1NJ9B

Cocaine hydrolytic antibody 15a10
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGPELVKPGASVKVSCKASGYSFTDYNMYWVKQNHGESLEWIAYIDPSNGDTFYNQKFQGKATVTLDKSSSTAFMHLNSLTSEDSAVYYCARGGGLFAFWGQGTLVTVSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin variable chain
publication title Crystallographic and biochemical analysis of cocaine-degrading antibody 15A10.
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 215
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nj9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nj9B02
4QRRA 5EB9A 2Z8VC 3P0GB 1KCSH 3Q3GA 4Z7WB 1UWGL 1HE7A 4Y16C 4AIXA 5DRZA 5ISZA 4QHMB 3RWDA 2F54E 3VXMB 1EHXA 4PGJA 2MOVA 3PGDA 4WWID 1TJIL 3T0EE 4HQQH 5I1DA 2FDBP 3UBXB 5GS0L 4YE4H 4KY1L 4NFDA 3V8OA 4FFWD 4XPHH 3T3PF 1LEIB 5FXCH 5J1AB 2DQHH 3TIEB 3C5ZD 1ZS8B 5HHPA 1CT8A 3UAJC 1F2QA 3B5GA 4OV5B 3TT3H 43CAA 1LO5B 1O7VA 1L0XA 3M07A 3HLAA 4FOMA 4GLRH 1LDPL 4HG4K 1RIVH 2C9AA 4NWUH 1U91A 2GKIA 4X7SL 5I76A 3MRQB 4YDIH 3PWLA 1C5BL 4GXUM 5ICXA 2C3HA 2Y06H 1TZIA 4KK6D 2EDLA 5ICZA 2AQ3A 1HWHB 1X4ZA 2B1HH 3P11L 1E27B 1EO8H 2YMXH 2RAMA 1GOFA 3CH1A 4AEHL 3NACL 4MJ5B 3K1DA 1KCUL 1A4KB 1JL8A 4TSCL 3HFML 4OFDA 1D5XB 4HXBH 4U7KA 3SDAB 2Z4QB 4OZFB 2R1XA 3DPBA 1U8HA 3NCJL 1T22B 3QXAB 4Q9QH 1F4HA 2BVPB 2MCPH 1JGLL 3REVB 3EO0A 4JFDB 4ERSH 1K8DB 4NRXA 1GZPA 2YWZA 3BO8A 4Z7QF 2ENSA 1IGYA 1OAKL 1OAXL 4KK9D 4KAQL 1G6RH 2J6EA 3C5ZA 3KVQA 4FFYL 4PB9L 5EUKA 5IF0B 2GJ6E 2XN9E 4JRXE 2UY7A 4L3EE 4D9LH 5C3LD 1FNEB 1VACA 4JO2L 2X9XA 4P57A 3TJEH 1FO0L 4MXQC 5ESVA 4JGUA 2HYMA 1U3YA 2EO1A 4ODSL 4LMQE 2P24B 5C08D 2CIIB 4HHAA 1MQ8A 5E6ID 1BVZA 1EPFA 4XNZC 4XVJL 2ZJSH 5E70A 3T8XB 4Y0GA 5C0BE 3MV8D 4N0FB 4RGOL 4L4TE 2JIXD 4XMLL 5AAMA 3L3HA 2FO4B 3OKOA 4W4OC 2W0LA 4S0SD 4MWFB 2FBJH 4NN7B 5D2LA 5DJ0B 5GS0D 3QQ9C 5JR1H 4JR9L 5D7IF 2OI9C 4PTUA 4PY7B 5MEQB 2YZ1A 1H5BB 3WFZA 4I48A 4M62H 1RIHH 5KVDH 4NQDE 5D71H 1NCAH 3ULVC 3K4ZA 1CD0A 3MFGB 5DUMH 3LZFH 1IT9H 1KN4H 4KHTH 1CDHA 4EUPA 5FCUH 3QFJB 1TVHB 4NUGH 4U0RC 1C5DA 2WSKA 2ICWJ 4RAHA 2D31B 5E00A 2J8UE 5EUOF 3UZEA 3L7EB 3PV6B 1B9ZA 2I60H 4ODTL 3CLFH 3OKEA 3RL2B 1AR1D 4V2BA 1XMWA 4JQVC 2DM4A 2J6EH 3NTCH 3L5WB 1Q94B 4TSAH 5BXFB 7FABH 1D5ZB 4PG2C 4XXCA 2V7HB 3F7VB 3UJIH 5HBBA 1EGJL 5CZVL 1N4XL 3ARQA 4MA1C 4RAUA 5C08A 4B41A 5E6IA 4PLOB 2Y25A 2UWEE 3W9EA 4HS3A 1FFPA 1OAYL 2P48B 5INDA 1MHPL 1FZMA 3HZVA 2CQVA 4C56E 3P4OB 1NC4D 4Y5VA 3SDXE 1KG0B 1F5WA 2VXVH 4WIQA 3MV8A 1T03H 3O6FB 2JIXA 1H3PH 4Z95H 4G42A 1FH5L 1MI5B 1ORQA 4Z7UE 3G6DL 5GJSL 4UTAL 1FYTE 1KPUA 2DF3A 1U6AH 1RFDL 2VH5L 2EDQA 4OFPA 3FT3B 1NCDL 2EKJA 2IFGA 3ESVF 4XNYH 3WUWG 1CDBA 1FIGL 1HI6A 3OJMB 1BREA 1AC0A 1AQDA 1MF2H 1N5AA 3LKOA 4RGND 5DD5L 1P53A 4FA8A 3VW3H 3VXSE 3LEXA 5FUOH 2BOBB 1FGVH 1WBYB 2B1AH 1I1FA 1I3GL 4NPYB 4FS0A 4M00A 1U9KA 4EUPH 2ILLA 3QEQE 4KUCF 1DJSA 4ZSOE 5AWNH 1K6QH 2DMCA 3VXRE 4ELMF 3MJ7A 1CFNB 2Q8AH 1W8NA 3OSKA 2JF1A 4JKPH 2VUYA 4GKNA 5C6TL 1Y18B 2VOTA 3CX2A 3V95A 3DVGB 3V4PL 5AZEL 5J13B 3QDHA 4WI6A 2X4SA 3EYVA 4PJAA 3IDJA 5JIHA 5E8DH 1I7RB 3WKMH 4JJ5A 3QIWC 1NC4A 2HTLC 1N8ZA 4LCYB 3MLVL 1B2WL 4JCLA 5CKAA 2I07B 5T33L 3KHQA 3WJLC 5ESQB 4WDIB 4OKDA 1GOGA 3N9GL 4OJFH 3HAEG 1KPRA 4NT6B 3VJ6B 1ZHLA 4I8DA 4D3CL 1P9MC 3HRZA 1ORSB 2FJGA 3EDDA 4QRUA 2DAVA 1PW3A 3FOMB 4OZ4A 5CINL 5DJ8A 1GZQB 1NH6A 2ZOKA 4DGIH 2QADD 5D1QC 1FO0A 4R6UA 4KJPC 3SDCB 1J05B 3LQZA 5EOTA 3BUYA 5EA0L 4CDHA 5D6DA 3ZYOA 2PYEE 4U1SA 1S7RA 3NH7L 4X6DB 1C5BH 2YUWA 5HI4D 2BVQB 3DWTA 4CMMA 4XVSH 5ID0B 3MRJB 1AO7E 5FFLA 1YPZF 3P11H 1ZVSA 4P2OC 3NACH 4PJ5E 1FL5A 2E9IA 3DX9A 5TFSH 5EO9B 2CR3A 4F3FB 5H37G 4MAUH 4PTTB 4RNRB 1FZJB 3O4LD 2R9HC 3NCJH 5J11B 1UWXH 2ARJA 1INDL 4JM2B 1QACA 2AQ1A 4M1CC 4B7IA 5CGMA 5KVGH 5I1IL 1PG7W 3DOSA 3NA4A 1DN2A 5I73C 1LK3H 3FTGA 1OAKH 2C3WA 4F9LA 2ADIA 5SX5K 4KAQH 2BNQE 5F9OH 5E2WH 1MFCL 3CDGA 4AK1A 1CFTB 4MB4A 1PGRB 1QFWL 1EGJA 4APQC 3G5VA 1FO0H 5EIIB 1JPSH 2P8MA 5K59F 2GK2A 3NBNA 4HUUA 1JN6B 3DMMC 3JWNC 3IS0X 5BV7B 5FA4B 2BJMH 1AJ7H 1R3HB 1AGBA 3WNPA 2HT3C 2P1YA 3KJ4B 3KYAA 4JFEB 4HEME 4KKLC 5DYOA 1IC1A 4LHQB 4LKCA 4Z5RB 2GSGB 5IWLA 4UT9H 1GGCH 3FO9B 4NIKB 1KJ2L 1MPAH 4N0RA 4XMLH 1IM9D 4ZTPL 3KJ6H 4ONFH 4DOHB 3SDDB 1KXQE 1NMCB 1V3JA 3H9YA 3HPLB 4N8VG 3VFTA 1F4WH 3O4LA 4MVBD 4PGDA 3CUPA 1KUMA 3QHTC 1XF3B 4CVXA 5DVOA 3IFOB 1F4XL 1ZT1B 1LDSA 2BP3A 1H15B 3CDYA 2YD4A 1EBPA 3QDME 4XPBL 4LL9A 1P4BH 3S3SA 2F5AH 1IAKB 3MCG1 4E41B 3HE6B 1CXEA 1KLUA 3KPPA 3VG9B 3VGHA 1HOCA 5HHOD 2HRPL 3P4MA 5C0GA 1MLBB 1RZFL 5JIKA 3RX5A 2CGRH 3ZKMC 5AUMB 5GS1C 1H0DA 1WWWX 1UXWA 5HVWA 3HNVL 3JWDC 4DTGL 1Q72H 3WDHA 1T1ZA 3NFSL 2DQIL 3QUXD 4WO4D 4M7LH 3CFKA 2YUVA 4Q6IC 3IAGC 4NOFA 1RZJC 3QH3B 3UO1H 3OKKA 1JF1B 4J6RL 4F2MB 1M1SA 3LKNB 2HJLA 4QTHB 3V5HA 4NO5A 4QRRE 2Q6WB 3BOVA 4WU7A 1IM9A 1MVUB 3FB5B 4M5YL 1YN7B 4YXKL 5A40E 1FH5H 1OGTA 1MCNA 5BZDA 4L5FL 5GJSH 1EUUA 5DJ2A 5HJ3A 3VH8A 3U1SL 4FQQB 5IVXB 3V7AG 3VXUD 3BDYL 3QDGD 3S88H 1XCQB 3GB7B 1RHFA 5I1AA 1WT5A 3RGVD 1YEHL 1J0JA 5DD5H 4KKCD 4BFIA 4O58L 1D5BA 3LRSA 5DMKB 1JRHI 1IQWL 2K7PA 2VWEE 1AGEB 2VABA 3FONB 5CJBA 