1NJ9B

Cocaine hydrolytic antibody 15a10
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
215
Chain Sequence
b'EVQLQQSGPELVKPGASVKVSCKASGYSFTDYNMYWVKQNHGESLEWIAYIDPSNGDTFYNQKFQGKATVTLDKSSSTAFMHLNSLTSEDSAVYYCARGGGLFAFWGQGTLVTVSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin variable chain
publication title Crystallographic and biochemical analysis of cocaine-degrading antibody 15A10.
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 215
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nj9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nj9B02
4RZCB 2XKUA 5EA0H 1CE6B 2W59A 3IFOA 5C8JB 1ZHKB 3S3JA 4DVBB 4X7DC 2WINB 3CAFA 3DX6B 1BFVH 1HKLL 3HE6C 2VXQH 4PY7A 4XC1H 1CXEA 1KJMA 3KPRA 2VZUA 5EBMB 2BY0A 1MJJA 1MUJB 5E6IA 3V6OA 3DMMA 3OJDB 2VXUH 4HKZA 4OQTL 4HAFA 3V8OA 2H2PD 3IGAB 5AUMB 1CXFA 1WC7B 4EBQH 2WZPD 12E8H 5BJTA 5HVWA 1DUZA 4PRPA 4S1QL 5EDXA 4PRBB 2OLDA 2BVUA 3LKNB 1FZMB 4TUKH 5FEBA 1PLGH 3P77B 5K9JH 2Y07L 2XACC 4KRLB 1TZHB 2YD2A 3G9VA 5I1LB 1A9BB 5FGBA 1CXKA 2D0HA 5IV2A 1QFPA 3CDCA 2SEBB 1KNOA 3PXJA 1LK2A 1B88A 4X98B 1HNFA 1CQKA 4MWFB 1MJUH 4QXUL 5DHVA 4RISH 4MA8L 4DN3L 3MBEB 3TA3A 3GO1L 3H0TB 2N7BA 4XCNB 1F02I 4RNRB 3WJLA 5K9QG 5FECB 2NY4B 5EBGA 5C92A 1J12A 4ZOEA 3HB3C 4GW4A 4NFCA 4LSQL 3UZQA 4UTBL 3QCVL 3GI9L 5FUOH 3C5ZD 3D0VB 4F58H 3QB7C 4KHTH 3IKCA 5DZLA 2O61B 5I6XC 3PP4H 4C4KT 2R29H 3V8CA 3TN0A 4OF0A 1JWUA 3BYTA 4GRLA 2XIDA 3U36B 4Q6IA 4P5TC 5EZOL 2JELH 3PHOA 4FMFA 5CD3B 3PV6B 4YPGA 2F53A 4FNLL 1MFCH 4FQPA 4ELMA 3S88H 2H9GB 4K94C 5HGAB 2ED7A 4Z77A 4P3CL 2APFA 1KIPB 2W0FA 1GGYA 1C12A 1ZT1B 4XXCC 2Q8AH 2C26A 4ZUTA 1ZEAL 3SKMA 3OGCB 5E2JA 4ERSL 2C3WA 3BDYL 5IEKB 4IBLT 4C56A 3NZHL 2UV3A 1YMHA 1R3LB 4LLYB 3MOBH 4Z7UF 5D7LA 1LO5B 4J3WA 4AEFA 1I1YA 4KPHL 2F54B 3LZFH 1KTKE 1E4XH 2J6EL 5KVFL 3G6DL 4YDVB 3X11A 2AK4E 1EEQA 2XY2A 3O45A 2VSCA 5C0RL 3IKKA 3KPNA 4KHXL 2EE6A 3U30C 1Z3GH 4Z5RB 5E94B 1LP9B 1U8LA 4O2EB 2APVA 5DC4B 3TYFA 4BZ2L 3HI5L 1KIRA 1WV7T 1Z6JT 3H7BB 4E41A 4RAUB 2YHGA 3V7AG 2EIBA 3LIZL 4U6TA 1NGZA 3IJYA 5TGBB 3OBAA 1CDYA 2ADFH 5KSBB 3FQWB 3RIAK 1JNHB 4PGBA 4YBHA 5L8KB 2X4RB 2XWJA 3KLHC 5I1AB 4CUCA 2W9LA 2OL3H 4HK3N 6CGTA 1K2DA 4AIZA 2NNAB 2C7UA 4MAYB 5GZOC 43CAA 1NC4D 4S0SD 2B4CC 4ZUSA 5C9KA 3QI9D 5IMMB 2P8MA 1JZ7A 2MKWA 3R1GH 5GS1C 2Q87A 4XAWL 5T33H 1CGTA 1OARH 1JHLL 3EOAA 1C1EH 3X17A 2Y36H 5EFIB 2PO6B 5KZCB 2HLAA 1J0HA 2ZUUA 4OQTA 2ZG3A 1BD2A 4DKDC 5GS0D 2EYSB 2BMKB 3BIKB 1HDMB 5EU7C 1KUMA 2ZKHH 4MNGB 4D3CL 5JQ6H 2V5SA 5CGMA 1MHEA 4QGYA 1K4DB 3KJ6H 5C0BB 2FO1A 2YS4A 3C2SA 4OLZH 1NCWH 1CLOL 2DWDB 2R2EB 4LCWB 5F71A 4I0PA 2YKLL 1KIUA 1JNNH 3UYPA 5FDWA 1NSNL 1IT9L 1BZ9B 1FYTD 2ZUTA 3ZKND 4URTB 4BFIB 3Q5OA 4Z7VE 4UDUA 5GGTL 1U8NB 1FO0B 4LVNC 2PTUA 1UWGH 3U1SH 1C08B 3BDXA 1HH9A 5TDPB 5FO8B 4OI7A 1I85C 4HJGB 2AV7B 3TNMB 1KLGA 1QNZL 3DROB 4JKPL 1FL5A 3V5DA 5ISZE 4G6AC 5DRWB 4NZJA 5MP6L 3PWVA 3QPXL 4H88L 4KK6C 1J1OL 3P73A 2COQA 4GG8A 3QYCA 4RRPA 4JR9L 2X10A 4IOIB 1GGCH 1OP3H 4R3SA 4K9EL 5DUMH 5I19H 3ARDC 1WIUA 1JYNA 4LCCA 5L9DL 1T1XA 1N64H 3O3EB 3WKMH 1DL7H 1NANI 1TCRA 2EC8A 4JY5H 1DBAH 1GGIH 3MFFB 5HPOA 2FRGP 4QF1B 3VXQA 3L5WB 2X7LB 2YPLD 2CUHA 4A6YA 5I18L 2B1HL 2CIIB 1Q72L 2ENYA 4I9WD 4L3EB 2BJMH 1DVFA 3QUZB 4QHLB 2IG2L 2J4WH 2P44B 1UC6A 5E1HB 1H3UA 4UIKL 1TQBC 2EYRA 2Y25A 4HCRL 1BZQK 4JFEB 4AMKH 1QBLL 3CH1B 2J8HA 4HJJH 2FJGB 3EDFA 3W39A 4C58B 1X5HA 2PXYD 3CFCH 4PLKD 3CFBA 4X9BA 4GG6E 5BO1H 2BOBA 3ZDXF 2XYCA 4YXHH 3FAWA 2AJVL 2P5WE 3QDMD 2A73B 2E6QA 3DV6B 2HH0L 1ORQB 3NVQA 5HXMA 2XQBH 2J6EA 5J0BA 3WS3A 1QLEL 2FR4A 3RKDC 1AGBB 5D93C 5HHMD 4DOHE 5I8CA 2WIIB 4R8WL 3STZB 3VFWA 4DKEL 4HWBL 2VXTL 2CUIA 2W65B 5GIRA 1DQQA 1QFWH 3SDXF 1J18A 2VR5A 2C3VB 3OKNA 2VZOA 2V2TB 4S1DD 3RWFB 4PJ5D 4X6DE 2AEQL 4X6EB 1DDHB 3PGDB 2BNRD 4E5XB 4L4TE 2CO6B 2OQJA 3KXFD 3U2SB 3ILQD 5J13C 3L7EB 5HDOA 2AXGB 5T1DH 3CFEA 4L9LB 4WU5B 1CGUA 1BJMA 3WIHH 3PWJA 3HFMH 5K59E 2NXZB 2IFGA 4H5SA 5E8EA 3G5ZB 4MGXA 2DDQH 3JTTA 3CD4A 5DI8B 4P23A 4AIXA 1RULL 2MWCA 4ODWA 5DJXB 1MHPH 1AHWB 4F7TA 4YUEH 1DQJA 2AI0L 3MRQB 3QEQE 3D69A 1MHCA 1IBGL 3RWDA 2BVQA 4X99A 3WO4C 5ALBL 3OXRB 3IVKA 3QPQC 3SGJC 4YHIB 5TJWK 1F4WH 3GSVB 2VLRD 4QTHA 3GFUA 4KKCD 1LK3H 5IKCB 4QRPE 2BNQE 3MPCA 1EMTL 2W0LA 4NQUA 3KLSA 3H9HA 2GSGA 4NKIH 1BQUA 4JY6A 4H20L 2ZUQC 4Z7NE 5E08H 4OZIB 4NIKB 4G6KH 4JRYE 1CGVA 3T2OA 3KR3H 4ZO7A 1S9VA 2BFVH 5EZLB 4IOFD 2QSCH 3RI5K 4PJDE 4LKCB 3SDDC 4OZFA 2YUWA 1WGOA 1INQB 3QRGH 1RAMA 3B9EA 4K3GA 3HCVA 4JZJC 5FYKU 2H41A 5CBAA 1NGQH 2IGFL 4KKAC 5C0FB 1HHKA 2EDFA 3VFUB 4S0TD 4LLDB 1B4JL 4HX1B 1CK0L 4JN2A 2AK4A 4JHWH 3PF2A 4OSUH 4EDWH 2AQ1A 1QACA 3FO1B 4FXLA 1BOGA 3MA7A 1G6RH 1AIFA 1MREH 4HEME 5D7SH 5LWYH 1VGEL 2CRYA 1EFXA 4NUJA 3QQ9D 1G9MC 2PYFB 2EDNA 1NC2D 1YN6A 2EH8H 3O6LH 4F7EA 1HQRA 1A2YB 4NP4H 4EI6A 1SEBA 5L2JA 3AROA 5CHNA 3T2QA 3UTPE 2MFNA 4OLWH 4NHCL 4O5LL 4NO3A 5DVMA 1Q9OB 4EN3D 2VLJB 1JNLL 2AJYH 4HCRA 3DIFA 5DRNB 4D2NA 4NN5C 3IDXL 3TIEB 5B3JF 3BEWB 1NCCL 4LLVB 3H9SE 3KLAA 3C60B 1XR9A 2GTWB 3AM8C 5F1NB 4OGYL 3GMMA 1S8DB 2H2PC 5L8LB 4G3YH 4BQ9A 