 4Y0GA 3OAZK 1BAFH 2X9XA 2XIDA 4YHMH 5J11C 2R23A 1MH5A 1J1XH 2R2HA 3UJJH 4FXGB 5D5MF 4YHYB 1Q0YL 4Y2DB 1XCQB 3AREC 3MFFA 4G7VL 1H15A 4N8VB 3FQUA 4JCLA 3VRJA 4M93C 2AXHA 1WAAA 4ONHB 4HK0B 5C09E 3TNNA 1G7QA 3QAZB 3SKUD 2OQJA 5DYOA 3BFOA 1ZT4A 1WWAX 4JQIL 2F53D 2XN9A 4MZ3A 1S7WB 1FJ1A 3BKYL 1YPZE 4XVJL 5DEZA 1ZGLM 5E2TH 3A6CH 1RJLA 4EDXB 3HE6D 3B2VL 1YEJH 4KMLB 4XBEH 1NMBL 1WC7A 2YD2A 3W82A 1RULH 3AGVA 1HCVA 3RWHA 4RGNE 4RX4D 3CH8A 4P2OD 1FNSH 5LGJB 1KN4L 3TV3L 3QUZC 2H2PC 4EJ1C 3X3FL 1LP9E 1Q9WB 3SOBH 4F58L 4PY7A 1IC7L 4MNHA 5KVDL 2BHUA 3SE9H 4GQ9H 1MJ8L 5CIPA 4F8QA 2D2OA 4HH8A 1NBVL 2OZ4L 5MEQB 1UWGH 3JBG7 2OS7A 2ZOKA 3WUZA 1RMFL 2C3VA 2X1WL 4U6XB 2AEPL 4YDIL 4ZAKA 3ZHLA 4F3FA 2G75A 3KPPA 4M6OH 5EIQA 1T89A 4PGZA 3GHBH 1ZEAL 1HN1A 4GMTH 1R5WA 5DRNA 3RDTA 3VWJB 5KW9H 4JRXA 1G1CA 2R4SH 1Z5LB 1N7MH 2BCKB 3I3DA 4JQVA 3MRPA 2DQIH 3WD5H 4F7CA 4HJ0D 2XZCL 4DOHB 5JUEL 4CVUA 5EOTA 5EU6A 2X1XR 2QR0A 1J05A 1YMME 1YYML 4PFEA 1VDGA 3BQUC 4QXUL 4XP6H 1B0WA 4YNYB 2WIIB 2X05A 3HR5A 5KSAD 4YUEL 1P2CA 2WUCL 5IWLC 3QWQB 1MWAH 3SHSA 5SX5K 2ZJSH 3QIUC 5D5MA 4F9PA 3QZWG 4NZUL 3UROR 4AEIL 2VXUH 1IT9L 1A8JH 1DBBL 2CXKA 3TJHD 3V6ZB 4LCIL 4ZYKB 3VXUD 1I7UB 1J8HE 4NJ9H 1L6XA 2YRLA 4L9LC 1N3NA 5KVFL 1BVLA 2PN5A 3DYPA 2VLLB 2IAMA 4R7NA 1E6OL 1YNTB 3X12A 2HT3C 1R6VA 3R06A 1OAXH 3QXTA 4D0DA 4JO1H 1DBMH 1H3UA 5IFHL 2VUYA 3VXQB 4WI9A 2D31B 1Q94B 3FQRA 1NCAH 3TZVA 2XN9D 3LPGA 1S8DB 3M8OL 4OIIL 3OMZA 8FABA 5DHYA 2B20A 3LRSA 4OGXL 5E95B 3MCG1 1AO7E 1UC6A 2EDXA 2KBGA 4JPWL 4XXCC 1OM3L 3T8XA 3C6SA 5DJAA 4HIJB 4LGRB 1IJ9A 2H3NA 3IS0X 1F90H 1JHKL 4LVEA 4YJZL 5I73B 2EEDA 3DUSA 4K55A 1QKZH 4F2MB 1Q8MA 25C8H 3KYAA 