4UNTA

Induced monomer of the mcg variable domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
SALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWEQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNAVEGTGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IG LAMBDA CHAIN V-II REGION MGC
publication title Formation of Amyloid Fibers by Monomeric Light-Chain Variable Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4untA00
1Z0NA 2UYLB 1EJ6A 2ZG2A 3F58L 4YXLL 1SMAA 3LEVH 5GZOD 4M6NH 3KPPB 3PF2A 5GHWL 5EUOA 4JG0H 5EPMB 2R8SL 4J12A 2CMRH 3IDYB 3BJLA 1TVBB 3S4SA 5B8CB 5C0GB 5E2UL 2NY7H 4QNPE 3WHXA 2VRAA 3O3UN 3PGFH 3PGDB 3IDYC 2GITA 4N5EC 1C12B 4WHCA 1CGUA 2QQQA 4UBDD 4F9LC 2Q3AA 5FGCE 1LD9A 3NN8B 1CDIA 3V7AE 4S1QL 3IT8D 3ZDXF 3K74B 3WIIH 2E7LA 2K3TA 2OSLA 1NSNL 4NQVB 1HH9A 3V5HA 1MWAH 1CXIA 3IFOB 4U33A 1ZT7B 1HH6A 3I84A 4GRMB 5T1KB 1KENH 5HGDA 3GMRA 4CU8A 4LF3A 2MNUA 1A6ZA 4KKBD 4LLMB 4TTDC 4ZUVA 1T5WB 1W8NA 5JXAH 3KLSA 3TJHD 2HN7A 2CLVB 4ONOA 4XP1H 1CL7L 4AYFA 2E7HA 4OQTL 2KUTA 5EU4B 4NQDB 2AEWA 2EH8L 4PRAB 1JHLH 1FDLL 2AXGA 4N9GA 3VFUB 3SJVA 3GIVA 4NOFA 1BLNA 4P2RA 4I2XE 2VXQH 4EOWL 3T1FA 1NL0L 5FHBH 3TT3H 1FVCB 1NCNA 4G5ZH 3T77A 5A3ID 3IXAB 2PXYA 5DQ9A 1F3RB 5HHNB 2ARJB 2ZOKB 2NY0B 4Q97A 1WBXB 3WO3B 4DEPC 1JN6A 3BP5A 3GJEA 2X4OA 4PJFE 1A3LH 1P4BH 1U8LB 3UTTB 3I3BA 1S9YA 4MCZB 5TH2A 4Y19B 4HIXL 5CWSA 4JY6A 1P9MA 5GS0C 4YDKL 1MAMH 4OGXH 3W5MA 1F8TH 1KYOJ 1K4DA 1VADA 2DQHH 5IIEB 2DQEH 4F33B 1EO8H 5EO1B 1J0YA 3CXDL 5JW4Q 2LU7A 2DM7A 5HDQH 3U0TA 1J0HA 3Q2CA 4HG4J 1QNZH 3CD4A 4Z8FH 2WUCH 1SBBA 3GK8L 4H88L 3V4UH 2B39A 3HC4L 5DZLA 3K8LA 2B0SL 4TUJB 2C1PB 3JTTA 3MNWB 5FV2A 3DURA 3PHOB 4CL7A 3BP6B 1CVSC 1WEJH 1IAKA 5B38G 4OLYH 5KANG 4XCCH 1MJ8H 2FYYB 1H5BA 3GMPB 4YBQC 4N0UE 1IVLA 3ORJA 3IDUA 3O41A 3EOTH 3MRNB 2P8LA 2UWEA 2DWEA 4X6DE 2NW2B 3IETA 3MLVH 1LDPL 4LSRL 5CINL 5CBEB 5C0DB 4ZFGH 5M95B 2ZJSH 1NFDF 1CE6B 3DUSA 4P3DB 4X6EA 3U4BL 4GKZA 4CVUA 2AGJL 5FUCC 1SYVA 1J9CT 3FQUA 1RK0B 4PJBB 1T0MB 1MLCA 2NY5L 3RUGE 4X7FC 4RGMB 5E0QA 3RI5K 3NCEB 3MRQA 4OLZH 4MDJB 4UIMB 4OCRL 1ACYH 2WK2A 1S9WB 2JELL 1I8MA 1S7TA 4UAOB 2BHZA 5C0RL 4XPHH 2VAAB 3H9HA 3NFNA 4FZEH 4KK8D 1HXYA 4BZ1L 2GJ6B 1T04A 2J3SA 4Y4FB 1BD2B 1CIUA 1RHHA 4ZQKB 1FL3A 5C08E 4I0CC 3B2UC 5BV7B 4RZCB 2E7BA 3LS5L 4OQ1A 3UDWA 4O2FB 1DQLL 4MD0A 4UB0H 1BP3B 3NTCL 3NIFF 2HG5B 4FP8H 5KZCD 2EC9U 5IVOA 5B3JF 1UACH 4L8SB 4CMMA 1SEBB 2AXFA 3G5ZB 4GAGH 4EDWH 4NO2A 3WLWD 3TA3B 1AI1H 4HK3J 1FVDB 15C8H 4P9HH 4WWKD 1JF5A 3B9KA 1S7VA 1MWAA 1FIGL 2WBJD 3LRSB 3SJVD 1ACZA 1FVEB 4P2RD 2ZCKH 4ZPVA 4Z7VB 3TA3C 4Y7MA 1NJ9A 2PXYD 2B5IC 3O9WA 4BQBA 1I1FB 2ATPB 5FO8A 4KTDH 3KXFB 3WUWA 4HGWA 1JZ6A 4G9FE 1L0YA 2QADB 3VXPB 5DO2D 3QDME 4X9BA 3PV6B 4A2LA 4UUJA 1KJMA 5FYKH 3E8UL 3MBED 3WFCH 5K59F 1NCCL 2DDQH 4F8QA 1BOYA 1U8MA 5I1HH 1KT2A 1ED3B 2FBOJ 3ZMRA 3QQ4B 2NLJA 1ZT4A 1XGUB 3CFKA 3ZKSD 1GZQB 3M45A 3LQAH 1G9NH 4PRNB 1BJ8A 3FRPA 4NC1C 4PR5B 1U41A 5T3XE 1EX0A 3H7BB 4XPGL 5D2LE 5F3HA 3WN5B 2PO6B 1R3HA 3AM8A 1BEYH 2Y36L 1R24A 3Q1SL 3V5DB 4H0GA 4J3XA 2VR4A 5ID0B 3BKMH 3MSPA 4KMTL 4TSBH 3ZTNH 1DQJA 5LAXB 4MA1B 1XIWC 2EO1A 1R5VA 3QNYB 4PD4K 5IJKC 3MRMB 2G2RA 4DCQB 4K3JH 5EZOL 3S88H 1AO7E 3DO7B 3PDOA 4RGOH 5EU5A 1UQSB 3GHEL 1T2QH 3RL1B 3BDYH 3BWUC 3MRHA 4HJGA 3OXSB 4WUKL 2UY7A 2VSCA 4DTGH 3U36A 3GMLA 3G6JF 4ZUWA 2EDBA 4XT1C 2EH7L 4PFEA 1W0VB 2CRZA 5IESH 5J3HC 5I74B 5H37H 2XZQL 4F7TA 5MEPA 4RFOH 3M8OH 1SMOA 1DEEB 3KNBB 2IC2A 1JPGA 4AL8L 2HFFA 5I1EL 2EO9A 2V17L 4MMXC 