4A7SA

Structure of human i113t sod1 mutant complexed with 5-fluorouridine in the p21 space group
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 41
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7sA00
2WKOA 1BA9A 4BCYA 1N18A 1YAIA 1B4TA 2NNXA 5CU9A 1TO4A 2VR6A 1UXMA 1S4IA 3ECUA 1B4LA 1SRDA 2E46A 3F7KA 2APSA 2ZKYA 3ECWA 5KBLA 4BD4A 3L9YA 2AQRA 1E9PB 1F18A 1SXNA 2C9UA 3GQFA 4MCNA 1CBJA 4A7GF 2XJKA 1OEZW 4N3TA 2Z7YA 4A7QA 2AF2A 3H2QA 3SODB 2WWNA 3HW7A 1IBBA 3KBEA 4OH2A 1IBFA 1P1VA 1RK7A 1SPDA 1YAZA 2AEOA 2XJLA 2GBUA 2Q2LA 1HL4A 3T5WA 3MNDA 1SXCA 2ZOWA 1IBDA 3HFFA 2ZKWA 4MCMA 2AQPA 2ZKXA 2WYTA 1PTZA 1Z9PA 2WZ5A 1SOSA 1E9QB 4L05A 3KM1A 3S0PA 4A7TA 3GZQA 2JCWA 1YSOA 3CQQA 3KH3A 1E9OB 2AQNA 2C9SA 1OZTG 1HL5A 3QQDA 1F1AA 1QUPA 2K4WA 1OALA 4OJAA 1ESOA 2WZ0A 1IBHA 2VR7A 2Z7WA 1MFMA 2GBVA 3GZOA 3KBFA 1SXZA 4A7SA 4U4IA 1U3NA 1OAJA 1XTLA 3GTVA 3MKGA 1F1DA 1JK9A 5KBKA 3GTTA 3HOGA 2Z7ZA 2SODB 2VR8A 3LTVA 1EQWA 2AQSA 1DO5A 3ECVA 3KH4A 4A7GA 1SXAA 1SXSA 1E9PA 3KM2A 1DSWA 1PZSA 3RE0A 3F7LA 4FF9A 4A7UA 4N3UA 1PU0A 1Q0EA 3K91A 1SDAB 1TO5A 1COBA 1XSOA 3H2PA 5KBMA 2R27A 4A7VA 1CB4A 2GBTA 2LU5A 1IB5A 2JLPA 1OZUA 1AZVA 2Z7UA 1L3NA 1XTMA 1EJ8A 2WZ6A 1N19A 2V0AA 2E47A 1JK9B 4B3EA 3CE1A 1KMGA 2C9VA 3PU7A 2WYZA 1UXLA 1Z9NA 3L9EA 1JCVA 1F1GA 1E9QA 1BZOA 2WWOA 1FUNA 2AQQA 2AQTA 1SDYA 1SXBA 1E9OA 4BCZA 2WKOF 3CQPA 3GZPA 3QQDB
chains in the Genus database with same CATH superfamily
1RIVH 2KLSA 2F53A 1MRCH 1N18A 3IE4A 5BZXA 5IZ7A 4FD0A 4NP9A 3TC9A 2IQ9L 4DQOH 2O4EA 4BQ8A 1HU8A 3MRIA 2NY2B 5F7AA 4XCEB 3GMMA 2BSBA 2VSDA 4ZOAA 4CVXA 4DFHA 5DEFB 4JDVA 4LLDA 3LZQA 1HI6B 2BSDA 2XNAA 2FQFA 3T65A 5EF2A 4TM9A 4XNAA 3V0DA 3GLZA 3GQFA 3U30C 1L5GB 6TAAA 3FFCD 1NCJA 4XPBL 3BH8B 1E67A 3P2TA 4XO5A 4R97B 1OANA 1MCKA 4Y5YC 3L1OL 4MCYB 1ZA3B 1CZ8H 3DIFA 2Q3XA 4PV9A 2JV6A 1TU2A 3CFKB 3VXUE 3MNDA 4N2OA 4GS7B 5BQ7B 2HJKA 1YJDH 2EDFA 2BNRD 3QIBA 3UAFA 2F58H 1IGIL 4B9PA 2WYTA 3L3OB 1LK2A 1PLBA 1OOWA 5J9PB 4HIEB 5JNYB 1RZ7H 1JGLH 2A1WH 2Z31B 3FRUB 5TPWH 4PJHF 5EUOB 3HHRB 3PWVA 3IRPX 3GYRA 3IDXL 2P5ED 4Z7VA 3MACH 3VD0A 2QSVA 2BOBB 3K0WA 1T7ZA 4AEFA 3ML8A 3NP3A 1XH0A 4KNUA 3OKDA 2HUHA 1A4CA 2E27L 4M48H 1BBDH 4F5CA 1T7VA 2K78A 2O93L 1WA1X 4ODBD 4JPWL 5E5MA 2FK9A 1I3GL 2ZUUA 1YNLH 2EACA 2EXSA 3DPBB 4RFEA 1R3LA 2P48B 1DUYA 5CSBA 4LHJB 1ZLWH 3CVHL 3U7AA 1I7UB 1A7QH 2H1PH 2WVSA 2XXMB 1MCIA 1HOEA 3UAJC 4GB9A 4NO5A 2VYRE 5BRZE 2F8XC 2EDRA 2MHAA 3TV3H 1OSEA 3MJWA 4MBOA 5LBSL 3DETD 5D7LE 5GHWL 3IPFA 1A47A 1JHKH 3HE6C 3AVEA 1BZ7B 3LDBB 4DGYL 4BXSV 2VR3A 2HUEA 2EH8H 1JN6B 1QBAA 4QHMA 5D8JL 5I6XB 4OVVA 5B1JC 3DSNA 5D7LD 2QADD 2H2SC 2AJZA 2F18A 2IXQB 3VFMB 3L4WA 2RIKA 5FA3A 2R2HB 5IVZA 2L7EA 2FWUA 3IGAB 4S2SB 5IB5A 1BZ9A 4JO4H 1CDCA 1FGNH 3VD2A 4G7YH 2RFXA 1OAQL 4KKRA 2X42A 2XC8A 4RQQB 3MQIA 5AKSA 4AGNA 2NNAA 4P9HL 2ICEC 3BN9D 5CMAB 4UTAH 2YEZB 3MRKB 4L8CA 5IKCB 2K7PA 5D4HA 4KI5D 3CZGA 1VJSA 2APFA 5DZ9A 4NQXA 1ZGLP 2AJXL 4HPYL 1MW1A 3MYZA 4ONHA 2IG2H 4HGWA 1FFNA 5D8JH 2ZX5A 3JYCA 4B97A 2APWA 2GT9B 2VUYA 3P30H 3GTNA 3VFWA 1GMIA 5F7KC 4YSEA 5GS1B 5DMIH 3C5SB 5HP5A 2J1WA 3OSVA 1OO2A 1YUHA 3GJFH 3A67L 1BLIA 3CHXA 2X4RB 4FOMA 3C5XA 1BAFH 3MV7D 3SBPA 1S78C 5F9DC 4P2CG 5HI4D 1KN4L 2VLLB 3F6LA 5DD3H 4PJDB 4HXBL 1A4KB 5SX5H 1X5KA 4Z7VF 4NBXB 4NUGH 2X28A 4TNWK 2GSMB 1T22B 4OBSA 4YXLH 4B6ZA 4BZ1H 4X6DE 3SYPA 1N64H 2R0WL 1RZKH 2AJXH 4HPYH 4O02B 5E8NA 2W9EL 1SJHB 5J12C 1WBXA 5E1QA 1E4XL 1Q9LB 3D85D 1XCQB 4M93C 1EV2E 4OAWB 2QQNL 2NSQA 3ZRSA 1B6UA 4PJCF 4RAVA 3R8QA 4HISA 1QKZH 4N68A 3VE0A 5CLTA 2O6PA 1Z5LA 4HMDA 4N2MA 4YNYA 1AS8A 2P8LB 4XWOC 5HDBB 1AR1D 4QNPE 5FYLD 5HDOA 2XZCH 1IM9A 3LPWA 5A16B 4N6QA 2OX5A 4YDKH 2X6MA 4KV5F 5L2JA 2KUTA 2VDNB 2A7BA 5F7YC 3KJ6H 5JHDB 3SB3A 3O0LA 4FQQB 1INQB 2WUCL 2XX1A 4K7PX 1M05B 2ZUQB 3NFNB 1BQHG 2J25A 5JHBA 2KMWA 4M7ZC 2QQQA 3DROA 2BMKB 3BIBX 3BVXA 1BBJB 2X3AA 4FI7A 4ZD3H 4UOW1 3SPGA 4LDEB 1CE1H 2C3XA 2WAHA 3LEXA 3SCMC 3UOAB 5AYUL 3M1OA 2E7DA 4GEJA 3QJRB 4BJLA 1WD9A 1MF2L 4F7CA 4RZKA 2PYEA 3PIQB 2AVFA 5D6CB 5GS2D 2WLHA 3V6FA 2DKUA 3LKQB 4M48L 4L8SA 4ALAC 3QZPA 3HE7B 3P1VA 3TA3D 4ONGH 1S7QA 1F11B 1HNYA 3EJZC 1RLBA 2GJ6E 2WXLA 1GVIA 3PWLA 1HHKB 4O5LL 4UIKH 5DRNA 3RHWF 5SWZB 2BY1A 3BAEH 5EZJA 3TF4A 4OCYL 2A9NH 3EO9L 4Y2DB 1CGSH 2XV3A 4MXVE 5D71L 2HFEB 1HHIA 4PIRF 3ATBA 5JW4R 2XIDA 2EYSA 1EAOA 4GUPA 1MFDL 2ICEA 1IU1A 4NP4L 1HL4A 2FX7L 1RP9A 3HG1E 1KIRA 3BKJL 3HUJB 5C0CB 2NX5E 1DQIA 4N2DA 4XNDA 1WAAA 4NC1C 3DXAA 2KHAA 4PJ7F 5AAPA 4YH6A 3HZMA 3MZGB 5EULV 1XF2B 3GSUA 1U8QA 3Q3GA 1ZLSH 5B39B 2BVOB 4U0RC 2VMDA 1EBAA 5HHOE 3BXNB 1ZLEA 4X8GA 1QVOA 3EBIA 3ARRA 5J11C 4N8VG 4WU7B 5BVPL 2XA8H 5CCJA 4S1SH 1RHHB 4GAJH 4LRIA 5CZVL 3GLDA 1XB8A 1R5IB 1FL6B 4BFOA 3G6DH 3UYOD 1UOWA 2DQHH 1OAYL 3QAZC 3RL1B 3TWYA 3GNML 4HMCA 1OSZA 4TSBL 1DSWA 1RUQH 1FN4A 3RE0A 1QSED 1S7XB 3O2DH 2IDQA 1DDTA 2FJFA 4PJXB 1YPZE 2ADFL 2NY6D 1G9NH 4I89A 3TIEB 3K81A 2YK1L 3K8MA 3NN8B 4MMZC 4M3HA 2ZXBA 1RV6X 3NIFB 4WEEA 4AQ1A 4GXFA 4ZUUA 2AK4B 3CX5K 3GPEA 3UX9B 4DT2A 1OT1A 