4AQOA 3QP3A 2DBLL 2WNGA 2BSSA 3PL6B 5KTEL 1F11A 1IGTA 1NLBL 1HINH 3FN0H 1A6VH 3T04D 5C9JB 3T3PF 3UYRH 5F89A 4NQVA 3RU8L 4N0CD 1KPUA 4WWKA 1NUDA 3UPRB 4Y4HA 1ZVHA 4HWBA 1S7VA 5I16B 4NZUL 4JFFE 1JZ8A 4FS0A 3KPRD 4P3WA 5KS9B 1H3PH 1HSAA 1PSKH 2ZUYA 3RAJL 1S9YB 1NCDL 5BQ7B 3MMEA 2DQDH 2YC1A 5E6ID 3ZMRA 1IAMA 3SHSA 4HWUA 1MWAL 1V3LA 4EUPH 3TJEL 5EIVA 4Z7VA 4PRPD 4IRJB 4Y4KA 2X4UA 4I18A 4CADB 4GXVH 1CN4A 2VL5B 5E8PA 1UYWH 3L7FA 5ISZA 4UDTA 1D6VH 1HSBA 2EYTB 2OL3A 2XTJB 1VACB 1T89C 1U8QB 3C5ZC 4U3XA 2CLRA 4MXWH 1D5ZB 5CIPH 2A74B 2NY7H 2BSTB 3SCMA 1P4LA 2BVTA 2WUCL 4L4JA 5EO9B 1JE6A 1U93A 3QBTB 1P4BL 1BZ7B 2EDRA 3GKZA 4X0KB 4G6JL 1KLUB 3TA3D 5KSUB 4LPWA 4NQCA 1VPOH 3T4AB 1UEYA 3I2CH 5F3HA 1FZJB 3MRIA 1T5XB 3TH3T 5FKAB 5DJZA 3S4SB 3QDJB 4LRNH 3CU1A 4X7TB 1J0ZA 1VFAB 5A2JH 2P5EE 3ARTA 4KRPD 4PB0L 4R96B 1ZT4B 2R0LL 3C2AH 1MCQA 5HYJE 3IXTB 4OD2A 1T1YB 2X44D 3CC5A 4IS6A 4POYA 1BQHB 2EE9A 1MCWM 4FZ8L 1MCJA 2X4PB 3F7QA 3ZZ1A 1TVBA 4GRLD 6FABL 2XKNA 4W6XB 1XH3B 5J57B 3VWJA 4M7LL 2F53D 2AK1L 4N8CL 4KU1A 5JNYB 1AD0A 5FYLD 4GG6A 3QXAA 3JV6A 5DEZA 1WFNA 5KG9A 3B2UD 1MCDA 2P5WA 1IEBB 3GMNB 4UBDD 2DJ4A 1N4XL 1XR8A 2E7LC 1P4IH 1AY1L 4CN6A 1DN2A 3RDTA 5FOBB 1KENH 4UUJA 2CO7B 4R90L 5KSAB 4C56D 5L2KE 2FGWH 2DTMH 3QWQB 4XBGA 3C87A 3FHAA 5D7LD 4JO1L 5DD1H 5AAMA 3RNKB 4UB0H 4C54A 4PGEA 2P8LA 4RAVA 3FFDA 4X6DA 1I9JL 2XWBA 2Y23A 3ULSB 2ILLA 3IJSA 4PJ7E 4G9FB 1OL0A 4H25B 4YHMH 4PJHE 4L4TA 4LNVA 2IALA 3SO5A 4XNXL 3VW3H 4L8CB 1WSST 1G0XA 2EDEA 3QI9C 1F4YH 1KCLA 1UH2A 5FXCH 1KIQB 3DI3B 2Q86B 4DZBA 3INUH 2HA1A 3RJDA 4E41D 1ZOXA 1OSPH 5C0CE 2DQHL 3NCCB 5FFLA 3HHRB 5GS0C 3HRZB 1RZFL 2H3NA 1S7UA 2QV2A 2V5RA 4YAQB 2HJKA 1QR1B 4JAMA 1NUGA 2YRPA 1UJ3C 3CSYA 3BOVA 3QEQA 5MI0B 4WO4D 3E2HC 5I75B 1MCHA 4YHNA 1RZIA 3WN5A 1L9MA 4TTDD 3GSOA 3GSRB 2B1AL 1FPTH 4TRPH 5C71A 1NCAL 4YHYC 4JM4H 5TE7L 4RGOL 3ZKNC 3O0RH 5DJ2A 3WJJC 5KW9L 1CE1H 4QRPA 3C8KB 5TF1L 4FFZH 4GRMB 4JDVA 3V4VL 1C16B 1A4KB 4X4XB 3BKJH 2IBZY 5BRZB 3MYJB 1ZHLB 2X42A 5J1AB 2JJUA 3Q6GH 3I6GA 1Y18B 2CQVA 2WQRA 3HI1A 3V4PL 4IM8A 1AXTH 4R7DB 3SDAD 4LNRB 3MRNA 1JK8A 4JRYA 3P0GB 1CTOA 2YZ1A 1NGPL 5IFHL 1G7LA 3C6LA 5FAAA 3TBSB 3W81A 3UTZB 4PFEA 4LGRB 5EC1B 4PJDA 4I0PD 1D5BA 3GK8L 4PBWD 2C3GA 4GT7A 1OY3B 3MV01 4KI5D 4GS7C 1VDGA 3WIHA 5J3HD 1H9VA 3OWEA 3EDJA 4XNZC 3VFGL 2IH1B 4UQ2A 3MJGX 2VO5A 5E6YA 5EN2A 4MSWA 3IETB 5F9WB 4ENED 1F90H 1SYSB 4GRWE 1N0XL 4XP1H 3G04B 5INCB 4OF3A 3V5KA 1VKXB 4ZFZA 3NABH 1NMAL 3T0BA 2XV6B 3NCMA 3IDNB 1RD6A 4X4ZA 5CP3H 4HT1H 1KB9K 5A1AA 1AR2A 3BKYH 4F9LC 4Z7QE 3D48R 3GSWA 4YGVB 1BBJB 2NY6B 3QIUA 1E4XI 3BN3B 4GH7B 4PBXA 2ZNXA 4XMKH 2PXYC 2FZ3A 2WP3T 5HHPB 3F8UB 4PLKC 4P0DA 4WEBL 1MJ7H 5EOQH 3TT1H 4RGMB 3PG2A 3RPKA 2GK0B 1YC7A 2OS7A 5I2IA 1L7IH 1UM5H 3H9SA 5FHBL 4MQXD 1MCWW 3PWNB 3QWOA 3QHZL 2YSSA 2F5AL 3TF7C 2DD8H 3VE0A 4GMSH 4LDOB 1DVFD 2JB6B 3IJHA 4DGYL 3QO1B 4V1DB 4BH8A 1WUNT 3BP6A 1OSZA 3PGCA 5MERA 3FRPG 4XPAL 4UNUA 3NAAL 4C4KO 1T0NA 4R2GD 4MHHG 4R26H 1RPQA 1FQ9C 1BJ8A 1JVKA 4OAWB 4S1DC 4JFFA 5DLMH 4D0DB 4HUVB 4ZSOB 3PWPE 5JPMA 5L88H 3TCLB 2P24A 2GJZB 1PG7W 2IEPA 4FQ2H 3U4AA 5JXAL 3ILQC 4XX1E 3WEXA 3EYSL 5DTFB 1OB1A 5IK3B 2VWEE 5E2UL 3VFTA 1JYXA 1BFOA 1FYHB 1BBDH 3U0PB 3U7AA 4M5ZL 1QSFE 3F58H 4LEXH 2QR0B 3CPLA 3RRQA 1INDH 2X41A 5LQBL 1MCKA 3U4BH 2DN7A 5CEZE 3KJ4B 2GTZB 2VDNH 1NFDF 3MRFA 2EIZB 1O5DT 1JV5A 4L3AA 2Y06L 4O2CB 4G80A 5C6PB 3HG1E 4WCYL 4ZOCA 2JJWA 1I3RB 3E3QE 4OLYL 4Q74A 4ODSH 3HI6H 4JB9L 2QL1A 1ZTXL 3EAKA 2R9HD 3VI3E 2NY1B 4OLXL 5BMFH 1ZA6B 2H26A 3CSPA 3VXMB 3RWGB 3WHE1 4J6RL 4KKCC 2R1YB 4MAUH 5LXGH 2OBGA 5FO9B 4XT1C 2ZSWA 4AEIH 4DKAA 3TYGL 3BW9B 2A1WL 1IGYA 4PY8I 1KPVA 3BKCH 1HHIA 2GUOA 5I8KL 2P5EA 4HS8L 4L5FH 4P23D 2HN7B 4JFHE 3FMGL 4G6ML 4G8GE 5HYJA 4GW1A 3D87B 3BP7A 3MUHL 2OZ4L 4XNQA 4HIHA 3RY6A 1MCCA 3C09B 4JQIL 2FX9L 1UT9A 3FFCB 2G75A 4CVWA 1RZJC 4IOFC 4N9GB 5FIEA 1LWRA 4OBRA 3FAXA 1BLNB 4X5WA 1X6LA 3L3DA 4NBZB 3N06B 1U6AH 1WTGT 2R2HA 1IKNA 1NJ9B 1IM9A 3UTSE 2I27N 4QT5A 3LV3B 2A77L 2HVKA 2PCPB 4GBXA 4WY7H 1EZVX 4DFHA 1A3RH 1FFNB 2F8OA 5CWSB 4MA7H 5I1JH 1QPPA 1QRKA 4N5ED 3VG9B 2J3SA 2D7QA 1AGEA 5CIPA 2ZUWA 2WUBL 1AXSB 3CZFA 5L2KA 1EPFA 3QQ9C 4WU7B 4K7PH 4FFYH 1U8OB 4QHNA 1HXYB 3MLSL 3UO1L 2EDDA 4HIIA 15C8L 4LL9A 3W0WE 2Q7YA 2R23B 1QO3B 2CLVA 2XT1B 1G7PA 1CXIA 1S9WB 3A6CL 1IL1A 4P9HL 4PJ7A 2V17L 5H35B 4EN3C 1XGRB 2RB8A 2J8UE 4PJHA 1D9KA 25C8L 1MFEH 2WANA 4LP4A 5SWSE 3ZT7A 2AK4D 3MROB 3BFOA 5HGGS 1EH9A 1VADB 5HYSB 4Q9QH 1I9EA 2YA0A 5J11C 1K8IB 2FX7H 4FQIL 4M7LT 5C6TH 2R0ZH 5CEZL 4UV7H 1YMME 4UOJA 4K8RL 4NFBA 5TDOB 2VE6A 3KWWB 4Y5VB 2B39A 4Z18A 5C0CA 1EFXD 4X6BA 5IGXL 3S3PA 1FFOA 1IGIH 4S2SB 1M7XA 1QLFA 3LRGA 4QHMB 5J1TC 1AH1A 4L8DB 4W81A 1E6JL 3ZDYE 3IDMA 3O41A 4YDKL 4WIQA 3QHFH 1MSPA 2VDKH 2FBJL 3BPOB 4N0CC 3EOTH 4BSVB 4HPYH 1A64A 4XCCL 4L1DA 2H45A 5I71B 1A3LH 1GIGH 3G6AB 3MRRA 5IT2H 1MRDH 1RZGB 3H7LA 3SE4C 2B0SH 2HJFB 1LDSA 2E8ZA 2YXFA 1YJDC 2BSRA 4PJBE 2VKWA 5IB2B 1PDKA 5F9OL 4EI5A 5E6IC 3V6OC 2WBKA 4LPXA 3ARPA 4U49A 1D6EA 1RUKL 3CSBA 4P59H 3UROR 5HHOB 4TSBH 1LILA 1KB9J 3MRCA 