1NJ9B

Cocaine hydrolytic antibody 15a10
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGPELVKPGASVKVSCKASGYSFTDYNMYWVKQNHGESLEWIAYIDPSNGDTFYNQKFQGKATVTLDKSSSTAFMHLNSLTSEDSAVYYCARGGGLFAFWGQGTLVTVSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin variable chain
publication title Crystallographic and biochemical analysis of cocaine-degrading antibody 15A10.
pubmed doi rcsb
total genus 36
structure length 215
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nj9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nj9B02
2RGSA 1HHGA 3AUVA 4WI7A 5EIIA 2PO6C 4X0KB 5HPMA 2F53E 2CKNA 1B0GB 1P4LB 2FHFA 1JTPA 1MFBL 4ZFOA 4HJ0C 5HHME 3RDTD 2ICEB 3O45A 4MA7H 4J8RA 1JGLL 5JHLL 4YE4L 4OB5H 3SDDA 2VC2H 2JTDA 3S35H 3OKDB 4YFLF 3V79C 4MSWB 3FQXB 4RGNC 4YHIB 2ICWA 3IGAA 3PWVA 5FYJU 3U0PB 5FO7B 3ZKQD 4GAJL 4AY0A 5CUSL 4RMTA 3TT3L 1I7ZB 1U92B 2WIIB 1ND0B 4RMWA 4HMCA 5IFJB 4RAHA 1I9IL 4P4KB 2XPGA 4L5FH 1SM3H 3LVEA 1HKFA 2ICES 1S7RA 2WLZA 1NUFA 3GGWA 3TN0D 2FH8A 4PRHD 4U05A 1INQA 2E5EA 4P3CL 4V1DA 2Y07L 3QFJE 1JBJA 4K3HA 3HZKA 1A6ZA 4RDQF 4HKXB 1JGDA 4HCRA 1OPGL 4FMFA 3MO1A 3T65A 3EOYG 1OHQA 3ARXA 2XI9A 4R26L 5D71L 4AJ0A 2NR6C 1ZT1A 2NY7H 5EO0A 4E0RA 1ETZA 5F97E 1NDGA 4AH2B 5SX4H 3FFCB 1KOAA 1KN4L 3RDTC 4N8CL 5H37H 1RZFL 3RWIB 4HX1B 3HI1A 4Z7QE 1UWEL 2D4DA 4H8WL 4XWGH 1PG7W 3C09C 3KPSA 2BHYA 4BM7A 4WO4B 4EDXB 4RDQG 2VYRE 4K8RL 5JXAL 1JMXA 5F1OB 5JHDB 4G8GD 4PLKD 4I77H 3DARA 3EFFB 4UIMB 3KJ4C 1EPFA 1REIA 4HIEA 4D3CL 3V6FB 4LSVH 5INDA 5FV2A 4XPBH 1U3YA 1S7VB 1EEYA 3MLWL 2XG4A 3PJSA 2DLGA 5KANG 4DGIL 3V5DA 2NY6D 5ANMA 5I2IB 3TN0C 3D3VE 1P2CA 3T0BA 5D6CA 4XCFL 3CU7A 4X5XB 4X9IA 5TFSL 5KZCD 1HN1A 4W68A 1A3LL 1ZVHA 3BKCL 3UTSD 4O9HL 2HFTA 3MA7B 2A6KA 2E7LA 2B1HL 4GG6A 5I1KL 4IOIB 5L9DH 1FRGH 2HVJB 3GSUA 5CSBA 3MGOB 5DJDB 1F11B 1IGFH 5EORL 1N4XL 4M1CC 4WVRA 5DR5H 2A6IB 4P9ML 1D5BA 3ULUD 4D9QE 2ESVE 4IRSD 5IVZA 2JJTC 5DQDL 4I3GA 3F6IA 2VDKH 5SV3A 3I50L 5TH2A 3VFSB 1WUNT 4RNRB 4R4FH 4WV1C 4GJTB 3R06B 3RWHB 5EU5A 2FATL 3IDYC 3MLSL 4LIQE 5ICZA 2LAGB 5CBEA 4JANB 3KLDA 1S7TB 4GG8A 2IFFL 4P4KD 5DD6B 5E8DL 5I16A 3H6JA 5E1AA 1JPSL 2PW1B 3MMEA 1WTLA 2I9LB 5H35A 4TNVF 3MCKA 3H9SA 2YPLA 4R96A 4XBGA 5F88B 4DVBB 2J4WH 1ZT7A 2NY6C 2UUDK 1YQVH 1NBVH 1G7QB 3QIBA 4U6HA 4JLRB 3SKNB 2G5BA 3N0PB 3HG1E 3VGDA 4O2CA 3TT1L 4M8VA 4HIXH 1F4YH 5L2KD 4ZTOH 2FEEI 2EDTA 3OF6D 5BV7H 3I6GB 4G7YH 3MRKB 5E6YA 4PJ8B 4HPYH 3FRPA 3T2OA 5DTFA 4LU5L 3FFCD 2APTA 2CLZB 4P2QD 1WCBB 3ULUC 4IRSC 3MFFB 4NQXA 4P9HC 1V3KA 4WUKL 2NY3B 1NEZB 1FL5B 3QNYA 4OCXL 5FYKL 2NTSP 5AD0B 4X7TA 3VXRE 1MJ8L 1Y0LB 5I8KH 4RAVA 3RIFK 3WHXB 1MCRA 5IJKC 12E8L 1I8KA 1RUPL 3V4UL 5EU6D 1HKLL 2W91A 3BJ91 1JNLL 1PY9A 4P4KC 4U1NB 3U30B 1WBXA 4X6CF 4N90D 2F5BH 3FN0H 1BIIA 3QG7H 3SGEH 5D7IB 4KTEL 1IQDA 1FLTX 1CXKA 5DK2B 1KCKA 2ZCKH 1DN0B 1BOGB 4JG0L 4YDIH 5KSAB 3OB8A 3FO9A 3WSQL 3T8XB 1OAXL 3ZDYE 1GC1C 4YFDB 4O5LL 1R24B 4E41E 5IROA 3HZYA 3BEWB 3EJYD 3FB5B 1KPRA 1OGAE 2KDGA 1DL7H 4JR9L 3MRBB 1PQZA 3DRTB 2NTFB 3LD8B 1NGWB 3QEQA 1U91A 3DXAD 4QHKI 4JFDD 1CFTB 3SY0B 3QQ4B 5D5MF 1NC2B 2AW2A 4YXLH 3W0WE 5I19L 3TYGH 1FZOB 1KJMB 4TULL 4XX1E 1DQDL 4GXUN 2IPUG 5FF6B 5DYOB 3V9FA 3P9MA 4PIRF 4XBEL 1D5XA 3V4PL 5CMAB 2VL5B 1UJTA 2BJML 4HS6B 1SEBA 4PV9B 1JPTL 1WGOA 3P30H 1RY7B 4TUJA 5E2WH 4MD5A 3OJDA 1K8IB 4JAMB 1LDSA 4HS3B 4IS6B 2VWEC 1FVCB 4HFWA 4JCLA 2A9MH 3FB8A 4PJXF 5IF0A 3SGJC 3MOBL 5DMKA 5JZ7D 4JFFB 1BP3B 2YA0A 1S3KL 3VWJB 2JCCF 3CFEB 2V2WA 1KCUL 3SJVE 4LRIA 4PJBF 3X3GL 4MNGB 5C0JA 5MEQA 1WVZA 1IGTA 1CFQA 5F7FA 3CMGA 1RI8A 4PJ8D 3P4NB 1X3DA 1NCAL 3BEVA 4OM1L 4P49A 3EJYC 1BF8A 1NMBL 3GMPA 1D9KB 2VXQL 5EO9A 3OKLB 3IYLW 1W0WA 5TDOA 2BSRA 4KUCD 2G5RA 2MNUA 3Q5YA 4OGAD 3U4AA 2HYMA 4ZSOE 3CUPA 3FN3A 4U31A 4RIRA 2X7LB 4M7ZB 4DZ8A 3HE7A 4H5SA 1EBAA 3IDMB 1ZHBB 2DDQL 3SKJL 3IFPA 4GSDH 3MRPB 3UCRA 1IM3A 2P42B 4NKDA 1KPVA 1J1XH 5C0BB 4I0PB 5D2LA 1QO3A 2EXYD 4XCYA 1KNOA 2Q86B 2YD5A 4JDVB 1QBAA 1WAAA 2XZZA 3S35X 2N1KA 4CADA 1WZLA 3RWEA 1V8HA 3UJIL 5JPNB 3EO1A 5GS0D 5EOCH 3MGTA 2R0WL 3VG9B 4UILL 1I1AB 1T21A 4PG9B 4EOWH 4HXAH 3UTTD 1NCDH 1RJYA 3PGCA 1XGPB 1CLOL 2GJ6B 4PRPE 2C4FU 2C9AA 2ZSWB 4PJ8C 3RGVD 3BW9A 2JK5A 3U0WH 1ORSB 4X4MA 5ICYA 3RZWA 1UYWH 3O3EA 3KPNB 3PUCA 5GGTA 4TSCH 2VXUL 4D9LL 4XGZA 5DD5L 1OW0A 1X5IA 5C2BL 1GZQA 5I17B 3UBXG 4G6AD 5C0RH 1LO4L 4LKCB 2C3GA 3QFDB 4J3SA 1V5JA 5F6HJ 5FA4A 4GMTL 1GYAA 1T66D 3RA7H 4CU7A 1X5HA 1KTDB 1T1ZB 3HI6L 3LQAC 4BZ2L 3MBXL 1OF2A 5F3HB 1FV1B 3KPOB 5EN2A 3FQNB 4NQEE 2PTUA 1NCCL 1G9EA 3CSYB 2EXYC 4WWKB 1MUJA 1F4XH 3QP3A 3VWJD 5KVEH 2XV6B 4M7JH 4HG4J 4JB9H 5A16A 1F4HA 3VXUD 3DVIA 3VFRB 2HVKA 3UJJH 5KSAC 4PV8B 1QSFD 1ZA6B 4H0HB 2VXTH 5KN5B 2HT4D 4R3SB 4I48B 3FAXA 3J8F7 3DOSA 4YK4B 4FQLL 4OZGA 2EDLA 5E2VH 2Z31B 2WWMD 3SGKA 3LD8C 1LEIB 3RGVC 1QSZA 4WRLA 3OB0K 3MUHL 3PQYA 2YSSB 1CFVH 1VSCA 4KK6D 1IM9A 2MPAL 1HQ4B 1RMFH 4A6YL 3O3UN 2QQQA 3TZVB 2Y6SD 4HQQH 32C2A 3L3HA 3PIQB 3HI5L 1T5WB 4G6AC 2ADJB 2XWTA 4UQ2B 1MFEH 1E0OB 1U3HB 1U8QB 1CIUA 3G6JE 1MCWW 3L6FA 3HZMB 4OSUL 5FCSH 5D1XA 1CFSB 1XZ0A 3LB6C 5D1QD 