4QRPE 1WWBX 2WAHA 4NDMB 5C07B 3IDIA 5DWUL 5KVMC 5HGHA 5F3BB 2W9EL 1BJ1J 4KKBD 1OGTB 3WN5A 4MXWL 1K6QL 3P4MA 4DCQB 1QQDA 3RDTD 1N0LA 1ONQA 4JRXD 5D6CA 3NAAH 4WFGD 1IGJB 4XTRD 4OLZH 1KG0B 3GB7A 3ILQD 4UNUA 3KPRA 5EU6D 1RK0B 4U7KA 1IM3B 3U7YH 4I13B 3S37H 3KPTA 3HAEA 5EBLA 1YZZA 3JUZA 5EH1A 3R8QA 4PJ8A 1UB6A 1SVZA 4BUGA 2LU4A 3TO4A 2JJSC 2P44B 3QH3A 1X44A 1NFDB 3LD8C 4NHCH 3SGJA 5MHSE 3KPOA 4Z95L 2NW3B 4X9FA 5C6TH 1LDPL 5HTSA 1LEGA 1JFQL 3CFDA 1S7VB 2HVKA 3MV7A 1H3PL 2IAMD 1A7NH 5E03A 4TSAL 3RGHA 1NSNL 5EB9A 4TVPD 2H1PH 4HWZB 4Y5XA 5JQ6H 5DD6B 1J11A 2XT1B 3A6BL 5F9JB 1T80A 3N1GC 4EI5C 3QXUA 2PXYC 3TZVD 1NBYB 1MCPL 3ZTJG 5JR1H 1XF2B 4S1RH 4GLRI 5E8PB 4OV6F 1PW3A 5AYUH 1OGAA 4G8FB 1U8PB 1T66D 5IHBA 4I3SH 3OPZL 5GQBA 1GYAA 3I84A 1NGPL 1N6QL 1IEAA 3FFCA 4GS7C 5C2UB 5GISH 3H3KA 5BO1L 5DSCB 2QSCH 2XTJC 1EZVX 1N8ZA 2DQFA 4X6BB 2ID5A 1YEFH 1TZHB 1HHIB 3MRRA 1BJ1H 3BKCH 1ZHKB 1RZFH 5D7JA 2OCFD 2NXYD 4NRYB 1LE5A 4N8PA 2PCPB 1RPQA 1CFQB 4IIQB 3BESR 3M1BB 3ARDC 1F11B 4D9RD 5MEND 4WFHD 1U8HB 4EQ2A 2BC4A 5I17A 4D3CH 1RJYA 1FVEA 4QYOA 1CF8L 5I1AB 4TN9A 1IAOB 3QA3B 1W72B 4LEXL 2W9DH 4KFZC 5E2WL 5C7XL 1R3KA 3KPRD 4KRPC 4MX7A 2FX7L 1CQYA 4PJFF 1PEWA 3U4EA 1BVKA 3PIQB 2DN7A 3Q1SH 4ZS7L 4M48L 3E0GA 2DD8H 4PJ8D 4PJIF 1A7PL 1MRCH 4MXVF 3TO4D 3WFDH 2E7LA 2Y1VA 3KLHD 3PWVA 2ITCA 5DD0L 1WV7T 5J7CC 5K59E 2ZUQB 5BJTB 1KTLB 5LAXB 3UJTL 2HFGL 5J9PB 2DQUH 4P2CG 2NY4B 4P4KD 3BP5A 2Y23A 1QO3B 3CVIH 2GFBB 3JTTA 1P7QA 2IPUK 4I0CC 4K8RC 5D9SA 1R0AH 3MV7D 2X5PA 3C6LB 3STLA 1F3RB 3S9DB 1CE1H 4HUVA 3W0WE 1YEKH 4R4FH 1MAJA 4NQCB 1KPRA 5HDBE 2CRZA 5K9QI 3V4PH 5FA3B 5D1QA 5FECB 1I1YB 3D9AL 4C4KT 4XWOC 4L4TA 1NGWA 4ZQKB 