5D5MF

Structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 55
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d5mF02
5E9DD 4ELME 1G7IB 4O5LH 3O2DL 3VDCA 1CT8A 1PQZA 4TSAH 4EIGB 2ADIA 2F5BH 4ISVA 3WN5C 2VXTL 4JPWL 5HJ3B 3VU2A 5C86A 3NAAL 5EZJA 4N0UB 2GTWA 3FKUS 4EN3C 1IFHH 3OAZK 3EZ8A 3EYVA 4JE4B 2ICEA 3DPBA 4N8CL 3BQUA 4NQDA 1II4E 1KLUB 1NC4A 3E6FB 4M1GH 3T0WA 4C83B 3KXFE 2Z35B 2J6EA 4N0YL 5D1ZA 1NMCC 3L3JA 5DURD 2OZ4A 1N8ZB 2RIKA 3I3EA 3P4LA 2VKWA 1TJHH 2AKRB 3RZCA 1S7UB 4HH9B 1I8MB 5I1CH 8FABB 4PJ8A 5ERWB 3MJ9L 5I8EB 3T77A 2VB5A 4F2MA 3V5KA 5J13C 1BJMA 3EOYG 1Q9LA 3V6FA 3VXUA 4G9FD 2FNBA 3GDBA 5TFSL 3TZVD 1E27B 3S5LG 4MJ2A 3CVHB 1P4LB 4KZEL 3JV4A 1EJ6A 2VIRB 1D5XB 4QXWA 4M7JH 5HPOA 2ADJA 5EB9A 5EUKB 1U8OA 3L3GB 4NZTH 4PJBA 3NOIA 4RZCB 3LEXB 4JJ5A 3R1GL 1D5IH 4BFEA 5E7BA 4X6DB 5T5NF 5HPMB 1MI5D 1JUFA 3C09B 1WVZA 4R0LB 1F4YH 3FB5B 5IJKA 4KTYA 3V6ZB 2Q76B 2D7MA 4JRXE 1TPXC 3LMJH 5EBMA 5DSCB 3BP5A 4ZQKA 1MJ8L 5D7JB 1YNKL 3TPKA 1FZOB 5GGQL 3L7EA 1XF4B 3QUXB 4P4KB 5J56B 5I73C 3DUUB 3FCTB 4NZTL 3N1PC 1YQVH 3D39A 5J57B 3QFJD 4JY5H 1KFAH 3RWGA 3SE3A 1A9EB 3TZVA 2XQBH 4UIMB 3DO3A 3PWPE 4WWKC 3DX7A 5E94A 1GIGL 1MY5A 3RVTC 4KK6C 1CVSC 1T80A 4I18B 2UUDK 1QFWL 5DQDH 4GG8A 4WO4B 3K81A 4RAHA 5L8JB 5IF0B 4DW2L 4E0RB 5DJ2A 3QNZB 4K8RH 5FM8A 4KU1A 5KW9L 2MMXA 4B50A 2R2EB 1E0OB 1NH6A 1KULA 3KR3H 5IHZB 4KDVA 3BXNA 3H3BC 2IAND 4GBXD 2Q7YA 3N50A 4GRLB 2HA1A 2IALB 2OXHA 2UZXB 2I26N 3OB8A 4WW2F 4WNQB 3CK0H 2EYTB 3P0VH 3D0VB 4X98B 3RNKA 1LEIB 3HPLB 3SE4A 1EHXA 4F8TA 1QSED 3PNWA 3L5JA 2ATPA 1YQVL 3U82B 4X7FC 5E70A 1HOCA 1QLRA 4M5YL 4U4BA 2ADFL 3EW3B 1RZKH 1U8NA 3PHSA 5JNYB 1KN2H 4PLOB 5BV7B 3WXWL 3MQIA 4R9HA 1W72B 2LAAA 4NN6C 4G80B 1HILB 3MRGB 3V6OA 2ATKB 4PLKD 4LP5A 1QA9B 4OF8A 3I02A 1VFBA 4LMQI 3EBAA 4P2OD 5JTWA 3GB7B 1IAIM 5JW4Q 3MRBB 1P7KA 1FVEB 5KG9B 5FCSH 1NLDL 4HG4K 3P4MB 1NGPL 5D2NC 2W9DH 4JCMA 2EDBA 2X44D 2E6JA 3SJVB 2DM2A 3PWPD 4WU5B 3HE6C 2ZSWA 4PJHB 3FQRB 3K4ZA 2L7JA 1QFPA 5GISH 4GKNB 3QEQA 4XH2A 1U8QB 2R0WL 3C2AL 1S3KL 2Q8BL 5FYJL 2DLFH 1Q0XL 2VKXA 3DYOA 3RVXC 5DC9B 1N5AA 1PX3A 3EAKA 5JXAH 1G7MB 3UAJD 4NQXA 1BMGA 3BGFB 5F6IC 3MBEA 2HT4C 1D6EA 3ZKND 3DVIA 3MUY1 4LASH 4Z7QE 1NLBL 1P1ZA 5ILTL 3STZA 1ZWIA 7FABL 1JNLH 5HI4D 2AEIT 2WBJC 3MJ8B 1IAOA 1V5JA 2B5IC 1FFOA 1XGRA 4G3YL 3PWPB 1S7WA 4R26L 3GSNH 4FHBD 1BVKB 3VCLB 2PCPA 5ESAA 5I19H 1K4CB 5T1KA 3HE6B 1MHEB 3WFEH 3WFBL 5KVEH 5DUBB 4O2CA 4S1QH 4Q7DA 3H3PL 3EYOA 3MRFB 3VRLE 3EO9L 4XHQA 5D5MB 3HFML 4XMLL 3F58H 1YC8A 4NM4L 4M6AA 4M6OL 4XWGL 3DVFA 4JRYD 1K8IB 3VFPB 2ICWA 3S6CA 1NEZG 2BRQA 3FONA 3G5XA 3MYJA 1W72A 1QYGH 2DLTA 3S36H 3MLTA 5DFVD 3VG0H 4JAMB 3PDDA 4NHCL 1FE8L 3WNOA 3RL1B 3SJVD 1R6VA 5I74C 1AGBB 4GFTB 4TNWK 2P5WD 1BX2A 2VDOL 1DBAL 2AKRA 2EDHA 3BMVA 3WIIH 1JGEA 1UA6L 2BNUA 4KMLB 4P9HC 4WFGE 1A4JB 4X6DF 1KGCE 3QIUB 2HN7A 1Z6JT 2YPVH 5EORH 1HOCB 2NY0B 5DRXB 4OZHB 3UO1L 1HHGA 3BEVA 4Y7MA 3FO2B 3WIHL 4MQXD 2AQ1A 2Z92A 5SX5H 2Q7YB 4GUPA 4XB7A 3ES6B 2P8LB 4N0CC 3ZT7A 5FUCE 3VWKA 3O45A 2H1PH 1LDPL 4G8FB 4YDKL 5I1GH 4RFOL 3CDFA 4OD3H 1M7IB 3HS0A 1CXKA 3FT4B 1X5AA 3QAZC 1NGXB 2DLEA 4MAYB 3U0WH 5I1EH 1Z5LB 5INCB 4E0RA 2FECI 1FSKC 4OCRH 5FIEA 3VG9B 3FN3A 4KTEH 4NT6A 3HUJE 7FABH 3LKNA 5IGXL 1HHKB 1MJJA 3MJ8A 1S7QB 3PV7A 2VAJA 1D9KD 4YK4B 3T2NL 1M05B 4K2UH 1NAKH 4DVBB 2O5XH 5CJQH 3B9AA 1UB5A 4HKZB 2E7LC 4LEOA 4UTAL 1BQLH 1MHHB 3AREA 3FB6B 4LNVA 1X44A 2FIRT 1NAMB 3TO4A 1E4XH 32C2B 3ARPA 1XAUA 4F7PA 1E4XI 1P9MA 4HWEL 4KI5F 4WENB 3KPLB 4RQQB 4EDWL 2GITB 1I7RB 5TQ2H 3CFKB 5K9OB 4FQPA 3SKOA 5MI0B 1VFMA 3K46A 1N6UA 4I9WD 4L3EE 3PUCA 1EEYB 4X7TA 5JDSB 3PE9A 1I85A 1HQ4A 1UXWA 3O0RL 1JF6A 4YEEA 1BQHG 3VFVB 3S9DB 1PG7H 4M93C 5C0IB 3OMZA 2XN9A 4JZJA 1EO7A 5DFWH 1NDGA 1UZ8B 2VL4A 1T1WA 3LDBB 4NN7B 4BA8A 1DQTA 4ZDHA 1ZA3A 4NNYA 4OCMC 4P4KD 5FV1L 4PJ9B 4PGBA 5E8PA 4XNMA 1TMCB 3EOBA 4JG1L 3MV9A 1ZXQA 1F90L 1MJUH 1V3KA 3RUGB 5I1DA 1L9NA 1A7OH 1XF1A 3BO8A 3WYRA 5IB4B 2C4FT 3O41A 5T1LB 1OGAB 1TVHB 2ESVD 5FA4B 4ZFZB 5K59E 5C7XL 5F3BB 4UMGA 3KPOA 3ARGA 4JM2F 4WHYH 4LRIC 4F57H 1BZ7B 5TJWK 4N5ED 4V1DB 2PXYA 3TH4T 3LEYL 3B9KC 3UJIL 4MCYA 3MLTB 3U36B 5TPWL 3KS0J 4QF1A 3DBXA 2A6IB 3RWCB 2IMNA 3T08A 1INDL 3VH8A 4Y1AA 3GSNB 2WW8A 2JB6A 1VADB 1BD2D 2YUVA 3B9EA 4HWBA 4YQXH 3OJDA 2W59A 1UJ3B 1GGBH 1MREH 5I66A 3TWCL 3SO3C 1V7NL 2IPUK 3K2UH 2E6PA 5EZLB 1FFQA 2XWTB 3QIBA 3DURB 1UQSA 4N5EC 1MLCA 1E6OL 3P9LA 2CUMA 4S0TD 1EVTC 1K5NA 3RGVC 5JW3H 5TE7L 2HH0H 4WTZA 2HT3D 2XYCA 5AWNH 1OP3H 1MLBB 5IVXA 3CDCA 2C7UA 1GJIA 4HJ0C 1ROWA 5ID0A 4JFFD 4ZOBA 1S7WB 3C5ZB 3PWUB 4MVBC 4DGIH 3T4YA 4P46D 1I3RB 1T1XA 3SJVA 3WE6B 4A2MA 1SBSL 2DICA 3BKYH 2ZUYA 5DD5L 5HHMD 4JR9L 2XY1A 2BNRB 3MJ7B 1MJ7L 2VXQH 4HCRL 1H3WM 5GSRB 4X5XB 3GMMA 3ZZ1A 1JGVH 1OPGH 4Y4KD 2IBZY 2FCBA 3V4UL 4HWBL 4JRWA 4UV7H 1G7MA 2NY3C 3TYGL 3QXAA 3QXDA 1DQDH 3BQUD 4LCWE 4XP5L 2GTZB 4XCYB 3VXRD 2BX5A 1IAIH 4XCEB 4TRPL 2VR5A 3WFHA 5DMYA 4W81A 3SEPA 4R6UA 1ZGLM 5KSVA 4JZNB 1LEGA 1N5YH 5SWZB 1G7HA 3MGOA 2I27N 4OFIA 2FJGB 