4A7SA

Structure of human i113t sod1 mutant complexed with 5-fluorouridine in the p21 space group
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7sA00
1E9PB 1F1DA 3H2QA 1YAIA 3MKGA 1PU0A 3CQQA 1CB4A 2GBVA 3GZPA 3HW7A 5CU9A 1OALA 2WYTA 3KM2A 4BD4A 1B4LA 2Q2LA 2AEOA 2AQSA 1IBDA 3KM1A 2JLPA 2Z7YA 3SODB 1F18A 2WZ5A 1E9PA 1RK7A 3KBFA 3MNDA 1COBA 2WKOA 2WYZA 2AQRA 5KBKA 1Z9PA 1CBJA 3K91A 1P1VA 2AQTA 2VR6A 3S0PA 1ESOA 1YSOA 2WKOF 1XSOA 2XJKA 1EQWA 1E9QB 3GZOA 2Z7UA 2VR8A 3KH4A 4N3UA 3L9YA 1OZUA 1SXZA 1OAJA 4A7VA 3T5WA 1UXMA 4A7SA 1XTMA 4BCYA 3L9EA 2ZKYA 3GTVA 2Z7WA 1QUPA 1E9QA 4MCMA 1TO5A 2WZ6A 3ECUA 4A7QA 1S4IA 1IB5A 1SXAA 1SRDA 3LTVA 4FF9A 2GBTA 1L3NA 3F7LA 2WWOA 1YAZA 2V0AA 2E47A 2ZKWA 3GTTA 1OEZW 1PTZA 2AF2A 3KH3A 3GQFA 1JCVA 2AQNA 2C9VA 2K4WA 1DO5A 1SPDA 2Z7ZA 1SDYA 1BA9A 1PZSA 2ZOWA 1B4TA 1JK9B 2GBUA 4U4IA 1EJ8A 3HFFA 1HL4A 1F1GA 1IBBA 1SOSA 2WZ0A 3KBEA 1FUNA 2APSA 4L05A 1KMGA 1F1AA 1Z9NA 1E9OB 2R27A 1TO4A 1XTLA 3ECVA 4N3TA 1HL5A 4MCNA 2NNXA 2C9SA 1JK9A 4OH2A 3GZQA 1MFMA 1IBHA 2AQPA 1Q0EA 3F7KA 3CQPA 4BCZA 2AQQA 2C9UA 3QQDB 1E9OA 4A7TA 2SODB 1N18A 2ZKXA 2VR7A 1IBFA 1AZVA 4A7UA 3PU7A 1SXBA 2E46A 4A7GA 3H2PA 1SXNA 3ECWA 1SXCA 1SDAB 3QQDA 5KBLA 3CE1A 1BZOA 4B3EA 1SXSA 1U3NA 4A7GF 4OJAA 1OZTG 1N19A 1DSWA 1UXLA 2JCWA 3RE0A 2WWNA 2XJLA 3HOGA 5KBMA 2LU5A
chains in the Genus database with same CATH superfamily
1VCAA 3QJZA 5F3BA 1PCSA 1KULA 1XVSA 4X0KB 1SOKA 1N6QH 2FZ3B 2P43B 2MPAH 3DGGB 5IGXL 1CU4L 1E4XL 3LKNB 4Q89A 4QGYA 3VXRB 1T7YA 1D3CA 2VZ3A 1R3HA 1YEIH 3IFLH 5GS3A 3KVQA 4GI9A 4AYEC 3MNWB 1XR8A 1TQSA 2VSMB 2NQCA 2NY4D 3VUAA 4I3SL 1LMIA 4OV6F 3PL6C 1D5MB 3O3UN 1E50A 4PJXA 4F1SA 2GIMA 4XI5D 1YUHB 1BYNA 3CQFA 5LB1A 5KSBA 3I84A 4XO9A 1BVKA 3LNIA 1N6VA 3MRFB 4JFVA 4LLUA 5J8OA 1H6FA 4QNPE 3OHXC 3UBXG 2NY6B 1LL1A 1HSAA 3GBMH 3HUJE 1O6TA 3G5VA 4QRPE 5A2KH 1JV5A 2NYYD 1P7QA 4NCC1 4P59L 5AYUL 3NDZE 3X3GH 4BKLB 4MB4A 1QSFE 2Q8BH 2APTA 3L3IA 2EDDA 1GTFA 2ZUYA 4R0LC 4D9QE 1JZ3A 2DQHH 2PP9A 4KKNA 2EP6A 4BZ2A 3VO0A 2ZCHH 4M7KL 4WWKB 2E86A 4N85A 3SHSA 3JV4A 3MLXH 5EFIB 2WVSA 4PBWD 5DLML 5ICUA 4IBVA 1HHKA 1XF3A 3CLFL 3G08A 4PRPD 4XPBL 2FIKB 1E3XA 3JBG7 5EU6D 1IC7H 3DDFA 3M7OA 4X6BB 4C55A 3I3BA 3GMNB 2VDOB 4UQEA 1TZIB 3SCMA 4GAJH 1QRNA 1KY6A 2BHYA 1FIEA 4XMLH 1W72B 2PYEB 3LDBB 3K8MA 4K7PH 2BO0A 2J73A 4PJIB 1KMGA 4MD0B 4MVBD 4Z3TA 1BFVL 4DPAX 4YSOA 1L0YA 3MZTA 3DBSA 2Y36H 3NJXA 2BNUB 4ETYA 4MXVE 1M1XA 3CK0L 5CD3A 3FT4A 3CVHB 4JKMA 4HGKC 2XI9A 5I18L 43C9A 3VXSD 2GUOB 2ISDA 3RGHA 2OYPA 4F8NA 2WBXA 1CZ8H 1JOIA 4Z3EA 4PVLA 1RJYA 1UWFA 3QDMA 2J2ZB 3OKKB 5SWSA 3OGCA 2QQNL 5DYFA 1E27A 4Y16C 5FUZL 3PDDA 3SY6A 2QGEA 4CJ0A 4I0PA 5E2WL 4RMRA 1HDMB 4ZDHA 3LH2H 1IJ9A 3KLAB 3RBGA 1V3MA 4RZCA 1LO3L 1S7QA 2WO4A 3LAFA 3ARZA 2XUWA 4DGUA 4OFVA 5ID1A 2WWMC 1XZWA 4M6NH 3VWJB 3EZ8A 3CZNA 4Y2DC 4KK9C 3P54A 4WHTA 4EZKA 1W8NA 3LCYA 3AG4B 1B88A 3MFFB 3Q2LA 2EIBA 4FCHA 4W9ZA 2BFVH 1F00I 2GBVA 3CN4A 3IM1A 3OAUH 1YYMH 4HVBA 5DT1L 3TA3A 5CD5C 2JB6B 5CZXC 2CLZA 4FXTA 1BCIA 4L9LA 1F0LA 4E5XG 1QBMH 5T8IA 2HJFB 2DTML 4G1MA 1ZT4B 1H6TA 4N0FB 3DWTA 5MEOB 5I1EH 1KOAA 1AR1D 1P1ZA 3MUZ1 1LNUB 1QKZH 1QVOA 4H20H 2OZ4A 1XGYL 1D5ZB 1E30A 4JEGB 5HSFA 1XSOA 4O02L 3OF6A 2IBBA 4J1UB 5CJOH 1NIEA 4PJCB 2WCGA 1ZT1A 2JQZA 3IU4L 2Z8WC 3MACL 3O3AB 4JM4L 3ULSA 1G7MA 2C3VB 5DJXA 2K7PA 1N59A 2HFTA 2QPEB 1PL3A 3TFKC 1MVUB 5C0GA 3TCLB 2FJHB 5KYYA 2UYLB 3GXTA 4PH8A 3UZVA 2OXGA 4JREC 4PJDE 1I8KA 3TT1H 2EUWA 3D34A 5DZAA 5CUSL 3KYKL 4HK3N 4U3CA 3FT9A 4L1SA 4KQ0A 1W15A 1VLXA 3IYLW 4N20A 5D2NB 1E28B 3U30C 4FTVA 5MI0B 4LLVA 3QQ3B 4P5TC 3CDCA 3WJMA 1EEQA 4NERA 4G8EB 5DWUL 1M7UA 4WY7H 3FSZA 2F5BH 1A6ZB 3K8LA 4F9PA 4PV9A 3T04D 4BFEA 4JY4B 2ZP0T 1L0QA 1AZCA 4FFYA 1RMFH 3CBRA 1JPTH 1NEPA 3P30H 4PJ9A 1UURA 4XO5A 4Z3IA 1LHZA 1UB6A 1QAWA 2P5EB 3MV8D 2MCPH 5JPMA 4NZFA 4E5XA 3OX8B 1MWAH 2IPTL 4FA7B 1BIHA 4ZX3A 2HG5B 4TUKH 2GSIB 4NN6B 2O6CA 3HHSB 4JJHA 4XPFL 1YEKH 2VDLB 4Y1SA 1SGKA 3KBHE 2VITA 1T6WA 4R5VA 3WEXA 1AZVA 3NZ8A 3VTMA 4F57H 4XP4H 4LLWB 5HYSG 3II3A 4Z7VB 1YEJH 2L4OA 1T21B 2BP8A 2CH8A 5IBLC 3WY1A 4Z7WE 4AITA 1CLZL 4M5YL 2UXVA 2IXQB 2YFOA 4XCCL 2AJYH 2EC9T 2WM0A 2HX8A 4LNVA 3JWDH 3QULA 1PZ3A 3BZFB 2Z6FA 5IOPA 5HXMA 1ZS8A 4WNQB 2GJ6D 4PJFE 5E8NB 2OTUB 1NCHA 4K9EL 1BD2B 1P2CA 2N7BA 2R7EA 4YSUA 3NPZB 3RVTC 3UG4A 3D69A 3MBEB 1ES0B 3MNMA 2EDBA 3TZVD 5KJ7E 3KEHA 4BIKA 3H9SB 1D6VH 3SPHA 1AOHA 3GJEA 1OO2A 3NRFA 3BVNA 4ZX4A 2FBOJ 5MENA 4PBVC 4KKLD 1JGDA 4YIQB 5KYXB 2WXHA 4UM8A 3WSQH 2D03H 3VGAC 3LV3B 1ZHLA 3T3MB 3QIUB 1NFKA 3LJ3A 1CYGA 4ANWA 4NGHH 2AXGB 4XGZA 2P9RA 2XXFA 3AG3B 3CFNA 3VFUA 2DB8A 5EOCL 3NZUA 3IRCA 2OMXA 4JM2F 2NY1C 2WZ6A 3EYOA 3SQBB 3TYGL 4PJ5B 3ZKNC 3QO0A 2R56H 3C2SA 3BQUD 1VFBA 3N44B 3H3PH 2EDYA 1KJVA 5TGBB 4X7SH 2XZAL 2YAEA 3KPSD 3L3JB 4XC3H 5HGGS 2XCMC 4W9DC 5L7XL 5EBMB 5T33L 1C16A 3C87A 2WUCH 3CHPA 3LPWA 4OVUA 5J6HB 4UT9L 4R2GB 4IBSA 4AI7A 2OL3A 4AUUA 4RVBA 3SDYH 3ULVH 1NGWA 2PN5A 4G11A 4JG0H 5L0QB 3EHBC 4FXKA 4K7PX 2F53E 4XCEB 1IAMA 5AB2A 4QRRA 4PMFA 