1TJGL 4KV5F 3WJJC 2DLFL 5FOBA 1OGAD 4DKAA 4JY5H 3PV6B 1MLBA 4PGCA 1JWSB 1KPVB 4UUJB 4ONGL 4OLVH 3DURA 1P7HL 3MUHL 4OF5A 4XVUC 3QB7C 3BAEH 3BWAA 2W0LA 1RZ7H 1FSKB 2RB8A 3SDYH 4L4VB 3G6DL 1E4XI 4MMZC 1IGFH 2AEQL 2XPGB 4UBDD 2BRRL 3FFCD 4DTGL 1FV1B 3EYVB 5TQ0H 2E9WA 1JTOA 3MV01 5M7QA 3E8UL 1LO3L 3OGCA 4JO2L 2JJVA 3RIFF 2VQ1A 3O2VL 4AEEA 3UTSE 4X6EB 4N90E 2LVCA 2P5EB 1IQWL 3I50H 5D7JD 5FYJH 3ALXA 5I8OL 3G5ZA 1MJJA 1T7WA 4I77L 2YPVL 4MQSB 3F12B 3AUVA 1G6RH 5EBMA 1ZT7B 5F1IA 2W65A 4AIXA 4R97B 4JRYE 1VFAA 4HQQL 3U36A 5MERB 1BQHB 1XF4A 3RJQB 4PJFA 4OLYH 4WDIB 1HHGA 5JO5A 4X5WB 3EOTL 4ZS6C 3SBWC 3VE0A 2AJSH 1KOAA 3RWCB 4PJIA 5GRVK 4WW2B 4XNYH 5DT1H 1EXUB 2WWKT 4GLRH 3PJSA 4GAFB 2FIKA 5T33H 4KK6D 1G7LA 1OAKL 4LKCA 4DN3H 1ZKAA 3VW3L 4M5ZL 2CDGA 4Q74A 4YAQA 3Q5TA 4FOMA 4LEOA 3I75A 2EDDA 4NN7C 2V17L 1L7IL 5IB5B 2DI8A 5T3XD 1P7QD 5IUSA 1G7MA 4NUJA 2W59A 5C0AA 2ARWA 1P84J 4E5XB 4PJCF 1RZ8A 2AEIT 1HH6B 3QDAA 1PKQA 3H9HA 5IFAL 5T1LA 5D1QD 1RUAL 1J88A 1QBML 5IROC 4Z7QF 1YN6B 1J1PH 4YHLH 3MJ7B 4L4TD 1DUZA 2OR8A 2A6DA 4K8RL 4NKOA 3SY0B 3S35H 5T1KB 4ZD3H 3FO9B 4WEBL 4JFEB 4OCSL 4HJGA 2V5TA 4NN5B 5I8EA 3BGMA 3WS6C 1YECL 1ES0A 5LGHL 2J5LC 5EO1B 1MWAA 4TSBH 3MRCB 4QCIB 1LEIB 5J6HB 3VFGL 3Q6FB 1CDCA 3KPMB 4X8JA 1MLCB 4EIZC 5GS2H 4OCNC 3MODL 1KIQA 4G43B 5IBLD 4L8DB 4S0TD 3NIDE 1AI1H 4F7EB 1PGRB 1X4ZA 1IM9B 4NO0B 3GI9H 5M94B 3GSWB 3DV4A 4WFED 4QWWC 1CE6A 1G84A 1AGDA 1IGIL 5GS0H 2C4XA 5T3XL 2EE3A 5GGTH 1U41A 4LHJB 3HS0B 3MOBH 3NFNA 1Q0XH 3V6BR 1YEGH 3V9FA 2NY1C 1JNHA 2EXWC 4U1IA 4M7LL 3SKOB 5I1HL 3QJHB 5AWNH 1A14L 4XAKE 2BY2A 5ESVB 1NGZB 4DOHE 1VENA 2F54A 5E9DA 2DIAA 3S4SA 4PP2B 4KROD 4LSTH 5IK3B 1QLFB 