2F54A 4RGMC 3G6JF 2ED6A 4QHLB 3EO1A 5K59F 4JY6A 4BHUI 1HEZB 1YJDL 3CX2A 1X5AA 4OJCA 4WNQB 5I17B 1LO0L 3V4PA 4NZUH 5I1GL 2B4CH 2NY3B 3CHSA 4I13B 3D85B 3D9AL 3RB5A 4MQ7B 1P2CB 2CDEA 2HT2D 4X8JA 4NZTL 4AQOA 3EG9A 1SXBA 4N2FA 4JHZA 4LNVA 4U1LB 1JNJA 3W9EA 3GZPA 1CLVA 5FO7A 2J8UE 1SDDA 3D33A 4MAUL 3MLYL 4LK4A 1IZKA 3NCMA 3QO0A 3U2SA 4PJHE 3EGDB 1AZUA 1MRDL 1YEIL 1ZS8B 2H0JA 3WDJA 3RFZC 1RURL 1BX2B 1B9KA 2MOVA 1MN4A 4FCHA 4LCWB 4P2OC 5DYOB 1SXNA 4YSOA 1BF2A 3OKYA 2P5PA 3HIZA 3CAFA 3N41B 1FA4A 2XBZA 2PXYB 3EYVB 4ZYKB 3BSGA 3ZIYA 4EIBA 4BFJA 2P80D 2JTDA 3JV4B 3U0PB 3LKRB 1H6EA 4JY5H 5E9DA 3BUPA 3JV5A 3ZHNA 3VSVA 2K9UA 1ACXA 1N3NA 1RK7A 2EZ0C 4TLUA 1R0AH 3SQBB 4FN0A 4XP6H 3I9GH 4P4RA 2CDGB 2KZBA 3BFQG 1KWKA 2ZCHL 1CGVA 4UUJA 1KTLB 25C8L 5EU6D 1ZHBA 1OP3K 4HKJB 2VISB 2YAFA 4NKOA 4I0PA 1JGVH 3T4AB 5GZOC 1Y1UA 5B4MD 2VXSL 1T3FB 1NGPH 5BVJB 1BMWA 4XMLH 3T0BA 1X5MA 4UTBA 4HIPA 4DFIA 2GYSA 1J10A 1UEYA 1UOLA 2Q9OA 3I74A 4A6YB 1J8HA 1N68A 1I9JH 1NAMH 3LNGA 2HMIC 2OCFD 3ULVL 5FKAB 4B0MB 1NGXA 2AJSH 3MLZH 3IBOA 4ODXB 4BSJA 1B2YA 5FFOA 3RZCB 1GCYA 1UATA 2W9LA 3D2TA 4EAEA 3TO4D 3EH4B 5A2JH 5ISZE 3ORJA 1KLFA 2EC9U 2B59A 4XMXA 5C0IA 4QT5A 3BWSA 3VXRA 1S7TA 1UWFA 4HLEA 1W91A 4S1QL 3DO7A 2YD6A 5CZKA 4N2NA 3CH1A 5D1ZI 5GRJL 3I6LD 4NKDA 3IJ7A 4OZIE 3ME0A 4D94A 5ISZB 5T1LD 1Q4NX 5F96L 5IIEA 1U8PB 3PNWB 5FGSA 1ADQA 2X1QA 4LFHG 3W39A 1L9RA 2J5WA 4L29B 4F27A 5LNDA 3AWEA 4H8UA 3SDDD 1AQDA 1KZYA 1Z9NA 4OJDH 4PCYA 1JMZA 3Q5OA 4ODHH 4KMTH 1LWJA 4QJ5B 3MREB 4X4KA 1RZIA 1EUUA 2WJ7A 3LRMA 3WFHA 1KOAA 2CHZA 3BIKB 3K2UL 4PRIA 5HYJA 1VEMA 2WSPA 1U4EA 3GJFK 3P0GB 2N4IA 4PLKD 3ARGA 3P3TA 1V27A 1BVZA 4KAQH 1D9KC 1KB5B 1L6PA 2YD2A 3CFEB 3O8XC 4L8BB 3NCBB 2X05A 4FFTA 4RWHA 4I87A 2NPLX 4FG6D 4IEFA 5KZCB 9CGTA 15C8L 1NOFA 1ROCA 4K23H 1YC7A 3G7TA 3EW3B 5T3ZE 3UGXA 5HXMA 1HL8A 5T1JA 1F41A 1G7LB 1HOCA 1FQ9C 5D1ZC 1A7RH 1R17A 4N3TA 4GBXB 2PTVA 5CZVH 1CD1A 2YARA 4P4KC 1FORH 4FXKB 3QUYD 4AL8L 1F4YL 1PKQE 4P2RA 4DEUA 2BC4A 4ZS6D 4IOFD 2MPAH 2LOEA 2F7IA 1T03L 35C8L 4MGXA 3B3IA 4X8CA 1AXIB 2HJLA 3ABKB 1J5HA 2M26A 2EDBA 2JJUA 4Z77A 4IRZH 1BW8A 2DWEA 5AAWC 1YEEL 4NQVB 3TJHC 3DX7B 5I19H 5IHBA 1NIDA 4IK7A 4ZAKD 2H1XA 1AQMA 1EEYB 4D9QD 1GOFA 3ASOB 3U7WH 5C0RL 1AQKL 2A9BA 4AXWA 2NDGA 2AVGA 2WO2B 4J3VA 3CFJA 4PJ7B 3I6LE 2DQEL 2ID5A 4KKLC 5ESQB 2ATPA 3QDJE 1S9WB 5GGUA 2JELH 5D1ZB 3LNFA 5EEWA 1G0DA 4KPHH 5DHVB 3PGDA 4NUMA 2H0PA 4JLRA 1CF8L 5I1GH 1RLWA 3T8VA 3ZTNH 4NI6A 3OLGA 1ZANH 3PP4L 3WS3B 2EIKB 1K4CB 3LSOA 5HHMD 1HJCA 2A99A 5CSGA 4M7JH 5E6ID 1PYWA 1TJMA 1MNNA 3ZE1F 1MFDH 3BPOC 4TQEL 4OZHB 2O30A 3FH8A 3PJSB 4GH7B 4WW1B 2NTFA 4W68A 1KZQA 4JO4L 1Z0NA 2NQ3A 5E00A 3EHBD 1DBKL 5J11B 3OX8B 5KAQG 4AEIL 5IF0A 4WHYH 2K1MA 3O41A 4XX1E 4DF9A 1N6QH 3PXJA 4P3CL 2UVFA 1V05A 3FQXA 1DQLL 1KB5H 4P4KA 5C0AE 4CW1A 3GHBH 4KHXL 2IAAC 2Y06L 2D73A 4P46B 4QEGA 2H9GA 5EORH 3CC1A 2Y3NA 2X0VA 2UZYB 1JZFA 3H56A 3ZDXF 5C07A 5I76B 2VDOH 5JZ7C 2ZG1A 4WHDA 2DTMH 3NZ8A 2W0FA 4KROD 3GXNA 3SDYL 1CF1A 4Z7UE 1BQUA 3B2XA 4KC3B 3O4LA 4QXGH 4YSDA 4EEEA 4LSVL 1OE1A 3T0AA 4MNQB 4MWFB 4E42A 4HYTB 2ZKHL 1BF5A 4NWTH 2FNWA 5TDNB 5ABDE 1F6LL 2OJZH 4L4VA 4P23D 2NY6B 2WAQA 3IXTB 2CZNA 5INCA 2NY3C 1RUAL 4BZ2H 4YPGA 2TAAA 4FNLH 3HS9A 4Q0XH 4PW9A 1QTSA 1E3ZA 3DHMA 2VL5B 4M43H 1XH2A 3TTYA 4ICXA 2IDCA 2J55A 5GIRB 1U3HA 1BJ1H 3CLFL 1N64L 1VESA 4KI1A 3V0WH 2I5YH 1T5XA 2CPCA 3U83A 3BJLA 3QH3B 2ZOKA 2UXGA 3EDKA 3QXTA 1BVNP 5F71A 3BHBA 4FQXB 1IC7H 3ZHDA 4HPOL 5BXFA 3ZZSA 1PD6A 2EH7H 2CIIB 4NC0B 4N2GA 2P5EA 1JZ4A 2JKXA 4NO3A 5DEGB 1C1EH 2J88H 3L4YA 5E5UB 4ETYA 1VDGA 2BVQB 3ECBA 4NQCA 1IAIL 1M71B 1U8MB 1ZV9A 4OUUB 3U0WH 1IGYA 3LH8A 5F0PB 4HAGA 1ZEAL 2QEJA 3FHQA 2FR4B 2YGNA 5ALCL 2VLRE 3GMRB 2KZKA 4R4FL 4Y2OA 2VWEE 3GIVA 4E9RA 4LSPH 4AV4A 2BNRA 3MNZB 4HBQA 3V7MA 1HQRA 1O7VA 2AXFB 2GIYA 5BOZG 1QLEB 1WF5A 4MJID 3ARDB 5I75C 3EYOA 3BZFA 4EQ2A 3D25A 1NGZA 4R4ND 1FYTD 1QMUA 1YRKA 3S3JA 3FOLB 3LJ3A 2Z31D 4HUUA 1Q9WA 1C7SA 1U8JA 1MCBA 1IAOA 5ALBH 5D55A 5K39A 1L7IL 2JIXD 2GKIA 2VR8A 3O6MH 3HMXA 3EO0B 3STLA 2V7HB 1P4BL 2P5EE 3KLKA 2BCMA 3PAUA 4KDTC 4PJIE 5F89A 4AYFA 2VXTL 1DANT 2YLHA 1HQ4A 2E7LA 2ADYA 4KKQA 2P42B 2WZPD 1FWXA 2A9MH 4YDVA 3V9FA 5F6HJ 1H8NA 1ICTA 4K3EH 2YUWA 3EUUA 5GGRY 4F2EA 1J8RA 4YDIL 4OM0H 1IQDA 4BWTA 4I2XB 2K70A 3GIZL 3TBVA 1JGIA 5TPWL 4RCAA 1AI1L 1NBZB 3GRWH 4Z7VE 2AEQL 1I75A 3V6ZA 3ZLQC 1E2ZA 4J3SA 4L4VE 5CIPA 1U8NA 2XLLA 4AJYV 4BRVA 2NNCA 3HI1B 3ZYJA 1QFHA 4P23A 4LF3A 4L9LB 4MMXB 2IFFL 3NCFB 2YA0A 5DFWH 5EBWA 2BVYA 4HV8B 5ALCH 1J5OL 5D7KE 3O4LE 4EUPH 3NPSC 2A73A 1OVZA 5D7SH 4ENED 3FONA 3CFBA 4XCFH 5JHDD 2P3YA 1I8LA 1JWMA 1AD9A 3DHJA 4PJBB 5F9WC 1MAML 4U6YA 5BNXD 3U9PL 4PWEA 4JPSA 1IV8A 3BI9X 3WNMA 4U6XA 1YNLL 5DHYB 3V5HA 1EAJA 3P4OA 4WUUA 3PHSA 1INEH 1CYGA 1WBZB 3KJ6L 4HT1L 5C0AA 2GJZA 1BVLB 2HX9A 3RILA 3MRDB 3UG3A 2WNXA 1QI5A 4GP4B 3IAQA 3O6FC 5K9JL 2J6EA 1UQSB 2VDPH 1AZZC 4JRYA 4ESKA 4LPYA 2XJLA 1EZLA 2O6EA 3BUTA 4JPWH 1OLZA 3ESVF 4HHWA 5CN1A 4ORZC 2DQCL 4I1PA 2DW5A 4H0LC 4PRBA 5DVPA 2WBJB 5C1MB 