3VNYA 4WENB 2CWRA 4AKPA 1WLHA 2WANA 1EHXA 4WU7B 1X5YA 1ADWA 4I85A 4PBXA 9PCYA 1QATA 2XKUA 2OZNA 2WB7A 3GXNA 4P06A 5FPIA 5FOBA 4KK5D 3V4PH 2UZIH 1NMBH 3IDIA 3O0RH 2FCBA 4KI5E 3WFZA 4PN6A 4AE1A 5I0VA 5F44A 4GW5B 2I9TA 3JVGA 4JO3L 5E5RB 5ITFA 3A4EA 3E2HC 5AKSA 3FULA 1J8HE 1SXBA 3TPUB 5TQ0H 5KBPA 2VLRD 5HJ3A 4MNHB 3A22A 4B96A 3LZNA 4G9FD 1UA6H 4B3EA 1U6AH 3P3SA 5DFAA 1GOFA 2EEAA 1U8OA 1IC0A 5GGQH 1NUFA 5T1JA 5FF6B 4ABUA 4KXDA 5E8EB 4KZDL 5HI3C 3V6BR 2ADIA 3JWNC 3BIBX 5LN8A 3MN8A 2ZWZA 1MRDH 4E9VA 3FFCB 4QAWA 5G55A 3RWCA 1D6EB 4IBYA 1PGRB 2ZOKB 4JR9H 4DAGH 5L2JA 2JELL 1YJDH 2DQUL 3QXDA 2E5EA 3G3LA 2VWEE 4K71B 3TBVA 3B6SA 3T8XA 2QR0A 4QXWA 3STBA 3NIGF 1R33A 1RFDL 2FHFA 1GMEA 2PWGA 5DTFB 2RHEA 2Y7QA 1JDCA 3RZCC 4BXVA 1S9VB 3ULVD 5CWSB 3IMSA 1SM3L 5DHVA 2ENYA 3LEYL 4EN3D 5JIIA 4U2YA 4BFIB 2A6KA 4HEPA 5GS1B 1GC1H 4GLRH 4U1KA 1CXEA 2BWDA 1KCVL 2BS71 5A7BA 1GGBH 5JUEL 1RV6X 3PFQA 1MKFA 2SEBB 3SY0B 2EICA 3WLBA 3U7AA 4AKOA 2QHLA 4HKZB 5ALCH 3VXUD 4Q58C 4DVRL 5GS0H 4JLRB 5HDBB 2BW4A 3EYUH 3O6KL 5F6IB 4IRJA 2V2WB 1DHKA 4LCCB 5C9JB 4ZW7A 3IFOA 3QISA 4I9WD 1MFAL 3MNVA 4F7PB 2O5NA 1J7VR 1Z9LA 2IDQA 2DI7A 2VUOA 1KFGA 1AE6H 2CIIA 4DZ8B 5DEZA 4LLQB 2ZZUT 3T1FA 3NIFB 2XPYA 3L9RA 2XG4B 3B7SA 1VZIA 4JFOB 5I9QB 3ZVVA 5KSBE 2XACC 4S1RL 2YGPA 3L81A 4PLJD 2RB8A 4H8WH 5C0RL 4NBXB 5F1NA 1F1GA 3GTNA 2J25A 2DIJA 1UCTA 4FL4C 4DN3H 1AMYA 4ALAC 1S9WA 1XEDA 2EZ0D 3FSAA 1NANH 2YJLA 4HF5H 3WNPA 2YD5A 3KCPB 5BPPA 3IAQA 5IJBC 4QRFA 1TO4A 3DUUB 4N2HA 1N68A 4MKTA 3N1GC 2KPNA 4QYOA 2H8PA 2UWEB 2ARJB 1A3LH 4NKMB 3ALPA 4ZMAT 1HNGA 1PKQB 3K6FA 4QXGH 3RNKA 3VFWA 2VDQL 1WWAX 3RX9A 3D39D 5EZPA 4IGBC 4TNWK 1SHSA 1IVTA 4ETQB 3F5WA 1ITBB 5C6PB 1QRNE 3GXMA 1BFOB 1SXCA 4FGMA 5D7IB 3TEYA 5KBLA 1D7CA 1YHPA 2WVUA 4ZTOH 1KJ3H 3QK0A 4KX7A 1I1FB 2FE0A 5GS0D 3QXUA 3FUMA 4WI0A 1FFQA 1AAJA 1JZFA 4QOKA 2DWTA 4FYTA 4OY9A 4XN5A 3BN9C 3TH2T 3ZIMA 2MWCA 3DMMA 1FH5H 4H8HA 4YXHL 5IV2A 4FNRA 3T3PB 3HZMA 1YEDA 1R24A 3KLDA 5IQMA 3C5ZC 2G5UA 1AY1H 3LRLA 3O8XB 2OSWA 1YNTB 3QDME 3DRQB 4UDTA 1DN0A 5SWSE 1C8QA 5DMIH 4CN6A 4XMUA 5E2VH 3D18A 1V54B 2AJSL 3VNZA 3D2UA 3NQIA 4R26H 3WELA 1FZMA 3AB0B 1GZPB 4MXWL 4RZKA 4OBSA 1T5KA 4MDJB 1JGLH 3FQNB 2ATAA 1Y6MR 2WSPA 3C2AH 4NWTH 5FO9A 5D1ZI 5DHXB 4TNEA 2Y9RT 2XXCB 1JERA 2XTLA 4KZ0A 4FQJH 4N0CC 4E0RB 1NH6A 5GGRY 3HRZA 5KSUA 3NJVA 4BA8A 1KCLA 4XR8C 1F4YL 1ZWIA 3OKOA 4JN2A 3D8MA 3QDGB 2L7QA 4FLOA 1TVHB 3NCWA 1IB5A 2ZCKH 4IU3B 3U1QA 5CP7B 4DEUA 5IEHA 3GMPB 5DVMA 4MX7A 2WMPB 5DQDL 5DJ2A 3UEZA 1AZZC 4YSSA 1BF2A 1RJZA 5FDWA 1HYRC 4YUEH 1IBGL 2EABA 4R7NB 2FX7L 2K6YA 4TTDC 2E7CA 2DJMA 4IHOB 4UWQB 4AZUA 2AMGA 3MRBB 2J6EH 1E2VA 4QHLA 5JHDD 1A1MB 2D7QA 3D9AL 1JYNA 4PP2B 2ICWB 4WKZA 5JIMA 3HEIB 2EVGA 2XFXB 3MOAH 1XWVA 3UJJH 2J8UF 3RJQB 1QI3A 2PYFB 4HWEH 2LW3A 4C83A 1I7UB 2AFNA 5AOZA 1E4HA 4N2CA 5IEKA 2NSMA 4N22A 3PAZA 4HHAA 1NAMA 3AVEA 2UXFA 3SE9L 4M5SA 4YX2H 1R5WA 2ICEC 4K2UL 1GAFH 3ZDYE 1WAAA 2G3ZA 1AHWA 4PRBA 1HHIB 5TDOA 1EFXB 4ZMWA 5F9JA 5F1KC 3RUGA 1M05B 5IB1A 1UA3A 2C4FU 4RISL 4HS6A 1LQBC 3DO7B 3RDTA 3VFPB 2VN4A 3Q13A 2VW7A 5MEQA 3AZUA 2HJKB 1EDHA 4EKXA 3AACA 3OBAA 3QJUB 4FTVE 3OKNA 3LNDA 5CKAA 3NP4A 3EH2A 4BFRA 4G3YL 1G0DA 2AQ3A 2HN7A 5HGBA 5F3HB 1KBPA 2QT6A 1TPXC 5EA0H 2CJUL 5CGMA 3SJVB 2WUBH 3T09A 1S78D 5DYOB 4KI5C 3VSUA 4L3AA 4OR1A 2WPGA 4YK4C 3G6JA 2EXYD 2Z31D 4TPRL 5A6LA 3FQYA 4QD2E 3SPGA 3B2UC 1N64L 4L23A 1HSBB 3QDHA 1IC4H 2R2CA 4BZ2L 1U92B 4ZQTA 2WQXA 5TDNA 2W59A 4M6OH 1KDJA 2DQTH 4MD4B 4F2EA 4MGXA 1WC7A 2F7OA 5EULV 4M93B 1LEGB 2XPZA 1IV8A 1QEWA 3ISYA 2DDQL 2ZUTA 2H3NB 1K4CB 2VXUL 4QHNA 1B9KA 3NTCL 4MA1B 3EJPA 1RK0B 2JCCB 4LL1A 1E5CA 2OM5A 4ODHH 1DFBH 4JB9H 2IALB 2AJVL 3DOSB 5I8CB 4WV1C 2OMUB 3RL1A 1MHHB 3HNVL 5T5FA 4OZIB 4NO5B 2Q86A 1KB3A 1ITCA 2HJLA 3TU6A 4M1GH 3Q2WA 5IGXH 4GXFA 1E4XH 3NOIA 4CMMA 5BXFA 1HKLH 2QSCH 2WXIA 4LU5L 1A6UH 4P3CL 1CICB 2ZSWB 3LKOA 5CBEB 3ZUNC 1AACA 2ZKHH 5E2UH 4AQ1A 3L9EA 4PB0H 3LB6D 2Z7WA 1BGXL 4YHNB 2WGXA 1SLWA 5BS0D 3TJHC 4BM7A 3BRGC 2Y1VA 3GDCA 5D8JH 3TASA 4WRLA 2R59A 5DVOA 2HT3D 2A83B 2C7UB 3TBWA 3CXDL 5MENE 2GIXA 2IGFH 1S7RA 1ORQA 4LLDA 3TOPA 1B6DA 1IEAA 4Y4KB 4FQLL 3DYPA 4K94C 4Z7UB 4U1GC 3QZLA 2IAMC 1BQHB 3O6FB 3MLTB 4W9KC 1DBML 2PCFB 4OZGF 5JOEA 1XSIA 1JUFB 1XF2B 2DMKA 4YDNA 5C6WH 1NGPH 2BJML 2Z4QA 1CD8A 4EDWH 5FCSH 4R96B 4HS8L 4LSVL 2VAJA 2ZP9A 1J8KA 2Z0UA 2JIXA 4FRWA 3CLFH 3SKUD 1CD9B 3E8UL 1O7DE 2FYYB 3L8QA 5H94B 1G7JB 4AV5A 3T0BA 3TYFB 1U8KA 5SWZB 4NNYA 4ONFL 3VDAA 4YLCA 2ITCB 4PG2A 1ZGLB 5AAWC 5JA9A 1KGCD 1T1XB 5CMAB 5DVKA 3VI3F 4PGEB 3VX1A 1A6PA 3D1MC 3OLEA 4A7GA 2AITA 4ODXB 2RD0A 1BFVH 2DQFB 2KYIA 2VLKD 4HIEB 2OR7A 2B3RA 2CDEB 2NZ9C 1TZGL 3NP3A 4TNVF 3C60D 4BFNA 2EXWD 3V4VA 5IQ9A 4YPJA 1D9KA 4QRRE 4BFFA 2J5LC 2OJZH 1X4XA 4G6MH 5EEWA 5CZKA 4F3FB 1J5HA 1DQDL 3O2VH 5EG6C 4FZ8L 1ID2A 2WQ8A 4Q97A 4JM2D 2XOTA 3QUHA 1UM6L 3QIWB 4I8DA 1YDPB 32C2B 1N26A 1OM3L 5B38G 3T0EC 3KM2A 1QNIA 2QQNH 5A2FA 4CNIA 1JNHA 1O9ZA 3C8DA 5E2WH 1V7NL 2PO6B 4PJ7A 4MJ6A 1TYRA 4MNQB 1T04B 3BFQG 4R4FL 4M00A 