1MHEA 2OP4L 1NEUA 2DQEL 2YC1A 4POZC 4WWID 3HE6A 2YS4A 2WK2A 3KLAB 1RZKH 5D7JB 3GMOB 3MACL 4GW1B 4Y4HB 3GKWH 4U3CA 4NRZB 3VWJC 1VERA 5ITFA 1L7IL 4PJEB 4MNHA 2FRGP 4GRWB 5E56A 3CC5A 5TE7L 2EDOA 4EIGB 3C60A 5DJCA 2DQTL 3T2NL 5B3NA 1KLGB 2HKHH 1UEYA 1S7XA 1CXIA 2HT4C 4S11A 4P9HH 2FHBA 3QIWD 2A77L 4U1MB 1YJDC 4PD4J 2F53D 1VHPA 5HHMD 1GGYA 2IMNA 4PJAB 1VEPA 4NGHL 2BK8A 2Y7QB 3NH7L 2IEPA 3BOVA 2C1PA 2EE3A 3K80A 4K9EC 1YEIH 4L3EB 4LGSB 5B3JF 2I9TA 4XP4H 4HJGB 1PKQE 4KK6C 4LL9A 2XWJB 4EJ1C 3OR7B 4U1HA 1BD2E 2OMBA 4M7ZC 4YR6A 5KJRH 4X5WA 4GLRH 4XMPH 4N0UA 3M8OL 3MJ8A 5DI8A 5ENWA 2ED9A 4EBQL 4PRNA 1M7IB 4DKEH 5DHVA 1XF1A 3MBEB 3QHFL 3VI3F 1WLHA 1XGQA 3X13A 3I2CL 3TFKC 5MENA 1IGIL 3QCUH 5LWYL 5SWZA 3SDAA 4L3CB 1RSFA 5D1QC 4AEIL 3UPRB 3B6SA 2Q8BH 5IB5B 1OT1A 4PJXA 1JHLH 2XRAL 3ZSTA 3L3KA 3FB7A 4HGKC 3WIIL 1GC1H 4HC1L 2EDFA 5MI0B 4XP6H 3VG9C 1I1AC 1LEGB 3E1F1 3RGHA 4PJBA 3IXTA 2D7OA 3DMMD 1S9XB 1LE9B 2Y36L 4Y16D 4UT9L 1FIEA 3KWWA 2RIKA 1ZHKB 3QIWC 4G9DA 2IAMD 4XNUH 4AZ8A 1DANU 3S96A 1M1SA 4OCRH 4XVJH 3F6LA 4JN1L 2HJKA 1ES0A 3QDMD 3WNPA 2FYYB 5HDQL 2MCPH 5K93A 3LEVH 1T04A 3BYTA 4KRLB 5HI4D 4I5BB 4X4ZA 4RA0C 3KPPB 4AEEA 4CJ0A 3LKSB 1DBBL 3W11D 2VLME 4OLWH 3D9AL 5L2JB 3T4AB 4XTRC 3INUH 4JGJA 5K59F 1P9MA 5T3ZD 4NM8L 2H6PA 4NDMA 4WWKC 5EUOB 4KZDL 3D3VD 3MYJB 4FHBD 1R5WB 4P2RE 1QRKA 1UXSA 4TOYH 4TNVK 4LCUA 1ZLUK 1GSMA 3UBXA 3NFNA 2FJGB 3SKOA 2BNRD 3TVMA 3EOTH 3LMJL 4YK4C 5DQJB 3RI5F 1EEQA 1E27A 4Y16C 2Z31C 2G75B 4D9QD 3PL6D 1QOKA 1RJCA 2L7JA 1OAQL 4LPXA 2IAMC 4PJ9B 3GKZA 1QKZH 2Q3AA 4L3ED 4C56B 4G6KL 1D5ZB 3R1GL 3BPOC 3TZVC 4OLXH 1TVHA 1I3VA 2KQMA 4UT7L 1U36A 3EYVB 1R3IL 5DJXA 2L0DA 2Z35A 1B4JH 1E28B 1IZKA 1FH5H 4S1SL 3BXNA 2XN9D 4Y4FA 5IVXF 5HI4C 3WIHH 5E99H 3CDGB 1IT9H 5C0IA 5KG9B 1U3HC 1K2DB 5BMFL 2E8ZA 1MFNA 5J7CC 1YN7A 5ILTH 3PF2A 3S34H 4NQSA 1DEEA 4LQ1A 5HVHB 1C12A 4HUWB 4JZNA 4UV7L 5D7JC 2Z92A 2GCYA 5DF0A 4Y4HC 3QNZA 4EI6A 4Z78B 2CH8A 3HG1D 1VACB 2P5WB 3F7YA 5FO9A 2UY7A 2A9NL 5EU3A 1RUML 2FO4A 3P11L 3TIDB 4M00A 3Q3GB 3DX9A 5DUBA 1VFMA 2JIXD 3QH3B 1A4KB 1RHFA 5E7FA 2I07A 3T4YB 4LSPH 5I66B 1WWWX 3PL6C 5BS0B 1RFDL 3V6OE 3WE6A 4YHOL 5F9OL 2R23B 2AEWA 3RHWF 5CJQL 4ZFZB 4JJHA 4N1EA 2CPCA 3VWKB 3VXRD 4DOHB 5IMKB 4DZBA 3C5SA 4F3FA 3PHOB 3TO4B 1B2WH 1RK0A 3HB3D 3KPQB 3HKFA 1S5IL 1NSNH 3IDXH 3IJHA 1DQLL 1JE6A 4FQ1H 3MODL 5ECJE 3MBEC 1YUHA 3KYKH 2B8OT 4G7VL 4XZUB 2X70A 4DGVH 1EJ6A 4YEFA 3VJ6A 2ICCA 4I18B 4U1IB 1GJIA 1T1XB 4EVNB 3MR9B 5TQ0L 1A7RL 1M6OB 2AJXH 4TVPD 3KPLA 1ZGLP 4M48H 1J8HB 1IEAB 1X5ZA 4OCMC 4EKXA 5CILH 2A6DA 3CFKA 1ZGLM 5MI0C 4NN7C 1R0AH 2BX5A 5ADOH 1GZPB 2ZUYA 5MEPA 5TDNB 1JYNA 2RR3A 1BAFL 3DNKA 4YDVB 4U6XA 4FZEH 1J9CT 1WAAE 1MWAB 1OGAD 3V0WH 4HWZB 3FN9A 4LK4A 1QQDA 3LQZB 2V7HA 3HFML 5DVOA 5IBTL 4UDTB 4BSVB 2DLTA 5C0DB 3IETB 4M1GL 3O0RH 1CBVL 2PN5A 1RZ8B 1R3JA 1MCNA 2HT3D 4KI1A 4PJIB 2E9WA 3ZKND 3L5WA 1KIPA 2HKFH 3S4SG 1I85A 2CKBA 4JRYA 1HHGB 3TH2T 2X1QA 2EYSB 4YHKL 4HZAA 4N9GB 1D5IL 3HB3C 2H26A 1LO0L 1U8MB 2ILLA 3EOBA 2IFGA 1OAKH 3DTXB 3DX6A 3GSQA 3UTPD 3T0WA 2MKWA 4JQIH 2APVA 4OZHB 5CP3A 2ICWB 3WUWB 2D3VA 2WUCL 3NZHL 3LEYL 3TPKA 3MV9B 3T1WA 5F7LB 4TUOB 2YMXL 1I8MB 4JFEB 2FGWH 3ECBA 4NCDA 1FN4A 2AI0L 3ARBD 3LKOB 2AJUL 1YJDH 3E6FA 1XF5A 2WBKA 3WS6A 2YA2A 5D7SL 2DRUA 3BHBA 3KXFE 5H8DA 4K9EH 1P7KA 3VRIA 1EMTH 1KC5H 2X1WL 2ZOLA 5T5FH 5FUOL 1CDCA 4BQ8A 1F45A 1A6ZB 3BMVA 4PJ9C 5EC1A 5EU4B 1EDQA 5L88L 1KFAL 3E3QC 3T3MF 3RPIB 2UWEF 3T65B 3MRDA 1PSKL 1CR9H 4Y7MA 1F3JA 3LKPA 1K4DB 3RVUC 5CHNA 5IBLD 3ZKNC 3R4DA 4DEPB 4MCYB 3MGAA 1CD9B 1TFHA 5EO0B 1DDHB 2IH3A 4E0RB 3O4LE 1NDGB 4N0YL 4RA3A 3TPUB 3H9YA 4PJCA 2VRAA 3PQYE 2OL3L 2P8PB 4YO0A 4HK0A 3CK0L 1F2QA 2VQTA 3HI1B 2C3WA 1CK0L 1CU4L 3MRIA 4HKJA 3RZCD 1EFQA 5LXGL 2FBJH 5JORA 2DKUA 2NLJB 3L5JA 5DJYA 5KSBB 1G7LA 1U95B 4NCC2 5FHAH 1J86A 4YGAB 1VFBA 3MLPA 1EO8L 5IESH 3K1DA 1HHHB 5DVNA 3S6CA 1CLZH 4PJGF 5CS7A 4JFOA 3NBNA 3WN5B 3MNWA 3ARBC 4HAFA 35C8H 2NXYD 3NA9H 1ONQA 4LPTA 5F9AC 3RY5A 4N8PA 1HNFA 5ANMB 1KXQE 5D7IE 1AJ7L 5K9QI 4YBQD 1HOCB 3BUTA 2X1XR 2YN3A 4MNQA 5A2KH 4J3OC 3C6LB 5FA3A 5F6HI 3QXVA 2E6QA 1W72A 3GIVA 5D7KE 1MY7A 4GXVH 1JHKH 3KYOA 3CSPA 4LVEA 4F15B 1ZT4B 1PX4A 4ODVH 3VWKC 3QDGB 3D0LA 3DBXA 3TO4C 4YH6A 4CAGA 1EFXA 3PDOA 5T1MA 2BY0A 5T3XD 2W0FA 4G42A 1IGCH 5K9JL 1J0ZA 4NN5B 2QKIA 1VKXA 3NVQA 1MCHA 5IVXA 3TA3B 3SDDD 1QEWA 1X7QB 2FD6H 2J8OA 2Y25A 5F7UA 4NKQB 2BMKA 4P23A 3NMEA 4I18C 5FO8A 1WBZB 4NQCA 3N06B 5HD8C 3GSOA 1MCSA 3UZQA 1T5XB 4N0UE 3ZL4L 5CBEB 2FBOJ 5C6WH 3HNVH 4TSAL 2CRZA 5GS1B 1WIOA 3GSNA 3HCVA 4O2EA 2V17H 5CP7B 5HYJB 4AEHL 2JJUA 1I1RA 3BISA 3KDMB 5H94B 1N0XH 2ITDA 1KACB 4PTTB 3QAZB 2F9BT 1I7UA 1E6OH 4V1DD 2NXYC 2YA1A 3W81A 3WNMA 4JFFE 5F1NA 3UDWC 4GBXA 4YBQC 3IFNL 4U6HB 3V5HA 25C8H 3P3YA 5HHNA 1ZANL 2D03H 4CU6A 3OTTA 3X3FH 3DI3B 1P6FA 3WIFA 2J6EH 3D1MC 3IKCA 4KV5F 2DL9A 5HHPA 2WBJB 5DTFB 4NPYA 5IVNA 1BLNA 1NMCB 4CL7A 4EUPG 3STZA 5T3ZH 3WJLC 4AL8L 3PWJA 5DWUH 3EZJB 3SE3A 9CGTA 3MRJA 5GSVA 3SDDC 3KPSD 3FOMA 4PRIA 1IGJA 4GRWH 3OAZH 4C58B 4K3GA 4RAVB 1GPOL 4OQTA 4WJ5B 2G9HB 5HPOA 