1QFWM 3GJEB 1MQKH 1CFVH 3UBXG 2WBJA 1FJ1A 3MJ7A 5CJQL 4FRWA 3ZTNH 3I9GH 4GAJH 4WWKD 1YQVH 3UTOA 1KEMH 4Y4HD 1CFSA 2WLZA 4U1NB 1T7YA 1A7QH 2E9BA 4Y16A 4IRSA 4WW2A 4LSUH 3GGWA 1OM3H 4ZFOL 1Q0YL 2DQFA 2FCBA 4LSRH 3S35H 4CMMA 5CINH 5IR1A 2NPLX 3F7VB 3TA3C 4Y4KD 2G5BB 1OVZA 2YWZA 2I24N 3WJLC 3MNZB 4LSVL 4KRPC 2NX5B 4IOSD 4Z7UB 2VDMH 4G8FA 5HDQH 4Y8DC 4Y2OA 2DQGL 1YYLL 1GHFH 1I9IH 4I0CC 3D85B 3DURB 3ET9F 4K7PX 3HR5A 4LU5L 1CFQB 4QNPF 3SCMD 1K3ZA 2OZ4A 1A5FH 2PYEB 4NO2A 1K8DA 4U6XB 1AKJA 4ETQA 4GRLC 3BVNA 4NM4H 1TMCB 4Q6IC 4BKLA 3WFDL 1I7TA 2ARJB 4AL8H 2AJZB 1KB5H 5IQ7L 3GIVB 1GC1H 1EZVY 5DRXB 1ACYH 3WYRA 1EV2E 3MLUL 3MXVH 4IHOA 2KUTA 2ED9A 1DQTA 3B2UC 3OL2A 1OP5H 1DQLH 3GSUA 3IDGB 1CICB 1PEWA 4UBDC 3SKOB 3MBXL 2ZUVA 3WKNA 2R0WL 1BHGA 3JBG7 4ZFFA 2ARWA 5GHWH 1A7PH 3S96A 5LBSL 1F58L 4NC2B 3GIZL 3QXWA 3QQ4A 1JPGA 4XP4H 3HC4L 1U8JA 1UG9A 4CVXA 2Q1EA 3T0EB 4QTIL 5FO7B 1YEIL 2D0GA 3GSNH 3T2NL 3VWJD 3SE9H 5EOTA 3D3VB 3I85A 3DRQA 4GKZA 3PWPA 3SGKA 1UM4H 5I1DB 5GRWA 2R0KH 4HKJA 4D9RE 4DGVL 5TPWL 1A6TB 4M03A 3RIFF 1CZ8L 3ZTJG 5CGYD 3R8BB 4DWHA 3L3GB 3RDTD 1T6VN 2KZ1B 4LVOB 1QSFA 2EEAA 3G5YB 1CCZA 5D1ZA 1Y6NR 5LGKA 4UV4L 4NNXB 3RJQB 1PW3A 5F72S 3MCG1 1NBVH 2DOCA 4DVRH 3CDFA 4M43H 3TT3H 2DLFL 5DHXB 3OR7B 3IF1B 3HG1A 3ZYIA 1X5KA 4WO4C 3UP1A 4M4PA 5C7XH 2QQLH 4TTDC 3PE9A 4ZODA 2Y6SD 2G60H 1SM3H 3RWIB 1H8NA 4GKNA 4PP2A 4HHAA 4ONGH 3QSKB 3MX0A 1G7HB 1KCVH 2RHEA 3E8UL 5LG1A 1C5CL 2BHZA 2V9RA 3M17B 4M7KH 4G8GA 3U0WL 4U33A 3SDAC 2YRZA 5FYJL 2P47B 4X7CC 3MRMA 3IFNL 1DLHA 2HFFB 1LVEA 1H5BB 2Q3ZA 4I0PC 5AD0B 4RMQA 1WITA 4IMLA 4KI5C 1T7VA 3WFHA 5GRJL 5TE4H 1H3GA 1K5NA 5J3HC 5JOEA 4G43A 4QRPD 5BV7L 3T0DA 2BNQD 3HZKA 3UTSA 1XF3B 3MRKA 5IVZB 4OF5A 2VYRE 3I6LE 3F12B 3R4DA 5D96B 3X12A 2ZCLL 3KYMA 4ENEC 5E56A 3ALXA 1NPUA 4JRYD 5IIEB 1NKOA 2ZWLT 3CSGA 5I74B 5JPNA 4OCLC 43C9B 3C6LD 1D5XB 3P4OB 4XHQA 2ZP0T 3I50L 2XZCL 4XRCA 3TH4T 2P7TB 1A7OL 1AO7B 1NH6A 1OW0A 3VRIB 1DQML 4AT6B 8CGTA 3D0LA 1J05B 4BZYA 4U1JB 3W0WA 3WBDA 1NGYB 3EJZD 4LF3A 4F7MB 3QAZC 2V2XB 3MXWL 5DXWA 4MS8D 4NYLA 3O3AB 2GITA 2XZZA 4M1DL 2J8UA 3SE8H 5SWSA 4JFQA 1UQSB 1MRFL 4M48H 1FNGA 2QQNL 4OV5A 3SDXB 2CKBH 1FSKB 4OCSH 1VERA 4WW1A 4MQXC 2EXYD 1B9ZA 1YMMA 1DBML 4IJ3C 1P7HL 3CH8A 1DVFC 1U8KA 4NUGL 5I1KH 3CNKA 5IUSA 1BFTA 1DUYB 1IEAB 2IPUK 2CK2A 3DOSA 2R2BB 5I30L 4R2GC 3RPIA 1S9XA 4JPVL 3UZEA 1X5IA 5CBEB 5I73B 3P0VH 4UQ3B 1X7QA 1HI6B 1W72L 4PJBA 3VXUE 1F6FB 4J4PA 5B38G 3H9SD 5IB4B 4M62H 3TV3L 2OTPA 1HHJB 3RWEB 4FQLH 1OLLA 4NRYA 3VG0L 4RX4A 5B4MD 2OR8A 5HHXH 4L29A 3A6OA 4N0UE 5LGJB 2V9QA 5T3ZH 2ZCKL 2H32B 5TDNA 3K4ZA 1QFOA 4QRSA 1U3ZA 4RMSA 4PBVC 2FLRT 1EEYA 2O93L 4OUUB 4GLRI 3HE6B 4WTZA 3MCLL 5I1GH 4XCEA 1UZ6E 2BHYA 1I3GH 2D03L 3EZ8A 4KUZL 3QEHB 3I6KB 2R9HC 1ZGLB 1FBIH 3VH8A 4G7VL 3SOBL 2X1PA 4CDGC 3IDUA 1N5AB 1I3UA 2HT4D 3OB8A 5EZIL 4HKBB 5IHZA 2R4RL 2ICWA 1TZGL 2V5TA 3FONB 3NIGE 4U6VL 2EH7H 3TO4A 3G5XB 1JPTL 3P4MA 1EVTC 4PP1D 4LSPL 1JF6A 3OX8A 3WL9A 4U0RC 2QQKH 4P23C 5E4IA 4F7PA 5H8DA 4FXKA 4NKDB 3OKEB 4MZ2A 1QD0A 5IVOA 4XMLL 1DE4A 4JM2A 4R0LB 2OR9H 3FB6A 3V9FA 2OI9C 2ZOKA 2PF6A 3OHXA 3MLYH 4FFWD 1OGTA 1U91A 3HA0A 3WFCH 5JZ7D 1KT2A 2GY5A 2NYYD 2VAAB 3NIFF 5DJYB 5E4EC 4MX7A 3MJ6A 4TVPL 1WWAX 2OR7A 4FP8H 3D2UB 5T3ZE 1J0JA 3FT4B 3PP4L 4Z76B 4HJ0D 3P30H 2P5ED 2A38A 2PR4H 5ICZA 4UT6H 1PX3A 3GJFK 5HYJD 1OPGH 1LO0H 2R69L 4N5EC 1SBSL 3C5SA 1LO3L 3I75A 1MELA 4JPKH 2XRAH 5I6XB 5CZVL 3PWUA 3ZL4H 1A1NA 3WD5H 2I9TA 2V7HA 4HULB 4P5KA 2K9UA 3NFPA 1EBPA 3GMOA 2NY0D 4APQA 3BH8B 5JLZA 5TH2A 3ARFA 3GRWH 4XWGL 1IM9D 3LEXB 1MRCL 5D7IF 2ARJQ 2AVGA 3ZT5A 4D0CA 4GBXD 5D9SA 4ZAKD 3CFJB 3MOBL 1CGYA 1FNSH 3RTQB 3T4YB 1RJYB 5BOPA 3P0YH 4FXGA 4O02H 1NGWA 2VOTA 4GOSA 5L2KD 5EBWA 3HS0B 4QRRA 2DLGA 1PBYA 1KB5A 3VDCA 2F54E 2D4FA 3TBTB 2IFFL 2EZ0D 3T77A 3JWDC 3VXRB 1D9KD 5AYUH 4I4WA 3DV4A 8FABA 4IDJL 3HC0A 4AG4L 2A6IB 3ARRA 3V0WH 2DKSA 1YEGL 1JGEB 1A6UH 5LVEA 4LCUB 1LP9E 1VGKA 1MI5B 4ZPTB 4PGCA 3KPQA 3LEVL 5C0CD 4YHPB 5DK3A 3ECBB 3UJTH 4ELMF 3GZKA 4DTGH 3NTCH 4XPHH 5ANMA 5HY9A 5KSBE 1WBYB 4TN9A 1I8KA 3JWOH 4WWKC 1MCRA 1S5HB 4QOKB 4Y4HC 5JMOC 3D18B 3WHXB 2Y36L 3GKWH 4NNYB 1BWMA 3QUMB 2JLLA 1ACZA 2OJEA 2WP3O 1KXQE 3IYLW 4HWEL 4EI5D 1QZ1A 1QQDA 3AAZB 4XP6H 4K3JH 1IAIH 3ZKXB 4ZO8A 5EC2B 3BT2H 2XA8L 4R7NB 5GSRB 5T1MA 2PUQT 1CDHA 4JFXA 1BQLL 3EUUA 4Y4KC 1P84K 4PRDB 4ZDHB 4I18C 4W4NA 4RAHA 1EAPA 3B6SA 5GISL 2R8SL 1DFBL 4NSKB 2WBJD 4MVBD 1FGVH 1WISA 3EO9L 4FZEH 4KWUA 5JHDB 1CD1B 2OTWB 2Q8BL 4HIXL 4MA1B 1U58B 4BQCA 2I07A 4Y16D 3OKLA 4IRSD 5C0BE 3FO0H 1N6VA 3QJHA 3SCMC 5C3TA 5F88B 3OKMA 4ALAL 4NQEB 5HYQA 1G7QB 5H2BB 1FFPB 3L3JB 3ORJA 3IDIB 3FOLB 1OGAB 1V05A 2BOCB 3RGVA 3REWB 5E2TL 5EO0B 4V2BA 5HGDA 2C3HA 2V5YA 2W9EL 4MMXC 5HDBF 5D1QB 4JG1L 3MLRL 2ATPB 4I3GA 5KANI 4S1SL 4FQQA 5DVLA 4KTDH 2NZIA 3SQBA 3GMRB 4CVUA 4RA3A 1LDPL 4K2UH 2APWA 2GKIA 1AKJD 1S3KL 3MLVL 5T1LA 2DQTL 2R56H 3KDMA 1A7RH 4MJ5A 3EYVA 3PNWB 3HMWL 3VWJC 3O4LB 4Z0XB 2LABA 2DM3A 1U42A 3QWRD 5CFHA 1GYAA 3N9GH 4OT1L 1OAYH 3VXUA 3LN4A 3VMNA 3A6BL 4R4BA 4YX2L 1CG9B 5HPMA 4TSAH 1M7IA 2BRRH 