5HHOA 1A6ZA 2ZCHL 4X6BA 2AJYL 5I18H 4ETQB 2ZPKL 5GGQL 5JNYB 4JY6B 2IEPA 1G9EA 1BOGA 1A1NB 1LE9A 1PY9A 3T2PA 5BW7A 1YNKL 5HYSB 1CFSA 4S1QL 3WIHL 3QUXA 4M03A 4WO4A 2Y72A 1BPVA 5C0AB 4EI6A 1OD9A 5ITBH 3E1F1 1U8QB 3IRZA 4NZUL 4U6VL 4MA7H 1B2WH 2W60B 4FQJH 3R0MA 1T80A 2WIMA 3BXNB 1SYVB 3CD4A 2DI8A 4FQIH 3BZ4A 3QQ3A 3ULSA 2OMBA 2V2XA 1C8PA 3KLAA 4P9HL 1QBAA 3EDEA 3VXUA 2ZOLB 3QDGA 1IEHA 4D3CH 4ESKA 4QHUA 1DVFC 2QV2A 5E6ZA 5EPMB 4UUJB 3VFUA 1U3HB 4JPKL 3HS0B 3GMOB 3RGVA 3MBEC 3NCYS 5HVHC 3R8BB 2QSTA 1J1PL 1A7OL 1R6VA 1ZANL 1VGEL 1NUGA 4U1MB 5CJ8A 3UBXG 2AJZA 2I9LA 3GHBL 4RBPK 1CLZL 4EOWL 2OBGA 2HFGL 1QA9B 5T1MB 1TITA 3ARTA 4J8RB 3SKNA 2C4XA 4C4KT 2ZSVB 3NH7H 4ELMB 4K94C 4X5WA 1MFAL 1QHOA 3VFRB 2IBZY 1XFPA 3IDMA 3QUZC 4MXQD 1GPOL 2DL2A 1QFPA 3TBYA 1MCDA 1QBBA 1KJ2A 1KNOB 2NZIA 2V5SA 4ALAH 5KN5B 2DJSA 3FJTA 3EFFA 1G84A 1Z2KA 3WMSA 3ZL4L 4OCYL 1MCKA 2F74B 5D2LE 4EXPX 4PRIB 2XPGB 1X4XA 2XICA 2JK5B 1GL4B 1XGTB 4RX4D 1K8IB 4PJXB 1QZ1A 5F1OB 3ZHLA 4WJ5B 3QUYD 4NNXB 1HZHL 2NY6B 2V2WB 4MNGE 3WFHB 1S7WB 2NW3B 3T77A 1J86A 3BKCL 2OR9L 3QQ9D 3VD9A 4OZFG 1NGYA 5E4IA 4YHKH 2H3NA 5L2KE 1ZGLM 3H0TB 3GSQB 3JVGC 1MFCH 2VJXA 4Z0XB 1INEL 3SE4A 1QFWH 4ZS7L 3SQOH 2J8UF 1LP9A 4HXAH 5FM4A 5A43C 3EO1A 2BY3A 2WWMC 3U4BL 5C07E 1VEOA 4WHTB 2XZAL 3LV3A 3GUTB 5ACLA 3LN4A 4PJDE 1SMOA 1U95A 2E8YA 1CK0H 2L0DA 5DD1H 3D69A 1FRGL 3VA6A 4G8IA 1Y6KR 1T89A 1DUYA 4LDOB 2UWEF 3OXSB 4P9MH 3AM8C 1TQBC 2LU4A 4XP5H 5DSCB 1XGYL 1YY8A 5F8QC 3GGWB 1IQDB 5TPWL 3QEHB 1YPZB 1KSRA 1X6NA 1M7DA 1FNHA 2QTEA 3SDXF 6CGTA 1T7WA 1QEWA 2VE6A 1P4IH 2ATPB 3OX8B 4RX4A 1FHGA 3S34L 3B9KB 3LPGA 3QUYA 3CLEH 4R26L 4Z7UF 1RQ5A 2X4NA 3O0RL 4W4OA 2VTFA 1F00I 4AQOA 2AABL 2J88L 1DBML 1A9BA 5DK2B 3L3IB 5A2LH 5DDHB 4MD5B 1TVDA 5KVFL 1BZ9A 1FNAA 1UKTA 4PJ8C 4OI7A 3HMWH 4QXTA 5EG6C 1AE6L 2FATH 3HC0B 3NZ8B 5ELIA 3DX8B 1EVUA 3IKKA 4JO4L 3CC5B 4TQEH 12E8H 5E94B 3UJJL 3WXVL 1NFIA 4MB3A 1D5IH 4BELD 3MGOB 4DTGH 1JHTA 5D7SL 2ICEB 3WIHA 2EDNA 3CXDH 5BS0B 5HGHA 1C12A 4AM0A 2DQGL 3OGOE 3MRRA 3DURB 4ZUWB 1CXIA 2A74A 5DEFA 5AD0B 4P5TB 2F5BL 2NY2C 4GUPB 4MCYB 1S5IH 4J6RH 4F15C 2V9RA 2WK2A 5D5MA 5FK9B 2A6DA 3S7GA 4D94A 1J12A 4LHJB 2X1WL 4YXKH 1FFQA 4U1KA 3QIWD 4BQ6A 2X70A 4A2LA 3U1SH 2VR9A 2IBZX 1G0DA 1MCOH 4JRYB 3MLWL 4XTRD 3EDFA 1MWAB 2GSIA 1OAQL 5E8EA 1CBVL 4NC1C 5FF6B 1KEML 1NCCH 3G04B 4FQ2L 4O58H 1DE4A 1IQWH 3EUUA 3FQUB 2XZZA 2VXSH 1BQHB 2FH8A 3IDNA 4Y1AB 2AJSH 3SO5A 4E42A 4TVSa 2WP3O 1AD0A 3FZUC 5F7HA 5F7UA 2WUBH 5L7XL 5FO8A 3IKCB 1EAPA 4H5SB 3AC0A 5GGQH 4MMXC 5D1QD 5C0CB 4LASH 1RHHB 3ULVH 2AGJL 5LXGH 5E8OA 4ZUUB 3C09C 4KJWC 5KS9A 3VFVB 5L0QB 1VKXA 2P47B 2AK4B 3MOBL 1YNKH 1V3MA 5CD3B 3HC4L 4UOW0 3QO1B 4GKZA 3CZJA 3M45A 3QCUL 4TUOB 5DK0B 4Z76B 1FPTH 3RTQC 4NZUH 4QXUL 3FQNB 1DBKH 1KOAA 2Y07H 3UMTA 1MIEL 1FZOA 4NFCA 3GRWH 2DWDB 3TF7C 4UNVA 1N0XL 5FYLL 1D6EA 3EYOA 3QIWA 3VE0A 3IETB 4LQFL 3VGFA 3MLUL 3C9NB 4XH2A 2ITDA 1TENA 2XIDA 3CFEA 4K3DL 4JPKH 3W11D 3ARWA 1WQVT 5GRVL 2R9HD 4PJIB 1J1PH 4I3RL 1A6VH 2XY2A 3L3GA 3WO4B 1BVLA 2IAND 3QYCA 4HK3J 4O2FB 5BRZD 4M1CD 2FNBA 3FB7B 3GHBH 1CLZH 3K0WA 5F7DB 4NNPH 1PYWA 2CLZB 2Q86A 3GKWL 5K9QI 3QWRD 5FUCE 1PSKL 5C3TA 5D1QA 3SGEH 3ARFB 3IXAA 5INCA 4APQD 3KPOA 1Z5LA 5I15L 3GKZA 2BHZA 3O4OB 4X0KB 1CDJA 1RJZB 1BHGA 4LSVH 4FQXB 2P5EB 4P4KC 3INUL 4GRWB 1RMFL 3IFNL 4DZBB 3ARGC 4ODHL 1G7MA 4OCYH 5FUZL 4HUMB 3SBWA 2EC9T 1DBBL 3STLA 5J12B 4I4WB 3T4YA 4D9QD 5JOEA 5J6HA 3O4LE 4OLXH 4XNUL 1V05A 4JDZB 3HZKB 4OGXL 5KSAC 1MQKL 3DYOA 5HY9B 2FD6H 2H45A 4PP1D 4XXDA 2YPVL 5GXBB 1Q38A 3RBGA 1JK8B 1S7VA 3WE6A 1R3LB 3JUZA 5FM5M 3IU3A 4OF5A 4HIXL 2EIZA 4HUNB 3CZFA 2D7OA 1XAUA 4MLSA 4MQXC 3U6RA 3PP4L 2IANA 5BRZA 1ZLVH 3X3GH 4RFNB 2AJUL 3ZKXC 1KF9B 2H32A 1YC7A 5IFJA 3Q6GL 4DVBB 3U4BH 3O6LL 4LAJH 3ZKMD 4KV5E 3T0XA 2XZAH 3GSXA 4AMKH 2GJ6B 4XRCA 2XN9B 4NWTL 1JNHA 5FCSH 1FFRA 4APQA 2RJMA 3AU1A 1IGCL 2X1PA 3S3JA 5FYLD 4QCIB 5C0RL 1RVFH 3NIGE 1XGYH 1ZLUK 3OB0H 4FP8H 4YAQA 2I5YH 4XMKH 5FYKU 5IM7B 3GJEA 3S34H 4ZFGH 3D0LB 2IPKB 5C0BB 1Q9LB 5B3JE 4JFZH 5C86A 2W92A 1RSFA 5D7KD 1ZEAL 5GGSB 3KXFA 1OLLA 5CJXA 2ZG1A 4HH9A 2J88H 3MRCB 4XCFH 2DM3A 2RCSL 4D8PB 5HHOE 1J10A 1FNSH 3LKRA 2D7QA 1AGDB 1DL7L 1OGAE 5FAAA 3BT2L 2CO7B 4UTBH 1AE6H 5JUEL 5F1KC 4WEBH 4JO4H 3LKPA 3AS3A 3QNYA 3TVMB 1N0LA 2OXGA 2VL4A 2FZ3A 2WLYA 3PWJB 3WXVH 3RZCC 1D7FA 1OOAA 1ONQB 4LRIA 1AY1L 1LEGB 2AJ3A 2XXMB 1SJHB 5DD3H 3K2MC 2IFFH 4F33B 2H32H 5I8CB 2AV1B 5GS1A 1T5WA 1ZE3C 5CD5D 1G7QA 3DX6B 4OCSH 4YEEA 1SVCP 1UQSB 1RZ8A 4KQ4H 3VWJB 3WNLA 1DQMH 4R7NA 4G5ZH 2EZ0C 4L8CB 5TGBA 2P5WB 2H8PA 1F3DJ 4HCRL 4NBZB 3H3BC 4O2EA 3UYRL 2FSEB 3PGFL 4RGMB 4YDLB 3PWNA 4JG0L 5I8OH 2CMRH 4F7MB 5EWIL 4R4BA 3MGTA 3EYUH 3O45A 4C56B 3VXUE 3AB0B 3AMLA 1W8OA 2ICWI 3MJ6A 3MLWH 4FQHA 3PUCA 3Q5OA 3CFDA 1DEEB 1J18A 1U42A 1ZHNA 4CVUA 5EN2A 1OAQH 2FJFB 4BSJA 1CBVH 4Z7UB 3X11A 1ZGLB 5T5NF 3N50A 5CMAB 4ODWA 2H2SC 3FO0H 1F58L 4IIQB 1FL3B 3QIBD 2NCMA 3RKDD 2A6IB 5I1HH 5ADOH 2A73A 3ARRA 1JWSB 3ZE0E 3TBWA 4KRMB 4UT6L 5L7XH 4I2XA 1ADQL 1QFUH 3CX5J 3QEGH 1IC5L 3MRPA 2AGJH 5T1KB 2J1KA 3QNZB 4NUJB 