4A7SA

Structure of human i113t sod1 mutant complexed with 5-fluorouridine in the p21 space group
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 41
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7sA00
3KH3A 1P1VA 2GBTA 1EJ8A 4U4IA 1E9PA 2Z7UA 2AQQA 2WKOF 1MFMA 4OJAA 3K91A 4MCMA 1SXBA 1E9QA 1N18A 1CB4A 1N19A 2GBVA 3GZPA 1SXCA 4OH2A 4A7UA 1TO4A 1SPDA 2AQPA 3GTTA 3MKGA 3RE0A 3GZQA 1IBDA 2XJKA 3GQFA 2AQRA 3SODB 1JK9A 1Z9PA 2WYZA 1E9OB 1UXMA 2AQNA 1EQWA 1PTZA 2AQSA 1SRDA 4L05A 3KM1A 2C9SA 1IB5A 1COBA 2JLPA 2LU5A 3CQPA 3ECWA 1BA9A 2E46A 3QQDB 1B4LA 3ECUA 3H2QA 3L9YA 1B4TA 1CBJA 1SXNA 2K4WA 1SXZA 1OAJA 1PU0A 5CU9A 1F18A 4BCZA 3T5WA 2Z7WA 4MCNA 1DO5A 4BCYA 1E9PB 3CE1A 1SXSA 1HL5A 1E9QB 2NNXA 4A7GF 2WZ5A 1KMGA 3KBFA 1ESOA 1F1DA 1JCVA 3HFFA 1OALA 1SOSA 3ECVA 1YAIA 2WKOA 1PZSA 1F1GA 1UXLA 3MNDA 3KBEA 5KBLA 3GTVA 2ZOWA 2GBUA 2ZKYA 1JK9B 3F7LA 4A7SA 4BD4A 1IBBA 2E47A 1OEZW 2VR6A 1XSOA 2WWNA 4N3TA 1AZVA 3KM2A 2XJLA 3PU7A 1QUPA 1SDYA 1RK7A 2AQTA 3CQQA 2APSA 1TO5A 1FUNA 2WZ6A 4FF9A 3S0PA 1F1AA 1IBFA 3GZOA 1U3NA 2AEOA 2VR8A 4B3EA 2Q2LA 2R27A 3H2PA 1SDAB 1L3NA 4A7VA 2C9VA 2WWOA 5KBMA 3LTVA 3KH4A 2SODB 1Z9NA 3L9EA 1YSOA 1E9OA 3HW7A 4A7GA 1OZUA 4N3UA 4A7TA 2VR7A 2WYTA 1Q0EA 2JCWA 1S4IA 3HOGA 2Z7YA 1IBHA 1HL4A 1BZOA 2C9UA 1SXAA 5KBKA 2Z7ZA 2V0AA 3QQDA 1XTLA 1YAZA 2ZKXA 2WZ0A 3F7KA 1DSWA 2AF2A 2ZKWA 4A7QA 1OZTG 1XTMA
chains in the Genus database with same CATH superfamily
2R9HD 1YECL 2CBTA 4TSAH 3HJ0A 5IVXB 3COOA 5JLZA 1GW6A 2W0LA 5E6ID 2ZSWA 1DBMH 5G4OA 1TVBA 2WAQA 1XIWC 1QWUA 2AV7A 4X4ME 4DESA 5JXED 2VT0A 3A23A 3DJZA 4HALA 2P49B 4TQEH 3ARFC 3LMJL 4KFMA 5IIEB 4JPWL 2ADIA 5ADOL 3ZIYA 3VXTA 1SDDB 5T3XH 3C5ZA 4K5PA 2DN7A 4GKSB 1I8LA 1LEIB 3NEXA 2N7AA 4Y19A 5C0JA 4PG2C 1NMBL 3TIEA 1T04B 4XRCA 5ACZA 4HT1L 5IQNA 1CICA 4GG6F 2IPTL 3GBMH 1A7PL 4MAUH 5I15H 5J89A 1A7BA 1S9VB 2A0LD 3LXUX 4KKNA 4B41A 3V2AR 2RAMA 5KSVA 2DQHH 1I7RA 1FL3B 5SWQB 3N1GC 4P2QE 1U0QA 5I1JH 3FO2A 1F8TL 2EDWA 2XN2A 3FH5A 3DK2A 3V4PH 5AZEL 4YHKL 5I66B 5LNDA 3FAXA 1A6UH 3OMZA 3NJLA 1RZFH 1M05A 3TCLB 5HHMB 2MOQA 5FWRA 1Q9LB 4JO3L 3MUUA 3S36L 4N5EC 4NENB 4X9FA 5HYJE 4LEOB 1EJFA 1XF4B 3ULUD 2GTWA 1A14H 4D2NA 1FYHB 2Y23A 4FQIH 4N3TA 3UROR 5D5MA 5T1MA 3NJFA 2Q86B 5J1AB 4EUPH 1KEGH 3OAUH 5F71A 4WEUD 1TZIA 1BYNA 2HX9A 1IGCL 2Y2TA 3F84A 3ATDA 2P8MB 4XN7A 3KPRB 5B38B 5GGUB 2D03H 1MUJB 4TUKH 2HVBA 2LTQC 1OLLA 4C83A 4MAYB 3INUL 1UGKA 1OTTD 4NFDA 2L8AA 1KTLB 1LJMA 2M83A 5C7XL 1YEDA 4IGBC 3HG2A 5HTSA 5F6HJ 3N9GL 4L4TE 5B7FA 3G5WA 4EN3A 2Q2LA 5JPMC 4AEIH 5F7BA 3VWJA 4RGND 4NJAL 1NBZA 1IX2A 2WQSA 1TQCB 3UGEA 3IGAB 3MCYA 5I6LA 3AXIA 5A7BA 12E8H 1ZKAA 4FTVE 3MRDB 3ZSTA 1RUQH 2F1AA 4LKCA 3O8XC 3VRLF 3TYFB 5EO0A 2CLRA 3RGVC 3ULSA 5GRZA 2J1XA 4DGIL 3DOIA 2D3LA 4HU8A 1PZBA 2WYHA 4WWKC 2XZCL 4QRFA 1OARL 4H5SA 3DHUA 4YAQB 3H7BA 4B95C 5DSCB 4LSDA 3X2QB 5L8JB 2YJQA 4OZ4B 3MNZB 2I9LA 2R39A 4N90D 3WI9A 4GIPD 3ZR5A 1A9EA 4Y2DA 1VCAA 1BQKA 1DVFC 1N64L 1FC1A 2PETA 4D3CL 5KSBB 1RUPH 3LH2H 5JW3H 2B0SL 3OHXA 1T89C 4DPBX 4PI0A 3UYOD 1E5CA 3ARSA 1TJIL 5T3XE 1RLWA 3RY5A 4BSWB 5GZOC 4N20A 5KJ7E 4O9HH 4ZMYA 1FRGH 1N8ZB 4U6YB 1R24B 3GLAA 3RI5F 4QF1A 3D9AL 4ZMVA 1IC7L 1K72A 1MNUL 2H6UA 4HUKB 5HDLA 4S1RH 4AYFA 4PN6A 3DVGB 2X0UA 4MA7L 3QNZA 2OMVA 5FDYA 3CQPA 1HH9A 4KHTH 5C0GA 3OAYH 4G7RB 4JFDB 4HOXA 4P2RD 5TH2A 5I9QC 4V1DD 1K8IA 1MCFA 4HGMA 4M9OA 4WK2B 3TVMD 2XZZA 3UTPD 3VW3H 1AZNA 1SUJA 4PRIB 4PP2A 1UH2A 1CFBA 2CRZA 2IWEA 3BYYA 4YHNB 3N44F 3SDAD 4M6MH 2X0WA 1BXAA 4O4YL 1Z5LB 3Q8BA 2E59A 5AYTA 1OIOA 1X5JA 3R06A 1KDIA 1IEBA 3PRZA 3MUJA 2BNRB 2Y07L 3P54A 4NWTH 5TJWK 3BRDA 1EHLH 2MPAL 3QH3A 4PJDB 3HZ3A 3C5JB 4K94L 5E9AA 3GKWL 4JY6A 2ICCA 5C0AD 3MLVL 4UB0H 5B22A 4G1MA 2X4RA 4ZMLA 1JD9A 2YRBA 1JZ8A 4NRZA 3U9PL 3BZ4B 4GMTH 3WO4C 5E08L 4L0PB 3TZVA 1ETA1 1X44A 1R3IL 3LEYL 3X14A 4GW5B 3O2WH 3Q7JA 3S0PA 5I1IH 4XBMA 4X7CC 3KPTA 3L3GB 3LRSB 4JDVB 3TBVB 1ED3A 1G7QB 1AIFB 1FZKA 5T1LA 5IM7A 3BE1H 1I7TB 1F2QA 4JB9L 5TK2A 2HLAA 1NFIB 1O9WA 1OCWL 2CO1A 2VLMD 1UC6A 3FMGH 3EJCA 3THML 1MQKH 3Q5TA 5FPIA 3BH8B 1D2PA 1I31A 4BH8A 2FTAA 2IG2H 4HKJA 2ARJQ 4L3CA 1RH8A 5LHDA 3QUKB 4YFDB 4UDTA 4ADGA 5ILTH 2HRLA 2CO4A 5AW2B 4AI7A 1BQ5A 4G8GE 1S7VB 3KBPA 4Z8FH 5HDBF 3QDGD 1RXLA 1W0WB 4KNSA 4K5NA 4DH2A 4A7QA 4R7DB 3REWB 2BOBA 2E6QA 3SDCB 4KKLC 1JMZA 1MJUL 2ICWJ 3CFBA 3WIAA 3P9WB 4P5MB 2X4SA 4GS7C 3MRHA 2CPCA 3MV9D 4BXSV 3FQXB 1TQBB 5CBEA 3KPLA 5E6YA 4OH2A 2MEJB 4PBWD 4UT7L 3BPCA 4KDWA 4ZPTB 4ALAC 2WOYA 1BP3B 2EIJB 2DWEB 4LLMB 4FMVA 2GI7A 3WTVA 1P4BL 2XJKA 3K72B 3QQ9C 3T71A 5AENA 3ZPDA 4MS8D 2WP3O 4BA0A 4N2EA 1RZGB 2KHAA 3CU7A 1T2JA 4IIQC 3RX8A 3UTQA 3WFEL 4MMXA 2H1PL 1JS4A 2FEDC 1Z9SB 3B7RL 4ZW6A 2KZBA 2XN9A 4P49A 4PPTA 4P2QB 4EEEA 1VLXA 3Q0HA 1DBAL 3QHFL 4BUQA 4PJ9A 4B97A 1MFNA 2E0PA 5LGKA 4KU1A 5DMIL 1E65A 1DBBL 4N2KA 4LCWE 2J21A 4OM1L 4HFUH 3SB3A 3PAUA 5EU6D 4P3WA 2MQCA 5G4NA 2H0PA 3RIFK 2DQCL 4TVPL 2XTSA 5EZPA 2CPUA 3KDPB 1WT5C 2YC1A 4IBYA 2ZAHA 1UASA 4LHUB 3BFOA 1DE4A 3QZNA 5K9QG 3HNTH 2IFGA 3QFJA 4UT6L 