3ECBA 4M43H 2HLFC 3BDXA 1A4KB 1YMME 4YX2H 5EIIB 3BAEH 4RGNB 1KCKA 5FYKL 4RGMB 1LP9F 3HI6H 1QLFB 2ED8A 5HDOA 2H2SD 2DJUA 2AEPL 3QB7C 5DFTA 4G8GA 5FHBH 2VDPL 4MX7A 4XPGL 4GRMB 5I9QB 2X70A 1X5ZA 1PX4A 4O9HH 5MHSE 4RMSA 3NCYS 3NPSB 2MCPH 3KPNA 3O8XB 2C9AA 4OFVA 2NXYD 4Z8FL 4WW1B 2F9BT 1BAFL 2PXYB 3A6BL 5DJCA 1U8LB 4LSPH 4KDTA 5C0CE 2FEDC 2VAAB 2G2RB 4GKZA 2W60B 4OD2B 2NX5A 3OJDB 1OWRM 5E1AA 1MREL 1VADA 4NCDA 5FUZH 3P2TA 2XZAH 4PJXE 3VWJB 5BJTA 3RGVD 3R06B 2CH8A 4BKLB 4AZ8A 3QQ4B 3A67L 4QRRD 2XKNA 1U8IB 4NHUA 3LH2H 2QSCL 3QFDA 5F3HA 3UAJC 4J1UA 4G9FB 2Y4SA 3QPQD 2X89D 2EE6A 3ESVF 4DCQA 1JGLH 4MQSB 2YHGA 1TCRA 3O6LH 1FVCB 1MAJA 4Y2DC 1IGMH 2F8XC 1S3KH 5FYJH 2Q8BH 1E28B 4IEFB 3VXOA 5I76A 4YDIL 5GGUA 4HQQL 2B1HH 2GFBB 5FYLD 1F4YL 5E9DE 5SWZE 5E4EC 3LN4A 3FQWA 4JFFB 5DJ8B 1IM9A 4LLUB 4AG4L 2UWEE 4TNVF 5HHXL 2W65A 4M5ZH 3ZDXF 4P9ML 3IVKA 4OUOA 2QTEA 4OM0L 1JL8A 3JV5A 1RIVH 4OCLC 5DVKA 4BSWB 3KYKL 2ZCLH 5KSBF 3QCVL 5MEOA 2Q7NA 1GGIH 1X5IA 4GXUM 4JFXB 3C08H 1U95B 4F80A 2D2OA 5GGVH 3TNMA 2VNCA 4L3EA 2C3WA 1KN2L 3A6CL 1QRNA 4FQHA 3SDCA 4F33B 4F7CA 2F58H 1ZLSL 1KTRL 1O5DT 2Z8VC 1OAYL 5IVOA 3QJFA 2DKUA 3SE9L 3OQ3B 1BEYL 2VXVH 4LPUA 3LV3B 4PS4L 1T5WB 3RVXD 3S36X 5CBEB 4H26A 5E8OB 1UWXH 3CUPB 4LSSL 3K8MA 5EULV 2DWEB 1P7QA 3CVHA 4ZO9A 3E6HA 1I9EA 5EU6D 3QDMD 5KVFL 3F12B 2FO4A 4DUVA 5LWYH 4Y5VC 5K9KA 5FUZL 1RUML 2HT2C 1VFBB 4Y88A 2ZG3A 4TOYL 1PKQE 3VFUA 1YEKH 1QA9A 2XZCH 5DWUH 9CGTA 1ADQH 3MSPA 3U46A 4PJ8D 4NQTA 4TNWF 1J9CT 3WNPA 2OI9B 1TJHL 5GSVB 1QACA 3R0MA 2P8MB 4K8RL 3RTQB 1WEJL 3I84A 2QR0A 5GGTA 4G42B 1TNNA 5IBTH 1FGVH 3P11L 1BP3B 1NUDA 4QXGH 4ODWB 2VDPH 1LILA 5E1HB 2CO6B 4QHNA 3NCJL 3L9RB 4ODHH 4HZLA 4X98A 1NCDL 2UV3A 1IM3A 2XQBL 4ENEC 5F89B 4OSUL 5D70H 2Q86A 1SVZA 4WFHD 4JY5L 5D7LB 3I9GL 2UWEB 3STBA 1MCQA 3NIDF 43CAA 2Y5TA 4IIQA 5EIVA 2NY6C 2PR4H 5I8OH 3OHXA 3QUMH 3MUGA 2D7TL 3RWIA 4AL8H 4NZJA 1HKFA 4L4VB 4FABL 3KXFD 3NIFF 3PQYB 3VA6A 5BZDA 4I77L 5D2LF 4OJFH 3EO0B 2QHRL 5C6WH 3UBXI 5DT1L 4BSJA 3TA3C 5C0AE 2W9EH 5F70A 1CL7L 4MHHG 1I4FA 5L6YL 4NJ9L 4MNGB 4TVPH 1A3LL 5A2JH 3QULA 4NO5B 5TDOA 5KZCB 3QUYA 2WINA 3KPRE 5C0EA 4G9FE 2AK1L 4PRHB 1ZGLA 2HWZL 2L0DA 1U3ZA 3DGCR 1HHJA 1M6OB 35C8L 4L8CA 2R23B 4HK3J 5H35A 1CQKA 4HWEH 2V7NB 1BQHA 3SE3C 1NL0L 3SQOH 3U83A 1KJ2L 1MRFH 4FXGB 2I60H 2NW2B 3VFSA 3D5OF 3INUL 2G60H 4Y4FA 1MFAL 3FFCE 1IBGL 3QDGB 1ZHBA 4PRDB 2I60L 3T0EC 5L2KE 2BY3A 1ETZB 2EYRB 3BKCL 2CLRB 3IU3A 1SBBA 2NXZC 4JHBA 4MNHA 3MRMB 2QHRH 4UQ3B 1OSPH 1W8OA 2E8ZA 5CIPB 2HVJA 4NRYA 4PB9H 5HHMB 4PV8B 1IQDB 1IAKA 2HVKA 3W0WE 5EWIL 1W0WA 5CKAA 1KEGL 2EKJA 3VXSD 3Q5OA 3P4MA 5E6ZA 3S34L 3B2UC 5I1GL 4RMWA 4BFIB 4MJIE 3RZWA 5C0FB 4LHUD 4GW1B 3VE0A 2HFGH 2N7BA 2BVPA 4KKBD 1QNZL 3CC5B 4PJ8B 3JV6B 5D70L 2JJVA 3MLWL 1LO5A 5E8EB 2EDOA 2HKFL 4PY7B 5EORL 1V05A 3UYRH 4A6YA 4EVNB 3BZFB 5ALCL 5I1HL 3QQ9C 2AI0H 4WUUE 5IK3B 3OR7B 3D0LA 3QG7H 2HFGL 1WEJH 4ERSH 3MRQB 1B9ZA 4L9LC 3PJSB 4HW6A 2VH5H 3F7VA 3T3MF 4NZRH 3VGAC 2VDRH 3NCCB 4NCC1 2DQCL 2YA0A 3VXRB 1ZS8A 1NCDH 3BWAB 2AQ2A 1DBJH 2Y07H 3ZTJH 2R56H 1I8IB 3GMPA 2Y9RT 4RA3A 4XVUC 1FVDB 4LGSB 5CZVL 4MWFB 1YDPB 2F5AL 4LPVA 1R3LA 4F7TA 5C0CD 4Y89A 5EO0A 3LPWA 4W6YB 4MQ7B 1B0WA 1RZ8A 5K9OA 3T2NH 3QIWA 1JRHI 4FP8H 1BQHB 3TN0A 5EU3B 3JWOC 5DTFA 1J0IA 2R2BB 2VDNL 2EC9U 1DUYB 3P4NB 4XP9H 2VLKB 3DXAD 3ZDYE 1IEAB 4E42A 4ODVL 4PB0L 1FZJA 3V0VB 1CFTA 5C0EB 2Q76A 3CXDH 1F4WH 3K1KC 3UTTE 5LGHL 2YPLA 4HKXA 1NC2B 1AGDB 5CGYD 4JKMA 2MTPA 3QUXA 2X6MA 4OIBA 3RVWD 3NVQA 1OT1A 3ESUF 5B38A 4OZGF 5EUKA 1ZE3C 3G6AB 5IB2B 3NPSC 1RVFL 2G9HB 1HHGB 1Z0MA 4RIRB 1MCLA 1KB9K 1N0XH 1IC5L 3BPNB 4ZTOH 1MIEL 4XP5H 3SDDD 5LAXB 3T8XA 4ONFH 4KK6D 4S0SD 1TCRB 2APVA 1RZFL 5JHDD 1ZLWK 5AD0B 4XNYH 5CGYC 4OZHE 3IFOB 1T04B 2IANB 2Q1EA 2G5BB 2BOBB 4R4BB 4X0KB 4HCRH 1AD0A 1NUFA 4MJIB 5E7FA 4M7JL 3KYOB 4UB0H 5CSGA 1OOAA 1E4WH 2UWEF 5JXED 1U3YA 1MCCA 1UVQA 1YEFL 3JV6A 5I8KH 1JRHH 1Q72L 4M1DL 1J1OL 2OK0L 2J5LB 2A6DB 2F74A 4WI6A 3V7MA 4GO6B 5I1CL 1T7YA 2AXGA 3O3DA 5ITBH 4XBGA 3GRWA 3V4VH 1FFRA 3ULUL 2PETA 3L5HA 3VXTB 4UQ2A 2BC4A 3K2UL 2V7HA 2ZWLT 5C9JB 2DQFB 3MZTA 2A6JB 2XACC 3MODL 3RVUC 3ZL4L 3BGAA 4OIIH 1KXQE 3MO1A 1OHQA 5ACZB 2NW2A 2QQLL 4HJGB 1RUAL 4LU5H 4BZ1L 1IAOB 4C57C 4JRYB 4M7LH 2CRIA 2FX9H 3QEHB 3LKOA 1MH5B 1MOEA 4P2OC 3TNMB 1PJ9A 3OKNB 1WWBX 4KK5D 4R3SB 4WI5A 5TDPA 4XC1H 3V0VA 4PRBB 3O6FB 1ORQB 3IFPA 4HGKC 3LRSB 1A6TA 4OI7A 1ND0A 2V2WB 1F90H 1MJUL 3LRSA 1NFDB 2D7OA 1KPUB 2X05A 1JRHL 1Q72H 4M1DH 5DI8A 2NMSA 3AS1A 5CAYB 3FRUB 5FYKU 2OK0H 1MI5B 3TFKC 5IG7A 5E00A 4H20H 3BUYB 1LO4L 3QHZH 4OB5H 1QBML 5FYJE 3PP4H 3AAZB 4JG0L 3HPJB 1KFAL 2FL5A 3EYUH 5ACLA 1A5FL 3TBVA 1A64A 1ACZA 4NNXA 5KJRH 1EHNA 4HFWB 4KTDH 4PJ5E 3U2SA 5HYIA 1DQMH 3ILPA 1TITA 5ALBL 1AHWB 1OW0C 4CDGC 3DRQB 5K9JL 3RWFA 3KPRA 4ODBD 1T1YB 4I3RL 4XBGB 4HD9A 2Y06H 1OD7A 3F5WB 4XB8A 3T65B 2VO5A 3QQ3B 3TLRA 5KS9E 1IARB 1EEQA 5IHBA 1OAKH 4X6BA 2HH0L 3GJFA 1DZBA 4M93B 1ZGLP 5HDBE 2J88H 1JZ8A 4YXLH 3V4UH 3OAUL 1PSKL 1S9YB 3R1GH 2P1YA 1UXSA 4I0CC 