3WXWH 2EYRB 3MFGB 1M6OB 1MQKL 4IRJC 4JPKL 4NWUH 5T1DL 4CMMA 1XGTB 1GL4B 2Q8BL 4H8WH 5A43C 1GGTA 1X5XA 2I60L 4XH2B 2P49B 2IPTL 3HE7C 4TNVF 3FTGA 5DHXB 4DGIH 4OZIB 3BZ4A 5SWZA 3UJIL 3QG6B 4O51B 1DQDH 5F6HI 5C0AD 1XGRB 4QGYA 1UB5A 3H0TB 3B3IB 2FB4L 2PO6C 4P46B 2AJXL 5T1LD 4WO4B 4L8SC 3SKJH 3WFHB 5CEZL 3QZWB 3VXRB 1VFMA 2LU3A 4U6VH 1OWRM 4J3SA 3NGBC 5C86A 1BJMA 2CIKA 4POZD 1LDSA 2J4WH 4UINL 4QRQB 4LSQL 4QTIL 2Q7YB 5DFVC 3VI3F 2GAZB 1RVFL 3TT1L 4HUXB 5JIKA 3BIAX 1XIWC 4O5LL 5DUBB 1JF1A 4XCCL 1FL6A 4TPRL 3GSOB 1HKLH 3CFJB 4HAFA 4JN1H 4Z0BH 4ZUTB 3FRUA 4FQ1L 4LARL 5JMOC 2JB6A 3F58L 5D7KD 1FFQA 5D7SH 5DK2B 4KK8C 2XI9A 1CLYL 2ATKA 1T1YA 2VE6B 3L3OB 1JZ3A 3KYMB 4M3JA 3O4OC 4YO0A 2ICES 2N1KA 5HYQB 1NCNA 1SYVB 1QSED 5ADPL 3O3UN 1EJOH 2C3HA 4JHAH 3ZZ1A 1W0WA 4J3WA 1PQZB 2DDQL 4KVCL 2C26A 2NNAB 3CVHB 4NCC1 2WANA 4U1HB 3IDGA 5F1KC 1ZMYA 3MLZL 4JAMA 1FFPB 2H45A 5DS8A 5JW4R 4LBEA 5IMLA 2F54D 5E9DD 1TETH 1IGTA 3HUJE 3QDMB 1WQVT 5CJ5A 4W70A 5HHMB 2K7PA 5K9JH 1WF5A 3JWDC 3DOSA 4H5SA 4QRUB 5LVEA 1C5DB 5I1DB 2DQTL 4AENB 4ALAL 5KAQF 2WBJC 2OYPA 5GRZA 1RZIB 3BPLB 3GZKA 4ZUWA 5GJTH 2H9GB 2B0SH 4KKLD 1RU9L 1CIDA 2O5ZL 5SWZD 4JO4H 4QHLA 4ZXBC 5HYSA 4G8EA 5DRXB 5IQ7L 1V5JA 3Q3GB 1A64A 3IXTB 1XR9B 1A7RH 2CK0H 1DBML 3SDCC 1OF2B 2YD3A 2DTML 5I71B 3TP4A 2BHZA 5IB1B 1YNLL 2Z31B 2BVPB 1XIWB 3VXNA 1INEL 3D0LA 4PGBA 4RDQF 1EFQA 2VZ1A 5FCSH 2J6EL 2VIRB 2Y9RT 1KEGL 4YDVA 3MLVL 5D7IB 4NRZA 2PW1B 5FGRA 3RTQC 3UTQA 4TVSa 1I9RL 4J2XA 1FFNB 2VITB 1S7SA 1Z9MA 2AK1L 1D9KA 5FYKH 3DX6B 3HMWL 3SDAC 1S7UA 5IVXE 1FVDA 5IJVB 1MIMH 5JW4Q 5ESAB 3TC9A 5ENWA 3QEUA 1AGFA 1Q9KB 2EC9T 3TO2B 1OP5H 2A9MH 1BHGA 1WBYB 5ACMA 1ZHBB 