1KPVB 4R90L 1T4KA 3QDHA 2WM0A 2JB6A 2ID5A 2ITDB 4G43B 4OLXL 3K7UA 5DC9B 5IFAL 3B2VL 4XXCC 1S9VA 2AV7B 4UT7L 2WAHA 1U91A 4F7MA 4FQLH 3QEHA 3ZHKA 3GMOA 1HILA 3HG1B 3JTSB 2OK0H 1HXMA 3B9KD 1JCKA 3G5XB 3NACL 4OSUH 4JRYE 4IIQB 5I1AA 1JHKH 5CAYB 1AQKL 5ILTL 1T22A 3GIZL 3BKJH 3OKYA 3CMOL 4PGEB 4DOHE 4FZ8L 2VDML 1YJDC 2J88L 5CMAA 3ZE1F 5JHDA 4RMTA 3O9WD 4CDGC 3QXAA 1PLGL 3ZDXE 1MIEL 4M43H 2B8OT 4RDQG 2X7LA 4J8RA 3KPSB 3SE3C 4D9QE 5MP6H 1FLRH 1CGTA 3BZEA 2VE6A 3QNXB 4NM4L 4UV4L 4I5BA 5GISL 3ZSSA 3TEUA 1FC1A 4BK5A 2DQIL 5CZKA 2Q7NA 4WO4C 4RAVB 4WGWB 3TV3H 1OB1B 4ZFZB 2B4CC 3KYMB 3EDDA 1I3UA 1T0NA 5DDHB 4EDXB 5BS0B 3JZ7A 3SCMC 1XF5A 3GM8A 1JWUA 4OD3H 4ZD3L 6CGTA 4BM7A 4RQQB 5JZ7D 2JB5L 4F37F 2BDNL 3MXWL 1WCBA 1AGFA 3CSPA 1IEAA 4JR9L 4KHXH 2XWTA 1OF2B 3N50A 3HZMB 4LOUD 5HHMD 1XEDA 2DLIA 3MRRA 4LVOC 5C07A 1OTSD 4PUBL 43CAB 1H9VA 4MX7A 1JYXA 5GGSB 4JRXA 3DTXA 3KPRA 4MYWB 4M5YH 3WCYA 4W6WB 4IOIB 4AEIL 4KTYA 3L3DB 4MDIB 1N5AB 4JY4B 4Z7WA 3KLHD 1T1YB 2DJ4A 1KIRA 3REVA 4S1DC 2XG4A 5IEHB 1MRFL 2F5AL 5HHVL 1DBJH 5GIRB 4FQ2H 4MMZC 2JCCA 3UYPA 2MWCA 4D9LH 1EXUB 4J3UA 3PQYB 1TZIB 4XNYL 1FFOA 3BRFA 5KSAC 5L9DH 1D5ZB 1NQBA 2X9XA 2DMBA 4PJCE 2L4OA 3I6GA 3BH9B 2LU3A 1INDH 4JFYB 1TZGH 2FH8A 4Y4KB 4O02L 3SGEI 3A6OA 2Q86A 2XKNA 5FOBA 4Z5RB 4X9HA 5CHNA 8FABA 1XR9B 1MVUB 1V5JA 3CUPA 4JFEB 5AUMB 1EBAA 4WI5A 3WHE0 2BOBA 4Y4KC 3QDJB 1LNUA 2ZCLH 2VLLB 1KPUB 4CKVX 3IFPA 1UXWB 5HYSB 5JW4N 3TWCL 5B39B 2EYRA 5FA4A 5D7LA 5L2KE 4L3CB 2ZSWA 5DMKB 2W92A 4M61B 2BVOA 2EKSB 4P2OA 4YO0A 1BFOA 2CIKA 4HJ0D 4Q58C 4JZJB 4XB8A 4PGBB 2GI7A 5IM7B 4MXWL 3REWB 3WL9B 1BVLB 1DUYA 1TNMA 2XRAL 4AH2B 3MOBH 3KJ4B 2OQJA 4DUVA 1Q9KA 3OR7B 1YN6A 1DDHB 5I71C 2MQCA 2H2SD 4JFFD 2W9DH 3DRQB 1A6PA 4WEMB 1TFHA 2VDPL 4I77L 3D39E 1AHWA 1AP2A 5DI8B 1NANI 3SBWC 3FTGB 3ULVD 2B1AL 3IU3B 3RFZC 1A3QA 3QI9A 1RMFL 3KPLA 1QVOA 4R0LB 4HIIA 3IDXH 5TPWH 3ECBB 3NVQA 2OBGA 1YEEH 5C07D 4YGAB 1EGJA 3QAZB 1A4JB 3DVNB 4YXKL 1Y6MR 3AFLA 4IRZH 3VXUA 1U58B 4JRXD 4E5XB 2BVQA 4JFHD 5ALBH 1CFTA 1WWBX 3KPMB 3SE9H 3FHQA 5LQBL 1IJ9A 2WSKA 4H1LB 2X44D 1HHIA 5FGSA 2Y7QB 4H8WL 1CXFA 3QUXB 2BSTB 1XCTA 5EIQA 3WXVH 4QOKE 1K8IA 4TSAH 3T2NL 3T65B 2RBLA 3WKNA 1U8IA 1I8LC 4KAQH 3FB7A 3D3VE 4ZDHA 4HPOL 3RY5A 1TQBC 4I2XA 5I16B 2XZCH 4MJIB 2FL5A 3KYNB 3QB7C 1MFCL 1X3DA 5MHSE 2XIDA 3MJ7B 1IGTA 2PTTA 3ES6B 2WP3O 1IGMH 3SO3C 1MCNA 5AYQA 5T3XH 3LN4B 3IU4H 4OIBA 2VXQL 5HYJB 2BMKB 1GPOH 5KSUB 3VD9A 2ESVE 1I7RB 4NOBA 3VRIA 2YHGA 4U31A 3QHFH 1P4BL 2Q87A 2YKLH 3SDCA 1QR4A 4D9RD 1R3KA 4Z7QF 1MAML 1T83A 4OGXL 5D7LD 1B0WA 5EO0A 1Q9WA 4YGVA 4YNYA 3THML 1EO8L 2V2TB 1ZWIA 4R96B 4L8BA 3O4OB 2C3GA 4PJ8A 5AWNL 1FP5A 4H5SA 4LLWA 4P2OD 4DQOH 4LCWA 4OD2B 4H0IA 3A0OA 1I7ZA 3O45B 4WNQA 1S7WB 1FZOA 2IG2H 3U6RA 1P6AB 1SHMA 3P9LA 3EOBA 5IB1A 4X6DA 3MPCA 4OLYL 3L3HA 4XCCL 1QLEH 1HHJA 1VFBB 3PXHA 5DVKA 1S7UB 2VDNL 4FXKB 1KJVA 4JGJA 4HH9B 2OMNA 1JL8A 3JWOL 4Y8AA 2CSPA 3RUGA 4LARH 3ZE1E 1L7TL 4KWUA 2IH1A 4IMKA 2AAVA 5D9SB 4RMRA 5FAAA 3B9AA 4PJIA 3QI9D 4U7KA 5IGXH 2R15A 3HCVA 4QHMA 4JM2B 2R9HD 2VZTA 3JUZA 3QIBB 5GGSY 3SE4C 1UB5A 5C08A 4OZIF 4ODHH 1FLTX 3VXUD 2DIAA 1U8PA 4RMUA 1VGEH 5D1ZC 2CPCA 4LSQH 4EZMA 1IKNC 4XWGH 2VUYA 2EXWD 1K9TA 1IILE 4YDLB 1LK3H 1P4LB 1NGXB 2PYFB 4PP2A 3R1GL 3F6IA 4K9EC 4LLYB 4GG6B 3UPCA 4GKSA 4NWUL 3HMWH 3TZVC 4HWUA 5ADOH 4YFLI 2CJUH 3TGXA 3BXNB 4NO3A 3T0EB 3IGAB 4N68A 1H3PL 4QRTA 2N7BA 4KRLB 4MA8L 4RNRA 3QIWB 1TENA 4WWID 4PGZA 3VE0A 1SJHB 2P8PB 4Z95L 1P6FA 1IC4L 2KBGA 2GK0A 4JFDB 5JTWA 1RPQA 4Z78A 4AY0A 