2HTKD 5KN5B 1BF2A 4XPTH 2RCSL 4Q9RH 1XFPA 1LD9B 4K7FA 5CGYC 4NWUL 3ARBD 3RDTC 4L3EE 1RIVL 4N0UA 5C8JA 3UYOD 2JJTA 3OJVC 3ARQA 1ZHKA 3B8YA 4WFGE 3MV8B 4ONFH 4DVBA 1TQBB 4LQFL 4AENB 5C08D 3DX6A 4JFEE 4HV8B 2ZUSA 4LCIL 2D7TL 4N1HB 5EBMA 3PWPD 3V6ZB 3C6SA 1OAQL 1MUJA 2Y6SC 3MV9B 4LPYA 3M8OL 3WO3B 1N6QL 5AUMA 3MYZA 1WC7A 1B0WA 5D93B 1P9MA 4Y88A 1QSFD 5D1ZD 4PRBA 3LKNA 3E0GA 1FZMA 2OM5A 1YPZE 3P77A 4WENB 1FG2A 1TZHA 3MACH 2UWEF 4U6YB 3BKMH 5T1DL 1MCLA 1U36A 5I1LA 1A9BA 5GZND 3B8SA 2ZG2A 3HG1D 2SEBA 3IAQA 5I0ZA 5J4MA 4X98A 3O6KH 3E1F1 2HWZL 3WN5C 3MUZ1 4QKXB 5GJTL 4G42B 3SJVD 5J13B 3QIWB 4MWFA 1JGVH 1P5UA 4DW2L 2F8VA 4HPOL 3MBEA 5SWQB 2BY2A 1MEXH 3H0TA 4F37F 1TLKA 4GAFB 4XCNA 5GSVB 1O0VA 2FEEI 4RNRA 2ZJSL 5FECA 2YK1H 4CW1B 2V2WB 1XF5B 4YWGL 5F8RC 1GAFL 5CMAB 3F5WB 4JFPA 1LK3L 1NAMB 4M7JH 1HCFX 4CNIB 5I8OL 1RFDH 4KQ4L 5IMKB 3C6LC 3WO4B 1WK0A 4YZFF 1EO5A 4BK5A 2VR4A 3LQZB 3QG7H 2VXVL 4JQXA 1MCOL 3GBNL 5IWLA 3ALPA 1Z0MA 1FDLH 2EDBA 3EJZC 4Q0XH 4XCYB 2N4IA 4XTRD 3UZVB 3PV6A 4Q9BA 1UB5B 3FZUD 4MS8C 4MDIB 3S5LG 4N0FB 3U0TB 2H9GA 5HGAA 4UT9L 2ZUQB 4XPBL 1KIPA 1ZT1A 4ZTPH 2X1XR 4OZIE 4HS6B 2EXYC 1JGDB 1YZZA 2CDGA 4ZXBB 3U7WH 3G08B 2XKSA 2GJ6B 3QNYB 3SDDB 5C2BH 4JHWL 2DQEL 5DT1H 2NW2A 4Z8FH 4MJ2A 1LO5A 3QCTH 3W0WD 2DKMA 2F54A 5CGTA 3IS0X 1P84J 5IFJB 1QPXA 3MRBA 4A2MA 1KV3A 3MRHB 1EEUA 3GMLA 3HNVH 5SWSD 1XGQB 4YDVA 5EUOE 4LFHD 2GIYA 1NFDB 1AJ7H 2DLEA 4DEPC 1G7IB 1CR9H 1YMMD 4Z5RA 3O6ML 4OLWL 3KPOB 1LP9A 1J87A 5IJVB 5B4MC 3G5VB 4RAUA 3WNLA 1H15B 4K71C 1FRGH 3ULVL 1YNTB 4OLUH 4XVSL 4X9IA 3B2VH 5KSVB 5KSBA 3FQWA 1CLYL 2CRIA 4Z95H 4Z7WB 5HHQB 4PJIF 1JNHA 1ONQB 3GRWA 5IEHB 1TTGA 2X4RA 5I1AA 2X70B 3SY0B 4WHTB 1A6WH 3FO9B 2OMNA 1NCNA 5DD5L 1WQVT 3QQ3B 4GQPH 3H42H 2VLJE 3IDJB 4MCZB 4OD1H 1T7WA 1JHTB 3WFEL 1OTUD 4ZNCD 4MAYA 2DL9A 4KDTC 1VFUA 1MH5B 3JXAA 1CFNA 2HT4C 5IMMA 3TP4A 3RZCB 3T8XB 1CL7H 4RX4D 3KPSE 4HGKC 2APXA 2O5YH 3FKUS 4PP1C 5EFIA 2PO6A 1NCTA 4P2QB 4G5ZH 1I4FB 4DN4H 5GGRB 5I1HH 2EYSA 2BMKA 3BIKA 5GRVK 1HDMA 4LGSB 4GO6B 3REVB 5AYQA 2JB5H 3AMLA 3S34H 1K4DA 3PDOB 5C0BA 5KS9E 1D5MB 4YHKH 2RQ8A 2DWDA 4OZGE 3L5IA 2R2EA 4FFWC 3UBXB 5DJ6B 5JZ7C 2FD6L 2BVOB 2NYYC 5AZEL 2L7UA 4GSDL 1D6VL 3RQ3A 3O81A 3V2AR 3TO4D 3MLZL 4BFIA 1QHPA 1GVIA 2ZCHH 1U8NA 1FO0A 1C08A 4HJ0C 3PJSB 1RUAH 2FDBP 1L6ZA 2CK0L 4HBQA 5TDPA 5FO8A 2GAZA 4HJGA 4QRTB 2AV7A 4JM2D 2K7QA 3TNMA 1JGLH 3ZYOA 5IOPB 2ICCA 3DROA 1VPOL 1N3NB 5CLTA 1FAKT 2XTJE 3C5ZB 4Y7MA 4OGXL 4POZD 3LHPH 1HYRC 3Q3GB 3IFLH 2Q7NA 3WV0A 3GJFH 4F57H 4JPIB 4IOIA 3QUXA 2NY0C 3VFVA 4WUKH 1IKNC 2IPKB 1HOCB 4PLNC 3HPLB 3EFDL 5A2KH 3O3EA 4Y4FB 2MKLC 4G9DB 3MFFA 2HT3D 4GBXC 1R24A 4LQ1A 4QF1A 4ZAKC 3L5WA 3P9MB 2X7LA 2ESVB 1HQ4B 1BAFH 2P4AB 4MA3B 5EIIB 3GNMH 2FLBT 2CIIA 4LSSL 5GGVL 4P2RB 1RJZB 2EDXA 4L3EA 1INEH 1YNKL 3BXNA 4AEHH 3QUZA 4QHLA 4HUNB 1MFAH 4M6NH 2FB4H 4WHDA 5DF0A 5FKPB 4FQJH 4JFEA 3C08L 1G9MH 4RQQB 3CH1A 2AXJA 5D1XB 1ZA3B 3IAGC 1W0YT 3ARFD 2EZ0C 2QEJA 4I2XB 3ZKQD 5IBTH 3RVUD 1G9NH 1D9KC 4D9RD 3RKPA 4R4FL 4YXKL 1OD7A 3DVGB 1U8HB 4OCYH 1Q94B 5KVDL 1A22B 3CK0H 2A73A 3DV6A 5GGQL 3HR6A 5HHVH 1UVQB 2L0DA 1YEHL 3BGFC 1AGBA 3OAUL 1V7NL 2IJ0C 2WIIA 5JIIA 2VISB 3BSZL 3STZA 1YPZA 4C57C 2XI9A 2W65A 5KVEH 3LQAL 1A3QA 1ZT7B 5JDJA 4ORGB 1RVFL 3U4EB 4JJ5B 2K7PA 2OP4L 2C3VA 2V2TA 5AG8A 3RWFA 2X1QA 4LLMB 1TJGH 1OCWL 2NLJB 1JPSL 1DDHA 5BOZG 3PGDA 3LS4L 5C0AE 4G9FE 4KZDL 1HYSD 3VFOA 4HK3J 1NC4B 4EI5C 3U2SA 5E1AB 3QI9B 3L7EA 1ZLWK 1DANU 4XH2B 2XOTA 2AXGA 2BCKB 1J0IA 4L9LA 3U9PL 3H3KA 4KJYB 4WU5A 3TESA 2ZPKL 4I77L 2BX5A 2HRLA 3TO2B 4XBPB 1WT5A 5DC0A 3G5ZA 4PV8B 5DD3L 1QKZH 5DI8A 4Z0BH 1U8PB 1F45A 2WBJC 2CLZB 5ICYB 4MVBC 4OCRL 5DJXA 2BSED 1UJ3B 4YIQA 2F9BT 5SWZE 3WNKA 3MRQA 5DA0B 3E2HB 4W4OA 4NHUB 4Y16C 4IRSC 5TQ0H 3BKJL 2W0KA 4WW2C 2H6PB 3L3HB 1FIGH 3OXRA 1CBVH 4YHYB 4YHIA 1J8KA 1JBJA 2O5ZH 2R39A 3GSVA 3ZKMD 4HUUB 3BPCB 1IRAY 1FYTB 3OKOA 3O3BB 3BMVA 1SVZA 2HMID 1V7ML 5IKCA 2MQCA 1TETL 3B83A 5BRZE 3I6LD 4M7ZC 4NZRH 5LCVL 4NT6A 2Z31B 3OTTA 4F15C 4RMTA 5C0GB 4OZIA 1KCUH 4JDZB 2XXMB 2AKRB 4KQ3L 4GXUM 3HRPA 2JIXD 1QHOA 2YPKB 5CLWA 2ZOLB 2Z93A 4G6FB 4AY0A 1CGXA 1F90L 1INQA 4OIIL 4GS7B 1Y6MR 2HKFH 1JGUH 4H8WL 3VFUA 3RGVD 5E03A 3WCYA 4LLDA 3FQNB 4HX1A 4LARH 5DJDB 5EUOA 5HI5D 3X13A 2YPLB 1AE6H 5ICXB 1RZKH 2HTKC 5DS8B 3L1OH 4OCNC 5DQ9B 4L8BB 1JNJA 3FO1A 3V79C 3ARBC 5FB8B 3O8XB 3D9AH 4JG0H 5I8EB 2PYFA 5T1LD 3F6LA 1RZ8B 4D0BA 2O5XL 3H3PL 1A2YA 2A9NL 1B6DA 1BM3L 5C0JB 1MIEL 4LLUB 3L9RA 3MJ9L 3ARGD 4O4YL 2A6JB 3HC3L 2OJZH 1Q9OA 2VLJA 3NA9H 2EDOA 3VXUD 5DRNA 3TIEA 4ONHB 4UILH 5EORH 3BEWA 1YEJL 3QDMB 4ZO9A 4LLVA 4MXVE 3FRUB 3OXSB 5F1NA 3KNBB 1S8DA 2VWEC 3SKUD 3KPSA 4U1GC 5HHMB 4U0QB 2F74B 1IGMH 5CILL 5D2LF 4DAGH 1YQ2A 2R4SL 5D7JD 5D1ZC 3PL6A 4V1DE 1BWWA 1I3VA 1DP0A 5B38B 1L0QA 5TF0A 4NQSA 1DBBH 4TOYL 3UDWC 5I15H 5TQ2L 1D5IH 5DUBB 5GZNC 3UPRA 5I16A 3K4AA 3E3QC 1XIWB 2YD1A 5HYIA 3CXDH 1R5WB 5KS9A 1CD8A 2BNRB 1ZS8B 2VIRA 4ZSOE 3MODH 2NXYD 1MNUL 1S9YA 3KXFB 1IAII 4ODBD 2ADIA 4MD4B 3V52H 1YY8A 3ZE1F 3WUWG 4H1LH 3WXWH 5K93A 4IRJA 3D1MC 3RA7H 1JUFB 1JHKH 4X9FA 