4JO1L 4PY8I 4OGXH 2JE8A 5BRZE 2Y72A 3I3BA 5AZ2H 2RCSH 4ODXA 1FNSH 4QOKB 3S4SA 2ADFL 3JXAA 4QXTB 5ID1A 1WBXB 4JO3H 1FL6B 3MJ9A 2HN7B 1J1OL 2CLVA 4AIZB 1T89C 2LFGA 5JW4N 4U1JB 4X8JA 4BKLA 5HI5C 4HEME 3W9DB 1SJVA 4N8VG 4L8SA 4HAGA 4FTVB 2CDGA 4HUVB 5D2NA 4ZUVA 3HR5B 1UFUA 3WLWD 2AK1L 1W8OA 1LILA 4D2NA 1J0HA 3ZHLA 3FO9B 4WGWB 5FM4A 3IJYA 4KY1H 1S8DB 4LGRB 4ODWA 3DX8B 3NACH 4MS8D 4BK4A 1PD6A 5DJ2B 4DEPC 2OTPA 4OLZH 3V95A 3Q5TA 3SN6N 1QVOB 4W70A 5EBWA 4ZDHB 4NRXA 2NMSA 5ACZA 3QEQB 4FRWA 1MJUH 4LSQH 1SQ2N 3PP3H 4Q9QL 3ETBF 3GMLB 5HYQA 3BP7B 1VGEH 3DV4B 4OGYL 2V5TA 1T0PB 4HS8H 4ZUWA 3P4OA 4KDTA 4MA7L 3KGRA 1A1MA 2ZUQB 2A1WH 1N59B 4OB5L 4AQ1B 2VC2L 1S9VB 4MLSA 1OL0A 2BC4A 5EWIH 1IKNC 2UVEA 1SEBB 1HHKA 3H9SD 4TUJB 2YPLD 2GUOA 1G9NC 3JV4B 2Q6WA 4HFWB 2BCKB 1L0XA 3N1FC 5IF0B 3IRZA 5J11B 3AAZA 5IG7A 1YDPA 4OZFG 4L5FL 4Q0XH 1G7MB 3QIBD 3Q2CA 1SM3L 1UB5B 2ZNWA 4CDGC 3RVVD 2BVEA 4HIHA 3C6LC 3FT3A 4NYLA 1I8IA 3BDBA 4C83B 3ARVA 3RI5K 4F15C 1DBMH 1UZ8A 1IGTB 1HHJB 4MS8C 3B4NA 3ZTJG 1MHPH 1WT5C 2XFXB 2SEBB 2VZOA 4HWEH 3GMPB 2BSSA 3RX8A 2CK0H 3WNOA 4P5KB 2VLMD 2CUMA 4YWGH 3TA3C 3FTGA 2NW2A 4YX2H 2BHUA 3ARRA 3VXQB 5DHXB 3B5TA 1Y6NR 2NY7L 4Q74A 1CIDA 3KYNB 4TVPH 4S1QH 4P46A 3L3JB 3WS3B 5FGCE 4GMSH 4RZCA 1BMGA 2MOVA 4DZ8B 3HE7B 4H5SB 3ZHKA 1O7VA 3QISA 2CIIB 1JP5A 4IEFB 5GS1C 4YBHA 1UA6H 3IFPB 2XA8H 4XWGL 4ZD3H 4P3WA 1IM3B 4ZS7H 1CLCA 2XTLA 1U8HB 1KXTB 2PYFA 2VABA 3VXMB 2AABH 4I77L 1X44A 4H88H 3MLRH 3VFNA 4CADB 4WY7H 1A14H 1FZJB 2X4NA 5D1ZA 1HYRC 4XPBL 3EO1B 3QIBC 1LK3H 4PJEE 4NRYB 3MRQB 2K1MA 3I6LD 5GQBA 3O3DB 3BD3A 1Y6MR 1OSZA 1KLUA 1G0DA 2PETA 1T2XA 3QEQD 2JK5B 3ZDXF 1NMCC 2ZPKH 4LDLB 2Z8SA 4POUB 2W0PA 4IMKA 1FRGL 3O3EB 2Z8RA 3RHWK 2HJLA 2J5LB 1IGFL 5KVDH 4N1HB 5DR5L 1QSVA 4HF5H 1HSAA 3RY4A 2DWEA 1T7XA 2D9QB 4G8EB 4O58H 1I1CA 4QRQA 2VDKL 1UXWA 5C0GA 5BQ7A 5I8EA 4JPWH 2M2DA 1GHFH 1JV5B 4L4TE 4ISVB 4R4FL 3K8LA 3O2WH 3E0GA 2V7NA 1U0QA 5IBUG 5D70H 1RHHA 2BOBA 2R4RH 3DHMA 2EC8A 3MRCA 3U79A 3OXSB 5D9SB 4UV4H 2MSPA 4OKVA 4TYUA 3K2MC 2APWA 2CJUH 5DQ9B 3JUYA 5A16B 5IMMA 3QG6A 2E6PA 1KYOK 1SJHB 3GMMB 5DS8B 2J4WL 1S7SA 1K4CB 2F15A 3BGFC 4LNRB 2OM5A 3KPRA 1YQVL 1NBVL 1X5AA 5IROC 3MXWH 4LDEB 4LF3A 5E2JA 1F4YL 1NANH 5IP4A 3LAFA 4ZTOL 4PRBA 4P3DA 5D96B 1JGVH 4OUOA 1MCLA 5BV7L 4FXLA 2NNAA 1MCDA 4JM4H 1IM9B 1A6WH 2GAZB 2PTTA 4X5LA 3DETC 5IQ7L 1WCQA 4HLZH 3HE7D 5IGXH 2UUDH 1J0KA 4HW6A 2A73A 1LVEA 3L3HB 4PGBA 1U8PA 2ZUQC 2D31A 4KK9D 1NFDF 4PJCE 3A6CH 4WU7A 4GAYB 1IJ9A 3CPLB 1MWAH 4WTZG 7FABH 4LLDA 4HUUB 2DTSA 3L6FB 1X4YA 4ODUB 1YYMH 2YPVH 3JUZA 4X6CB 5IHZA 2FX9H 5CEZH 1P4IH 4J4PA 4H26A 2YC1B 1B90A 5J11C 2OSLB 1AH1A 1UM4H 4CRPA 4K7FB 4HGMA 2E6JA 3QUYB 2COQA 5IEHA 1AI1L 2F5BL 1PZ5A 3FN0L 1HK6A 4J7RA 3D25B 3QG7L 5DJCB 5J06A 4LRIC 3IB4A 1JN6B 4OZ4B 1BWMA 1Q0YL 2AGJH 3OKKA 2LU3A 5F7DA 3BN9C 2ZCKL 4L1DA 1HXMA 5ICXA 4YDIL 2XY1A 2ED7A 4MNQE 4JQXA 5ETUA 4MMXC 1JHTA 4KHXH 5CEXB 3CXDH 3FKUS 4DW2H 1T3FB 1QSEA 3WXVL 1KB5B 4LCWA 4M6MH 4OZFA 5D5MB 2I9TB 1P7QB 3G6DH 1NAKH 1DL7L 2W0LA 2VNCA 3K4AA 4D0BB 2VISA 3GUTB 2OQJA 4BYHA 4X5WB 2MTPA 3HE7C 1FFOB 4YXLL 4HFUH 4IOFC 3TYGL 4CW1A 4DK6A 4RWHA 3EGSB 2X4RA 3SDAB 4NQCE 4LMQI 2H41A 3DURA 1D5MA 5F1KC 4PJXB 1GIGH 4K3EL 4RBPK 1RJZB 3K8MA 3KVQA 4PJFF 5E2WL 1XGTB 1N5YH 4GFTB 4M61A 2P5WE 2JCCB 4JN2B 3OMZA 2ORBH 2AERT 3V6ZA 2GT9B 4ZMAT 5TDPA 2YPKA 2YUWA 3I75B 4S2SA 1PFCA 1JWUA 4KKNA 4TUKH 4O51A 3LRGA 3PV7A 1C5CL 4WU5A 2ZG1A 4ONFL 2RFXB 3P77B 4NJ9H 1H3TA 3PQYD 5T1LB 3S96B 2J5LC 1IM9D 4HKZA 3TESA 2IBZY 3LN5A 1YPZA 2IPTH 1RPQA 4PPTA 2VH5H 3UJTH 1WBYB 1N7MH 1OW0C 4XNMB 4DOHE 5IB3A 1J05A 4JRXA 5BO1H 4X98A 1T04B 1HILB 3N1MC 2VLJB 4G3YH 2QTEA 3NIGE 3DUUB 2C4XA 3HRPA 1G9NH 3ULSB 3O2DH 2YD4A 4A2MA 5IHLB 5E94B 2IGFH 4MAYB 3B3IB 1RZIB 4GRLB 4UDUA 1EERB 1H0DA 5IK3B 5D1XD 4WDIA 3EYSH 3MREA 5KVFH 3HE6D 2H6PB 5CGYD 1ORQA 1J88A 1FFNB 1FQ9C 4GSDL 4M4PA 3NAAH 4N0FA 4WI5A 1NUDA 3FFDA 3CFJB 1J1XL 2BNQA 2EICA 3C60D 3QUKB 3DO7A 5D7KD 3UBXB 1HH9B 3H8NA 5C0FA 1BX2A 4N9OB 5GRUH 3AS0A 4P2OB 4XH2B 5I1HH 5C07B 4XPAH 2BRQA 5ID0B 3VFUB 1E27B 1GOGA 5EOCL 3BZFB 1KIRB 4G9FE 2VR9A 3RNKB 4NQDA 4NC0B 5D2NE 3SGKC 4KVNH 5CEZE 1BFSA 4HXAL 1XGRB 2E7HA 4JM2A 1NCDL 5D96C 2IH1A 1EV2E 2CRYA 3U0WL 1DVFB 1UYWL 2Z35B 4CJ1A 3NCFB 3IDIA 4TSCL 4NCC1 4KZEH 3FB6A 1NJ9B 4XMKH 3JTTB 3VXTB 1B6DA 5JO5A 1SY6A 4N5ED 5GHWH 4J1UA 3GM8A 5MEND 5C08B 2R1WA 5SWZD 3SDAD 5C0RL 5D1XC 3ESVF 1IBGH 2IQAB 1SYVA 4XVSH 4L4VA 4XB7A 4X6BA 5DA4A 3RA7L 2WUBH 1IL1A 4PJDE 4JZJB 3FO1B 5HDBE 3QUYC 1YYLH 1NC4B 6CGTA 5ALBL 1FE8H 1SVCP 3T09A 2CXGA 2XT1B 1HDMA 5JOFA 4Y5YB 4KRPD 3VMNA 3MLYH 5FO9B 4UNVA 3BN3B 3CFIC 5EU3B 4PJHF 2NW3A 2AQ1A 1F4XL 2VDPH 5KVEL 4ELMF 4XP1H 1FNAA 4M1DH 2DJSA 4M7JL 4JB9L 4RQQA 1C08A 1NCBH 4XNQA 4YXKH 5DUBB 5D8JH 1Z9LA 5MEOB 1NLDH 5HJ3A 5E8EB 2VXTL 5AYUH 1RAMA 5B22A 5TJWK 1H3PL 3WE6B 2WSKA 2D0FA 4BZ1H 1NFKA 5CBAB 1UGNA 3PWNB 5E2VL 4GT7A 2X41A 2ZUVA 4QRTB 3IXAA 1MFCH 1R3KA 4R90H 5C86A 1WWAX 1Q72H 5C70A 3GO1L 1CTOA 5D93B 1CLYL 1CFVL 3IJHB 1Z0NA 1RMFL 1ZS8A 2MMXA 2H9GB 2VDQH 3QEUB 1LO5B 1PX3A 1YUHB 1E4XH 2X70B 