3S37H 4LDLB 4QYOB 4MXWL 3NFSL 4OF7A 4TSBL 4WW2C 5D2LA 2BNQB 3GSQA 5DD6A 1DBKH 4JPVL 4DOHE 4RX4D 5GSVA 2Q20A 4WJ5A 3RI5K 3BMWA 3U46B 5KVMC 3JWDC 3SGJA 5HHNB 4F9PC 1T6VN 3ARQA 4C56D 4M62H 1VHPA 1J8HE 2DLIA 1YYLL 1KJVA 4N1HB 4EUPH 4IRZH 5HY9B 3GMOB 2HTKD 1E6OH 1KCUL 3QCTL 4LFHD 3BUTA 4Z8FH 3IRZA 3QXVA 4MD5A 3RPIB 4LARH 3QNXB 5FYJD 1W2KT 3HHRB 4K7PX 2XRAH 4RDQF 4X6CB 1CIDA 2G5RA 3G5YA 5DD1H 2HTKC 1T7XA 1YEDA 5L7XL 1VPOL 3U7YL 4DQOH 1TENA 3WFHB 4TUKL 1YJDH 2MQCA 1KV3A 3N85L 5CEZL 4O02L 3RA7H 4PJBE 3N1GC 4NKIH 3RFZC 4MXQC 1IE5A 4UIMA 5HI3D 4QXTB 3AU1A 5JPNA 1HNGA 2I24N 1XIWD 3BWUC 5HDLA 5ESQB 4NP4H 4J7RA 3MLWH 5ISZD 4S1RH 1SQ2N 1RZ7L 1S7XA 3BE1L 4XNQA 2DQFA 4H0GA 4APQC 2Y5EA 3DMMB 3BT2H 3RZCD 3ARFC 2YXMA 4PTUA 5B39B 4YHMH 4EOWL 1CLYH 4ZUTB 1K8DB 5E6IC 1ZLWH 1ZT4A 1FDLH 2DDQH 1UENA 3F7YB 1G7JA 5GIRB 3ULVF 3VFWB 1S78C 1CZ8L 4HBQA 5BMFL 3UDWA 1B0RB 2E5EA 2XI9A 4UDTA 4PUBH 1OAUL 2YPKA 1Q9OB 3MRNB 4NZDA 5MENE 2VABB 3MZGB 2HG5B 5H37G 4OZIB 1DL7H 1T3FB 3R06A 1WFNA 5EG6C 1J8HA 3FB7A 3NPZB 1AD0B 3IDIA 2H32B 2BK8A 4JM4L 2Z8SA 3QIUA 3GBNH 4ODSL 4N0UE 4NO0A 3KYOA 1JHTA 4XAWH 3QO1B 3DSFL 3D1MC 2HLAB 3WNNA 2C5DC 3HE7B 3KPNB 3RQ3A 5JA9A 2OJZL 3EHBC 1QFWM 4AL8L 2MHAB 2R1YA 5HYQA 4M5ZL 4R7NB 3MROA 3U6RA 2AV1B 5FAAA 5BW7A 2DJSA 4HFUH 4ZNCD 2F15A 3U9UB 3TF7C 5J0BA 4Y16C 1YEJH 4Y8DC 5EOTB 5CEZD 1DQJB 2ERJB 1AIFA 4RCAA 3FOMA 4KRLB 1L7TH 2HRPL 3FT3B 3EJJX 1M7XA 3EYSL 4NZUL 3UDWC 2AJZB 5D1QA 4U6YA 4F7CB 2C3HA 2EH7L 4LPTA 5EBGA 5KSVB 1MFBH 3L5XL 2FEEI 3MOBH 4HFUL 4YHOL 1KN4L 4XXDB 1UWEH 1KYOJ 2VLKA 1IC7H 3EOTH 3UTPE 3CFJA 4UILH 3RIAF 3RVWC 2ADFH 1GVIA 4PY8I 1QO3B 3OKYA 2O5YH 2J8UB 4JHWL 5FM4A 5I19L 4DKEH 4AEHL 4OZGA 3MNWA 2EC8A 5CINL 3V5DA 1A7NH 3QIWB 4TPRL 5E4IA 3WLBA 4MJ5A 3ZKMD 3CCHA 1D5ZB 1G1CA 2OQJB 3HZYA 2DKMA 5DJ8A 3T1FB 3CNKA 3PDOA 2P4AB 4I5BB 1OB1B 5DJDB 4PGZA 5D6DA 2G60L 1P2CB 5F1SA 3RGHA 4LCIH 4L8DB 1YN7A 2P24B 1KPRB 4I3GA 2EE3A 2I5YH 3IDUA 3MRKB 3E2HB 1Q0XH 2NY0D 3P9LB 5C0DB 1MI5E 3ZDYF 4WU7B 1UM4L 1G1YA 5HPMA 3DURA 3NACH 3QUMB 4G3YH 2BHUA 3BZFA 5IIEA 1OAXH 3VWKC 4HIJA 1FGNL 3VXMB 4P9HL 3GMQB 1CU4H 1FBIH 1PKQB 2VLJD 4LGRB 4QXUL 4YHML 4MMZC 1NLBH 4YE4H 5ICZA 1ED3A 2RCSH 4U1IB 3GI8L 2HJFA 5EO1A 4E41D 4QF1B 2GY5A 1QSVA 4NJ9H 2R69L 1B4JL 1CLCA 4B53A 3I2CL 4HC1L 1F3JB 3IFLL 5E1AB 4U1LA 5SWQA 4S11A 1RSFA 1T04A 5GZNC 1T3FA 4KUZL 1G7PB 3VI3E 1I8MA 3GKZA 1JI1A 4N9GB 1RIHH 3S35X 3L5WA 3W39B 2NY1C 5CEXA 3PV6A 5GISL 1FNSH 1YPZE 3C60A 2WK2A 3DX8A 1ORSA 5BXFA 4C58B 2R69H 2IPUG 1HIML 4NQEA 2Y6SC 4PGEB 5JPMB 2DIBA 3IDXH 4Z0BL 1UM5H 3BKML 2APWA 1OWWA 1OVZA 1ES0B 4X9HA 1S7SA 4Z0XA 1MAMH 3ISWA 5K9QI 4D0DA 5CBEA 5C08B 4YDJA 2IQAB 5C07E 3K7UA 1XCQA 1TJGL 4PJFE 1GAFL 2QQLH 1FGNH 1YEEL 3CZFA 5EPMB 4XWGH 3I3DA 5FCUH 4APQB 3A0OA 3L95A 3O3BA 1CT8B 4U6VH 3H9SA 2BDNL 4PP2B 2LU7A 4HV8B 2CMRL 5LBSH 3RNQA 3X13A 3QNZA 4MCZA 2J7LA 2XN9E 3P4OA 4KZDH 4FQ2H 4ZXBC 3BP4A 1KB5L 3ZHKA 2QADC 3IVKB 5J89A 2AXHA 5DS8B 3AREB 3FB6A 1NDMB 4P3CL 4ZS6D 1CI5A 2W65B 4IMLA 3SDDA 4Z7UF 3W0WD 3CLFH 4PJFA 4UIKL 4Q9QL 1GSMA 2A83A 2GW5A 5CD5C 1G9NC 4JRYA 4H25B 3AM8A 4WFFD 4EJ1C 1JCKA 1A1MB 5BS0A 2OI9C 5F7EH 1ZVHA 4NO5A 3RVUD 3B5GA 1A7PL 2XTLA 3F7PC 2A1WL 4HPYL 2F5BL 2NY2C 4UT6H 2QLVB 4IJ3C 1W0YT 3QDHA 3IDGB 1PYWA 4PGCA 1DSFH 1F00I 4JLRB 4KJPC 1N6VA 4D3CL 1M7DB 3D18B 1GOFA 4TQEH 4JQXA 4KKLD 5ALCH 5I1HH 1P84K 1KENH 4ZTOL 1EAJA 2VISB 3KLHC 1YEFH 4GAJL 2NYYC 2Y06L 2Z92B 2HLAA 2OBGA 4JGMA 5KVDL 2Q87A 1NAMH 3DRTB 4ZD3L 1G0XA 3O45B 4JGJA 4JDVA 4KK8D 2Q86B 1T83A 3ZE0F 1A7QH 4HZLB 5A16A 3V0WH 3GNMH 2UYLA 3OKDA 4KJPD 4XBEL 4JO1L 1MJ7H 1XCTA 4CN4A 5C08E 3W5MA 1G6VK 1VACB 3RTQA 4H88L 5GGSA 4ZD3H 3U36A 2EEBA 4EDWH 1UCBL 3PWJB 1S9YA 3RX7A 3WL9B 1IC5H 1B0RA 5HGBB 1OSZA 4KI5C 2DYPD 1TZIA 3H7BB 4CUCA 2VDNH 3RZCB 4LSDA 3KVQA 4PG9A 1N4XL 1JFQH 1GC1L 4YH6A 3JV0A 4BQ8A 4NQCA 4S1DD 3FHAA 4XC1L 5IWLA 4HBCL 4FFZL 1A9BA 5T1MB 1XH3B 4GAGH 3MTRA 3ZT5A 1K6QL 3VXMD 2XFXA 3CFEA 3HG1A 4CU7A 1AP2A 2EDXA 5CCKL 1CD0A 3O11B 5L2KA 3ULUE 4LLWB 1U58A 1AC6A 3QH3B 5B39A 2A9NH 1EERB 5TE7H 4RFOH 2VZUA 1FN4B 4NGHL 4W4NA 4LSPL 3ZE1E 4KV5F 4BZYA 5ESAB 4QNPF 3V4VL 2EIZB 2DQIH 1BAFH 5MEOB 3ZT6A 4XC3L 1HHJB 4KVNL 3GGWA 4F9PA 2VSCA 5F7LB 1YNLH 2DL9A 4AIZA 1KTLA 2CLZA 3T04D 3BOVA 4YXHH 5ENWB 1MNUL 1AXIB 3HRPA 2V17L 2XG5A 3HNSL 4BQ6A 3P77A 4YZFF 5E03A 2OTWB 1BBDL 1HSBA 4C56B 1NGYA 3E1F1 3GUTB 3MV01 4Z7VB 5D1XA 5EU4B 5GGSY 5EUOE 1M71B 2CXKA 4TULL 4XTRC 1CBVL 3HE7D 5MERB 2HKHL 4NCC2 3NCJH 2X4UB 4LBEA 1IKNC 1MCPL 1HHIA 2VLME 1VA9A 3MJ6A 5KVGL 1ZT1B 4OFYD 1D5IL 4P2RD 4XC3H 2BY0A 1E27A 1OPGL 3WHE0 3IETA 2LVEA 4JKPL 3RWCA 1EZVY 5D5MF 5MENA 4HEPG 5CEYA 4PTTA 3D85D 5DJCB 1F4WL 1MCWW 3AY4C 3SDCD 3GSOB 1XGUB 4ACPA 4Z7NF 1YEKL 2LABA 4QHUA 5SV3A 4OD2A 3LD8C 4ELKA 3QWRA 3V0AC 4G8EA 2IC2A 1F3JA 3PABB 2IH3A 3PL6D 4CBPA 1Y0LB 4BSVA 1T4KB 1XT5A 4OCYL 4L8SA 4P5KA 1I8KB 1A2YB 3Q48A 4WHYG 5KSUB 4DFIA 4HS6B 3IXTA 2FRGP 3UPRA 2GHWB 3GSVA 4PY8J 1ZLSH 1S5HB 3AMLA 3D3VD 1JGDA 4Q58C 1H3PH 4IS6A 4Y4FB 2HFFA 4OF6A 4PJXB 5KSAC 