4BSWA 4Y4KB 4M4RA 4MCYA 2IQ9H 4HXBH 4N5ED 4NYLB 1JIBA 1KTDB 3UZVB 1GPOH 4LSSH 4OSUL 5DJXB 4G6AD 2M26A 3FO0L 1YDPA 4OF6A 1CFBA 4JHZA 3BZEA 4O2FB 2HP4A 2ZWLT 4IS6A 1INDH 2XA3A 3NZHH 2NX5E 3F7VB 3S88H 3BP6A 1V7ML 1A7QL 1JBJA 3DMMB 3IS1X 2MHAA 1VHPA 4N8CL 3RVTD 4FQHB 1R5VA 4OCRH 1BGXH 1A6PA 1QFWM 4FMFA 4XNXL 2Q1EA 3FT3A 43CAB 5DD5L 3TCLB 3LKOA 5ETUB 5LBSH 4X5XA 3FB8A 4RBPK 1SEQH 2AABH 2AW2A 1CDHA 4KVNL 4LNRB 3ZSSA 1ED3A 3L3JB 5LWYL 1CG9A 3IAPA 5KSBB 1DQQA 5IP4A 3VGDA 3BRDA 2BDNH 2HYMA 1B0RA 2QHRL 4NQCE 4MQ7B 3KG5A 1G7IA 2DQHH 3FT4B 3UTZA 4LNVA 3OG4B 2ADIA 4JN2A 3GMPB 4OV5A 1WICA 3BZFA 4FG6C 1DVFA 4UTBH 2VDPH 5MP6L 4PBVC 1VPOH 4LRIA 2OJZL 1H8OA 1CK0L 4J3OC 1HHHB 2D0GA 2HFEA 3MACL 3WLBB 1WZ1L 3ARXA 3UPRB 2X70B 2XTJE 2AV1A 4U1NB 4JLRA 1D9KD 5IKCA 4ZNCD 1BREA 4UDTB 3BPCB 3UTTA 5DRZA 5BQ7A 1N5YH 2LABA 2D03H 1I7ZB 5DDHA 3RVVD 2DOCA 4DVRL 5FYLL 1V8HA 1G9NH 1I8MB 2Y36H 5F9WC 3D0VB 3MRHB 1NUDA 5HI3C 3VI4E 4K94L 1JGUH 3QDGB 4XZUB 3QJFB 4CN4A 2G5BB 2DTSA 2HJKB 3L95B 5CMAA 3V4VL 1I3RA 4F9LA 3IDXH 5EO0B 2YOCA 2YBRA 4Q6YA 1UEMA 1SJHB 3K8KA 4OLUH 4Z5RA 1ZTXL 1ZANL 4R7DA 1MFEL 4MJ5A 2QSQA 1UKTA 1TENA 4NHUA 1TZGH 4BFIB 5IB4B 2E6PA 1WCBA 3REVA 3DECA 1S7XB 1CXLA 4R90H 4RFEB 1T22A 2FR4A 2FDBP 1CFVH 1ZS8B 4FN0A 4NC1C 4G5ZH 1HQ4B 1LO5B 5DHVB 2EH7H 5BOPA 1MHEB 2FBJL 1QD0A 2CPCA 2AXGB 1DBKL 3GSUA 4S0SD 1JVKA 4Z7NE 3PGDA 4WI2A 1U58B 1BP3B 5ISZA 4P23C 4XNQB 2ARJQ 3AS3A 3I6KA 1RY7B 4L3CA 4R0LA 1QLEH 2AJZA 2X1PA 3P4OA 1RSFA 1U93B 2R0ZL 1D5XA 2EDJA 4XPHL 5CEXB 3LAFA 4J8RA 3MRIB 4GRLA 5F6IB 4KI1A 5GGTA 4M1DH 2V5MA 4I0PB 2F9BT 3QNYB 5BOZG 1D6EA 5A16A 3GMOA 4Z0XB 4E42B 3SCMB 2IGFH 3HFML 4WWKB 1FNHA 4RFOH 5HHVH 