4XI5D 5GGRA 1ND0B 5CEZE 1FNSH 2A83A 1M1SA 2R1YA 5J7CC 5JW4M 4KTDL 3G5YB 5EC2B 4K3HA 5TE4H 2EEDA 4UINH 5IW3A 1CLYH 1NMBH 5A43C 2HT3C 4KRPD 1T21A 4M1CC 4IJ3C 3RNKB 5GPRA 2VLJE 3LAFA 5DC4B 1FH5H 4HJJL 5HDOA 4Z7OF 2IPTL 1PZ5A 1QFWM 3ULVL 4KMQA 5H35A 1AGDB 1KPRA 3IJHB 1MCSA 5T5NF 2ZNXA 1HQ4B 3DO3A 4LCWD 1UM4H 1P7QA 1I1YA 4WV1A 5B3NA 4KUCF 2H1PL 4OCMC 4JN1H 5D70H 4Q9RL 1L4IA 1JUFA 2J4WL 2GTWA 3RVXD 2RCSH 1MOEA 3BSZL 1OT2A 1MRCH 5SWSB 4BUHA 1DVFC 1GGBL 5ACZA 1X4XA 4OCNC 1YNLL 1KULA 4YFDB 4K3JL 4AEHH 3C2AH 3VWKC 1WFNA 3DSFH 2JIXA 2C3HA 3O4LB 3RIFK 3EYSH 3QPXH 3ZLQC 4Y5YC 3TN0B 3BESR 1KLGA 5FUCE 5L2JB 4X4ZA 1SJEA 1G0XA 4QRRB 3PABA 4Q6YA 1G7QB 4GAJL 2VOTA 3L3KA 4HDIB 4TQEL 3ZKND 5C08D 3U7YH 3BIAX 2A2QT 4P2QE 3T0BA 1J8HE 2VXTH 4OZFA 4FFZH 5BVPH 2BHUA 4JN2A 3QCVL 4YHLH 4CDHA 4Q7DA 2VXUH 4NWTH 1EEQA 1U8QB 5EOCL 5F3BB 4IRJC 2IGFH 2R4RL 4KZEL 5D6CB 1BQUA 1J5OL 1QD0A 1KG0A 4J1UA 3V0WL 2GJ6E 3ETBF 1JHTB 3GKWL 1VHPA 4YDJA 1UJTA 2OL3H 4B0MM 3H3KA 3GSRA 3CDYA 2XA8H 2MHAA 2E6QA 3K81A 2I60L 1H15A 3BZ4B 4X5XA 5C0NC 5JPNA 1FFPA 4GAYA 1LO3L 3FRUA 3ZT6A 5E8NA 5GRUL 4PB9L 3UTZB 3L95B 5KJRL 4D0BA 5I1JL 3FQXB 4G9FD 4E0RA 2VLKA 3D18A 1V8HA 3PWJB 3O6FA 3CFCH 3P4MA 1S7QB 3BZFB 3GRWH 1FFNB 1OPGH 1QSEB 2BY0A 3FO9A 5CIPB 4DGIL 5EZJB 1F4YL 4UDUB 5GRWA 4JZNB 3MGAA 3CLFL 3LKRA 5D7SL 1CF8L 1NUNB 3IJSB 4QY8B 3L5JA 1YZZA 4Q0XL 5JDJA 3SDAA 1EZVX 1N6VA 2QR0B 1RULL 5T3XD 2IPUK 4WRLA 3R0MA 3CGTA 5E8EB 2A0LD 1TZHB 5HPMA 2FEDD 4NQXB 4JM4H 3GSOB 4NC1E 5CEXB 4ODUB 5D2NC 3NA4A 1EGJL 2IF7A 4FMKA 4IHOB 2FIKB 1I85C 1J18A 2IANE 2L7JA 5DUBA 5DJ6B 1A6WL 3UAJC 4KPHL 2YN3A 4OFPA 3HE6B 2DLTA 2NX5B 3QR2A 5EZLB 3MC0A 1S5IL 3ARWA 1J05B 3EDFA 2NMSA 3VH8A 1CU4L 2PCPB 3RWHB 1MCRA 2ZP0T 1LO5A 4D0CA 4FXLA 3D25B 2JIXD 5A1AA 4Z7QE 4C4KO 3B5HA 3DVGB 3KYKH 1A6UH 4P46C 1XCQA 3EOAB 4PLKC 2YWYA 3FONB 2NNAA 1CLZH 4OGYL 4JDTL 3PGCA 3DBXA 1TQCC 1A6VL 1NAMH 5C0JA 1G6RL 2O5XL 1ORQA 2CLRB 3L3OB 4KKAD 1QFUH 2JF1A 4Y16A 4CVZB 4OFIA 1JWSB 3U82B 3D0LB 5C7XL 1CFVH 2PR4H 2VDQL 3TIEB 5I18L 4Z76A 3PL6A 5FGRA 1EHLH 1X5KA 1X9QA 1AGBB 2GUOB 1NFDA 5ICXB 2R2BA 3V5KA 4D9LL 1CICB 3BX7C 2EDLA 2VIRA 5C0CB 1OCWL 4G8GB 1Q0XL 1ZLWK 4HKZA 3TBYB 5SX5H 2UZIH 1IEBB 4YZFF 4BH8A 1VFOA 2IALA 1DANU 4ZO8A 1JZ4A 4JO1H 4PJDB 1PDKA 2BRRH 4TNVF 3NIDF 2J8UB 3K1KC 2R23B 5EOQH 4U6YB 2ARJQ 4WI3A 3V6OC 5L2KA 4JZOB 4P5MB 1UA6H 3GNML 4OZIE 3CFEA 1LE9B 1QR1A 1AGEA 2VLKD 5HGHB 4D9QD 2PNDA 3KWWB 4Z9KB 2PYEB 2OL3A 3IF1B 3TH2T 2AJZB 4C83A 2Z8SA 1IM3B 1VSCA 3S96A 4UU9A 3X17A 1UZ8A 4JDVB 3HFML 5EBGA 1CDCA 3P4NB 4JHZA 2DYPA 2Y9RT 1NBVH 4HS6B 3SDAD 3NOIA 3FT4B 4HAGA 4CU6A 2FO4A 1AXTH 3KAAA 1JGVH 2DQGH 1NGWA 2F8VA 3VXRB 3F7QA 3OX8B 3GRWA 2ATKA 4N0RA 5I1GL 3KPSE 2ADGB 3L6FB 5C6TH 2OYPA 3L3JA 3K0WA 3CX2A 4RBPK 3CH1B 1KCSL 2FSEB 2EDFA 5HYSG 4YIQA 5AG9A 3N1GC 4NN5B 5B39G 3OKKB 1XZ0A 1M71B 5DRZA 2A6JB 4PTTB 4J3OC 4M7KH 2XT1B 4WGVB 3EO9L 2ZOLB 3UTQB 2A6IB 1YMHB 3DARA 3GSQA 2H6PA 2A9ML 3EFDL 2OTUB 3OKMB 4D94A 1Y6NR 2AEPL 4JO4H 4XH2A 2IPKA 2YMXH 3MBXL 3EJZC 1G7MB 4HXBH 2R2HA 2EDKA 1I7TB 1YDPA 3ROOB 2EIDA 5CEZH 1T6VN 4TULH 3WDJA 4Y16D 5IW6B 5IROC 4EI5D 1U8KB 1IT9H 4N8VB 3DUHA 5BVJA 1FV1B 5ACMA 3UPRB 4LLVA 1WFUA 2IQ9L 3PL6D 3WEXB 1JFQH 25C8H 2GJJA 5KVMC 4KKLD 5GS0H 1AKJB 1LEGA 2IBBA 1HOCB 1N2RB 1BOGB 3FB6A 4JO2H 2ESVA 1MNUH 5GSVA 2NXZB 3BGAA 3G6JA 5F9WC 1F11A 5TGBA 3PQYE 1T7XA 3LEYH 4JG1L 4WHTA 4LMQI 1L7IL 3RGVB 1GPOL 4QRQB 1XF3A 1A14H 5FDWB 4UTBL 1M05B 5L2KD 1DQQB 4H1LG 2HTKC 4P23A 1GC1C 2NY3C 4LIQE 1JTTA 2VABA 4HKJB 4L9LA 