5JHLH 4X7TB 1I3GH 3VFSB 3D6GA 3FB8A 3OKMB 1BM3H 1G6RB 1R5VB 2CO7B 5DUBA 2YBRA 4ZPVB 4POYA 3JWNC 5CBAA 4M6ML 2ICWJ 1MVUB 3C5JB 1QBAA 1FZJB 3OF6D 4D9QD 4EOWH 4IOFC 4LAQL 4KHXH 3MNVA 2O5YL 3CSBA 3JUYA 2IJ0C 5DRZA 1PDKA 3VGFA 5J6GA 4GH7B 3T2QA 4HK3N 3SDAD 2OQJA 1S7TB 4KDTC 1XZ0B 5AG8A 2VWEE 2QQQA 1S7TA 3KPPA 5DS8A 2Q3ZA 2B1HL 3BEWA 3GBLA 4ZXBB 1AC0A 4OLWL 4J6RL 4XCFH 4BK5A 4HMCA 5GS1B 1C16A 1KJ3L 2HTLD 4YPJA 1IT9H 2AXJA 1T0NA 2ESVA 2P45B 5ECJE 3CPLA 4FXLA 4QRSA 5I2IB 1QLEH 5GRJH 4HKJB 3T3PF 1W0VB 4PRHD 3KPSE 2J1KA 3MC0A 5HYSA 3QFDB 5JR1L 1AR1C 4XX1G 4LHUB 5C0NC 2ZUQC 1NMBL 5C0JA 3QRGH 5I1JL 5F9JB 3P11H 4XPHL 2ZUXA 5E2WL 2AEWA 2VE6A 3S35H 2HT3C 4P2QA 2IH3B 3WFBH 4N9GA 1A6PA 5IGXH 4PRAA 3BN3B 3JWDL 5F3BA 3RWJB 4OCYH 1T1ZB 4AQOA 2O26U 5CHNB 5FA3B 5LXGL 4KHTH 3VXQB 5I71C 4XPAL 5C0ND 1NSNH 3KPRD 2JJUA 3IGAB 1PZ5B 1WSST 4N90E 1C5DB 2YK1H 2QEJA 4U1IA 2W91A 1BOYA 3MV7A 2Z93B 5C0IA 3SE9H 1MCKA 1AY1H 4ZDHB 4MAYC 5EC1A 4MAUL 4H5SB 1I9RH 4FQCH 1BFOA 4YIQA 4FQHB 3WSQH 3BPOB 2AVGA 3CFKA 1KTDA 4POZD 2R0KL 4XPFH 2ZNWA 3LN5B 4X6EA 5CP7B 3LB6D 1MFDL 3H3KA 4OM0H 1DTUA 3AREC 3U4BH 4WO4A 1LK3H 4GJTB 5K59F 3H8NA 4MDJB 1INEL 1MHPH 5EU3A 3ULSA 2A74B 2VOTA 1OP9A 4HPOL 2BXYA 5I71B 5DGQA 1U8KA 4OCWL 1BFVH 5BS0B 3DX7B 5E94B 4ODXB 3UJJH 1I3UA 1H3VA 5FO9B 4Y19E 1KLFA 3IYLW 4L29A 1NKOA 4PGDA 1RK1A 3GGWB 5CUSL 3U4AA 3OZ9L 1ODAA 5GHWL 5E9DB 3VFMA 2GK0A 2WSKA 3AM8C 1EGJL 1IQWH 4EN3D 4Y5YB 1K3IA 2EDEA 4XXDA 1SJEB 1J0ZA 3IKCA 1U6AH 4Q6YA 5F1IA 2VLLB 4D2NA 3ROLB 1EZVX 2OTUB 1ADQA 5D5ME 2OR8A 1BPVA 3BDYL 2D3VA 4XPHH 1FIEA 3TBWB 4LF3A 4NKDA 3RVTD 1GPOH 4LRNL 1NCBH 2BJML 3X14B 2W0PA 5IB1B 5GS1C 4PJGA 5KSUA 4XAKD 4OF3A 4JFHD 4R7NA 3U6RB 3HNTH 1CTOA 1H0DA 1FC1A 3MLYH 1J0JA 2QQNH 1QLEL 1BEYH 5DMGC 5C07D 4OZHA 3H7BA 2R2CA 4HK0B 3TZVC 3FT2B 4ERSL 1OSZB 3QG7L 3FO1A 1QFWH 3ZLQC 3EYFB 4ZS7L 1LK2A 2EH7H 2Y25A 4P5TA 4PY7A 2EO9A 3H42H 3GSQB 1A6AB 3LSOB 2XY2A 1OARL 1J8HB 3UTPD 1JJUA 4NDMA 2QHLA 3OL2A 4ZFGH 4U1KB 4PJ5D 4Y5VB 4GW4A 1KCSL 5ICZB 4W6XB 2P44B 4GSDH 3TBSB 5IVZB 1V7MH 4F3FB 1X9QA 1INEH 1MHPL 5HYSB 5HXMA 5IFAH 4U33A 2BFVL 3KJ6H 3GIVA 4YWGL 4GAYA 1QFUL 4K7PL 3O4LA 4HJJH 4XCNB 5FV2A 4YHYC 2W07A 2X4RA 4JZNA 1Z9OA 1BLNB 3ARFB 1VERA 2IPTL 4OD1L 4JFHE 3H0TA 4I18A 4D3CH 5M95B 1MRDH 1KPUA 3X12B 4HWBH 2FH6A 4MNGE 4WTXA 2ZPKH 1NEUA 4RGND 1KTLB 1IZKA 1ZGLB 3WKNA 1XGRB 4OT1H 5F7MC 1N3NA 4MJ5B 3PWNA 1JZ5A 1F3DH 4NWUL 5E00B 4BZ1H 3QULB 1HYSC 1A1OB 2YPLD 3DI3B 4P9HH 2A74A 5D7LD 3PP3K 1EH9A 1A7NL 5B38G 4LRNH 1G9ML 2V2WA 1CFSB 4KH2A 1UCTA 3SKMA 1I7ZA 3MNVB 3LEYH 3MA9L 2EIZA 1ZT7A 4HF5H 4XNUH 3VXNB 3VD9A 1R3JA 3ULUH 3W9EA 1JK8B 3FT4A 1OAZL 3ME0A 1D7FA 1RZGB 1YQ2A 2E27H 4W68A 1MCBA 2C4FU 1P6AB 5SX5K 3DETC 2R29H 2XWJA 2WV3A 4Y5VA 4P46B 4Y8AA 4J1UB 3MRIB 4NFBA 3HC0B 2NCMA 3VH8B 2EE2A 5D96C 5F96H 5A40E 1LO0L 4TVSa 1WAAE 4F2MB 5EUOA 4EI5D 5F96L 5KSAD 3H2WA 3PGCB 1IL1B 4HUXA 4QRPA 5FOBA 1UJ3C 2CKBL 1GZQA 2IQ9H 1GL4B 4PFEA 2DWDA 3SCMB 5JIPA 4NBZB 4OM1L 4L4TE 1P4IH 1WCBB 2RJMA 3UBXA 1VEMA 3C8DA 1QVOA 2ICCA 4ZUUA 5IMLA 1RD6A 2E27L 2FBJH 3KPQA 4GOSA 3BXNB 1RIUH 4JPKL 5FXCH 5BW7C 2D0HA 2KBGA 5FM5O 4G8GE 2BOCA 3FFDA 3LKPB 4UTBL 4NQUA 1QTYT 1AQKL 5BS0D 2HT4D 4JFQA 2CUHA 5BQ7A 2AJVL 2ZUTA 3QXUA 2JELL 4UT9L 1K4DA 4Y2DA 3SY0B 1YY9C 1RURH 4IRJB 2P8PA 1QSEB 1T5WA 4CW1A 3I6LE 4NWUH 4I3SH 2AJ3B 3PDOB 3KPMB 2XQYG 1KJMA 3HZYB 2VLRD 3S37L 1MCIA 4K2UL 5FFLA 4RWYH 2GKIA 2IADB 4HZAA 3QISA 2DQEH 1X6LA 1RZ7H 3ZTJG 3VMPA 4NIKB 4JFXA 5B3JE 1J18A 3BZ4B 3FQXB 1D5BA 3NZ8A 3L1OH 1KIQB 3AY4A 5DMKB 5EU7C 4P2OB 5I16B 3ALXA 1EHLL 5I75C 1CFVH 3S96B 5C6PB 5CEZH 4OFDA 5KAQF 1HHHA 1CLZH 2EDFA 3FQNA 1T66D 1XFPA 2DBLH 3G04A 3GSUB 4MXVE 4OFKA 3OPZH 4XT1C 5I75B 3TIDB 5C08A 3E3QE 3QUYD 1JMXA 4N68A 4WV1A 5HGDB 4V1DD 1FSKB 2YOCA 5DUMH 3OX8A 1KIRA 4QTIH 1U93A 2Q6WB 4IJ3B 2FJFB 4YDIH 4P59L 2IQ9L 4LCUB 4L8SB 4PYGA 3LZFH 2X4OB 3RUGE 4U6XB 4X7DC 4FQJH 4HDIB 2IBGA 3O6LL 4I48A 3D0LB 1BBDH 1CD1A 1MIML 3MRJA 3U7YH 1JV5B 1JHTB 4K8RC 2R9HD 1WGOA 1F6AB 4JY6B 1CG9B 3BHBB 4U3CA 5D2LB 1IGJA 2NNAB 2BOBA 2ZUSA 4LARL 4FTVB 2PYEB 4KI1A 1RUKH 5T1DH 2FX7L 3IU4H 4KVNH 5I74B 1KYOK 4GG6F 4HBCH 5JIIA 1KF9B 3O6KH 4UINH 3BPNC 4ISVB 4N1EA 5C07B 2WIIB 5ISZE 4FNLL 4OV5B 4JO4L 3UYPA 1NGZA 6FABL 1RFDL 3MRLA 1J1OH 1MWAA 4EZMA 1I7ZB 4PV9B 5DYOA 3TGXA 3P77B 4JGUA 4ZFOA 2X1PA 4M02A 1UB6A 1ZHBB 2DL2A 1ZVSB 1MFEH 4EUPA 3WS6A 1BJ8A 5B8CB 3PWVA 4PJCF 2WBWB 3O6FC 1A4KA 1M6OA 4JPKH 4MB5A 1F13A 4WW2A 1EEUA 2Z31A 3WEXA 5K9QG 3EYUL 1BZ9B 3PGFL 3RWEB 3IKKA 3FN9A 1KEML 4M3JA 3MACL 1NDMA 1I4FB 1RZKC 2P43B 2R2BA 1QO3A 1QUNA 5MEPB 3SGKC 1BWMA 1YMHA 2XG4A 1C08B 3G5VB 1A6TB 4ZS7H 2YD9A 4XNXH 3P73B 2WP3O 3VXME 1RZKL 2QKIA 4LCYB 3WN5A 3HI1A 3OKEB 5D6CB 1VKXB 4TVPE 3LS5H 3TVMC 4U1GC 1DANU 1UQSB 5GRUL 3S88L 4WI7A 4K3JL 4K9EH 3U7WL 4R2GB 1L0YA 1YN6B 2YK1L 4WDIA 3KDMA 4ODHL 2XZQL 1QSFE 4NRXB 1E6JL 2VDQL 1AH1A 1MLBA 4QRQB 3NIGE 2NX5E 3FO0H 2GQHA 3EO9H 1IGML 4E41B 1KIPB 1FGVL 2DQTH 3LQZA 3T2PA 3ARBC 5HHQA 3MUZ1 4DEPC 4UBDC 3GSOA 1FL6B 3PWLA 3V2AR 