3RWHB 2LTQC 4KVCL 3CLFH 4CADA 2UZYB 2VL5A 4HQQL 1YEDB 1WZ1L 1T2QL 5EU6B 2XZAH 4YO0B 5LXGL 4KMTH 3RGHA 5I9QC 4XVJL 1TIUA 1YEKL 1VACA 3EHBD 5SV4A 1CIUA 1U8QA 2MTPA 1E6OH 5JO5B 1BX2B 2I26N 1NAKL 1D5ZA 1KEGL 3LKPB 3BIBX 2A74A 2BSTA 5GGUB 4NJAH 2VZ1A 3I3BA 4LMQE 5JW4M 1IAIM 5EO9A 1T1WB 2D31B 2VLRB 3VXME 3ULUE 2ICES 1BZ7A 4X0KA 4OFVA 1KLUA 1FZJA 1R3JB 5T3ZD 4XTRC 3MLPA 3OQ3B 1T5XA 1FNFA 1ZXQA 3HUJB 3HZYB 4X9HA 1KN2H 3FZUC 3S4SA 4X7TA 5C0IB 2IQ9H 1VFAA 3VXNB 1WZLA 4JFYB 4R96A 1ZT4A 1LEIB 2KPNA 1IC7L 1M6OB 4BFBD 3R0MA 4QYOB 3IXTA 1T1YA 5FM5O 2E27H 1BQHA 5AEAA 3NIDF 2DB8A 2UVFA 3FFCE 4OUOA 4MQ7B 4X80H 3VGDA 2X4PA 1A9EB 3KYNB 3OAYK 3MO1B 4FTVE 1OW0C 4ZS7H 3SO3B 2BNUB 5DUPL 3ZDZF 4I0KA 3UCRA 1XH3A 4JN1H 3LPFA 5I1JL 2QQQA 3NCYS 4LSTL 1XEDA 3NFNB 4YDIH 3F6IA 1XF4B 5JNYA 1A7NL 3E6HB 3TIDB 2BVPB 1EUTA 3K2UH 4WNQB 2E8YA 1WICA 1IEBA 4H26B 1U0QA 3GMNA 1DLFL 4UINL 5JIKA 4KC3B 2X89A 1S78D 2PW2B 2A6DB 1ZV5A 2Y5EA 1MOEA 1G9EA 1F4XH 1F13A 5SX4H 5KSAA 2C5DC 3MRLB 1RZ7L 3WXVH 2XXCB 3OB0K 2WK2A 3G6JE 4UV7L 3BPNC 1YUHB 5L6YL 3AY4A 3R0NA 4O58L 3EOBB 5C0AA 4G9FA 1DTUA 4H25A 1OTUC 1F3RB 4N0YL 3ARZA 5J11B 3MJ9A 4JHAH 1MJ8L 3HTLX 5DK0B 1GXEA 5JW4N 4ZYKA 1X44A 3EOTL 4UZGA 5E8NB 2YD4A 2ITDB 4HPYL 2Q86A 4MMZC 1CDBA 3DI2B 1PVHA 4ODTH 4OB5H 4XBEH 3NPSC 1JWSB 3WFBL 4Z6AT 3O9WA 2AJSL 4TQEL 4XWOD 3EYUL 5D4QA 1QR1A 5E2VH 2LQRA 5SWZA 1QFUH 4FQHB 5IBLD 1WWBX 2HJLB 4NN6B 4V2CB 4BFEA 1C5DB 3V7AE 1MJJB 4RA0C 4HBCL 1NCUA 1KFAL 4NQDE 4OTXH 4MAYD 5C0EB 4H0IA 4X4YA 3GSRA 5DEFB 2F5BL 1JPST 4PRIE 4AZ8A 4PRPB 3TO4C 3C8KA 4GRMA 4I3RH 4Y89A 5HHOE 1C16A 2PO6D 1A4KA 4X4XA 3UC0L 5BRZA 3BD3A 1ZHLA 3MYJA 3D25A 5J1AA 4KMLB 3ZYJA 4QRQB 1Y18A 5CINL 2HRPL 4WFFE 1HEZB 4JM2C 5DMKB 4PJFF 1EJOL 4R7DA 3WSQH 3W9EB 4J3TA 5D7IB 3TBSA 4OJFL 3UTZA 5EC1A 4YXLH 4POZC 4UNTA 3WIIL 5GJSH 3JSSA 1T21A 3NFSL 2FEEL 1OAUH 5CSZB 4X7FC 1M1SA 3LS5H 4LAQH 1BGXL 1IC5L 5JW3H 4JKKA 4RWYL 3T3MF 2FWOB 1CD9B 4M1GH 4X5XA 3VGAB 1GSMA 4N1CA 5DFVD 4PJGF 1A1OB 4O9HH 1TITA 2IH1A 2VLME 4LIQH 2HT3C 4KRPB 5DA4A 4KJPD 4B7IA 3IETA 4Z7UE 1SYSA 3N1MC 3SKNB 4JO3L 5INCA 1VKXA 4EUPG 3EYFB 4NRZA 3WDHA 1NDGB 1WFOA 4PV9B 3IKCB 4HC1L 2H1PL 3IDNA 4Z78B 5ILTL 3SDYH 4ODVH 4GRLB 4M6OL 4YGVA 1NBZB 3QUXD 5BCAA 3PHOB 1EHNA 3ARFC 5HHPA 2F53B 4ELMB 4ZFOB 3RIAF 3RVUC 4BA8A 3OMZA 4KH2A 2W0FB 4WHCA 2GK0A 4QRUB 3CZJA 3LVEA 1A6AB 3HNTL 4FOMA 5E7BA 1K4CB 1W0WB 2X4SB 1QR4A 3QUYB 3CVHH 5JW4R 5ESQB 4L3ED 4JLRA 2I5YL 3RX5A 3BGAA 3QUZD 4M1CD 1RUPH 4V1DA 1YMHB 4WFGD 4N0RA 5IW6A 5DWUH 5EWIH 1TDQA 4EEEA 5D7LB 1AI1H 4DZ8B 5ADOL 1GC1C 1M7DB 4XZUB 3VGEA 4OAWA 2PTTB 4OZ4B 4WEUD 2CDFB 4D0DA 1GOHA 5DMIH 4ZSOA 4NM8L 4NKOA 3ZE2F 4FQCL 1HYSC 2GJZA 1CL7I 2OMBA 5F96L 3UJIH 5DTFA 1I8LA 5IK3A 1U8LB 3DBXB 3U0PA 2GHWB 2QR0A 5C7XL 4JFDD 3AXLA 1I7UB 3QEUB 1E28B 1ZLWH 4E0RB 2GTZA 2M2DA 3DO3A 1DJSA 2EIZA 3LDBC 4WI3A 2XWJB 4Q97A 4PB9H 4O2CA 4JO4L 4WO4B 2XZQH 1I3RA 3PGFL 5ADPL 1KJ2H 1ZA6A 4PJCF 4YC2C 5KOMC 3VXMA 3RWGA 1E27A 3ZKMC 1UWEH 3QIBD 3FT3B 4CJ1A 4KV5E 2VDQH 5AWNH 5GRUH 1ZK9A 2BK8A 5FO9A 4WI2A 2HMIC 3NZ8A 2CH8A 5DHVH 4NC0B 3LKQA 5EU3B 2HN7A 1X5YA 4OZHF 3IDYC 1S7WB 4DUXA 3SDAB 2DJSA 4DJMA 2RGSA 5BZDB 3GMPB 1PZUB 4JREC 2A9MH 3FFCA 3QXVA 5DO2D 2Q76B 4RMWA 2LAGB 4N9GA 4Q7DA 2AS5M 4YHZH 4HH9B 1YNLL 3EJJX 4FTVA 1BLNA 2AJUH 1MIMH 1TJIL 2OCFD 3Q1SL 1TENA 4GAGL 4P46D 3U7YH 4LVHC 4FA8A 5CJOH 3N1GC 2P48B 1MCNA 4F33A 1NJ9A 1ES0A 4BZ1L 3RGVC 1ZANH 2VLKD 3L5XL 2VC2H 3LV3A 5HI5C 5IB5A 2E5EA 1E4WL 2NY5H 5C70A 4PTTB 1LE9B 2MOVA 3BUTA 3PWVB 1KC5L 5C0DB 2DTSA 3VFSA 4HUWB 3S5LB 5FHAL 2UZIL 1N7ML 4KI1A 1AXSA 2NTFA 3QFDB 2J8OA 3ZDXE 1NEZG 1AO7E 4WU7A 2H32H 1U8OA 5IFAL 4R3SB 1HXYA 5CJXA 4HC1A 5MENB 2DLIA 2WV3A 5FV2A 5FGCB 4XP5H 5ECJE 3QISA 3RL2A 3TBWB 1T1XB 3ARGC 2R23A 5BXFA 1QO3A 4A2LA 2P8PB 5IESL 4XPGL 5H35A 4P9MH 2X4OA 3VXQB 3CCHB 1E4JA 3MROA 1VADA 2UWEB 1FV1B 4A6YB 3X3FL 1K8IA 1TJHH 1LNUB 3MV11 5BV7B 5T3XE 4Z7OF 3VCLA 4FHBD 2IBBA 1OP3K 4UT7H 4O00A 5TDOA 3KWWA 4N90E 4Y5VA 1HZHL 4PS4H 5D7JC 3SPVB 5HYEA 5FK9B 2JJTC 4ZTOH 3PIQB 4S2SA 5IG7B 1FC1A 4QHMA 3CJJA 4L8DA 5ESVB 4XX1G 3BEVB 1RMFL 4R2GB 5AZ2H 4CKVX 3P2TA 4PJEF 5B8CB 3W39B 3L95B 2DIAA 4BSVA 3TCXA 3G6AA 2VLJD 5L7XL 1FAIL 2DMKA 1QRNB 1C5BL 1RZGA 2J2ZA 2BOBB 4NQDA 2HJFA 2NXYC 5IB2A 2G2RB 4X7SL 3KS0J 5LAXA 5F7UA 2FR4B 2J5LB 4F7CB 1VESA 1HKLH 3KPSD 4PRIA 1XCTB 1P9MC 1NEUA 3MJ8B 1B0GB 5HHOA 3PL6D 1J8HE 1U8MB 2VDRL 4N1EA 4OQTH 1DEEB 4GUPB 4I5BB 5D7KE 4N5UA 2R1XB 3EHBC 4S1QH 4U1NA 1MLBA 3AFLA 1FHGA 5M94B 4OGAD 3ZYZA 3JV5A 4MB5A 3C8HA 3EO1B 2Y07H 1T04A 2IAMA 3F7VA 4S10A 3PWJB 3GDBA 3RI5F 3KYKL 2G5BA 5L0QC 3LSOB 4OBSA 2NMSA 1XGYL 3MNZA 4IRZL 4YFLI 5JR1L 4U0RB 4WI7A 1OQXA 3BESR 4Z7UA 1OT1A 4QXUH 3AS1A 4MA8H 4DN3H 5B3NA 5IMLB 1T22A 1F6AA 3BO8A 1KJ3L 1DQJB 2OI9B 2XTJD 3GO1H 2KBGA 3D85A 4X7EC 4P2OD 3DURA 3PV7A 4U1IB 1SY6L 1MHCB 1ETZA 3P30L 2BDNL 3ETBF 3NCJL 3EYOB 1CFQA 4WEMB 5FM8A 3ISWA 3WFZA 1FORL 3B9KB 4U6XA 2DM4A 4PYGA 3NN8B 2QTEA 4LSQH 4X6CF 2ARJA 4G7YL 4UTBH 5IWLC 3QCVH 1EVUA 2DQIH 2AJZA 1FNLA 3EKCA 3GI9H 1RIHL 5DRXA 4JZNA 1G0YR 4NO0A 5T3XL 1ZAGA 5CD5D 