4L8DA 1R5IB 4WJG3 1USZA 4JFED 2XRAL 4LHJB 1DBBH 2I9LB 2LV4A 4A37A 5DHYB 2PXYD 5IIEB 5FYKL 3V6OA 1GTNA 1UXSA 3EJYC 3ZL4H 5AG9A 4PJHB 2AEWA 3IGFA 3T77B 2NY4B 2WBKA 1FNFA 1VIWA 1BF5A 2FD6L 2H9GA 4JRWA 3N43B 5AVRB 4IKKA 1C12B 2VLMD 3ARGA 1IM3D 3BJ91 2O6FA 2DTMH 2B5IC 2EE9A 3GNML 2WNGA 4HJ0C 3PXLA 2QGCA 4K5PA 1JDAA 3BWZA 1XGYH 3IDUA 4GG8A 5CLZA 2A6JA 4AL8C 1QTSA 4M8VA 1UH2A 2GIYA 4OAWB 1URZA 3WO3B 3CG8A 3LQMA 3IU4H 1CDBA 4X98A 4Z95H 1KXQA 1RUML 1ZDSA 4UQCA 3W56A 2YKLL 8CGTA 2X7LA 5IKCA 4NS0A 2TRYA 1I9JH 1ID5I 3ILQC 1SOSA 1EO5A 4JDZA 4KRPC 4AE0A 3MRIB 1HHGA 2X0WA 3EJZD 4F2MB 1HH6A 1TKWA 1CO1A 1F4XL 1YC8A 1FG9C 3IJ8A 4PRPB 4CC0A 5J5EA 1DEEA 5E0FA 5EU6B 4W9JC 1FRGH 4L5FE 4DUVA 3NN8B 3KPOA 4G8FA 4OCSL 3S36H 1T1YA 5CCKH 4G9DA 3HI6H 3BN3B 3SBWC 5JHAA 1ONQA 3KYOA 3QZMA 2QQLL 4IKJA 2E6PA 2QHRH 2JKWA 2FLBT 1KJ2A 4OZHA 4ZXBD 3S4SB 4DO5A 3OSVA 4HUVA 2I7SA 5LGJA 1SEBA 4ONGL 5E7BA 1OCWL 1FVCB 2F1BA 3LKPB 4Y4HC 3EGSB 3MRQA 5J56B 1PDKB 4W9GC 1U8LB 3UIZA 2KZKA 3PGDB 3VXSB 2UV3A 4LFHG 1JHKL 3CE1A 1BZOA 1YA5A 4A6YH 2R4RL 4C56A 1CXIA 2OV0A 4ZQKA 3EGXA 1MCDA 3UAJA 5TQ2L 1NCTA 3UC2A 4H2CA 3EGDB 1R3IL 4XPFH 4N2IA 3RX8A 5J7CC 3FO0L 1KB9K 1LE9B 4I18B 1AXSB 2VO8A 3IJHA 4Z7OF 1FSKC 5EO1A 3ABLB 4IK6A 4PCKA 1EEYB 2CDGB 1YO4A 2ZWNA 1CTMA 5F97E 3UC0L 3EG9B 1F41A 1HYSD 1XZ0B 1WP6A 1IQWL 3DJZA 5I1KH 1VENA 2GSGB 1J1OH 3NAAL 3OQRA 1JF1B 4L8BB 1RUKL 4I2XB 1HIML 3HLAA 4QHUB 2H6PB 2NZIA 3PWPA 2CRZA 3DVFA 5D1QD 4L37A 1HQRA 4KXCA 3ZTEA 1CDCA 1J18A 2X0VA 3CDYA 4ILDA 2OL3L 4QOKE 2XZCH 5CCJA 4NQVA 3VRIA 1RZ7L 1AR1B 1A7QL 1FZOB 2A99A 2R23A 4BHUA 2DEXX 2ZKYA 4JRLA 2G0LA 1MFEL 4AC2A 2EUZA 5AVUB 1E5AA 1IFHL 4FQIH 4RMQA 4U1NA 1CXFA 1W0YT 1WA0X 3P9LB 4ZS7H 1KBGL 4ENEC 3IU3B 4WI2A 3WIFA 4WW2F 4DK5A 1WD9A 2XWJB 3HZ3A 4YDJA 4M56A 3GO1L 3Q8BA 2V2TA 1JXKA 1X7QB 4BQCA 4KK8C 4EUPH 3M1CA 1B0GB 3H7BB 2MQ0A 2DI9A 1I8UA 5ICYA 1FPTL 2YGQA 3W3BA 1TETL 3T4AB 3PNRB 2AC0A 3MR9A 3FN0L 3SOBH 3O3EA 3KHQA 4U6YB 1T1WB 5D2LB 4OFYA 2VIRA 3A23A 1LTXA 4FQPA 1DLHB 3FAXA 3US9A 5I76B 2JI3A 1JZ4A 1OSPL 2APVA 5B7FA 4C58B 3AREC 5DUMH 3ILPA 1YECH 3JTSA 3FQUB 1CG9B 3KCWA 2NW3A 4ACTA 5EEYA 3BWSA 4X6DB 4LQ1A 2EE0A 3LPPA 5TD4A 4F27A 1LD9A 5D5MA 1BBDH 2K6ZA 2L7EA 1EJOL 2UZYB 3MV8B 2OX5A 5INCA 2J12B 5IHZB 3DXAD 3CN3A 3D30A 2VXVH 4JFYB 1LM8V 3WY3A 3FTXA 2WN2A 3CFUA 3U6RA 2OYKA 2LVEA 1ZAGA 2IH1B 4MAYC 3N06B 2JKLA 4FG4A 3TIEB 5LUMA 1GYCA 2YK1H 4LZKA 1BDYA 1OTUC 2Z64C 3WOVA 2ZPKL 1WAAE 2OW7A 4L5FL 5KSVA 3CFCL 1P5VB 4NC2B 2NUPB 1JHLL 4JO3H 4XXDA 3RUGE 4K8RC 1RURH 3CTTA 3QUXA 2AQSA 3TVMD 5I1CH 4NSKB 1UUSA 1O0VA 1PIFA 5KBDA 4F7CA 1G9NH 1OAZL 2GJ6B 4L1BA 3VGHA 1JFQL 1E43A 3MJ7A 4CW1A 3NG5A 4HK3J 1TZAA 4ZFGH 1FGNH 3APNA 5BV7H 2XY2A 4LT7A 1CL7I 4XNXH 5HGDB 4XODA 4JW3A 2GTZA 2ZWSA 4DN4L 3OR7B 5IMMB 4I0KA 5SX5H 3VI4B 1CR9L 2FATH 4OFQA 2PWEA 3AXHA 3QPXL 3TZVB 4FXLA 4N6RA 2R2EA 1OHQA 4PJ8A 5I75C 2DQUH 3X14A 1HJCA 4IOIA 5JHLH 2E3VA 1DVUA 3QJFA 3W39A 3GSQA 4MCMA 1TCRA 5MEPB 4HXAH 1SM3H 3SN6N 3TBCA 3LEYH 4RAUA 1ACCA 4UNIA 2Z93B 2XVBA 3LNFA 4JHWH 4ZT1A 1KCVH 2ROXA 5IQOA 2X4TA 4HIJA 1GGUA 1NFDF 5ICZA 3MBWB 5JUEH 3WIIH 2W92A 1H9DA 1IUZA 3T65B 1XGUB 4CRPA 4OLWH 3BE1L 3MLYH 2LU7A 3GMMB 3BQUB 2AMUA 5F6HJ 5CEZE 4Y1AA 1DE4A 1MFCL 4XMXA 2PETA 4DVRH 3KPSB 1PAZA 3T8VA 2V5RA 3S5LG 2VL4A 3TBSB 1PAMA 2VQ1A 4JO4H 1A3RL 2J20A 3MLSH 1ZT7A 4LVOC 3F12A 1MFAH 2XN0A 2MOVA 4IJ3C 5FM8A 1W80A 3UABA 4GAFB 3P0GB 4LPVA 3MUHL 3AXLA 1EJ6A 4ODTL 2UUDH 1RP9A 5EU7C 3SDDA 3S36X 4EKJA 4KZCA 4MQTB 1MFUA 4OIIL 4TOYL 3ZT7A 3SDCD 4N5EC 4AENB 1S3RA 4OQ1A 1CLYL 2NZ1A 2VOTA 2BHFA 2WIIA 4FLHA 4AEEA 5C0RH 1RZKC 3OAZH 5HDQL 3ZE2B 3GSNL 3DI3B 4NQVB 4P2RD 1U91B 2W60B 2EH8L 5E4IA 1ADQH 1RIUL 2P28B 4LP4A 4X8XA 4IRJC 1O6VA 4HEMA 5TH2A 3F58H 4LSPL 5DJZB 2J72A 4B9YA 4CBPA 3JWOC 3KLSA 4R83A 3T2QA 3VD9A 2HKAA 4MS8C 3OKEB 3Q5TA 4JQIA 3KGUA 3N40F 2COQA 1UB5B 4ZUVA 4ZAKC 4LGRB 4JK0D 1OP5H 1WH0A 4WNJA 1KLGB 4TQ8A 2VLRB 5E1AA 5IFJA 3L3OC 1Q4NX 3CXHK 1LP9A 4G9FB 2O93L 3AADB 5KUMA 1HHHB 4PRNA 2B1AH 3BPLC 3P3RA 3QR2A 4KK6C 2C4FT 2TAAA 3ATEA 4MS6A 5E9DD 1EZVX 1AD0B 1FE8L 2VR5A 4MA8H 4Z7NF 1QRKA 3KS0H 2APFA 4NBZB 5EDSA 1UCBL 4QHMB 4E42A 5HPMB 4FG2A 1OWRM 2AZAA 1E6JL 4N0UA 3S5LA 2XWDA 4G6AD 2K9UA 2UY7A 1DUZB 3CHSA 4FTDA 1JWSA 3VXOB 4KVNL 3SEPA 1NC4A 4POYA 2BVOB 4HYTB 3H0TB 1PJWA 1QTYT 1N3NB 1UH3A 2ZCZA 4XZ4A 1TTRA 3D0LB 1HOEA 1RK1A 4NQXB 4EN3B 1HOCB 1BOGA 5TDPA 4PHZA 3NGBC 2OMYA 4R9HA 1T6VN 5E99H 4I1PA 5JYLA 3LMJL 4Z7QE 3ETTA 3RFZA 3I6GB 4PJ7E 1TJHH 2CU9A 4J28A 4X9HA 3QI9D 4FEMA 1T1ZB 1K6QL 2OULB 3PP4H 2Q7YB 4Y4FA 4U6HB 2A2QT 1EVUA 4YHPA 2IFGA 2IQ9H 1KG0B 3VXUB 1KGWA 2F68X 2B2XL 2MFNA 3U48A 5ID0A 1FO0A 3CU1A 3L1GA 2EECA 5JMOC 4YL4A 1Z3GL 2NY3B 3DUSB 3KMDA 1B4TA 1JPFA 5LCVH 4G7QB 3V6OE 5FGRA 5CIPH 5A2IH 1UFGA 2R9HC 3LS4H 3BP7B 3QNXA 4QXVA 1QQDB 1HQ4A 3T6ZA 2PCXA 4GSUA 1I9IH 1J9TA 2N3JA 2MMXA 3IDMB 4UAOB 2I07B 2ERJB 4X7DC 2OK0L 4LDOB 3AITA 3GBLA 1AKJD 4NO0D 4XNZC 2AAVA 1TJIH 3T4YB 4NDMA 3CZJA 4XBGA 1JD7A 4BJLA 2NMSA 5FECA 3RWGB 2RALA 2FX7H 3II1A 