2YMXL 3CNKA 3DMMB 4YSAA 5C09A 4NKOB 2X3AA 1PS3A 4ZNCD 2CCVA 1NBCA 3OG6B 4YWGL 3ULUF 3H53A 3QORA 3QQ3B 3TT1L 4Q2ZB 4PGEA 3CPUA 3O2VH 4GO6B 4W9LC 1CIUA 5D2LB 1NOFA 3FFCA 4P2OD 1MCSA 4F57L 3LNHA 3AT0A 3U4BH 3UBXA 2UWEA 2DQIL 1JZ2A 3GO1L 4HSQA 4EI5A 3KLDA 4ERSH 1H3PL 3HE7B 4L4TB 1JPTH 4NC1C 4F8TA 4WU5B 1K4DA 1SEQL 4ETQB 2XRAH 3CFTA 4HS8L 5FV1L 3OXRA 3QEQD 4U1IA 1GVIA 5FKPA 1GKOA 4NUGL 2OMXA 4PUBL 4WW2B 2BIHA 4YDVB 1PX8A 2QLYA 4QOKD 4MZIA 4Y5XA 3DROA 3VFPB 1RIHL 5FCUH 5D4IA 1B3JA 4LVHC 3EYFB 5JMRA 1A1NB 4FZEH 3SJVA 3ABLB 4WFGE 1AQDB 2WXJA 3N85L 2Z7ZA 4AW4A 4WI9A 3ARFB 1OK8A 1RERA 2J6EL 3O9WD 2YD2A 4OY9A 4PV8A 3DUHA 5IVNA 3QDJE 3G6DH 2Q3AA 4X98A 4XCNA 3EYUL 2VIRB 4X7SH 5E2WL 2BIPA 1A1OA 4XBPA 4XE0A 1JGLL 2PYEE 1MWAA 2CIKA 3QS2A 5D93C 1FGVL 3SGDI 1NCOA 3WNIA 3WKML 4AC4A 4X83A 4U0QB 1SQMA 4LSRL 2K0RA 3GZQA 1Z7JA 5AZUA 4Y8AA 1OGSA 3HMWH 3DBSA 3FO9A 1WG3A 1HI6B 1E9OB 3MRIA 2ZJSH 4KTDH 4PW9A 1T7WA 3JTTA 4U3XA 1QO3A 5D1QB 4DSYA 1KCRH 3B9AA 4PGCA 3PV6B 4PG9A 3W5MA 1YEIL 3GJEA 2EEAA 4BYHA 2JJUA 4ELMA 2K6ZA 4YGAB 1KTDB 3E8UH 1EK3A 3L3OC 3B9KC 1QSEE 2G5BB 3T08A 2D0FA 3FZUC 5AVVB 1W91A 1E4XH 1KBWA 3PWVA 4N0YH 3BGMA 3MXVH 5FCSH 3SE3C 1C8PA 1WZMA 4L1LA 3V6ZA 1J5DA 3PL6B 1V5JA 2DOCA 4NQDD 4G8FA 3AACA 1NIDA 2W07B 1B0IA 1CQKA 1FJ1A 1W9XA 2IQAA 4XXWA 3GTVA 4MCZB 4HKXA 5IY5B 4R3SB 1BYPA 1EO5A 1X7QB 4KX7A 4YBLC 3B43A 2F74A 5DC9B 5ENWB 1H3TA 2LTQB 2XNAA 4FL4B 5HGHB 3GM8A 2Z35B 3ETTA 2WINA 1AXSA 4NHUA 1E8ZA 4IGBB 5HYQA 1PZ3A 5J8OA 3SBRA 2W8CA 3QA3B 4KQ4L 5HHQB 4NC1E 4K9EL 1G9NC 1OLZA 3OJDB 4JRYB 1KPUA 2A4ZA 5C0BB 3P0VL 3GSVA 3AREA 4UM9A 3HRZA 4LU5L 4M5ZH 3VFTB 4G71B 3O8XB 4Y5YA 3W1ZA 5KJRH 5L4FA 4G2AA 4MXVF 1MEXH 4WIQA 3VRJB 1DQQA 3MLYH 5GJTL 1J1XH 3BFWA 3OF6A 2V8MA 2ZX8A 5DJXB 5E8PA 3O6FA 5GGQH 3MACH 3WO3B 2F19L 3FHEA 1UZGA 3KMDA 1WA1X 5JDJA 3I9GL 4H44C 2VR7A 3UOAB 2AK4D 1KB9J 3DHMA 4NP9A 1G0XA 1X5AA 4QRRA 2Y1ZA 2FJSA 3QJRB 3H3KA 2R2EA 3NTCH 4NQCD 1WJ3A 2PW2A 2VLRE 5I16A 2ITCB 4LSPL 4FJZA 4PBVC 4MJ6B 3AG3B 3H0TA 4O5LL 3IU4H 2J4WL 3VH8G 1JYWA 4BRJA 4FNLH 4DNLA 2C4XA 5ABDE 4GSDL 3QFGA 5LBVA 1JXJA 1MWAH 3N42B 3QRGL 2AEIT 1LK3L 3NCBB 3K3QA 3EH4B 3V6OA 3FSAA 1D9KB 4HK0A 4G6ML 1OGTB 4DZ8A 4DEPC 1J05B 2KPWA 2ZCHL 4QJ3B 5FA3B 5CILL 4WW1B 1KJMB 3KNBB 2CALA 2V5RA 4H0HB 1IIIA 1NDGB 1B9KA 4JR9L 1PTZA 1YPZE 2BIIA 3NIGE 4LKXA 2JELL 3QDHA 4JGMA 1J9SA 5CZVH 3R7QA 4HWBL 3WXWH 4EBQH 1KWKA 2VZTA 3LS5L 4XOBA 4WEBH 2IGFL 3MKKA 5TD4A 4HBQA 5KVDH 4LCWB 3NSCA 4FI6A 4HQQL 4QI3A 4L9LB 3WY1A 3D6GA 4OCWH 3MX0B 5E4IA 4FMFA 2FWOA 2VC2B 2H0JA 1RV6X 5B8CB 3VH8A 3SEPA 3F58H 3L3DB 3RL1A 4Y9CA 1EUUA 5IJVB 1NUGA 4OTXH 3RWDB 1AGBB 1WFNA 1G7IB 5E9DE 5TE4L 3VDCA 1FVEA 1CD0A 2DL2A 3L1EA 4JMNA 3SDXA 4H25B 3VCLB 4I2XA 1FYTD 1OALA 1CL7L 3S35L 3ECVA 4IRJC 3E2HC 3T65A 1WBYB 1KN4L 3CZNA 1AZZC 4AZ8B 4ZMXA 3KVQA 2FEEI 3ZKND 3GJFA 3I3BA 4XNQA 1AZRA 1E90A 1AD0B 3D0LB 1Z3GL 3M7FB 2JTYA 2WWNA 3LB6D 4M7KL 3MN8A 1UJ3C 3D12B 4I85A 2QMKA 4CU8A 3GWJA 1XF5A 3BMVA 5CBAA 3CBJB 4ZFFB 5I5RA 4KJYB 1TNNA 4OI7A 4HA1A 3ARGC 4P4KC 1SLUA 1F90L 3GSUA 2IBGA 1TO5A 3BXNA 5JIQA 3IJHA 3I6LD 3FB8A 3U4EA 4OZIB 5EU4B 3AAZB 4ZTPH 2D73A 1IBFA 2H2SC 4NRYB 1IM3D 5FC9A 1UUNA 4F33B 3MXWH 3IMVA 3S36X 4M48H 4ODVH 4XNUH 4EIGB 4JRFA 4OGAD 3M46A 4UBDC 3V0FA 5D1XC 4N3UA 3GLDA 5FO7B 2XWXA 1MY5A 3FPYA 1GOFA 3O3AA 5DS1A 4C4BA 4DGUA 5C9JB 7FABL 4KITB 3LRMA 3C09B 2GFBB 5A3IC 3QDJB 1MW0A 1IGJA 3JZYA 4N25A 4W6YB 3UGUA 3HI5H 4C4UA 4EXPX 1TZAA 4XN5A 5BXFA 1LP9E 4GP5B 1U6AH 1UWEL 4HKBB 2ADGB 4NN5B 3BKMH 4HX1B 1E9PA 2C1PA 2VL5B 3AUVA 3ILPA 3N41F 1NGPL 5EIIA 4O2CB 3IXAB 4OD1L 2N1TE 3TNNA 4Z1PA 3MUZ1 4FP8H 1VSCA 1EXUB 2RALA 4UOW0 2AZUA 4L5FE 4AL8H 5HHPA 4YHPB 3QIBA 2AKRB 3WMSA 1MFBL 4XE5B 4CILA 4D8PA 1KPRB 3AUWB 5KVGH 4MFHA 4Q9CA 4B50A 3CTTA 2E56A 5BRZE 4L4JA 3B5HA 2XU9A 3VNZA 1MVUB 2R1XA 2OQJB 4U4BA 4LLQB 4ADIA 4MWFA 2BNUB 3GGWA 4YGVA 1B4TA 1T7ZA 1LMKA 1J1PL 3TESA 1Q94B 2K4WA 1PNDA 1IFGA 5TQ0H 5KVMC 2VZ1A 1J87A 1N12A 5DD1H 1SF5A 2HTLC 1DQDL 5B4MC 1OT2A 1R6VA 4NQED 5D70L 5AD0A 1PNCA 2FQDA 1KBGL 1BHGA 4Y1AD 5IBUG 3MA9L 4XCYB 4XBEL 2L04A 5LGYA 4X8JA 3A6CH 3Q5OA 3DO7B 2H32B 5IBTL 1L6XA 3REVB 3D4ZA 5FECA 1MJ8H 1PSKH 1ZDSA 2QPSA 1S7XA 3TCTA 1MFVA 4PJBF 1G5GA 3FTYA 3O0LA 4KQ3L 2PXYA 5B39A 1EO7A 4JFXB 2VABA 2P5PA 2UYLB 5ACLA 1N59A 3EKCA 3QJFA 1T5WB 3DV4B 1R1CA 1XZ0A 3BAJA 3TV3L 4KJWD 5CN2A 2D3VA 2GKIA 4K8RD 1CDYA 4NPYB 3RPIA 3DRTB 4DJMA 1FN4A 2CHNA 3VXSD 3B6SB 3DI3B 4EKXA 5ADPH 3IJ9A 1UZ6E 4FI8A 4XN1A 2TRYA 1U3NA 1BF5A 5I76B 3BISA 1A7OH 1XDTT 4OLEA 5D1XE 5IB2B 4Y5VA 4O2EB 1FG2A 2NW3A 3ROLA 5L2JB 4Q8BA 1UADC 2JKJA 1YECH 4HUMB 1EAJA 2JE8A 4WI8A 1G87A 3MROB 4PR5B 5DMKA 1Q0EA 1J0JA 2H0EA 2JQAA 4H1LB 3QWQB 3MNMA 2C9UA 3WJJC 2GJJA 4MRCA 2V0AA 3LMJH 1H6EA 3QNXA 4YN3A 4JPWH 5ADOH 3BEVB 4Z7VE 4DF9A 4CC0A 2CD0A 1EA9C 1ZT1B 3QNFA 1NMBH 3PXHA 5DD3L 3U79A 4HT1H 1KTKE 4PS7A 3S5LB 3SZ6A 1ZANL 1ZIAA 2IPTH 2XQYK 1FWXA 1M6UA 1A7PH 5F9JA 3BCFA 4EKJA 4PVBA 3E9TA 5F21B 5IEHB 3NRQA 3OKDB 4PJHB 3P4MB 2X05A 4WEMB 1HE7A 2BY1A 4MB5A 4YSDA 3BZDA 