1KTBA 1TQCB 4ZMXA 1KYOJ 5D5ME 4ZSOB 1NCOA 2QZQA 1GIGL 3N04A 1U3YA 4WWOA 4L3AA 4PJ5B 5DZAA 5DZPA 4U1MA 4Z0BH 5G5DA 4DP9X 2A6DB 1D5IH 3WFZA 1N10A 3WD5L 1JHKL 1IGMH 4QXUL 1J5DA 1I4FA 1NFKA 2YUXA 3JWOH 4I0PC 5GZOA 5FGBA 5H4YA 2XWRA 1HH9A 3ILPB 4WFGE 2VZ3A 4IBYA 4WWNA 2Z7WA 4LKXB 2WQSA 3O6FB 3DV4A 1V3MA 1YY9D 5D7SL 1AZBA 2GJRA 3D50A 3Q0HA 5EFIB 3L48A 4ZTOL 5K9OA 3O4OB 2HKHL 1M6OA 3ZY7A 1J5CA 2EIBA 4WI0A 3FQNB 5I15H 3DK2A 3WS6A 4YFLI 1S7VA 5GGVH 1OPOA 3C60D 4PUBH 5EN2A 2F7OA 3FZUC 3QWOB 4L1LA 3BEWA 2P5WA 2QVKA 4QXTA 1LO4L 4BA0A 3WIHL 2EECA 3REVB 1PKQA 4G7YL 4P2RE 4OZIB 4M5ZL 1SLWA 3T04D 1A3RL 1KIUA 2N1KA 3B2DC 1T1ZA 4XZUA 3HS0A 4XVUC 2VDQH 2VB5A 1GGCL 1SHMA 4NHUB 2WXRA 5G4OA 3I85A 4H25A 1M7IB 5A3IC 3TBTB 4DIXA 4XWGL 1IC4L 5D96B 5ESVB 5DJYA 4QRRE 4LEEA 5BRPA 5J6HB 1UB5B 3OXSB 2Q6WB 5AVTB 1P5UA 2EXYC 4HUNB 4LHUB 4MA7L 1HNGA 1IVLA 1WIUA 5EF1A 3ISRA 1E6OL 1U95A 3T2PA 1HZLA 2GPZA 3K5RA 2CXGA 4I1NB 2XRAL 4JO1H 4UM9A 3RBGA 1VFAA 2ZOTA 4FQIL 5EO0A 4YR6B 4ZO7A 4K7PH 4YGVA 5JXED 1OARH 2XQBL 2HTLC 3OKKB 2ZSWA 4JN2B 4QXWA 3S4SA 4F7EA 3CD4A 4ZQKA 5KZCD 4LSQH 4KFZC 4ZFOB 2TSBA 2IWGA 2XWTB 4Y5VB 1LVEA 4Q14A 5JDSA 5EEZA 3HBPA 1CLYH 3FTXA 3LCYA 1XHHA 2MQ0A 3PWPE 4HLJA 2XWJA 3O9WC 3QJXA 4WI8A 4Q58C 5H37A 2F7RA 2CU9A 4PGEB 5GGRB 2JCCB 3ZO0A 3LNHA 2ZXGA 5JOPD 1EAQA 4UILL 5HHVL 4EN3A 4J8RA 3VQLA 1G7MA 5I6NA 3V0EA 3F85A 3FT4B 4GXVL 5E8DL 1HINH 4UU9A 5CEZE 3U79A 2F1EA 1OT4A 3CMGA 1MIEH 2BVUA 4U31A 3QPQC 3MJ9A 2N0KA 1HE8A 4BA8A 4PJ8C 1JV5A 4FFVD 1G9ML 2H8PB 1DQDL 1MVUB 4DZBB 1L9NA 2CCVA 3DX4A 3LEYL 2WNGA 2DS4A 3Q01A 3GUTB 4N0CD 1PSKH 1K3IA 1T2JA 4R90L 1RIVL 2WN3A 3ETBJ 2F08A 2C9PA 1OALA 2FVNA 3DUUA 5DD6B 2FWOB 2X4TB 3MROA 4G5ZL 5C0GA 4LHUD 3WNJA 4G6JL 2Q7YB 4LSVH 4TTDD 4OD1H 4F2MB 3FFDB 3NEXA 1FZKA 4YE4H 3EJZD 3ARBD 5MP6H 3FJTA 3QBTB 3RJDA 3NP4A 1VPOH 1Z9OA 3MBWA 3FRPG 4JBSA 1RZGB 2VT0A 2WN2A 1SOXA 1E50A 1TZHA 5HHOD 2DOCA 3KGRA 1ADQL 1ZIBA 5DUBA 1E90A 2CBQA 3MSPA 1FORL 3OZKA 4V2BA 3IDIA 3RTQA 3VD5A 2YHGA 5IM7A 3SDAC 5F6HI 1YY8A 1DHKA 4KQ4L 1S3KH 4NCC1 3LV3A 2L7JA 4Z95L 5HJ3A 1CO1A 4GW4A 3EDDA 1ZJAA 1LD9B 3WE6B 1PQZA 4HZAA 3X3FL 3OF6D 1QYGH 4YDLB 4AKPA 1L3NA 5T1DL 1OTSC 1WISA 5JW3L 3APFA 3RY4A 3L1EA 4V2CB 4AYBA 4LNRB 3BFOA 1DP0A 4UT6H 4Y0GA 1X9QA 4PJHA 1H9DA 2AGJH 4N9GB 5LGHH 4Z78B 3BP6B 3DDFA 5BUAA 2J8UA 2Z8SA 1NPUA 1MJ7H 3BVNB 4KK8C 2IH8A 2EVFA 3NSYA 4YN3A 2C4FT 2Y6SD 5GGTH 3RZCC 4WF7A 4CMMA 1ID2A 4FA8A 1CFSB 4Z7WE 3MRQA 3PHQA 2AERT 1PNCA 4G8FB 1SY6H 3UTOA 1JG9A 4U4BA 4JO2L 3NJIA 3T3PF 3GBNL 4X6FB 3KPNA 4ACTA 4AE1A 3VI3A 4PLJD 1FI8C 3MJ7A 1NFIB 4GSQA 3BSHA 3DUSA 3BPCB 2ZAGA 5TDOB 2VMEA 3ZSSA 2RAMA 2H45A 4NN7B 4PWIA 3MUGA 1M3IA 2JQZA 1JXFA 3DVIA 1FL3B 2CO3A 1KBWA 3D18B 1WIPA 5C3TA 3TA3A 4EI5B 1KG0A 3IDYB 4GQQA 3WNNA 1QFWM 1DLHB 1F00I 3AUVA 5CZRA 5MHSD 3P0VH 1E4HA 2LHAA 4PJGE 2DDQH 4NJ9L 2ZSVB 4DP2X 3X3FH 5DC0A 2X3CA 1DBKH 1UJ3A 4K94L 4P2QB 4YSPA 3T8XB 4GG6E 5T8IA 4KAQL 1P4IL 3VFPA 4L0ZA 1BLNA 1OB1A 5KOVC 4MXQD 5HD8D 5BPPA 1U3HD 2J43A 4L1SA 4OFVA 4ADIA 5KVDH 4Z7UB 5L4IA 1QSVA 3HI6H 4CMHC 3ZMEA 1U6AH 4MJ2A 4DCQA 2QGEA 3NK3A 4H44C 5L2KB 4G8GB 4BFEA 1YEKL 3JWOC 3DXAD 5AQ0A 5GXBB 4UNTA 5T5FH 2VDRL 3HN5A 1E4KA 2QMJA 1ZMYA 4GNKB 4MA7H 4XAWL 3UCRA 4PAZA 1UH3A 3W1ZA 2F5AL 3ZUNC 3OWEA 4TQ8A 2P28B 5BRQA 2JI1A 1JERA 5IFJA 3MXWH 4GP5B 4I3SH 2GTZB 4MKMA 4GMSH 4GRWE 4XAKE 1OPGL 4FERA 4IDJH 5JHDE 4YHMH 5D1QE 2R0KH 5I19L 3IDUA 1BWWA 3AREB 2H32B 2HWZH 5DWPA 1FYTA 5DRZA 5T1KB 1NCGA 3TZVB 5DS8A 4M02A 2VCOA 3SY0A 3JWNE 4OSUL 4TNVF 5IHHA 1PIGA 3LKNB 4FLSA 3BW9A 1JGEA 5IROA 4K3JH 2BNQB 4UQ2B 4FZ8L 4DW2L 2ZWKA 5LGKA 1A2YA 3LPPA 3UTZB 4C47A 2B0SH 4JFDB 1HK6A 3BPNB 2OMYA 1VADA 2MFNA 1EGJL 2PYED 3GDCA 4OCXL 3HC3L 3HPJB 3SD5A 5E8DH 5I8CB 4B53A 2YD3A 3NJMA 4XB7A 1GW0A 5EU3A 5KYYB 3FFCA 5AZ2L 4ZDHA 3VXMD 5KBDA 4UI2A 4HUXA 1QOKA 1FJ1B 2ADIA 3CLEH 4W93A 5GGSA 2GAZA 5AB1A 4G6JH 1Q94A 4H26B 2D3VA 3ARUA 4QXUH 2BP0A 4I3SL 5I1AA 5KW9H 1IBGL 5MERA 3TEWA 2Q5BA 4KK9D 4Y5XC 3UP1A 2JK5B 3DARA 1AP2B 3FUKA 2QLYA 4O00A 5D96C 1KIQA 1PSKL 1S4IA 2LLLA 4LIQL 4ZXBC 2OMUB 3NRPA 1QRNE 5KBLA 3QUKB 4TVSa 4XAWH 3WKQA 5LG6A 4F7MA 3CVHA 2YQ2A 4R3SB 3ELQA 3KYMB 4ZUVB 4XNYH 4NDMA 2XDHA 1QBLH 3QDHA 3QEUB 3GSVB 3T0XA 5I6LA 4UIMB 3MNVB 4FTVA 3AS3A 1QRNA 3EYSL 3FT3A 2UY6A 4PCTA 4Y4KB 3F62A 2LFGA 4Z7WF 4CSTA 4OFPA 3JWDH 3K1DA 2W0PA 2QKIB 5DQ9B 1SYSA 4KU1A 4OF8A 2NY4B 2UUDH 1B3JA 5D2NC 1A6VH 3L5WB 1QO3A 4GP8B 5EOQL 3HFFA 1E4JA 1EHAA 3AT0A 3MUJA 2BHZA 3AXHA 3AY2A 4W9EC 2GSIA 4FZ8H 3WKMH 4DW2H 4YHYC 4P2RD 1GOGA 2AMGA 5KN5B 5AYUH 3B7YA 4KK5D 5MEPA 4QAMB 4UDTA 3NJVA 4XGZA 4WO4A 3PDOB 4X5WA 4G7VL 4ABWA 1J1XH 3BT2L 2O6CA 2UXTA 1HHJB 2CUMA 1THAA 5A6MA 4ZFZB 1OD7A 5JYLA 1QSEA 4FP8L 4KV5E 4NJAH 1MY5A 3IWUA 4A55A 2CIKA 5D2NB 4ODUA 4N90E 4GRLD 4I18A 2A77L 1PG7L 2OL3L 1FAIL 5D7JD 4F20A 4JVUA 2ARWA 4OF6A 4Z76B 1B88A 4M61B 1LEIB 2YBRA 5E8PA 1PCXA 3EIFA 3QUYC 1DQVA 5ANHA 2DIBA 4E5XA 3BSZL 1I85C 1PU0A 3OMNB 4MX7A 3G5YB 4X4YA 2FJHB 2IAMA 4R5VA 3K2IA 3DTXA 4NGHH 1GOHA 3O6KH 4NRXA 3DVGA 4CSPA 1ZK9A 