3JWOH 3T2OA 2NY2D 2CGRL 3ARDD 4XCCH 2RHEA 1AGBA 4FTVA 3IDIB 1O7VA 5DD6B 1HINH 2F54B 4YHNB 3C8KA 1VGEH 5DJYB 3U30B 4GQPH 1E6JH 1QP1A 4ORGA 5JR1H 1ZHNA 2YD2A 3TO4C 1LO3H 4M7KL 2NYYD 4QY8B 3KPTA 1T20B 1Q9KA 3MRCB 5BV7C 5EBLA 2R2HB 5EOCJ 4XCCL 4U0QB 2V2TA 1X5FA 4D9LL 4Y5XA 5LAXA 1IC7L 3EOTL 2UVFA 4HS3A 3ARDB 4J6RH 1MHCA 4RMQA 3PHOB 3FO0L 3OF6A 4HUKB 2YMXH 2C3GA 2I9TB 3DYPA 4EUPG 4Y4HA 1FYTB 1WZKA 2V9QA 5DA4A 4ZSOA 4XGZA 5CIPH 2C3VA 4E9LA 2AS5M 3QQNA 4NYLB 4OLVH 4GRLC 5B4MD 2KL6A 1OGAD 3ETBF 3MJ9A 2X4QA 4LSUL 3UJJL 5I6XC 1JN6B 3EZJB 2CDEB 4HWNA 4FXGA 3BVNB 4MB3A 5HYJB 5HDQL 3ZTNL 1UB5B 5C2BL 3REVA 2Z31C 5JA8B 4OZGB 2JJTA 5GGQH 4LVNB 1IGCH 3C6LA 4YJZL 4S1SL 2EZ0D 1AGCB 4NQVB 5IR1B 4WWKB 1F8TH 3BKCH 4L9LA 4X4ME 3TPUA 5C0AD 3IRPX 4YC2C 1IBGH 1WT5C 3BESR 2FATL 1NFDF 4NSKA 4FQXA 5HI4C 4OZFG 1U3HD 3BI9X 1U8PA 2VZVA 3QUXC 2GUOA 4NUGL 2I25N 3P30H 3B8SA 3F6LA 3O2WL 4M3KB 2UZYB 3LAFA 4AY0A 2GSGA 5KZCD 3VWJA 4IIQB 1A4JA 2YSSA 5C09E 2HJKB 1MEXH 3RU8L 2CR6A 3C09C 4BK4A 4U0RC 2VQTA 1BOGA 5HY9A 4YDLB 4DK3A 2LQRA 5CMAB 2XKNB 4ONHA 3PWJA 1ZANH 3L5IA 5T33H 2PYFB 5CZVH 1HXYB 4P5MA 4OM1H 4J2XA 3FB7B 2F19H 5F9OL 5E5MB 1NCWL 1VEPA 3KHOA 5GJSH 2DQCH 2FSEB 1OTTD 4TUJA 1BFVL 3KPSA 2C1PA 1D9KC 4MNQA 2VZ1A 3SE8L 2CJUH 3T65A 5IQ7L 5IWLC 5BCAA 1R0AL 5M7QA 4ZFFA 2FHBA 4KJYB 4M48H 5T1LD 3CPLB 3WDJA 4OZIF 1LNUA 4XNYL 5MEND 5EU7E 5D6DC 3U0PA 1R3IL 3N06B 5I0DA 1X5XA 5GGRA 3UX9B 3HZMB 5ICYA 3O6ML 1LEGB 3CH1A 5L88L 2QV2A 5BO1L 1IC4L 1CFSA 1N0XL 4LKXB 1PW3A 5DF0A 4KKCD 4ENED 4ZG1A 4E5XB 1S7XB 3JUZA 4OLUL 4GXUN 1FH5H 5LGKA 3GKWL 5EOQH 3WN5B 1VKXA 1U95A 3MNWB 3HUJA 3VJ6B 4FA8A 1XGPB 1IRAY 5ITFA 1BZ9A 5LQBH 4MB4A 5F9AC 3CFDB 4N0RA 4IMLB 2DM7A 1NC4D 4U1SB 4Z7NE 3DECA 5IROA 1G9MH 2DIJA 1GGUA 1XF3B 4G5ZH 4CDHA 4LNRB 4P4KC 3CVHH 4Z5RB 2D7NA 4PJEF 1U8QA 3H9HB 3RHWF 3QDAA 2BSRB 2PF6A 4IOIB 4KKAC 4XMPH 1WIPA 2NY6B 1X4XA 3GHEL 3LCYA 5BRZE 5FKPB 5CJQL 2CD0A 3CDYA 1QBLH 4OBSA 4TVPL 5I76B 4B41A 4Y5XC 1MCDA 3EO0A 1XR9A 2W0FB 4P2CG 1UH4A 2UY7A 5EUOF 3D3VE 1RJCA 4IHOA 3U0TA 5HHME 2AJVH 3P3YA 1P4LA 3FQRA 1IKFH 4R7DB 4KROD 3SPVB 1CG9A 3BHBA 35C8H 5E2UH 1CGSL 2HMIC 1C1EH 1OQOA 3HE7A 4P5TB 4X7SL 4XWOD 4F3FA 4MNQE 3EYFA 1CICB 3DX9A 5FHAL 4K7FB 3T09A 4KAQH 3TNNB 1AQDB 1J1XL 3T0ED 4N8PA 1DQML 1G6RH 5D7IA 2OL3A 3VXUE 1CDIA 4NN5C 4CU8A 3ARBA 1XCTB 2XIDA 1T7VA 1IEHA 2R15A 4FXKA 1NFIB 4JO2H 1JWSA 3TN0C 3C6SA 3DBXB 1DVFA 4HIEA 3RY6C 3IDJB 3H42L 1YEHH 1UM6H 3PXJA 4ZFOL 2HMID 3U4EB 1NMAH 3O3AB 1EK3A 5C0FA 1DBAH 4G7YH 1U3HB 4WEUD 1S9XA 3ZE1F 3EYVB 5DRNB 3OKKA 5TQ0L 2FJHB 2ZSVB 3FT2A 4YGAB 4EN3B 1LE9B 1G7JB 1KCUH 3QCTH 5GIRA 3G6JA 3Q6FA 1UXWB 1OP3K 2WBKA 4PRHE 1CGXA 1N6QL 1CLZL 2VDMH 3KJ4B 4JM2A 4V1DE 2FX9L 1YMMA 5EC2A 1PYWB 3DJ9A 1FO0A 2F19L 1CK0L 3QWOB 3T0BA 4DGVH 3GSXB 3QQ9D 3QWRD 2YPLB 4GAGL 1A6WH 2IAMC 4F8QA 2R39A 4G43B 3GMNA 5I30L 1XZ0A 4DVBA 2JIXA 1MVFA 3L3HA 1B0GA 1CFQB 4JVUA 4XVUD 1WBXB 2BVQB 2ARJB 4DZ8A 3QXDB 4F7PB 1RY7B 2J8UA 3GZKA 4N9OB 1JPGB 1YEDB 3VFNB 4Y2DB 2EIEA 4RAUA 3NMEA 2VXSH 1YY8B 5L9DL 4X4YB 3QEGL 4TSBH 3BN9D 3BVNA 4KTDL 1X7QA 3U48A 1J1PH 3GMLA 3C5ZC 3V0WL 3CVIL 2IAMB 2KUTA 4QKXB 3WMSA 3ES6A 4RZCA 1DFBL 2AK4D 2VLKD 3WFZA 3EGSA 4MMXC 5IVXB 2EYSB 2HFEA 3MOAL 4OAWA 5CJ5A 3BWAA 1WICA 1FVCA 3VFGL 3EDFA 5T5FH 5CKGA 5MEQB 2HN7B 4I3RH 2E3VA 1ORSB 1JGEB 2BNUB 4DN4L 4JO3L 1ITBB 3TP4A 3L5WB 3QEQE 1M1SA 5JUEH 5KSAA 5FOBB 4LVHC 4WFFE 1MUJA 2LVCA 2BRRH 2VIRA 1VPOH 1AY1L 1VACA 2WZPD 1HEZB 2KPNA 4QHNB 4ZOCA 3ZKQD 5DA0B 3MFFB 1DVFB 4HIEB 3LEVL 5J11C 1JHKH 1XIWB 4Z7UE 1T03L 1K85A 5KVDH 1AQDA 1UH2A 3RP1A 3GSWA 4HJ0D 4EDXB 3I85A 3MUHL 2AK4B 4XBPB 4UI2A 5CHNA 1RHHA 3IFOA 3QDJA 1FORH 2ITCA 4H8WL 5LXGH 2VSDA 3MNZB 3QUZB 4FNLH 2NY5C 3JWDH 4P49A 1NANH 1R5WA 1UEYA 5E0QA 2KZWA 1FNAA 3OXRA 5KSBA 3OJ2C 1OGTA 1Z9SA 1NBZB 4KPHL 3EO1B 4M4PA 1O7SA 4N8VA 2X1XR 3SKUD 2ARJQ 1RULH 5TDNA 5E8OA 5JW4N 3TBYB 3MV8B 4OUUA 4C56A 1UFUA 4LU5L 1R3HA 3DTXB 4R97C 3MRIA 3CXHJ 1DVFD 3ZKXC 4MS8C 4P5TD 1HQ4B 1A1MA 2IAMA 1JMZA 4LQ1A 1FRGL 5JPNB 5CSZB 2H41A 3QFJA 4O2CB 4JPWH 7CGTA 2R1WB 4OZFH 4PREB 3GJFH 5F1KC 3CJJA 4FFZH 4KGJA 5ESQA 4KJQC 1G7IA 4HSQA 3FRUA 3RY4A 1CFTB 1YPZF 3P9WB 2BRRL 4YX2L 4DAGH 2X89A 4WO4D 2J88L 3VRJA 3VI3F 5DRZB 5DO2C 3CX5J 3IS0X 4KK8C 2YRZA 4UU9B 4OLYH 1B0GB 1ZTXL 2HT2D 5IJVB 3LKRB 3REVB 3HN3A 3S5LA 1ULVA 4HXAL 1JYXA 4YK4C 4MA3B 1X3DA 1XR8A 3QEQB 3RGVB 1T0MA 1I9JL 1F4XL 1ZLUK 3RY6A 4WGWB 1RZIA 1A3RL 1A5FH 1V8HA 2MKLC 4X99A 3K2MC 1R3KB 4HHAA 5C9JA 3MLZL 2FEDD 4KZEH 5JUEL 3IXTB 5D4QA 2ADGB 1AO7D 3OHXB 4HAGA 1ZVYA 5I8CA 5L0QB 1NSNL 1HZHL 1YPZA 2V2XA 4MQXC 4PRNB 5JXEC 3MRQA 4K07A 1I1AB 3MRGA 2P8LA 5CWSB 3B9KB 2R2HA 4Q9BA 4LLAA 5HBBA 5TGBA 4HKBA 1FFPB 4TYUA 3ARXA 3GB7A 1UJ3A 4JRXD 3QIUC 1UJTA 4DKAA 2QSCH 5D7SH 4U1HA 2ZUUA 3Q2CA 4HMDA 5C0CA 5FKAA 2X4PB 5ADOH 4N0FA 3ALPA 4G8EB 1WLHA 3HAEA 1VFOA 1S5IH 3NH7L 1KG0A 4HLZG 1FG9C 5BZWB 3HR6A 1U92A 3HA0A 4XNZB 4PTTB 5KSBE 1RULL 4OI9A 3K74B 4ZYKB 4U7KA 3IDYC 4H1LA 5C92A 3QIUD 3MBED 4GXVH 4FP8L 3ZDXE 3QP3A 2N4IA 3NCYP 