1UQSB 4HZAA 5CJ8A 5D1ZC 1C08B 4JFZL 1KEMH 1DVFD 4ERSL 4YHIB 1Q72L 1GZPA 5GJSH 1TDQA 3QRFM 1MHCB 2HLAA 4GQPH 3HB3D 1EHAA 4JG0L 2MKWA 3WFEH 4P4RA 3BXNA 3MV8E 4LRNL 4HEME 2F19L 1I3GL 4YZFE 4RMQA 2UWEF 4HLZH 3MJ6A 3UTTD 1P5UA 3QI9C 3SGEH 5L2KA 4Z76A 3KDMB 2NY3D 3P30L 3EFDL 5EN2A 4IHOB 4ESKA 1MAMH 1ZXQA 5TGBA 4YXLL 1BF2A 4OKDA 2IPKB 3D1MC 4MVBC 1PYWA 2GJZA 2P5WA 1QR1B 5E56A 1KB9J 3EO1B 3EYQD 1UT9A 1BLNA 2ESVA 3NPZB 1OTUC 4Q0XH 1DBAL 3TH2T 4UT9H 1MCQA 1CTNA 1P53A 4J3VA 1SM3L 1KCVL 3HAEG 4LQ1A 3DRTB 2HTLD 4OUOA 4QNPE 5CD3A 4F37K 2XNAB 4M4PA 3MLYH 1A6ZB 2GK0B 2H8PB 1I3VA 1VFOA 1Y6MR 5C0EA 1WWWX 5CAYB 1XGYL 1BEYH 1KPUB 3U9UA 1KBGL 3M07A 5DLMH 1VESA 2DKSA 5HGGS 5FK9A 2J88L 5C0IB 4RMRA 3H42H 1QSZA 4GW4B 2WWMC 5ISZD 3P9LB 3LEVL 3N1PC 3V52H 1AQDB 3AS0A 3EYUH 1CFNA 3NA9H 3BPOB 4U0QB 1UM6H 1RFDH 2IFFL 2VL4A 4PLKC 1HYRC 5D71H 5BS0B 3GIVA 2ED9A 5I30L 1SJEA 4KDTA 2Y7QB 5GS0D 1A9EA 4GRLD 3IFOA 3MRGA 3KPLB 1IAIH 5B39B 5HHOE 1P69B 1QZ1A 3U6RA 1X4YA 4KUZL 2FGWH 3E2HB 1FL5B 2C3XA 1AR1D 3L5XL 4WW1B 1DE4A 4HAGA 4RAUB 1NCTA 1U3HA 4AIZA 1I7TA 1A3LH 1OT2A 4ACPA 4OM1L 3QI9B 5C6PB 1F4HA 1ZVSA 4DUWA 2V7HB 2OXHA 1XAUA 1MCBA 2N7AA 4G6JL 2HMID 5TFSH 2DBJA 1M05A 5T3ZL 4HG4J 5CSZB 1KLGB 1UM4H 2B1HH 1AD0A 1D5BB 1R24B 2W0FA 4P3DB 2UWEA 4U2YA 4X98A 4Y16B 3BEVA 4D9LL 4DQOH 4ORGB 2X4UB 3BUTA 3PWPA 2QQNH 2UUDH 1TTUA 3LB6C 5L2KD 1MCDA 4Q2ZB 3O45B 4G42B 5I8CB 3X14B 1OB1A 1GIGH 1IC1A 3CXDH 4KRNA 5D2NC 1CDYA 5AAMA 4OZGF 4X4ZA 2VXQL 4R8WH 4FQXC 2P5WD 4L8CA 1A1OB 2ESVD 4K71C 1JZ7A 2GJ6A 3ARFB 3MCKA 4X7DC 1X5KA 4HX1B 3NCJL 4ZTOL 1GGUA 5DJCA 4NNXA 3MRLA 4QHUB 4C56E 4BK5A 1INQA 5CHNA 1P9MA 5DQJA 4PR5B 1KJVB 1YN7A 4I1NB 