2WPGA 5F9JB 1NIFA 4K0OA 4X4XA 2UZXB 1MIEL 4QTIL 3FTVA 4TUOB 4NUGL 3OKNA 4NQSA 2WYZA 3ZL1A 4ZFOL 2XV6B 4UT9H 5T1LA 4APQB 4WV1C 3BAJA 4FA6A 1RZKL 1T1WA 2BINA 4GIAA 3TJEH 3ARTA 3CZFA 2OMWA 3I75B 1XF5A 1G7IA 2BIHA 4KKBD 4S1SL 3DYPA 5GS2H 2ZP8A 2JH2A 1TTUA 3QUXA 2WCPA 3ECQA 3GSRB 4PHXA 3OHXB 4G43A 4IU2A 3VFUA 4L8DB 1EIBA 1MRFH 2VQ1B 2VN4A 3CZEA 1BD2D 1FG9C 3V7AG 4PP2B 3SOBL 3L3IB 1S2EA 2XQYK 5FHBL 2CBMA 2CAKA 4M8QA 2FX8H 5LAPA 1LE9A 1QKZL 2J12B 3QS3A 4HX1A 3ZDYB 4NQCD 5FO9B 1U9KA 2PW1B 3E6HA 4JQXA 2AGJL 3WV0A 3MRBA 3SE4C 4EIUA 2VH5L 3KPRB 4QRPE 1NEZA 3RI5K 2IMNA 3FB8B 2J71A 2XFXB 1CXLA 3H1ZA 1SEBA 3BEVA 5T1DH 3VDBA 3NAAH 6FABL 2R2CA 1G4MA 4I88A 4IBZA 1YSOA 4X6EB 1OAZH 4ZZKA 1V3KA 2WQXA 5JPMB 3AG3B 3MGOA 2IFGA 1AYOA 3RL2B 5IBTH 1XGQB 2ITDB 4H5SB 3BP5B 3UBFA 3U2JA 1AO7A 2EH8L 2DQJL 5F7LB 2GFBB 1G9EA 3NIFF 4J28A 4RRPM 2DTML 3KLQA 3IF1B 4JDZA 1WQVT 4Y19A 3T0EA 1LXMA 3QG6B 5D2LA 2G3NA 1PX4A 2IANA 1A7NH 2J1XA 1NJ9B 2ZYRA 4EDXB 4EO5A 1OARL 3VXUA 4MNHB 2ORBL 1TITA 2P43B 1A14L 1D5XA 1WCQA 3KBHE 3VGGA 2YMXH 2E3VA 1HVXA 3KGUA 1DVFA 1UA7A 1KJ3H 4ETQA 2IV8A 4UTAL 4P9MH 1JGDB 3RUGA 2OZNA 2Y6TE 1C1EL 4XBPA 4YHLL 4F2FA 3TCXA 3VXPB 4E0RA 3GINA 5SV4A 5E2WH 1K9TA 4JFXB 4KJPD 4M9OA 4U6HB 3U4EB 1QWUA 1I1CA 3D0VA 1QACA 2BHFA 5BUGA 4FXLA 4LLMB 4U1IB 1LEGB 2EEFA 2XWCA 4MA1C 1JZHA 3CFUA 4FEIA 4DO6A 3MCLH 1OGAA 2J2ZB 2X70A 5I1LA 3AFLA 3ISWA 2VXQH 4BUHA 5DUML 4PUBL 1EFQA 5CP3A 4NKMA 2FSEA 3HI5L 1IEAA 4YAQB 3HUJE 3NVQA 4AQAA 5DUJA 1FVEA 3EJYC 1ZD6A 3OV6A 3HG1B 5DD3L 3RB7A 2X7LB 3U6RB 2R0ZL 1HSAB 4XCCH 4TVPE 1J0KA 4RMTA 4QHNB 1VCAA 2VDML 4LO9A 4JFED 3RWFB 3QULA 5GRUH 2Q8AH 3TA3C 4YIQB 4ZAKA 3LVTA 1W8NA 1IBBA 2PP8A 4NFBA 4TQHA 4P46D 2FGZA 3KCWA 1OP3H 2V5TA 4YXHL 4RWYH 1VAHA 3R8BB 1RFDH 2ZWZA 4YZWA 4JM0A 4MCMA 2ITFA 4AGQA 5ICYA 4PB9L 1YEHL 3TO2B 1H8SA 5EBLA 1E43A 1F6AA 5HYSA 5CJQH 5FFGA 4A1RA 3E80A 2DI7A 3D4GA 4GAGH 4MB5A 3L5XH 4HKBB 4ZTPL 5B8CB 2ITEA 5C86A 5AD0B 5E7BA 5ICZB 1OTUC 3ILQC 4QRRA 3SOTA 2H3KA 2IAND 1DVSA 3RX5A 1YYLH 5AOZA 3HBQA 4UDUB 4BH7B 3IU3A 1S7WB 3E8UH 3EJJX 1G1OA 5AOLA 3PWUA 2R1XB 3COOA 1YNKH 4X80L 2EC9T 3GTTA 3D05A 3WHXB 3UBXA 3LKPA 4DKFL 3O0RH 1MVYA 2AEPL 3GSNA 2OMTA 4KZ0A 5KVEL 4XOCA 1RZ8A 4GQZA 5LCVL 3H53A 2Z0BA 1UD5A 3X14A 1JHLH 4JJHA 2B1HL 1GC1H 1XH3A 1KPVB 4GKSA 5J12B 2JF1A 3MLUL 3NCJL 1T03H 4F7KA 3S98A 4AKOA 4M93B 1F58L 1ZEAH 2LT9A 4PJ8B 3GMMB 4AM0B 2BM3A 1UOKA 4V1DB 3ALXA 3ARFA 1T83A 3WY2A 1YEEH 4RZCA 1I1RA 4K8RD 3M17B 3BAYA 3BWAB 1NC2A 5D72L 1SYVA 2KPNA 2XNAB 2NW2B 1BCIA 3ULSA 2FO4B 5TF1L 3AQZA 2EE0A 3ESNA 2Y1ZA 4UB0H 5FK9B 2UV3A 1OD9A 1KPRA 3I9IA 4NNPL 1TT6A 1XSIA 2A5UA 1PY0A 4AVHA 1NGQL 1RULL 4YXKL 3C8DA 2VO8A 1AFVH 2DLIA 1ZA3A 3DSFH 4J3WA 4NQEB 3QJFB 4BCYA 3C6LD 5ITFA 2XOTA 2HJKB 4CUCA 3DURB 4MD5B 3K4ZA 2FSDA 3BQUA 5DMKB 3V79C 1NDMA 3VRJA 3OGOE 2GEEA 3RDTB 2W07B 4HAFA 3MXWL 2O6FA 2V8LA 2ORBH 4Y1AE 2A0LD 1W6LA 5EU6A 4A66A 3GXMA 4OCRL 4F57H 1HILA 4Z8FL 3B5TA 3SYQA 4UNIA 1DZ0A 4HETA 2Z92A 3D2UD 3Q48A 2YXFA 2ZOOA 1WE5A 4GSRA 3CDZA 2Z8RA 4JFQA 1EVUA 2Q2EB 3QUMA 4G1EA 5KSBB 3IDMA 1XF3A 5L2KE 5FECA 2W88A 1TTFA 4QAWA 1LDSA 1MW0A 2D3JA 3GIZH 4Y19E 2QVMA 3V5KB 4J3XA 3S0PA 1HT6A 3HE6A 1UWEL 1ZE3H 4I5BB 4JN1H 4Y9FA 4NO0B 4EBQL 1DN2A 2C9SA 2Q86B 1M57B 2NXZB 2GSGB 4GW1A 1HKLH 5JW4M 1HWHB 1CFQB 1CI3M 4NYLA 5HHXL 1CT8A 4PEEA 2MHAB 4QPEA 3QEHA 4X9BA 3S8FB 1XGTA 1N0XL 1SJMA 4QWWD 5F7EL 4CJ1A 3EYFA 5IFHL 4A7SA 5B3SB 4YSSA 3D9AH 2R23B 1JZIA 1F3JA 2MPVA 4XI5D 3JTBA 3O9WD 1JN6A 1DVZA 32C2A 3QPXH 1U8LB 5HI5C 2O61A 1LYQA 5C0BD 4PH8A 5KSAA 2H3XC 3QI9A 4MVBC 1E6JL 3NIGF 2VLKD 4U1SA 3IFOB 3AQYA 4IRZL 4HOZA 2V3DA 3ZMRA 4YSRA 1NICA 1CLCA 4P0DA 4D8PA 1T1YB 2VERN 1R75A 4YQXL 5KYXB 3RX8A 1BZ9B 3R19A 4JS7A 2EVIA 4NLAA 2HLAA 4FFVC 4BSWA 2IBGA 4X5XB 5IBTL 5CMAA 1N19A 2BPBA 4HUWA 1DDHB 5KS9E 5KSVA 2HRPH 1KBKA 3L9EA 3HAEG 3LB6C 4WWKD 1F1GA 1ZT1A 4DUVA 2X2YA 4D2NA 4NQXB 1N6VA 4JN1L 3B7UX 4KKAC 1O7DC 4HGWB 1IEBA 3ZPDA 3QUML 4FJZA 1R3JA 1UADC 4JX0A 1M7XA 1AC0A 1W6WA 3WFCH 5JPNA 4TSCH 1RD6A 1ZPUA 1FO0L 1RJLA 3VO0A 1UWYA 3OB0K 5IHUL 5DFVC 4JZJC 3S5LA 2R0KL 5DJ8A 4FFZL 5GGSY 1AAJA 2B2XH 2C7FA 1ADQH 3HLKA 1TMQA 1JNHB 1SLUA 5CO1A 1OAKH 1MHHA 3I6GA 4APXB 1E28A 4QHUB 1X5IA 4PJGF 4A38A 3ZTJH 5EZLA 2ZG2A 4X98B 5DHDA 4UF7C 5EB9A 4QJ3B 1A6WH 3CDGB 1PZDA 3FW6A 5F96H 1T22A 5CEZH 1FSKB 1P1VA 5AB9A 1OP9A 5EPMB 4YHPA 5JW3H 3DRTA 1VGEL 4W9JC 4Q52A 4O02A 4JFYB 4GKNB 4DP1X 2QZ5A 4MHHG 4DESA 4JZJB 1JXDA 3D08A 2JI3A 4EN3D 3LHPL 1RJCA 4RGOH 1FO0H 1JK8A 4KQ4H 3T3MB 4K4KA 5GZNC 3U7YL 5IVXB 3RGVC 1T1XA 1NGQH 3KH3A 1EGJH 1TVDA 5B3JE 1KACB 1MRDH 4K7PY 1ET8A 4XP1H 2BVPA 4TKWA 2NY1C 3FRPB 4NNYA 2OX5B 1JYNA 4NENA 4TRPL 3LPOA 1F13A 4XRCB 1H5BA 1WGOA 3IDJB 3QJSB 3VXOA 2DQFA 1EX0A 3LXCA 4IQHA 2R56H 4R4BA 4BQBA 5MENB 2VC2B 4MAYD 3WN5A 3HAEH 2X4UA 3IMSA 1AKPA 1GTFA 2PR4H 5F3BB 2OAAA 2WIIA 5GS1C 3TYFB 4KQ3H 2OKMA 4M5YL 3SKOA 2EYTA 1UGNA 3EBHA 4OZFH 4P2OD 5CS7A 4CILA 1NBVH 2I26N 1FGVL 3M88A 2Z4QB 5E2VH 1ZXKA 3OKOA 1EFXB 2E9IA 4M7KL 3SE6A 1KGYE 3IFPA 4ZMVA 2QL1A 1THCA 