2RFXB 4GS7C 4N0YH 1QBBA 1ZA3B 3DRQA 3QIBC 3O4OC 4G6AC 4QRUA 2CLRA 4YBHA 1SY6L 3ILPB 4IMKC 3C60D 4HX1B 1TQBC 3OX8B 4PRDA 1QPXA 2VL5A 4Z7UB 4FQLH 3PGDB 4XNQB 1ZV5A 1IC4H 3MGTB 3WLBB 5DO2D 3MR9B 4K9EL 2BERA 4L4TB 5DJAA 4KQ4L 5DI8B 2VDRL 1LP9B 2OTWA 2GT9A 4MA8H 2H6PB 1DR9A 4U3XA 1RMFL 1ORQA 3QIBD 1JPSL 4G6AD 4I0KA 4DUXA 2E8YA 2WBJB 3MREB 4LLVB 2CLVB 1NFDA 4FFWC 5KANG 4LCWA 2JIXB 4TTDD 2YA1A 5GGVY 2DKSA 4BUGA 1RAMA 5FO9A 1XGPA 5ITFB 5C0BA 1Y6KR 3VMOA 3ZE2E 2Z31B 3WEXB 1BQUA 4ODSH 3ROOA 43C9B 2ZCHH 1JPTL 2EDJA 1LHZA 4FTVD 3OAYH 1KPVB 2VN4A 1K2DA 2DAVA 3T4YB 1H15B 2FHFA 1I1AC 1OP5K 5KVEL 4JJ5B 1N64H 4JKKA 2E9IA 2CIKA 2NPLX 3B6SA 3OB0H 3ULVE 5D7IF 4MXVF 1Q94B 3PL6C 5IVXE 2YR3A 1A6VH 2AXGB 3O3DB 4U6HB 1T21B 3GIVB 2YZ1A 1IVLA 4GW5A 4X7EC 3DIFA 5AAWA 5EBLB 1B6DA 4QWWC 4TUOA 5IUSA 2XKUA 4OD3L 1FVEA 3VI4E 5KG9A 2UY6A 3UEZA 5I8EA 4AK1A 4YDKH 3ZYOA 2VMFA 2NTFA 4WJ5B 3DNKA 5F3HB 3MBXH 2PYEA 2H32A 4PRAB 4NHUB 1U8MB 12E8H 1NC2D 2JB6B 3BEVB 1HEZA 4KVCL 1U8MA 4Y1AE 5MP6L 3V8OA 2FX8L 3TJHD 1DQLL 1PG7W 1C12A 1TZIB 1F6AA 2OCFD 3T0VA 5I1JH 4MVBD 1LK2B 2VAAA 2ICES 3D69B 1WK0A 4GRWF 2IPTH 3FRPG 4NJAH 4K7FA 1NCAL 1Q9OA 1CQYA 1PEZA 1Q1JH 4HKBB 4UT9H 5IP4A 4YHIA 1DBJL 2Y07L 4RNRB 5DEZA 2EDDA 1KNOA 4Y0GA 1FPTH 25C8H 4HLZH 3F7QA 4JFEB 4JN2A 3P40A 4XRCB 3K4AA 1A7RL 1D9KA 4M48L 2V5TA 1DBBL 5LQBL 1Z2KA 1BD2B 5HVWA 1A7BA 2CJUL 4GLRI 1R0AH 3GNML 4PRIA 2OX5A 4PTUB 2ICWB 3CGTA 4KQ4H 2XA8H 1QD0A 2J6EL 1NJ9A 4O58H 2LTQC 3B9KD 5CLTA 3TBVB 1OT2A 1CDHA 2APBA 4NC1C 3QHZL 1L7TL 4OB5L 2FL5B 2DN7A 4R2GC 2VLRB 3QDJD 3GMLB 4NBYB 4FFWD 3BEWB 5SWZA 3O6MH 3RGVA 1HCFX 4UV4H 3H9HA 3O0RH 1OY3B 3JTTB 2GITA 5ACMA 4PRID 3TC9A 2DQIL 2DI7A 1KXTB 5HYJE 5DMKA 2R23A 5H35B 1Y18A 2B4CL 4LPXA 3NZ8B 3CAFA 1A7PH 3KYNB 4LOUC 1A8JH 1WAAF 1BIHA 3ARVA 1CVRA 1BQSA 1FNEA 2NXZD 3RPKA 3WKML 2PXYC 2BVEA 1NCAH 3UPAA 4QT5B 4X6CF 1V3JA 4UIKH 5HYJA 5E6IB 4Q9QH 4LKCB 4OGAD 2QJDA 4E5XA 4X9IA 1DEEA 2CDEA 4FQ1L 1UB6B 4QTHA 4JDTL 1T2QL 4OT1L 4PRPA 4IMKA 2IQAA 4LPWA 5BRZB 3CLEH 4QRUB 2CDGA 4YPGA 2FWOB 1TQBB 4NKOB 3KWWB 5HGAB 1KSRA 4JB9H 4MAYA 5GGUB 1TVBA 4HIHA 4QRTA 5ADPL 4KTEL 3VWJD 3MA9H 3MUGB 1GYAA 1BFOB 1ZKAA 2VITB 3W39A 4JQXC 3IDYB 3PJSA 3O3AA 5DHVH 3KPSB 2IG2H 3VW3H 3DGGB 3IDJA 3QXTA 1TJGH 4GUPB 5EOCH 4CN6A 4QHUB 5T3ZL 1Q9KB 2ENSA 1WWCA 4PJCA 3GSNA 2YD5A 5I1LA 2PYFA 4YGVA 4Z77A 4Z7WB 1G9EA 1AXSB 1A7QL 1ITCA 4KROB 4PJ7E 3CC5A 1T4KA 2XNAA 4FFVD 3RBSA 4Z7WA 4YGVB 3PV6B 4GBXC 4YEFA 2F54A 1N4XH 3UO1H 3H6JA 3MRJB 4X7CC 4M4RA 4QO1A 2NTFB 2K7PA 4AT6A 3D48R 1Y6NR 1YUHB 3FFCA 1A02N 2VJXA 1QSFB 2CKBH 3WJJA 3A6OA 1YMMD 4OZFA 2H9GA 4K94H 1D5MA 4LLMA 3ARUA 2FHCA 2MQ3A 1JGLL 2GK2A 3B9DA 4Q6IB 1UZ8A 3O2DA 5L0QC 2B2XH 1YN7B 1ZT4B 5L7XH 4LHUA 4GRWH 1FL3B 4HPYH 3HC3L 1V3LA 1MF2L 1MNUH 1NGQH 1FNLA 5F7EL 4U2YA 4KRPB 1VDGA 4PRPB 4TVPD 4KRMB 3CDGA 1AGDA 3IDMB 5F93C 2DYPA 1RZGA 3KJ4C 5CP3A 1JVKA 2VYRE 2LAGB 3ZL4H 1T0NB 2ESVB 3B9VA 4UNUA 3ROOB 3FL7A 3BKJH 4AIZB 5JO5A 1UZ6E 1G0YR 2WUCL 5DK0A 5B22A 2DTSA 1FNHA 4JZJC 2YWZA 4FQ2L 2FDBP 1OB1A 3P4NA 1RUQL 5E2WH 4R3SA 5TDPB 3MREA 4M8VA 3TN0B 5LGJA 4YO0B 2AV7B 1F6FB 1T89A 3O9WD 3ORJA 5D7JC 4M1GL 4NQCE 1F3RB 3PHQB 4G8GD 1DN2A 5HVFB 1C8PA 4L29B 4PGDB 4XZUA 1EPFA 3VD3A 2A9ML 5T3XE 3IJHB 4G9DB 4HXBH 1S8DB 4MWFA 1Y18B 4FZEL 1FL5B 2VDLL 1HXMB 2PO6A 3PG2A 2ITDB 4MXWH 4I2XE 5IMKA 1NGXA 3B2VH 3ZKXB 4R97B 2QADD 3M07A 2J8UF 3VXPB 4M43L 3ZDZF 2H32H 5C6TL 4X5WA 4PD4K 4D8PA 1FV1A 1NBYA 4C54A 1NUNB 4DN4H 4O9HL 1K3ZA 4PG9B 4JANB 4TRPH 4XPGH 2HRLA 5TH2B 3KYKH 4OZGE 5HD8C 5L8KB 3OKKB 4RNRA 3C6LD 1NCCH 5EZLA 4GRWB 3QQ4A 1P53A 1A2YA 5GRUH 3S88H 2LU4A 1NGPH 5BJTB 1NCTA 2EH8L 1CIUA 1TTGA 4KDWA 5IB5A 4XBEH 1J1PL 3FO2A 2VDKL 1D3CA 4JR9H 4Q2ZA 1QRKA 5JLZB 1EMTH 4G80A 1F4XH 4K94L 4S2SB 4QYOA 5GRWA 1WISA 5HGBA 5FECB 4QHMB 1JV5A 3WHXA 3HZKB 1S7RA 3BJLA 4TUOB 3Q1SL 1XGYL 2H2SC 2YXFA 4XP1H 4Z7OF 2NQCA 4O4YL 4OZIE 2XN9D 3DO7B 2JE8A 4P0DA 1B4RA 2B0SL 2HJKA 1I1YB 2AJSL 4DAGL 5HHOA 4LK4A 1KB5A 1IGYA 3INUH 2ZOKA 5ID1B 3CSPA 3T0EA 5D1XC 1CTNA 3LQAC 1OLLA 1NFKA 4MNQD 1WCQA 2CDFA 3WO4C 1UKQA 4MJID 4N0UA 5F7NC 1X5JA 2XKSA 3F7YA 5T5NG 5IKCB 1NCNA 3QA3A 3T3ME 2VLLA 3L3IB 4XPTH 4D8PB 3IKCB 3BW9B 3ULVC 1PEWA 5GRJL 4UTBH 1I7UA 4L3EB 4QHKJ 3QDGD 4GKSA 5GZOC 5LGJB 4X8JB 1MIMH 2V7NA 3VXNA 5E9DA 4XXCA 4JJHA 2GCYA 1KIQA 2EE9A 4G9DA 4H1LH 43C9A 4MD4A 2CKNA 1D5BB 1FFOB 1CDBA 2VC2L 1NMBH 1XEDA 4PJFB 2H8PB 4UAOB 3MR9A 2Z91B 4JFED 3AB0B 3ZHLA 3WJJC 5E8DH 2WBJA 4JRXA 4P4RB 2YEZA 2Y1VA 1J0KA 2X4SA 2G75B 3QG6B 2BMKA 1ZS8B 1RK0A 3TIEA 2OZ4L 3F7RA 3PXHA 3T3PE 4WFEE 1A14H 2IH1A 2IBZX 3ILQD 3EDEA 3OGOE 3C9NB 1E4KA 3CFEB 3HG1B 4M6MH 4R0LA 5BXFB 2CUIA 2XRAL 1JWMA 3HCVB 4XPFL 4WUKH 2GJZA 5T33L 1I3GL 1JZ4A 2D9QB 4RMUA 3HMWH 3I02B 5DHXB 1D5XA 3E3QC 3BDBA 5IBTL 1LO5B 5E8EA 1RV6X 2B5IB 3V5HB 4U31A 1HXYA 4P5MB 1AJ7L 3RDTA 2CPCA 4HT1H 1Y0LA 4KHXL 4YHKL 3RU8H 4RGNE 4OF5A 2JF1A 2G5BA 2R1XA 1C5BH 2UZIL 1OQXA 1CZ8H 1JWUB 2YUZA 3DGGA 1Q1JL 3WV0A 5KVFH 3GM0A 4JFEE 1ERNA 1SJXA 4H0HB 2AK4E 3UBXG 3VFOA 4F9LA 5HGHA 