3IAGC 4ZFGH 5IIEB 1F45A 4F33B 4JY6A 4AL8L 2IG2L 4H0GA 2UZXB 2YK1L 4P2RE 3V5HB 1YQVH 2MPAH 2P42B 5T1MA 1EJ6A 1JPGB 1UCTA 5DUML 4XBGA 5C0CB 3ZE2E 5C0ND 1LK2B 3L7FA 3B9KA 4V2CB 1E4XL 4HJ0C 4X99A 5DJ2A 4OD2A 5CILL 2CIIA 4U7SA 4DVBA 2ZSVA 2CD0A 2JJTA 2J8UB 5IJKA 1LMKA 4MNQA 1A7OH 4P3CH 1EZVY 1S7RB 4GG6B 1NDMB 2EDQA 4K3DL 2OSLA 3G6AB 2ENYA 3N1MC 1U3HD 4J7RA 3LQAH 1I7RA 1AJ7L 4HGWA 5F7YC 1XR8A 1UZ8B 2BVYA 3QEGH 3DGCR 1JPFB 3OKKB 2NYYC 4P49A 1EEZA 1A21A 1NCWL 4HCRL 3O6ML 4KC3B 3CLEL 4YBLB 3HE6B 3MA9L 2E8YA 3O0RH 2FX9L 5DK3A 4ELKA 3MBEA 4HXAL 4OZGA 4FTVE 3LVEA 4PGDA 4XP4L 1C12A 4UTAH 4S1SH 1QRNB 4OT1L 4ODXA 4PJ9C 4U6HA 3QXDB 4W6XB 3OZ9L 4P2OB 2ZZUT 1N4XL 1YEIL 2O5YH 5JHLL 3CZFA 5D7LA 2GJ6D 5JW3H 4Z7UB 4N0UB 4WI8A 3TNMA 5E0QA 1AC6A 3L3IB 5HI5D 4LLYA 1A1MA 1ZSDA 4LMQI 1WGOA 4N5UA 3MLSL 1EGJH 3BP4A 3RL1B 5SX4I 3E1F1 2X09A 5IESH 4NO2B 2YS4A 3VRIB 2G2RB 5CS7A 5FYKD 4PJ7E 5E8NA 3MLXH 1TCRA 2XWTA 3QUMA 3O6LL 4KDVA 1JV5A 4MA1B 5E99L 4KPHH 5KG9B 1FH5H 2VTFA 4X8XA 2BVQA 2LFGA 4Q58C 4JDZA 3T0XA 4JQXC 3P0VL 1B2WL 5KSAB 5DUPL 3B9KD 4NSKA 1ADQH 1AXSA 1I8IB 2BY3A 1M7DA 1HH9A 1MVUA 1AFVL 2VDRH 5KSBE 1A6AA 2R23B 4MNQD 1FLRL 1MH5B 5ALCH 4KQ3L 5KVGL 2R2HB 3MSPA 2A6JA 4HWEL 3EDFA 4TTDD 1A7RL 3DX7A 3AU1A 3QULA 4OQTL 3OKEA 4C4KO 1J0ZA 2NY5C 3OG6B 3ARGC 4K7PH 3MFFB 3QRGL 1H15B 1ZHNA 3FQUB 3VRJB 4PJHE 1EO7A 2EIEA 2VAJA 3TNNB 1G7QB 2OQJB 5DYOB 1ZT4B 4PRHD 1U2CA 1IFHL 2XN9B 1YA5A 4JDVA 4L3EA 4LSPH 1R3IL 4EDWH 1FJ1B 2EIZA 4EVNA 3BJ91 2P8PA 2Z8VC 4RNRA 1OPGH 1AXTH 1RJLB 1V3LA 4GKNA 2VZ3A 3UTOA 2AV7A 1WC7B 1F4AA 3MBED 4ODTH 1MCLA 3FQXA 3MOAL 4M7JL 2KZ1B 1F6LL 3ABZA 3PNWB 3RWHB 5E70A 43C9A 3TBSA 1YEEL 5I1EL 5D7LD 