4NIKB 5ACMA 3TA3C 2H6PA 3ULVD 1F8TH 1CL7I 5E4EC 4J28A 4YSQA 1MCWM 3LNGA 4IHOB 1SMAA 1I3GL 3MLTA 5AZEH 4YHKH 1FNEB 1YZZA 4F7EA 5GIRB 5BMFL 1U8PA 3HFML 4G7QB 4N0UE 1JPGA 4F7MB 4O2FB 3HZVB 3MFFB 4HSCX 4NO3A 4U31A 2VN6A 1BJ1J 1FIGL 4Q56A 4TM9A 5I6PA 3S36H 4JO3H 4FG6C 1R3HB 1XAKA 2Y5TB 2RMNA 4ODWB 1P2CB 1P5UA 3ZHFA 2CKBL 2I24N 1NC2B 1NCCL 5MEOA 4HP5A 3QDMD 2AFNA 3L3JB 1Q72L 1IGCH 4NSKB 1O6SB 2C4FU 5FDWA 1BQSA 2N0KA 3GI8L 5DO2D 3CFMA 1E3XA 1QABA 4Z7UF 4WUUE 2ZONA 4F2EA 3BVTA 4Z3IA 3INUH 3DX2A 4NC0B 5JO5A 5KUKA 1TJHL 4CAGA 1MFEL 5C7XH 4P2CG 1YMHA 1QSFA 3LD8C 5EUKA 3VXUA 1BZDA 2PTVA 1MRDL 3N9GH 1GW0A 4JM2B 2BNQE 4V11A 2EYSB 4NJAH 4UQIM 2OV0A 5CS7A 1UWXK 5IVXA 3MI6A 4K73A 3VXME 1OTUC 4TUOB 3AS3A 3C8HA 4A37A 4PI2A 4WSJA 1E43A 2YSSB 4Z3TA 4Z7NB 3V4VL 1R47A 3CC5B 2QPUA 5IIEA 1PBYA 4GAFB 3ABMB 3MTXA 4DGIH 1PEWA 2F7OA 1G4RA 1Z32X 2XZCH 1OARH 2NY3B 4GKSA 3VMPA 5ISZD 4JQXA 1LEIA 4MVBD 4UZSA 4Z95L 2F7PA 2QPDB 3TO4D 4JLRB 1BLIA 3Q2VA 1T04A 4WVRA 3CDGB 3C8KB 3HS9A 3NFNA 1N64H 4XNXL 4D3CH 5HI5C 5KS9E 2LLGA 4JNXA 2GJ6E 1RZJC 2B0SH 1G7MB 1S9VA 5DWUL 1CD1A 3FYIB 1TJIH 2NR6C 2OJZL 2A99A 3FTSA 3AROA 3I84A 1FL3A 3KL5A 5SWQA 1ZXQA 1LL1A 2YHGA 2GSMB 3VX0A 1PAMA 3D9AH 3EO1B 1IC7H 1MNUH 1WICA 4N8UA 5LVEA 3VQ1C 2FK9A 1TDQA 4MA7H 3V8OA 4XOEA 1OF0A 4D9RD 5I66A 3PJNA 2R23B 3D5OF 1A2YB 2Y7OA 3TCLA 2AVFA 4YK4B 4NGHL 1JXGA 2B9BA 1RCYA 3RWCB 1PDKB 1Q9LA 3OLIA 5D7LE 3V5KB 4NENA 3LQZA 2XOTA 3SGDH 1XF4A 3S5ZA 5KYXA 3W37A 2VDLL 3QXAB 2GY7B 1CWVA 3HC0B 2J8UF 3IS1X 3V0GA 4AH2B 3VAEA 4PJCE 2LV4A 1TTGA 4LE8A 2Q86A 5J1AA 5DEGA 4O4YH 2VDOB 1IAOB 2FATL 3BPLB 2IV8A 3JT2A 1RFDL 2P8MA 3GMPB 4JPSA 1PZAA 2Y07H 4Y4HC 5CZKA 3KPRA 5C0RL 2NQ3A 2MPAH 1MUJA 4GQRA 4RISL 4UT6A 2WYIA 4K94H 3FUKA 3JVGA 3GKWH 4MAYA 2EE6A 1KTLA 3N04A 1LK2B 1MCBA 1JTOA 3DIFB 3MLVH 2PWHA 2V2TB 2EIBA 3OLEA 1J86A 2HT3D 4KAQL 5L8LB 4M4RA 3VRIB 5FA4B 3U9PH 4CBPA 5E08H 2P3YA 3FU6A 2D9CA 3IGAA 3M6DA 3V0VA 1R3IH 3LEYH 5EEUA 2BVOA 2QHRL 3ARGB 4X0KB 3MRDA 1E42A 1BZ9B 3BW9B 4FAAB 3TYFA 4N2MA 2B4CH 5E8EB 1KJ2B 2O5YL 4MNGE 1FZOB 1F3DJ 4YPGB 2YGVA 3CZUB 2LAAA 1YO4A 1BZ7B 2WQXA 3Q44A 4K5MA 4Z7QB 3NQKA 2EDXA 5DSCA 4APQC 4YAQA 4JB9H 4KK5D 2XWRA 4M43L 4KKRA 4OZ4A 1OCWH 3MNZA 2QADB 3THMH 4WF7A 5HD8D 4OLWL 5DD5L 2R0WL 2BVYA 1PL3A 4F58L 4JFTA 1P0SE 4JFYB 1PY4A 3ATAA 5KSBA 2XDHA 2YAOA 1CPUA 4RFEB 4JBSA 3BWUF 1AQHA 4BSWA 2NUTA 1TQVA 1RQ5A 2CXGA 3P40A 4FXGB 1N8ZA 4U6YA 4XB3A 1R24A 1IKOP 2C8NA 2JIXD 4J3OD 3RKDD 4BFRA 1FVDA 4B9ZA 1R34A 1UA6L 2J6EA 1XFPA 1MJUH 3CN1A 1JZ5A 3DVGA 3ZE2E 1V3JA 4K0OA 2BVTA 2ZXCA 4YSPA 4BK5C 3VU2A 5HVFB 4JFDA 3BUBA 5C08E 1BWMA 4UT7H 2AANA 4JJOA 4ZTEA 1DUYB 2WBJB 3SDDD 1HKLL 3DTUB 4BQ8A 1NKOA 1P4BH 4Q14A 1G6RB 2MWCA 2FJGB 3T8MA 3DSNB 1LXMA 4PRIA 5DFAA 3DXAE 2Q2EB 4MQ7A 3WFEH 4R4ND 4YHNA 2H1PH 3Q06A 2MCG1 1Z5LA 4P2YA 1J8SA 4P5SA 3TOPA 2FLRT 4FQXD 3ZQ9A 3ESMA 2H9GB 4L1DA 1PKQE 1HU8A 3C75A 1DBAH 1JMXA 1TQWA 3QUXC 3QHFH 1V27A 4XPGL 4PJDA 5DMIH 2NY0D 1DBBH 1N26A 4GINA 3ULAB 1DL7L 3KPMB 4OM1H 3ULVF 1RZ8B 4GOSA 1TKWA 1X6NA 4NQSB 3RDTC 2DQCH 4TVPH 3P4NA 2WWKO 3L1GA 3WD5L 5D2NC 2YXVA 1ZJAA 1FCCA 1WO2A 2P5WE 3FO0L 5KAQG 4K3EL 1UJTA 2BWIA 1ZS2A 3L9YA 4DP0X 1CBJA 4HIQA 4Y4KD 3PXLA 4UT6H 2YMXH 2J8OA 4DIXA 4MNQB 3T0VA 4LF3B 4QEGA 4GW5A 4YWGH 2PF6A 3EAKA 3TT1H 1JERA 1YNTB 1U8HB 2L3BA 3L3GA 4JDVA 1GOGA 2GUYA 2R4RL 5GS1C 1G7QA 1AIFA 2ESVE 4OFYA 1I7TA 4F57H 4L29B 7CGTA 5A40E 4EI0A 4GXFA 1NFIA 2DQIH 3FT2B 4QHUB 1N7ML 3GO1H 1E5AA 1H3PH 3BH8A 4OD3L 5F72S 1FCGA 1GY2A 5ID1B 1AKJD 2BNQB 1A64A 4LVNB 2CXKA 1SEQH 1L6PA 3QUKA 3HUJF 4HS8H 1TR7A 1NAMB 1AFVL 4M5YL 4NIYE 2Y25A 3NH7L 4OBSA 6PAZA 3UO8B 3VXMB 1T7VA 3FN0L 1BZ8A 2EO7A 2IVFC 4NUGH 3VI3F 1S7VA 5I1HL 4PUBH 1FHNA 1W0WA 5EUOE 3EBHA 3QQNA 3P77B 3AS2A 5F6IB 4Z7WB 3REWA 5AG8A 1N0XL 1RIHH 3SDCA 5KVFL 4JPKL 1OAZL 2J8HA 3DOHA 1KFGA 4JCLA 1WLHA 1IGTB 2OSXA 2XX1A 4P5MA 4ANXA 1MDTA 1I1AD 3ESVF 5EZOL 3FQXA 2FQEA 3S35X 3N85H 5DHVH 1XF2B 1N6UA 4ZPTA 2DYPD 5T3ZE 4LLMA 2DWEA 3ZQXA 1CGSL 1FFQA 1VGKB 2CO2A 3BDXA 5DJ2B 2J6EH 3WKYA 1A3LL 1CGVA 2BP0B 2GJ6B 5E6UB 3TBSB 5CN1A 2ZOLB 4MJIA 1UWGL 3EYUH 5E2WH 4GAJL 3Q9PA 4Q89A 1JGLH 2OI9B 1WH0A 3K46A 1Z9SA 4WO4D 1XB3A 1FGVH 4XO5A 5C0CA 4P2QA 3CFNA 5AYUL 3UTTE 4NZTL 3WKMH 3OZLA 5LAXB 1I7UB 2HSIA 2OR8A 4LSRH 4YPJA 5H37G 1FFOB 3H55A 1XTMA 1ZDQA 3APNA 2XV6B 5C71A 1T5XA 3OWRA 1BOYA 3DX9B 3W11C 4GP4B 2NT0A 8FABB 5KBNC 3BWAB 2A74B 4JW3A 1YEIH 4HWBA 4EIBA 4LHUA 4HK3N 3OLDA 3DMMA 4PJCB 3X13B 4XCEB 4NKOA 1GGBL 1IVLA 1T1WB 4DP8X 4R2GC 3FO1B 1AGEB 1C5BL 4Q2ZA 5D2NE 2DQUL 3ZKSD 3MLPA 5A2JH 4HGWB 5IHWA 5D2LA 3T6XA 4F7CB 2VSMB 2WQRA 4QGTA 1Z3RA 2FO4B 3CN0A 5SX4H 1SXNA 2DQJL 5I0WA 2EUVA 3W2DL 3HE7A 4L4TA 3QZLA 2HB0A 4WU5A 1E4KA 2Z7WA 2D0GA 1Y6NR 4ETQA 1PKOA 4PMEA 5H37A 3CXDL 3HVDA 5E95B 5BOJA 3ETBJ 1XB8A 2KS0A 4UMSA 2LVEA 3S97C 3K71A 4IK6A 4W9EC 1MSPA 2WGXA 4KQ4H 2OXGB 3VFPA 5I6OA 4K9EH 3VD1A 5FYJL 3EYFA 2DIEA 3P0VH 4BFJA 4LU5H 5IJCC 2EEDA 1AQDA 2F58H 5FYKD 1VHPA 2AMUA 4XWGL 2V9QA 5GJTH 3MREB 1OPOA 1ILSA 1HHKB 4ZMNA 2K45A 2F19H 1LDPL 