5EPMA 5AW2B 2IO5A 2WZAA 1W8EA 3P9MA 3VSQA 4JQXC 3V2AR 2MNWA 2BCKA 3P1VA 5E5MA 1FP5A 1KXQE 4NRYB 1MQKH 4W9FC 1ZEAH 3MRNB 2Q7AA 3RWFB 4A39A 4S1DD 3LD8B 4JFHE 4ZX5A 1JGEA 4GRWH 4MMXA 4ZOBA 4NUQA 4JAMA 1KNOA 2CCWA 2D4DA 3AY2A 4S2SA 2F61A 5EN2A 4ZUUA 3SE9H 1ZOXA 3V5HA 2CO3A 3FU7A 1GYUA 2ATPA 5DK0A 1JNJA 4V1DB 4WU5B 3C9NB 3O9WD 1QWHA 3NSYA 2F2HA 1XL6A 1B0RB 3QUMB 4RISH 1I31A 1I1YB 1QSVA 3RG1C 1U8NA 3LVTA 1QFOA 3QYMA 3MGTA 3KGSA 5JPNC 4OZHE 1JWUA 3WUWB 2BRQA 5IUCA 2FT7A 4TQEL 5I0DA 1H0DB 3V0JA 3HPLB 3S34H 4JKWA 4PIBA 1U58B 2X6MA 3KXFD 4TRPL 4X0KA 1AHWC 2FBJL 2FZ3A 3DIDA 1II4E 5DD5L 3CFJB 3QYNA 3DGGA 3L4VA 2IAAC 3LKNA 3GFUA 2VR3A 3VXRA 4B27A 3UO1L 5KVDE 2HT2D 4M5TA 4C56E 3HFML 5CR1A 5E1GA 3RWJB 3V0EA 2P8MB 5DA4A 4LEXH 3PIQB 4OVVA 3ZKXB 1UXMA 5AL0A 3OG6B 2NNCA 1YUHA 3HKFA 2HLAB 5DS1A 3M88A 3MRFA 1ZRUA 3GSRB 3WN5B 2DDQH 3FB5A 3FUEA 4LE8A 1HEZB 1UJ3B 3IJEA 3P2TA 4FG6D 5F1IB 1X5KA 3IPBA 4KMTL 5IVXA 4NNXB 4DEWA 1NAKL 1DVFC 4BKLA 3F7VB 4M5ZL 1IKNC 3KJ6H 2ZJSH 2VM9A 1E8ZA 1A14H 2IWFA 5C9KA 5FEBA 1DJSA 1HT6A 2R69A 3PWPE 1FBIL 4X4ZA 2G9HB 1NGQL 2F1EA 1BXXA 1JNLH 4BZ1H 1IIIA 4WWKA 4X5PA 4F8OA 3CVBA 2DMGA 1XXFC 5EFIA 3HNTH 3C75A 2QVMA 3G5WA 3ZIYA 1H5BC 4TL4A 1DBKH 2FIKA 4LEBA 5F8RC 3WLWD 1ET7A 3NMEA 4KKAD 2XWCA 1MFNA 4X6BA 2ZWKA 3RQ3A 3UROR 3K72B 4FZEL 2FVNA 1A4AA 1TZIA 5D6DA 5JHDB 1A64A 4S1SH 1KENH 1SDDB 4OM0H 3F7KA 1DDHB 1HU8A 1U3HD 4KO9A 1QUNB 1W72A 1GS8A 5T1MB 3GBNL 3ARWA 5L8JB 4QHPA 4NT6B 4JFFD 1QBBA 4PJIA 4MD0A 1GRWA 2DQDH 4FJ6A 4MJHA 4F2FA 4E9XA 3T0VA 2NSQA 2JTYA 5BW7A 2N1TE 1RJLA 2XQ0A 2BNUA 1T5XB 1T7XA 4NCC2 1XB8A 3CVHA 1VPOH 2AK4D 1SXNA 5GS2H 4OB5L 5DO2D 3SPJA 4MJ5B 2DL9A 3OZ9L 2GUOA 5BCAA 1MCSA 3VG9B 4BZYA 2HTLC 4NUGL 3WIHA 1U3NA 1U2CA 3N0PB 4OJAA 5TE7L 1P9MA 5IHUL 5F21B 1T3FB 5I1HL 3OJDB 5I71C 2J2ZA 1WZAA 3OKKA 2F8XC 3L6FA 2H1XA 4EXPX 1DQLL 5EBLB 2D3JA 1OTSC 3P4MB 2JMRA 1HDMA 4Q4IA 4K23H 3KLKA 1N5YL 5JW5B 3PWUB 1QLEB 4RA0C 1GW6A 4HUKB 1EX0A 3JV0A 4TNGA 5C0DB 3VWJA 2WHVA 2Z31B 3O4OB 4OD1L 3BAKA 2JI2A 4GQ9L 3MBXL 5D5ME 3MXWH 1TZGH 3VYNA 3MFFA 2CO7B 1YNKL 3LPOA 1M2OA 1XF4B 4XP5L 5KBKA 3ARTA 1BF8A 4FNQA 1ZXKA 4Z0BL 2B1HL 1E8YA 1LO4L 2JB6A 1KY7A 2V3EA 5J1TC 1ZK5A 4OD2B 1FNSL 5AKRA 1BV8A 1MJUL 1ZT4A 2W9EH 4N0FA 5I1GH 3H55A 5MEOA 5SWSD 1LNUA 2HH0L 4KGLA 4CILA 2ZXQA 3ESUF 1V7NH 5LXGL 3L5HA 1D5ZA 4YLQT 4Z0XB 4FQXB 2O5YL 3CDFA 4J1UA 5D4HA 2F0CA 4MASA 1IC5H 1KV7A 1MJ8L 4PJCA 4RGNC 4UF7C 5FV1L 5IK3B 3O3AA 2C3VA 2CR6A 4Y7MA 2R2HB 3O11B 1KJ2L 3MRKB 1L5GB 3KJ4B 4PEEA 1MVUA 5HVHB 5FYKH 4W9EC 3TCLA 4OGQC 3GI9H 4YHYB 2YPLD 1LGVA 2UYLA 5D72L 1RERA 2FD6H 4KTEL 5BS0B 2WXFA 1BIIB 3PLYA 3NCJH 5E2TL 2W65B 4FNTA 4OZFH 5EZOL 1MCRA 1WFNA 2W91A 1OV8A 5D2NA 2EUXA 1E28A 4YBQD 3UTZB 3ETSA 3MA9L 2I5YL 3U0WL 5SV4A 4JZJB 5GRJH 3QQ3A 3J2PA 4G8EA 4HHGA 4JS7A 2GITB 2XY1A 2X9ZA 3DVGB 1TEFA 5M95B 1A6ZA 3K2UL 4JY4A 5DGQA 4HOWA 2R83A 2VNCA 1GKOA 1B2WH 4K3GA 4QCIB 1U8CB 2NY7L 5SX5K 2P5EA 4PLOB 3BLKA 4XE5B 4L0ZA 2YXMA 5HHMD 3OX8A 2ZAGA 3O0LA 4Y1AE 2JLLA 3V79C 2HG5A 2GSIA 2BNQD 1ZJAA 3HHSA 1OE3A 3CC5B 3K2IA 2B7DT 3ETBF 3TN0D 1ZA6B 1MFBH 3QNYB 2ADYA 4LLWA 1XCQB 1V5JA 2MOGA 4Z7VA 1T21A 2CJTA 2VLKB 1V05A 3M07A 2IXQA 3C60B 4LCUB 2YN5A 5FYKD 4P2OC 3LIZH 3CCHB 2QLYA 3HPJB 3KPLA 2WP3O 5MHSD 2DYPD 1NLBL 5EUOF 5I1AB 4NAQA 1RU9L 3BZFA 3QDAA 4NHUB 1FNGB 4L2LA 4WNQA 4HCRL 4HEME 1TZHB 3KAAA 3PS6A 4JM2B 4PRHD 5E8NA 1WBZB 2OTUA 2XWTB 2NY0C 3ZRCC 1BD2A 3Q48A 4D9LL 1L6PA 4PRID 3MLRL 4JZNB 1U3ZA 4MDRA 5F0MB 3VM7A 4AEHL 2XJKA 1R3IH 5ANHA 3MBEA 2FJUB 1ES0A 3ASNB 2F54D 1JXDA 5LKNA 1CK0L 3MVSA 3OJMB 3WFBL 3SO5A 3H9SA 2UUDK 3FF8A 4ADJA 1A7NL 2DRUA 2NX5D 4HC1A 1LP9E 4JFEB 1W8OA 2BNRD 4YIQA 5KYXA 2PXYB 1JPST 4HXBL 3OAZK 5ADOH 1IQWH 2WNKA 4UIKL 3UAJC 1XAUA 3QIUA 3ELAT 1RUKH 2H0JA 3A6OA 1Z9SB 5JLZB 1GXEA 3QAZC 4BGDA 3QO1A 2AXGA 4OCXL 1Q72L 3NIDE 1IM3B 4Y9CA 1THAA 2H26B 2PWDA 3VM5A 3SQBA 2QTVA 3TBYB 3ARVA 4PJ5A 4N0UE 2ZOWA 4AMWA 4M7LL 5DZNA 4YNYB 1OP5K 2FR4B 1ORSB 3T6QC 5TGBA 1W0VB 3H42H 2GUYA 3BMWA 3BZ4B 3QFGA 3L3JA 4F33B 1IFHH 1F1AA 3A67L 2PCPB 1FAIH 3HS8A 2Q6WB 2Y7MA 4N8CH 3QORD 3BKML 3IJSB 5J6HA 1KELH 1BAFL 3BHBB 4NN5B 3I6SA 2ZD0A 4YHKH 5E00B 1E8XA 2ZUWA 3OMNB 1I82A 5IT2L 2ZQKA 2WCSA 1EMTL 1TETH 2VDNL 4WU7A 4BFBD 3BVDB 2NOYA 4LSSH 4MFHA 2ENQA 4YVUA 3I6KB 3NIGB 2J71A 4ZXBB 1AQHA 2DH2A 3DURB 2Y1AA 3NCYS 4GW5A 4S0TD 4KDTA 4Q2ZA 3Q2NA 1NKGA 3KL3A 3RKPA 3MJGX 3TPUA 4OF5A 4I89A 1XSJA 1TJGH 2FLRT 3FU5A 1BM7A 3GPSA 2BIQA 3GHEH 5A40E 4QXUL 3OVUB 4R4ND 5FF6A 5E8EA 3FFDB 3EO1B 5GGRA 3F65A 4QRRD 4JPKL 1RK7A 1ODUA 3FFCA 1PIGA 4FHKA 1MCLA 1D6EA 3EIFA 3D87B 4ZTPL 1I7ZB 2ZOKA 2BIIA 4X8CA 5K9KB 3KLQA 4Y5VB 2X2JA 4XPHH 4P5MB 3SBRA 3K6OA 1WJ3A 3BLBA 3N50A 1MJ7L 4UOW1 5DTFA 5FHBH 1EUTA 1S9VA 5CWSA 3T5WA 3EH1A 4M61A 4Y9BA 4FLSA 4BFIA 3RVXC 5GS1A 2QSTA 3KYMB 4GFTB 1ZSHA 5D1QB 1ZTXL 2JB5H 3NK3A 4Q6IA 1HE7A 4N5UA 4TM9A 4ALAL 2E7DA 2JK5B 3K6NA 4TSCH 1OP3H 1SRDA 2SEBA 3HR6A 3SY0A 1KCSL 1S3KH 1Z6JT 1I7RB 3LXCA 1NA8A 3U7WL 1OL0A 2CXKA 3P11H 4HKZA 3DECA 3OJ2C 1SPDA 3L3DB 3QPXH 3QARA 