4U1HB 4W6YB 3ROLA 3S98A 5AZ2L 2FX7H 4HUVB 4YPGA 5HYQB 2IAMB 1ZHLA 1Q9OA 1R3LB 4FQJL 2HTLD 4AT6A 5ISZE 1F90H 4KUZL 4WU7A 4MXVF 5IJVB 4ONFH 4DKDC 1D5XA 4U3HA 3QUZD 4XX1E 1Q8MA 4YHNA 5DK2A 2Z4QB 4APQD 3QIUA 4X5WB 4XAKE 1WBYB 3VDBA 1VPOL 1Z5LB 3WS3A 3GSNB 1DBMH 3S3PA 4OLWH 3E2HB 3VFMB 2HWZH 4QHKI 7FABL 1P1ZB 4DAGH 5JOEA 4YX2H 2V5RA 3KYOA 1U93A 3GKZA 3E1F1 1IAII 2XWBB 1U3JA 1KN4H 5LWYH 3B6SA 3BQUC 3AU1B 3QUMH 3LOWA 3QQ3A 5CS7A 4EI6A 1JGUL 5KSVB 1D6VL 2IADB 1H0DB 5D1XC 1ETZA 4XC1H 1UCBH 1ZA6A 4M8QB 4NDMB 3ARTA 1ITCA 5IKCA 5A2FA 1XR8B 1A9EB 3EYOA 5I1CL 1KUMA 1FYTA 3C5JB 3W2DH 4JCMA 4QOKD 3L5WA 1K8DB 2AK4E 2LABA 1FHGA 3D3VD 2FR4A 3RTQD 2DWDA 2HH0H 2DQTH 4JQXC 5E94A 1H8NA 1BREA 5K9QI 4PREA 1GH7A 5MHSD 3FCTA 1GYAA 1GGCL 3RX8A 3ARSA 2FBJL 4XVUC 3QWOB 4M6OH 2I9TB 3SOBL 1YEJH 1U42A 4JEGB 5FM8A 1TIUA 3QYCA 3DRTB 3H7LA 4Y4HB 4X4YB 1R0AH 5BMFL 2ESVD 5CUSH 2APVA 5I8EA 1MJ7H 1N4XH 3V8CA 2VNCA 4O9HL 4PLJC 4Y8DC 5INDB 1CVRA 1RZGB 2VLJA 3U4EA 4IDJL 1LP9F 4J3TA 1MCOL 4PJEF 1J11A 3MFGB 4WU5B 4YBHA 4WI4A 3D85A 1CXEA 1FGVH 3HC0B 4KVNH 3OXRB 3MRBA 1OM3H 1YEFL 4FHBD 5BO1H 1B6DA 1FH5L 3K4AA 4U1KA 4EN3C 1AQDB 4K7PH 5C0FB 4GUPB 4JVUA 5IVXF 3TO4C 3RX7A 3SDDB 4A6YH 4NRXA 4I9WE 5KVEH 1QO3B 2NYYC 3VFWB 2HJLB 3K8MA 1DUZB 2X10A 1KC5L 5DRWA 5F1IB 3OSKA 4YZFE 1I9JL 2AW2A 5EUKB 2APBA 2HFEB 2V2XB 3Q3GA 3NIGE 1T7ZA 1OAUH 1FL6B 5D70L 1GOFA 2CXGA 4TN9A 1KELL 3MRCB 3PWLB 5FYLE 3BPLC 3NFSH 3MRPA 1GAFL 2E3VA 2WIIB 1CD0A 2P5WE 1XF1A 3O2WL 2C1OB 4XNZB 1VACA 4YHIB 3QFJB 5FO7B 4NRZA 4M7JH 2HJFA 2IH3B 3C2AL 1K5NB 2CK0L 2R69H 2XXCB 3C9NB 1PGRB 4N8CL 1BF2A 2X1PA 4WTZG 1BQHB 1EMTH 4K7PX 1KJ2H 5HSFA 4X7TA 3EYSL 4M4PA 4PJAF 3DIFA 4XNZC 5KS9F 1K2DB 3F5WA 4FQHA 1J8HA 3BD5A 5EOTB 4N5ED 3ZKXB 4IOSD 2XPGA 5EULV 2OS7A 5I17B 3LKOA 5CJQL 5IQ9A 2VDOL 5D1QB 5D7JB 2E6JA 1IQWH 4ZUSA 1S7XA 5CD3A 4NNPL 5BZWB 1M6OA 1CL7I 4QYOA 4UNVA 2ORBL 3OKNB 3V8OA 3RNQB 4QTHA 1NBYA 3C08L 3TBSA 1T3FA 5E4IA 3QUMA 1QFWH 4TTDD 3FT3B 5D1QC 2HFGL 2VZOA 3CK0L 1UB6B 4XMPH 3WFBL 4I0PB 3U1SH 1N26A 4NC0B 1OWRM 1GSMA 2SEBA 2ZG3A 3WE6B 2DQUL 1W8OA 4I4WB 2ZPKH 3Q6FB 4BK4A 5MENA 5EWIH 4CJ1A 2CKBB 2VL5A 4ZUUA 2VQ1A 3TBVA 1B6UA 5CEZD 4KXZH 1AXSB 1A7PL 1X6LA 5EFIA 3EJJX 4QT5B 3CSYB 1MEXH 4XCFH 3CX5J 3MO1A 3S5LB 1CLOH 3CFCL 4WTXA 1NCUA 5D5MB 3MGOB 2APFA 2E27H 1OPGL 2GSGB 4CNIB 3QO0B 4LCUB 4G8IB 2VLJD 1TTFA 3AXLB 5GS0D 5HJ3A 1FORL 1YPZB 4KFZC 4NZDA 1JBJA 3C5ZB 3D85D 1B2WH 3RVTD 4YAQA 1KIQB 4LEXL 2G60H 3RVVC 4QHNA 1NCDH 4QXTB 1B88A 1TTGA 5DRXA 2Z35A 3VFSB 3ZDYE 2FX9H 3KYAA 5EN2A 4HULB 3C5ZC 4GG8A 5DK0B 4I18B 1OW0A 4YE4H 4EUPH 2J8HA 3GGWB 3NA9H 4YBQD 1T5XB 3BH8B 4MS8C 2YOCA 1OY3B 2MQ3A 1GGIH 1XIWA 3WFEL 3LCYA 4FQQA 4PRHB 5F96L 4DZ8B 5CKAA 3RZCA 2YZ1A 4OCSH 3K8KA 4TUKH 4Y2OA 1JGDB 3DSNA 2C4FU 3U30C 1JPFA 1TJGL 3MRKB 1PKQE 1WIPA 2R0LL 3DI3B 3MRLB 4GRLB 4NNXB 4UQ2B 2W0KA 4KK5C 4A6YA 4G9DA 5AD0B 1N0LA 4RGNB 1IL1A 1S5HB 2VISB 3VW3H 1RUKL 4GRWF 4R4BB 4ERSL 5E24E 5FCSH 3MNVB 5SWSE 1Q94A 4B41A 3KYKL 2R56H 3N9GL 3O2DH 4JHBA 3QUYC 4P2QD 2A6KA 4EBQH 3VXOA 1J8HD 3HZVA 3WFDH 3UTPE 4MXVE 3ESUF 3ZDZE 1S78C 2ICWA 4HUUA 3R06A 4I3GA 3OGCA 3W81A 1UC6A 2YC1B 3DX8B 5GS3A 5HI4C 4GXVL 3B2UD 1X5IA 5DGQA 4JGUA 1E6OL 2YD1A 4LIQH 2AK1L 3HZKA 3ARPA 3D87B 4QRUB 3WJLC 1IGIL 1KJ2A 4UOW0 3S36L 3TFKC 5KW9L 5H2BA 5DS8A 5KG9B 5DEGB 3QDGA 1NCBH 2PF6A 3V95A 1NGZA 4NRYB 2DM2A 1NKOA 4XXCA 5DYOA 3NCFB 1WUNT 4XP5L 2C4XA 1VGKA 2GT9A 5J13B 1M7XA 4YDIH 5MEND 3IVKA 3B3IA 4ELMF 1RZKH 1T7YA 2NY1B 4OFDA 5FA3A 2DTMH 3QXDA 3PP3K 3QG7H 4L3EB 