1IQWH 3BKJH 4WW2B 1GH7A 2CKBB 4CU8A 2F1AA 1JGUL 1I8IA 4L4VD 4JRXE 3NZSA 4XXWC 5EIVA 4PR5A 5IB2A 3BLBA 3TFKC 2R56L 3SYAA 3U1SL 1AD0A 5IR1B 5DJ6B 4R7DA 3PWLB 1S7UA 1A3LL 4POZC 4G9FD 4GRMB 3MLTA 5DK2A 4J3OC 4D0DA 2OTUA 3F7PC 4EKJA 3H2WA 2DDQL 3OD3A 5AUMA 3VXSD 1GPOL 1TENA 4WGKA 1W2KT 3U1QA 1J0YA 8FABB 2CKNA 5DDHB 2Y9RT 4KXAA 4R8WL 3FFCE 3IJ9A 2X6CA 3NSFA 3QDMD 5EZIH 1UB6A 4MA8L 3ZT7A 5ABZA 3UMTA 1W72H 5GGVL 1KEGH 1F58H 3JWOL 4HWZA 5E6YA 2L3BA 1MY7A 2H4EA 4PGJA 3MLPA 1F90L 1MI5E 1FVDB 3GSUB 1XF2A 3TN0C 1EWHA 3ZHKA 2CHDA 4G7SB 5CLZA 3BXNA 5F8RC 1A0QL 4OLWL 1ZIAA 4AQ1C 4WNSA 1FVCB 1FGVH 3E8VA 3R4RA 5D1QA 5HDQH 1MW2A 5CEXB 4ODHL 3B2PA 1QSFE 5EUKB 3BLKA 2WVVA 3FTUA 2ZD0A 4FFWC 4K3DL 1FG2B 4WI6A 5DURB 4P2QE 3V52L 3VFGH 2DRUA 4PHZA 4W9LC 3O3DA 2J6WA 2FIRT 3FTGA 2E8ZA 2IMMA 4NKIH 3Q2LA 3L7EB 3KPOB 1JYWA 3CWGA 3WJMA 3VQ1C 1P0SE 4Q6YA 2PTTB 2HVBA 4P57B 5C6WH 3DIDA 5FM5O 3HPLB 3QZOA 2IPKB 2EIMB 3CFIC 4W70A 3KWUA 1SM3H 4PJXA 4FMKA 5IQNA 3TIEA 3X1FA 3ENEA 3ZTDC 4JG1L 2WZPA 3T2OA 3F65A 4HIHA 4AQ8A 1YPZB 5BS0E 3S2AA 2AK4A 1A22B 1FCGA 3BIAX 2GBVA 4LSQL 4YO0B 3S5YA 1OSPL 3K71A 3M1BB 4GG6A 3FTZA 4XXDB 5I17A 2Z31C 1RZJC 2H47C 2PMZA 2Y23A 3P9MA 4X5RA 4QJ4B 2CUAA 5SV3A 2BS9A 2CDEB 3DX6A 4X8JB 1IE5A 2PUQT 5FWRA 2ZXWB 1R1CA 3BD3A 3GS4A 4H88L 3WN5C 4XXCA 5JMRA 2WWKT 4GIPD 3ZDZF 4DKAA 3QO0B 4OJYA 3U2SB 2EIZA 4OLXH 4WVRA 5K1JA 2A9NL 3UGEA 2VE6A 1OQXA 4M5TA 3ZQWA 3K72A 3N85L 25C8H 3IDGB 2KPWA 4OZGE 1CR9L 3LEYH 3EDEA 3ARGD 3P3UA 3ZTCC 2YPVH 1H3TA 3EYVA 3FCUB 5DURD 5DWUL 4PG2A 2YAOA 1P4IH 2DLEA 1U58A 4KY2A 1QSFB 5E9DB 2VLJB 1P9MA 5AL8A 4IGBA 1X4XA 3C5ZC 2WLLB 3WL9B 5KJ7E 3D8MA 4OIIH 1DYZA 2YRLA 1DJXA 1REIA 1TO4A 3H42H 3VG9B 1QLFB 2OM5A 4ADGA 5IHLB 2X4NA 1F4XL 4ENEC 2WXMA 1EXUA 3PABA 2HFFB 2X10A 1KTLA 1ZHBB 2ZE0A 4XR8C 2LV4A 5FPIA 4C56E 1MFCL 2XXCB 4HKJA 4NKOB 5DEZA 4GT0A 5F9AC 2E75C 1N9PA 3LNIA 1JWSA 2CLVB 2YPLD 4L3CB 4PBVC 4WEBL 1OHZA 1R4XA 3N85H 4P5MA 5C92A 1E8XA 1ZGLA 1FFTB 4Y4HA 5C6PB 3H2QA 3MBXH 3QJVB 4MXWH 4ZW8A 3VGDA 3UBXI 2APVA 4F15B 1SEQL 2BY3A 3GSWA 5FKAA 1NIAA 3TCLB 2EDLA 2XRAH 3FU0A 3NZUA 3CFMA 2DWYA 5CBAA 1SOSA 1W0WA 1WSST 2KLTA 5I71C 3T6XA 4KJWC 4ALAH 1NLBH 1I1FA 3V0FA 3NACH 3N1QC 2P24B 3RIKA 3LRLA 2F8VA 3GBMH 2DM2A 1FC1A 2O5XH 4X4MA 3WUZA 5A7BA 2PCPB 4OJAA 3J27A 4OZGA 4DEPC 3K6OA 3AJ7A 3ZL2A 5IIEB 2OI9C 1MFMA 3KBFA 3RTLA 2HN7B 1UXWA 2FEJA 3DO4A 3FHAA 3W39B 3O2WH 2Z64C 4XC1H 1YMMA 1AGBB 4Q74A 3SDDB 1RULH 4HIXL 1YN7B 1A8ZA 1UCBH 1Z9SA 2WLKA 1NAKH 4NM4H 4A2MA 3C8HA 3NABH 2VLME 3VH8A 5F7HA 1BQ5A 2ENJA 4PRIB 3IGLA 5D7EA 1KFGA 5KBNC 2YLKA 5I18H 2EUXA 3UFIA 1JDCA 3OM3B 1IGFH 1JTOA 4EZJA 5IG7A 2AZAA 4LVEA 1BAFL 1DQQA 4RFNC 1KYUA 2Z91B 3CFEA 2YQBA 3FQUB 2QPEB 4XP9L 1U93A 1GSKA 1QNZL 5KS9B 1T5KA 4YZFF 5BS0A 1WAAF 3LOWA 5CGBA 1Q1JH 1VACB 4ZO8A 2WLIA 4BSVA 3CZKA 2FEEI 4FADA 4ORGA 1CG9B 4HWNA 1G7LA 1M42A 4O9HH 2WKGA 5IQ7L 1E9QA 3L7FB 1AR1C 4Z7NB 5I1KL 5DQDL 1G9MH 2C9AA 2YPVA 1NBYA 3V4PL 4WTZG 3ZT5A 4XO4A 4RNRA 3RWGB 3UACA 2Z1PA 4FMVA 1W15A 2F8OA 2BZ7A 3UTSB 2CCLA 4ZUTA 3SD2A 2ENQA 1U8KB 1ONQA 2OXHB 4OTXH 3BD4A 3QHTC 3GB7B 3IK2A 5TGBA 2GHZA 2HX8A 3M1CA 3FCTA 4K3HA 3EZJB 4D0BA 2B5IB 4KUCD 3NA9L 4D0CB 2JKNA 3CFJB 5I2IB 3JTTB 1WFMA 1QHPA 4MRBA 4TOYL 2HKFH 3OWRA 3L95B 5GGUB 3ZTNL 1A6UL 4OGYH 2HKHH 3PGDB 1RKRA 2P26A 3FSVA 4X0KA 1SFHA 3UZEC 5AZEH 2EXWC 4JR9L 4OH2A 5LHDA 1YAZA 5IQ7H 1W72A 4KXDA 4ZD3L 4X83A 1LP9F 3ATFA 1NAMA 2R1WB 3MRHB 1P4LA 2LTQC 1CICD 4P2AA 1KGXA 4PTTB 1C08B 1BZ8A 1ZHLA 5DC2A 1QZ1A 2HH0L 1PYWB 3WXWL 4H40A 2FJGA 4TN9A 2XPYA 4XODA 5F88B 2BY2A 3TBYA 2P52A 2CM5A 2DYPD 4JM2D 1PJ9A 1PIFA 1XIWD 3S3BB 2BSEA 3BGMB 1X4ZA 3GRWL 1T20A 4HAKA 3QDGB 1ASPA 3VXRD 1PBYA 4HIJB 4ANWA 1B0RA 4AUYA 4MD4B 5HPMA 5D5MF 3AMKA 3EH2A 4PU2A 4NQDE 3EOBA 3JBG7 3UADA 4X7TA 3ABLB 2VUKA 3C6LB 4JHBA 3FSZA 1FFOB 4XNMB 4XPAH 1YN6A 1A7RL 4BE6A 2ZOUA 4X99B 3QIBD 4RBPH 1NMCC 2PO6D 2QVIA 4WHTB 1I3VA 1GS6X 3LRSB 3QXDA 2CO6B 4ELKB 4YVUA 3FF8A 1QD0A 1VCBC 1TLKA 2W0FB 3BOVA 4Y4FC 2I25N 4LSDA 2XT1B 2CGRL 4HF5H 5EC2B 3VWKB 1BYNA 2YEQA 5IEKB 1EZSA 1KWGA 2VO5A 1ZAGA 1KV3A 5E6IB 4E42B 5EU5A 1WCBA 3EYQC 5JIPA 3SGEI 1YDPA 3HZYA 4CC4A 3C6SA 3BZEA 1CU4L 3FT2A 3FUFA 4G6AD 4IHBA 1L6ZA 4W9HC 3IPBA 3VFNB 5I26A 4YPGB 3VNZA 2IDSA 1RU9L 2K9FB 2R0LL 2ZKMX 4PY7A 4MJJA 4R4FH 5EBMB 2G9HA 5DD5L 5HJGA 3T6QC 1HJBC 3G6JB 1ND0B 5FYJH 3G04A 2J21A 5HDBE 1SEQH 4HJJH 5IHZB 3RWJA 3QH3A 1EGJA 2H0EA 4YSCA 5E08L 5EUOF 4N6RA 2JJVA 4MSWB 3DOHA 5BW7C 1CE6B 4EDWL 1MFBH 1H8LA 3P73A 1MEXH 3QNYA 4WO0A 5ACZA 3PWPD 4X6DB 1J0ZA 1NAKL 5IV2A 3R1GL 4Q56A 3MLVH 3MFFA 1XBDA 4NQCB 1M71A 1WFNA 1JF6A 5HY9A 5LXGL 2BOLA 2G2RB 2WCGA 2ATAA 4Y2OB 2A83B 3MV8E 2YD0A 3GIVB 3HHMA 2Y2WA 5IW3A 1NEPA 3S3PA 2NRDA 3SO5A 3ARDA 4GMSL 1I9RH 1L7IH 2Z6FA 2XN9E 3V0VB 5AB2A 4PGCA 2DI9A 5CWSB 4HUUB 4HUVA 4G59C 3S3CB 1HZHH 1KTDB 5DWUH 2A77H 1E27A 2FNBA 4NN5B 5K39B 1ZSDB 4YHNA 3RFZB 3ZMNA 4O2EB 2H3NB 4NT6A 1PL3A 2AAAA 3SGKC 5EEUA 3FCSA 3NK4A 2DL2A 5DUPH 2B0SL 1NKGA 4JUSA 4P5SA 1S3RA 3KHOA 1P84J 2VW7A 2W95A 2AQNA 2IALB 3QAZB 