4JLRA 3B9KD 3QUXC 1JZ5A 3GKZA 3VXRE 3S35L 1C1EL 1PZSA 2V2WA 4LCCA 3FH5A 5C9JA 2XSKA 3QDJD 4LCIH 4PHXA 4GS7C 4F7PA 2C5DC 5GZNA 1CFSB 4DZ8A 3BFOA 2FO1A 1V7MH 4EOWL 3KBEA 1B6UA 4QDGA 5B1JA 2Q76B 2X87A 3SSGA 1H3WM 1Z9NA 3TA4D 2XG4A 4JFOA 1D2OA 3GC3A 3CMOL 3VXMD 3Q6FB 1F58H 1MNUH 1S9YB 4DGIH 4LKXB 4TLTA 2MIZA 2FWSA 4PJ8C 1GGCL 4TYUA 4D9RE 1T6BX 15C8H 5B1BB 3SPVB 3NSJA 4BK5A 3KCPA 3U4EA 2ZXBA 1PG7L 3LXAA 1AS8A 3DUUA 1MFCH 1GYWA 4L1DA 3H2WA 2UWEA 2ARJA 4NKMA 2ED7A 4M43L 3PFUA 3SBPA 4WO4D 1PKQA 3DUHA 2GQHA 4U1IB 4LVNC 3UTTD 3QG7L 5GQBA 2C9QA 3I2CL 1BWWA 3C6LC 3TIDB 1ZIBA 4RAHA 1DSWA 2HUHA 1AQDB 4JJOA 2HRPH 1NBCA 1BVNP 4XP1H 3Q01A 4ETQA 3DXAB 2YPVL 2C1OB 4J4PD 1BFOA 5D7IA 4DT2A 3ATDA 2JKXA 3AUWB 1E4WL 2PYEE 4ZD3H 4NZDA 1GHFH 2CIKB 2Z92B 1B9ZA 1I1FA 4GMSH 4PJIE 2RTTA 2AEIT 4LHUD 3ZTNH 1PSKH 4B60A 4HIHB 4Q9CA 3OKMB 3FZUD 3VMPA 5KS9F 4WK2B 4N2NA 4XPAH 1COBA 3GBEA 2OI9C 1I8MB 3A4AA 4WHDA 2XZQL 3C09C 4ZMVA 3KWWB 3X1EA 2NT0A 4AGNA 4EUPB 3TVMB 1S7SB 3NACL 3O8XA 4BCXA 1CF8H 1I9RH 1YNTA 3UTSB 3DRQA 4F91B 2EUVA 2H7WA 3DO3A 4GT7A 3W11D 4IK7A 5L4IA 4C57C 3F64A 3QJSB 3ULUE 1GZPA 3LZFL 1HN1A 3QCTL 4MDJA 3FQNA 2YBRB 2J8UB 4XO8A 1UGNA 1GCFA 2FQDA 4XC1L 2G3MA 3A5VA 1TDQA 3EOAB 3R06A 3FL7A 3MYZA 4B3VA 3T8MA 3V0WL 3AFLA 3B56A 3W0WD 4G8IB 4E0RA 3E8VA 4BGLA 4MCZB 5EIVA 4JANB 4KVNH 4ZBJA 3ASWA 2H32H 2XBZA 2WXOA 3HMWH 2ENJA 1TVHA 2X10A 1ZY9A 4IU3A 5CJXC 5CP7A 3STZB 3GMPA 4WJ5B 3U0TB 2WMPA 2YUVA 4DP1X 4ELKB 3RKDD 4R7NA 1KBBA 2PCYA 2IWKA 2ZAHA 1WSST 3GHPA 3V8CA 3L4TA 1AZBA 4IHOA 3MRBA 4BUHA 1AMXA 2DQIH 2WTPA 2DQGL 4J3XA 4OTXH 1A1MA 4QJ3B 4OGXL 4PI0A 2ICWA 4LPUA 4PJCE 2FJGB 2WB1A 2XFXA 2LR4A 2OMWB 4PGBB 5ANMB 4AEIL 3WJJA 2PYFA 1W0WB 3NCFB 1I7UA 3GJFB 1G6RL 1G6VK 4WI3A 2PR9A 4I88A 1FFRA 4M7LT 5IROC 4ZOEA 1JGUH 3T6VA 4Q74A 2YOCA 1WHOA 4N8VB 2DMBA 1L7IL 4J6RL 3KGTA 2ZNWA 5BRZD 2OK0H 1CL7L 2YUWA 3E6FB 1HHIA 1XB3A 2R39A 4HJIA 1EFXA 5I1JL 4Y4FC 1KV3A 1NEZB 3HAEH 3SDCB 3ZKMC 1M05A 3RVUC 4XAKD 1UVQB 3UPAA 3W57A 2BOBB 3VFPA 3DO7A 5D2NE 2JJVA 1NGZB 4P2RB 2VDPH 3SO3B 1GC1C 2HJKA 4IMKC 4BH8A 5J13B 4H0HB 1MCQA 2V6HA 4P4KA 3HR5B 5CILH 4BDVA 3MNZB 5EORL 3SJVA 3NJNA 3OZKA 4HH9B 5E24E 3QWRD 1BQHG 5C3IA 3PV7A 5ERWB 1NC2D 1WZ1L 2WLLB 4LSRL 4BA0A 5HHPB 2P5EE 5H35B 1KBVA 1IMHC 4P2CG 2A9NH 1HSBA 4HCGA 1CCZA 2IOIA 5I82A 1RVFL 1GYAA 2KZWA 3GUTB 3ESOA 5E9DB 3C8HA 4MD4A 1LEGA 3RDTD 2B4CC 2XHNA 3MROB 2H3NA 5B39B 4Z7VE 1K4CA 4GO9A 1C5CL 2FGZA 4H8WC 3D06A 4L48A 1RK0A 2JCCA 1X5IA 2IALA 3DOSA 4ANXA 5I8CA 5C86A 2OMUA 1MHHA 4OZIA 3BX7C 2P46B 4NO5A 1CFBA 4TRPH 1OSZB 4YDLB 4OZGB 4BQ8A 2OLDA 3M45A 4UTBL 1JK8B 3DC0A 4DFIA 5DS8B 2DS4A 4K5LA 4Y88A 5DRNB 5F96H 1CICA 2ZSWA 2XQBL 5CBEA 5H8DA 3RU8H 4AEFA 3D09A 1BD2E 4XNMB 5CGYC 2VH5H 4YHNA 3RY6A 1CVSC 1XH3A 5KTEL 3OB8A 5I6XC 2WAHA 1UOKA 4K3DL 4MHHI 3QI9B 1F4WL 4YZFE 5DFVC 2A3TA 3HBPA 2V7HB 5B4MC 3H9SE 2YGNA 2A83A 2C7UA 3NJIA 3P02A 2MEJB 3VI3B 5DVLA 5CZRA 1JZEA 5D96B 2YS4A 4Y4KA 4DGYH 4JG1H 2KL6A 2FUTA 5G4NA 4Z7UA 4HHWA 3GZQA 2JJSC 1BQHA 1Q0EA 3T3ME 3O6FA 3MLTA 5C97A 2VDQB 3CQPA 2PCFA 1MDAA 5FCUL 3M86A 5I2IB 4KZEL 1XF2A 1JUFA 2Y1YA 3QQDB 3PL6D 4BFOA 1I3VA 2W88A 4Y9EA 2ZX9A 4M6MH 3VU1A 4LHQB 3Q8EA 4R96A 1AKJB 4NO0B 5IFAL 5AL8A 4PJ5E 2QV2A 5I8EB 4ODWB 1X9UA 2F18A 4M48L 2GFBA 1GZQB 3N40P 5DJ0B 2FYYA 5H94A 1G7JA 1OVZA 5C08D 4RDBA 5T3XL 4RGMB 1ZGLA 4XMPL 4FFZH 4QHKJ 5FUOH 3B5GA 1NBQA 3TH3T 1U4FA 2ENSA 3NEOA 1T1XA 1XH2A 1PZ5B 4PGEA 2C8NA 3MTXA 4UQ3B 3MUUA 3SKJL 2E7LA 4X4XB 4ODXA 3ZHNA 3H4FA 2DQFA 4EQ2A 4YDMA 4HIEA 3NPSC 1RQ5A 2CDEA 4HFUL 2EYTB 3ZKSD 3IJ9A 1IGIH 5JMRA 1VFMA 2HFFB 5GRWA 1JZ7A 1SJHB 1Y18A 2VC2H 3O9WB 4F3FA 3ARRA 3VXPB 4YHML 1A0QL 2C9RA 2WZPD 3QIWA 2CO6B 1YDPA 32C2A 3I9IA 4XNUH 5DJ6B 4O2CB 5I1HH 2C26A 1FORH 1A7PL 4AL8L 4K3EL 1FVEB 2YFNA 4JHZA 2IQAB 2PO6A 2J8HA 3QRFM 4MNQA 1T04A 3AROA 2E7BA 3HA0A 3KXFB 1U95B 3I02B 4MMZC 4TVPE 4N0YL 5CIPB 5KZCD 5LJYH 3S4SG 5IHHA 4GH7B 1CUOA 1R5IA 2YD1A 2H2PD 4OCYH 4OD1H 5DMGC 1TQBC 2I9LA 4AGOA 3VFSB 2WC7A 1BVLA 4IBZA 1DVYA 4K0OA 4TSBH 5DHYA 5IIEA 1RULL 5JHMA 1EHAA 4KQ3L 3QH3A 5HGAB 3ZE1F 4PJHA 2QPUA 4G2AA 4CVXB 3BAEL 4IYKA 4Y16D 1SXAA 3T77A 4TXVB 4ORGB 5B3JE 4JFZH 1LO4H 1GKEA 3FFCE 4X8GA 3I3DA 1FYHB 1C12A 5DVNA 4F9LA 1UZGA 5J3HC 1WK0A 2ZIDA 1A1NA 2WWMD 2W38A 3PWVB 2A9DA 2FHCA 5E8PB 1RZGB 5LXGH 3QUYD 2YD3A 4KI1A 1NCAL 1X9RA 4OAWA 4UB0H 4HIXL 1Y0LB 4JCWA 4EBQH 1MJ8H 5CD5D 3BKYL 3NABH 2A0LC 3R0NA 5CZXD 1KJMB 1XCWA 2J6WA 2VMFA 3MAWA 3UYOD 3B2VH 1FFNB 1KB5H 2QKSA 3C5SB 4XAWL 1AGEA 1TQCC 4TUOB 2OMBA 2QKIB 4IU2B 3MRIA 4F2MA 3CC1A 2IC2A 1S7VB 3ILDA 3BH9B 4WGKA 4PRPA 5D1ZD 3WNKA 5EU6A 4X9FA 3CIAA 1N2RB 5AOLA 4Y5YC 2VMJA 4LKCA 5HDBE 3F7PC 2X1QA 3LPGA 1BHGA 4CUCA 4NZRL 2BZ7A 5EZOH 4Z7OB 5HHQB 1U3HB 4LPXA 1SMOA 3D48R 1CDHA 4ZSOB 2FUQA 3VFOB 4JFFB 1PZ2A 2BVUA 3S4SA 3U0WH 4JQVC 3NIFE 5DC9B 4NOFA 4ZJ9A 4MHHG 3LKPA 1FVCA 2ZCLH 4EO5A 3L7EB 3CD4A 5B22A 4FAAB 5GRUL 3GSOB 4UOZA 3EGSA 1QPXA 4Q6YA 4Y9GA 5JW4N 1G7IB 1PDKA 2AK4B 1U8LA 2FEJA 4AZ8B 4E41D 3PGDA 2F7RA 1OP3K 4W68A 3VXSA 4ACPA 1FGVH 