2EDEA 3K3QA 5TE6H 4CRPA 2WZPD 5JNYB 3L7FA 4BQCA 3BW9A 3QEGH 2ERJB 4XGZA 4P2CG 4LSUH 1K4CA 3X3FH 4OZGF 1MAJA 4JQVC 1A5FH 4P59L 2QQLL 2PW2B 4Y5VA 4Q74A 5BZDB 4WO4A 1DTUA 4Y1AE 3OF6A 5JW5B 2D7TH 2BJML 1FAIL 4F57H 9CGTA 2DQGL 3OR6B 1QYGL 4PJ7B 1G7IA 4XPBH 4UQ3A 3BP7A 4LAQL 5MEQB 5JORB 3VG0H 2IAND 5ID1B 5AEAA 3F7VA 4R6UA 2OR9L 1I8IB 5T33H 4HQQH 2X70B 1MHPL 1XIWD 2O5ZL 4OLEA 4PY8J 3LKPA 3WDIA 5HHPA 3UC0H 4CADA 5IOPB 3JWDC 2RAMA 3OKDB 1EEZB 1OAKL 1L0QA 1U95B 4RIRB 1MELA 5J1AA 3FKUS 4M7KL 3JV4A 4X99A 5F7LB 1IC7H 3P11L 1AIFB 2AKRB 1LP9E 1RJZA 3DYOA 4ZO7A 3CXHJ 3UJTL 4PJEE 5DVOA 4X7EC 4EUPA 3QHZH 1OARL 1UM5H 1YYML 3HI1B 3C60C 2BSSA 3BHBA 4MNHB 1V7MH 5IB5A 2HJKA 2C3VB 4QHUA 3Q48A 2AJVL 3EOYG 4EIGB 1INEL 1IARB 2DLFL 2F19H 4F37K 1CT8A 5IVZB 5J3HD 1OSPH 3PWUA 3VFVB 3HAEB 5I1IL 4NUGH 4JFZL 5KSBB 4TULL 3ZSTA 3JV6B 1J1XH 3MRGB 3ARGA 1Q72H 5KSAA 3MRJB 1A1OB 2AQ2A 4M62H 1I3RA 1FJ1B 3RWGB 3O2DA 5GS0L 3RU8L 3GMQA 4PJGB 3V0VB 5MERB 3QDGD 4OD1H 3DYMA 4HC1L 3C5SB 2ADFL 1N5YH 1E6JH 5ITFB 1MLBA 5ENWA 4GKNB 4ONGH 5EBWA 4LHJB 4O5LH 4OM0L 4K7FB 2CO6B 4WFHE 1G0YR 3N06B 4G8GE 3WFZA 4PJHB 1HI6B 1QBLL 4OJFH 3CVHB 2A77L 3V6OE 1QA9B 5IG7A 4PJDE 5IB3A 3OGOE 4N8VG 1JZ2A 4C58B 3SY0B 1JPSL 5EUOB 1QSVA 5F7MC 2M2DA 3S4SB 3I02B 3AC0A 3BIKA 4BA8A 3WHXB 4ONFL 3DI2B 2I24N 4WO4D 4NKQB 4M7LL 3GSXA 4X9GA 4Z7VF 3SCMD 4E41A 3O3EA 4FTVA 4YHKH 1FQ9C 3ARQA 1LD9B 3BDXA 2ZUWA 2JJTC 2OSLB 2Y6SD 1E4KC 1A4KB 2V6HA 3V5HB 4W68A 1YQVH 5L8LB 1HH6B 1MI5E 1URLA 3GMRB 4LRNL 5AYUL 2A6DA 3VXRE 4LF3B 2WQRA 4K9EH 5KZCB 1KEMH 4XMLL 1QUNA 4NPYA 4ZUVB 3FQRB 3RVUC 2E7LC 4GJTB 1I7UA 2VDKH 4NQEA 4LHQB 3RL2B 5FF6A 1XGRA 3ABZA 2Z0BA 2YA1A 3P0GB 5DC0A 5E2WL 2AXGB 3MUHL 4WWKB 3QJFA 3F8UB 2WBJB 3SJVB 2AK4A 4ALAH 5DJYA 3GIVB 3AUVA 1BLNB 4P2RB 4KUCD 5J89A 3T1FB 3FB5A 3MLUL 4YLQT 5E08L 4S1DD 4XVJL 2PXYB 5DQ9B 2HRPH 1YNKH 3I75A 1JN6B 3BP5B 2ZUTA 1GXEA 4HS3A 3V4PH 4OI7A 4JO3L 2DQTL 3GHBH 1S9YB 1UCTA 3LDBC 5TH2B 1BIIB 2QQNH 5T3ZE 5CWSB 4JY6B 5KSAD 1F5WA 3MBEB 4QCIA 1X5LA 4G7VH 4LLDA 5E99L 2HMIC 1K4DB 3G6DH 1VADB 1OAQL 3S34H 1HZHH 3U0TB 5DO2C 4IDLA 1VFUA 3DX7A 1DSFH 3PQYD 2HKHL 1P9MC 3RHWK 5HVGB 1JGLH 4JPKL 4L9DA 3T3PF 2OCFD 3EJYC 1LO2L 4U1IA 4M1GL 1KB5H 3JTTB 2R4SL 3TCXA 2X4TA 2YSSA 3DURB 4XNQA 3QRFM 1IAKB 4X4XA 1CE1L 3QNZA 1H5BB 3VI3F 4U6VH 1MFNA 1VEPA 4NQCA 4WW2A 3GI8L 4HHAA 3MACH 3O41B 2AERT 1I4FB 2P8LB 2UWEB 4GAFB 4XXDA 2PW1B 3IETB 3LZFH 5ISZD 1MF2L 4QHKJ 3BYTA 5FFLA 4KHTH 1HSAB 4KU1A 4X6EB 3KS0J 4TRPL 3MCLL 4GKZB 4XAKD 1SYVB 2XA3A 2Y07H 3FQUB 5IQ7L 4OTXL 1MLCB 4NZTH 1C5CL 3MV8A 5DA0B 3O3DA 4LQFL 3VFOA 3MRQB 1I8MB 3L1OL 3QJHB 5DFWH 1OAUL 1G7LA 3K46A 3H9HB 1EHAA 3NFNB 4E41D 1HXYB 5MI0B 4PJ5E 4PV9A 1T04B 4J6RL 4ELME 3Q5OA 2AI0H 1RZFH 1RHHB 1AY1H 1AXIB 2V2WA 3U7AA 4BFGA 3BPOB 3LPFA 4N90E 2EYSA 5EDXA 5DZOA 5I75C 4DN3H 4OF8A 1EVTC 2YEZA 1NFIA 1BX2A 4PYGA 4OLUL 3SE4A 4CMMB 3W39A 2D7PA 4AIOA 2W0LA 5L88L 1X5JA 4U1SA 4GMTL 4P5TC 4NO2B 4KZDH 4N1HB 5D1ZA 2IEPA 5TFSH 1NMAL 5FHAH 3B9KB 1MWAB 2AK4D 2Y23A 2BVUA 4DGVH 5TQ2H 1RJCA 4ZPVB 4GQ9L 3VFTA 1BPVA 1WT5C 2CD0A 1NJ9B 5F93C 4ODWB 1BZ7A 4X8XA 3O9WB 2LU4A 5FO8B 3STBA 3WUWB 1YJDL 3B9KC 1MCPH 3TZVA 5TF1L 4XP4L 3MCKB 1P5UA 4UIKL 4C57C 4PRBB 3G6AB 3IJYA 1BQHG 1J0JA 1KT2B 2ZPKL 3CJJA 3IDGA 1IBGH 4WFFE 1T1WA 2NLJB 3WO4C 1ZT4B 3CFKB 5CILH 1JPST 4TNWF 3LKQA 2EE6A 1MFEL 2R0WL 4L5FL 4RISL 2B4CL 5F3HB 1R3HB 4U1JA 5ERWA 1R24B 3QEQA 5FDYA 4WJ5B 2EYTA 4ZUTA 1YEGH 2B2XH 2E27L 4LSTL 1DQJB 2KPNA 3IFLH 4WEBH 4HV8A 4L4VE 5KTEL 1R5VB 1PVHA 1GGYA 3AM8C 