5E2UH 4EI6B 3VFOA 3VX1A 2V5YA 2YSSA 3VSUA 4L0YA 2V9TA 4YHZH 4TVUA 3MLRH 4LESA 2BNRE 4NPYA 1UZ6F 2EE6A 3AC0A 4QY8B 3CQFA 5DJZB 1E40A 4J6RL 4YBLC 4ILDA 3LAFA 5IQOA 1M7UA 4MAUH 4MMZB 4NQCE 4S1RL 3PREA 3VMPA 4OU3A 3MA7B 4B41A 1QA9A 5F1NA 3SIKA 2CBTA 3KH4A 3DJTA 1LO5B 2D3LA 2J5LC 2AI0L 1S9YB 4IMLA 2A73B 4J4PC 1BFOB 1H15A 3OGCA 1UKSA 4KK6D 3MOAL 5EIIG 2H2PC 1NMBL 3MRIB 2NXYC 2APXA 1IFGA 1OZUA 1TVBB 1VGKA 4NRZA 3EFDL 3MV8A 5DEFA 4XMLL 5FUZH 3LS4H 2AKRA 3S2CA 5BO1L 4P5TB 2H6UA 1A65A 4PJAF 5DA4A 3P4OB 3U46A 1GGBL 1JK9B 1XR9B 3IJSB 3SPVA 1A1MA 2WWMC 3PU7A 1Y07A 1QSFD 1VF5C 3PWNA 3HI6L 1AGFB 1KGCD 4G8IA 5C97A 5J6SA 2FLMA 5C0BB 4HULB 2Y2TA 4JUTA 1C8QA 3ILDA 4BE5A 2D31B 3HRPA 4JRYB 4LBEB 1DBJL 4ZZFA 5I1JH 3SGDI 3QORC 3V10A 1W9XA 2XG5A 3OF6A 2R4SL 1WBYA 5E1IA 1GZPB 2B8OT 4WKZB 4OLEA 4EBQH 3MV7B 3PFUA 1PPIA 4XB3A 5J9PA 2LFEA 5D2LF 5E95B 1KYOK 2LLNA 4YWGH 5ETUA 5IBLC 3FRUA 4Z95H 3SBQA 3U4KA 1DBMH 2EVJA 4U1MB 2NLJB 5E4EC 2W8CA 3NH7L 3HG4A 4WKXA 4L1BA 4WNJA 1WWBX 4D9QE 3CSYA 3VXTA 1UTDA 3T4AC 4IGBD 4JFOB 4UT7H 1D9KD 3LZFL 4RBPK 4MMXC 1A3ZA 1GZHA 3DVNA 3KR3H 1CBVL 3D4CA 4FYRA 1X6LA 4OQ1A 3E0GA 3MLUH 4NN6B 2X9YA 3ILEA 5HGBB 1AHWB 1KJVB 2CQVA 3ROOA 5I0VA 1F4HA 3CMOL 1PMYA 4WI0B 1NCNA 5BZWB 5KOMC 3WFBL 5HHOB 5E6SB 2Y7SA 3F7YA 3MMEA 5DTFB 1UGKA 3M86A 1S7VB 2OYPA 5I30H 4PJ6A 5FYKD 3BWUC 4RMUA 5F0JB 4ZFGH 5CUSH 1I7UA 1KT2B 2HLFC 3TA4D 5JPNC 2MQ3A 4FKKA 4QUOA 5GGQL 3S5LG 2EE3A 1F42A 4JRLA 4UV4L 4ZX6A 5LGHL 1BIHA 3OZLA 2AK1L 1ERNA 4KK5C 1J48A 4Q6IA 4XO3A 4ZPTA 1AFVL 4Q89A 1A1NA 3MLVL 3GBLA 1G84A 1TVHA 1U0QA 3U4AA 3TN0B 1I1YA 3GS0A 4UT7L 2K45A 4NQDD 3GJEB 1CLYL 4PJAE 4R7NA 2P7TA 1RZFH 2R9HD 1WC7A 5B39G 5JW4Q 4A7GA 1U95B 3HMXL 2X2HA 3PGFH 3EYSH 3ZE2E 4ES8A 2VDLL 4MDRA 3P77B 5FA3B 1P1ZA 3MRFA 3RZWA 1CL7L 3N42B 3U25A 3O9WA 5AW9B 4AIZA 3GSXB 4ZFGL 1JP5A 4NOFA 3S4SB 4IRSA 4NO2B 3UPCA 3GFUA 2FIKA 1C12A 3CDFA 1B0WA 5DK3A 3X1EA 4L9LC 3BUIA 1FZMA 4KGLA 7FABL 1JHTB 1MCNA 1DQDH 2FT7A 4BKTC 5FUCC 3S34H 2YEZA 3T0WA 1J7VR 1CUOA 1W8EA 3MR9A 1E5YA 4UAHA 1QFUL 2W1NA 1XB3A 4HEME 3G5VB 4HKZB 1CDYA 1I8KA 3F12A 1XXDC 1U33A 2J8UF 5CIPH 3MO1A 5F0MB 1MVFA 5I23A 2FCBA 4PRIE 4QOKA 1P7QD 5IJKC 1OAYH 3KPPB 4JPVH 3RP1A 2LU3A 3EOTH 3KEDA 3VFWB 3AXLA 5KVDE 5J3HC 4KMQA 3D4ZA 1FF5A 1LO4H 4PBXA 3H3PH 1X6NA 3AG1B 1BZEA 3FQ1A 3FPXA 4X0NA 1WS8A 4FQHA 1JFHA 3BESR 3OPZL 2CLRA 4R96B 3S48A 4KZEL 3ETSA 2WKLA 1Q9KA 4DZBA 1ORQA 1MJ8H 2APTA 2UYLB 4IMKA 3GUTA 2P8PA 4U1JA 2VLLA 3ES6B 3C5JA 2WMPB 5K9QI 1PF3A 1T6WA 2MSPA 1A4KA 1S7RB 4JQIA 43C9A 5EWIL 4ZXBB 1I8LC 3H9HB 2AJSL 2FWOA 3MLZL 3QZBA 4G6FB 5JW5B 4IDJL 3V4UH 2Q7YA 5H4ZA 4HQQH 5KVGH 1TTBA 2XACC 4WFED 2WUCH 1AHMA 2DI8A 3QIUB 1IIKA 1FZKB 1T5WB 5DXWA 5E8NB 1RUML 1SXCA 1KXVA 3BDYL 2CSPA 5I1IH 4KUZL 1DVYA 1XCQA 4OAWA 4HJGA 3CSGA 4MQSB 5AW5B 1YEDA 2VXQA 4TUUA 2AXJA 4BRJA 4RAVB 3VE0B 2YPLB 3QC5X 4XWGH 3ZOAA 5F0LB 2WB1A 5IM7B 3VXUD 3OKMB 2B2XL 1OB0A 1U2CA 3LD8C 4MA3B 1EAPB 4MB3A 4QKXB 1OCZB 3B9KD 1FDLH 3X12A 3K6SA 5AW7B 3INOA 3GMNB 4XBMA 3RVVC 1DSFL 4MQXC 2E56A 3RUGE 3L4VA 4RAHA 3VD4A 1I9RL 3DTDA 1S9KC 1CDUA 3TBWB 4H20H 1MEXL 4MDJB 1OGTB 2G75B 4Y89A 3WFEL 1AJ7L 5CFAA 3OR7B 2WO3B 1SXAA 4Q2ZA 2WM0A 2YN5A 3EYUL 2GIMA 1RFDL 5C0DA 4AH2A 2PN5A 4R4NC 4BK5C 5HVHC 1NZRA 3F3HA 1OP4A 1RJYA 2ODIA 1ODAA 5E51A 1V3LA 3QUZB 4FQCL 4IIQB 4XMKH 5D6CA 4A7VA 2CUHA 2GJPA 3LD8B 1EHLL 3L4XA 3PHQB 1BMZA 4QTHA 1MJJA 4X6CA 5D1XE 3VCLB 4PG9A 3GSQB 2XWZA 3OMIB 3VI3B 1NLDL 4GFTB 3TU6A 4C56A 4RX4D 2EILB 1JPSH 1TPXB 2J5LB 4X9IA 4ZUSB 1L0XA 3DUSB 2X4QA 3HB3B 4DEPB 3BPCA 4AMWA 1R6VA 2UXVA 4QRFA 1UJ3C 5CN3A 4JQXC 4FLHA 3IYLW 5IROD 2HFEA 5SWSE 4JHWL 4R90H 3FO9B 2F0CA 3KJ4B 1P53A 4MD0A 4H8WH 1DLHA 2DMGA 4OD3H 5TK2A 5FYLL 4BELD 4G5ZH 1R33A 1CQYA 2QFRA 4XCYA 2JVUA 1GAFH 2F5BL 1RHFA 3W0WE 2W80C 5C0NC 3OSKA 1LEKB 4Y4KD 4RLDA 4K3EL 4JJ5A 4OKVB 5T1MA 4HWEH 5J4MA 1N0XH 3Q9PA 2YD5A 3X13B 4TSAH 4OGQC 4DCQB 4G8GD 3WEXB 2GTQA 3D39E 3FKUS 3LQZB 1QVOB 1EO7A 2H2SD 4JGJA 1EXHA 4HZLA 3UYPA 1JPTL 3EJPA 5DVKA 1EZVX 1CXHA 3T71A 3ZRFC 1IC5H 4PJCE 5DMGC 5JW4N 3FU9A 4Z5RB 3VNYA 2QDVA 3DV6B 3HLAB 2F19H 3IETB 4KMLB 5EOCL 1A14H 5ESAA 4X7SH 1FPTL 3A6BH 2Y2YA 3P69A 4UQEA 1I1AC 1WAEA 1JPGB 1FN4B 2XYCA 5GRXG 4HUCA 1YEJL 3NIDB 4EI5D 2AK4E 4DTGH 5KSUB 3QQDA 4U3XA 3FB5B 5I73B 3VMOA 5HDBF 5T1KA 2BVEA 1KCSH 1IJ9A 1AC6A 1FNHA 1M9WA 2VM4A 3MRPB 1R3HA 4HCGA 4PJXE 4BHUA 3ULVD 5DD0H 2ZCLL 4WGVB 2VR7A 4OI7A 2V2XB 3F00A 1OAQH 2XA3A 2EDTA 4TSAL 3ZDWA 4QHLA 2V2WB 4LIQE 2PPCA 1MFVA 4F58L 4OCYH 4PY8J 4JO1L 2NX5A 3V4PB 1G87A 2XTJE 1KLUA 1ZLVH 3RKDD 1RK1A 2QPSA 4L4JA 2OL3B 4PS8A 2I5YL 3BISA 3EG9B 2OZ4L 2ZKHH 2ZOLA 4F37F 4F8QA 3W9EB 4GSDL 4OUOA 3QG7L 1WEJH 2VQ4A 5TE4L 3NSXA 1SDDB 4GPVA 3NJHA 4LDLB 3WIFA 4FG2A 1IILE 1QR4A 4W9FC 4FABL 1M1XA 7CGTA 3VFRA 1SMDA 2YN3A 1AP2A 1IB5A 5JIHA 4BBWA 3AB0B 4YHIB 1NCWH 2GC7C 2OSYA 1AGDB 2Z7UA 5IBUG 2G3MA 1J8KA 3QUKA 4KKCD 5T5NF 2A74C 1Z7JA 3LXBA 5DYOA 3TJPA 4F7MB 3FZUD 4FL4B 1OK8A 4FHBD 1T83C 1U8IB 3FUIA 3JT2A 4I85A 3VYOA 4RSVA 5C08A 4PJ5D 1GYVA 2UXFA 4M1CC 4KZCA 