4K3GA 4CMHB 4NWTL 4W70A 5MENB 3L3DB 4N1CA 5GS2D 2JB5L 4GRMA 2P7TA 2XN9B 2Y7QA 3ULVD 1RU9L 1P2CA 3GKWH 1WUNT 2XWBA 4WNQA 3ZSSA 1CL7H 3EUUA 5ISZB 3NIFE 3PQYE 5BMFH 1T0MB 3FFCD 1IFHL 2DF3A 5J12C 5IF0A 3MRKA 3S97C 3WFCL 1L7IH 3S96A 4RRPG 5F6HJ 3W9EB 2WWMD 1GRWA 2PO6B 5DJ2B 5I8OL 1SJEA 4HT1L 1RMFH 4K9EC 1F2XK 5HHXH 1WWWX 1WIOA 4QTHB 4ZXBA 1Y6MR 4NUJA 3TO4B 2AP2A 2VQ1B 4YHOH 3QEUA 2D4DA 3F6IA 4GG6B 2K3TA 1D6VL 3RY5A 3NIGF 4U49A 1CXHA 2ZCHL 1UACL 3OKOB 4GG6A 2JCCE 2R1WA 1ZMYA 2A6KB 4QOKA 1MCEA 4NM4H 1WBYB 2P5WE 4X5XA 1QQDB 4BZ2H 4NKIL 2GCYB 1Z5LA 5INCA 5H94A 3HMXH 1W8NA 2GY7B 2P46B 3PQYA 3PL6B 1TJIH 2EKSA 1WC7A 2VTFA 3QI9D 4PJ5B 4ODUB 4OFYA 3BP7A 1JE6A 4OCXL 3EO1A 2D31B 4G8IA 1OL0A 4XHJC 3QUZD 3CIQA 3ZKMC 4DCQB 1OP5H 2HFFB 1CFNA 2F74B 5I18H 3QSKB 1ZHLB 3J7HA 4EN3A 1LE9A 4XI5D 1U8OB 3DSFH 4Z6AT 4KUCF 2NY1D 2AK4A 4K7PY 4P2RB 3P30L 1IGJB 2NNAA 4BH7B 2BC4B 1DLFH 4Y4KB 1KB5B 5MP6H 4LASL 3MA7B 1HKLL 4NDMB 1NFIA 1R5WB 3BN9C 4OZFB 4YHNA 1GZQB 3QUZA 2DTML 3WXVH 4XNUL 1JPST 3QYCA 3I75B 4KXZI 4B7IA 5JORB 3L3KB 4XI5C 2YD6A 3WL9A 4OD1H 2R0WH 4CNIA 1A21A 3WS3A 3QPXH 1S5IL 3MYJB 3NH7H 3WIFB 3ZYJA 3ULUF 3GIZL 2CK0H 2WWKO 4P2QB 1EDQA 3NN8B 3VGEA 5IHUL 2VRAA 5J12B 4HIIB 3QIWD 5IBLD 1EAPB 5JXAL 1KCSH 4L1HA 2ICEB 4GMSL 4XPBL 1RUPL 2ZUQB 2WUBH 4WU7A 3SKOB 2MSPA 4LMQE 1HHHB 15C8H 2O61B 3BPLB 4J4PC 5DHVB 4QRPE 2EC9T 2FJGA 2E7HA 2G9HA 4YC2B 5F9DC 1K4CA 5T1KB 3GSUA 3QBTB 1IGCL 5HYFA 1DQQB 4ZUTA 3VCLA 3FQNB 3HR5B 1U3JA 3EGSB 5B3NA 5C71A 1R3IH 1QSEE 1C08A 3BRDA 5BRZA 3FTGB 1RUPH 1WBXA 2PNDA 5LCVH 2PW2A 1OD9A 4M5YH 3MRPA 4JO1H 3IS1X 1BIIA 1P84J 3IJHA 1RK1B 1SM3L 4CKVX 4PJXF 1CGWA 1SBSH 4LLQB 4G43A 4UOW1 1MY7A 4OI8A 1PY9A 4U1MB 5DJAB 4PD4J 3KPPB 4LSRL 4F7EA 3S98A 4NT6B 4XHJD 2MNUA 3F58L 3D85A 1DVFC 4FZ8L 1WZ1L 2NY4D 1MCOH 1TTUA 4NUJB 1KCVH 4GAFB 2H6PA 3MLXH 1OAZH 4WVRA 1PLGH 5C70A 1JF1A 4QHLB 1DE4B 4Y16A 3UTTA 1KBGH 3B8YA 3BYTA 1HKLH 5D2NA 5JDJA 4J8RB 1KTDB 2GJ6E 1MCOL 1ONQB 4KMTL 4U6VL 2VL5B 4Z7UA 5IMOB 4GW4B 2XZAL 4QCIA 4Z76A 3SOBH 1RPQA 2F53B 4ORGB 1S5HA 4MJ4A 1L9MA 3DV6A 2Y7QB 1QVOB 4UB0L 3HC3H 1MELA 1DANT 2X42A 4MA1B 4JFDB 5IW6A 5CEZE 2YD3A 2FGWL 1MRDL 1A22B 1JFQL 3O4LE 1BF8A 3BKJL 5CS7A 3RDTB 5ERWA 1XGYH 4XP1L 1MIEH 2APFA 4FZ8H 5SWQB 5C0AB 1J0YA 4GBXB 3IF1A 4NQDD 1CGTA 5GRYA 3ARBB 3N1MC 3RUGA 4HS8H 4EQ3A 4GQ9H 5IB5B 3IDNA 1R5IA 1SEBA 3FONB 3W0WB 3GEWB 1AE6L 3KDMB 3B83A 3H9YA 3HTLX 5I1AB 3NCEB 4JFDE 2XWJB 4PJCB 3QDME 1EFXD 5E2TL 2EIDA 4GSDL 1J87A 3WD5L 2B2XL 4KJWC 4IRJC 4WHTA 1J05B 5EIIA 4JG0H 3TVMA 5LGHH 1BBJA 1RZFH 2AQ3A 4Q9CA 4P3DA 4U1GB 2VLMD 3VXUD 2ADIB 4J3WA 4PBVC 3SDCB 4F33A 1BFSA 2ADGA 2QBWA 3FZUD 3HAEH 4K23L 4X9FA 4XCEA 5FM5M 2ZJSL 1CGVA 4J3TA 4XPBH 5J11B 1RJYA 1A1OA 1FL5A 4M61B 3PWNB 2Z9TA 1CXIA 3O6KL 4QXTA 2O93L 3B3IB 4RGOL 1TZGL 3NA9L 4HXBL 5IQ9A 3QEQD 3A67H 1Q9WB 2N7AA 4M7ZC 1EFXB 2N1KA 4NNPH 3MRPB 2ID5A 5B8CA 3D9AL 3D2UB 3WE6A 3I3BA 4DKFH 3C60C 1JYWA 2PW2B 3TA3D 3WKMH 4YDVB 4UUJA 1I7UB 3OR6A 1N7MH 1HINL 3T4AA 6FABH 1C5BL 2UZIH 2R8SH 1CXFA 4PRHA 5EFIA 4P23D 4RGNC 3RKPA 5EBMB 4KPHH 1J0HA 4O5LL 4PJHA 1OTSD 2CKBB 5I30H 1VCAA 3A6BH 5KN5A 4C59B 1H8SA 3LZFL 3MV11 5IBUG 4UV4L 2JCCB 1FZKA 5D7LA 4Z95H 4Y19A 2V5RA 1JTPA 3GFUA 4DFHA 2X40A 4HUWA 4Z0XB 5E5MA 4JO2L 3WNMA 1JHLH 3HZMA 3NN8A 5E2VH 4NO2A 3DROB 1PG7L 2ED9A 4MXQD 5T1MA 3MRBA 3LSOA 4Q6IA 1FLRH 1FJ1B 5C1MB 4G6FD 3WO3B 3SCMA 4Y16D 3UTTD 3FMGH 4CVZA 4OGYH 4UILL 3N9GH 5DXWA 3RZCC 5E8NA 4AT6B 4ETQA 5C0AA 1A7OL 5E2UL 4PJDF 1R24B 4U05A 2NY6D 2YPLE 4FTVE 1IGIL 2MOVA 4ODTL 3BP6B 2ZG1A 2FO4B 4XX1E 5F6HI 1V3MA 3E6FA 4C83A 3MLPA 3X11B 3ULVH 3O9WA 2YD1A 3JTSA 5EZJB 2HG5A 5JHDE 1IM9D 3TCXA 5GRXG 2X1WL 3AXLB 4TNVK 4NGHH 3NFPB 1QLFA 4LVEA 1MCNA 3EOAA 5EOCL 3UP1A 1JIBA 4RBPK 4D0CB 4X4YA 1HH9B 2R2EA 4Y5YA 2OTUA 3PL6A 4L3CB 4U6HA 4Y4HC 1UM4H 1MWAH 4H26B 3B6SB 1G84A 5DJDA 1SY6A 1YMHB 1MCHA 1ZEAL 3M8OH 4MSWB 2KH2B 4RRPA 1Q9WA 1GZPA 3S7GA 3L3OB 4P23C 1PSKH 4OLZL 5IG7B 3A6CH 4PR5A 4NP4L 1OAUH 1F8TL 4O4YH 2EEAA 1AGEA 3LN4B 4K23H 4CW1B 2YZ8A 3AC0A 1H5BA 4R96A 3M1BB 1T89C 5D7JA 4NFCA 1RIVL 1FDLL 2DDQL 4JFFE 1AQKH 3HMXA 1QFOA 3QO0A 3BPLC 5J8OA 1QR1A 1AKJA 1CLYL 4I1NB 4YHKH 5IT2L 4XH2B 3STLA 1A14L 4F7MB 4LEXH 3MRLB 4JKPH 4DQOL 3CZFB 4X6DA 1I1RA 1KJ3H 4YBQC 4L5FL 2AJUL 2ORBL 1GH7A 4IIQC 1FVDA 5ESVB 5C0GA 5HI5C 4A2LA 3VRLF 4WUKL 5E5RB 2V7HB 5DT1H 4GS7B 3U4EA 4PGEA 3W0WA 3CXHK 2VC2H 1OGTB 2HYMA 2MKWA 1CD9B 2JJSC 2VDOH 1B88A 5EIQA 2AJUH 1T66C 3DXAE 2ATKA 1A0QL 3QNYA 4KRPD 4PRPD 4EQ2A 4GKZB 4GXVL 4MA8L 4YHIB 1UVQB 1XGUA 3CSYB 1G9NH 5EUOB 2DJ4A 1AR1D 4APQD 2VDLH 4FZEH 3HNTL 2CRZA 3GO1H 4XPTL 5I1KH 4ZUWA 1T1ZA 3F62A 3KAAA 2IAMD 1T7WA 2YD4A 4BH7A 3SDXA 3O2WH 2MPAH 4F37K 5AYQA 4MX7B 1T6WA 3TV3H 4X6CE 4QXGL 3MA7A 2CSPA 2JK5A 4ZXBD 4FS0A 1EEZB 3K8KA 3SGKA 4KVCH 4Q9RH 3WUWA 1YY9D 3BQUB 4NOBA 1MPAL 5D7KE 2CGRH 1PBYA 5IFHH 2JB5H 1EO8H 3CX2A 4L3ED 2BHZA 3SPVA 3SDAC 2O5ZL 4YR6B 1MRFL 3ZKSD 5I1EL 3I50L 1J11A 5ABDE 1HZHH 4NKOA 3G5VA 5DD0L 1F97A 3GBMH 1QQDA 3OG6B 3OR6B 5FYKE 3IDGA 1JGUL 