4HLZG 3MOBH 4OLVH 4ZO9A 4MJ6B 1I8MB 4OCLC 2YSSA 2R4SL 3QI9C 1XGQB 3HC4H 4CW1B 4ZSOB 1CD1B 5GS2D 4U6HA 1I1YB 3MYJA 2R23B 3NFPB 1OLZA 1NGXA 1CLOL 4QXUH 5J56B 3JWDH 4ZNCD 3QUZD 3ZYJA 4KMTL 4NSKA 2ED7A 4G6AC 5EZOH 2ESVE 3FHAA 3MRBB 5HGAA 5GGTL 4I77L 1N0XH 5HGBB 4U6XB 5D2LF 3ZE2E 1PDKA 4WFHD 3SKOA 2NY1B 5DEGB 1EEYB 2XG4A 3A6OA 4JGMA 2IAMB 2NXZD 1OCWL 4AEFA 1RZJH 3SGKC 5EBLB 5D70L 4ZOAA 3BE1L 3WUWA 5JLZA 2BNUB 5EBMB 2Z92A 3SE3C 2LAGB 3W0WD 4MD0B 1TPXB 2PW2B 4OBSA 1XZ0B 3QIBA 5IB2B 3M1BB 4BSWB 1LP9E 3MMEA 4OIAA 4P46D 5T1DH 1QR1A 1F6FB 1W72H 3JWOL 2X4TB 1HNFA 1PSKH 3CFJA 2ENYA 3P73A 1WEJL 4K71C 2VZUA 5ANMA 1KTDB 5I15H 4NZDA 2ADJB 4PV9A 5L8KB 5H2BB 2ARWA 3E3QE 3DUUB 1JWMA 4BH8B 4PJDF 2PYEB 5LAXA 5SX4H 3AREB 3INUH 1RMFH 2PYFB 5B21A 4ODHH 1JPST 5I2IA 1ZLSL 1VA9A 3W5MA 3HG1A 3HMXL 3X12B 1FJ1B 4O02H 1QKZH 5KG9B 3QUZA 2D4FA 4JFYA 5I8EA 3MNWA 1Q0XH 2WINB 2Z8RA 3VG0H 3CK0L 3LD8C 1MJ7H 3L3JB 4OGXH 4PD4J 1MQKH 1QLRB 4NQVB 4M93B 4BSVB 1WCBA 4PJ9D 1MRFH 1MJ8H 4PJ5B 4AIZA 2X4RB 4QRTB 1BBJB 1SYSA 1U8OB 1T3FA 3U4EB 1EJOH 3UP1A 5ESAA 2XFXB 3CH8A 4RIRB 1PKOA 4HIXH 4OTXH 3VMPA 5FYKE 1MCSA 1TLKA 1X6LA 1T0MA 1HIMH 4YO0A 4YFEA 3W0WA 3EW3B 3KLDA 1J0YA 1ZT4A 4XPAL 3UTTE 4KKAC 2AJUH 2K1MA 3WLWC 3N1MC 4P46A 4ORGB 3NABL 4R4ND 3K80A 3ARBC 3O6LH 1IJ9A 2PXYB 3IDXL 3TA3D 3JVGA 5JW5A 3EYSH 2GY7B 1TJHH 4UILL 2Z9TA 3I3DA 1JGDA 4HCRA 4P3DA 3GSUA 4JLRB 3EOTL 2Q3ZA 5JIIA 4P5KB 1IAMA 2DJUA 5CHNB 1E4WH 1R5VA 2IQ9L 1V8HA 4DKAA 4DWHA 4YR6B 1X3DA 4P2QD 2QSCH 1MY7A 2NY2D 3FAXA 4H1LB 4OAWA 5GS2H 2LABA 1MHHB 3I2CL 5CCKL 5F93C 4K94H 5KZCB 4WNQB 4HT1H 3LOWA 4M7LT 1PJ9A 2M1KA 2QQQA 3BESR 2WM0A 3T04D 3HE7B 3Q6FA 1UACH 1NEZA 1OM3L 4PJ9A 1ZEAH 4OLYL 4HPYL 3QEUB 1J1XL 4HW6A 1O7SA 1CDIA 3SGJA 1BEYL 1U3JA 5IROA 2RCSH 4KDTA 1NGZA 4V2CB 1DFBL 1A9EA 1JGVL 3F65A 4L4VB 1S7SA 1ADQA 4U49A 5ETUA 4LCUA 3U7AA 1ZT7B 3BT2H 1S9VA 3E2HC 4BQBA 2YPLE 4GS7C 1HINL 4GW1A 2AI0L 5JUEH 4ZNEE 2D7NA 4ZXBD 2A0LC 5L8LB 4U1IB 3S35L 2XQBH 2H1PL 1HH9B 3QXDA 4I0PB 4JAMA 3PGCA 1LK2A 2AEIT 3FFDA 2DM2A 2RHEA 1MCJA 4Y5YC 3TA3A 4OD2B 3SKMB 5TH2A 2WWKT 1FG2A 4Z7OE 1YA5A 4MQ7B 1BZ7B 1IGTA 4PLNC 2VZSA 2DJ4A 1S7XB 3L9RB 4K8RL 1VADB 3MCLL 5GGTA 4LCCC 5BO1H 1GRWA 1T0PB 3IB4A 4HCRH 3RY5A 2OR8A 3UYRH 3D2UB 3PGFH 2C3GA 4HMDA 4JG0H 1E4KA 2R4RL 1OY3B 3MRHA 1LE5B 4N0YL 4P2QA 2B5IC 4GKOA 5F8RC 2MQCA 4LVNC 2ZNXA 5CJ5A 4LP4A 3WIFB 2VZ1A 4FXGA 3SQBA 1NCBH 2YA2A 2XZCH 3L7FA 4G9FD 5DJ6A 5T3ZH 4N8VA 5I9QB 1T7YA 4JZOA 3IGAB 1IM3A 5ISZB 3EJZD 5BQ7A 1J5OL 2Y23A 4PYHA 5ID1A 1F58H 3EJYC 3PGDB 5HDOA 3IDUA 1B0GA 2GYSA 4UMGA 4BH7A 3MNZA 3OWEA 4GRMA 2QKIA 1G6RB 3H7BA 2AERT 2BFVL 4LSTL 4PREA 3O8XC 4L9LC 2VZOA 3H42L 2VQTA 4MS8D 3L1OL 3ELAT 4KVCL 4M6NL 4NGHL 4ZXBA 4QGYA 5HHPB 1LO4H 3VI3F 43CAB 1B0RB 1GHFH 4OGAC 1CDUA 5BVJA 1BQHG 3RJDA 5IB3B 5CBEA 4JG1L 3IJHA 2VN7A 1WFTA 3H9SB 1QVOB 3PWPD 3HMXA 2FX7H 5TDPB 1VHPA 5DR5L 4KU1A 3U9PH 3T2OA 4QOKE 3HZYA 1F4YL 5I76B 4QRQA 4LEOB 1CLOH 4NQCE 4Y7MA 4JHAL 1SHMA 1F97A 5FGRA 4ZAKD 5ICZB 1I9IL 4YHML 3EIFA 3AAZA 3CMOL 5GGTH 3LPWA 1MCQA 3EOBA 4OGZA 2HT4D 1PZUB 3TM6A 1OCWH 4I5BB 4G9FA 4WGVB 2BVUA 5D70H 1CGTA 3BE1H 2R1XB 1U8HB 2NYYD 3AGVA 1DUZA 3C5SA 3BH8A 3V5DB 1M7IA 2IANE 9CGTA 5EZJB 3VGAC 3VXMD 5HVFB 1M05A 4MCZA 2YN3A 2AKRA 1A2YA 3LHPL 1GZPB 4DKEL 2EEBA 3BO8B 3DGGA 1FFNA 4NQSA 1IGYB 4ZODA 4ACPA 4WTWA 2H26B 2CK0L 3FQXB 3BKYL 3MRIA 4MQXD 3KWWB 1U58A 5EOQH 2I9TA 5I16A 2ICES 2YD1A 4K8RD 3FN3A 1BJ1H 2MMXA 4P57B 3AY4C 5HHXL 4KZEH 3D39B 2FECI 4GAGH 3O6ML 1CR9H 1IC7H 3DV6B 4KV5F 3ZSTA 4YNYA 4GH7B 3Q2CA 5I74C 3AUVA 3BW9B 5KAQG 4HHAB 3PWPA 4NQEE 1KYOK 2JKXA 1A6AA 3QIUB 2V5MA 3HI5L 1UH2A 2VDOL 3LKSB 4U1NB 4LMQI 4EDWH 3MNVB 4D9QE 3QFDB 1CL7L 4NM4L 1A64A 3NIGF 3ARDC 4TOYL 2L4OA 3L5JA 4BFEA 5KSVA 5DJCA 3L3HB 5DC9B 3OKOB 1BIIB 4HIJA 3BRFA 1Z6JT 5DGQA 5ENWA 1YC8A 4XBEL 4NRZB 5CZXD 4FTVE 4PTUB 5JIPA 3HC3L 4AYFA 2SEBA 5B3JF 3SDAD 1UM5H 4Z7WA 1NDGB 3LN5B 4PGEB 2GJJA 3QUMH 3BP5A 3VXMA 2VDNL 2JLLA 1N64L 2E7HA 2HVKA 4WI5A 1UC6A 4EUPB 4JFDD 1UA6L 1A5FH 1C5DB 4U1GC 4Z18A 3NABH 4LCIL 5E00B 1YEEH 4HX1A 1QFWM 5DC4B 3IDXH 3HTLX 5CBAA 2O5ZL 4P2CG 3KPLA 4HG4J 1QYGL 4BKLA 1S9XB 3ZT7A 4OV5A 3EAKA 2DQTL 2QHRH 4UILH 3SGEI 3KYMB 4D9RD 5FYLE 3EOTH 3KPMA 4WHDA 5C08B 1DZBA 2XT1B 5E6IB 2IQ9H 3WS6A 3W9EB 4HPOH 1FFPB 3TESA 5IJKA 4LSRH 1UKSA 1FZMB 3OJVC 3HZVB 3T2QA 4Y5VB 1T04A 4L9DA 2J5LC 2EZ0D 4KVNH 3VGEA 1XIWC 2Q7YB 3MV8B 2EDFA 4GXVL 3FRPG 2JIXB 4XAKD 5D7KE 4G42B 1OM3H 1ORQB 4HPYH 1J1XH 1KPUB 1W0WA 4MJ5A 4N9OB 1A4KA 1BEYH 1WK0A 1VDGA 1FVDA 2WBKA 3ALXA 5I30L 2AXFA 3TBSA 4OZFA 4ZMAT 3D6GA 4HZAA 5EIVA 5F3HA 1T22A 3QXAA 1HINH 4I2XE 3UDWC 2BVPA 1UH3A 1I9JL 3TBTB 2NY7H 4JFDA 2YOCA 3QFJD 2RR3A 4OM0L 3LH2H 4WW2C 3ZE0F 1HQ4A 2X4QB 1YQ2A 4L4JA 1NSNL 4GO6B 4KRNA 3ZE1E 3WDIA 5IF0A 5D93B 3WIIH 4HGKC 1MFNA 1OP5H 2DQEH 4YFDB 2AEWA 3CCHA 1L7TH 4X4ME 1C08A 1CVRA 1FNEA 3A6CH 4IRSC 4GKNB 3MCLH 2D7TL 3ILPA 3FN9A 2X4SB 1S78C 3N1GC 4PJAB 3IDJB 1LVEA 5D9SB 3RI5F 3U46A 4IOFC 4NKQB 4P3CL 4JJ5B 4E5XB 1NKOA 4KC3B 1EVTC 3T8XA 1KXTB 4HIHB 5EZIL 4QRPD 4N0FA 5CGYC 3ZE2F 3O6FD 1IFHL 2BDNL 