4JQVA 3AQXA 1DQJA 3MNVA 4FTVB 3FT3B 3GD1C 2F54D 1IGCH 3BO8B 5DMIL 5LJYH 3JV0A 4Y4KA 5EMYA 1D5IL 2FUTA 2OMVA 1BD2E 3GSOB 4FAAB 4LOUD 4DAGH 5BV7H 3ATEA 3GI9L 4UQIM 4LPVA 3VRLF 3QG7H 3O3BB 3MV9D 1R3IH 3QORA 2GSIB 5TK4A 1G4RA 2ICWI 4L4TD 3VXSE 4IBSA 3BSZH 5B1BB 5BVJA 3PJLA 4JGMA 3N6YA 4LU5H 1QG3A 3OC8A 3KPSE 1HHJA 3TNNB 2O5YL 1SMOA 5JTWA 4WI3A 3VTTA 1QSEB 1AJ7H 3V9EA 3C08L 4LRNL 3OR6B 4D3CH 3RYMA 1Q1JL 3UJTL 1MI5D 2TSAA 5HGHB 3HKZA 4DSYA 1SBSH 3KLAA 3QRLA 4KO5A 3EXLA 4NBYB 4OLVL 3T2LA 3VH8G 4UQ3A 5C0IB 3OMZA 4LHQB 2VMCA 3GI9H 3HNTL 1R24A 4RIRB 5E8OB 3L3JB 1GZQB 3IPEA 4PJXF 3TT1H 3EF7A 2ZPKL 3WEOA 3KZ8A 2N3JA 3KEHA 3BD5A 3BCFA 3GK8L 5J57B 1NC4D 3OJVC 1QPXA 5B8CC 4BINA 3GJFA 4MZ3A 3NFPA 4ZX3A 3HOGA 5IB4B 4ADJA 3H7LA 2SODB 4WEUD 2VM3A 5IK3A 4XVTL 3QUXC 3GUFA 3JYBA 1MRCL 4PIBA 3ABZA 4O2CB 1BAGA 3SE3A 1F4WL 1BFSA 4BM7A 4DZ8B 5L7XH 5MENE 3IMBA 4A7UA 1JDAA 3NCWA 4QRRD 2PPEA 1XF5B 4LPXA 1NCAH 2VQTA 2Z3FA 4JQIH 4RGOL 3TBCA 5FM8A 3IJEB 4NHCL 4PJ9D 1AXSA 2VSKB 1EDHA 2W38A 2WOBA 3RI5F 1UXSA 4DO5A 1CURA 5J5EA 1BD2B 3CFKA 2K3HA 4IS6B 3TURA 5I82A 5SWSD 5FYKL 4NPKA 2C8NA 1TTRA 3QIBB 3ZKNC 3CLWA 4CSZA 3L3IA 1E4KC 1NCCH 3ULUL 4POUB 5D1XD 4HIEA 5F9OH 3G5ZB 3WE6A 2X4OA 3IN0A 2YWZA 4AJVA 2BC4B 5EUOA 4AQZA 4UQDA 1OTTC 4QRUB 2R39A 1X7QB 4Z7VB 4U2YA 1S8DA 2PO6C 1MLBA 4F3FA 3RVTC 5AW4B 1Q72H 4BYHA 3HZKB 3C60B 3RPBA 2H1LM 2XWDA 2DD8L 3FB8A 1UXMA 4O02H 3HJ0A 3QUZD 1MZYA 5IUCA 4NBZB 1UENA 3F7KA 5DFVD 2HKAA 4FHJA 1G7PB 1FFQA 4Z7QB 4OZ4A 1YCSA 2R69A 3D39A 3WY4A 4N8UA 4OM0L 1VSCA 1FH2A 3PDGA 4KTGA 3ROLB 3JXAA 5JPMA 4KK8D 4Y16D 4N2LA 2VWEC 5BRZA 1KEMH 2IH3A 1JNLH 5HTSA 5DHVA 1QWHA 1AO7B 1ECYA 2K6ZA 4JL2A 3N0AA 3FT1A 4G6AC 4LPTA 4EVNB 4JFPB 4HOWA 1MAJA 3KBEA 3M8OH 3LEVH 1IBFA 3P9LB 2AEWA 2YMOA 3VWJB 1PEWA 3ABGA 4GI8A 3HZVB 3NCXA 1CR9H 1UA6H 2V5MA 4NXKA 4OLUH 3QG6A 5TQ2L 1JXJA 5D2LB 5CM1A 2IANB 5CJ5A 1UFUA 3N06B 2P1YA 1FBIL 3AZUA 1X7SA 2VL4A 5L88H 3VXUB 3FUNA 4M8RA 5C0AD 2CR3A 5DJAB 3TP4A 4RESB 4TVPD 3HS0C 5F7WC 5TE6L 3O41B 3WI9A 3QGVA 4ETQB 4A6YH 1ADWA 1D5MB 2IXQA 3BWUF 4AGLA 1T89A 1MCWW 3RUGB 5GS0H 2B15A 3HC0B 2QLVB 1GY1A 3VXPA 5E4EB 1GJUA 2QHRH 4E36A 2R2BB 3FQTA 1RPKA 4U05A 1KJMB 1U3NA 2H9GB 4QDGA 3WGUB 3P2DA 4OLWH 2EDOA 4JHVA 5F7UA 2ZQKA 4UV7L 5JHLL 1RK0A 3SDYH 5B38B 2H6PA 3ZDZE 2LAAA 2BRRH 3CBRA 1AH1A 4LLMA 4U1IA 3T6VA 3QR0A 4N8PA 3X1BA 2CPUA 2WP3T 4Z7NF 2RA1A 2WQ8A 2X6BA 4HFUL 4QD2E 2F15A 3L8QA 3AAZB 1CQKA 1I7ZA 2W65A 4MNQA 5TE7H 4S0TD 4LCCB 2J4WL 1ASOA 2GBTA 4ONHB 1IEAB 3I3BA 4Q0XL 4YAQA 4Q9RH 2PXYD 2Y7QA 4JHUA 2GT9A 3BZDA 4WV1B 1RUKH 3MACL 2XZQL 5DUPL 4K3DH 3VGFA 2P44B 1KCLA 4I1RA 1TYRA 2XSKA 3IMUA 4HFWA 4WU5B 2DN7A 2VL5A 4LLAA 4PGBB 5GIRA 3VACA 3PJNA 3ARFD 3LDBC 1V7MH 4LVOC 4ZAKB 2JMRA 2WGNB 2F53E 1GKOA 4JDEA 5I71B 3G6JE 4HWBL 4L4TE 2V8MA 4POZD 5DRXB 4AKQA 5IJVA 2XPGB 1QQDB 1T04B 2B3RA 2GW5A 1AE6H 2YAEA 3Q13A 4PJBF 1PZ5B 4F7PB 5ICYB 2C3GA 5DJ2B 2Z8WC 1ITBB 4ZT1A 5EBLB 4MJIE 1MREH 2JE8A 5C0EB 4B50A 2OPCA 5IMKB 5E94B 2LE9A 4XHJD 2HVKA 1CBJA 2DY2A 1RZFL 3OAYH 4PS4H 5E24E 2D7QA 4XC3L 1RVFL 3J7HA 1URLA 3PWPA 5L6YL 1IMHC 4TSBH 3BZFB 2BW5A 3TN0D 2P8LA 4YSUA 1XGUB 3S6CA 4A63A 4CJ0A 1IM9B 1F0LA 2AEOA 4JG5A 1KDJA 4CMHB 2HWZL 3WHXA 3W11C 4AC2A 4ZMTA 1L6XA 2V7HA 1CYWA 2FD6L 2ZKXA 4S1QH 3K7UA 3POHA 4K3JL 2E5EA 3WUWA 1M05A 1VEOA 3NFNA 5F89B 3X14B 4JPKL 4LGRB 4PRPA 2ZP9A 5IBUB 3UZEA 4GKSB 1JZ6A 2KDYA 1TTGA 1QI3A 2Z4TA 4XPGH 3NGBB 5MEOB 4NEHB 3D0LA 2X1PA 5E9DD 2CBOA 4DH2A 2DICA 1TFPA 2NR6A 1N7MH 1KENL 1M3JA 4FGMA 4A68A 1OK0A 4E9LA 4LLQB 4OCMC 3M17A 3PAYA 4PRPE 5FDYA 4XP4L 3CXDL 2NW2A 3AU1A 3ULSB 4ISVA 3LS5L 1H3GA 3V6FB 4YHYB 4AZ8B 2UWEE 1EJOH 2FO4A 2GCYB 3CC5B 2IEPA 4HOXA 2NDFA 3LTVA 2BJMH 3HJEA 4AE0A 3DSFL 4IRSD 3BQUC 4P23B 4H1LG 4L9LA 2XWXA 3EKCA 2WTRB 5LG1A 3X1NA 1NCDH 2MIZA 1J9SA 5D7JB 4JB9L 4AL8H 1KC5L 2WANA 3LMJL 2LU4A 4UTAA 4OZIF 3B9KB 3BKMH 4RGND 3BVVA 5EZJB 5IW6B 4HSAC 4YBQC 3KDMA 4LT7A 4GUPB 4K94H 2ICEB 1FV1B 4XHQA 4TRPH 3V5HB 1NIBA 5TQ0H 3ZRCC 1XZ0A 1KIRB 2CRIA 3HUJA 2NYYD 2GQHA 4MFHA 2FT8A 1GS8A 3QCVH 4XN1A 4B9JA 1TCRB 2AC0A 2Z92B 5A2CA 2RGSA 4JZNB 5GZND 4QRTB 3W9DA 1ODUA 3L9RA 1FRGH 2WKOF 5LUMA 1UQSA 3KPTA 4K94C 2PP7A 3ZJAA 3AT9A 5LNGA 2BVOA 2V5RA 3FU7B 5FOJA 1UM4H 3QUMB 3WNIA 4DP4X 1AMXA 2NY1D 3MTXA 1XF3B 2AMUA 2IPUG 5CR8A 5KG9B 3DA0A 4YHKL 4AV0A 1O7SA 5DZJA 1DVFC 2CH8A 2J73A 4JRYE 1NGWA 3WO4B 5KVDL 5J06A 1DZBA 1GL4B 5I9QB 2NT0A 4BD4A 1SLXA 3ARED 4PJ5A 5G5DB 4NO0A 1KXVC 4N2KA 1DN0B 2LLGA 5JXAH 2B77A 4JJOA 2GSGA 4O51A 3KMDA 1CFQA 1E8ZA 1S7XA 2VXUL 5IW1A 3IS1X 3BRFA 1ACZA 4KROC 2VR4A 5I0YA 1LNUB 4JQIL 1G7QB 1HTYA 4B7LA 4CNIA 1BP3B 2YJLA 4YHOH 4AQ1B 1TTAA 2IANE 3T0EE 4D9RE 4G82A 5K9KA 4JANA 2YMXL 2BHYA 3T6ZA 3QW9A 2KZ1B 3BEWB 4QXTB 3ARWA 5IJKA 2NY3D 4Y5YA 3WAJA 4N2IA 3MRNB 2OTPA 3DX9B 1MWOA 1JNNH 4XP5H 2A4CA 2K4AA 3ZDYE 3V6OA 1BFTA 1P2CA 3LRHA 1F1AA 1WFTA 1JE6A 3QUYB 2D2OA 1A8JH 4N2EA 3VWJC 1JV2B 3SDXE 1CD8A 3O81A 2VN7A 2VDKB 2ZAIA 5TTRA 2I07A 1PGRB 2WZ0A 3E1F1 1U21A 3L4ZA 4J3OD 1OGSA 5FFLA 4NZUL 3BDBA 3IB4A 4XBEL 4DGVL 