1C1EL 4I9WD 5F89A 3S37H 5HHMB 4PRDA 1XGTA 1MCLA 5EU5B 2DLEA 4JPVH 1H3TA 1TXKA 1KB5A 1KEGH 2AEQL 2XACC 4KJQC 1IGYA 3MRHB 1ODAA 2J5LB 5FYLD 4Q9BA 1PZUB 1WTLA 1RIUL 1LDSA 3C6SA 5CJOH 2P5WD 3GMLB 3K2UH 4YE4L 1DVFA 3GBLA 3BUYA 35C8L 4UT9H 3V6ZA 3L5XH 3OKLA 4JFOA 1YUHA 3S5LG 2F53E 1CZ8H 5IHZA 1PG7L 1E4WL 2IBGA 2P47B 1BM3H 3KPOA 5IMKA 1XGYH 5A16A 4JPWL 4HWBA 4M3KB 3VWKA 1UYWL 4NYLA 4HX1A 5FYJU 4PTUA 4F7TB 5MEPB 3W9EA 1RIHH 4R7NA 5SV4A 5TDNA 2D31A 4Y5YA 1BGXH 1JPGB 3ELAT 4FXGA 4CVXA 3RY6A 1T4KB 3H42H 4E42A 43C9A 5IBTH 5GZNC 2JB6B 1B3JA 3PWPA 1MSPA 5I15L 1S9VB 3EYQD 2ZSVA 2WV3A 2GFBA 5D1ZD 3UO1L 4F7MB 3QEHB 1CDGA 1ZV5A 3VFRA 4J4PC 2FO1A 1HXMB 2W0FA 4MAYC 3IDIA 3BWAA 1EFXA 5ADPH 3MMEB 1DN0A 3PJSB 4IRJA 4KKNA 1T22B 2FJGA 3UPAA 4LIQL 3CSGA 5CMAB 3N0PB 5I1LB 2DB8A 2BNRA 3OTTA 2VC2H 4GMSL 2R0ZH 3QXAB 1HN1A 1DQDL 3TZVD 1F6LL 1ZLSL 2RHEA 2X7LB 5K9JL 3HPLA 3BZEB 2VE6B 1GZPA 4I5BB 4DGYL 1DLFH 2QQKH 4G3YL 2CIIA 4BZ2L 3EHBC 1HSBA 4Y5XC 3GJFH 4KGLA 3LD8C 1QKZH 4XCEA 3EDJA 1T0NB 3H8NA 4UILL 2MJWA 4JFFB 1QFWI 1CWVA 1XF5B 2DMCA 1JWUB 2OP4H 1X5YA 3MRDB 1FRGH 1OAXH 2F58H 5C09A 2HT3D 1X5ZA 4M1CD 4U7MA 2LTQC 1TVHA 1ES0A 2E9BA 1AGFB 2YPVH 4FFYH 2XWTB 3LV3B 4XVSH 2X1OA 5DMIL 5C07B 1BZ9A 5D5ME 1DBKL 3QBTB 3T0DA 3QSKB 4EXPX 2D7TL 4JRXB 1I1AA 5D2NA 4F57L 3GO1H 2YD2A 2YRPA 3P77B 3TVMC 1T6WA 1YPZE 5IT2H 3LQAC 3QH3A 4ODVH 1G9NC 3HNTL 3RX5A 2BNQE 4MSWB 5IHUL 4RFNB 4HWZA 3IS0X 5FB8A 1DVFD 2IWGA 1MY7A 4Z7WB 5DQDH 4L4TE 1JNNH 1RY7B 1LP9A 2D3VA 3REVB 2F5BH 4PJEA 1S7RA 1BF8A 2UVEA 1HE7A 2NQCA 2JCCB 3VWKD 1LO4H 5F7WC 3D9AL 5I19L 1FFOB 4P46A 5IVXA 4OCXH 5E2VH 4CVWA 1KTLA 2X4SB 3OHXA 3V52H 3I6GB 5ESQA 1UKSA 4H25A 3UTPD 3P0VH 5E6IC 4ACPA 4P0DA 4GRWH 1HIMH 2XQBH 2XKNB 2Q86B 5FOBB 12E8L 3M17A 3RKDC 8FABB 1U8NB 5TQ0H 4QXUH 4U0RB 3WD5H 1B9ZA 4NBXB 4TVPH 3CUPB 1U2CA 4ETQA 3S36X 3MA9L 2BOBB 4KK6C 1LNUB 1RURH 3VGEA 2MCPL 4IRJD 1CGYA 3WBDA 2DMKA 3T0AA 5F88B 4M62L 2EYRB 3O8XA 5FA4B 5JA9A 4MZ2A 5D7LB 2B1HH 2BNRD 1B4JL 3LB6C 2ZSWB 5DT1H 3QXUA 4PJAA 2BVOB 4P2OB 4YO0B 5KS9A 1JZ8A 3RWEA 1BFOB 4PD4J 3WV0A 4NHUB 2CIKB 3VGAB 1LK2A 5CZVL 4KJYA 3TP4A 1M4KA 5C0ND 2VH5L 3I2CH 4PLOB 3V6OA 3DOSA 5TDOA 5E70A 4O5LL 1DUYB 3LKNA 1OP3H 1YNTB 3F7YA 1Q9KB 2CUMA 5J12C 4LCIL 1KYOK 3VFGH 1A9BA 5FYLL 3HAEG 1YN6B 5JLZA 1C5DA 3TYFA 1UH4A 3FOLB 3LH2L 3VMPA 3RAJH 4KQ3L 5C09D 1JZ5A 4JHWH 1I8KA 1AP2B 4PY7B 4Y1AD 2OI9C 2BVEA 4TNVK 3N85H 3B83A 5DWUH 3LEXA 3QI9B 1ZVYA 4NZRL 3KPLB 2UVFA 1QVOB 3IB4A 4HIIB 3GJFA 5FGCB 2DL9A 2HLFC 4F7EA 3BN3B 3NZHH 5E56A 1WK0A 4WUUE 1AHWC 2CO7B 3R0NA 4YFLF 2DQJL 4Y2DA 4G6MH 4Z0XA 3SE8H 1JNHA 1G9EA 4S0TD 4L8DA 3VXUB 3PNWA 2BVQB 2P43B 1CFTB 3H9ZA 3LPGA 2BFVH 1D6EB 1YMME 2WWMC 5DHVH 1UZ6E 3UBXI 5L8KB 3CZFB 3UAJD 5C86A 5IFHL 1YQVL 1HHIB 2L7UA 1FNGA 5T1LD 5IBLC 1XCTB 1MREL 1K8IB 5D96B 4YHZL 1UJ3C 1U8IB 3AS0A 4U2YA 1MFAH 2CUIA 3S4SG 1YN7A 3MLSL 4ZDHB 3T0VA 5JO5A 5GJTL 4I2XB 5IBUB 4P46D 4PLKD 4F8TA 5JR1L 1CXLA 4QRPA 1J8KA 3JV5A 1C08A 3GFUA 4XZUA 1A0QL 1OLZA 3OAYH 5DLML 1ZT1A 5F9JA 3RDTC 2ENSA 5CJBA 3MLPA 4PJFB 1CDJA 1WTGT 3GSWB 3HR5A 3RWIA 4UV7H 5IROA 3VDCA 5GRJL 2VERN 1KB9K 3T3MF 1P2CA 2DIBA 4IMLA 3VFPA 2YA2A 4PGJA 3V4PL 3VRIB 5DXWA 3OB8A 5GXBB 5JIIA 3MOAL 3I9GL 3CU1A 4XI5C 1RAMA 5E9DA 1MCEA 4G7VL 2R2EA 5EO0B 1L6ZA 4JB9L 4YGVB 5CBAA 1ZWIB 4H5SB 4LLWB 3QXWA 4WFHD 4LCWB 3SDCC 1I7ZB 1JGLL 4Q9QH 1FZOB 3LKSA 2DKSA 3OAZK 4N0UB 3U6RB 3P9LB 1KB5L 2KQMA 4NZUL 1BBJB 2G75B 1NBZB 4PJ8C 5IB1B 5JQ6H 1JI2A 4X6DB 1NCWH 3L3HB 4H26B 1I9RH 1HHJB 1TETL 2BSED 2Y1VA 3RP1A 