1HHKA 3F7QA 1KPRB 2PUQT 1J5OH 4MWFA 1UKQA 3IJSB 1MJJB 1ZHLB 5MEQA 4RA0C 5JPNA 1H5BA 5I1CL 4HJGA 4NQTA 3HRZB 4OZGA 4LSPL 2FJGB 3ISWA 5ALBL 1QBLL 2BFVH 4LSTH 1UG9A 3PHOA 5DJ8B 4R2GB 4FN0A 1N7MH 2HH0L 3H42H 4EI5B 3L1OH 4RGNB 4KVCH 3TBVA 4M6NH 4NGHH 1FO0B 5ANME 4XP6L 1AQKH 4W6WB 1LP9F 3QFJA 1TVHA 3SEPA 5ITFA 4JG1H 4U6TA 3AROA 3L6FB 2D31A 5CJQH 4KK8C 4OD1H 4G9DA 3RL2A 3M8OL 1FBIL 5DR5H 4GSDH 3BUTA 1S7RB 4XPFL 5EORL 3L5WA 3DRQA 4XP9L 4PGBB 4JHAH 4CMMB 3TCLB 3F7VA 5MI0B 4LARL 4YHMH 4FMKA 1NGQH 3DUSA 4WFHE 4HK3N 1ZVSB 2YUXA 4OCXL 1VGKB 4QTIL 1FL5B 2Y9RT 4K3EL 5BV7L 3DX9B 4OCWH 1UADC 1KG0A 3V6OC 4QRPA 1F90L 3O6FA 4ODUB 1OTSC 4F7PA 3RDTC 3W0WE 1KV3A 3ZMRA 1JFQH 2ARJB 1T2XA 1QO3B 1NBQA 4F8QA 2DTSA 3LHPH 4RMTA 2VDKH 4CMHC 4DKEH 4JFFE 1JPGB 3FTGB 1ETZA 3RUGB 2ADIB 1S7TB 2CK0H 3KDMA 1MHEB 2QADB 3BKYH 5IESL 4ZFFB 3S96A 4HF5H 3CDGB 2CRIA 4KKAD 2BOBA 4XZUA 3WLWD 3HKFA 5HHXH 3O2WL 1AFVL 1SJXA 5B3NA 4DAGH 5HGDA 5BMFL 4Z7VB 4X4XB 4ELKB 3BPNC 1MCRA 4Z78A 1CFNA 1AGBB 1M7XA 3HI5H 5M95B 5I71B 5MERB 4H8WC 3UPRA 4P2RD 1CL7H 5DYOB 3O11A 4NM4H 2F8XC 3EDKA 1YEGL 3NPZB 2E9WA 3D3VB 3WKNA 4IDLA 1SEQL 3MLZL 1SBBA 5C0IA 3SOBH 5CEZL 2GW5A 1H8OA 4XBEH 1E4XL 3QNXA 2I07A 3HC3H 5FHAL 4YXLL 5IBLC 3GK8L 5ESQA 4WDIA 4DW2L 2VDQL 5MP6L 2VDMH 4PGDB 3CUPB 1GAFL 3MUJA 2VLJD 3HHRB 5E4EC 2EXYC 4XVTH 3NCEB 4NRYB 1YYML 4EEEA 4XWGL 4JM2D 1RURL 3VJ6A 1PFCA 2W38A 1UA6H 4FFVC 4UAOC 1KLUB 1QD0A 1ULVA 4JPWH 3O3DA 1HOCB 1ORSA 2H2PC 5GSVA 4PJGA 1G7LB 4XX1G 1H0DB 1NJ9A 2O5ZH 2PNDA 1IAOA 1UXWB 3GO1H 3LDBC 1P6AB 4JPVL 3D48R 5F89B 1J05A 3LQAL 1U8KB 4NKMB 3QAZC 4U1HA 3CFCH 4HULB 4Z9KB 2V17H 3ARBA 4RQQA 4Z7OF 5IMLB 2APWA 4P2QE 3CFKB 1RUKL 4KXZH 4K7FB 2VLMD 4FABH 4OZHA 4X6DA 5SX4I 5DTFB 4P2RA 5H94B 4GBXB 1I9EA 4DEPB 3MRJA 3PNWA 4LSSH 4GXVH 5M94B 4GRLC 4WU7B 2DQDL 1AGCB 1IM9B 2NX5D 2DS4A 4XMPL 1OGTB 4H1LG 3FOLA 3F58L 1Z0MA 3PL6B 2HJKB 5HJ3B 3VH8B 5IB5A 4FNLL 2EH7L 3BGFB 4F7EA 1QSEA 5EO9A 1CFVL 1T0NA 3V52L 4PTTA 2UYLA 1FZJA 2VLJA 5I1AB 3CMGA 1NGPL 4LLVB 4M6OL 2V5RA 3IRPX 1KLGA 4JM2A 4BFIB 3UYOD 3MODH 2UY6A 1D5BB 3LRSB 2BOCA 3EJYD 4RISL 4E41D 4DVRH 3HE6D 1PAMA 3NGBC 5HHOB 1KBGH 1A6ZB 5F7NC 2OLDA 3O2DH 1UM4L 4JKLA 5AYUL 4X6BB 5GPRA 2R2HA 1UXSA 5IHBA 5F7WC 4OGAD 5EFIA 5TQ0L 1LE9B 4Z8FH 3RNKB 2YBRB 1ZWIA 3N85H 2DQCH 2EDXA 4PRDB 4ZYKB 4DFIA 5CEZD 4HC1H 3I85A 5DEZA 5FA4A 4EI6B 3SKJH 1R3HA 4D0BB 4PGZA 4DGVH 5KVMC 4GAYA 4Y4KC 3SKUD 3KPSE 4XGZB 4G9FE 5EZIH 5E08L 4LCCA 3V7AE 1BBDH 5FO9A 2C4FU 5DD6B 1IFHH 2NX5A 1JZ2A 3BZ4B 3QQ3B 1WFNA 3ULSB 2XTJC 1UYWH 2WQRA 5DQ9B 4MZ2A 4HZLA 1G0XA 3VXUB 3HPLA 2OTWA 3HN3A 3QDGB 1ZVYA 4QHUB 4DN3H 4RFOL 5I1CH 4PJFA 3VFUB 3QP3A 4LSPH 3S3PA 1AXSB 5ALBH 2AEPH 4ZOEA 2A9NL 3KS0J 4WRLA 3T65A 1XF3A 2HH0H 4LU5L 4Y16B 3IFOA 1ZT1A 4OZIA 1H15A 4X8JB 5FYJL 4MXVE 5EOCJ 3ZDXE 4XP6H 2R0KH 4N0CC 2AJZB 1U93B 4WGWB 2I9LB 1IAKA 3L5XL 4E41A 3HE6A 4YIQA 5IOPA 1MLBA 5F96L 5KTEH 2E5EA 3PWPE 3SKNB 4M43H 4LIQL 3M8OH 1FBIH 3P3YA 3Q1SL 5EORH 1BF8A 3VRLE 3K2UH 15C8H 3IDMB 4XP9H 1I3VA 2WAHA 3IFLL 1NANI 1G9NL 1MJUH 1OARL 3EOYG 4LARH 4M6ML 2W65A 4QHNA 4YQXL 4YC2C 2VXQH 3MA9L 1OT2A 3EFFB 5ALCL 5C0AD 2CR6A 2UZXB 4UINL 1I1AC 4K3EH 1JF1A 4F2MA 2DKMA 4QXGL 3LKNA 4JN1L 2PTTA 1QLEH 1WAAE 3TO4C 1HCFX 5HDBE 1F90H 1ZLWK 2NW2B 4GQ9H 4Z7WE 4M4RA 4NJ9L 3FB5A 4HFUL 1I1RA 1A3QA 4HV8B 4BZ1L 2W1NA 3T77B 3VXME 2ATKA 1F45A 2CIKB 1EEUA 4FQQA 5DK3A 5IVXA 1NGYB 1XCQA 5KSBA 2JJSC 1U3HD 2BY0A 3BQUC 5F70A 4ZS6C 3OJDA 1U8IA 3BN9C 1FN4B 4U7SA 1QBMH 5IESH 3C8KB 2WUCL 5IB4A 3ARYA 4CAGA 3WNKA 1KFAL 1P1ZB 1LP9B 4JDVA 4OV6F 5ABDE 1B6UA 5BMFH 2CKNA 3MYZA 4ETQA 1H3XA 3LV3B 3QHFL 5GS3A 5JNYA 4KRLB 4JY6A 1U95B 2VQUA 3AY4A 1HQRB 1WZ1L 1U8LA 2XWJB 3CJJA 3D69B 1A1NA 5K9KA 3G6AB 4G8IB 2NR6D 2Q7NA 2APFA 1EAJA 1DUYB 4OD3H 5E5MB 3PWUB 1TZHB 1YEIL 5C0AA 2JTDA 4XVUC 5CILH 4EIGB 2NPLX 4XNZB 2CJUH 1M7DB 3MLRH 4PRID 1QEWB 4U3XA 2BRQA 3GK8H 1XIWD 1SM3L 3BXNA 1GGBL 3PDOB 2VDQH 4RCAA 3CPLA 5MP6H 3WCYA 5F1IA 1GAFH 3DXAB 2V9QA 4UT7L 1RIUL 2OL3H 1A9BB 4JFDE 2OI9B 2ZOLA 5HHQB 2FGZA 5EPMA 4UUJA 1BZ9B 4KTYA 1U3HA 4ODXA 4MDJA 1IKFH 5CAYB 5K9QG 2XYCA 4JM4L 1MWAL 2HLFD 1B4RA 4U1MA 5L6YH 1NFIB 4U0RB 3TJHC 1G9ML 4D9RE 1CG9A 3OKDB 2IGFH 1I9RL 3ZE1F 1QA9A 5TF0A 1PKQA 3IT8D 3VWKD 4AM0B 1C12B 4J8RA 3MRRB 3QCTH 3UTSB 5C9KA 2ZSVA 2A74B 5DEFB 3EHBC 1RUKH 4DUWA 4YX2L 3HA0A 1QUNA 5DO2C 3EGSB 4ONOA 4U4BA 2V5TA 2D4DA 3NIDE 2EDOA 4Y4HC 3U7YL 1DLFL 1CF8L 2NZ9C 4IRSD 1KNOA 4MA1B 1XF2A 5D5MB 4XAKE 3DROB 2WANA 1S78D 5E99L 5SX5H 4WWKC 5HHMD 4IOFD 1KIPA 2FIKB 1V3KA 2F74A 4H20H 5B39B 4R8WL 1PLGH 4PRIA 3RJQB 3TNNA 1FSKC 1XR9B 4WY7H 1XIWA 1XGTA 1K8IA 3B9KD 3V52H 3CSYA 4WJ5A 4KHXL 2V2WA 3WNOA 1NGPH 5E8EB 3WFHA 1RZKC 3G6JB 4HWEL 4HSQA 2A6KB 2DLGA 3QFJE 4RISH 5A2FA 3CU7A 4G43B 1UM4H 4E42B 2JJWA 5AYUH 1WITA 3EZJB 1AD0B 4NYLB 4CN4A 2G9HB 2R8SL 5FO8B 3P0VH 3GSQA 2FEDC 5JW3L 3TYGL 3C60D 5C0EA 3K4AA 5E8OB 1EMTH 2G60L 5KS9B 2E9BA 1CQYA 5C2UB 5E1HB 2QQKL 1VKXB 4CU8A 3VWKA 2B20A 4KK8D 1YMMD 4WHTA 5DRWA 4GKZB 1NCWL 3MCKA 3BJ91 3IXTB 3B2UD 3GUTA 2NXYC 4WFFE 1RULH 4XAWH 4PJCB 2R1WA 4OT1L 2VITA 3CDFA 