1UOVA 5GGTL 2BCKB 2HKFL 2X87A 4KXBA 1ANUA 1FL5A 1E6OH 5ENWA 5DJYB 3ARPA 1E65A 2VDLB 5J6HA 3C9NA 3TIDA 3OXSA 1ZS8A 2DMBA 3H54A 2FHFA 1BX2A 4LCWA 2FEDC 4QRPA 1FFPA 4NZFA 4LL1A 4CVWA 1OW0A 4N26A 4PJIA 3HG2A 4OF5A 4JY5L 2E86A 3QAQA 1L0PA 4FF9A 5DJDB 2DWXA 3WMPA 2X2JA 4YR6A 3MNWA 4EKXA 4G7QB 4ONFH 4KQ0A 1TJIL 5DD1H 3S5LB 4Z6AT 4FKHA 4X6CF 3R06B 3MLXH 1JNHA 3MRMA 2ICWA 4Y5VA 2ZG3A 2Q20A 3QO1B 3S8WA 5I73C 1MCOL 4FFWD 1UA6L 5TQ2H 4Y4HC 3M6DA 2RJMA 4QR7A 1NBCA 3CIQA 1SQMA 2WZAA 1ZA6B 1BVNT 1HINL 2JCCA 4QTFA 4RA0C 1IM3B 5L8LB 1L9TA 2VISA 4F58H 2M2DA 3MLRL 3CDGA 4IBQA 3G6DL 2WLYA 4KKPA 4I3GA 5EUOE 2WXQA 5EPMA 4UU9B 1O6SB 3BUYB 2XX0A 4JPIB 3V5DB 5I0XA 4RGNB 5KBPA 3QZLA 2QKSA 4DKFH 4A2LA 4ODWA 5I6KA 1VPOL 1PD0A 3ZKXB 5IVXA 4FCAA 1NGXB 4XMUA 2ZCKL 3OL2A 2E8YA 1GCFA 1U8CA 4JKPL 3C2AL 4HG4K 2MOQA 2GTWA 4CU7A 5K33A 4IK6A 5AZUA 4KO9A 1H5BB 4X80H 4XMPH 3EHBB 3MROB 4YDIH 1IFRA 3WG7B 3DO7B 4MAZA 2PWFA 3F7VA 5MENA 4NM4L 4LEXH 1Q9OB 2L8AA 2C9RA 3RG1C 4LCIH 2V2TA 5H94A 1OSYA 3C87A 1D3CA 3SQRA 4PQXA 4OW6A 2VXTH 3R0MA 3MBWB 3EAKA 5DC9B 3BMVA 4DGIL 4GG8B 4P3DB 3BLPX 3X3GL 4NNPH 5EZOL 1J1PL 5I28A 4YEEA 3MYJB 3Q1SH 3HVDA 2YGOA 2Z4QA 2V17L 4PN6A 4Y16A 3T4YA 3L3DB 3S9DB 2Z93B 4Z7OF 1XF4B 1QNZH 1YY8B 3B3BA 4L23A 5HJ3B 3QISA 3WFHB 1QRKA 1U2HA 4AWJC 1CIDA 5D93B 1D7DA 2GG1A 1JPFA 2B1OA 3RWEA 1SXZA 3Q6GL 2YD7A 3NCEB 4PM1A 1LMKA 3IFLL 3FXIC 1KTKE 1KXHA 5CKAA 1RZQA 4CU6A 2DIEA 5FM5M 3GMLA 5MEQA 1PAMA 2IBZX 4N9GA 4N25A 5LN8A 1TNMA 1TQTA 5L9DL 3D69A 4L5FL 4JG0H 3T0EC 1GHFH 3UYRH 5FHAL 1MCDA 1SBSL 4PMEA 1HOCB 2DWDB 1SDAB 2QQKH 5F7BA 8FABA 4FTVE 4Y4FD 4JO8A 1F45A 5DDHA 4GBXA 3KPSA 4GAAA 1T0NB 1ETZB 2CJ3A 4BFIA 3HC2A 4N20A 3WHE1 1CFSA 1BXVA 3S88L 1GYCA 1XAUA 3WIAA 4QF1B 4M6NH 1T0MB 1NSNL 1AIFA 1L7TL 5AG9A 3PRZA 4MCZB 4Z7WB 5INDB 4RH4A 3WCYA 1JGLL 4Z77B 3QA3A 1E0OB 3DJSA 4HH9A 3AY4A 2DWEB 2AXGA 4NN6C 4NQVA 5J56B 3DX7A 1QLRA 1BZOA 1S5HA 1WZMA 5CJQL 2FAUA 4PMFA 5EU4A 3VGAC 1VZHA 3V52H 4UOJA 3BGAA 5AB0A 3QFJD 3SE4A 1UKTA 4AYEC 4QHPA 2ATPB 1KCUH 4IU3A 5FGRA 5L9DH 5BMFH 3LRGA 2WVVB 1U91A 5D1ZA 4XVJH 5CBEA 3WTVA 3DJ9A 1DE4B 4ERSH 3CZNA 1VA9A 2Z35B 5I15L 4AUUA 2V3FA 1BQLL 1N4XL 1H0DA 1TEFA 3SHSA 5HPOA 3VRIA 5E99L 1K4CA 3LSOB 1OB1B 4PRID 5BCAA 3BRGC 3PGCA 1E9PB 3MRRB 3HPLA 2EO9A 2WXFA 1UCBL 2ZCLH 3GRBA 4XXCC 4LOEA 3OAWA 4R0LC 4H88H 4MLIA 3QZWA 2P4AB 1A3QA 4QO1A 3TWCL 4Q9QH 4WW1A 4HIHB 3C6EA 5CKGA 1IZJA 1IGJB 3V8OA 1ZKAA 2BS71 3E3QE 2GC4C 3D6GA 3UZQA 1QUNB 1KCWA 4PS7A 1T2QL 3WO4C 5ERWA 3TH4T 4XXDA 4GBXC 3NJXA 4F9PC 4P4KB 4UM8B 4GSDH 5SWZD 2WYIA 1NSNH 3JVGA 4Z7QF 5HYJE 4J1UB 1JZ8A 4MB4A 2IQ9H 4DQOL 4RMBA 3PL6D 2X9ZA 1NC4A 1A4JB 1HIML 3HN8A 4N85A 4HGMA 1QATA 2CRYA 2DLGA 1QX1A 2ZUQC 4XMWA 5FV1L 4OZGF 5E2WL 3HNVL 3TO4A 5I74B 2WXIA 6PCYA 1HDMA 4JAMB 2LVCA 1BIIB 4Q7DA 5F7DB 1D5BB 1M7DB 3BW9B 2DYSB 4LIQH 1NCBH 2I60H 3KYOB 3GC3A 3N43F 3UTZA 3STZA 1JVKA 3IKCA 2OMYB 4LQ1A 1I3UA 3B5GA 4UOQA 1SHSA 4LE8A 2E7MA 3IXTA 7PCYA 2BVTA 4AMKH 4PJGA 3WGVB 4XTRC 1HHHA 1TLMA 1FJ1A 2ADIB 1V7NL 1FZJB 1BYOA 3SDCD 2BIIA 3EBAA 3HE7C 2KC0A 2CO1A 4QWWC 3C75A 3MCKA 3RU8L 4F33B 1OE3A 2ZOKB 2JK5A 2W91A 5CZXD 2X4NB 4AENB 5BXFB 3L1OH 1SM3L 3UTTA 5HYFA 4JM2B 1J8HE 1TJXA 3O3AB 2CDFB 1YNTA 2ED7A 5FOBA 3VWKC 3D4YA 2YUVA 3VJ6B 1U8HA 4IKJA 5EOCH 3L4UA 2O26U 4ZUVA 1QBML 4AK1A 1FH5H 2YKKA 1A6AA 3L5IA 5C09E 2BERA 2Y07H 3NSDA 3VXQB 4E68A 3ESMA 4L18A 5AVUB 4ZMNA 5DC4B 5SWSA 2I85A 1BA9A 3GSWB 4JKMA 4TQEH 5DQ9A 2H26B 3L5WA 3SGKA 1QO3B 3EGSB 5DA0B 1UJTA 4PSRA 3WAKA 5ITBH 1Q9WB 1U8JB 1IAOB 1B4LA 1QHQA 1W0WB 2DYPB 4R5TA 3SPCA 4C4BA 4Y9CA 1AY1L 3I2CH 3P4LA 5HJBA 1H6UA 1LM8V 4JFWA 1YO4A 3D30A 4LCCC 1YHPA 1QW8A 1IL1B 2H6OA 2KYIA 2OULB 5AVQB 5BZZA 2F7QA 4NQQA 5LN4A 4WFEE 2WWNA 2J72A 1CD9B 3CVHH 4L3ED 2GEQA 3HC3H 1ULVA 4OCWL 1XIWA 1UT1A 2HN7A 3CG8A 2JKLA 3SCMA 3JWNH 1B4JH 3NABL 1WPCA 3HMWL 5TQ0L 1AGBA 3V4VB 3CLEL 4BK8A 4ODUB 1OWWA 1T89C 4Q9RL 4OSUH 2R51A 3WBDA 1N8ZB 2IOMA 5ACLA 5A43C 2N7AA 5FO8A 1JXGA 3P3SA 1KYDA 4XPTL 4NZRH 3V6BR 1H5BC 3V6ZB 1U8NB 3CN3A 4G11A 2DQDL 1DJZA 2NYZA 1J5IA 1HSBA 3WNKA 3SE9H 2BSRA 4YDMA 1VFBB 1WZ1H 2JKIS 5ILTL 3MJ9L 2D7PA 3KW7A 5FYLH 5HHNB 4F80A 5EC1B 1U93B 4FQLL 2F54E 1L9OA 2E7LC 5IOPB 4OCSH 3UZVA 4PJEF 5BS0B 4Z0XA 1E5CA 1JWMB 5TFSH 5D1QC 4FFYH 3GRWA 1CG9A 4NC2B 5FHBH 1LO2H 1UM5L 1CXKA 1DEDA 5DRWB 4EPSA 3MRLA 3F7LA 4N9OB 3G3LA 5C0AB 5EU7E 2ZUTA 4AVKA 4AG4L 5JHMA 3PUUA 2BOCB 2QSCH 4MAYC 4QOKD 1NKRA 2TRYA 2LR4A 4ZUTB 4UOZA 1P6FA 1RJZA 4GRWF 3MTRA 3HG1D 4J27A 2E9GA 1I7RB 3GSRA 1U92A 4N0UB 3V4UL 1A21A 3MA9L 3MV7E 2DQDH 2ROYA 3DIFB 4G43B 4IU2B 4L8DA 4PV9B 5BOPA 1IEHA 2ITCB 2F8IA 4D0CA 4MZ2A 1LK2B 2X89A 2MPAL 5DJ0A 3B5HA 2KQMA 5FA4A 2K7QA 4HX1B 5FO9A 3CV5A 4JFFB 1GS7A 2BZDA 2PW1A 3E6HB 4X7FC 5E2TH 2WQAA 1QASA 5AVRB 1H6FA 1EEUA 3QJHB 1NAMB 2R1WA 4M56A 3MRHA 1NUNB 4YHZL 4HEMA 4GG6F 2QJDA 5E2VL 1EFXD 1HAUA 4I2XE 2DQEH 2FT6A 2X09A 3ULUF 3CXDH 4X7EC 2WW8A 4YL4A 3TNMA 2F61A 3L17A 4AM0Q 2F53D 3OKDB 5L4MA 1IQWL 2DM4A 3MZTA 5I1CL 1CTNA 1FNSL 2AJYL 2JFCA 3QDGA 1RUPL 1MI5A 3A22A 4HIJA