4CMMB 4NRXB 2VIRA 3I9GH 2FX7L 2CDEB 2JKTM 3V0JA 2NNCA 2B39A 1DJSA 2TSBA 5E0FA 2VSKB 4J3BA 4G8IB 2CE6A 4LSPH 4O5LH 2J4WH 1ZVSB 1Q1PA 3FN9A 3SOTA 5JXAL 4AG4L 2SODB 1RULL 4FQJL 4GSDH 2IXQB 4J3OF 1HI6A 1E9OA 4MASA 4PJIF 4UTCA 1FFTB 4PJGE 1H3UA 5ALCL 3NMEA 3QRGH 5D1QA 4ANUA 1LK3H 5JHDE 3OZKA 3JYBA 3KYAA 3PV6A 1UD2A 4G6MH 3QG6B 1WUNT 1HHIA 3JWNG 1KTDA 3KPPB 2DLFL 3DXAB 2YJLA 1L5GB 2ZCHH 3IGLA 3SBWA 2G5BA 3BQUC 5CILH 4ZQTA 1QW8A 1FHGA 1VACA 5ICXB 4PVNA 1ACCA 4JR9H 1PKQB 3SCMB 2JELH 2D4FA 1IZJA 3PL6A 3UTSD 4HWBH 3HPJB 3ZDZF 2I85A 1QQDB 4PJ8D 1M7IA 3LS5H 1XCQB 3TEYA 2IGFH 4ICXA 3RA7L 1JFHA 2GJZB 2BLFA 4XI5C 4HQQH 3RZCC 4MB1A 3OKYA 4MCZA 5C3TA 4R3SA 1X7QA 1XL4A 3R0NA 4AWJC 1HYSC 5ENWA 4WTWA 4OM0H 3Q43A 5HGHA 2XPGB 2Z35A 3U6XA 4CGUB 2QPEB 4L4VD 3TYGL 5EU3B 3UACA 1Q9WB 3L48A 2GTQA 3MV8E 3QEGL 4LDLB 5GSRA 3QA3A 4P5KB 3N5AA 1CL7H 3S35H 5HHQA 3P02A 4M3JA 3L08A 4EPSA 1HQ4B 1KN4H 3OJDA 4JRXD 1HSBA 5GXBB 4JRYA 5J13B 5H37H 3APDA 5C0BA 4JREB 1Z3GH 1CGTA 2O72A 3VFTA 1G1KA 4M7KH 3NJXA 1QFUL 1IKNA 5KANI 2GK0B 3NDZE 3VRJA 2L7QA 1DJWA 5E1HB 3QI9C 1S7UB 3B9VA 3ARXA 5DJXA 4RMQA 5F2FA 2P9RA 4KVPA 4FLSA 1JZ3A 1AAJA 1F90H 2NQDA 2EVJA 5EUOB 2MKLC 4HHWA 4RCAA 4BSVB 3ARQA 4JGNA 2K3TA 2ITCA 1I85A 1XMWA 4MJ6A 3TNMB 5JR1L 1I8MB 3RFZC 1CJYA 1MW2A 5M95B 1TTRA 3FB7B 1HXKA 5AAMA 1SF3A 3KLSA 1MZZA 1RK0B 5EF0A 3OMIB 1UACL 3TP4A 1D9KA 7FABH 1BQHB 5HHOB 4F5CA 1OGTA 4J3XA 4LGRB 3FB5B 1J05A 3S98A 2AC0A 3LN9A 4M9PA 2XVGA 5FA3A 4WW1A 5ETUB 2QKSA 4JX0A 1KJMA 3KNBA 3UAJD 1KB9K 4YFLF 2CDFB 4OB5L 4YR6B 4CSTA 1NDGA 4MCYA 1UWEH 2E74C 3B56A 3FQNB 4KUZL 2TRHA 3LZRA 2QVIA 3ZZLA 1NGPH 3T6ZA 4JO2L 4OD1H 3QPQC 3WY3A 3CFIC 5CIPH 4U1KB 1TLKA 4WTXA 2XN0A 1NGWB 4L9LA 5DTFA 4XP6L 3D0AA 1UG9A 3J8F7 5CFHA 3Q48A 1MFBH 1NFDB 1QASA 3MX0A 2P5ED 4YO0B 2Z4TA 5EULV 3MOQA 2ZF8A 5B8CA 1ZT7B 2HT2C 1JZGA 2IOMA 3FUHA 1UA3A 3L3DA 4ZX6A 4ZX5A 4IBSA 2Z31C 2CH8A 3RWDA 2WLHA 1AGBA 1NANH 1G7IA 2CO3A 4FFVD 4GW1A 1GZQA 4UF7C 1F00I 4WZ9A 5KUMA 3RDTB 3HBGA 3VCLA 3S3PA 3Q1EA 1WBYA 1J1PH 4GSRA 4AZ8A 3TFKD 1UHVA 3B37A 1BJMA 5KBPA 1AD0A 1NM4A 1DQDH 5AOIA 4E9LA 1HWHB 1SRDA 3GUFA 5D70H 2LAGB 3X1FA 1ZPUA 1KBGH 3ISYA 3E80A 5CGYD 4DKFL 3MA9H 1T83C 4HWZB 4XBEH 4ORZC 4KJYA 3HRPA 2VXUL 4MKMA 3QUHA 1R75A 5IBTH 2A73B 1AJ7L 1AHWB 5C07E 4OZIA 3MUGB 5EU4A 3AAZA 3ATEA 1INQB 4KQ3H 4K5LA 5C0DA 4KY2A 3FJTA 4W9JC 3RTQD 3PYCA 4NRYA 1SFHA 4F33A 4IOFD 1CE1L 5FO8B 5AQ0A 3Q1SL 1DQML 4DGYL 3TV3H 5JMOC 4M93B 2ZKYA 4K9JA 3T2NL 3HN8A 3KWUA 1TPXC 5HYSG 3U2SB 5FO7A 3TBCA 5C9JA 3OQ3B 2EUXA 2JLLA 2GFBA 2EXYD 3NZHL 3QDJA 5DZPA 4AEFA 4OFDA 1JGEB 4JN2B 3WGVB 3P11L 1KN2L 4XH2B 4JCWA 4HKBA 2ADGA 2VLJD 3OC5A 5CSGA 4HX1A 4IKKA 4QYOB 2FT8A 3IXAA 2AK1L 4UQ3B 1IM9D 2VZVA 2BSDA 2Y1VA 1EXUA 1IUZA 4PJGB 2A1WL 2ZCLL 1T5KA 3I6KB 1RJCA 4YHPA 4YL9A 2Y3NA 2AKRA 1JZ4A 3S5YA 1KPRA 2NYZA 2EDBA 3OLGA 4WSKA 3M07A 1Q38A 3KPSE 5HGGS 3MBEC 4UAHA 1NCAL 1RZKL 2EILB 4QRUB 3K8LA 5DD3H 2OQJA 3D52A 2LFEA 4GY4A 3QR1A 1ZANH 5HYSA 1KBKA 2K70A 4LLQA 2QTEA 2BNUA 3HN3A 4OQTL 1Q94A 2CBPA 1B2YA 5DZLA 4E9RA 2HZHA 2YQGA 2ARJB 1I8KB 4C56E 3ZO9A 3HLKA 4WFFD 4R2GB 3B8SA 4XCYA 4NWUL 2JFCA 3C8DA 1I3GH 5BMFH 5IVZB 2B2XL 3QB7C 4HMDA 3HFMH 4JFFE 4OCSL 1JAEA 3DO7A 3L7FB 2H32A 4DK5A 1WEJL 2RBLA 3REVA 2B5IB 1FIGH 4U2ZA 4AV5A 2AQRA 1AQKL 1Z9PA 2QVTA 3LZPA 2A6IB 2YS4A 4B96A 2PP7A 1PF3A 4JFXA 2CKBH 3SYOA 2UYLA 1W6WA 1NCCH 3DNKA 3ML9A 2CO7B 3RVWC 4JPQA 1T5WA 5C7ZA 1AO7D 4YIQB 1Q72H 1QI5A 5DJ0B 4NPYA 3GI8H 3S5LG 3L4CA 1AMYA 3DRTA 5INDB 1MVYA 1ZV5A 3H54A 5FW8A 3B6SA 2WN2A 1K4CB 1TJHH 1XSJA 1MFEH 1HL5A 3H9ZA 4ZMAT 3GI9L 2FH6A 5I76A 1A6ZB 5JZ7C 2JQMA 1MRDH 1U8KB 1SHSA 3X3FL 4TV3A 2BM3A 1KCWA 5IB2A 1UOVA 4O2EA 3TLRA 4AUUA 5L2JA 4XHJD 3WE1A 2ZOTA 3ZGIA 2ETWA 4D94A 5GS0L 3MROA 4PR5A 4OZGE 4WWKD 3KLKA 2ZYRA 4NZJA 2ZG1A 2OR7A 3R4RA 2F0CA 2JKLA 5IB5B 1QRKA 1U33A 2J55A 1SDYA 3PDDA 4ZUWB 2WKGA 2EKJA 5A2CA 1USQA 2HKHL 2XV3A 3M8OL 1W8NA 1C8QA 1OY3B 4I48A 4Z95H 1ZT1A 3DPDA 3C5ZD 4NQXB 4EN2A 2WV3A 3JWOL 3MRBB 4XNXH 3S5LA 4B9FA 3QBTB 1V3KA 5IHHA 1JRHL 4Y19D 3ZMNA 4FI7A 1HK6A 3N3EA 2EC9T 2R27A 5DWUH 3QRFM 4QHKJ 1R19A 2GITA 3OKDA 2OJZH 3GF8A 3P4MA 1I9IL 3FOMB 4J3SA 4PJHA 1D7BA 4LSVL 2HRGA 4B27A 1ZV2A 1ZAGA 5SWZE 2NSQA 1KWGA 3L1OL 4OFKA 4OFVA 1KCKA 4ZUTB 2BZ7A 4IHOA 4M02A 4AV4A 1FNEA 2DKMA 3F7VB 5GIRA 4C8XA 4E41B 2GB2A 1DJXA 4G8AC 1QACA 4O2FA 4F7MA 3HZVA 3MFFA 1DSWA 1X7SA 3PLYA 4NGHH 1P6FA 4NZDA 1SN5A 3NGBB 2FE0A 2Y5TA 5F96L 2FBJL 2VDLH 4KH2A 3Q9QA 4A2LA 1WBXB 1P2CA 1S46A 3S2CA 2UZIL 2Z65C 1NC2A 5G4MA 1P53A 3FT9A 1P7QD 2H32H 1PVHA 2FATH 4YHYB 4NSKA 3NK3A 1O6SA 1RFDH 5TDOB 5KANG 2BSCA 5C0RH 2BWQA 5EU7E 5HJDA 1ZS8B 2QQKL 3ZK0A 4ZS6C 2WO2B 4HGKC 2UUDH 5T1JA 3VWKB 5HVWA 3BGAA 4JJHA 4QLRA 5BZXA 3AMLA 5TK4A 2HLEB 2YA1A 5C07B 3QO0B 3QWNA 4JM2A 4KAQH 2EYSA 5I1GL 1KTCA 3WFHB 5ITBL 4EN3D 4TUOA 2YOAA 4GPVA 2QHRH 3VWJD 2QKIC 2UV3A 1MCRA 4CSSA 2YSSA 4YSRA 2ID5A 4MJJA 3V55A 4WGKA 2CO6B 2O5YH 2AXJA 4R4FL 3CC5A 5EEVA 1UKQA 2RIKA 2NXZC 2O6DA 4F2MB 4M43H 1E2WA 3BN9C 2QDWA 4XNYL 4OLWH 5DD5H 2R0WH 