5DJXB 1VFMA 4DK3A 4IRSA 1WBXB 4FZ8H 35C8L 4S1DC 3NOIA 1FZOB 3OXSA 5EOCH 3QG6A 4MZ3A 5DSCA 3BHBA 1IQDA 1MI5E 3EYOB 3LEYL 2Q87A 3QIWB 3VE0B 4KKBD 4RFOH 4XH2B 4HGWB 3B9KA 5TF1H 1GJIA 1S9WA 5JZ7D 5E9DD 4MNHA 1XF4A 5A1AA 1BVLB 3L3IA 3QISA 3M17A 4M5ZL 1PYWB 4FRWA 5FM5O 4LVHC 1GIGL 2Q86B 5E8PB 1V5JA 3HC0A 3DX8A 4LIQH 5D1QB 3C60A 4S10A 5E94A 3IXAB 4HDIB 5C0CD 4N1EA 1ZSDB 3Q5YA 3MGOA 3KPOB 1Z5LB 1ACZA 2ICEA 2X40A 4JFPB 3IFLH 3OKNA 2AK4D 4ZFOL 2ITCA 1I75A 1YMMA 5A3ID 4YQXH 1URLA 3MA9H 3D25B 3DURA 5BOPA 5DVKA 3IU4H 1WUNT 5ICYA 1GGIL 2JCCB 1JPFA 1N6VA 3T4YB 1MFEL 2VRAA 5FK9A 3S37X 4FMFA 4P2OB 4JO1H 4K23H 4BZ1H 4YWGL 3GJFK 2W9DL 4JN2A 4XXDB 2ZUQC 3EO9L 2VISA 2O5XL 3V6OA 1S7VB 5FKPB 4YGVA 3ARSA 5T3XH 1JWUA 2EIZB 3DV4B 1X5XA 5E9DA 5F21B 5DMGC 5FF6A 2EXYD 2D0HA 5KANI 1D5MA 3U6RB 2IANB 5BRZB 3G04A 4WUUD 3U0PA 2EYRB 2J2ZA 2F19L 3FQUA 5I73B 2H32B 3BH9B 4UNUA 4TPRL 3STZA 5IFJB 2H2PD 1HSAA 1NFDA 5IMMA 1M4KA 2ORBL 3MJGX 3QXTA 4ZO8A 1HXMB 1JNHB 5C0CA 4OZHE 4X6DE 1MVFA 4APQB 4ZUUA 2VAJA 3DO3A 5FKAA 3VFVA 5CIPA 3AU1B 2AK4A 3D9AH 1C1EH 5CD3A 2JJUA 3T2NL 4TUKL 3DMMB 3FO1A 2P5ED 1A6TB 3MXWL 2EE2A 4UZGA 5D2NC 5IW6A 4PJ7B 1RUPH 4Q97A 4YAQB 5E2JA 4QKXB 2Z93B 2VAAB 4YHOL 4RBPH 2XY1A 3MLYL 3GJEB 5HYFA 3P0YL 2QJDA 3V7MA 4U2ZA 2VLJE 2DWDA 5TE6L 2APBA 3R0NA 5GZOC 4Y5XC 1OHQA 1QSVA 3KXFB 1N2RA 3W39A 1F11A 4HH9B 1Q9KA 1GCFA 3C9NA 3RFZC 1BGXL 3LKRB 4M7KL 1OTUC 4IHOB 4PJIA 2ED8A 3LKPB 1UCBH 4U0QB 4WUUA 4ZQKA 2FZ3B 4I18A 1ZHKB 5F7DA 2CLZA 3TP4A 2AJ3B 1NUNB 1I9RH 2PO6C 3G5ZB 2HJFA 3QO0A 1LILA 5TDOB 5GS1B 5FGBC 4X5XB 1G7QB 4MXWL 2VLME 4YX2H 3U30C 1QSFB 5ADPH 4BFGA 1E0OB 5FYJU 4KI5C 2P7TA 2R2CA 4TVPE 4JFEE 3H3KA 4R7NB 1MIMH 1RUML 3U7YH 1DLFH 5GGVL 5AEAA 1EH9A 1X9QA 4O2EB 5J11C 5CIPH 3PWNB 2P5EA 4Q6IB 4R4BB 3MGTB 1L6ZA 4DOHE 2A1WH 1E4JA 2C7UB 1N59A 4W68A 4JHBA 1MCIA 4H8WH 4FQHB 1W0VB 1A6PA 4PR5B 4CUCA 2NY3C 1VFAA 1F13A 2XWBB 3CFDB 4JDZA 1X5KA 1ZHNB 1BECA 5EN2B 1K2DB 4OZIE 5E2UH 5HY9A 3BVNA 4O51B 5SWZD 3KPTA 3GBNL 4L3CB 4ODWB 5IEKB 1JK8A 3ARVA 5IEHA 2WLZA 1Q0YL 4E41E 4GFTB 4LOUC 2A73B 3QULB 5DJYB 3RVWD 4DQOL 2WV3A 3RAJL 4MXVF 1JRHL 3RY6C 5JW3H 3RRQA 3FB8B 1T6WA 5E0QA 5IQ7L 3MRPB 4Z77A 4N0CD 2G60H 4ZFOA 4JREC 1MUJA 5DD0L 2QQKH 3TPKA 1I7ZB 2VLKD 4DVBA 2MJWA 2YSSB 5AYQA 4PY8J 5CEZE 3MBXL 3VRIA 1A7PL 2HWZH 2WW8A 3VRLF 5F44A 2OSLB 1R3JB 3VWJD 2Q1EA 3MYJB 1X5AA 3WN5C 1NGXB 1CLCA 4KXZI 1BWMA 2P5WD 2X6MA 3GI9L 4LPXA 5HGAB 3EYQC 4QCIA 4Q0XL 1HYRC 1N6QL 2BSED 3FRPA 3ILQC 3LEYH 3ZKND 2CDEB 3FO2A 4XP4H 1I1AD 3NCFB 5IVXE 4Y4KA 5HDBF 4JRWA 3TO4D 4Z7WF 1CGXA 3D0LA 2IPKA 3I6KA 1Q9LA 2NY4C 1UB6A 2Z92B 4YJZL 5GGSA 5SWZA 1NBZB 1Q1JH 3LN9A 4E0RA 4DUVA 3MRCA 4PJHB 2A77H 1DVFB 3QDJD 4POYA 1WTGT 4U3HA 5DT1L 1GIGH 1AGDA 3BQUD 4ZUSA 3MBEB 5FGSA 5HVHB 1DANT 3CFJB 1X5HA 4DZ8B 3P73B 4W70A 3RP1A 5DLMH 3PWJA 3BEVB 1NQBA 3KLSA 1CZ8L 5T1KD 1Q9WB 1RZKL 5FECA 1ONQA 1TETL 2BMKA 2KQNA 1S7UA 2VLKA 3CDCA 1LEGA 2Z8WC 1SJHA 2E8ZA 1BD2D 3GHEL 1FV1A 2BHYA 5LAXB 1UCTA 5C0AE 4HWZB 2Y5TA 3VWJA 5I75C 3CFBA 4CJ1A 3WHE1 5I2IB 3HG1B 1NCUA 5HHVH 3BP7A 2MQ3A 2X9YA 3QUZB 4JFYB 5CP3H 4LFHD 2ZNWA 4KTEL 5I8EB 1N5YL 2P5WA 1B0WA 2W59A 3C8DA 1A22B 3KNBA 1A6WL 4F7MA 4XVUD 1U0QA 4WU5B 5DA0B 1RPQA 2W9DH 1TNNA 1I1AA 5GRJH 4BZYA 4QHKJ 1SYSB 1QQDA 1V7NL 3B8YA 5EU6D 1CE6A 1T3FB 3TO4A 5ESAB 4YUEH 1DEEA 5IK3B 2UUDK 1T0MB 3ZTNL 5CSBA 1U8JA 1ZGLA 5TE4L 1LO3L 4NN5C 1NL0H 5CMAA 2NNAA 4XPTL 2F19H 1SQ2N 2QQLL 3QDJA 4HQQL 1IL1B 2A6IA 3GSNL 1PKQE 3BQUA 4XPHL 1JWSA 1CWVA 2DQHL 5IGXH 4HK0B 3MRLB 4IJ3C 3KPRD 5T1KA 1EHLL 4NQUA 4MNQD 4BK4A 3QNZA 4EVNB 1JGDB 4P3DB 4J3XA 4YZFE 2DRUA 3GBLA 4MJ6A 1BD2A 1RIVL 3SDYH 2NTSP 1R5VB 1FZKA 1KCVL 4PRPB 4CW1A 5JXAL 3V6ZB 3GNMH 3MXWH 3ARED 3EHBD 3P77A 1WISA 3NIDF 4QXWA 1I1YA 2R23A 1CCZA 4G6FB 4OAWB 5DO2D 3NFPA 5D7LD 4TNWF 4PRIE 2Y06L 1JI1A 4L8BA 4P0DA 4Y4HD 4LGSB 4PJXE 3T1WA 3PHSA 2Z31C 2C26A 2ZKHL 1TQBB 3ROOA 3Q6FB 2N7AA 3VFMB 5FYJE 1NEZB 2YMXL 1EO8L 2HLAB 1CLYH 5HGBA 2DQJL 4KMLB 3O3EA 5DEGA 1EEYA 1HXYB 2V5YA 2QLVB 5EU6A 4OZGF 5J6GB 1NGZB 1A9EB 5EBLA 2HMIC 3B83A 1BGXH 4M7KH 4LIQE 1M6OB 5C9JB 1U8NB 5J1TC 3JZ7A 4Q9QL 2MCPL 5F7FA 4FZEL 5HDQL 2KQMA 4C54A 4ERSL 3M1BA 4BSWA 4NM8L 4PJ8B 4JAMB 4TN9A 3K1KC 3PGCB 1UWEH 1LK2B 3FFDB 2X4TA 1G6RL 2PXYD 3VMOA 1UEYA 4U31A 5TH2B 1G1CA 3KPRA 2WWKO 1FG2B 2FEDD 1OT1A 1A3RH 1IGTB 3BRDA 1CI5A 2RFXA 4MNQA 3WO3B 3TJEL 4OQTH 5H2BA 2EH8H 1QG3A 3JXAA 2Y6SD 3DUUA 4QEGA 4FQ1H 1JPTL 2HT2D 5HHME 4XP1L 3AREA 3OQ3B 2PYFA 4P2QB 1YPZE 2PKDA 2NXYD 2NY2B 2IG2H 2ZJSL 5D7LA 3X12A 1NBVH 4F15B 5KG9A 4Y4HA 4FXGB 2O26U 2N4IA 2WINA 5DJ6B 5D72L 3L3JA 1QLRA 2EDRA 4NQVA 1CGYA 3FQTA 2P4AB 5B39G 1RUAL 5BQ7B 2FBJL 4U1LB 5SV4A 4EDXB 5JR1L 1BBJA 1Q0YH 1SVZA 3U4EA 1WZMA 3GBML 3MNZB 4GRMB 4X9HA 2XFXA 1QOKA 2J4WH 4M62L 4PREB 5DI8B 3C8HA 5KVDL 3ZSSA 4DQOH 3RAJH 2X1XR 3KGRA 2R1YA 1NCAL 3BEWA 5D71L 1JRHH 2BERA 1ZLUH 5DUML 1Y0LA 3LZFL 1IT9L 1KN4L 4KHTL 5DFVC 1CU4L 1VCAA 5BVJB 5FCUL 3Q0HA 4LLUA 4G80B 5DD0H 5CBEB 5BS0E 3TH3T 2X4PB 4ORGA 1YMME 1ZHBA 3RWCA 2PXYA 2I60L 3MBXH 3CLFL 4ZD3H 4HJJH 3CGTA 3NTCL 1T1YA 3C09B 3B3IA 