4LDOB 3IAGC 3SDAC 5FEBA 3U36B 5FGRA 3GBMH 1AXSA 5E2UH 5DO2C 3FO0H 1MFEL 4UOW1 3EYQD 2VLKA 5AWNH 5JIKA 1FFPA 4G5ZH 5EZIL 3ILQD 4OV5A 1NAML 5MEPB 1RZKL 3N85H 3TVMD 3MUY1 5DDHA 4E9LA 3GKWL 4UOJA 3G08A 3ARUA 2BFVL 4P5TA 5GXBB 1D6VL 4XNXH 1QQDB 4NO5B 1X4XA 4LLYA 2V7HB 4KWUA 4KAQH 3GZKA 3MRFB 1WFTA 1WICA 4RGMB 4MJIA 1EO5A 2DOCA 5GRYA 1UEMA 3QDGE 1KIPB 4JFHE 5FYJE 5I1GH 5H2BB 1FLRH 3RAJH 3ARGA 4JRYB 3N1PC 3T0XA 5BJTA 2FCBA 4Y4FD 4W4NA 1OB1B 1YEIL 2IJ0C 2OJEA 2H26B 1MRDL 3VDAA 4KKAC 2D0HA 5IKCA 4MAYC 4NO3A 5BW7A 5GRXG 3HAEG 1HXYB 4GRLC 5IMLA 1TENA 3AXLA 5KJRL 3DLQR 4XMPL 2DMBA 2AK4A 2WBWB 1JYWA 1X5YA 5JW4Q 1GOFA 3M17B 4UNUA 3H2WA 5J6HB 4IMLA 3QZWG 5SV4A 2X5PA 4KPHH 5GRJH 3U0TA 3L1OH 4PJFA 3ECBB 3NCJH 4QNPE 3P73A 1FN4B 2Q8BL 4LSTH 5HGDA 4QY8B 1QLRB 3NN8A 5IFHH 1JHLL 3SCMB 3WLBB 3WEXB 3WMSA 5KVMC 1MEXH 3ULUF 1GC1L 3TBVB 5J4MA 1AHWA 1S7UB 2D0GA 4POYA 1F6FB 4XP6L 3VRIB 3PHQA 4CU8A 2XZCH 3MJGX 2FR4A 1FHGA 3DVNA 5FECA 1H8NA 3W2DH 3KPRE 3CD4A 4ZS6D 2O5ZH 1F3JB 3ILPA 3MLTA 5CHNB 3D85B 4XNUL 2GSIA 1S9YB 3RUGA 3PWLA 4PGEA 4OCRL 4XVJL 4JQVA 3UZVB 4E42A 2CMRH 4OD1H 4Y4FC 1TTFA 1XCQB 2BVOA 3VXPA 2A83B 1AQKL 1MI5E 2MCPL 4PJ5B 3VD4A 3LEVL 2IANA 5CINH 5CZXC 3WNNA 1UB6A 4KROD 3EO0B 3I85A 3KHOA 1EXUA 1HNGA 5I1JH 1FL3A 4OLWL 4JFQA 5IV2B 5LGJB 1OTSC 1VFBB 3INUL 4EDWL 4QOKE 4PRDA 3I02A 1AIFA 1QFWI 4JFOB 3DVGB 3MNWB 4I2XB 3L7FB 1CCZA 1SJEB 1YA5A 2C26A 2JF1A 1T6VN 4TOYL 5I18H 3OPZH 4X6DF 1JK8B 5DJAA 2VOTA 1D3CA 4FTVE 1MIEH 4B0MM 4Y5XB 3CDYA 4DCQA 1JYXA 1LO3H 3AROA 2X4SB 5GJSH 1JWMB 5FA3B 1A8JH 3EOTL 5FHBH 4BUGA 4EZMA 3KYOB 3RVWC 5IW6A 2OS7A 2B2XH 4JRYD 3TM6A 2VITB 4RX4A 2G2RA 4ZS6C 3W5MA 4M03A 3D39A 3PDOB 3ARPA 4NO2B 5T1MB 5GGQL 3W9EB 1Z5LA 3BKJH 2DMCA 3F12A 4S0TD 1ZLUH 1QSEE 4I8DA 4OLXL 5IUSA 4LCWE 1KCSL 5GGRA 1B4JL 1FH5L 1CD1A 2YBRA 4RFEA 5A2IH 5FO8B 1JZ7A 5EBMA 3G5VB 3OZ9L 4KROC 1CF8H 3UTOA 1DLFH 2NX5A 1IT9L 4OJFH 1BECA 3BO8B 4OAWA 3BZDA 5GPRA 4DN3H 1UWGH 3U9PL 3TBTB 2GFBA 2DQCH 4LCYA 3H7BA 5E6IB 4OZIF 4Y5VB 4IHOA 2X4QA 3FQUA 3BP4A 4Q2ZA 4APQA 4Z7WB 4ORGB 4G6FB 2Z8VC 2VQ1B 1XR8A 3MRHA 1RIHH 4HK3J 2VKWA 2QADD 1FGVL 2R1YA 3NFSL 3RQ3A 2GYSA 1OTTC 3BVNB 1IAKB 2NY2B 5F1NB 2JELH 4GBXB 3TYFB 5J12C 1MHHB 3NIDE 4ZUSA 3V5HB 4WHTB 5C2UB 1OWWA 5FK9A 4TPRH 3ZE0E 4LSPL 3IKCB 4NFDA 3BMWA 3RJQB 4U1LA 5GGUA 3RPKA 2DKSA 2YR3A 4MJ4A 1S7QB 3PWJB 5I1EH 4YNYA 3PP4H 3VFTB 2DQJH 5ISZE 4CMMB 1B2WL 4LAQH 3SDXF 1RIVH 3FCTA 1UT9A 3MUZ1 1M7DA 1NSNL 4KHTH 1N8ZB 4L8CA 4FQ1L 4H1LA 3FT2B 3MNVB 3KYKL 3LOWA 4ZXBA 1K9TA 4X9FA 2AEPL 4MD0B 4QRRB 4Y0GA 5ESVB 4WW2F 3VFMA 3MNZA 4P2CG 3LPWA 4ONHA 3GSVA 3SCMC 2AJXL 3WS6C 3BZEB 4Y19B 3GK8L 2QADC 2Q8AL 5CILL 1B0RA 3MTRA 5F9WB 1G7PB 4X8JB 1N5AA 2B4CC 2F54A 2WLYA 3HAEA 4KUCF 1BJ8A 1KB5H 2XZQH 4Z76A 2P44B 4MNQD 1R0AL 4L8SB 5ADOL 4A6YA 5I1AA 3ROOA 1IVLA 4FZEL 1N3NA 2LE9A 3IJYB 3QZWA 3TBSB 4UNTA 2ARJA 5DEFB 4DN4H 5CGTA 5KSVB 4EQ2A 5C0ND 5GJTL 1J5OL 4MQTB 4F33B 2V9RA 1EFXD 2DQUH 4ODSH 3O0RL 1CGYA 1VPOH 1YECL 1KJVA 1MVUA 4DKFL 5LGHH 4WHYH 2DLFL 3Q0HA 5JUEH 4P23D 2HKFL 5HYQB 1KF9B 2P45B 3NIFE 2X40A 4NQCD 5CJOL 1OP5K 2VLRB 3QRGL 5GGRY 3WNLA 4QRPE 4M3JA 4ZUWB 4AK1A 3GDBA 1A1MB 2VTFA 2QV2A 3MV7B 3LKNA 4LBEB 1E4KA 1LHZA 4JQIL 4DAGH 1L9NA 1H8SA 4MDJA 4OCLC 1EIBA 3UZEA 3EIFA 1UZ6F 1E6JH 4LPVA 3FT4B 4QF1A 2Q6WB 2FGWL 5E9DA 4GBXD 1K8DB 2XQBH 1YJDL 4Y5XC 5I74B 2YZ1A 1ZHLB 2J2ZA 3QXDA 5B8CB 4HIHB 2NY4B 3TIEA 3GJFK 1A6TA 1VENA 1I8IB 4K9EL 3NCBB 1BVLB 3LV3B 2UWEB 1EMTL 3MROA 1H5BA 2GK0B 5FOJA 4NNXB 4L1HA 5C0NC 3OXRB 1K3IA 1G9MC 3AC0A 2HRPH 5B39G 4U49A 3LSOB 4B50A 1CR9L 2NW2B 3OX8B 2CXKA 1JIBA 1I7RA 4DUVA 4P23C 3U46A 4PRID 4L9DA 4CVUA 2RHEA 4U1SA 4HC1A 3F5WB 3G5YB 4EI5A 1UJ3A 3IT8D 3CFDA 3OSKA 4QWWD 4WFFE 1UQSB 1WC7B 3T0EA 5E6IC 4Y5VC 1NBZA 4NZDA 3PABA 5ACMA 3X14B 3QUXB 3DO3A 3H0TB 2FBJL 2Q7YB 2EE6A 4PJGB 4X6CE 2PYFB 4DVRH 1SBBA 4PJ7F 5IESL 2NY2C 1CLZL 3VFNB 1JZ2A 1SBSL 1IQWL 2DQDH 4GBXC 3S88L 1GL4B 2W38A 1YEHL 35C8L 1CQKA 3NA9L 5KS9F 5T1KB 3B2UD 4Y1AA 4L3AA 4K3JH 1AD9B 1LP9F 2DQGH 3VD5A 2AAVA 1XF3B 3ZSSA 2Q87A 3D69A 1DFBH 3MRNB 4GXVL 3W39B 1JHKL 1N64H 3BESR 5LGKA 4FMKA 3NFPB 1MPAH 4XNZB 3VFOA 2OXHA 1F02I 4MJIE 4G43A 5D5ME 1QRNA 2X9WA 1IGCL 4LPWA 3V7AE 3LN9A 5DA0B 2FD6L 2IC2A 3U7YH 5EULV 5BQ7B 5I8EB 2GJZA 4CMHB 4ZUUB 4OZIA 2R1XA 1JF6A 3X11A 1K6QH 1RHHB 2A6JB 1I3RB 2HLAB 2AK4E 3T0AA 1OCWH 3DVFA 5DRZA 1JF5A 2OZ4H 5EUKA 4EUPB 5F9WC 3U6RA 3P9LA 2J8UA 4LVOB 4OKVB 2X10A 3QUZB 1EBPA 3REWA 1N0XL 4L8SC 4KI5E 2V2TA 1BQLH 2NY4D 4XC3H 3T0VA 2HJFA 3MUGB 1ZGLA 3LZFH 1XIWA 2W9EH 1E6OL 3SE9H 3BP6A 4N0RA 1AXTH 2KZ1B 4UB0H 3B2UC 1BQSA 3CH8A 4ZNEA 5J6GB 2GTWA 1J8KA 1SVZA 4X6EB 1A9EB 25C8L 1MCOH 1P4BL 2D03L 1V7MH 1M71A 3EKCA 4NSKA 5IW1A 3EBAA 3X3FL 2Z91A 4X4XA 3DV6A 5J9PA 3VCLB 1IAIH 4RGOH 4DK3A 1LEKA 1JPST 2J6EL 4QYOA 3IDGA 4LFHD 2V2XA 4N8VB 4BQ6A 4P46D 3SDXA 4L29A 2PTTB 3QQ3A 5LQBH 3QI9B 5K9OA 4JFXA 2VLJE 1F2XK 5CCKL 2X6MA 5T3ZL 3MOQA 4NHUA 4TVSa 2D31B 2A74A 1QR1A 1U3ZA 3KG5A 1OP3K 1TQCB 1BM3H 5EBLA 3C5ZA 2V5SA 1JNNH 1TXKA 4R4BA 3JTSB 3L5HA 1T6WA 1R3HA 4OGXL 5DURB 2HFGH 5LAXB 4NOFA 