1QFPA 2ADFL 4F58H 4U0RB 3CDGA 3C8KA 2VLLB 1DLHB 4RNRB 1G7MA 4KKLD 4KXCA 2R2CA 3QPKA 3HLAB 4KO5A 1P7HL 4Y2DD 2VW6A 3UPAA 3X17A 4LGPB 5BV7B 3NUKA 5D7JC 3SYPA 1TQSA 3DVIA 3EO1A 3ZHNA 2R1YB 1UA6H 5C86A 3LIZL 1T3FB 4JDTL 5L4IA 3DJRA 5CJOL 2I07A 3STLA 1C12B 4JJ5B 2R23A 4PJAE 1A2YA 4UMGA 2Q6WB 5KVEE 4BCXA 3KPSB 4PRDB 4AIEA 3RWCA 1PDKA 2FHBA 1HKLH 2PYFB 1MVFA 3V5KA 4GBXB 2JJSC 3QXAA 3TPKA 3HC0A 4AH2A 3EFDL 1YJDC 3BVXA 1U3HB 1G7LA 3DJ9A 3EH5B 4HCGA 1NIEA 4IRSC 5FXCH 1NUFA 1O9ZA 2N4IA 1U3ZA 2WKLA 3T0EC 3GRWA 1GGUA 3GMPA 4C56B 5E5LA 1SGKA 3DWTA 3NA9L 4FD0A 4XMKL 4XPGH 1YMME 3CFJB 5FX3A 4FG4A 3K80A 5CCHE 2B1HL 1DL7H 3HG0A 2PPDA 5JHLL 5F7EL 1LK2A 3DIFA 5E2UL 2QPFA 3LKOB 2V2TA 1A4CA 3WD5H 1M1SA 3H9SB 3FO0H 4K3EH 3VRIA 5FA4A 4GRLB 3FUIA 4F9LC 2WANA 1DVQA 2A6DB 2P46B 4M62L 2GC7C 1S5HB 3OL2A 1TNMA 4MQXD 1QR1B 3AMKA 4J8QA 4X0KA 1BZ9A 3BW9A 4JHZA 5DVOA 3TZVD 1KJ2A 4YPGA 2GT9B 1FZOA 4BJLA 3ZT7A 4LDOB 1NBQA 3KWWB 3S37L 1VZHA 4KVNL 3AITA 1PG7W 3DRQB 1HH6B 1N7MH 5TE6L 5T1LD 2CJUL 5LG6A 4OD3H 3SKJL 3D39B 1EZLA 2W94A 4JFYA 4PH8A 2OYMA 1TPXB 1JTTA 2WNKA 2QQLL 4M5YH 1AFVH 4N8VB 2RACA 3L5XL 3NH7H 1TVDA 4RFEA 2VO8A 2W80C 1BECA 3FN0H 5I1HH 2XV0A 2VSCA 4OZGB 4RAHA 4ZXBB 3S4SB 3II1A 3VFMB 2C3HA 1EBPA 3MV01 4NCDA 4PWJA 3KBEA 3O3DB 5E6ZA 3L95B 1CLYL 1JRHI 1N0XH 3V0WL 5KVFH 1P4UA 2DJUA 1OAZH 1VADB 3FSZA 4JPKH 4Q9BA 1KGJA 3RILA 2AITA 5EZOH 4KTGA 5DVLA 3I50L 4HIJB 3MGAA 2HT4D 5AKVA 3QCTL 4MMZB 4DKDC 1H3GA 1DUYA 5FYLE 2V3DA 2WBJA 5BS0B 3KS0H 1CGSH 1G6RA 2FJGA 1A3LH 1QW9A 3B7UX 5LBSL 3DSNA 1KPVB 3FFOA 4MBOA 5IFJB 2PMZA 3O4LE 1UWGH 2QVMA 4IBZA 4GAJH 1H3XA 3HB3C 4QNPF 5AVQB 1SY6L 3W82A 4Z0BL 5TDPB 5AYUH 2H9GA 4NZTH 1SMDA 2OMUB 2XFXB 2LR4A 2H26B 4R0LB 4F15B 1DJYA 2WLIB 1WZ1L 1D5IL 2XN9D 1MFCL 2V8LA 3F65A 4PY8I 2F2HA 3KGTA 1JVOA 3GM0A 4X9GA 3KPMA 3WN6A 1RZ8A 4J12A 3F62A 2BVPB 5GGTL 4NQSA 4PJ9D 3L4XA 4ZRGA 1A6VL 2D7NA 4AENB 4GG6A 4FXTA 3PGFL 3NSYA 4G83A 5AKTA 4FMKA 4K8RL 5EZIL 5AVRB 4IBLT 5IV2B 2E6PA 1E40A 4MNQA 1VZIA 4LF3A 1D6VL 3CX2A 5DFVC 3TONA 4HAFA 4JZJC 3VRLE 1GGBH 2NY6C 3RHWK 5JOPE 3BIAX 3CHSA 2YA0A 3D2UB 1YNTA 3KPNB 3QFJD 2N01B 1PYWB 1NCIA 2DQUH 3FRPB 5C09D 4QHMB 1ZA3B 4HULB 2I69A 3RIAF 3QORD 3SE4C 1RK1B 3EDKA 4L29A 3RX5A 2DWYA 5D5MF 2Q1EA 3V0AC 3MO1B 4QHUA 1YYCA 2DQJH 4KK6D 3W2DH 3ZIMA 3FFCD 5ID1A 4FGMA 3EADA 5IW6B 2AEQL 1FZJB 4HH8A 4LCVA 5JXEC 1NAMA 1N9PA 4EI5D 4POYA 3CXDH 1LE5B 3MRFB 1WV7T 1KCBA 1GZHC 5TPWL 4JFVA 1HILB 5LDUA 2DBLL 4Z7OF 5JW5B 3BVDB 3EJYD 3P77A 1KJVB 4Z7WA 4ELKB 2Z91B 5FYJH 4A2HA 2DWDA 1IGTA 3IPFA 1KXQE 2R29A 4YMPA 1QI4A 3G9VA 1XF2A 4R97C 4QTFA 2Z0BA 1Q9KB 4KDTA 2A0LC 4QWWD 4OR1A 2VCOA 4XWGH 1ZLUK 3RVVD 1UD5A 4JHUA 2WQAA 3SJVD 1VGKA 5DJ2A 1O7SA 3AW5A 3A4EA 1PFCA 2BP0A 4LCYB 3TBSA 2ZOLA 1BMZA 4H26B 5KVFE 4YFEA 1LDPH 3I9PA 2Y2WA 1T2QL 2ERJC 2ZG3A 1IBBA 2FX7H 4R5XA 1OAXL 1XBRA 3MRQB 1E67A 4XP5L 5I6XB 3BGFB 1T4KB 3ORJA 4X6CB 2QELA 5LAXA 3FU3A 1I7UA 5T1KD 3JBG7 2AERT 35C8L 3AWFA 1F2XK 1FFOA 5JXAH 4AG4H 1RULH 3F00A 2EABA 4FQJH 4D7BA 5DRXA 1ZRUA 3DX9A 3ULUC 2R83A 5ALCH 8FABA 1DDHB 3FK3A 5BNXD 3BWAA 2A74A 1UCTA 2OM5A 5G5DB 1H3VA 3QAZB 4DO6A 3H2PA 2WXNA 3I3EA 1MJ7L 2DLFH 1T0MB 3K81A 4PJCA 3X13A 4XCEA 5HI4D 3WEMA 1MCLA 1T1WA 3LN4B 2OCCB 1AGEA 3FO1A 1CK0L 2IAMB 2KQNA 3A24A 1PFOA 1I7ZB 5IHZB 1OTTC 3HOGA 5F7HA 2Z7YA 4HGWA 3LPPA 4PRHB 1YMMB 3RA7H 3VFNB 2E7LA 4F7CA 3T3PF 2FO4A 4LQ1A 4RGNC 3GBNL 1NZRA 5EN2B 5HGAA 2X2UA 1M2VB 2IADB 1XMEB 4ODHH 3KAAA 4RSVA 1A02N 2XYCA 3RAJL 3B5GA 1E27B 1PD1A 1NKRA 2WN3A 4TOYL 1V54B 4H7VA 2X88A 3A4DA 5HDBE 4BFKA 3B3IB 4EXKA 3TYGH 3QEGH 2DPKA 3MBXL 4RZCA 5EBWB 1RUAL 2C9PA 2EIZA 1X9LA 5DUBB 2OXGA 3K2UL 2VR9A 1GS7A 2YPKB 4TN9A 1XSIA 3F7YB 3IDGB 1TXKA 5B3JF 5J4MA 1DJGA 1I3UA 1OWWA 1VERA 1IB5A 1KLFB 1QFUH 4S1DD 3ZE1B 4YDLB 3ARED 4UM9D 3UL4A 4FC3E 1GOHA 4Y89A 2X2JA 3MREA 5T1DL 2WNWA 4GAYB 1HHKA 5T5FL 3PE9A 3N91A 3UADA 2W0PA 2XVLA 4CMMA 5C3IA 5D1ZB 2PR4L 2CDEA 1DO6A 2XPZA 5SV4A 3V52L 1VENA 4MMYB 5IESL 3O6FD 1IJNA 2OJEB 4G8IA 1R17A 2IO5A 1XH1A 3ZDXF 3K0WA 2KZWA 3PP3K 1VRSA 3T0BA 5JR1H 5FGBA 5E99L 1ZVSA 2NNRA 4QRRD 2IXQA 2ZOWA 4R4BB 4FA8A 3TVMC 2CIIB 2CNZA 4FFYL 2WZPA 3QIUB 4KQ0A 1NEPA 3HI6L 4M7LT 3HBZA 1IC4L 3PWUB 1A22B 1UACH 4W4OC 4HYTB 5MERB 1YYML 4UQDA 3ERXA 3QG6A 2FBRA 4CRPA 1T2XA 3KPPA 1VFUA 3DXAA 3H85A 1L5GA 4Y16B 3ULUE 3MOAL 5AOMA 4RX4A 4OB5H 5ICXA 1U8CB 3J07A 3K5RA 1T66D 1PKQA 4U6VL 3SCMA 3IMWA 1OF2B 3HPJA 2X9XA 3DX0A 1QQDA 4KUZH 5ANMA 2YKKA 4ISVA 1XCQA 3FCTB 2HA1A 2XTJB 4JO2H 4KTEL 3DO4A 3QUYB 4FYQA 4P04A 4BZ1L 3DX7B 2GJZA 5D96C 4LEEA 4MKTA 4AJ0A 3BT0A 4XP6H 5BZWB 5J1SC 4OJYA 5HDOA 3DURB 3AS0A 2XBTA 4JHWL 2V3FA 2X9ZA 2XPGA 3GB7B 3EJZD 4RGNE 1JSYA 5EU3A 3RWEA 1Q9WA 1QLRB 4PLNC 3T8XA 1UTDA 1TVHB 4I1NB 3T4AB 4P5KA 1ACYL 3GSXB 5EN3A 1KG0B 1DEEB 1HQ4A 3V7AE 1EFXD 1WAAF 2XWCA 1QHOA 2QJDA 3CFKA 1VCBC 2XG5B 2ZT9C 1EVUA 1NH6A 1S2EA 4DKFH 2GK0A 2HCZX 2BW4A 1NIFA 1HOCB 1S7UA 4LZKA 2WO3B 3FTGB 1EDHA 2VXUH 4QR7A 5A2LH 3PJLA 4N90E 4BBWA 1IU1A 1AJ7H 1VGEL 5I19L 1JGIA 3MRGB 1XGPB 1KDJA 3V5DB 3AG1B 2UWEF 