3SGDI 2KPNA 3TZVC 4N90D 4ZOCA 1T66C 4OCRL 2X2YA 3UJIL 4YHIA 5EH1A 5JHDB 4JLRA 4WVRA 4P5KA 3AAZB 3GI9H 5CHNA 4Q0XH 2VQ1B 5KW9H 4YR6A 3L5HA 3RTQB 1UFUA 1MHHA 4L3AA 4HKJB 1F8TL 4NKDA 4H88H 4Y19A 4JRYE 1T03L 3CXHK 1H3PL 4KFZC 1TTUA 3QUMB 4Z95L 4RMQA 3FCTA 1CDGA 1DUZB 3UTZB 1LMKA 1M7IB 4X7TB 3QEUA 4HUKB 1U6AL 2GEEA 5EU7E 1M05B 4LVOB 3GSNA 2OJZH 4MCZB 2AKRB 3G5YA 1EIBA 4IDJL 2N1KA 1FFNB 4NQSB 4XNYL 5DT1H 4Y1AE 3MUY1 4WFGE 5ACMA 1MF2L 4MJIA 2Q76A 1U58B 3U0WH 5I16B 5C0CE 3NCBB 3VW3L 1KC5H 4U1IA 5FUOL 4U6YA 1RZKH 2B1AL 3RQ3A 2AK4E 4IM8A 25C8H 4O2CB 3GHEH 3QG7L 3B9VA 3H9SD 4LPTA 5AWNL 3SKMA 3IFPA 1YECH 4I9WE 4OZHF 4X6DF 4MAYC 1BZ7A 4TULL 4HIEB 1ES0B 1JZ7A 4JKPL 3BWAA 3L9RA 3MREB 1VADA 3BZFA 4UI2A 4HBCH 1KIQB 3C6LC 4HS6A 3K7UA 5HYEA 5A2KH 4P4KB 1ZA6B 5DRNB 3ARGB 4TYUA 4HIJB 3WKML 4QHLB 5KBNC 5ENWB 1O5DT 1S3KL 3SE8H 3WIFA 5EZLA 4UIMA 1KJMB 2SEBB 4C55A 4HAGA 5KSAB 4JM2F 3IGAA 5CJOH 5GRZA 5GZOD 4OJFL 4PJIE 3ZTNH 1R0AL 1EDQA 2R56H 3BP5B 5TE4H 1LO3H 4JFQA 4XPTH 2HVKB 4QNPE 1IGJB 4LLMB 2QQLH 4CJ0A 1G6RA 3GSNH 4HLJA 2VC2H 1CQKA 2R0WL 4HX1B 1F42A 5CBAB 4DGIL 3VXPB 3KPLB 3MZGB 4BKLB 3U2SA 3WFEH 1B0RA 1XGRA 1WTLA 1EHLH 3ZKXB 1PZ5B 1T2QL 5IB3A 3D39D 4JVWA 1JZ5A 3KPMB 2PO6D 3H9SA 2P5EE 1KCVH 1QVOA 5JXAH 4GRWE 5TDPA 4KROC 2Z91B 3RPKA 3QIUD 4GKSA 4LEOA 3MUHL 4KI5D 4XC3H 1T04B 4XVSL 4U2YA 2ZKHH 1G7IA 1MAKA 2DQJH 5D2NA 5IHUH 3GIZL 5IB1B 1W0WB 1MRDL 5E5RB 3T0EC 2ICCA 3S4SB 4I5BA 5TFSL 3FKUS 1RK0A 1FVDB 2AXFB 3TBSB 2QQNL 4MAUL 4AQ1B 4OZIF 1OPGL 5D7JC 1BP3B 5F3HB 4F7TB 4LCWB 4UB0H 3V5DA 4FZEH 5HDQH 3WNNA 5EZJA 3VCLA 2DMBA 3RI5K 4K7PL 1OW0C 2HKFL 5KVGL 3BIBX 4KZDH 1K5NA 4NM8H 1LK3L 1HQ4B 4KQ3L 2H26A 3UX9B 1Q8MA 3FQXA 4J1UA 5F9OL 3U9UB 4FG6D 4JB9L 3NZHH 5E2WL 3KWWA 4FXLA 3GMNB 3UTOA 1PBYA 3CCHB 3RWGA 4G6MH 1C08B 2GUOA 3O3AA 5LCVH 3GI8H 4WHYG 4TTGA 1KYOJ 1JPSL 3D39A 3DV6A 2PO6A 3ILPB 3KAAA 2CUHA 3BW9A 1JPTH 4OIBA 1RD6A 5FGBA 1AI1H 4XP1H 4GW4A 3U46B 1NDMB 2D9CA 3MROA 2BJML 4W6XB 1AJ7L 3QIUA 5B8CC 3LKSA 1PQZB 3ULUC 4U1NA 1YN6B 3RPIA 3MNVA 3QFDA 1NC2D 3QPQD 1YJDC 5D72H 4UT9L 1GGCL 2D7MA 3EYQD 1MPAL 4P4RA 1HHKB 5J3HD 3KJ6L 2D03H 1BIIA 3ILQD 4ONFL 1DP0A 1RUAH 5IVXF 1T1XB 3BIAX 4N0UB 2CKBH 3MRDA 5ERWB 1K3IA 4NRZA 5JPNB 1SJEA 1T21A 3MUZ1 3ES6B 3E8UL 1J88A 3GBMH 4HJGB 5EBGA 1F4WL 4OZGB 1DSFH 5IV2A 3PHOB 1Z9SA 1NDGA 5IUSA 4LGPB 3LN5A 8FABA 4PGEA 1KJ3H 3TBVB 3VDBA 1EFQA 1KTRL 3RBSA 4AT6A 4BJLA 1P4BL 5DUBA 1CU4H 2FO1A 3LB6C 2F5AL 1MCBA 1U3ZA 2F53B 3KYOA 5ITFB 5HDLA 3OR7A 4FQPA 2VXTH 4G9DB 2CGRL 3LAFA 4K2UH 4F58H 2FB4H 4ZTOH 4HKZA 3RY6A 2VKWA 3P40A 3DRTA 4KK5C 2ADFH 1S9XA 1IZJA 3RNQB 2ZSWA 3DRQB 1Q72L 4OCRH 1T2JA 1FFOB 3KYMA 1UH4A 1NEUA 2P5WE 1DQTA 3QI9B 4M7LL 3DUSB 1NLBH 4Z7NE 3BMVA 4P99A 3I02A 3UO1L 1F8TH 4OKVA 1NC2A 4QRPB 4TTDD 2Q7YA 3R4DA 4F7PB 3DO7A 4G8GA 1RJCA 5H35B 4LPWA 2D3VA 3QDJE 3S88L 2HA1A 2AJXL 4IDJH 4PJEB 3SO3C 5GISL 1ETZB 1MHCB 2PTVA 4R2GD 3KDMB 4EI5D 5BJTA 4M8VA 3GEWB 4LGRB 3S96B 2ZZUT 4Y4FC 3MX0A 3TBTA 1L4IA 4XZUB 1G7HA 4DKFL 3V79C 4I13B 3DETC 4OCMC 3P30L 4TRPH 2X4QA 3QG7H 5HGDB 5I18L 4JQIL 4TSBH 5IJVA 4K71B 4Z78B 1NAKH 4TULH 2VZVA 5LQBH 1MFDH 3UEZA 4YZFF 4NC2B 3UPRB 1HYSC 3O11B 2MKWA 2AK1H 3VD3A 2P42B 1LHZA 2IH1B 4LLDB 2VIRB 2M26A 4JJHA 5D9SA 1JHLL 2HTKC 3R1GH 5HHNA 5ITBL 2KL6A 5C0IB 4HWUA 4E5XA 4MA7L 3RWFA 1S3KH 1KB5L 4FQJL 4HIHA 3QNXB 3O6KH 4PJXF 4U05A 3OHXA 2YD2A 2ZWLT 3S36X 3LD8B 2Z31D 1YEJL 2EC9U 4BUGA 1C5CL 1R0AH 4FQIL 2DOCA 4HS8H 3WD5L 3X14A 2HN7B 3IJSA 1MJJA 2EDBA 3IDIB 2LE9A 1J7VR 3GSVB 1XF5B 2HMID 3O3DB 2IPUG 1RZIA 5GSVB 4PJGB 2R0WH 2A9MH 5DGRA 4BZ2H 4EI5A 1NJ9B 2ZUVA 4KUCD 1IAOB 6FABH 4NO3A 5DUPH 1T2QH 1ED3A 4M7JH 4M9OA 4G6KH 4U1HB 3L6FA 5CWSB 3ARBB 4RQQB 5F7KC 2WBJC 5TDNA 4ZO6A 1UM6H 5EO0B 2IAMC 4PIRF 1Y6MR 4OZHB 1EFXB 1I8IA 1NAMH 4P2RB 4X5LA 4PGBA 4JEGB 3TCLA 5LVEA 5IIEB 1AP2B 5F6HJ 4G6JH 3BPOC 3PNWB 3V6BR 4ALAL 2BVTA 3FB6A 4WTXA 4J3TA 2ICWA 3D3VD 1KIUA 5D8JH 3GIZH 3N1PC 3FOLB 3T09A 1VGKA 2DM7A 3CSPA 5IB5B 1MRDH 2XG5A 4F7EB 5IFAL 1QSEB 1SBSL 3WSQH 1NFKA 3ET9F 3RWJA 5E2VH 4PLJC 1NEZG 1T0NB 2Z31A 4H26B 2QQNH 2UYLB 1OPGH 3HI6H 4ODUA 3L3OA 2VLJB 5DA4A 4XX1E 1KLGB 4OFIA 1QO3A 3JV6A 4XI5C 4K7PH 5I1GH 2HKFH 2BOCB 5J7CC 4KDWA 2UVEA 4TUJB 3V6FA 2DIBA 2JJTC 1JPGA 4IMLA 4YHKL 3VD5A 3RUGA 4KQ3H 4O5LL 1S7TA 3E2HB 3HNTL 4GS7B 2R2HB 1MHEA 4JB9H 1AC6A 5ACZA 4ZFFA 1GGTA 3BFOA 1UXSB 4C83A 1OTTC 5EFIB 4S2SA 3SQOL 4UQ3B 5DZOA 4HXAL 1ZWIB 5EU3B 4DGYL 1A7NL 1WZKA 1CGSH 4LKXA 4Z7VA 4Y5YB 3WL9A 4X4XA 4ELKA 2F9BT 3TFKD 4X6CA 3P9LA 1BQUA 5MERA 1P7KB 1CK0L 5DD1L 4GAYB 2OTUA 4GBXD 4LCCB 1RY7B 4JDTL 4P9ML 5FO9B 3D3VA 2NX5B 4XP5L 3VA2C 4M61A 4L1DA 3CIQA 2B5IB 5DHYB 1H3UA 4LVNB 5A2IH 3PL6D 4HZLB 2BY2A 1NCTA 2OTWB 1P4IL 4PJFB 4O4YH 2FLBT 3E8UH 4L4VE 4DKDC 3CLEL 3DX7A 1BFTA 1YNLH 1H3WM 3T65B 4DCQA 4OZIB 5DQJA 3H9HA 4NRYA 1NBYA 3GSRA 4PJBB 1JNLH 3MV9B 4RMRA 3VGDA 4YIQB 5IOPB 2GFBA 4PBXA 3F7RA 3O8XB 1G7LA 5B4MD 4L9LB 2ED9A 3HMWL 2FATL 3OKLA 3FFCD 1ZAGA 3U4AA 4TQEL 12E8L 5F89A 1D5IL 2XA8L 2NLJB 2R0ZH 2XV6B 3RVXC 1U8KA 4YFLF 4KGLA 5DVLA 2HRLA 4ISVA 4YEFA 4NKMA 3CXDL 3OZ9H 1GH7A 