3OAYH 1J7VR 5HGHB 3QXDB 4HMCA 3IDGA 5ERWB 1Z5LB 4PJIB 4OCWH 3SKOA 5EZOH 4Y1AE 1S78C 3M07A 2RFXB 1REIA 3A67H 4TVSa 4FNLH 1ZLUK 5J89A 1FLRL 1OQOA 5B3JE 4LFHG 2CUMA 4Y0GA 1C8PA 4P3CH 3T65B 5I1CL 2GSIB 2WLYA 3T0EA 3QDAA 1XGTA 5FO7A 1ZEAH 4BQ6A 1H3VA 4ZFGL 4KXZH 4WV1C 4ERSH 1OD9A 3BDYH 1RSFA 4YBQD 5F9AC 2WWKT 3NZHH 5I1DA 4LMQI 2AK4B 2DQUL 4RFEA 2IADB 3T3PE 3VJ6B 4ODUB 4Q6YA 2X89D 3U48A 1BOGB 1AP2B 3O4OB 4KPHH 5HJ3B 1NFIB 3RHWK 3L3GA 1KSRA 1N8ZB 5GS2H 2J6EH 3G5YA 4HDIB 1EFXB 1TTFA 4NUJB 1FVCB 5KVFH 3G6DH 3SGDH 1JCKA 1ZKAA 5J9PB 3DXAE 5C0RH 3V0WL 4KHXH 4XWOC 3OR7A 1FE8L 3IF1A 4WDIB 5IBLC 3CX2A 3EZJB 5KANG 3JUZA 4NO3B 4BZ2H 3HI5H 5DMJB 4NJ9L 2Y72A 5C0AD 3VXRE 1OAXL 3LIZH 4MAYC 3NCEB 3ARED 4WGWB 1KTDB 1K3IA 3H6JA 3RWIA 1I7ZB 1MI5E 5FA4B 3KPLB 2BSSB 2MHAB 1ED3B 4PD4K 2PO6C 1F11B 1IGTB 2FATL 1RU9L 1AFVL 1NFKA 2W60A 3O9WD 3M17A 1LO2L 4PTUB 5TFSL 1KPUB 4WWKB 5SWZD 1WVZA 2VABB 3IFPB 1J1XL 4OLVH 1ZGLP 1DBJH 2WW8A 5FDYA 1UEMA 2HFFA 4B50A 1UZ8A 2YC1B 2MCPL 1HWHB 3DYMA 5AD0A 3CFKB 5FCSH 4HF5L 3G9AB 5H94B 4KGJA 4D3CH 4LHUG 3NBNA 4HXAL 4PJAF 4Y4KB 3QDGD 4UAOC 5D71L 5DFVC 4I18B 4HS3A 5IVZA 1JMXA 2YMXL 5BRZD 1Q9KB 1NMCB 5E8PB 4P57B 3F12A 2YKLH 4KJPC 1TZIB 3JWOC 1NSNH 1IT9H 2CIKB 3VRLF 5JHDE 5IIEA 43C9A 3P4OA 3HE7B 5GGTH 2CMRL 1KJ2A 3SCMB 3WNNA 2P7TA 1P4LB 2RAMA 1AO7A 1R3IL 3KS0H 4K94L 3VRIA 2C4XA 1EHXA 3B3IB 3N1PC 1SY6A 4AT6A 4NQEE 1QNZH 3QUXC 4JKPH 4OZFH 5C6WH 1J05A 3QCUL 4U1JA 5F3HB 1ORSB 4F8TA 5MP6H 3QPXH 1HIML 2V2XA 2QHLA 2APBA 1OGAE 1SJXA 1J1OH 4NCC2 5D6DA 4EVNA 3UTQB 2QSVA 5ACLA 1UQSA 2FH8A 2X4TA 3EOYG 5BW7A 4JR9H 2VDLL 1DEDA 4K9EH 4IS6B 4K3EH 5SX4I 1GZQB 2BRQA 3LKOA 5L9DH 2D4DA 4JCLA 3QUZC 3B9AA 4M1CC 5F70A 4RGNB 1QBML 1DUYA 1R0AL 2NY6D 2R2BA 5JORB 2B1HH 3KVQA 1Q72H 3VWJB 4PRHB 4J1UA 4YDJB 5CBEA 3O4LE 4UQ3A 2IG2H 3MLXL 3P40A 1AGCB 3JV6B 2HKHL 4XNYH 4UIKH 3JWDH 2VERN 5IB4A 4RFOL 1XR8B 4HCRH 1MCIA 2DAVA 5DD0H 5IF0B 3W11D 1QBLH 1MHHB 3S36L 5GRYA 1HHJA 3RWEA 4DOHB 3RDTB 3FQUA 4UUJB 4D9LL 5LGJA 3UEZA 5JUEL 1J8HA 3OG4B 4P5MB 4JZOA 4I48B 2H32A 3MV8E 2AJVH 3OZ9L 3HZVB 2HH0H 3QUML 4PGEB 5HYSG 3HE6A 2B4CL 1F3JB 1YDPB 3H3BC 4R8WH 4EQ2A 2FX8L 4DKEH 3QEHA 3I6KA 1BP3B 2VXTH 4HWBH 4P4KD 1UH4A 3VWKA 1LO4H 3MV9E 1N5AA 3QIBC 4HKBA 4GJTB 3KPTA 1K9TA 5FF6B 3FONA 2ZSVA 2J1KA 3LPGA 5E8DL 3DO7B 1WT5C 3G5XA 4YNYB 1HILB 4EOWL 1KBGL 2VH5L 1JN6B 2BY1A 1MF2L 3RWJB 3U82B 3OKEA 3MREA 3WUWB 4R0LA 1A14L 5A2LH 4W4OC 2CSPA 5F93C 5DO2C 1RZIB 1UXSB 1YYML 2B2XH 3WN5B 1EX0A 3ULUD 3VXMD 1RULH 2VAAA 5DJYA 4P46C 1AQDB 2AI0H 2R1WA 4HD9A 3LD8C 2BNQB 4QXGH 3ES6A 4PGJA 5E9DE 2IQAB 3FT4A 4Z76A 4U1SB 1IBGH 5ALBH 1IJ9A 1JL8A 3I6GB 5T1KD 3VFPA 1MVFA 1VHPA 4Y19B 2CJUL 4Y1AA 4JRYB 3B5GA 4XCFL 3A0OA 5IQ9B 3ARYA 3DETD 2A2QT 2FJHA 2YN3A 1GGBL 2E7CA 4JRWA 3FFCD 1EMTH 2XICA 1D5BB 4FTVD 3WNOA 5LGHL 2JK5B 4H20H 4K3HA 2A6KB 3B9DA 1T1ZB 2VKXA 3LH2L 4NC1C 3B9VA 3BH8A 3Q0HA 5D2LB 2EO9A 3LEXA 3M45A 5FYKE 4PD4J 4YQXL 3MNWB 2DRUA 1RHHB 1WIPA 3NACL 5MHSE 3CFJA 5F7EL 5BS0B 4TSCL 2DWEB 3RVVD 3RTQA 4M5YL 3T4YA 1RJYA 1X5GA 2IGFH 3ZKSD 4P49A 4RCAA 2AJXL 2E9IA 1ADQL 4HGWA 5F7NC 1B4JH 1IGFL 3HS0A 1CK0H 3MFGB 1MFDL 2YBRB 1J10A 4AIOA 3ZSSA 3BZ4B 2OXHA 3DXAA 4PJ9B 4F8QA 4KROB 1I1AB 1RUML 4UOW0 5DURB 1TNNA 4KK8D 2FZ3B 3RWCB 5D2NE 4U2YA 4NQCE 2EDKA 3VXRA 3C5JA 1VGEH 5C07D 3GBML 3LN5B 3RY4A 1KCRL 3H9SB 1NFDE 4U7SA 2VZTA 3IRZA 3SQOL 3RVTD 2A6IA 1VENA 3QWOB 3AU1B 1Q9WA 1JGEA 3T0VA 3VE0B 4WJ5B 4LCUA 1MI5A 4ZPTA 4O5LH 4BH8B 4YHPA 3BWUC 3ECBA 3PL6C 3FQXB 3LRSB 4K71B 3IDXH 1P69B 3KYOB 1T0NB 3BQUD 1WBYA 4OGYH 4PUBL 2IF7A 2VZSA 3Q2CA 1OWWA 1S5HA 4LDEB 3D18A 3WHXA 3EW3B 2DBLH 5JPMB 4JY4A 4OGAC 4G8IB 4NQDD 3QUMA 5KTEH 3MRDA 4JEGB 1NLBH 4DN4L 1N5YL 5J1SC 2ORBL 1G6RB 5EC2A 3RU8H 2PKDA 4PRID 5GSRA 4R7NA 1BFOB 2JB5L 4NZUH 2N7AA 4PRDA 5HHOD 4ZDHA 1NAML 2BC4A 3RAJH 3BP4B 1NCDH 4P2QE 1TXKA 4NSKA 2MQ0A 1QSEB 5I1IL 4WFFD 5JW5A 1I9RL 1KPRB 5JHDA 1MWAH 2OTWA 3TJEH 1Q1JL 2XTJC 1U58A 1X4XA 3DGGB 4P2OC 3MSPA 1FH5L 1B3JA 4CN4A 3MLWL 2OSLB 3C9NA 4KZEL 5FYKL 5F88A 1MCPL 2Q20A 4NQEA 2IAMD 4OI9A 2ZSWB 2BP3A 1G7QA 2LAAA 3JV4B 3L3JA 3IDIA 3FOLA 3O2WL 1TNMA 2P5EB 1OGAA 5JIPA 5CD5C 2BOCA 5F21B 3REWA 1X5JA 3U6RB 1MCBA 5EO0A 4FMKA 1I8MB 4HUKB 2R15A 2W07A 1P4BH 3VA2C 3WDJA 5D1QA 3BP7B 2BHUA 4WFHD 4G6JH 1YY9D 1GOFA 2ATPA 2V7NB 1WJ3A 3D85D 1PZ5B 4U1MA 3V6FB 1ITBB 1I7RB 1PX4A 1CGSL 3GMRA 1HE7A 1FL3A 2J7LA 1BVLA 2VDOL 2R0LH 3WDIA 5J6HB 1PYWB 4GKSB 3M1BB 4EUPB 1U3HD 3PNWA 4XB8A 3IB4A 5IW1B 3DUUB 4K3DL 1IM9B 1ZLUH 3O4LA 5C3LD 5JA8B 2WWMD 4NO0D 4Z0XA 5IHUL 4FZ8H 4YBQC 2CDEB 2HVKB 2GCYA 4GBXB 4ZAKB 2HVJB 2FB4L 1CG9A 3MGTB 3O2DL 4KK9D 1UACL 4XHJD 5E5MA 6FABH 1EEZB 4WGVB 2F15A 5AAWA 2ESVE 1LD9A 4KDVA 2GK2A 1DBKL 5GGTA 4M7LH 5CIPB 4P2RE 4YDLB 2AK1H 4N8CH 3CZFB 5L2KB 5ALCL 5EIQA 1MAKA 2X4QB 1A0QL 3LEYL 2FBOJ 4NZTL 3MV8A 4AENA 1OOAA 4OM1L 1ADQA 1N4XH 3P9WB 5HHVL 5D8JL 3VXSD 4HV8A 2XQYK 1AY1H 2Q7YB 5ITBL 1UFUA 3AY4C 4XNUL 3WS6A 4I2XE 4R90H 3V6ZA 4PJHB 2FNBA 1N2RB 3FRPA 3MUJA 3MGOB 3THML 3AREC 3MV9A 1QEWB 3PQYB 4PJFB 3U46B 3BJ91 2W9DL 3BGFB 1I9JH 5GGSY 3QULB 2CXGA 5C0CB 