3REVB 2FGWL 5LDSA 4AYFB 4PS3A 4JDTL 5F9DC 4BV1A 1IBDA 4DGVL 3W38A 2N4IA 5E8OA 3ZGHA 3MDJA 4G43B 4P5TD 2UWEE 5B8CB 2O5XL 3DIFB 5EC2B 5EZJB 3NCMA 3T2NL 1LE9A 1CGWA 1PKQE 1AXSA 2Y72A 2VERA 1UHVA 2E0PA 2CA3A 1UJTA 1EEYA 2CDGA 5GGTH 1RZPA 3GEWB 4W6WB 4WW2B 1PD0A 3O3BB 3BP6B 1ED3B 1KTBA 2VB5A 4GIAA 4I5BB 5FGBA 2YA2A 4FA6A 1MW0A 2P24B 1XZ0A 4GQQA 4U1JB 2GSGA 5DHEA 5D7IE 1YEHL 1JF1A 4L8BA 4I2XA 3MO1B 3LN5B 4QHUA 3TLRA 1N4XL 3FKUS 2DLFH 3QYCA 1DVTA 2QSVA 2VXQA 1UM4H 3CJJA 5L4JA 2BOLA 3MV9D 3UX9B 4DUWA 3ARQA 4QJ4B 5IBLD 5H37H 2YGVA 3FU8A 3SZ6A 1FZOA 1HH9B 4GFXA 3UBXB 4FFWC 3SPIA 4LAJH 3T3PE 4PJBF 5CCGE 1MZZA 4NXKA 4OF3A 3W9DB 3GXPA 4Z3JA 4XHQA 4CC4C 2H45A 3IU3A 3QVAA 4ZS6C 4QYAA 2XWJA 4F7TB 2HFGL 3HMXH 4KHTL 4UIKH 3WXWL 2QFRA 1B0GA 2YPLB 1OANA 1KLFB 4MQ7B 4OLZL 3RVTD 2HCZX 4X5WB 1A02N 4M7ZB 4NQSA 1GOGA 3D2TA 3VU2A 4ONHB 3T4AA 1T7ZA 3KE0A 3U82B 5C6TL 5J0BA 2XBTA 3WO4C 4FDWA 1OARH 3BPOB 2R51A 1Q8MA 1AGCB 1A7BA 1FCGA 3KR3H 4U6YA 4AW7A 1T1WA 5D2LA 4RDQG 4EI5C 5L6YH 1R3LB 1DLHA 4HDIB 3QDGE 4K8RL 4JFPB 2LGNA 1E3ZA 1QFPA 5GGUB 1AOZA 3FQUA 1CG9A 4URKA 3HBGA 4KH9A 2Z4TA 4P57B 1XT5A 2KLRA 1JMZA 4X6DA 3BKMH 5KG9B 1SFDA 4XWGL 4OLXL 3O2DL 2E9BA 4KAQH 2NY1D 4CSPA 3HC3H 2UZYA 3MV8A 5IHZA 5DA0B 3JWNH 5HHMB 1BZ8A 3WI9A 4GAGL 4PB9H 3VGEA 4JFYA 3H2QA 1H3VA 1KIUB 4F58L 2XXMB 4N26A 1XGZA 2BNQB 4GW1B 4NIYE 1BZDA 3EJSA 3WHE1 4M8UA 2IH1A 1MREH 5INDB 2R0WH 2X9YA 3TN0B 3WXVL 5JR1L 3W37A 2D9QB 3FPYA 4FQQB 1WF5A 4YDVB 1YYLL 3NQKA 3KBFA 1INDH 1O9WA 4JE4B 3HNSL 1P5VA 1NCUA 2NUPA 2JKTM 2WINB 3WEBA 3EHBD 4WEBL 5BJTB 3U6XA 3S97C 4NSKA 4MMYB 2EADA 4Q6KA 1NFDB 2GJ6A 3LHPL 2ZOTA 4PRHB 5I6OA 4OZFB 1SMDA 4G5ZH 4CSSA 1Y1UA 5HGDA 4WWNA 5C07D 4PRIB 4U0QB 1M71B 4ZK8A 3SJVE 5LGYA 5KAQF 5DZLA 5IREA 3OR7A 5IMMA 4N28A 3VI4A 4FADA 3FT3B 4LAQH 4KDTC 2Q8AL 2F54B 5H2BB 2NNRA 3L1OL 3TZVA 4OLUH 3AM8A 2G5BB 3EDJA 4M8RA 4JPWH 4GI8A 1YEGH 3MRPB 1KBKA 2NX5B 4UBDC 1LE5B 5I73B 4G5AA 5K5YA 2BNRB 1MJ7H 1SQ2N 1OE2A 4OCRL 3TC9A 2XYCA 5D9SB 3FSOA 1TEYA 3WKQA 1RIVL 3VRJB 2CDFB 3VCLB 3VFVB 3PAUA 2ZOOA 1JK9B 4TVUA 2Z93A 5DK2B 1XR9B 4NZUH 1WFUA 4MCYB 1HZKA 1YQVL 1RCYA 4W6YB 4ALAH 2JCCE 3MBWA 3S8GB 1F11B 3BUDA 1HX0A 3T65A 1XGUA 3WTTA 4OZIE 2DWEB 1ECZA 3FCGA 3GMMA 3BQUA 4NZTH 5SWQB 3MRCB 3KPSA 2BSSB 1P4BH 1FVDB 2EC8A 1HXKA 3JYBA 1C1EH 4JN1L 4UM9D 4YHLH 3L1EA 2DKUA 4JDEB 1KZYA 2BVTA 4Q6IC 3QORB 3CSPA 2EVIA 4EE2A 3PU7A 4HIIB 4YSPA 2MTPA 3ZTDC 3HJEA 5F6HI 5LBSL 2JJWA 4U6VH 4ZUWA 3U4AA 4AENA 1FH2A 4Z7NB 2NLJB 2F1AA 1OZTG 2GTWB 1ZHKB 2W60A 1U91A 3GXIA 1GGCH 3F84A 1FNLA 1TT6A 3HI5L 1IT9H 2F58H 2ZOLB 2K70A 2JQMA 5C2BL 4Z7UE 4DPRA 4WVRA 4NQCD 3IXAB 3MGAA 1F6FB 3Q5YA 5DEFB 3SE3C 3DTDA 3OKEA 5B1JC 2LFEA 1ZLUH 1G9HA 2HTKC 4NLAA 2CK0H 3ZR6A 5I9QC 5DQ9B 4NUJB 1UB5A 2WBJC 2ZP8A 2BY0A 1KLGA 2VLRA 2Q3XA 3QG7H 1FI8C 4TTGA 3WMPA 4G9FA 1G4MA 2XN9D 1HHHA 2WD0A 3Q43A 3BRDA 5KVGH 1YMHB 1NFAA 5SWZE 4YGVB 2YPVH 1MRFL 5J11B 1EQWA 5DQJB 5IJKC 3ARDC 1AD0A 2DI8A 3RFRA 1A3QA 3MV7D 1S2EA 2PNDA 4LDLB 1F42A 2VKXA 5J4MA 4HSAC 3RIAF 3G9AB 4JPQA 4QHMA 2OJEB 1NOFA 5IBUB 1Z0MA 4BRJA 5HPMA 3G5XB 2FEEI 4ES8A 3SE8H 4QRSB 3ARFC 1LLAA 2G3XA 1QI4A 1E90A 1RH8A 2ZF8A 1DANU 4IGBD 4Y5XC 4B95C 3QCUH 1DUZA 3VXOA 4RFOL 2BC4B 4O4YL 2MQGA 1N3NA 4I3RH 1ZV9A 5AOMA 4EN3A 3AUVA 1IGFH 4KKBC 4NQXA 2CHWA 2Y2TA 1E5BA 4IOSD 4XVUC 1Q9KB 4JE0A 2UX7A 4Y19D 3LH9A 3GLDA 1JG9A 4Z6AT 2OXHB 4UINH 1L0XA 3I6GA 2NTSP 5FK9A 5T3ZE 4MNQE 3C08L 5GIRB 1T1ZA 4XXCA 2Q7YA 1L6ZA 1WGOA 2FX8H 2XVGA 4JX0A 4U6HA 4ZMOA 3QCTH 3X2QB 3N41F 1KG0A 3VXUA 2QADB 4NM8H 1I53A 4XPTL 3QCVL 3GLZA 3QG6B 4YS4A 5I5RA 2A74B 4IRSC 2YA1A 1CQKA 1IZKA 3B9KB 1I3GH 1T20B 3C5ZD 4XMVA 4ZFOL 5KYUA 3V0WH 4KQ4H 2R29H 3DUSA 4KVPA 3S48A 2DOCA 3QDJB 1K2DB 3CMGA 4PJHE 2YD4A 1E3FA 4PWFA 3BP7A 1GPOL 1QQDA 5F89B 3IDMA 4MLSA 2I07A 1INEL 3VD0A 5I5IA 3P77B 4ZFFB 1QPPA 4KKPA 4YHIB 3T4YA 3VXMB 4W81A 2MNUA 2YXFA 4GO8A 1EHNA 1TFPA 1WFTA 2XXGA 2X6CA 4WSJA 3RWGA 1G7QB 3U9UB 4YQXL 3DX8B 4OKDA 2L3BA 3IPFA 2DQGH 1ZVHA 4N0CD 4OGXH 1WAPA 2OMZB 4AEIH 1FAKT 4XP6L 4NRYA 1G6RH 3MRNA 3RWFA 4CMHC 3F85A 5BZXA 1M6OB 4WO4B 5I16B 1PNCA 4F2ME 5L88L 3UTTB 5CLXA 1L7IH 1SBBA 3HC4H 4PRPE 3ZZSA 2ZXAA 1LO0L 1MCPH 3D39A 4OLVL 5EDXA 4V1DA 4WU5A 5EU6E 5IHBA 1CFMA 5I1JH 2DQEL 5I8KL 3C9NA 2VUKA 1A4JB 1P0SE 3BP5B 2ZYSA 4JG9A 5JNYB 1XIWC 5EEZA 3QUMA 1B0RA 1I1YA 3FTGB 2QVTA 5IHWA 1MCNA 1GYVA 2AK1L 1NCGA 2E7HA 2YEVB 5C0EB 3WUWA 4LHUB 1H0DA 3HPLA 3TP4A 1VEMA 5IZ7A 1U58A 1R9FA 1A8ZA 3N1PC 4GY4A 3UACA 1KC5L 2MRYA 5EO0B 1WBXB 3CFJA 3VXSE 2IOMA 3L4UA 1R3KB 4XN9A 3RNQB 1IKOP 2BDNL 3N1MC 1RZJC 7FABH 4O00A 5ACZA 5L9DL 3HE7C 5EOQL 3V52H 5EV7A 4P4KC 2P8MA 2YQ3A 2C7FA 4HGWB 2M8XA 3PIQA 5E23A 3ES6A 2DBLL 4PY8J 5FV2A 2HLAA 3GSRA 4L4JA 3QHZL 5CJ8A 3L48A 3Q2VA 4GAYB 1NCDL 1HEZA 1SUJA 1UJ3A 4H5SB 3CHQA 4K94H 5F1IA 3HFFA 4NNXA 3B2UD 3W0WB 3F7VA 2GVYA 3B7TA 4FMVA 4I2XE 4UTBH 5AKVA 4POZC 3OWRA 2YQ2A 4OFPA 1FIGH 5J9PB 5AD0A 5ESVA 2BIPA 1NTDA 1I3RB 4NWUH 2E27H 2E56A 4EN2A 2IGTA 2B59B 3J7HA 4K4KA 2DQJH 4WWPA 3GSNB 2AVFA 5HHOB 5EC1B 