1ITBB 1WICA 2W65B 4QHNB 4UQ2A 5IMLA 1KB5A 3BSZH 2Q3AA 4K7FA 5DMJB 1S5IL 2YR3A 2ARJQ 5DTFA 5H94A 4GBXA 2PTTB 4X6EA 5IBTL 1JIBA 3BKMH 3PABB 1T20A 4ZPVA 1AGCA 4EXKA 2OL3B 5ISZE 4CVWA 2DB8A 1KENL 3PL6A 2HJKA 2ATKB 1MCOL 3ULUL 5GIRB 2AJXH 5KSBB 3BIKA 3PHQA 5F88B 5GISH 2E6JA 4LNRA 4PJIF 4PY8I 1YJDL 3OJDB 1U8IB 2CRYA 4LLVA 3UBXI 4Y16D 4F7CB 1NCCL 4QNPF 1T83C 3VU2A 5IB4B 2DMKA 3NFNA 3WFDH 3F6IA 4DKFH 2VXSL 5GRVK 4B5EA 4JDVB 2AJSL 3P30H 4LBEB 2AJVH 4JQXC 1KEGH 3NIFE 1A4JB 1WWCA 3H9SE 5KAQF 3FFCA 4MGXA 2WUBL 4YDKH 4JQIH 3SE9H 4BQCA 3W9DB 4HD9A 3PXJA 4HJ0C 5D1XC 2FECL 3UAJD 1JBJA 4LASL 4RWYH 3ULVL 3NMEA 5LXGL 1FLTX 1U8LB 2MPAH 3D18A 1DTUA 5K9KB 1MNUH 3RNKA 3U83A 2YBRA 4P3WA 3IJYB 5I74B 4GRWF 4PRDA 4ZYKA 1CXLA 1JHLH 5D2NE 3RA7H 3S9DB 2GJZB 4D0BA 2AXJA 1FPTL 4WHCA 4EBQH 1KB5H 3FMGH 4XGZA 1DBKL 3K8MA 2Y07L 3I3EA 1D9KC 3ARDB 4J3WA 3DARA 5DD6A 3CPLB 4U7MA 1YEJH 3GRWL 5F1IB 1HH6A 2XZQL 1YY9C 1C5CH 1KELH 3CVHL 3FN0H 3WD5H 3DSNA 3OXRB 3ZKSD 5DQ9A 3T0ED 3MRNB 3QZWG 1A0QL 5IHZB 1MCFA 1AXSA 4ODXB 3O9WC 5D7JD 4MDJB 5LGJB 1MEXH 2FLRT 1A6UL 3MTRA 4G8EB 4Y16A 2FEEI 1TZGH 1A6VL 4X8JA 3FL7A 2YN5A 1U93A 2XQYG 1VENA 3ABZA 3D39E 4NNPL 3WUZA 2Y36L 1CG9B 4U1GB 3UCRA 4EZMA 2GITA 1PKQB 3MZTA 3GMPB 1CICC 3ZKQD 2IQAB 3HB3C 5FHBL 2RQ8A 5KJRH 5I6XC 2JELL 4A6YH 2H9GA 4D0CB 4QHKI 5HI5C 2BXZA 3O2VL 1XF2B 5DXWA 4XT1C 4LSQL 4X4YB 4LSVL 1FDLL 1XGUA 1KIPB 2EDEA 1HWGB 3ULUD 3MXVH 4IS6A 2AEQH 2OP4H 3KYKH 5IFAH 3TNNB 4AEEA 1SBSH 2J5LB 4FFWC 3MACH 1XIWB 4OLXL 2NW2A 3CSYB 3MRFB 3S6CA 3C5ZC 2D7PA 2AXGB 3DXAD 2FD6L 4HV8A 2KDGA 5I1JH 4M3JA 1UJ3C 3S4SG 4YLQT 4XBPB 2CIKA 3HRPA 3T0EA 4M1GH 5F7YC 3SY0B 4AZ8A 2WIIA 4ODBD 3BRGC 5HI3C 5D7JA 1J0IA 4O5LH 2DL9A 3S5LB 3HNTH 3T0BA 2HVJB 1FN4A 3V0VA 1OQXA 1I1CA 2OQJA 3ULVD 5C6WH 3C8KA 4JRXD 3X3GL 4FQCH 5C0EB 4KK6C 5K9JL 1KIRB 4WW2B 1P1ZA 1MFBH 4DN4L 3VWKB 5C08E 4DGYH 1A7NH 5DRWB 3MCKB 3UTSD 4AMKL 4JHWH 2R1WB 2VITB 5F97E 1HQRA 4OB5H 2XWJA 1OSPH 5E8NB 1JYNA 3G6AA 4IRSB 3H3PH 1JNNH 3MV8E 2IMMA 4JDTH 1IC4L 2NY0C 5E5MA 4CADB 1HHHA 3QG6B 3PWUA 1RVFL 1TZHA 4R97C 4ENEC 4Z7NF 3BHBB 5HHMB 5DQDH 5GRUH 4FP8L 4LNVA 4OLWH 2I5YL 4XMKL 5FDYA 1VB9A 2FX8L 4ZFGL 2X4UA 4KK9C 3PDOA 2ZCLL 4BK5A 1S9WB 4JFZL 3OF6D 4NQDD 3DXAA 3THML 4P48A 4MNHB 1XF4B 4K9EC 1LD9B 3BP4A 4R0LC 4XCFL 2FCBA 4XXCC 3VFNB 1OVZA 5HHQA 4UBDC 3M17B 2YK1L 2NQCA 1AXTL 1FNSL 3UXFA 3U7WH 4I0CC 3ESUF 3PE9A 1FAKT 3NCMA 1CDYA 4UTBL 4WEBL 4JRXA 3C60B 2B4CC 3ZZ1A 4Y4FD 3BYYA 2I27N 2XA8H 2X41A 5GHWL 2XACC 3OKDA 3OKNB 3ZTJH 5C0FA 2ITCB 1TXKA 4S1SH 1YMMB 5DD3L 1GYAA 2IFFL 4PJAE 2VUOA 3UTSA 2IH3B 4OCSL 4KQ4L 5GS0C 4JQVA 3MV11 5ICYB 3GFUA 3GMQB 3EGSA 1JPFB 4PG2A 1DQML 5I1KH 3HUJB 2FWOB 2GHWB 4G5ZL 1Y6NR 3GRWA 1A14H 5IBTH 4NBYB 2X10A 3CVHA 3DJ9A 4UV4L 2P44B 3DROA 5I8OL 2CMRL 5CSZB 2A83A 5DHVA 1WZLA 2YD3A 2FIKA 1FYTD 3EYUL 4JN2B 3X17A 1KENH 2HTLD 5L88H 5C0NC 3I84A 5GRWA 5B39A 3MLXH 2VISB 4WW1A 1XR9A 3ULUH 4YGVB 1A3LL 1JWUB 3OF6A 1INQA 1CFBA 1YJDH 4L8DA 4NQDA 3RDTB 1X7QA 5GGUA 5E9DB 4QWWC 3EKCA 1GSMA 5FIEA 4RGNE 5JHLH 1D5MB 3DGCR 3G6JA 3VXSD 1V7MH 3U0PB 3JV4A 3FO0L 3VXTB 2A6KA 3WXWL 1MCPH 4JO3H 1JZ6A 4N5EC 3O3BA 4CMHB 3TN0C 4LDEB 5I1HL 4G43A 3STZB 5ADOL 5JQHC 1HSAB 5C8JA 4XBGA 1NFDB 1QFHA 5IMMB 4NYLA 1IKNC 2G9HA 1QFUL 2FL5A 1PVHA 3BJLA 2G75B 4Y4FA 3QEGL 3PQYB 5DJDB 1H3GA 4KJPD 5FKAB 5CIPB 1JGEB 4OLVL 5E24E 5JOFA 4IRJC 1MAML 4XCCH 3FO1B 5IW6B 3IXTA 3WFCH 4UOW1 3BPNB 2CH8A 3BD5A 4PJCA 4KMQA 4ETYA 4QO1A 4XCNA 5DJXA 3SDXA 3JWDL 1WBXA 4AG4L 2BY1A 4HKBA 5CFHA 1X5JA 5IFHH 5EZOL 4OCNC 3AXLA 3BAEH 3MA7B 4YHLH 2XZQH 1X44A 4LF3A 4OF0A 4P2OD 3CVHH 1FYTA 1N2RB 3W39B 1F11B 4M7ZC 4CU6A 1GGYA 1Q9KB 5DHVH 4AH2A 4QLRA 2DLFH 4K3JH 1RZJL 1ERNA 1A0QH 3WJLA 4HGWA 4OIIH 3QWQB 5D6DC 4OF7A 3RUGE 3AS1A 1Z3GL 1A6UH 1M71A 4GG8B 2YC1B 2LQRA 5E4EB 4WUUB 3VXSA 4ZQKB 4LLQA 4XI5D 2F15A 2HKHL 1OAZH 3VFGL 4I18B 1K4CB 4YXHH 4UAOB 3VI3E 2DLEA 1P9MA 3DVNB 2CRMA 2Y36H 5T1DL 1W72L 5E8PA 1ZLWH 4Z7VE 2HJFB 3V0WH 3QO0B 2YD7A 2PTUA 5FHBH 3KYNB 3LDBB 4X9BA 3TWCH 5J9PA 4HDIA 1CDCA 2JELH 2VLLB 1ZSDA 1F4AA 5K9OA 1OTTD 2P7TB 2CSPA 3O2VH 3QAZB 4JFPA 1G7JB 4GT7A 5BZWA 4LSQH 1FNGA 3RVUC 3D3VE 3D25A 2A2QT 3MR9B 1FDLH 3DMMD 3VXQA 2FRGP 5E03A 3B4NA 2HT3D 1UT9A 2JCCA 4O02L 2EDWA 1N59B 4LP5A 1QKZL 1IEBB 4KKLD 1Q0XL 2VB5A 4PBWD 3VG0L 4F9LC 1MJ7L 1TDQA 4GRLB 4MX7B 1VFAB 1B3JA 2QADC 3C08H 4P2OA 3BVNB 1MRFL 3KXFD 1MJ8L 1ACYL 2GI7A 2NTFA 5EU5A 5IEHB 4RMSA 2LV4A 1EJOL 5FKPA 5FUCC 4OTXL 3DV4A 1HIML 3MQIA 2B39A 1NLDH 1EV2E 1CE1H 4HKXB 1R3IH 4BUHA 2EYRA 3QHZH 4Z77B 4ZFOB 5K9JH 1MUJB 5T1LD 3NGBB 3BH9A 5IWLC 4DN4H 2W9EH 3E6FB 5IMKB 3VRIB 1R3KA 5CP7B 1FL6B 1KT2A 1HXMA 3MPCA 1HHJA 3EYSL 1QSFD 1AKJB 4XNMA 1TJHL 1BFVH 2YWYA 1KPVA 1O0VA 4Q2ZB 4L8SC 32C2B 1E4XI 4M4PA 1MCCA 1MH5A 3ALWA 1IC4H 1E4WL 3D0VA 2QSVA 3DMMA 1A6TA 2XA3A 4PJ7A 2QSCL 4P23C 3FO2B 4OLUH 1ZOXA 2Z93A 2VAAA 4Y4KB 4K94L 3W2DH 4HT1L 2FX8H 1A1MA 3GSOB 4CVZA 2EYSB 5LJYH 4NZJA 3UZVB 2ZCLH 3I6KB 1UACL 1A1OB 5E7FA 1UB6B 3THMH 5SWZB 4E0RB 2XTJB 3VFOA 5EC1B 5F7MC 5FEBA 2FH6A 1JE6A 4NO2B 1QSZA 1IE5A 2O5YH 2YK1H 1AXTH 4ZUSB 