4OF8A 4OF7A 1G0DA 3BRDA 3P4LA 4Y2DB 4DK6A 4L4VB 3KGRA 5FUZL 5IVXF 3AC0A 1B0RB 1P7QD 3O9WC 1FZOB 3UTTE 3W2DL 4U6YA 1JRHL 4NWTL 1IQWL 2KZWA 5MI0C 1G9NC 4CDHA 4PJGB 5MEPB 5I75C 1XGUA 4PJ8D 2DQHH 4YHOL 1RK1B 4Z0BL 1PY4A 1IKFL 4G42A 1S7SA 2LU4A 3QIWA 1RZFH 1U3YA 2ADJB 1GZPA 5SWQA 1VEMA 5CS7A 5BVPL 5E9DA 5GSVA 4FG6D 2QHRL 3ROOB 4QNPE 4CW1A 2WAHA 2V2WA 1XF5A 5HDLA 4POUB 2E7BA 1RIUL 4QCIA 5CMAA 2O5ZL 2B1AH 1NCAH 1RUQL 3F5WA 3FQTA 3GB7B 5TE7H 1NCBL 4RGOH 4U05A 3X3GL 4HZAA 4M3JA 3RBGA 4CNIA 4XAKE 5KW9H 5TF1H 4AM0B 4Y16B 4JFZL 1G7MA 4TULL 4KY1L 4KJQD 4ZOAA 2MNUA 4CMMB 3LQZA 5IR1B 3V4PH 1NQBA 3DMMD 4JANA 3VD4A 4M9OA 5IFHH 4XCYA 2DYPB 1UB5A 3N0PB 4MDIA 4N0FA 3U0TA 2XN9E 4M7ZB 4WI5A 3GK8H 5F9WC 5EUKB 2QBWA 1SEQL 4F15B 5T5NF 5GGRY 4YK4C 1JFQL 1S5IL 4ACPA 2IBZX 4HS6A 3FTGB 2DQCL 1JGDA 1ODAA 1R5VA 4ZXBA 5EPMA 1IC4L 2VZ3A 4OCXL 3G08A 2JF1A 1M05B 3ZSTA 3VFGH 3QNYA 5JDSB 3SDDA 3S37L 2F19L 1AO7D 1U41A 4DKFL 4OFIA 1BIIB 1N0XH 3L3OA 4FQ1L 5F1IB 5IP4A 2NY6C 1AD9B 4HMDA 2P1YA 1NMAH 5D2NA 4HK0B 2YN5A 3O11B 3ZT6A 2JE8A 5IFJA 2Z91B 1CT8B 1IGCL 3MRHA 3P9LA 4KUCD 3FB7B 1XGQA 1NEZB 3GSUB 1NFDA 1YEFL 4DGIL 2Y5TB 3DTXB 2AP2A 2E6PA 1G7IA 3W11C 2EIEA 1FN4A 1MLCB 3OF6A 3K2MC 4I9WE 3ARBB 3KPOA 3JTSB 4N90D 5DJ8B 5IJVA 3S96B 4WEBH 1UCTA 3B43A 1QFHA 1CYGA 1H15A 3DSFL 3CXHK 2MPAL 4PG9B 4PJCB 1YNTA 3TN0D 3MNVB 4XVTL 1P1ZA 5DK2B 5C08B 5FHBH 3HNSL 5HHQA 2FSEB 2EC9U 1ONQA 1D7FA 3QHZH 5IEHA 1OP5K 2F5AH 1DR9A 3UAJD 5IB1B 2X70A 4TPRL 4Y5XC 4WHTA 3SY0A 2IANE 3FO9A 3O6FB 4LASL 4DGYH 3QQ3A 4MCZA 3IDJA 4HKJB 4P4KC 1JHTA 1Q0XL 1RZKC 4XPAH 4BH7A 4OZHB 2C4FU 2DLTA 3CU7A 4J3VA 3QDME 3AM8A 3NAAH 1MH5A 4Q2ZB 5FV1L 1I8LC 1GPOL 5J7CC 1HNGA 3RZCA 3T8XA 4U1GB 5GS0L 1YECL 4JJHA 3T09A 1J8HD 1FNAA 1WWCA 2FO4B 4L9DA 5EUOF 35C8L 4P2QA 1I4FA 3QT2A 1KACB 1W0VB 5GGRA 1WFTA 4LRIA 3S6CA 5JXAH 3FB5B 3EYSH 5D7KD 4KTEL 4MD5B 3UMTA 1RURL 4ZUVB 5T5NG 3U9UA 1I1FB 5E2UH 3HG1B 3S7GA 2JCCF 1BFSA 5H37H 3DX7B 3REVA 4AYFA 1A6ZA 3WNPA 3QNXB 1FVEB 4M5ZH 3PDOA 2YUVA 1JYWA 3UJJL 1D5MA 4FABL 3VWKD 5LQBH 1NBYA 4JVUA 3KXFE 3SJVB 3UBXA 4YEEA 4PGDB 3ULUC 2AQ2A 5DJ6A 4PP2B 4HHAB 2BVOA 2WWKO 2Z0BA 2Y06H 1CLZL 2YEZB 4WCYH 4O2FB 4OLYH 5EB9A 5GRZA 1ZTXH 2LTQB 4W70A 3PJSA 4OLXH 4M9PA 4KAQL 3VXTB 4MB3A 4QRTA 5EU6E 4J6RH 3OV6A 4KMQA 5F3BA 5IOPA 4I13B 5I9QB 4GRWH 5JMRA 1N3NA 3TYGH 3DETC 1ZWIB 2A1WH 9CGTA 1R3KB 5I8KH 1C7TA 3Q3GA 3PDDA 4HS8H 4PJXF 3HPJB 2Y4SA 1MAML 4XMPL 5D5MF 5EOCL 3FMGH 4G6MH 2VLRE 4JPIA 2BXYA 3HZMB 5MEOB 2OZ4H 2UYLB 4P48A 1EGJL 2IPKA 2FX9H 4JQIH 3HPLA 1SHMA 4K07A 3B5HA 5E00B 3TJHD 3ARUA 3AVEA 4Y4FA 4G9DA 4OZGF 3X12B 5K9OB 1JZ2A 2AV1B 1BD2D 1OAKL 1MWAA 2D2OA 2ESVA 4PJEB 4Y1AD 4MA3A 1MVUB 5ENWB 5EIIA 1CDCA 1RV6X 3RVVC 3P11L 2HFGL 4KTYA 4L8SB 4P2RA 3VFNA 1AQKL 4WI4A 2ICWJ 2A77H 3ESUF 3KYAA 1U2HA 1TTUA 5FKPA 1HWGB 5HYFA 3SDCB 1DQDL 4JFOB 3W0WB 3ZHDA 4QY8B 4KK8C 4LF3B 5D1XA 1ZA3A 5E99H 3KPMB 4NDMA 1P6AB 1WCBA 3QJFB 4I2XA 2GITB 1X6NA 4CGTA 3R06B 2EXWD 4R4ND 32C2B 1NANH 3WXVL 4OV5B 4HKXA 1U8HA 1Q94A 3MLSH 3RVTC 3UO1H 3RTQD 4XP9L 15C8H 1U92B 1UVQA 2O26U 1U8KB 4Y5VC 1TQCB 4I8DA 3A6CH 4P9HH 2V17H 2VISA 1PAMA 4EIZC 1OHQA 25C8H 3OPZL 5M95B 4DUVA 3T0AA 3MZGB 1ZT7A 3DXAD 4ORGA 3Q6FA 1MFBL 3UTTA 4FQIH 3U4EA 3BQUC 4JJ5A 3BPOC 5CEZH 5BZWB 4CBPA 5MEQA 3O3DA 1UM6L 3F7YB 4K8RH 3I3DA 1X7QB 4J8RB 4LLMA 4UMGA 1T83C 2DI7A 4NGHL 3VXRD 2LVCA 3BAEL 5IGXH 3W82A 3T1WA 3EBAA 2IPTL 2VUOA 5F7DA 2AABL 1E6JH 4YDKH 4HWZB 2DQJL 3QI9A 5E1AA 2YA2A 4XH2A 4MCYB 4O51A 1A4JB 2BCKA 2FBJH 5INDB 5E0QA 5IBUG 4KJYA 4L29B 4XCCH 4XBPA 5J6GB 2IPUG 4PV8A 4N8VG 5F9OH 1U8PA 3CLEL 4FQXA 1EEYB 3S98A 2CLZA 5ICYA 1FNEB 4X6CB 3NIFE 3AGVA 1RUKH 2QADD 1UJ3A 3V4UL 5TE6L 5D6CB 4CVZB 1EA9C 1IZKA 2H6PA 2YD8A 1JF1B 3JZ7A 3OJMB 1KELH 1QLRB 5CJQH 4HUUA 3BPCA 4ZUWB 2ERJB 2IAMC 3O3BA 5GS2D 3WJJA 5DR5L 2XN9A 3WL9B 3CXHJ 2DL2A 2DMBA 1Q0YH 1JZ4A 1T5WB 1RZJL 2Z31A 5EO1B 4C83B 1SQ2N 3IU4L 5JHDD 4LHUB 5C0GA 3FB6B 4J3OC 4JDZA 1YY9C 1NLDL 4U6HB 1BREA 4DCQB 4LLWB 1MPAL 5D7IE 4I3SL 4LSVH 2YPKA 3VI4F 4XC3L 1OGTB 4JO2L 1T3FB 3EO0B 2X1OA 4D9QE 1KT2B 4NQED 1U3HC 1YEEL 5DQDL 2DQGH 1YYLH 5ID0B 2ADGB 4Z7WF 1FGNL 1KN4L 2Z4QA 2WWMC 5DJCB 3LMJL 5E7FA 5B39G 3S3SA 4LU5H 5DJDA 1P2CB 5I76A 4OD3L 5KVGL 3BZEA 4KK9C 1X3DA 4UIMB 4XHJC 5ICXA 3JVGA 5D1QD 1ND0B 3WFDH 4L8BA 5J8OA 3C5SB 2VQ1B 1UXWB 1PD6A 5IQ7H 4YE4L 5FB8A 2QSQA 3TWCL 3O8XA 4EXKA 4WUUE 3MRPB 3MLUH 5I8EA 4JPWL 1GGUA 1CFTA 2NW3A 1NUFA 1RZ8A 2VXSL 3MBXH 4GQ9L 1CDJA 5C0JA 2Q3AA 4HLZG 2R0WH 4LLUA 3ARFB 3VFRB 3O4LD 2WQ8A 2IANA 2A6JA 1N6UA 4PRNB 1A21A 4ESKA 3QH3B 1F58H 5LBSH 3GIZH 3SE3A 3BHBB 5FUCE 1V3JA 3HC4H 4ONHA 1CU4L 2W92A 4F2MB 3QDMA 1IFHL 3O2VL 3FRUA 4QTIH 3OXSA 3KNBA 3VXOA 1XZ0B 4FXGB 1YEIH 3T2NH 1PKQB 2F74A 4R97B 4LVOC 5EU4B 3L3KB 5IM7B 3ARVA 4MNHB 3BX7C 3MV8D 4DGVH 5B38A 5E8OB 4HXBL 5TPWH 1YJDL 2QJDA 1CZ8H 1Q9LB 5DUBA 1JI2A 4PJAB 2GJJA 3T77B 3PWLB 3ZE0F 4HGMA 1WZKA 1XIWA 4UTAL 1R5WA 1ZS8A 4PJ8C 4YLQT 2KDGA 5IW3A 4UV4H 4TNWK 2PN5A 3DV4B 3WLBB 3KXFA 3MV9D 4CJ0A 4M8QB 1VSCA 4MD4A 3MUGB 2DLFH 4LBEB 4K23L 4PGCB 3KPQB 1EO8L 4FG6C 1JUFA 1N26A 2VLLA 1DSFL 