5KTEH 4K3DH 2HLFC 1H9VA 5KW9H 1BEYH 2IBZX 4D7PA 3K72A 5JHDA 5LLIC 4YZWA 2WSDA 4L3EB 1SDDA 1DDHA 35C8L 1LO2L 1QUNA 2YAPA 5T1MA 1B3JA 2V9UA 1QNZL 4NT6A 2K8MA 2X1WL 3DDGA 1G9MC 4NM4L 5T3ZL 3G6AA 2A1WL 4TQPA 4ODBD 4A2LA 3DPBB 2JCWA 5FCUH 1D5IL 1T5XA 3F7YB 4EDXB 5BRZB 3U7YL 4ZFQA 1YEFH 2FECI 5FW7A 4MJ5A 1DVQA 2X4OB 2GEEA 3BEVB 2Y07L 5FGCB 5DJCB 5D1XD 1JXGA 1T3FA 5DRXB 3BW9B 3OJDA 2A5UA 4LOVA 2P4AB 4MB5A 5D2LE 1LK2B 2Y7SA 5EBLA 1SLVA 5L2KD 2IAMD 1H19A 3FRPB 3P4MA 3K80A 5T3XH 4F7EB 2VE6A 4NBYB 3OKYA 3PWUA 5JW5A 5E95B 4APQD 3ZE0F 4EVNB 5EWIH 2PYED 4KXZH 3NJLA 4X6DE 5GRVL 3SKJH 1C7TA 3U46B 2Z31A 3IETB 1NC2B 4N0RA 3MV8E 1DQQA 4K3JH 4P8QA 3NJGA 4KKRA 2CO7A 2L0DA 5DZOA 4GMTH 2YJQA 5CU5A 5HHXL 2J4WH 3P2DA 1UM5L 2I60L 1AJ7H 1OF2B 4NJAH 4A63A 4OD2A 4OGYL 1F3DJ 3KEDA 1FYTD 5EUKB 4LLMB 2OTWB 4BEIA 2E7LC 3SPCA 1A7PH 3NUKA 4M29A 4AL8H 2NZ9D 2WNWA 4TV3A 4FQXA 4UI2A 1C9SA 4GQRA 4HUWB 2X09A 1J11A 1JXJA 2A6DB 5IK3A 1N6QL 3N1QC 2MPAL 4QRAA 3FJTA 3LZQA 5DS2A 2X6BA 2R2HA 3O11A 3MRKA 4HS3B 4Z5RB 4KY2A 2GJ6E 1IBBA 4YE0A 1L5GA 3HAEB 1M6UA 5JOFB 3K5SA 1YEIL 3M6DA 2EYSB 3R8QA 1DJYA 3HS0B 3T0ED 2OZ4H 2C3WA 3CSBA 3BAEH 3FH8A 2R27A 1TF4A 2YN3A 1AD9B 4ZPVB 3VI4E 3I75B 3VAEA 5BS0A 4O58H 2WNXA 1BIIA 5T3XD 4GKZB 5GSRB 5FO7B 2P47B 2W65A 1HAUA 1Q9LB 3ZHDA 2X2UA 2EYRB 2Y3NA 3T2LA 3VVVA 2XWXA 4ELMF 2A6IB 2WXPA 1XQ4A 3JQOB 3GBML 3KNBB 3UTZA 4KJYB 2O30A 3X17A 4AH2B 4KWUA 4JPIB 2I69A 1HEHC 2W9DH 3DTXB 3EJYD 3IDNB 4JZJA 3UERA 3X3GL 2Q8BL 4AV0A 5BVPH 2GITA 1C5DB 3DVGA 4JMXA 4ZO8A 1MHEB 3PL6B 2DQHL 2ZTBA 5EUOB 4KO6A 4UILH 3L08A 1M2VA 4HJ0D 2I32A 3CVIH 4QCIA 1MI5D 1ETZB 1UXLA 2HX7A 3MLXL 5BO1L 3R7QA 3VWKC 1P4UA 4GSQA 1KIRB 5C08B 1IC7L 3KPSE 4P3WA 3VD2A 2X42A 3VTTA 5HP5A 3CC5A 5F7WC 1PD1A 3TO2A 2LHAA 2YUXA 3BVUA 4GAJL 4OW6A 5C09D 3UDWA 5HI5C 4FFYH 4CVWA 4XMLL 4K7PL 1ZA6A 1MG2C 3QNYA 1XCQA 3CFEB 1T4WA 3FO2B 4CDGC 1KWKA 4PUBH 3ILQD 2VLKA 1N0LB 3GIZH 1RSFA 3C60A 5I6MA 1CBJA 4LCUA 5B7EA 1BPVA 3M1BB 2Y36L 5DC2A 3Q8AA 1NIBA 3CCHA 3IJ7A 4Y8DC 3HPJA 4Q9BA 4AKQA 4XOAA 4B53A 3H6JA 3ZE2E 4LLAA 4DPBX 5I1AA 1VFAB 4NHUA 3MRMB 1FNGA 4XOEA 2AQ2A 4JM2A 3G6JF 1WBZA 1CS6A 1JNNH 2XWTA 1CI5A 1PW3A 1BVOA 5JOPD 4JZNA 3ARBC 1F3JB 3ZU8A 4N2DA 2OYLA 4TLSA 3QFDB 4Y4HD 3PPEA 2DQCH 2H0EA 4GB9A 3T2NH 2VR9A 5CJ5A 1OT1A 2LLNA 5KZCB 1VFUA 1DVXA 4YSTA 1DVSA 2VLRE 3BUBA 1BPLB 1RZFH 3W1ZA 3DOHA 2ZKWA 4UQAA 4M6NL 4OSUH 4G9FE 4JFEA 1E42A 1Q0YH 1OXYA 2EIKB 2PXYA 2R8SH 2GAZA 3RA7H 4UT6H 4M7JL 4QAMB 4Y16B 5JLZA 5D7SH 3OAUL 1YYML 3DKHA 2NTFB 1N4XH 2WXLA 3CBJB 1RHHB 4TVSa 3BYYA 1IM3A 2DL2A 4LSQH 5K93A 1QBML 2XYBA 4RAVB 3ZXAC 3MCKB 2H26A 1ZVYA 1ZLUK 5J12C 3IS1X 2EIEA 5C0BD 1D7FA 3TBYA 4AVJA 4Y2DB 3ROLB 5I1EL 4PWEA 4Y2OB 5AZUA 1QKZL 4YNYA 2FR4A 1L3WA 4H20L 1W0VA 3F6IA 3BZ4A 5DZVA 3QUYB 5FYJU 6TAAA 3ULVE 4L3CA 3KWUA 3GI8H 3QC5X 4F33A 3HN5A 5CJOL 3GSXB 4JVWA 4X6CF 2PCPA 4LF3A 4LCWB 3WTXA 2Y7NA 2QQKH 2VC2B 4LL4A 3SDAD 3KBPA 1MCEA 3IJSA 4UDUB 1J87A 1NIFA 3BHBA 4CADB 1YY8B 5B21A 5PCYA 5E00A 2OSXA 4FQCH 4RRPA 3ROOB 5ELIA 5EF1A 2X4UA 2EO9A 3VXUE 3ZDZF 4AIZB 5FKAB 3TT1L 4B9JA 2K9FB 2DTSA 5B7MA 4I9WE 2F8VA 3I6KA 5D7JC 1G7PB 4RMVA 1SF5A 1P6FA 4ZXBA 1AP2B 3BGAA 3DURA 1F45A 4WY7L 2EIMB 5BUAA 2F5BL 2HFEB 2ZUXA 3SE4C 4JREB 4E41B 4XT1C 4XWGH 3O2DH 1DQVA 1RMFL 1AIFB 3SQOH 1JPTL 2XLLA 1YMMD 3P30L 5DD6B 1GZHA 1CE6B 4LPTA 2AJZB 1ESOA 2MCPL 5EF0A 1PBYA 2V3FA 2EDRA 4GAGH 1G1OA 1T83A 3EO1A 1MWAL 3U30B 3ZT5A 4PSRA 1AGFB 4UZUA 3JTBA 4P5TB 4TUKL 5B38B 2VM4A 3CIQA 3ARED 1YEKL 2C3GA 4O02A 2VZUA 1I7ZA 1EXGA 1SFHA 3TJPA 5K9KA 3WXVH 4Y5VA 5IB2B 4P5MA 4F57L 1NPJA 4AUYA 1YEJL 2VN5A 4V1DE 2V4LA 3MRLB 1MFDH 4KBPA 1Q9OB 3IMTA 2P80D 4PP1C 1HC1A 4DUXA 3JWDL 2RR3A 3KYMA 4G42B 4PRDB 1U2YA 1ZLVH 3EBAA 5D1QA 5HPOA 3DETD 4JZOB 4MAYD 1OB0A 3MV9B 2JK5A 4HQQH 4HIPA 4YH6A 3NJFA 4L18A 1OTUD 1K85A 1I7RA 1XGRB 2EDQA 4FQ1H 5BUPA 5D7KD 3BUTA 2D7TH 3FFCD 4K8RD 3L3DA 1OW0C 1L0PA 5DRWB 1R47A 1PX3A 3SGJA 1D6VL 1G9EA 2X05A 2JKJA 3S5YA 4GXVL 4WNSA 3WL9B 1WEJH 4NPYB 5K9JH 1JS4A 4OCRH 1CFSA 2R0ZL 3HG2A 2EKJA 2FHBA 5I24A 4EUPG 4L4TD 4M62H 2OA9A 2ED8A 4AW4A 2Q76A 2QBWA 2D03L 2IH3B 1RZKH 4UV4H 4XN8A 3Q6FA 4HJGB 2VXSH 1S9YA 2HA1A 4JO2L 4LKXA 1YQVH 4NGHL 4JGUA 4R4BB 3WE6B 3D07A 1BQUA 3POHA 5DD0L 3JWOH 4B6ZA 3SPVA 1PCXA 1WFJA 5KS9B 2R56L 1NCIA 2GABA 1ILUA 1QHOA 3H3PL 5KVFE 4X7SL 2EAEA 1NUDA 3PHOB 4HKBB 3FCTB 3VGAB 1CMOA 3VGFA 3S2CA 4ZOCA 1SEQH 4XC3L 4JN1H 4UNTA 4B41A 2AXFB 2ZNXA 3FB7B 2GK0B 3D7PA 3G6DH 3NK4A 4E9RA 4XVTH 2WUCL 4JCMA 2YAHA 2BXZA 4OBRA 3LZOA 5HDRA 3G7TA 2NY1B 3TIDA 4PIRF 1IQDB 4BWTA 5AUMB 5LBSH 1AQDA 2IJ0C 3AABA 2KERA 3SDYL 3EH5B 1KCRL 5JHDE 1I75A 3DXAA 4OV5B 1JMXA 3LN9A 1UADC 3MCG1 2C1OA 1PYWB 2NXYD 3K8KA 4LGPB 4PGCB 5LDUA 2CIKA 4Q7DA 2Z92A 3MUJA 2V2XB 5C2BH 2VR6A 3ELQA 3ZMEA 4GUQA 5DGRA 4HIHA 3MZGB 4D0DA 3OKMA 1DCEA 1XBDA 4WF7A 2WLJA 3AWEA 4W4OA 3NFNB 2UZIL 3O0RL 3V4PL 1I8MA 2ZG1A 3OLDA 1S5IH 2ADFH 4RMTA 4WTWA 2A4ZA 3EHBB 3KWWA 4LVHC 4MD5A 4N5ED 1IEHA 3CDZB 4GKNA 4N8VG 4EUPA 5DWPA 1S7SA 2EDOA 2YRBA 3TVMA 1KEGH 2EC9U 5D7LD 