3GB7B 1UWEL 4IS6A 1L0XA 3O3BA 2A9NH 3BRGC 5B8CA 2EE9A 3EZ8A 5BV7H 2P42B 3I50H 3C09B 3RUGB 4QEGA 1UWGH 4WCYL 1FPTH 2IH1B 4HWBL 1EERB 5BRZE 3ULUH 3HCVB 2P8MA 4QHMB 4PJ5A 4ELMA 2C26A 4NKOA 4P3CH 2I07B 5SX4I 1UB5B 4G7YH 5C08B 2C9AA 2APWA 4XWOC 3KPQB 1Z2KA 3IFOA 1HHGA 1U8PB 4LVHC 1FCGA 4HS8L 4OT1L 2R1XA 1MI5D 1KV3A 3PWNB 3U0WL 1V3LA 4LLMA 5DJZB 3JVGA 4FQCH 4P2YA 3U7WL 2O5YL 3BQUA 4K23L 2CLVA 2YPKA 3QT2A 4OZGA 2UZYB 4GKSB 3ARVA 3PHQA 5D1XA 1QHPA 4L1HA 3G9VA 1W0WB 4JPIA 1YEHH 4PB0H 5H94A 3GBNH 4I13B 3MJ8B 1RUQL 4NO3B 4OAWB 1HINL 3EJZD 4MLSA 5D72L 4QRTB 3EYUL 5DHVA 1FVCA 4RNRB 4F15C 3IXAA 1ZANH 2ZOKA 5KANI 3LSOA 1FZJB 2OJZH 4G9FB 3QCTL 5IFJA 4JCLA 2GK0B 4P57A 4JQXA 4XPTH 4IBLT 5GS2H 5EORL 5GGRB 5T3ZD 2FHBA 1F3DH 3WKMH 2R1YB 4R4NC 5CFHA 1VENA 5EO1A 5FUOL 2JLLA 2OR7A 3SPVA 2I25N 3PIQA 5J11C 4WW1A 1CGSH 3O11A 4ZFOL 5ALCL 2E7CA 1RV6X 1N59A 3E3QC 5H35B 1JP5A 1KPRB 3U9PL 3SKJL 4Z7UF 4HPYL 2OX5A 4BSVB 2XNAA 4L8CA 1D7FA 1I1YB 5GGVH 2F54A 1RUPL 4WV1B 1CFBA 5FIEA 2DJUA 1QP1A 4OF6A 2HTKD 3OJDB 1CGWA 1LO0L 2NY3D 1JUFB 2DKUA 2GTWB 2VZSA 4O2EA 6FABH 2A1WL 1U92B 5CBEA 4UDTB 4DUWA 5ACZB 2FIRT 1CE6A 3WUWG 4WV1C 3TT1L 4EN3A 4ZS6C 1YEDA 4ORGA 4OUUB 3BGFB 4ZNCD 1EO7A 1J0KA 4S2SB 2D9CA 2WUBL 1RZIA 2JIXB 1G7PB 4IEFB 1F02I 2J8UF 4ETYA 4IRSC 2CK2A 3FFDA 5DD5L 1RFDH 2CXKA 1KLGB 2VAAA 2F53A 1F4AA 3S3SA 1WZKA 3FRPG 2VXVH 1J87A 4PJ5D 4R7DB 3BVNB 3MREA 1NC2A 3L3KB 3K2UL 1BD2A 3CFBA 5GGQH 5DJ8A 5ABDE 4OZFB 4JN2B 1MPAH 1BIHA 5E8PA 5GJSH 4N90D 3KR3H 4X9FA 1E27A 4ZSOE 3FB8A 5I1DA 5TDPA 1RIHL 3FO0L 4ZPTB 4YC2C 1N6QH 5DD1H 3BQUD 4Z0BH 5ACLA 5ELIA 2XN9E 2X4RA 1A7RL 5E03A 4DKFH 1O7VA 5JDSA 3AS1A 1KG0B 3H42L 5D1XD 1QEWA 1FVDA 3CVIH 5E4EB 1FGNH 3TBTA 3GSRB 1W72H 4NSKA 1FVEA 1BFVL 4X5XB 5JPNB 1MHEB 1FFPB 4GAYB 3FRUB 4P9MH 4Z7VA 5F9OL 1S8DA 5L0QC 3ZT7A 2C5DC 4D0BB 3O0RH 4CJ0A 2ADJB 1MQ8A 2VLKB 3D18B 1U3HC 3P4MB 3MODH 3P0YH 5CSZB 2XZAH 1NDMA 3FO9B 4R3SA 5D93B 4LFHD 5FUZH 5I73C 3QQ9C 4I3RH 2DS4A 4J2XA 1OGTA 3QQ4A 4WFFD 1AJ7L 4LU5H 3A6BH 2FATL 4XVUD 1EBPA 4CMHB 1XGUA 1SM3L 1HHKA 1GZQA 3O6FC 1IE5A 2GIYA 3OPZH 3W0WE 5GS1B 3SDAB 1SVCP 4YHYC 4NJAH 4AG4H 1S7SB 4LEOA 1RZ7H 2D7OA 4ODSL 4NBYB 1AE6L 3V5DA 5HPMB 1WBZA 3LRHA 4JKPL 2LVCA 4PLJD 3MLRH 4OLVL 4F58L 2F54D 3L5HA 2EC8A 4L4VD 4XCYA 3QXTA 2LQRA 3GUTA 3MRMA 3MZGB 4FNLH 2Z93A 3B5GA 1FRGL 3RIAF 3DO7A 4XNMA 4LK4A 4HT1L 3T3ME 1CLCA 2YPVL 4EN3D 3HHRB 4FFYL 3TO4D 4KI1A 5F6HI 3RL1A 2QHRH 5DD0H 3VH8B 2NYYD 1HHHA 4XBEH 1QBAA 4F3FA 3S3JA 1KTDA 4YQXL 4ZS7H 4D0CB 4K2UH 1SEQL 4B5EA 4POUB 4TTGA 5JHLL 1XCQB 4L4TA 2NNAB 4ZTPH 1PG7X 3PGCB 3DBXB 3UMTA 3X3GL 2FH6A 2F53D 5C0JB 1NKRA 3O6LL 1ORQB 4MJ4A 1RZJL 3GBMH 1NC2D 4Y16B 4ZTOL 4XAWH 3SGEH 4EQ2A 3MJ9H 1DEEA 4JQIH 2LE9A 4EI5B 3WLBA 3KNBA 4NN6B 4OFYA 4Z76B 3PL6B 4U4BA 5LG1A 3RZWA 5T3ZL 3C6LA 4JANA 1KPVA 1MVFA 4XP9H 3VCLA 1NFDB 2LVEA 2R2BB 3V5KB 2J6EH 4R8WH 2EECA 3EIFA 3QUYA 5IB2A 2GSIA 4HKZB 1CDHA 3HS0B 4FFWC 3MV9E 3V6FA 4W70A 3BMWA 2MKWA 3AB0B 3HG1A 4KKLC 3WNKA 3VD3A 3G5XA 3SKMB 3QDAA 5TQ0L 5L2KB 3HB3C 2Q8AH 2Q6WB 5LJYH 3CFEB 5D1QD 1QR1B 1F2QA 1AGEB 3EO1A 4G6FD 4RFEB 1FE8L 3OKEB 5GGRY 1YY9C 1GC1L 3MLTA 2E5EA 1MFBH 3CNKA 2Q8BH 3TBWA 4OKDA 2OL3B 3E6FA 4C83B 1KBGH 4FQXC 3SDYL 3DWTA 1W72A 4C56A 3S96B 4UU9B 3TPUA 1RIVL 1UZ8B 2EIZA 2AJSH 2DLHA 4RX4D 4RAVA 5K33A 3QUZB 4APQB 3I2CL 5JHDE 4G42A 1RI8A 4EDXA 1NANH 2FO4B 1NGWB 5DURD 4YBLB 4U1GC 4M6ML 3HNSL 2ATKB 1ITBB 2R29H 2UUDH 1ZLVK 1ZHKA 3FT2B 5FGBC 1HKLL 3MOQA 1QBMH 1IGFH 4DUXA 1KCVH 4YIQB 3PP4L 4H1LH 1PQZA 1Z3GL 4R97C 