5C0BE 5KOVC 2BFVH 3QDMB 4K3EH 5CSBA 5FYJU 1AGEB 2B1AL 4F7EB 5C2BH 3G6DL 1S9WB 2F58L 5E5UB 4HUMB 2ENYA 4M61A 3LB6C 1QOKA 3QIWC 5D8JL 1F42A 3OBAA 4M00A 4EI6A 4YO0A 5HVGB 1ZVSA 1KC5L 3BSZL 4LCCB 3HB3C 3MX0A 2CIIB 3CFCH 3FTGA 2NLJA 4QEGA 2YBRB 3VRJB 3IFPB 5KS9F 3IFLH 4FN0A 5FK9A 3SKJH 4GRWE 3T0AA 3BP5B 4ZQKB 3FQUA 2BY1A 1QKZH 5JO5B 4M9OA 4F7TB 1HNFA 4KY1H 5DJXA 1K5NB 2RQ8A 4XVTL 5EZOH 4BJLA 3SE8H 4WUUD 1AIFB 4A6YL 4YIQB 1HI6A 3BIKB 1AE6H 3LKSB 3MLYL 4Z7WE 4HJGA 4PJ7A 5GJSL 4XP4L 1CU4L 2J8HA 4IS6B 4YDJB 5DYOB 4J4PA 4PJBB 3VXRA 4BUHA 5D7JD 2GJ6B 4M6OH 4ZUUB 3F7VB 4F37F 2EDLA 2MHAA 4WY7L 3MMEA 2GJJA 1A6AA 4FQIH 5SWSD 3IF1B 4JY6A 4LVNC 4P5KB 4R4FL 5IK3A 1F11A 4JY4B 2XPGB 1Q9LB 3V6FB 5IVXF 4MNQB 4ZPTB 4TUJB 1YUHA 2A77L 1BHGA 3MGAA 1CN4A 3PGCA 1KG0B 4HUXB 3HI5H 5T3XH 3IETB 1GGBL 3W82A 1J5OL 3D69A 2GEEA 1RUAH 2OMBA 5F88B 2A6IA 3CK0L 2W92A 3SGDI 3ZYZA 1KACB 5FGRA 4LSRH 3ZE2F 3MFFA 1P7QB 1J5OH 3U7WH 1BVLB 1E4WL 1JNHB 5F1NA 3C6LC 4G6KH 3BDYH 1SM3H 3M45A 5C0GB 1A47A 3ARDC 1N6QH 5H2BB 5GRVL 3GSRA 2DI9A 5JDSA 5MERA 3EYOB 3MRFA 3MV9B 5K33A 4JM2C 4P2QD 1IMHC 3MYZA 3RWFB 2AI0L 5GJTL 4DTGH 1G7LB 1B2WH 3FJTA 4Y1AD 2KQMA 2MFNA 4GT7A 4OLEA 1AGCA 4NQVA 5CGMA 1K8DA 5IR1A 4DGYH 3M1BA 1BVKA 4G6FB 3LV3A 3KHQA 4NM8H 1U8PB 3FN0L 4YDVA 1I9RL 3X3FH 3UTQA 1TETH 3AU1B 1U91A 3P0YH 2OL3H 1V7ML 5DZNA 1IEBB 3SN6N 2X4NB 4I2XB 1I7RA 1GZPB 5CFHA 2DBLL 5HHOD 4KY1L 2X4NA 4LSVL 4RAUB 2QSTA 1C1EL 1UKSA 1XGTB 1VENA 4JDZB 1ZSDB 3RL2A 2IG2L 3VW3L 2D03H 5DUPH 4HWUA 5DJZA 4XP9L 3MRHA 5JW5A 3L3HB 4HC1H 4LDEB 3WXVL 4EI5A 3BW9A 4C56E 4UTAH 4YZFE 1S7QA 2FLBT 3CVIH 5BS0E 3BPOC 4X80L 3TCLB 1GGCH 1XCQB 4P99A 3OSKA 4MD5B 2YKLL 4UBDD 4G6MH 8CGTA 3MLVH 1I1YA 5DVNA 3SOBL 4JFZH 5IMMA 2EECA 5HI3C 4I0PB 4WI4A 1P69B 1I85C 4ZYKA 4AEFA 1A1NA 4P3CH 3UTSE 3UJIH 5IESL 1OAQL 1IGTA 2B4CH 4QNPE 4F57L 1FYTD 5T3ZD 4J3VA 2NZ9D 5IROC 2UUDH 1SYVB 2PO6D 4S2SA 3MOQA 4U1LB 3X11A 1FZMA 1U8LA 4FQJL 4QHMA 4I4WA 4JY4A 5DC0A 1AXSA 5LG1A 4YQXL 4YBLB 4ZTPL 2D0FA 3FOLA 5SWZD 1YEIL 2X4PA 1RJLA 2VUOA 4KKLC 3DXAB 1LDSA 3V9FA 1MF2H 2GJZB 1I7TB 2OM5A 3BGMA 4NQSA 3OPZL 4PJ7B 3ARYA 4G6JH 2F8OA 2BNRE 3SDAA 3MLUL 3SKNA 3G5XB 1LQSR 3O3EB 1C7TA 5CWSA 5TQ2L 4RIRA 3ECBB 4OQ1A 4Z7VA 3LY6A 3U2SB 5JIHA 5JW4M 1NBYB 4LPYA 3SKMB 1XMWA 3TT3L 5D5MA 1N0LA 2HP4A 4YFLF 2BSTA 3TYGH 1BWWA 5TE4H 4KWUA 3H7LA 5IJVA 1AO7B 3SDDB 2H8PA 4PJAA 4WI2A 2ZKHL 2CRYA 1XIWC 3ZE0E 2XTJC 4RWHA 2H26A 4LHJB 4RDQG 5DJ6B 5L9DH 2CK0L 4CN1A 4LNRA 4DN3L 1N5AB 4PJHF 3Q3GA 4OCNC 4LLVA 5I0ZA 3JZ7A 2EXYD 5EDXA 1ZA6B 4LVHB 3GMRA 2VZOA 2ED7A 4JFZL 1JP5A 2PKDA 1P1ZB 4Q97A 3EFFA 5E2JA 1P5UA 5EPMA 3HUJB 5DSCA 3VJ6A 5EO0B 4PJAE 4KRPC 4LVOC 5FDYA 4PS4H 3IAPA 1BGXL 3MJ7A 4WU5A 5F7DA 4MD0B 3MGTA 4PIRF 4K8RD 3TBSA 4NC2B 3TWCH 1U41A 1KT2B 3QRGL 4PRIB 1MRCL 1RURL 2F54E 4K94C 4UNVA 4PJAF 5EO9B 3TT3H 2KDGA 2AJYH 3UTOA 4JFEA 4JN2B 3MXWH 2DD8L 1WZMA 5ALBH 3RA7L 4XBPA 3QUYC 3MV7E 1IT9L 2VXUH 1KJ2B 5ANME 3MNZA 1EEZA 1A3RH 3PP3H 2EDKA 3I75A 1SEBB 1UYWL 1OGAA 1TVHA 5FA4A 4ZFZA 3C8KB 1VESA 2DM3A 3V5HA 1HH6A 3EYSH 4NZUH 4H1LG 1CE6B 1RZJH 2F53A 4Z77B 4OLYL 2HJFB 4I4WB 4XTRD 1X4ZA 1U8JB 2AAVA 4RA0C 1HQRA 1QFHA 3WXWH 5D72L 4BFIA 2XPGA 2X1QA 3VFVA 1DLHB 5DHYA 4JFDA 5IW6B 3TBWA 1Z0NA 4YFLI 4JFYA 5DJ0A 5DRWA 3FMGL 2H3NB 2HVJB 4NRYB 1Q0YL 3MV8E 3W9DA 5E8PB 1M7DA 3D18A 4J3SA 5C0DA 2UVEA 2LE9A 4M62L 1AHWA 4KUCD 5A2FA 2X9WA 1YN6A 4GG8B 3NIDE 2FJFA 2EKSB 5IMOA 2X4TA 3PIQA 5ENWA 3VFMB 2E7BA 4LKCA 3P9MB 5F8RC 1QHOA 3I6GB 5B38B 4M1CD 3MODH 2FD6L 3SQBA 5F7UA 1BJ1H 3MGOB 1L0XA 3O4LD 3LQMA 2BVYA 1XR8B 2A6KA 4QOKB 4CVXA 1HN1A 4HEME 4J12A 5KW9H 2BVOA 3M8OL 1YEGL 5IV2A 2XXMB 3AVEA 2FATH 2BVQA 4MHHI 2E9WA 1YA5A 3UTZA 3V5DB 3GMRB 4I3SL 5JHDA 1JPGA 3VFNA 4PUBL 3M17A 4ZO7A 4JREB 2C4XA 3C08L 3C6LB 4OGXH 2MJWA 3L7EB 3BD5A 4P2RE 1G7QA 4MCZB 1UWGH 3VXSE 3MPCA 1S9WA 4LSSH 2J4WL 4IOSD 4JPIB 3DVNA 3NTCL 4LEOB 3ARBD 5CJOL 5K93A 3W5NA 3FQTA 3DSNA 1MFNA 2YN3A 1KELH 1F3DJ 5D7SL 5FYKH 1DDHB 3RDTD 4U3HA 3EFDL 3BT2L 4N90D 2EH8H 5KTEH 3VWKB 2Q8AH 2PYED 1RJZA 4LL9A 4P2YA 1YDPA 1TZHB 1ZLUH 4PJIB 1RZJC 4Q74A 3HMWL 5IMLB 2W0KA 2DMCA 3CMOH 4PLKC 3HAEG 1SVCP 1RIHL 4OQTH 3LHPH 2P42B 2RB8A 3J8F7 4KUZH 4PJEB 1I8KA 3OR7A 3OXRB 4DTGL 2DWDB 4NC0B 4C4KT 1U36A 4TSCL 3TN0D 3MACH 3BGMB 4DVRL 3C5ZD 2A6DA 5D7LE 2WWKT 4NQEE 4AEIH 2YUXA 4HMEA 1NLDH 3ZTNH 3SGEI 2COQA 2B1AH 2EDTA 3MV7B 2IPKA 3GJFK 4BQBA 5C0BD 3SGEH 4QXUH 2XNAB 1KCLA 3WIFA 1FCGA 1SYSA 4D9RD 1OARH 5BVJA 4LSQH 1DN0A 5JQHC 4NO2B 4ODVH 5C09A 1GPOL 4DZBA 3DHJA 3MJ9H 3H3PH 2F53E 2X4OA 1WTLA 4WUUB 5CIPA 3O6FD 3O8XA 3QR2A 4IRZL 5E56A 2XZCL 1MHEA 2FX7H 3CUPA 1INQA 5IEHB 1NGYB 2PCPB 5C09D 3UTSD 3VXSB 3ZSTA 1CFNB 1GAFH 4FG6D 3MLVL 1H3UA 1NC2A 3LEVH 3EFFB 1PQZB 1EBPA 3WNKA 3RJQB 2Z8WC 2FYYA 2V5MA 4AM0B 3DETD 3LS5L 3B3IA 1PG7X 4L4TD 1EXUB 1QPPA 4L8BB 3CFDA 2CRMA 3Q0HA 4Z5RA 2CMRH 5LBSL 3MOBL 4L8BA 3C5SA 4I13B 5MEPA 5FGCE 2FIKB 4Z18A 3BZEA 1GGIL 3ARZA 3QJHA 4HKZA 3JTTA 3OKOA 2DQUH 1SEQH 3BIBX 3KYAA 3QEHA 4XVSH 4POZC 4LIQL 1IEBA 5KANI 1XF5A 3OKMA