2X1OA 2IPUK 1NEZG 3IBOA 4BK4A 4ZUTB 3RURA 3WKPA 3ZY7A 1GGYA 4WFHD 5GGQL 4WQOA 5C07B 1OM9A 4DH2A 2UZPA 4E9QA 5IG7B 4KROC 5TPWH 2YBRA 4EI0A 2J8UA 1WV7T 3FTUA 1KFAH 4QXTB 1MRDL 3NSXA 5I6NA 4WGWB 3EOAA 4PV1C 2ENPA 1J0KA 3E2HB 4ZAKD 5F70A 2Y25A 2D4FA 5E6IC 1X5HA 3FUDA 4DAGL 1A3ZA 1YJDL 5L8LB 4G8IA 4FABH 1IEBB 4CDHA 1G1YA 1ZVSB 2A9CA 4JANA 3R0MA 1WG3A 4GW4B 4L29B 2VZ1A 4MJ2A 3MRGB 5CLTA 1JV2B 1IGYB 1BG9A 3ML9A 3X1GA 4FQ2H 3IDXL 4X5XB 3S7GA 1XGTB 3A3YB 4WJ5A 3U0TA 1GC1L 4J3OC 1XMWA 1VF5C 4X9IA 4Y9FA 3IGAB 5HI4D 4ELKA 2VDNB 3WNLA 2APBA 1GGBL 4P9MH 1NJ9B 3LEXA 4LP5A 3S6CA 3MSPA 4E9LA 5B39G 2XA3A 2FJGA 5DJ8B 3FU9A 5ALCL 3RZCB 2OMWA 4HP5A 4OKVA 4PGBA 4WK0B 1QW9A 5ANMA 1A6TB 1W0WA 2OS7A 5GS0L 3GJFA 3FUNA 3EXLA 4BE6A 2G2NA 3B2MA 3EYUL 3VTAA 4UM9B 3X1FA 1ZLWH 1FNEB 1DTUA 2LE9A 4XZUB 4N8VA 5IMKB 2WQUA 4A67A 4LCYB 1AE6L 2XTJC 1JAEA 1L7TH 5BS0E 3QDGD 2LU5A 3E6FA 4XPGL 1SQMA 3SDCA 1NEZA 4XH2B 1S7XB 3ZMRA 2B4CL 1GGTA 4OD3H 3EJJX 4XOBA 3QJOA 4H8WL 5AYTA 2X3BA 1NGZA 4P2RA 1NAMH 1WWWX 5JXEA 5B3SB 2L7UA 4DN3L 5JORB 4CGUB 4YQXH 4W9HC 4XCYB 3SODB 4ZO7A 3HR5A 4NQCB 3VGBA 1JF6A 4JFSA 5DLLA 4GJTB 4HWUA 2R9HD 2AQRA 3MNZA 4J3WA 1HWGB 2IGLA 4YSCA 5GXBB 1OQOA 1EANA 2IV8A 1A3LL 3LS5H 3NEXA 3QA3B 4JPSA 4WFFE 2PPCA 5I0WA 5ERWA 4PLJC 2WLLA 1Y7VA 5HHPA 5L88H 5H35A 2CO4A 4QXGL 3UFIA 4AC4A 1NSNH 3GYRA 1QSED 4AGQA 2XN9B 3ARPA 4GOSA 4XBPB 3TEZA 4HAFA 4I7ZC 3WFDH 3G9VA 3GUTA 5E9DA 2ALAA 1CN4A 2YRLA 4ENZA 5DR5H 1KGCE 3MV7B 3MROA 5GJTH 1KJ3L 4ZTOL 5AAMC 5B39A 2VLKE 1G43A 1CD1B 2IDCA 4M1DL 4KMQA 1OSZA 2F8IA 1CYXA 1E4JA 4IGBB 4ODSH 4OZGA 2AKRB 1BA9A 4U3SB 1M7IB 1CLOH 3JV6B 5JDJA 1JK8A 2R4SH 1P7KA 4R5TA 3FB6A 5DRNA 1AY1L 4JHAH 4P49A 4B7LA 2N0MA 1U93B 1DDTA 3O6ML 3APCA 4PW9A 4Y19B 1NLDH 3JUZA 5DMIL 5T5FH 4K55A 5KSAC 2WLNA 3RJDA 5E2VL 3QI9A 5GGVH 3DX2A 2DBLH 4R26L 3PUCA 5E7FA 5IVZB 2V7HA 1MCOH 3TWCH 2VABB 2WLZA 5BRPA 3PHAA 3VI3A 4ZMNA 3L45A 2W80C 4BE5A 2E9GA 4JFEE 2CHNA 3WMSA 3C2AL 3C5ZB 4NWTL 1WZMA 4ABVA 1SLXA 5ABZA 1ZGLM 2XKNB 3S3CB 4FQJL 4QTIH 4PS7A 5I2IA 3UAFA 2LABA 3QQDA 4NP9A 4B9CA 1O9VA 5AZ2H 2VLME 5GZOD 2DLEA 4ECNA 5C71A 1JPSH 2BINA 2DYRB 2ZCKL 3SGKA 1QZNA 1YPZF 1AKJA 4NO0A 3Q3GB 4ISVB 1OAXH 4NQED 1MRCH 3LHAA 4LQFH 1GMIA 2XJLA 3PXJA 4L9DA 5I8EA 3RIAK 1KGIA 1OP9A 4XN2A 3PG2A 1JZDC 1LILA 3U36B 5DJ0A 5J89A 2FEEL 4PAZA 1DVFD 3F2LA 2J6EL 1EA9C 3BWUF 5KVEL 4J12A 3FQTB 4HWEL 3UJJL 2D73A 1PZ5A 5EIQA 1ZVNA 1X44A 4UQ3A 1GGIH 3WY2A 4X4XA 5FKPB 1P53A 2A1WH 4G6KL 2EYTA 4YX2L 3M17B 4YMPA 2FJFB 3ZE1B 5FFLA 3EJCA 4KH2A 1GAFL 4LASH 3U7YH 2HFFA 1JI2A 1SJHA 2F7IA 4QHKI 1UOWA 3O9WA 3EBGA 2Z91B 1ASPA 5ACMA 2BIOA 3VXPA 1BSIA 3R7RA 1UT2A 2IWEA 3OKDB 5DJ6A 3GINA 1J5CA 4O2CA 3HIZA 4FXGA 4OUUB 3NIGE 4A7SA 1AQKH 1LO5B 3B83A 1DCLA 4YFDB 4ZUSB 3KPNB 3V4VH 1DLFH 2IQAA 3BAYA 2FQFA 2ICEB 5SWZD 1AC0A 2D2OA 1EHLH 4FC3E 5C3LD 3KXFA 5CIPA 1RLWA 1U95A 2N1KA 3I02A 5EA0L 3RVWC 1UKQA 2HVJB 4P9HC 1Q1JH 4QWWC 3VG9C 4Z3FA 3UCQA 3VFSA 3CZLA 3UYRL 2NR6C 3A4FA 5AOKA 2NCMA 3W9EB 3CN2A 2X6UA 3ZYOA 4ORGA 1IC4L 1OTSD 1UM5H 4M6OL 1IKFH 1TPXB 2DQTL 4OGYH 2EO1A 3INOA 5F3FA 1S78C 1SYSB 2LU4A 4C47A 3PWVA 1G6RB 5LAXB 4B9KC 3Q06A 4ODHL 1DFBL 4H25B 4TUJB 2R1WB 2DV6A 3E3QC 2X88A 2TRHA 1BJMA 4I4WB 1XHHA 2A77H 5T3ZD 1GCYA 3AS2A 3ASOB 1Y0LA 4QR7A 4M1GL 1T7VA 1KJMA 1GS6X 5D1QE 3BQVA 1Z5HA 1HKLL 3R19A 1FFNA 2QSCL 3C5SA 1A6UL 2IBZY 2ZKHL 3A6CH 1ZE3C 5E2UL 2QKIA 4IU2A 2V8LA 4PB0L 3C6SB 1S7VA 4WI9A 3AW5A 3BH9A 1MVYA 3UZQB 1JRHH 1KEMH 1N2RA 4LP8A 2FB4H 1AG0A 2B39A 4ZFZB 3K74B 3VD1A 2WAQA 3QC6X 5D8JL 2BXYA 1Z5LA 4RFEB 1GR7A 4AIXA 5HHQA 1U3HA 3FCSB 2B0SH 3MRRB 5JIDA 3T0XA 5E4OA 3S37H 4ZSOA 3VFOA 3LN4B 2IGFL 3IFPA 4PTTB 4JFFA 4J3VA 4NPJA 3SYCA 4HK0B 1D5RA 1THCA 4DTGH 3F01A 2OYMA 3LB6C 1JF5A 4YHYC 1GOHA 2ICCA 1ZLVK 5L4FA 3L7EA 4BXSV 3GSOA 4AZ8A 1NGPL 2AK4A 3VFRB 1JFHA 5E0QA 4EDWL 4QTHA 3REVA 2HT3C 2JV6A 3EH4B 4HJSA 4TUUA 1P1VA 5ILTH 5BO1H 4AYFA 1URIA 5D1XB 1R3HB 1WT5A 4LK4A 3WS6A 4U1GB 5L2KB 2IAMB 4G43A 5B8CA 4PJBB 3DIFA 5EC2A 3FQ1A 4FQHB 5EZJA 4APQB 1CDJA 4PJXB 3BWAB 4MDIB 3N2JA 5KVDH 4WW2A 3O3BA 4PR5A 3HVNA 4NZ8A 3BP6A 1ED3A 4PWIA 4JFWA 3T6XA 2BZCA 3D0VB 3DXAE 2AEQH 2P24A 3ET9F 4IJTA 4U1JA 2PTUA 4PRAB 3MO1A 4RX4D 2OJZL 2YAMA 3LN5A 1NBZB 1JP5A 4JVPA 3L3IB 1XGQB 4G6ML 3IKKA 4U1LB 1K5NB 2VLLB 2A73B 3O2VL 3CSFA 2BSRB 1FYTB 5ETUA 3JYCA 3SKMB 2VDRL 3CZGA 2W95A 1HL4A 3PJSB 3NFSH 4NC1C 3OMAB 1NMAL 2MHAB 1HH9A 2Y06H 3UBXA 1WITA 2EXWC 3V5DB 3G08B 2IG2H 4L05A 5E08H 3QT2A 3FU3A 4YDKL 3U2JA 4BINA 1CPUA 2J5LB 2QGBA 2JJTA 4KXAA 2NSXA 3W9DA 3HZYB 4XCNB 1KUMA 2FECL 2Q9OA 3UTSE 1MPAH 3AG1B 3EFOB 2MTAA 3S3PA 2ITFA 4DCQB 1DBBL 5E56A 1RKRA 3BT0A 4HCIA 3T0EB 5I17B 4U7SA 1CFVL 3EXJA 4M7JH 3ZL4L 3R18A 1VEPA 3S88L 2YPLA 2ZXCA 1KLFA 4MQ7A 1ASOA 5HDWA 5C0NC 1E40A 2J8UE 1QX1A 3CX2A 4OZFG 4W93A 4JHUA 2X4SB 4ONHA 1V3KA 2FNBA 3EOBB 1LEKB 1KYFA 1TTBA 3QJHB 1AGCA 5HDLA 1G0XA 3ERXA 3FT1A 4H1LB 4KRMB 1DBAH 2XN1A 3APFA 1N0XL 1NBVH 3E6HB 1BW8A 1R3LA 5HDOA 1RJYB 4HDIA 3PGFL 5FX3A 4XN1A 3OGCB 4BRVA 3KPRD 4G72B 3VRLF 5GGUA 5CZVL