4H25A 4PY7B 3NFSL 5BZWA 3VXSA 4MNHB 3MJ9A 4YE4H 5CIPB 5IHZA 5DF0A 3O6FC 3RZCC 2ZOKB 2C3VB 4XVTH 4HC1H 1DQMH 2FRGP 3PDDA 5SWSE 5C2BH 1GHFL 4ZAKB 4F3FB 2G75B 3KPPB 2DLEA 1A5FL 2V5RA 3RDTB 5DRNB 1R5WB 5CGTA 1CGXA 4JRXB 4ZPVA 5J1SC 4Q9QH 4X7EC 1NMAH 4AH2A 3MRPB 4LU5H 4WV1A 4F7CB 4Y1AA 4Q6IA 1R3JA 5EOTB 5EU6B 5E2UL 4C58B 2KKQA 2QR0B 1E6JL 1J05B 4HULB 2GJJA 3KLAA 4MAUH 1FCGA 2F8OA 1OP9A 1UWEH 2BSRA 3HR5B 4GH7B 4S10A 5HYJA 4KGLA 5IF0A 1P2CB 4M5YL 2VH5L 3P11H 3WL9A 4XPFL 4NM4H 5D5MB 4IDJL 2AK4E 4LSRH 2R56H 4KJWD 3GJFH 3H7LA 4PG2A 1U6AL 3CUPA 2OM5A 2B1AL 5I6XB 2I5YL 3IYLW 5J13C 2DQCL 4M02A 4UIMA 3K4ZA 1N3NB 1LEKA 1BVLB 2PNDA 4JFPB 2IAMB 4R7NB 1KYOJ 3HCVA 3X12B 4FZEL 3R06B 3KLHC 1A0QL 1NAKL 3FOLA 4Y4FA 2V7NA 4HPYL 4D0DB 2NTSP 4DK3A 3FQRB 4DAGH 5L88L 1IGCH 5SX4H 3TZVB 4P4KC 5IV2B 3NH7L 12E8L 3RVWC 4L3ED 3L5WA 2NY5L 8FABB 2UZIH 3FQNA 4F15B 5DHYB 5I8KH 4MB4A 3LRSB 2RFXA 3T2NL 4QXTA 3QUML 3ARBA 5IEHA 2Y5EA 2R1XA 2JELL 5IB3A 3MRBA 4XMKH 3T8XB 5JIHA 1UH4A 3C6SB 5DJAB 4NGHH 3ISWA 5D96C 2Z0BA 3ARYA 2H3NB 2MKLC 1KJ3H 3DUSB 2VXVH 5FGBC 4NZTH 3JSSA 3SO5A 3VXSD 3MXWH 2BOBA 5L0QC 3O8XA 3FB7A 4HKJA 3RPKA 4NC1E 2ZG2A 3IKCA 1P6FA 3IDIB 4RAVA 5HGDA 2EYTA 1T5WA 4H20H 3CFKA 4PYHA 5HGHB 2QQKH 5C0FB 2FYYA 5CCKH 2NXYB 4IM8A 4J3UA 4XP5L 5ERWA 3WN5B 3P4MB 3CU1A 5E6IA 2WW8A 1QQDB 1RIVL 2KDGA 3W9EA 3PHOA 4M6ML 1ONQB 2Y6SD 5D6CB 1DL7L 3JV4A 2PR4H 3GIZH 2LVEA 4RMWA 4BFEA 2FEEL 3PV7A 1QG3A 3PL6A 3GB7B 4Y1AD 4M62H 4Y19E 3KPRB 3T1FA 2VDML 3CSYA 3LSOA 5IG7A 3HAEB 5EBLB 5TQ2H 4OF8A 4R96A 1DLFL 4ZSOE 1OAQH 4P9HH 3C60C 1NGQH 1MRDH 4PJ8B 5HYJD 2DF3A 1UB6B 3QCUL 1EEUA 3DROA 5BS0E 3KPSD 3TO4B 2F5BH 4X6CF 3RIFK 3E6HA </