3GHEL 4LKXB 4YFLF 1B2WH 1QFWI 5GRXG 1CF8L 3GSNB 1YEDA 3LDBB 3L6FA 4TNVK 5EU6A 2P42B 2VJXA 1T03L 3ZLQC 2HG5B 4F9PA 2NY2D 3C8DA 3QG6B 5T5FL 4U3HA 3E8UH 5JO5A 1BX2A 1C5CH 3LKPA 1NL0L 5FCUL 3BN9D 4MD0B 5GGUA 5KJRL 1LHZA 3LB6D 1F4HA 4KJQC 3QIWD 1T1WA 2D31A 2VLRA 5HDBE 3U0WH 1T7XA 5DZOA 3DMMC 5JHLL 5T1MB 4W6YB 2AJ3B 3CDGB 4JHZA 5FYJH 5C09B 1R3JA 5E9DD 3VGHA 3IFNH 3HZYA 2EDLA 3H9ZA 5C0IA 3HAEG 1T0MB 4JFYA 7FABL 2PNDA 1EERB 1F2XK 3IDYB 3PHQA 3FN9A 1LEIA 3MA9L 2AGJL 1M6OA 5GRJH 4QYOA 5I74C 5FGBC 5BV7H 2JIXB 1J86A 4JREB 2GFBA 4NN7B 4QHKJ 3QJHB 4S1RL 4MQ7A 4ELKB 5D70L 3FQRB 1A9EA 2ZCLH 2D9CA 3BD5A 4QO1A 4UNVA 5FYLL 3TBVA 5I1EL 1TPXC 5HYQB 1A1MB 4LAJH 5CUSH 3I50H 3DPBA 5K9KB 1U95B 3QFJB 1I8IA 1XF4A 3TIDA 1BQSA 2RR3A 3E6HA 1A7OH 5E2WL 2DIJA 5HGDB 1WAAF 2BVPA 4WNQA 5BW7C 2L4OA 2NTSP 2RIKA 3BE1L 3TVMB 1R3HA 1DQMH 1FSKC 2VQUA 4H26A 2VN7A 2OK0L 5ISZD 2A6DA 4ZXBD 3MXWH 4FQQB 2XNAB 4EJ1C 3QQNA 5KBNC 4M1DH 3MRLA 1MRFH 5T1LB 4JDTL 5M7QA 4HFUL 2QQNH 3TN0C 4PIRF 4HZLB 3KDMB 4ZD3L 5FYJE 5MENE 1DBMH 5FGCE 3ARGB 1YUHA 3UAJC 2VDPL 5I73C 4NQCD 3V0AC 3MLTB 4NUGH 5CJ8A 3VXUB 3LN4B 3EOBA 2V5MA 4GMTL 4LCYB 5HPMB 3HMXL 2NY5C 2UWEE 2AEPH 5I30H 3LRHA 3WNMA 3OF6D 5E8NA 1HHHA 2ITDA 4JPVH 4N0UB 5D7JB 4L1HA 1W72H 1JWSA 4I1NB 4PY8J 5E6ZA 2JKXA 3BD4A 3TV3H 3D6GA 2F58L 3FO2B 1S9KC 4FQHA 3VG0H 2HJLA 4HIEB 3RUGF 3J7HA 1TVHB 3SKJL 3EFFB 1C5DA 3C6SB 3SE4A 3OKYA 3EDDA 1QRNE 5EG6C 3VWKC 2NXYB 2ZCKH 2CKBB 4YHLL 5C0EA 4M93B 3QDHA 4ODXB 2P5WD 4J3XA 3G6JF 5DEFA 2EDYA 4PR5B 3RZCD 2G9HB 3WE6B 3MCLH 3KPPB 1IAOA 1RJLB 4OM0L 2D03H 4KUZH 4P2QD 4YZFE 1FG2B 2P46B 4Y5YB 3AUVA 3JV0A 4HLJA 4G7VH 4QRRE 3SOBH 5CCKL 1EHLL 4QRQA 5EZIH 1I1CA 1HEZA 5DMKA 2R4RH 1IAKB 1TZGH 4R0LC 2J12B 4U6VH 3W9EA 1JPTH 5D7IA 1OAZL 3CUPA 4JRXB 2X5PA 3GHBL 4LSPH 2DICA 3BPLB 5CSZA 4L4TD 4BUHA 3CFIC 2L7JA 5ITFB 3N85L 4XMLH 2FWOA 4ISVB 1O7SA 5L0QB 3TJHC 3BJLA 3RY5A 1A1OA 2VNCA 1X4YA 1JMZA 2I60L 2BZDA 4ZPVA 3SBWA 1PG7X 2YPVL 3SKNA 4JFPB 4H1LG 2FHFA 5ANME 3EYFA 2ICEB 1J5OL 2EDHA 1K6QL 2DQIL 3DX8B 1KULA 4TVPH 1NDGA 4PV9A 1ZE3C 3QEQD 4WUUA 4ZQKB 4Z78A 1J1PL 1G7JB 1T4KB 4HWNA 4OCWL 1DN0A 1NBZA 3QEGL 2B5IC 2R69H 2K3TA 4WHYH 3VRJB 4M6MH 4XVUD 1SBSH 4A6YL 3A67L 1LO3H 3ALWA 1FCGA 2YD9A 1NMBL 1F2QA 1EIBA 1QYGL 4Y4FD 5CZVH 2EXWC 4R4NC 3E6FB 4ZFOA 4EDXB 3MOQA 4HH8A 3W9DB 3WIFB 4P3DA 4QRUA 2ESVD 1A6AA 4PJIE 1K4CA 3BP5B 1W0WA 5C0ND 4X8JA 3RTQC 2X4SA 2LE9A 3FT2A 3QUYA 2CDGB 4JVPA 4Y8AA 5ESQA 4P2RD 4XWGH 1WBXB 2FYYB 1MRCH 2E6JA 2DBJA 3L3IB 4NNPL 1MCFA 2YD5A 2HTLD 2NW2B 2J88L 2EDTA 5EU5B 5D72L 1SYVA 3BUYB 1UA6L 4DZ8A 3LOWA 3STLA 5D1XD 1M7DA 4XZUA 3VGFA 2PTTA 4OZ4A 1UENA 2CDFA 3MRBB 4NCC1 2D7MA 4WV1B 3CMOL 2GI7A 3CFDA 4LCCC 3GMLB 1WBZB 1PG7L 4KKLD 4QXWA 4E42A 3CX5K 2EICA 1SJHB 4TVPE 1QG3A 3DBXA 2IFFH 2GW5A 3HMXA 2XFXB 3GI8L 3BISA 3HUJF 1I7UA 1KYOJ 3QEUA 4G8EB 1E28A 2OTUB 4IDJH 4E0RA 3UTTD 1ZLSL 4AG4H 3V7MA 3F62A 1YEGH 2WIMA 2QADC 3QIUD 1L7TL 3UTPD 4WO4A 1ZHBB 3LEVH 4D8PB 3DUSA 5EA0L 2Y7QB 3UPAA 4ZS6D 4NCDA 3IU3A 1N59B 4P4RB 3QR2A 3TZVA 2DI9A 3RFZC 1CFNB 2WSKA 3I3EA 3DECA 3FT3A 3ZKXC 1LE5B 1BFVL 4AH2B 4OLVL 2VXQL 1DBJL 4MJIE 4UU9B 5CEYB 4XC1L 1BMGA 1I1RA 5EU3A 4RMUA 4ORZC 4HWEH 5IHBA 4FQXD 2NY3D 1S7WA 2VXUL 3SDAA 3KHQA 2X09A 5BZDA 2MSPA 2XA8H 5EBLB 3GMPA 4MA1C 1UKSA 1FZKB 4XAKD 5CSBA 5GXBB 1BQLH 4EBQL 2BERA 12E8L 5E24E 4JFFD 3KLDA 3QO0A 5HHNB 2Q76A 5GISH 4TUKL 2R8SH 4HH9A 1PLGL 1DFBH 3ARSA 5K9JL 3FOMB 4AQ1B 3EO9H 3OKKA 1QP1A 1PQZB 4U2ZA 2Q8BH 4HIXH 3GMQB 4UAOB 5DRZB 4RIRA 2XN9D 3BI9X 1YN7A 2XPGB 2CRMA 2Z31D 2GAZB 5D1QC 4ALAH 1MJUL 4KV5F 4PTTA 4RISL 1JPFB 1LE9A 4X9GA 5C0DA 2KQNA 4HUWA 3S5LA 2ATKB 1KXVC 2X40A 4NQXB 5E2TH 3QFDA 5DJ0A 4G6FD 2CXKA 2W9EH 4JG1H 3QUXB 3VFVB 4KJWD 5MENA 3MLRH 4K3EL 2X2YA 1HXMB 3TBWA 4S1SH 5FUOL 2FL5B 1PGRB 4F58L 2P8PA 4KHTL 4M6AA 1R24B 5IVXB 1UADC 3CCHA 4XNMA 1LDPH 2R29L 1S3KH 3MLVH 2UWEA 1FV1A 3MC0A 2DQTH 2HT2D 1Y0LB 2NR6D 2Q6WB 1LNUA 2QKIB 5I66B 3HMWH 2Z35A 2JELL 3BXNB 1M4KA 3OR6B 4BM7A 3O8XD 2X6MA 2YUXA 1II4E 3SPVA 5FK9A 4OT1H 4XNYL 1MFCL 3A6BH 2M8XA 3PIQA 5IG7A 3S88L 4RGNE 4YX2H 3JWDL 5ESVA 5DD0L 3BEVA 2RCSH 1G6VK 5B8CA 4P5TB 2Q8AL 3L95A 4NWUH 2IAND 3WS6C 4PRHE 3X14B 1RIVH 3SGEH 5J56B 5J06A 1QRNA 3BRGC 2G2RA 4LQFH 4K9EC 3QZWG 4KFZC 4F7CA 3LKSB 4KGLA 4LCIH 1XCTA 3MJ8A 4KRNA 2D7TH 1B0GA 3LZFL 1E4XL 1YPZB 4JFDB 4KUCF 1OAQH 1LO4L 4C55A 5I0DA 1U8MA 1MAJA 3FB8B 1IZJA 3M8OH 1N6QH 4JQVA 1DEEA 4GUPA 4I5BA 1CDIA 1Z3GL 1XF2B 3GSQB 2Z8VC 2R1XA 1XIWD 2NY2C 4BK4A 3TPUB 2MCG1 3VFOB 5HGBA 1SJVA 3BN9C 3EO1A 4WTWA 3LB6C 5ID1B 3QIWC 3MRGA 3QIBB 2ADFL 1ZHNB 1Z9OA 4M02A 3NA4A 3U30B 2IH3B 1W72A 1S7TB 3LSOA 2B2XL 2OL3L 2HWZH 5GJTH 3RNQB 1FC2D 1FO0H 1HK6A 5FOJA 5EU6D 4DW2H 5IMLA 4HPOH 1UCBH 5A2IH 4YIQB 2AW2A 3B5TA 4NFDA 2Z92B 4QXGL 4RFNC 4NQTA 3R1GL 5ETUB 3R8QA 4U1IA 3V5HB 5T33L 4J2XA 1OARL 2ZJSH 4HFWB 4HW6A 1C1EL 3EYOA 4YWGH 4L3CB 1GAFH 3CX5J 3B9KA 4LEOA 2EIDA 3OKOB 3NN8A 1GJIA 3GSXA 4P46B 3LD8B 2ZKHL 4MB4A 5I8OH 4KQ4H 5JQ6L 5GS1B 4IIQA 2H8PB 3KJ6L 2VLKB 2EKSB 4EIGB 4OLZL 1NCWL 3MTRA 5HGHA 3QXDA 4NT6B 2FJFB 1QVOB 5ERWA 1JNNL 1BPVA