4FRWA 3FU5A 3GKZA 5F9DC 4BSVA 1KYFA 3TNMA 1L9TA 2QT6A 1I8MA 4JKLA 1OD7A 1CE1H 2GBAA 1RY7B 5ESQA 3QXVA 1JZ7A 1DQMH 4DGYH 4QYAA 3FB7A 1F18A 4WQOA 2ROXA 2HRHA 2QQNL 3T2NH 1RK0A 4H20L 4PGBB 1JUFB 5JTWA 2MCAA 4X5QA 4AMKL 1GR7A 4LPTA 4P2RE 5HHOA 1BQHA 4LHJB 1WFIA 1WS7A 4JFOB 4V1DE 3FB5A 3WNNA 3I9AA 3NZHH 4KRPD 1U4FA 4HG4J 3QO1B 1MCEA 5ETUA 3UTPE 2NY4B 3OZ9L 3P11H 1TJXA 1LQBC 2CDFA 2YD3A 1KN2H 3N43F 1FC2D 4MA8L 1ZCRA 3SN6N 3CHOA 5L0QB 3FQNA 3HZMB 1FG9C 1WCQA 4YE0A 1M7DA 2BCKB 4H8QA 1J5OL 4L8CB 2AK1H 1FIEA 3GXFA 4PLKC 3C60B 3MJ7B 3ECBB 5EOTB 4U1KA 2Y22A 1NGWA 2WO4A 2A1WH 2ZCLH 5F0LB 1MQ8A 2YSTA 1NFDA 4YO0A 3UZQB 4X5LA 5C0AE 3VXRB 1ZT7A 4APXA 1HEHC 3QIBD 1UB5B 2HPOA 2NY2D 4B9KC 1NCAH 1RZKH 4G72B 4XAKE 4NCC1 1NBYB 2AEOA 5BZZA 1DANT 1XGTB 4LLWB 1RZKC 2DI9A 3VA6A 2BDNL 4P2OC 4QGYA 2GIYA 4ILDA 3KS0J 5BQ7B 2ZF9A 4OQTH 4ONHB 4ELMF 4EZJA 5E56A 1HDMB 3B7TA 4NKDB 4AGNA 4JZJB 2XXMB 4MXVE 1X5FA 2WVTA 5EU5B 2G2NA 2CKNA 2P44B 4FG6D 4NWUH 4HWZA 4QMEA 1QP1A 2B2XH 2HRPL 2VLME 3ZE0B 5D6DC 5EF3A 4OCSH 4XMTA 3EDEA 2ZAGA 3G5VB 4R7LA 1WEJH 4BWTA 5BVPL 2ZSVB 5HDBB 1JYXA 1AHWA 5I6MA 1AQKH 2UY6B 4FN0A 4AGQA 1KIUB 3MUGA 2X6MA 2KLTA 2XA8L 3HE6A 1INQA 3WV0A 1HCFX 1AI1L 1RZQA 2Z8VC 5E6IB 3RVXD 3QDGE 4HUXA 4UZUA 5JW4N 3U36B 4WHYG 1F42A 1GA2A 5FO8A 2PXYD 4F20A 2BS8A 2HKAA 5CSBA 5CN3A 2SEBB 1CFTB 3U1PA 1KUMA 2MTPA 2EDYA 5JNYA 3LKRB 3MV9E 4KK8D 3U2SA 3GPSA 4XMXA 4WK4B 5B1JA 1E50A 2WXPA 5E7FA 1JGUL 1M6OB 2CM6A 4N2IA 1VESA 3GI9H 4LDCA 1JGEA 5KZCB 4K3JL 2Y6TE 3W0WD 4KO9A 3X3FH 5BCAA 1DJIA 2IJ0C 1QX1A 1TZ8A 1GS6X 4F7KA 2ZWZA 3F5WB 4XH2A 1ND0B 5CU9A 3EJPA 3T5WA 4I0PB 5GS0H 4G6AC 1TETL 1TJMA 2YBGA 4HCIA 4QYOA 3ZX1A 3NIDF 5EOCL 3NSXA 4UQ3A 4F1ZA 4CN1A 4O58L 5D7KD 5J12C 3IDXL 2X6CA 3I6KA 4J8RB 4LB8A 4N22A 1PCSA 5EDSA 1QPPA 4TNFA 1QBML 3HN5A 5EU6E 2FJHB 4DP1X 3D2TA 4LCCC 2HKHH 3M8OH 3R0MA 3CDFA 2N1KA 2NR6D 3FQ4A 1A9VA 2BIOA 2Q5BA 4QRUA 2V33A 3JWOH 3S37X 1MG2C 3AB0C 4AYID 4D9LL 3BHBB 4I1PA 4LL9A 3VGHA 3LIZA 3ZRCC 1JRHH 3BVUA 5HVGB 2BP5M 1OGPA 4IRZL 4KROB 4PP1D 4J3WA 1I9IH 2EVGA 4LSVH 1FNAA 1NGXB 1UFGA 2V9TA 2ARJA 1I8KA 4HBCL 1NPJA 3L1OH 2A2QT 1CFNB 5IGXL 5L4JA 1WFOA 3GZOA 3PGDB 3L54A 5IVZA 4UOJA 3K6OA 3L7FA 3U4KA 5LNGA 4UYQA 1W0VB 4IBQA 4LNVA 1J8HB 2MPVA 4P23B 5DFTA 2YR3A 4RGNB 4ABWA 3GLEA 3O3BB 2A6IA 3QEQE 4I0CC 5F96H 2FBJH 3PWJB 1URZA 2UZIH 3GXIA 4NP4L 2VMDA 5JHLA 4RSYA 2CO7A 4HEMA 1UQSB 4QOKE 2COQA 4W9IC 4YIQA 4HHAB 3G7TA 5AW6B 3VFRB 4FQLL 1XQ4A 3D0VA 5DJ0A 2XX0A 1VEOA 2Q3XA 3GD1C 2VYRE 4JCMA 3TO2B 2Q10A 5INDA 2EIMB 3SDXF 4GW4B 1EJ8A 3GEFA 2G3MA 4U4IA 4XTRD 2QQKH 4HMCA 3GDBA 4BKSC 1EEZB 4WENB 2AJUL 2VERN 3MJ9A 4NKIL 4DGVL 3L3HB 1A6ZA 1HL8A 1U8KA 4PJFF 2CHWA 7PAZA 1WAPA 4N2NA 3SE9L 3IJSB 1QSFD 1KY6A 5I1GH 3VXUD 2G5RA 2V4LA 4MZ2A 5ITBH 4Z3GA 2Q76B 5H4YA 3Q8EA 2NXYD 1NGZA 4I89A 5CJBA 4KKAD 5DVNA 5IB5A 4R4FH 5MENB 2VW7A 1IEAB 1Q90A 4H88L 4ZUWA 4CNIB 1XCXA 3AWEA 4V1DB 5FW7A 4RESB 4XNYH 4NQXA 2ADFH 1VIWA 1RHHB 3WFDL 3HG1D 1HWWA 2WTPA 1S9YB 1JF1B 3SDAB 2NTSP 3SY0B 2G3XA 4N9GB 2CUAA 1A4JB 2XY2A 3FOMA 4WHYH 3MGOB 3GPEA 3NCWA 5EO1B 3B9EA 1CQYA 4M8VA 4L2YA 4NQDE 4AYGA 1RMFL 5L7XL 1W8OA 1T1YB 3LIZH 4JDTH 4M7ZC 5LBSA 4M6OL 5CJOH 3OPZL 3PHQB 3F7VA 5C0AB 1CG9B 4E41A 3HS0C 2EZ0D 3ISRA 2VQ4A 4PJBE 4DQOL 3OMNB 4X7TB 1QBAA 4C4KO 3DYOA 1PZ5B 3A21A 1WRFA 5HHMD 3V0IA 2ITDB 2OKMA 3EFDH 1SLWA 2F1EA 3PFQA 3LB6C 3B7YA 1OAYL 4GNKB 5J0BA 4PWFA 5AW1B 5GGTA 3AM8A 5IG7B 4QKXB 2ATPB 3DPBB 5CGMA 1MJJB 2JKIS 5TDOA 3NA9H 3DUSA 1OM3L 1B6DA 4XMKH 3UG5A 5IEKB 4TVPD 1X5ZA 2X2IA 1NLDL 3BD4A 5AUMB 5GS2H 2B1HH 5JHLH 3KPRD 2NDGA 5D1ZI 5F7EH 3NCYS 3VWKA 3T4YA 1UD6A 5E2UH 5F7WC 2DYSB 4YDNA 4CJ1A 5KN5B 1QVOB 1NPUA 3QO0A 3X3GL 3P73B 2F1BA 1TT6A 2WCSA 3G6JB 3WFHA 4NNPL 2AK4E 4M62H 4OGAC 3MLSL 3IMTA 1U58B 2EVIA 3WNMA 2VUKA 1YY9D 4NQCE 2DEYX 4FQ1L 2BOLA 1MREL 3L4ZA 1DQIA 1PZUB 3ARYA 3EO9L 2CO6A 2YEZB 3ZDYF 6CGTA 2RFXB 4GXVL 3SGJA 3MV9B 5FFLA 2QQQA 3S37H 4B7IA 5KBDA 4KVNH 2Y7NA 4F2MA 5TE6H 2VDKL 4K3GA 2CJUH 3SKJH 2E8ZA 4CC4C 4ZSOE 1RP9A 2VLLA 1NJ9B 1O5DT 2QQLH 4L3EA 1DLHA 4RNRA 5F6HI 3L5XH 2WNGA 4W9ZA 3HLAA 2A9NL 1WISA 5J5EA 2WXRA 3CN4A 2FX8L 4HUUB 2LE9A 2OW6A 2EVFA 5EG6C 1CLYH 4G42B 3RWHB 1SVZA 3V0WH 3WIHL 1T3FA 3CVHL 1UXWA 5K5YA 1OB0A 2YRLA 4NKQB 1C12A 4JJ5A 5EC2B 5EU6B 3ZDWA 3I50H 2Q6WA 3CZSA 5C0FB 3QCTH 3CH1B 3KPSA 1P4IL 3AQYA 3CBKB 3R7RA 2FECL 2JV6A 4HJUA 3AC0A 2PO6B 2ICES 3R18A 4CN6A 4JRWA 3QHTC 4GBXA 3W57A 1B4JL 4JFDD 4DTGL 4BGDA 1O7VA 2H8PB 5LBSH 4J6IA 2H1XA 5TE7L 1D7FA 1FNFA 2MJWA 2DQGL 5CD3B 1U3HA 1UOKA 3LQAL 4XN4A 3EDFA 1FYTE 1I8UA 1XEUA 3MAWA 3MLXL 4MA3B 1MW1A 1SY6H 3OAZH 2JQZA 4Z0BH 1JPEA 4C56A 4BXVA 4FQCL 4ZFGL 1PAZA 3EHBD 4Z7UE 5KSAB 5C70A 1WZ1H 1D5IH 2BP8B 1FSKB 2EC9U 1ACXA 1GGCL 4XPBL 1MFCH 3CFJA 4XN9A 1H0DB 4FNRA 1CFQB 3V6BR 2C3VB 2RR3A 3LVEA 4DK6A 5PAZA 5GGTH 1A6VH 3LKOA 2FUQA 4NLHA 3PGFH 3H9SA 1NOLA 2NY1B 3BQVA 4FE9A 4GRLA 4K8RH 3R19A 5CJXC 3C2AL 3I6LE 1S5HA 1D6VH 4K8RC 1NWPA 5KWYC 1QR1A 4LSSL 4NAQA 3EDDA 1KIPB 4DPAX 4DVBB 1ZE3H 3CCHB 1AGFB 3NCMA 2GT9A 1Y6MR 2Y0SA 