5AZ2L 4ZO9A 2ITCA 1FNSL 2ZSVA 4OCYH 4BZYA 2IBGA 5D1ZD 2EC9T 1RJLB 5B4MD 2FH6A 4Z7QF 1V3JA 3SO5A 4BH7B 5I74C 2UV3A 1DUYA 2NY4C 3JV0A 4F7EA 4C54A 1P53A 3OKNB 3UTZB 5FYJD 1IC5H 3QEHB 2R69L 3ZKXB 5ICXB 3SBWA 4R2GB 4OIIH 3SGDH 2V9QA 5ETUB 1G1YA 4KY1L 1FYTE 3ZZ1A 2WM0A 3NACL 4R7DA 1WFOA 4MMZC 4OF6A 4XAKE 5JQ6L 3BIKB 3MLZH 5F93C 4OZFB 5L0QB 4UTAH 3RL2A 1KPUA 4R8WH 4P46C 5E7BA 3BWAA 1MJUL 2WP3O 3D39E 4GAGH 4CBPA 1YEKH 1RK1A 2X2YA 4N68A 3ULVD 1VGEL 1YEDB 1QNZH 5DSCB 3MRLB 3QUXC 5JDSB 2B4CH 4CW1B 1ZV5A 1VFUA 3DURB 5B39A 5I1LA 3UP1A 2R29H 3JV6A 3K1KC 5EWIL 3CXHK 2AQ3A 2KH2B 3QPXH 1U9KA 5D1ZC 5BZDA 4HBQA 5B4MC 1RZ7H 3BP5A 4XRCA 1CGXA 3JVGA 3KPRD 5F1IA 5FDYA 1TCRA 2E8YA 4Q0XL 1AP2B 4BFEA 3L95A 3WFHB 4AENB 5KW9H 1S7WB 4XP5L 2OI9C 5E1HB 4IMKC 1MRCH 2C7UA 4XNZC 4HKZB 2VB5A 4GKZA 1MHPL 2FZ3A 3UROR 5EU7E 2PW2B 5HYIA 3B8SA 1EZVY 4F58H 3RWJA 1J05B 3GMNB 5A2JH 3V5KA 1DE4B 1NBYA 8FABA 1KIQB 4YX2L 5GZOD 4CMHC 2IALA 1CGVA 1FAIH 2QR0A 3ULVC 4XHQA 5A3ID 1H0DB 1JGEA 3O6FA 4GMSL 5EPMB 3D5OF 4J4PD 5JNYA 3MREB 1E4WH 5AEAA 2CUHA 2XA8L 3D18B 4ZD3L 3ARDB 4QRSA 3SKMB 5TPWH 3IJSA 4ZS7L 3B5HA 1INEH 3ES6B 3DYPA 2AABL 2KUTA 1BZ7A 4Z0BH 3O9WA 3HC3H 5KS9A 4K94H 3UYRH 4H88L 3QO0B 3MLRL 5C71A 1CQYA 4WY7L 4F8QA 3ZYIA 1A14L 1AGFA 3LKQA 1T1YB 1OARH 3BKMH 3NZ8A 2OL3A 2X05A 1LK3L 2F54E 1ZLSL 3FONA 1IC7L 1LD9B 4NUJB 5IBUB 4NQDB 1DTUA 3VXOB 4U3HA 1X5GA 1ZOXA 3A6OA 1QSED 1T2JA 5FYLD 5DJ8A 2EKSA 3ZE1F 4LCWD 1KJ3H 3VFPA 4QHMA 4YZFF 1Z9SA 4LVHB 2HRLA 1FYHB 2MJWA 4RAUA 2LU7A 2ZPKL 4IDJL 1MQKH 3QI9C 3JZ7A 5DRWB 4HUXB 5E08H 3CVHB 3RWGB 2M8XA 4K55A 3KR3H 1A5FH 4LHUG 4IOSD 4BFBD 4KXZH 3BZ4B 1TQCC 3ZDYF 2BDNH 5JO5B 3AM8A 3MV01 4HXBL 2E9IA 1J7VR 3VE0A 4F7PA 3BH8A 4O58L 5A3IC 4PB0H 5FKPB 3OWEA 4MWFA 4J4PC 4JPWL 1TZIA 2D7PA 4L4VB 1A2YA 1GHFL 3QXAB 4X6BB 4NZUL 1IL1B 3O2WL 1ZHNA 2AKRB 4Z7UE 5GRVK 5CLTA 1NMAH 2DI9A 4R7NA 5D70L 1EH9A 2ENSA 3CZFA 2R4RL 3I84A 4YHPB 2MCG1 1NGYA 5J1TC 5GS3A 4K3DH 4LSRH 1QBBA 3DX7A 2Z93B 5CEYB 4UV4L 3RVXD 1CG9A 5FB8B 1A4JA 2NZIA 2VSDA 43CAA 3ARFA 4QTIH 4IIQB 1FSKC 4GRMA 4UTBH 2ATKB 3ZKXC 4R2GC 4XNQB 5D7LE 4QHUA 4OGZA 1C7SA 5I1IH 4JKWA 4WUUB 3O8XB 1CDHA 4NKMB 1AO7B 1LQSR 4LLUB 1R5VB 1XCTB 3PWPB 3U9UA 5L0QC 3MXWL 1CL7H 4FXKB 5DD3H 4YFEA 1FPTH 4JRXD 1EK3A 3QFJA 5GRZA 3HNTH 3PWUA 1R3KB 5IQ9A 2BOCA 1JGVL 4FQJH 3TJHD 1NGPH 4UZGA 3H9ZA 2MFNA 4JM4L 4URTB 1A6WL 2OR9H 5JR1H 1OM3L 1NFDB 4E5XB 2X4TB 2H2PC 2DMKA 5IGXL 3JWOC 4LLQA 4ZUTA 3A6CL 1AXSB 3FMGH 1TQBB 1HSBA 4JHAH 3RWCA 2OR8A 3S5LA 2O5XH 1S5HB 3RKPA 1MWAL 3T0EE 7FABL 1FAKT 1MCFA 2BNQD 1ZTXH 5IIEA 2YPVL 43C9A 2K7QA 1FBIL 1FFPB 1AY1H 2FX9L 5CEZL 1P4IL 4FQQA 1T0NB 2AVGA 4PGCA 2AV7B 1Q94B 4OV5B 2D7TH 4XVTH 1UM4L 2VERN 4I2XE 2GI7A 5DDHB 5EOTA 3RVTC 3RVXC 3DIFA 4JEGB 1Z3GH 3G08B 1UCBH 1WSST 4NQDD 3KYMA 4JM2D 1U8JA 5C0EB 3VH8G 4K8RD 2AGJL 3KS0H 4KJQD 3SDCB 4HV8B 2J1KA 5AAMA 2R2EA 3QQ9D 2EDRA 2FJFB 2H8PA 4YHYB 3TO2A 2YOCA 5C0AB 2DD8H 3BT2H 4NC1E 4X7FC 2EYRB 5K9QG 3CXDL 5BJTB 4QXWA 4DW2L 4ELKB 4NT6A 1A6UL 1ED3A 4KTDH 4YPJA 2OJEB 3V0AC 4M6ML 2ZUUA 4HD9A 4UQ3A 3G6DL 1NAKL 2DYPA 1F5WA 1CXFA 1KCVH 1JFQH 2FJHA 3FRUB 4JGMA 2APBA 3BYYA 5DVLA 1NDMB 5CD3A 4L4VD 2QSQA 3TJEH 2ESVA 4HFUL 4S1DD 4NNPH 3ARDC 5HHQB 3L9RA 4W6XB 1URLA 3FZUC 4OI9A 1QLFA 3RKDC 4B41A 4X9GA 4Z7WE 4PJFB 4ZPVA 5FUCC 4WI2A 2XWBB 3UPCA 1GIGL 4CGTA 2LTQB 3UO1H 4ZOCA 2YXMA 2ZCHH 4MCZA 5HHOB 3LRSB 2J8UE 1N5YL 4TTGA 1OAYH 1T7YA 1TTGA 4ZNCD 4H8WC 5CIPA 4HBCL 4I1NB 2XA3A 5CKAA 4FXGB 4K8RC 4TUKL 5DUMH 3NOIA 1BF2A 3GNMH 3DVNB 4KJQC 1JMZA 4YUEH 3QQ9C 4LVHC 1KJ2B 3FQTA 3LEXB 3KYAA 4JDTL 5E95B 4X7SH 3MXVH 1J0JA 4LLWB 4WFFD 4RBPH 2UYLA 3A6BH 4PGZA 2IPTL 4YIQA 3M1BA 2VH5L 1F00I 4NUGH 3UJTL 3QDJB 1N7ML 3B9KA 3EJZD 5DK0B 3VI4E 1KTKE 3LKRB 1T20A 3L3IA 5BO1L 4NFCA 2PR4H 2IANB 4G3YL 5F7HA 1UB6B 1U6AH 1AGCA 1G9NL 3MRMA 3O2DL 2IGFL 4G80B 2X4OB 2VLKD 4S1DC 4U33A 3BH9A 1MNUH 2CUIA 3P4MB 1CE1H 4QRRE 4NQVB 4U6YB 5I71B 2C1OB 5EFIB 1WJ3A 3GMQB 5KVFL 2RQ8A 1Q9OA 3N50A 3W5NA 5FKAA 2VN4A 3BGMB 5J1AA 3VXSA 4LHUA 2P24B 1YZZA 3VGAC 3GJFB 3HLAA 4P5TD 3HMXL 3ALWA 4KC3B 1MLCB 1CDBA 1T7ZA 5FYKD 1MCEA 3G6JF 1IAOA 3SOBL 1NL0L 5GRUL 4DCQB 2CDFB 2K9UA 4RGNB 5I1HL 4XPAL 3OHXA 4MJID 1TJIL 2EIEA 1GOHA 4ZO8A 2VQUA 2X44D 3NTCH 3ARGD 3OQ3B 1YNTA 4KVNL 2PYEA 4XPGH 4Y88A 3S36L 3TBYA 3H7LA 1AC0A 1AR2A 1WEJH 2QHRH 2BERA 1JRHH 1KT2A 4AQOA 2LV4A 4ZOEA 4Y89A 4EUPH 5HBBA 1AD0A 4XBPA 5HYFA 4E41A 2HFEB 1CGSH 2X89A 4LARL 2AK4D 4WENB 5DZLA 1E4JA 4KZEL 1KG0A 5DRNA 1TQBC 3HNSH 2JB6A 5GHWL 5IEKB 5L7XH 3MV7E 4UBDC 4GG6F 2GFBB 2R9HD 3HPLA 1EEZA 4NO0B 2X4QB 1I3UA 5BZWB 3W0WA 2FB4H 2EDNA 1IBGL 1XR8B 4XVSL 2Q76A 2R2HA 2B5IB 2WUBL 3TNNA 2XOTA 4Z5RB 2R0LH 4PJHB 5IHUH 4AM0A 1YYLL 1KYOJ 5CZVL 4ZTPH 4ELMB 1FE8L 3RDTB 3IF1B 3IDNB 4OIAA 1A7PL 3MLYL 4F80A 4RMQA 4GH7B 4CNIA 3ZDZE 6FABH 3C09B 2VDPL 1HIML 1IKFH 4KJYB 2X4PA 4XP1L 4M1DL 5E8PB 3SDCC 4CVXA 1INDH 4YHYC 3K4ZA 1MF2H 1NCBL 4MLIA 1K5NB 4YXKL 5C6PB 3R8BB 2UWEE 1ZVSA 3U2SA 2G60H 1NLDL 1UVQA 3RY6A 3ARGC 5AYUL 1GGIL 5AUMB 1F3DH 5BVJA 3FO2A 3SJVA 5L8KB 3R0NA 4U1LB 5GGUB 4RFOH 1I1YA 1S78C 3C08H 