1F6AB 4Y2DC 5C09D 2R2EB 4IHOA 4AY0A 1TCRA 1TMCB 1WIUA 2XQBL 5LGKA 5T1LA 3S36L 5FECB 2BMKB 1ZHKA 1S7UB 5GHWH 2DIAA 2VLKB 5EU4A 3NIFF 3G5ZA 3T4AA 1FV1B 5TDOA 4X5XA 1VERA 2Y5TB 4EN3C 4HJ0D 3CFBB 1QSFA 5D1XD 2X5PA 3BP7B 5DMYA 2NMSA 4MVBC 1A7RL 5MEPB 5BO1L 1HHIB 1PEWA 1IAII 4X7FC 4YC2B 1WT5C 5MHSD 4UV4H 1PD6A 4NN6C 5CUSL 3KNBB 4RMVA 4Q6IA 2F58H 2VNCA 4PGCA 3LMJL 1I1AB 1Q9OB 2C7UA 1I7TB 3QDGE 1QQDB 1CE6B 1S5HA 3TO4B 1NCBL 2XZCL 3UTQB 1W0VA 4PR5A 2HFEB 1A3LH 1D9KD 4YPGB 5T3ZL 4XC1L 2XWBA 1K3ZA 3F7PC 3KG5A 4GG6B 2B8OT 1QR4A 1K2DA 3PF2A 3IAPA 4O51A 1U8JB 5C7XH 4L3CA 1CXKA 2LFGA 2NNAB 5IEKA 2R39A 3WXWH 1W72A 1K4DA 3QDJB 4QYOA 1DVFD 4J3VA 5BW7C 4TNWK 5DFTA 4FQLL 3BQUB 3QUXC 3QULA 1DDHB 4WO4C 5DJYA 3O9WD 5F7EH 4LK4A 3MBED 1C7TA 5C09A 3GJFA 2MFNA 3LS4H 1AR2A 3FB8A 1LO4L 4AEIH 1WVZA 4KWUA 3QRGH 3IF1B 1GHFL 4K9EL 5EO1B 1QTYT 1GOHA 1BFOA 1I7ZA 2BVEA 4NP4L 4HUVA 2DLIA 1NUFA 3RKPA 2VR4A 1BD2B 3RL1B 4JQXA 1CICD 1MAMH 1FZKB 4WHYH 2N56A 1J1OH 3HB3D 1GGUA 2FX7L 3U9PL 4IRZH 4L29A 2OSLA 3P77B 5D1XA 1R3JA 3MLTA 5LKNA 3HG1D 5HI5D 4URTB 4LRNL 4X7DC 2FR4B 4L8BB 4AG4H 5IQ9A 1BIHA 3RY4A 3RGVC 4OSUH 3ROOB 5GJTH 3MO1A 4KKCC 2YD6A 1RK1A 3RZWA 3O3EB 1AXIB 2CDEA 1P2CB 3TV3L 5EU6B 4B0MM 1D9KA 3JV5A 3NN8B 1FLRH 3H6JA 1Z3GH 3G08A 4AIOA 1NBZA 4CGTA 3UC0L 2WBWB 4MA8H 2YEZA 1IZKA 2HKHH 3EJJX 3VFGH 4PJHA 1DVFA 1XCTB 5HI3D 3O9WA 1ROWA 3MBEA 4U1JB 5I1EH 4DZ8A 3KPRB 5EOQL 1BX2B 3QQ4B 3GJFH 2RFXB 3BEVA 3NA9H 1IGIL 4MNQB 1Q9WA 2UV3A 4JPIA 2H6PA 1UB5A 2GAZB 4KZEL 4GAGL 1CR9L 1IC7L 2A6JA 2PR4L 2WWMD 1CICA 5DRXA 5I8KH 5I17A 3BX7C 4PRPD 4HWZA 4OLEA 1XEDA 3ULUE 1X4YA 4ZG1A 5D7LB 3OAZH 4G6FD 5HYQB 4EDWL 2HG5A 4Y4HB 5T3ZD 1U92B 3CU1A 3KHOA 5IW1A 5D6CB 4YHNB 2NY0D 4M8QB 3DXAE 4ENED 4WWKB 1TTFA 3FQTB 2OS7A 3GSWB 4WU5A 4OGYH 3SE4C 2D0GA 1ACYH 1FSKB 2BCKA 1UM5L 5L2KD 1NCNA 3S98A 1KTLB 3O41A 5IK3A 3IDYC 4R3SB 5I0ZA 4PRNB 4JKWA 3B5TA 2R1YB 3BEWB 3ULVE 2BSRB 4I1NB 3QUML 1UJ3A 1GXEA 1Y0LB 3U0TB 4LLUB 4UBDD 4ZO7A 1A5FL 1T89C 1IL1A 3S5LG 3E3QC 4MMZC 4PJ8D 5F6HI 5C07D 5HXMA 5JW4N 1ZHBB 3RWCB 1HNGA 1YEEL 5E2TH 1FORH 4HK0A 3UTSE 3MRLA 4JANA 1N3NB 1I3RA 2APTA 4MJ2A 3LSOB 1T1YB 2QHRL 3B3IB 1AHWC 4EVNA 3QUYC 4YHIB 1TQCC 4PJAF 5D5ME 3H7LA 2BZDA 2G5BA 4PRPA 1IAIM 3V6ZA 4M02A 4HPOL 4FXKA 2NXYB 3EFDH 4LSRL 3AMKA 2EKSA 3W5NA 4NKDB 4Y19B 1OAUH 4PV8A 4KVNL 2IWGA 3AM8A 3GIVA 4MNGA 3VFMA 3ECBA 3HR5B 4J3SA 2HLAA 4NCC2 3FCTB 1YEDB 3BZDA 1T7VA 2ERJC 1HXYA 3G6JE 5C0ND 4WCYL 5DMIH 3GSNB 1A7BA 5J6GA 3OR6A 3G5YB 1AGFA 1DQQB 1LGVA 5K33A 5L2KA 1M6OA 5C9JA 1KTKE 1U8NA 1FIEA 1FAIL 3K8KA 4QWWD 1R24A 5FDWB 5D1ZC 1S8DA 1A47A 1FQ9C 4MJIB 2Q76B 2AS5M 2DTML 4R0LA 4XPGH 2NY7L 2MQ0A 1F3DH 3B9AA 4U6YB 5KS9E 3S36H 4N5ED 1SEBA 3TN0D 3LH2L 4LVHB 4PJ8A 4MYWB 4ZDHB 5C07A 2EEDA 1P5UA 3FZUD 3ZO0A 4P9HC 4MSWA 4PJDA 3IFPB 2QEJA 1D6VL 3WIIL 5LBSH 3HNSL 2VDRH 2DQEL 4PJCE 4YFLI 1L7TL 1NANH 3NAAH 1QNZH 4KJWD 3W81A 3A6CL 3BWAB 3BZFB 1J11A 1A7RH 5JHDD 4R96A 4HS6B 3HZMB 4IRJD 3OTTA 3TEUA 5CUSH 1YQVH 3B43A 5CEYA 3PP3K 3LMJH 4WI2A 3JTTB 3RTQD 5CGTA 5GZNC 1T7XA 2RGSA 5EZLB 4UIMB 1DEDA 2W0FB 2J7LA 1B88A 1EXUA 2L7JA 3OAYK 2X4OA 4XC1H 3ZLQC 4WV1C 4P49A 4L1HA 2Q20A 2IADB 4U1LA 2ZUQB 4JFQB 4EDXA 2XTLA 4WI8A 1CVSC 1OQOA 3RUGF 5GGRY 2O61B 4FQLH 3VDCA 5DI8A 1N7ML 2YZ8A 4RRPA 3PDGA 4GMTL 2GCYB 4JY5H 4GAJH 4H0IA 3MUGB 1HEZA 3U2SB 1AQKL 1FE8H 1XGRB 4K9EH 3MLSL 4G80A 3TN0A 1A02N 4NP4H 2X4PA 4Z7VF 2YD9A 3BP6A 5CJQL 4OD1L 1IKNA 5LGHL 4KRPC 4X6CF 4GSDL 1C16B 3KPNA 3TPUB 3HCVA 3DNKA 4I3SL 2JCCE 4GKSB 1UZ8B 3SCMC 4X6FB 2B4CH 4LRNH 4XTRC 5JHDA 1OWWA 2DBJA 1UWGH 3V8CA 4IRJA 5FM8A 1NGQL 1G7IB 3RVUD 2VQ1A 1S9YB 2CKBB 4P4KD 5D2NB 5F1NB 3KPQB 1QLFB 2C1OB 3ARGD 4NC0B 3RTQA 1A7QL 3CXHJ 5C71A 3BD3A 1TJIH 1OSZB 4HKJA 3TV3H 5GS0H 3IS1X 4OCWL 4BA8A 4KY1H 1RK0B 2YPKB 4QY8A 3A67L 5CZKA 5KSAD 3QUMA 2ZUWA 3ARZA 4NHUB 3UTZA 4Y5XB 1JFQL 3UC0H 5BRZE 4X7TA 3VCLB 5L9DL 3VXOA 1I8KA 2YXMA 1OL0A 2VDKL 1LDPH 2XNAB 1K5NB 1I8LC 5HYJB 2YRZA 1AH1A 3PWVB 1WF5A 4X7SH 3MV7B 4J1UB 4CRPA 3V9FA 5EBWB 3GMRA 4HF5L 3SBWC 2M8XA 3RWGB 1IGIH 2GUOB 3O3AB 1DLHA 2PR4H 2PO6B 4DAGL 4O2CA 4AEHH 4GW4B 2UUDH 2CD0A 4PJ7E 3MROB 3U30B 1KCUH 1VFBB 4HIEA 1ES0A 4TSCH 3HFMH 4PFEA 4G7YL 3RPIB 1T5XB 5E6YA 5DC0A 3MREA 3QUKB 1QRNB 3C5JA 3W11C 4WEMB 1P4LB 1KIQA 1UVQA 5HPOA 4P4KA 1ZA6A 4P4RB 1JGLH 4LLYA 5DRNA 3REWB 3ARGA 2DLTA 3KXFE 4V1DB 3SOBL 4QHLA 5MEOB 4P23D 2Z35B 3BPLC 3MRDB 4F9PC 1SJEB 1T21B 1KJMA 1OAXH 4YK4C 3QZWA 2NY3B 5IV2B 2VDML 5KSAA 4FFYH 4PB9H 8FABB 1EK3A 4XVTL 4LCWD 1I4FA 4AT6B 4JO2H 5DUBB 4LHUD 1IGJA 4LLMA 1A8JH 1I3UA 3D1MC 4OFKA 3T0AA 4JPWL 3KYOB 3OR7B 4ODSH 3BN3B 3L3KA 3J8F7 2J12B 4Y2DD 4MHHI 4UV7L 2XI9A 4HKZB 3UPCA 3VXPA 3GO1L 4XVJH 2X1OA 3DRTB 4PLKC 1QSFE 5JW4M 2ZSWB 1PZ5A 3RZCD 4JREB 1MCLA 2CDFB 3CFCL 4RGOH 2V17L 4D2NA 2GTZB 4RAVA 2Q8BL 5IKCA 4PP1C 5CJXC 2PCPA 2Z91A 4EN3D 4FABL 4JR9H 4X80L 3I02B 3WN5B 2DIJA 5BVPL 4L8SA 1SY6L 1CTNA 4OKVB 1NC2B 1KB9K 1IGFL 3IVKA 4LSSL 1MRCL 3DO7B 4G8GB 3MJ8B 3WEXB 4CDGC 2KZWA 1XH3B 5IB1A 2B2XL 4P23A 2WZPD 4WCYH 4LRIC 3S4SA 3NPSC 4LLWA 3T08A 1OGAD 2NY4B 4ODTH 1FAIH 2CLRB