5L88L 4ZDHB 1T03L 3JT0A 2GC4C 2OMBA 4BDVB 5KBKA 2X1QA 5IB4A 3KWWA 3BWUC 2W0KA 3DC0A 1QBLL 1ZHKB 1JNHB 3DRQA 1HH6A 1QLFB 1ZOXA 5EO9A 4OFYD 3O9WB 3QQXA 3D39A 2B7DT 1TTUA 4GRWB 4RMWA 5ESAB 4KMTL 2AEQH 2VDQL 2J1YA 3UPCA 3GYRA 4N8VA 2AQ2A 5HHNA 1Q4NX 4D9QD 4GKZA 4U7MA 3U48A 5EZLB 4ZXBA 1BMGA 4OZGA 5TPWH 1G84A 2MQ3A 3TTSA 2DBLH 3VFMA 1ROCA 3EUDA 2HX7A 3UDWC 2JCCA 3L95A 1YY8B 1IKFL 4F37K 3L4WA 3BO8B 5T5FA 3WAKA 4G3YL 4DFIA 4NUJB 1ZSDB 5T33L 2C9SA 4HIJA 3L3IB 5HHVL 5IVXF 2WP3T 1BZQK 3SDCD 5HVHC 3NJMA 4MMZA 1LILA 4NAJA 5BV7H 1FAIL 1QMUA 3PF2A 5BS0A 4U33A 4YUEL 5FUZL 5C0EA 2J8UE 1T4WA 4YDMA 4JKKA 1KPVA 4OF7A 4HLJA 5IFJA 3TTYA 3QP3A 3WLBB 1T2QH 3ZKMD 2XQYG 3ULVC 1OAXH 4QRBA 5GQBA 4FFYA 4ICWA 1BG1A 2NY5L 4XP5H 4MJID 2R2BB 2MRYA 5TDPA 1EXGA 2OMUA 2XFXA 2H26A 4R0LA 3AZUA 35C8H 4PSPA 4FTDA 4E2OA 4NQEE 5C0CD 1P7KB 4XP1L 8CGTA 1BF2A 2XPYA 2ICWI 4PLOB 3NEOA 4Y1AE 2BVPA 3M17B 4ZK8A 4AENA 3ARRA 4RBPK 5F7MC 3EJTA 1AZVA 4X5WB 5DFWH 3I02A 2VLKD 2ROYA 1WQVT 5HDQL 1MJ7H 5IV2A 8PAZA 5GRUL 4BZ1A 2JJVA 3L13A 5DO2C 1AP2B 2GAZB 4LP4A 1CXIA 4XI5D 2X28A 3D2UA 3KPNA 3DMMD 1CK0H 1PYWA 3FRPA 2MHAB 1KGWA 1X5MA 4KI1A 4TTDD 4QHMA 1ZA3A 3RGBA 4AITA 1DQTA 2P43B 4GP8B 2XQYA 3ZZ1A 1RK1A 4F7PB 4N0CC 2E7CA 1EO8L 1DVUA 3MO1A 2ADJB 4FNSA 4QTIL 3GBNH 1M42A 4DCQA 4UQ9A 3VXSE 4X9BA 3EOAB 4YOKA 3RRQA 2G9HB 4PWKA 5IW6A 1UD3A 1FZJA 2VDNB 3RAJH 5LXVA 4TOYH 5F1IB 2AK4B 4QCIB 1LE5A 3MRFA 3HE7D 4L4TD 1F13A 3SBQA 1HILA 5JW5A 1OP3H 3C5SB 4G8EB 3MBXH 4WWID 1RUAH 3MNWB 1KJVA 3K2UH 4OKVB 4ELKA 4TNVF 2Z91A 4MVBC 3LIUA 2XSKA 3FCBA 4MRBA 5K93A 2C9QA 2E7DA 3PNWB 3MBWB 1CXHA 1H8NA 1Q9KA 3NJHA 4IMKC 5DO8A 4LIQL 5T1DH 5T5FH 3T0WA 3V8CA 4G43A 3MU3A 4H26A 2RGSA 2ADYA 1BFVL 2EO9A 2PR4H 3V52H 5C3LD 3MRQA 3MOBL 3ZTJG 5IESH 3BI9X 4I13B 1MCNA 2F54B 2IAND 1A0QL 1T4KA 3B1TA 4HPYL 1MHPL 4X6CA 3QJTB 4DOHB 4JQVC 4TRPH 1J8RA 5E99H 3Q6GL 5KSBF 3ULVE 4OGYL 1G7HB 4B9YA 2W95A 4FFYH 4WDIB 1KJ3L 4XMUA 3HI6H 1IC4H 4D0CB 1DDHA 1NMAL 5CEZL 1X9QA 5EBGA 3S48A 3ZGHA 1YYMH 5G5DA 4HAKA 1D7DA 2K4AA 1XGUB 3E6FB 4WUKL 5D1QD 4FHKA 1T0MA 3BPOC 4Q6KA 2J6WA 1TEGA 1HXMB 1FH5L 3MOAH 3QPQD 4JVWA 3T6QC 1JD7A 1J0KA 4BFNA 4A6YB 3ZZSA 1ZTMA 3DHPA 1QI3A 2IAMA 5L4MA 1I7ZA 4G80B 4U6VH 3SPCA 3IB4A 4Z7UB 4KKZA 1DFBL 3QDME 4PRHA 3HC2A 1YMMA 4KXDA 3V6FB 5B3NA 2HUEA 3VFNA 4P46B 4KTEH 4BZ1H 5GS3A 1S9KC 1ZTXL 2Z31D 3PL6D 5FEBA 1MXGA 2R1WB 4G70B 2AQ1A 4OIIL 3GMOA 5EN2A 4UUJB 2V2WB 3EJSA 1MLCB 3T0DA 2IADA 15C8L 1KYOK 4MDJB 3HUJE 2WMPB 4JHWH 1CFMA 4LEXL 1EJOL 1E27A 4RDBA 2KLRA 3VI3E 3QULB 4PJDF 4FXKB 3Q8CA 3B3IA 3ZU8A 3KVPA 3WJMB 5EBWA 1ACYH 5DUBA 2WLLB 4KK5C 4JFPB 4XXCA 1MDAA 1DJZA 1HHGB 2VSDA 2YPKA 3IN0A 3HW7A 2YD4A 3F7YA 3IDGA 5HD8C 1JDAA 3MLUL 1GGIL 2MIZA 4RFNC 3L5HA 4PJXA 4XOCA 2VQTA 3LNEA 4BK8A 3KXFB 4W81A 4JRYD 1KLFA 2IIJA 4IK7A 5C0BD 4WLCA 3FCSB 2VE6A 3VQ2C 3CXFA 2AXGB 5ISZE 4IS6B 4GAYA 3L5JA 4PCYA 5SWSA 3FUMA 5EORL 5E8NB 4U1HB 4J3OC 4AYSA 1ORQB 3RY6C 4AGPA 1VGEH 5D1ZA 4F92B 5I19H 2GTZB 3MV7B 4MMYA 2Y7SA 2XQBL 3MJGX 1A5FL 2VO5A 2ZWKA 1KYAA 2UY7B 2GBVA 4U1NB 1VA9A 4HWNA 5DXWA 1C08B 5CEYB 3V4LA 1BF8A 5AW0B 2R2HB 1AVAA 4LRIA 3SDDC 1BVNT 2KZ1B 4LEBA 4R4BA 5JPNB 3K74B 2CIIA 3QIUA 4I77L 2E6JA 2LU4A 2QQNH 4JK0D 3FPXA 4D9RE 4GUQA 3PWUA 3SKOB 4AMKH 2ILLA 5KTEL 4R4NC 3VQMA 5MERA 4FADA 2J8UB 5KAQF 3TWCL 4FQXC 2CNYA 4Y16A 1DVYA 1NDTA 2QGEA 2FCBA 1CXKA 3OZ9H 2VM9A 4WI2A 4PVMA 4RRPG 1B3IA 2NY0C 4BWUA 4ETYA 2FBOJ 5D7EA 4MA8H 2BXZA 3DGGB 1OF2A 3AG4B 4PFEA 3FCTA 4TSBL 5CLZA 3QUYA 4PS8A 5JIPA 3DX7A 1ZGLB 2JI3A 3SKNB 4E42A 4Y9BA 1NCGA 3DOSB 5BZWA 1BVNP 3P4OB 3H2WA 5AG9A 4TLKA 3DVFA 4IRZA 2RB8A 3CSPA 4S1QL 4ANVA 4Y2NA 1QZNA 4PJ5A 3GB7A 3ZTJH 3LDBB 1FQ9C 1QLRA 3CVIL 1TVHA 3D34A 2VNCA 3T4AA 1K3IA 1YEJL 4RMTA 2BDNH 3GSXA 1KG0A 4HOZA 2VDNL 6PCYA 2QVFB 2H5UA 1Y07A 2XG5A 3ALPA 2C1OB 5J56B 5EWIL 2HFFB 4RRPA 1N10A 3VXSB 2P45B 4PJ7B 1C16B 1M7UA 1MI5D 1MCOL 5DDHB 1HOCA 2HRPH 3D50A 3S3SA 4M5TA 3FTGA 3WHE1 2OK0L 5BVPH 5E1IA 3U30C 5D2LF 1SOKA 5DUML 2AJXL 1OVZA 3L4UA 3MRGA 1XGPA 3V5DA 2XA8H 5L9DL 1I1AC 1AI1H 3UZEA 3C6LA 3FXIC 3D08A 2BZDA 3U7YL 1JWMB 2ZUQC 1X9UA 5I23A 4PJIE 4LESA 4H40A 3A4FA 1IC5L 2XIIA 3D4GA 4L8SB 4N28A 4RA0C 5GHWL 5CKGA 2YKLL 2BXYA 4PGBA 1JUFA 4YS4A 1GIGL 5F97E 2WZAA 2DEWX 2NZIA 2XKNA 5E24E 3BP4B 4LPUA 4WO4C 4JFOA 1CB4A 2WUCL 1JGUH 2ZXGA 4LLAA 1GYAA 3KGUA 4UTAA 4QJ5B 1IEHA 1KV3A 3QO1A 4K3JH 4HISA 1X5GA 3VFWB 2XVKA 5DHXB 3ZDZE 1ET5A 2G2PA 5D7IF 2EDFA 2F53A 1CXFA 1E7UA 2F15A 1TETH 2R0KL 3HZMA 4PJEB 4OIFA 2J5LC 4J1UB 4RRPM 2BCKA 4L8CA 5EOCH 2GY5A 4PW3A 2O5XL 1G9HA 3C60A 3ECBA 3MJ7A 4O58H 4U3HA 4UQ2B 5EOTA 4UQAA 1JGDB 4CMHC 3DYMA 4ZT1A 4ZFZB 3IDXH 4A6YL 5HY9B 2VAAB 3K1DA 2Y69B 4JGUA 4MNHA 4WKXA 5LB1A 4AQ1B 1QBMH 3VXRA 3RNKB 3SQRA 2P1YA 1WFJA 1UB5A 4IOSA 4YH6A 5CGTA 3WDJA 5IQ9B 4HG4K 3QJZA 3OV6A 4D9LH 2CJ3A 3FU7B 1NBYA 4ODTL 1XGTA 4LLWA 5CJQL 3S9DB 1ESOA 2NSXA 2BY2A 4IRZH 2DQ6A 4W9FC 1N0LB 5BQ7A 1VFAB 4ONHA 3QDMB 2V5TA 2WIMA 4RGMB 4TNWF 4ESKA 2N3JA 2Q3ZA 4I18C 3EO0B 4NKDA 3DGDA 1H6UA 3LKQB 1W16A 4HBCH 5EU5A 3VG9B 4NB7A 