3FQWA 5TQ2L 2X09A 4M9OA 1EHLH 1KBGH 1WV7T 1MFCL 2IAND 3O6MH 4PBWD 4YNYB 1T1WA 4PRHB 3QHTC 4XCEA 2ADIA 2O61B 5E8NB 2MHAB 5I8OL 3G5ZA 1MFDH 3C2SA 1U93A 3FCTB 1NGQH 3OKMB 5F9JB 1EGJH 3CMOH 3TV3H 2VDQL 3LN4A 1JZ6A 4P99A 4FN0A 4ZXBB 3F62A 3GSRA 4HKBB 5I1DA 4PLJD 4ZSOA 1LK2B 2KKQA 3RL1A 3KNBA 4J3VA 3GBML 3VFMB 5FGBC 3F7VB 4PJGE 3S98A 3AB0C 4ONHB 4N1CA 5E2UL 3GSVB 3FO0L 3HUJE 5FOBB 2NYYC 5C6TH 4YDJB 4KGLA 4QHNA 3WL9A 1AHWC 5AWNL 3HAEB 3RTQA 5IMOA 1EVUA 4G5ZL 1JPFA 4OZFH 2OTWA 2XKNB 4A6YB 5JXEA 2GY5A 3N85L 3IDUA 3ET9F 3Q48A 3MV8A 4F7TA 2AJZA 2BVQA 1BVZA 4JJ5A 5HYSA 4XP9H 3CAFA 4JKPH 1CS6A 4RX4D 4ZO6A 5B38A 1S9WA 1AGDA 4G8GB 5LBSH 5F3BA 3D39D 1MJJA 3ZTJH 4KAQL 4RISH 3GMRB 5TGBA 1OQOA 5C09E 5E8OA 5ESAA 4JQVC 1MVUB 4DUWA 4I13B 2ZJSL 4YDKL 1IEBB 1JPGA 3BQUA 2OXGA 5I1GL 1FLRL 3RAJL 4PRPA 4X4YB 4KMQA 2N56A 3O11B 1BIHA 2NX5D 3L5XH 4HDIA 1KGCE 1I1FB 3Q6FB 4FABH 2VAAA 2QEJA 2IWGA 5KZCB 2HP4A 1HHIA 3LKNB 2MQCA 4APQD 3UTSB 4WI3A 2UZIH 3CIQA 3QQNA 4ZYKA 1VCAA 2NXZD 2R2BB 1OWRM 2HG5B 1FVDA 4YHNA 1ERNA 2NY0D 5SWQA 4KPHL 1X6LA 4QRUA 4IRSB 5GRJL 1NFIB 3UTQA 3NCJL 5E00A 4GAJH 5CUSH 2DQFB 4NM4H 4LSTL 5IFHL 2O93L 4NKOA 3QXDB 1I9IH 2AJSH 1MEXL 3TIEB 4Y4KA 2H32B 4NQEA 1T03H 4X9HA 3I9GH 4PTUB 1VGKA 1AGBA 2XZCL 3MROB 3VD7A 2XTJD 5F89B 3R8QA 3DROA 1NQBA 3W2DL 2Y5EA 3NCCB 4XC1L 1MIMH 2O5ZL 3T77A 4TTDD 2FSEA 1I7RB 3U46B 4HIJB 3HHRB 4P57B 1C16A 2CMRL 4OD1L 3D6GA 3CFDB 4Q58C 5DK3A 4FA8A 4Y2DA 3GM0A 4ZXBD 1TETH 4WW1A 5ERWA 3NCYS 5L2KB 4APQC 1U8OA 1TZHB 3G04B 3BD5A 1CFNA 2DS4A 2B5IC 4JHBA 4PG2C 5I1JL 3D0VA 1KEGH 1NCNA 2PO6A 3C6SA 2EKJA 3B43A 3A0OA 2ZOKA 2F54D 4LNVA 2XNAA 4P2QB 3V7MA 1CDGA 2C3VB 4X6DB 3TP4A 1QA9A 2YD7A 3G6JA 5C3LD 3ARQA 4U1KA 2P49B 1RZGA 3CVHH 5I18L 4Y1AB 3OPZL 4KKLD 2P5EA 4LKXA 1MIEL 4DGIH 1SY6H 4R9HA 5EU6B 1LO3L 1BVKA 5GJSL 3D69B 4FFVD 2K7PA 2XTJC 2I5YH 3O2VH 3OKOB 5FHBL 5FFLA 5DRXA 4JZOA 4XCFH 3F7QA 5D2LF 1I3GH 4Z7OF 1W0VA 3OR6B 2B2XL 4KMTH 3BKCH 1WAAF 4O9HH 3GIZH 3C5JA 1BBDL 2H3NB 1DLHB 3BKJL 3TNMA 1XMWA 2VE6A 4GUPB 5EZLA 3EDKA 4QKXB 2XQYG 4P9MH 1XFPA 4ZXBC 2GJZB 2QJDA 3S7GA 5IHBA 4OZIB 1PKQA 1OTUD 4GKNA 4G6JH 3VGFA 1BD2A 2WINB 1F3DJ 1CF8L 1DLFL 4OJFL 3X12A 1JWSA 4DN3L 1UWGL 5KSUB 1WZ1H 2DQCL 2FATH 3QULA 5E9DD 5IM7A 3U6RB 4LLVA 3DXAB 2E3VA 4MX7A 3IVKB 1CICA 2WV3A 4JFDB 4XPHH 1RIHL 4WNQB 4OUUA 2V2TB 4GAFB 1I9EA 5GZND 1J18A 5JLZA 1XIWB 2W1NA 4V2BA 2GTZA 3DUHA 1KTLA 2JLLA 3HRZA 4XT1C 3QO1B 3WUZA 5K33A 3TCXA 2JELL 1PLGH 2GTWB 4ZFGH 5C8JA 4H25B 4ZQKA 4PLKC 5C9JA 1SHMA 4FFVC 4RRPG 5IW1B 4XMLL 1MLBB 2Z91B 4F57H 4TPRL 5J9PB 3P4LA 5K9KA 3BSZL 3TT1H 5HI3D 1CT8A 3MJ7B 4EI5D 3ZLQC 1XGUA 3SDXB 1KULA 5K9OB 2Y06H 3T0ED 5I1EL 4LU5H 5F7MC 2A74B 2BVUA 2DL2A 1E4KC 2DQJL 4M02A 4LAQL 3ARTA 1N0LA 1RIVL 3CH1B 3EOAA 2VXSH 4OZGF 4KHTL 1UH3A 4KH2A 1BBJB 4WW2B 1MCPH 2YRZA 1F97A 1OTUC 4P59L 1XF2A 4X83A 2HFFA 1FG9C 5FYKH 5I8CA 4Z7VE 4HH9B 3PNWA 2AP2A 5C0CE 3V4UH 1RUKH 4U2ZA 5DJZA 3OGCA 4X8XA 5GZNC 4Y1AD 3L7EA 3BJLA 1A21A 4MJ6B 3VXSE 1KB5L 2XZQL 4KU1A 2QSTA 1T22B 3CFBA 3R0MA 1FJ1B 4P2RA 3RWFB 1D6EA 3TGXA 3V0VB 2IBZX 3VXNB 1ZWIA 4J3TA 3PV6B 4KUZH 4DN4L 3QWOA 4Q6IB 5E03A 3ARSA 4AT6B 1XEDA 1JNHA 3WSQH 3WXWH 5M94B 1QRND 1IILE 2DQUL 4ODSL 3ARWA 1VPOL 5EC2A 4L8DA 2PYEE 4BSWB 4EI5C 4HIIB 1JZ4A 5LGHL 3BWAB 3OJMB 2CDEA 1NAMA 2VZTA 4JR9H 1RK1B 5KTEH 1IGMH 1NPUA 3MX0A 5M7QA 3MRRB 3O6KH 2I26N 4PD4K 2EYTA 4KKBD 4PYHA 1J0IA 3UTTB 3QCVH 2Z8WC 2VZUA 3AREA 2OR7A 4QHLB 4K7PY 5CD5D 4X0KA 1P4LA 1YQ2A 3RGVB 4CN1A 3IU3B 2VZVA 2ICEA 3T1FB 4XBEH 3V4PH 1KJ2H 4RWYH 1XIWD 1E6JL 3OKDA 3S37H 4OD2B 4MSWA 3FQXA 5DJ0B 4YHIA 3U0PA 3BP5B 5T33H 5FO7A 1DBAH 1OP5H 2QSCH 2XQBL 1LE5B 2CR6A 2R2CA 4JG1H 5IFJA 4F7MB 3K8KA 2C7UB 1AO7E 2CK2A 4XPFL 1XF4A 2WMPA 1FNEB 4Z0XB 3RWJB 3WFDH 2PCPB 2HRPL 1NCAH 5FDWB 5EOQL 3VXUB 1SMAA 3V6OA 4PR5B 1QSFB 2IALB 3C5ZD 3RWDA 3GJFH 1RU9H 5D72H 4KKBC 1JGEB 3H3BC 3CSGA 5F21B 5CD5C 4GS7C 4AH2A 3CCHA 4PJ7B 4MJ5B 2Y23A 3IJSB 4D9RE 3RWIA 2R56H 4HX1A 4S10A 1RZJC 4DVRL 4LP5A 3ZE2E 1XIWC 3GI9H 1WFUA 3TEUA 5KS9B 4WO4A 4EDXA 3VDCA 5GIRA 2DJ4A 5JHDA 4WHCA 2DLHA 2BVPB 2VSCA 1CE6B 2DQDL 3E8UH 1LP9B 2OL3B 4K23H 3V8CA 3FONB 4UIMA 4QCIB 2H2SD 1RIUH 3V6FA 1S7VA 1MHCA 1ZK9A 3MV8E 2PKDA 4WFEE 5D1QB 2R0WH 5CLWA 1VEMA 1FO0B 2AJVH 1G6VK 5I2IA 5JZ7C 1FP5A 1N64L 2VLLB 4GXUM 3GFUA 4X5XA 1MPAL 2Y5TB 1H8OA 4J6RH 4RSVA 4IOIA 5LG1A 1DUZB 2HVJA 4FZ8H 4WW2C 3MGOA 5DJDA 1KEMH 1F11A 1T83A 3BH8B 2VXUH 5DD5H 1JI1A 3DHJA 1OQXA 3QIWB 4MXWH 2A6IA 3H9HB 1JTOA 2F53B 4RRPA 2FIKB 5HHMB 2ATPB 1CI5A 4FFZH 4R7NB 1K6QL 3CZFB 3BAEH 4OGAC 3VFSA 1PKOA 4RNRA 3D48R 3R06A 1I9JL 1OCWL 4J3UA 1G7IA 2OZ4L 1A6AA 2CLRA 3DX7B 3MBXH 1S7TA 1A4JB 43CAB 5HHOE 2F19H 1BQLL 4XC3L 3OL2A 5DD6A 3DUSB 3LZFL 1YMME 3SBWC 3SE9L 4QHUB 2I9LA 4LEXL 5DFVD 1PGRB 1AXTL 4LLMB 4UB0L 3WKNA 5DUPL 1ODAA 2LABA 2MQ0A 4Q6IC 5ADPH 4D0CB 2AV1A 4DVBA 1HEZB 3KXFA 1MCJA 2X9XA 2P8MB 1IFHH 1MCOL 2DB8A 3QFJB 3F58H 1V7ML 4NIKB 5E5MB 1G7QA 4FQLH 4NBXB 2D7MA 1XR9B 1HH6A 4RGOL 3V8OA 5GS0C 5JW5B 3QDJE 3SQBA 5CZKA 3O3BB 4MZ3A 5IB1B 3O6FD 5LQBL 1YMHB 3DMMB 3HA0A 1KIUA 3HAEH 1N6UA 1PYWA 4F2MB 2IQ9H 4WEBH 4Y16B 5DLMH 5KVGH 4A6YH 2YD3A 5IB2B 5BOZG 3KPMB 3O4LA 2IAMB 3P0GB 1BM3L 2GKIA 1WCBA 3EAKA 3MFFA 4DTGH 1I4FB 3DRQB 3HI5H 1JNNL 1BREA 2A0LD 3BPOB 3O9WD 4K2UH 2X4UB 5AD0A 4NWTL 4MQ7B 2HFGL 3QDMB 3LHPH 5MHSD 4PY7B 3VRJB 3WHXA 3JVGC 4OF3A 1BFTA 2IMMA 5AAWA 1T66C 4X99B 1EX0A 3IRPX 1OP3H 1UADC 15C8H 2ED8A 5A2LH 2F5AH 2BY1A 4OI7A 3GRWH 4RGNE 5DFVC 4FFYL 3VFGH 3IU4H 2P5EE 4F9PA 4OIIL 3TO2B 4FQHB 5D7IA 4JO4L 3D3VB 3EO9H 5DK2A 4MAUL 1KGCD 5DXWA 1BOGA 5CJ5A 2A77H 3LS4L 1TLKA 4NT6B 5KSAA 3MLZL 3UC0H 3ZKMD 3HMWH 4O2FB 3T2QA 4NGHH 1MAKA 5CSGA 3ULUH 4R8WL 1R24A 4RFNC 4PP2B 2BNRB 3MZGB 2DI8A 3K2UH 5IR1B 2FJHB 3BEWA 3UAJD 3FQRB 3O6FC 3WBDA 2OK0H 4DWHA 1YEKL 3DRTA 2NTFA 1NGWA 2ADGB 2WWMC 2ESVB 3AVEA 1QNZL 3PL6B 3QJFB 2H32H 5CSZA 2J3SA 3L9RB 4HLJA 2B4CL 3QQ4A 1NC2A 2A0LC 4M62H 5SWSE 3BI9X 3RFZC 5HHXH 4ZOAA 5BXFB 3QHFH 5F7EH 1FZOA 3IDJB 3O9WC 1KJMA 2R0ZH 2R29L 2Y6SC 1IAIM 4PGDB 3E2HB 1OGTA 5DYOA 5LWYH 3QPXL 3ARFD 4ELME 5CMAA 1VDGA 2XN9B 1NGZB 1RZ7L 1Z6JT 4PV9A 4BA8A 3V6BR 5CIPB 3DGGB 4HT1L 2LVEA 1K8IA 4JAMA 3O3AB 5IB4A 5IVOA 4HS3A 4LEOA 1AKJA 1GGUA 1MH5B 5KW9L 3QFJD 4OFYA 4JFFA 4F9LC 3FQTB 3WFBH 4ESKA 2Y36H 1MRCL 4UT9H 4D94A 3HG1B 4NN7B 2QL1A 4YIQB 1WF5A 3B9KB 3ZKMC 4U7SA 1QPPA 4F58L 2IBBA 1P1ZB 2YD9A 3P4NA 4FOMA 3JBG7 3L3IB 4PRHE 1PDKA 3MJ6A 2GSGB 5JPMB 1X4ZA 5HGBB 3EDEA 1D9KA 1AGCB 2NZ9D 3MRMB 2JIXB 3HZVB 3OKLA 1FAIL 2AJYL 4P4RB 4MHHI 3BH9B 1NCTA 1B0WA 3WO3B 3U7AA 4LHQB 4OF7A 2IPKB 2Z4QB 2VDMH 3BDYH 1E4WL 1CGTA 1DR9A 2HLFD 3OBAA 5EOCJ 1Q9OB 3VXRB 1MAJA 2W65B 3K74B 4GW5B 5EDXA 5C92A 5FKAB 5TPWL 2AEIT 4LHUB 3ZYJA 4PJCF 4OCWH 3IDMA 4MA1B 5BRZA 2HMID 1ZHBA 3HLAB 3UPAA 4DKAA 3ARFC 3TCLB 1GRWA 5FUZH 4PB9H 3MRPA 4M5ZH 4Z0BL 3S3PA 3HC3L 4K94L 2YEZB 1IAOB 3UYRL 3DI2B 5C0BA 4I0PA 4UAOB 1OARL 2Q20A 1U8KB 3ZT5A 4JDVA 5J8OA 2HTLD 2HH0H 2QSVA 4JFPA 1YN6A 4GKSB 3S37X 3LMJH 4G8GE 4XB8A 1EHXA 3CNKA 2DI7A 1I1AA 1KJ3L 1FNHA 2IADB 4H0IA 1KT2B 2DYPD 2E9BA 1J12A 2YKLH 2GJ6A 3DMMC 1MQKL 5GISH 2ZSWA 4E41B 5E08L 5DHYB 1IAMA 1OGAB 3R1GH 4L9LB 3KR3L 2ESVD 1RZJH 4WFHE 1A5FL 5EG6C 1ORSA 4PBVC 1R3IH 5DRNB 2BDNL 2LQRA 2NZ9C 1GGTA 2B7DT 3KPNA 3REVA 1ZXQA 5F72S 3UTSE 3HPLB 1U8IA 3W0WB 1YY8A 3QJHB 5I17A 2HLFC 4GQ9H 3TNNB 1Q9KA 3OKEB 4LKCA 1BJMA 5IOPB 3C9NB 1YNKH 4X6FB 1A6VH 3ULUE 4ERSH 4QGTA 4UV7H 1RVFL 3W11C 3L3OB 2HMIC 1KTDA 1T1ZA 4K3DL 4LSRL 4M3KB 4O4YH 4XNYL 5F3HA 1FV1A 3KPOA 1FNGB 5MERB 3FQNA 1ZA3B 3THMH 4WIQA 4UTBL 5FGSA 3BUYA 4KRNA 1BZQK 4G8FB 1UM6L 3WFZA 2HTLC 2YD1A 1JUFB 5ITBH 3U2SB 1CXLA 1KCRL 5BVJB 3VFRA 1T0MB 3FO2B 3CSBA 4QTHB 4WHDA 4PV8A 3B9KD 3ARBB 1CL7L 1ZA6A 1QZ1A 5DD3L 3QEGH 1I1YB 1XH3B 3FQWB 5KN5A 4YDLC 1Q9WA 4I48A 2P7TA 1II4E 4KJWD 2RJMA 4YHOH 4QXUH 1T1WB 4FQJL 1NGPL 2Z31A 1U93B 2IPUK 3IS1X 4XCNA 2AJ3A 1LEIA 2OR9L 1UG9A 3VH8B 2GEEA 3M45A 1PJ9A 2YSSA 1A6PA 5L2KE 5JOEA 1HQ4A 3TBWB 4ZSOB 3TZVA 1FORH 3U4EB 4G7VH 3FMGL 3VXSD 4LHUD 1MRFH 3E2HC 2O5XL 3NIGF 3EHBD 3LQAH 3FFCE 4D0DA 1F6AA 2ADJA 4P2QE 4YEEA 3WL9B 1AY1L 4UQ2A 4X6DE 5IMOB 2J6EA 1JPFB 1U3HA 4HWBH 1U8QA 3QUMB 2D7TL 4XVTL 3HZMA 1CFSA 1DSFH 1RURH 3BIAX 2AJZB 3RZCB 3N9GL 1Z3GL 1UCBL 3KLAA 5D7JA 1R3LB 5GS0H 5JHDE 5DC4B 2PYED 4GW1A 4OCSH 4Y4HA 4NRZA 1MJJB 4PJEA 5TGBB 2DBJA 3F8UB 4N90E 3QSKB 2W9DH 3B9KC 1KLGA 2VWEE 1FVEB 4E41D 2DD8L 3BT2L 2NXYB 2DWDB 2X89D 1DQQA 4KJWC 3HPJB 4OFKA 4RMVA 4U1MA 1ZSDB 3DECA 5FIEA 1BFOB 4KTDL 1QFUH 1OSPH 5DZOA 1CZ8H 3TLRA 2Y7QA 5GSRA 1I7TB 4HHAB 4JO2L 3VRLE 5IFAH 2BY3A 1KCVL 3MCLL 1JFQL 1WIUA 3W0WD 1LO0H 4HJGA 4YBLB 2AXFB 1HWGB 2EIZB 3TJEL 4U0RC 3EYUH 5EIIB 1SYSA 4B5EA 5SX4I 1TVBA 5HPMB 4ZFOB 4MA1C 4BK5A 3O45B 1M7IA 3IAQA 4L4TA 1ACZA 4J8RB 3MBEA 4PP1D 4R97C 3SDDB 1CDYA 5MP6H 5KAQF 4NKOB 3BFOA 3UO1L 3IGAB 3PWVB 4L3CA 4UAOC 4JKMA 4Y4KB 3UPRA 2HTKD 4LSSH 4PJDF 1OAYL 5HDBF 1JTTA 1VGKB 3KJ6H 3SJVD 2EEAA 2XPGB 3BX7C 5DUML 5E0QA 3GNML 1L6ZA 1S7RB 3PGDA 4PS4H 3GGWB 2BZDA 4XWOD 1LE9A 5L88H 1INQB 2FSEB 4V1DB 4X7SL 3MXVL 5EBGA 3A6BL 4L9LC 1ADQH 1ZHKA 5KAQG 2AQ2A 1C16B 1HI6A 1QP1A 4NUGL 3HZKB 4QLRA 2JB5H 4JFZH 1UH4A 1JGDB 3PGFH 4OF8A 4WGVB 4XPTH 3MO1B 1U8OB 1U6AL 2HT3C 2OL3H 1ZT1B 3CK0H 5CAYB 3K3QA 2VDNH 3C6SB 1CK0H 1CU4H 1ETZB 5A40E 4I5BA 3KPPA 5HYEA 2ZOKB 1CE1L 1H3VA 3RTQD 3QR2A 1FO0H 4LQFH 5JXED 5L2JA 1QA9B 3T4AA 3G6JB 3MV8D 1YC8A 3KPSB 4U1KB 5IT2H 3V2AR 1F6LL 3FL7A 1LNUA 1KTRL 1NH6A 2HTKC 3EZ8A 3MYJA 2I60H 2DICA 3RY6C 1DBJL 4HIEB 3T3PE 5INDB 4OKDA 3HC4H 2FJGA 3BQUD 1EEYB 3BGAA 3PJSB 3OAYK 4PRPD 3NTCL 3V5DB 1AR1D 4XPGL 1MQ8A 5DQJA 4XWOC 1P2CB 5D6CB 5CJXA 4LFHG 4S1RH 1WEJL 2QHRL 1TVDA 1U2CA 5EZLB 4PJ9A 2A6KB 4C56A 4GG6B 1D5ZA 5K9JH 1CGSL 1TITA 2NY1B 3QIUD 1PKQB 3UTTE 3GSUB 3EYVA 5IBLC 1FGNH 2BSTA 1E28A 5I73C 5L7XL 5DC0A 1D5BB 5IVZB 5BV7C 2FB4L 4LLVB 4MGXA 3RTQC 4OV6F 4B7LA 4TSAH 2VR4A 5TH2B 2EO1A 2A2QT 4Y4KD 5EU5B 5IHUL 4NQED 4ZTPL 1KTLB 3RZCC 5ICZB 2VDLH 4HUWA 2UZXB 1GVIA 4GG8B 3JWDC 2HT2D 3ULVF 4ZFFA 5C8JB 4Z6AT 4Z78A 5I16B 4QNPF 1IKFL 1VACA 1YY9D 5E1AB 1ITCA 2P5WA 3MMEB 3SKUD 5H35B 1INDL 3MCKB 5I15H 3WHE0 1MF2L 3H9SB 4ONOA 1F8TL 3SGEI 3H42L 2V9TA 1ACYH 1A47A 2YPLB 