5IGXH 3ARTA 1P6WA 3FB6B 3WFCL 3HUJB 4QHLB 4NNYB 4QRPB 3G5VA 1W80A 1INEL 3JWDL 2ZSVA 4P4RA 4OUUB 2UY6A 4LVOC 1KIUA 1J1XL 2VERA 2ZUWA 3W5NA 3IDYB 1B0RB 5E6IA 3DI2B 4NP4H 2P48B 3VJ6B 3FQ2A 3U25A 2CQVA 1R5WA 1G1CA 4FQLH 1HC1A 1SN0A 2SEBA 1CFTA 1MFDL 3BKCL 3LKRA 4N8PA 5J7CC 4Z5RB 4IBTA 3WLWD 2WXGA 1HEZA 5J11B 1L9PA 2F8XC 2AJUH 2D3JA 3TO4B 5AW5B 4NKIH 4DGVH 4ONOA 5D71L 4BFEA 1JK8B 1JPST 2EINB 1DBJL 3SE9H 1PIGA 2WXOA 3IAGC 1ND0A 1QSVA 3K4ZA 3RX7A 4I0PA 5IMMB 2WSDA 2DDQL 5BW7A 1CLOL 4NFCA 3H9YA 5EBLB 5IUCA 2G75B 2X89A 2N7SA 4F7TB 4J8RA 3ILQD 1HZLA 2PWDA 4L1SA 5CF3A 3ZSSA 4H88H 1JI1A 4E9VA 2FJHA 2B16A 2X3BA 2WYZA 5KJ4A 1UXMA 5HJGA 4ZAKB 4H8UA 5JQHC 3WFDH 3BHBA 4PJ8C 1NGQL 3IN2A 3WIHA 3OPUA 3N42F 2NCEA 4XO8A 2VDRB 2Y7MA 1X5YA 3B1UA 1GJIA 4WJ5B 4HXBL 4A1RA 4IJ3B 3T2QA 4Z76B 3RNQB 1DVXA 1NGXA 4X4XB 3VFSA 2OL3B 4FOMA 1TYEB 1ZT4B 4OVVA 1RMFH 5L7XH 4X6FA 3BVNB 4M6OH 3VI4A 4L1HA 3OPZH 2XICA 3W38A 2WHVA 3DLQR 3FT0A 4PWEA 5I1AB 1DVSA 1EAPB 5I6KA 1W0VA 1YNLL 4AXWB 1J8HA 4P23A 3EXLA 4IRSD 4HSAC 2EIEA 4DQOH 5DUPL 1MZYA 1MIEL 3O3BA 1LHZA 4KX8A 3KJ4B 3T0ED 1EFQA 3PWJA 4AJWA 3VFOB 4NN6C 4AGMA 3CDCA 2KMWA 4GT0A 1OAYH 1PD6A 3FFDB 3T3MB 1UQSA 1IQDB 4P3CL 1C5DB 3D3VB 4HHAA 2WXLA 3VFRA 3V9CA 4IBUA 1NC2D 1DANU 3PAYA 5DCCA 1D5MB 3RUGA 5J9PB 1OM3H 4GW4A 3GMLB 1NLDH 2JNZA 5FYKE 4P5TB 2EACA 3VDAA 4CBZA 1EEZA 1U2YA 1ULVA 3QIWB 3FTVA 3WHXB 1OT1A 3MJWA 1JNNL 3ESNA 3L3HA 4QT5A 2ENPA 4XVOA 5I75C 3X3GH 4KFZC 4LXFA 1SOXA 4KKCD 3HHMA 4NNPH 4Z0XB 1TTBA 3S88L 3MLSH 4JM2D 3U2IA 3FN3A 1BOGB 4M6NL 1ANUA 1LEKB 2AV1B 4JDZB 4FQ1H 2H45A 1DSYA 3VTMA 3SE8L 1MREH 4HIPA 4XWOC 2EDHA 3FC8A 3EO9H 4BUHA 3ATBA 5MENA 5BVJB 4GXVH 3I6GB 4OZIF 2BK8A 5CP7B 2L7JA 4CW1B 3EOBB 4Q9QL 4CNIA 1XGRB 1RHFA 2CLZB 4CSZA 3BUDA 4UNUA 3UAJC 4V1DA 2BC4B 2YEVB 2ZCKH 1BX2B 2VDKH 4K5OA 4HPHA 3PY9A 3KYKL 2NY3D 1JHTB 2ZX6A 1RHHA 1UKTA 4FS0A 4M61A 1KGXA 5DRNA 3NRFA 1OXYA 1S9YA 4NAMA 4XP9L 1JF1A 1XO8A 3SDAA 1NTDA 2XT1B 2VUOA 3PWNB 5FM5O 2A9NH 4N9GA 1A4JA 3MGOA 4FQXB 4ZQKB 2FX8H 5DZNA 5PCYA 4F9PA 3ETSA 2JF1A 3UTSE 1KB5B 4JFQB 4EQ3A 4GSQA 3TEWA 1A7NL 1EHKB 3IKKA 3WIHH 1T1YA 4NBYB 2DAVA 3CVHH 4XVUD 2IWFA 4OF8A 3QAQA 3PHQA 5GPRA 3UBXI 1CG9A 1QNZL 1P4IH 3BZEB 4KWUA 3HB3D 4QRSB 3C08L 4HS3B 2Z1KA 1JYVA 1SXZA 3TFKC 4X7TA 1OAJA 4WV1B 2IDSA 1PZ5A 1B4JH 2ENQA 4Y4KB 3PWPB 4W9KC 4X9YA 2Y7QB 1RJZB 4DTGH 5TE7H 1JN6B 2JJTA 2ITDA 4L4VE 2I25N 1SJVA 1EGJL 2DQGH 3LQAH 5CGYC 2ICEC 3IFOB 5DA4A 3MLXH 1TFPA 5IG7A 4JRXE 2ATPA 1GC1C 3DPBA 3LQAC 2VDPB 3ASWA 1MJJA 4FQCH 4ZFGH 2L7UA 4Q97A 2X4UB 2ED7A 5IEKA 4XPBH 5I1LB 1GGCH 2EDMA 4AOFA 5AUMA 5FR3A 3F12B 4KZCA 5FO2A 2A6JB 2BJML 3DX3A 5D7SL 4M5SA 3RTQC 4BE5A 5KN5A 1QVOA 1H5BC 4FERA 4IOFC 4LSQL 3IWUA 3P73A 3QUZB 4L8DB 3G6JA 1U21A 1SJMA 4JQIA 3C2AH 2K1MA 2X2YA 4HH9B 1U58A 4W4NA 4LSSH 4YZFF 4ENED 2YEZA 3VE0A 5L88H 5BUAA 1T03H 2RFXA 1U92B 2EXYC 3HJEA 3CU1A 5C6WH 3BZ5A 4W9CC 1QBLH 1M57B 2DKSA 4QY8B 2EEXA 2NZ9D 2OMYB 3BP5B 3TN0B 1IRAY 1T6BX 2GJRA 2O26U 3DGCR 3VTTA 4H8HA 4K55A 1AOZA 3BWZA 4KMTH 1NJ9A 2DQMA 2VDQH 5I26A 2QADD 2PTUA 2B1OA 1T7XA 1MLBB 2DWSA 2WZ0A 2Z9TA 5FYJD 4R26L 2RA1A 3L7EB 3MFGB 4HUUA 4JKNA 3KYMA 2E9GA 4MXQD 1FZMB 1IKFH 4G42A 3SBPA 2BOCB 4ATTA 2ZTBA 2ZOOA 3VSQA 2BO0A 1KCVL 3RWHA 4OCLC 2CHXA 4WI7A 4G3YH 5AW4B 3ZTNL 3GHEL 1VB9A 1Z66A 5EC2A 5T33H 5CEXA 2J5LB 5HHVH 4S0TD 3ATFA 2WK2A 1BIHA 2EECA 3CDYA 3F7RA 1BQRA 2Z0UA 3MA7B 2JTDA 1MCDA 3VM5A 1KC5L 4AVKA 1FAIH 3K4AA 4KRMB 2PO6A 2C26A 1WWCA 2FR4B 1P9MA 4YUEH 5FUZH 4UT9A 2FQGA 1S7WB 2H8PA 3ZYIA 1IBGL 4POUB 1WIPA 2WBJD 4Y4FB 5CD3A 4FFZL 1JZDC 2NY5H 4MA3A 4G9FB 4X9HA 1LDSA 3OVUB 2NY5C 5IJKA 3EFOB 5DK0B 5KSAA 2WWKT 1CE6B 1AIZA 3N06B 4XP1H 3Q01A 1H0DA 1CFQA 4BCZA 2C3VA 4JG9A 4PJHF 1RP8A 5EOCJ 3GXMA 3OKNB 3L1FA 2O5ZL 3PQYB 3QK0A 3OB8A 3QARA 3DBXB 4D0DB 4HXAL 3KW7A 1KNOB 2I27N 3R8BB 3CDZB 3GXNA 3O6LL 5HDQH 1YAIA 3FTWA 4I3GA 5F7NC 5GRUH 2GBUA 2UXFA 3BT2L 1WGOA 2O6FA 1KIPA 4L2LA 4YLCA 4DVBA 5ITFA 1CF8L 1WFUA 1IAKB 3CCHA 1AGFA 3N0PB 4MNQD 3VFGL 4BDVA 1ZHKA 1XD1A 4OLZL 1EO8H 1JNHA 2RH0A 3BH9B 2EJ1A 4UOW1 1G6VK 1I53A 1JZFA 4QTIH 2FO8A 4HJEA 2CRIA 4XHJC 3SKMB 3O9WA 3WBDA 1N5AB 5I74C 5AAWC 1GJWA 5ESAA 5A16B 4ES8A 1E8WA 3CFQA 3QR0A 4LCUA 1CFSB 3QFDA 5IMLB 5EZLA 2IC2A 2QLVB 3KYNB 4TL4A 1WD8A 2VLJE 3V5HB 1YY8A 5SX5H 4Q6IB 3TASA 1A65A 5IHBA 4JM2F 3BO8A 1SJEB 5I71B 4NUJA 1ZSDA 3C5ZC 4G1EB 3WN5B 1I8LC 5JUEL 3L3IA 1AGCB 5E1QA 1PLGL 1LO3L 4PRPB 5AVTB 2J2ZA 1IV8A 4XMLL 3WNKA 1TITA 4YQXL 4JPIB 3FKUS 4X42A 2C3WA 4Z7NF 4LIQH 1CICC 4U6XB 3OKEA 2ZKWA 2M2DA 2ZG2A 3NAAL 4LARL 3OJVC 3WLBA 1BFVH 1OANA 4JY5L 1CT8B 3TJHD 5CLWA 1KF9B 3MOBH 4QD2E 2DD8L 2BMKB 1A0QH 2R2BA 4HPYH 1MHPH 5K33A 1DN2A 4PJ8B 4DKAA 3OB0H 5C8JB 3BSGA 2R69L 4OIAA 1KCSL 3DETC 3IK2A 3JV6B 3Q6GH 1P7KA 3MRCB 4OGYH 4WFFE 3ELQA 2H3NA 1P69B 2WAHA 5DZAA 1BPVA 3ARDB 5IQLA 3IFPB 3NCJL 1KJ3H 3M17A 5FFOA 1NMAH 1GPOL 1UH4A 5CEZH 2VDPL 5A2KH 5FOBB 3F04A 3NG5A 2OSYA 1JI2A 4WUKH 4L4VB 4OZHB 4DP6X 1FH5H 1SBSL 1AP2A 2GAZA 3ZT6A 5I18L 3SKUD 4M3HA 5AOZA 4UM8B 4JRXB 3FQRB 1V10A 2MHAA