2DIBA 3BQUC 4OM0H 4R96B 4XBGB 3TIDA 3QWQB 3Q3GA 2G60L 1ZT7B 4X9BA 1AR1C 1VEOA 2H45A 4YHLH 1XGYH 1G6RL 3V4VH 1GCFA 3QH3A 3QIBB 4Y2DD 4CN4A 4RFOL 3MA9H 4WEMB 5I66A 5L8JB 2G5BB 4LCCA 5HTSA 1CXHA 5BS0A 1EHLL 4O2CB 4MNGE 3O6ML 1G7JA 5GRWA 2R23A 1DN2A 1QSFE 5D6DC 5ABDE 4ZFZA 1MFDL 4YBLC 1NGQL 3VWKA 5IMKA 2W60A 4XXDA 1EGJL 2PO6D 3PHOA 3TV3L 3TO4A 2HFFB 1L0QA 3RX5A 5JMRA 5INCA 4PJ7E 4NQXB 2WAHA 1I8LA 2UY6A 5CWSA 4XZUA 3QNYB 1FFRA 5DJZB 2PUQT 4I18A 1JI2A 5C6TL 5IWLA 4X7TB 4U1IA 4DFIA 1CD0A 1T1XA 3SHSA 4Y4KC 4V2CB 2P5ED 4EVNA 3MR9A 5DMYA 1M6OA 1I8KB 1DJSA 1TPXC 1LP9E 1J8HA 1IEAA 1Q1JH 5HDOA 2B1AH 1M05A 1KENL 4Q7DA 1ZWIB 1YY9C 1EZVX 4JKPL 5C0BE 5TDNA 7CGTA 3QWOB 4YDVA 1BIIB 1TZGL 2FHCA 1MCKA 3U82B 5LBSL 1MWAA 4OD3H 4RISL 3UDWA 1PEZA 4G9FA 1IQDB 5EC2B 4NWUH 1SJXA 1O0VA 3EYFA 3U4BL 4UDTA 4BSVA 4TQEL 4LIQH 4Y2DC 3IETA 3F7RA 5I30H 2JJVA 2NY1D 3H3PH 3CFCH 4Z7NE 1RZ8A 2OX5A 3BGFB 4PJIA 1BD2D 2KBGA 2NR6D 2XICA 4Q9QH 2GJ6E 2KQNA 3VW3H 1P84K 3L5XL 3HZYB 3AREB 4Q9BA 4YLQT 1KPRB 4FABL 4OGYH 2EYSA 1PQZB 5CIPH 4N9GA 2VJXA 1U91B 4JY4A 1CICD 1U8MA 2UZIL 3DTXA 2DIAA 3WJLA 4Q9CA 3T2PA 5E70A 4OZHA 2WIMA 2VZ3A 3WUWA 3MV9A 4PJDA 3P9MB 5GGVH 1D5XB 4NM4L 4TUOA 2F8XC 4JREC 4TNWF 4YAQA 4CVWA 5DZNA 3S35L 5M95B 1I8MA 2JJSA 2YZ8A 4JFEA 2AJSL 4NQUA 4H20H 3LKOA 1U58A 2HWZH 3TF7C 1B4RA 1T03L 4JY5H 4MD5B 3OJDB 5JW3H 3I9GL 3LDBB 1T89A 3FB8B 5DMKB 1VB9A 1XF4B 5L8LB 4BH8A 3GSWA 3AS3A 3NIDF 1Y6KR 1KV3A 2F8OA 2D9CA 2V2WB 3WLWC 1MIML 5EU4A 4ZPTA 3RP1A 2E7LC 5C0JB 5MEQB 2NY1C 3RWDB 1CFQB 3RPIA 3ZE0F 1A7BA 1K4DA 4M1CD 3BEVB 4MCYA 1BGXH 2CD0A 1DDHA 3MOAH 5JW4M 1TETL 5EO9B 1J10A 4NBYB 3TPUA 1W0WB 3CCHB 5TDOB 2BSRB 1KCLA 1YPZF 2P8PA 1CICC 4WI8A 4QXGH 3QNXA 1KEGL 3CUPB 3GHEH 4RIRB 3QDME 1PEWA 2NLJA 2DM3A 2J7LA 1YEJH 5GIRB 5KSBA 4UU9A 1U95A 2BY2A 4P2RD 1CFBA 1NCWH 1OAUH 1HHHA 1IKNA 5BVPH 4KMLB 3CVHL 4NKDB 3WN5A 1KPVB 1MHCB 4BSJA 5FM5O 3RJDA 2IG2H 5D2LB 3O2DA 1QO3B 5T3ZE 4AYFA 4XCYB 1KNOB 1SY6L 3STLA 2EDXA 1C5BH 1KN2H 2OJZH 2I5YL 3O2VL 3OJ2C 4TSBH 4LSVL 4WFHD 1HOCA 3RWEB 5F7KC 3HS0A 3IS0X 4GRWE 1I3GL 2VXVH 3RVVC 3C6LA 3MGTB 4KMTL 5J3HD 1T21B 2E9JA 3GIZL 1RJYB 1ZT4A 1A1NA 3PGCB 3ARED 3HMXA 2BNRE 3QDGA 1WT5A 1FIGH 3BW9B 4PJAE 4JM2F 5L9DL 3PXHA 5ICYB 4WFGE 3TA3A 4HUNB 1X7QA 1DBKH 1F4WH 4G6JL 1NLBH 4L3EE 4XGZB 3NIFF 2E7MA 3IFLH 3MLXH 1GZQB 3QXWA 1WBZA 1WZ1L 1FC2D 2E7BA 4DUXA 1G7IB 3LPFA 1A6AB 1T5XA 1H3XA 2CLRB 4KJPD 3ROLA 4IJ3B 4XPHL 5E2TH 5FA4B 2XN9E 4WI6A 5GS1A 4QT5A 4NC2B 5CP7A 3VGHA 5HYJA 3KDMA 5H94A 4PTTA 1OF2B 5EN2B 3UYPA 1PLGL 4ZFGL 1A02N 2AV1B 2XXMB 3KXFB 5HHVH 1MUJB 2OCFD 3NPZB 3RU8H 4F57L 2YHGA 1UM5H 2HVKB 1HH6B 1RZKC 3B83A 5J3HC 3F7PC 3QB7C 4FP8H 4OZGB 3AREC 2Y06L 1PYWB 4NHCH 2DQHH 2AXGA 2WBJA 3QUMH 4HIXL 4XI5D 1TDQA 1J1PH 4I0KA 3O4LB 5IQ7H 4NP4H 5F44A 4PREA 2VXSL 4UIKH 3PQYB 4G7YL 1H9VA 1MCPL 1MI5A 1UC6A 4HPYL 3JWDH 3G9VA 4GLRI 5CKGA 4WO4D 4M6OH 1LMKA 1ZAGA 2H1PH 32C2B 5JHDD 1F58H 4WJ5A 2G9HA 3NCMA 4KJPC 1RD6A 1RUKL 2DQIH 3STBA 1CVRA 3IFOA 2XWTB 1KUMA 4QOKA 4F37F 1OAZH 4QXTA 4OT1H 1FL6A 5I8KL 3QDHA 4Y8AA 5D1XB 1XZ0B 1AI1H 1MHEB 3LDBC 2HN7A 4AIZA 3ZE1E 5JDJA 3WV0A 3HE6B 4Q9RH 4U1JA 5EUOE 4NNYA 4MXQD 4YZFE 3W9DA 1Q0YH 3DSFH 4TVPE 3U83A 4FTVA 4HUVA 5ITFB 4KUZL 3GI8H 4MNHB 3HR5A 3CC5B 3C60B 3V6OC 3WXWL 5JIIA 1S8DA 4HH8A 1QR4A 3DX8A 1S7XB 5T3XH 5DJ2A 3WXVH 2BP3A 1QVOA 4BJLA 4ZDHA 5KTEL 5I76A 1IGML 3G6AA 4XI5C 3O6KL 1H3GA 2D7NA 2GJJA 5J1SC 4C56E 5CSZB 2FLRT 3E3QE 3GMLA 3QCVL 2C1PB 5HXMA 4FFWD 1RQ5A 3BP7A 4OLYH 4HULB 3DV4A 4U1HB 5BOPA 4EXKA 4X80H 4YR6B 4WO4C 2CRMA 4N0UB 1QBLH 3MJ8B 1IE5A 1OGTB 5DI8B 2R4SH 5ENWB 1N59A 1KXVC 1KJ2L 1S9VA 4KK9C 4RWYL 1N6QH 4PRNB 5TE6H 2RBLA 5DHVB 4UINH 4M7KH 3S37L 1XGQB 4K3EH 3X13B 3UTPE 5T33L 5MENB 1DBAL 4PUBH 2QSCL 5SWZB 1WZMA 3JV4A 5IB4B 3KXFD 3T08A 3B6SB 2BCKA 4OFVA 4LEOB 1AKJB 4JG1L 4Z9KB 3L3KB 4HCRH 3FB7B 4GW4A 1G7MA 3P30L 4KI5F 4MXQC 1UB5A 3SE4A 3V7AG 4HZLA 2A9ML 1C5CH 2O5YH 4ONFH 4KRPB 4PJBB 4C83A 3IXTB 4ZAKA 1H3WM 3WFDL 1HHJA 1QPXA 3GEWB 1T83C 2XFXA 2SEBA 3KWWB 4AMKH 3O4LD 5LCVH 4G9DB 2LVCA 4WHYG 4YHZH 4P5KA 5BS0E 1JF1A 4JDZA 2NY3D 1RU9L 5D72L 1NKRA 3VXQA 1UH2A 4MXVE 1RULH 4MJ2A 1MOEA 5ISZA 2HJKB 1ES0B 3KYNA 4FFWC 3VGGA 2EH8H 3RUGF 3L3JA 5A1AA 3WS3A 4IJ3C 5ACLA 3LIZH 1U8LA 2R56L 3K0WA 2CIIA 5BRZB 3GI9L 3H3KA 1U8HA 3C87A 3VXMA 2E27H 3CLFH 2HAZA 3E8UL 4K23L 4NDMB 2WQ8A 3C8HA 3BRDA 4JKKA 4JFPB 1YN6B 1RIUL 4JPKH 1J8HE 1FZJA 4K7PH 1UXSB 3HC0A 5KSAD 4LCUB 4NRYA 3MRQA 3NFNB 2AJVL 3O3DA 3SKOB 3EYOA 3TVMB 2C5DC 1P7HL 2YRPA 1R6VA 4J6RL 4EOWL 3FOLA 2FL5A 3REVB 1NC2D 4FZ8L 2EC9U 2NY3C 3Q5OA 1KEML 4PJIE 1U8IB 4MXWL 1YY8B 5A2FA 2BNUA 1TVHB 2ZNXA 5DJXB 4QRPA 5AG8A 4G8EA 5EZOH 1Q9KB 4JHWH 2GQHA 4FFZL 3BXNB 5FYKU 5T3XE 4Y4FB 3BAEL 2EEBA 1JV5A 4ISVA 2R8SH 5C0IB 3U30C 5LJYH 4M8QA 3LB6D 4L8BA 4OZHE 1YN7B 5ALBH 4NZTH 4POZD 5DD0H 1AKJD 3GSXA 2DLIA 4NQSB 1DEEB 2F19L 3MV9E 1C12B 3HE6C 4JZNB 4OFYD 3OXSA 4JFFD 2Z92B 5CGYC 5D9SA 3BUYB 2GCYB 1MVFA 4G8IA 4F9PC 3LY6A 1QLEH 5AZEH 5DQ9A 4JPVH 3QNZB 4JFEE 4EI6B 1BWWA 1KELH 4IRJA 3F7YB 1DEDA 5ADPL 3C60C 1SJHA 3GMMA 3VGBA 5DS8A