4YBLC 3HI6L 4JQVA 1MRDL 4XVTL 1XZ0B 5DRZB 3FN0H 4WUUA 3RVVD 1KCLA 4NHCH 1I1CA 4RWYH 2DQDH 3N85L 3CC5A 1OP3K 1WZMA 3S35H 1LEIA 2IQAA 3GSQB 2H6PB 1H8SA 1RQ5A 3O2VH 2BNQD 5FYKE 3NZHL 3C5ZD 4DKEL 1YMMA 3NGBC 2P24A 4AQOA 3L3DA 4XH2B 3SEPA 4G6ML 2P5EE 4F80A 1QRNE 5F7YC 4L4TD 4MS8D 3G04A 3OB0H 4KY1L 3LHPH 4MD5A 4QOKB 4KVCH 1TVDA 1YDPB 5EOCJ 4AZ8A 2VDRL 2BOCA 5C07E 1DBAH 3D3VB 4OCYH 4FN0A 1F13A 2ZCHL 4K71C 4JRXE 5HHOA 4KK5D 1J1OL 3KPRE 1D5ZA 2Z92A 1CBVL 5FM5O 3BGMA 4M93B 3C60A 3S35X 4AEEA 4Z7WE 1G0DA 3QUYD 4G80A 3S6CA 3GI9L 3KJ6H 1XR9A 5J06A 3V7AG 4BSWB 5DVMA 4JFEA 2ESVB 3K1DA 1CK0L 1S78D 3NCBB 4FABL 1QFHA 3MJ9A 3G6JB 1X5HA 5HI4D 4WHTB 1KJ3H 5LBSL 1XF3B 1T1ZA 1Z0MA 1HCVA 1XH3A 4D0DB 4L3CA 3HC3L 1D5IH 3T2OA 2PUQT 3TFKD 1KN2H 2VABB 4L9LB 1MJUH 1N3NB 1ZLUH 1ZHLB 4JVPA 4LPXA 2BK8A 4B7IA 1E4XL 2HRLA 2LFGA 2IMNA 3MLYL 3WL9A 4P23C 1JGEA 1F6AA 5IBUG 4AT6B 1BVLA 4C56D 4AH2A 2DICA 1N64L 3MXVH 2W9EL 1D5XB 4D9RE 4MWFA 4YHNB 4KV5E 5DK2B 1A7OL 2YA0A 5IV2A 3EYVA 4KC3B 3BE1H 4KMLB 2QSQA 3OAUL 4JRWA 5JQ6L 4LKXA 3QWQB 3MX0A 4LCCC 1A1NA 1JNLL 5I1KL 5SWQB 3QIUC 4MNGE 3FTGA 4XBGA 3OJMB 4KH2A 1A64A 5BRZA 1U93B 5JW3L 4XP6H 3P4OA 4TVSa 1ZKAA 4R0LA 1NMCC 1A7BA 4NQSA 4XMKL 2EDWA 1SY6H 4Y89A 4R26L 3QCUL 4XNUL 4WUUD 2VR5A 2V7HA 1A4JA 1CGVA 2OLDA 3B6SB 4M1DH 2YK1H 2Z8WC 3DVNA 3QQ3B 4D3CL 1WZ1H 3D48R 1U58A 2MPAH 4MJ5B 1V7NH 1ZA6B 5KAQG 4YWGH 1YMMD 2JJTA 5IKCB 1E4KA 3T4YA 1CDUA 4H1LA 3QO1A 1GGTA 3EYOB 1WF5A 4ZAKC 1S3KL 4FMFA 5MEOA 3T65A 1U0QA 3WHE1 1TPXB 4PPTA 1CR9H 2FR4B 2DWDB 1QSFE 5E94B 3VXUE 1BQSA 5EO9A 5HHOD 2EDJA 4PREB 3F7PC 1T7WA 3MUY1 4MAUH 3K80A 1TPXC 2V5MA 2CUHA 3AS3A 3C60D 4LPUA 5JXEC 5KVFL 2X4PB 4U49A 4KDWA 5E1HB 4EXKA 1LGVA 1UEYA 4CW1A 1JK8A 3HNVH 1JRHL 4UTAL 4OM1L 3C2SA 2IJ0C 4HF5L 4DEPB 5I8EB 5LGHH 4MHHG 3U0PB 4R2GC 3HUJF 4OIIH 4U6HB 1U6AL 1QLFA 4JREC 3VRJA 2CKBL 5HHQB 3GMMB 2VLJB 1OGAE 4K8RC 4M7ZC 4ESKA 1ZS8A 1GHFL 2Z8RA 5A2IH 4ODTL 4M6AA 3D85B 3BEVA 3VJ6A 2X4UA 2D7NA 2FX8L 1EZVY 2VN7A 4JDZA 4U1KB 3C8HA 1EFQA 5DVLA 3ARXA 4NKIL 4NRXB 1OSZA 1ADQH 1CTOA 5HDBF 3LQMA 3RVTC 4S1SH 5DRWB 3WSQL 1VFBA 1KXQE 1G7JA 1QZ1A 2YRZA 3RPIA 1DZBA 2YBRA 1KFAH 1WIUA 5DSCA 3Q3GB 2V5TA 1IGJA 1SJXA 5DD6A 3UZEA 1JF1A 5LXGH 3INUL 2I5YH 3MRPB 4LCWE 3IKCA 4X98A 2C7UB 1VACB 4FS0A 1XGPA 5C2UB 1JNJA 1AFVH 2Z91A 1Y18A 1FSKC 4NRZB 4K3DH 3NABL 5BRZD 3IKKA 3N1PC 3L7EA 2RGSA 3BZDA 4U1LA 5DR5L 5GRYA 4X7TB 5C1MB 3ARDC 3VXSE 4P2QB 3F5WB 4YK4C 5LCVH 1J8HB 4LSPL 2BVTA 2XPGB 1HDMA 3H3PH 3D1MC 3T2PA 3RWJA 1I9EA 5IQ9B 4ZSOA 1IFHH 3CDFA 2M26A 2P7TB 3A6CL 3FMGH 2G5RA 1NCAH 5C2BH 1S7XB 5CD3B 1P4LA 1TJHH 1YEKL 2PYFA 5D8JL 5KVGH 1M6OB 4PJIE 1R3IH 1YECH 1MPAL 1II4E 4QYOB 1MCWM 1SY6A 2XN9A 4TSCH 2CR3A 2OZ4H 1FBIL 2HKFL 2H32H 1NBYB 4PIRF 4QTHB 3TBSB 1T3FB 1A7QH 3PE9A 4NP4H 1R3JA 5CIPH 3RVUD 3BMVA 4JHAL 4OZ4A 4TOYH 4Z0BL 2GAZA 4P5TA 3T0EA 3IGAA 5J4MA 4P3WA 2DKMA 4NT6A 2SEBB 3CIQA 3BISA 1ZEAL 1SJHA 3NPSC 2E9WA 4PJ7F 5MENB 2VL5B 5CKGA 3QRGL 4JFDA 4ZUUB 3NH7H 3TBVB 1F6FB 3WIHL 1WT5A 1ND0A 5E00B 5EU7C 2B5IB 3V4VL 3LIZH 5EFIB 3SDXF 1F58L 4OZFG 1NAKH 3MO1B 5TE7H 1FIEA 1GRWA 3QUKA 3W0WA 4HCRH 4MA7L 2HMID 5HJ3B 1J0IA 4G6KH 4LU5L 1AGDA 2KQNA 3IJHA 1FO0L 4YAQB 2WQ8A 1EEUA 4QHNB 1T89A 3U83A 3R4DA 1UVQA 3EYFA 5BW7C 5DFTA 5E8DH 3CLEL 4NJAL 5DRXB 2Z35B 3HKFA 1KCRH 1RZ7L 3EJYD 1N7MH 3E3QE 3P9MB 5EN2B 1I9IH 2VLRE 4GG8B 2IANB 3QA3A 4FQIH 3ZHLA 5HGAA 4CAGA 4HIEA 1XIWB 4FQQB 3JWOC 3N1FC 4XNXH 4DW2H 2X41A 1JPFB 1OW0C 4PJGF 3JWDL 4XPFH 1H8OA 4A6YB 1ADQA 1OWWA 3QPQC 3TN0A 5CJXA 4BQ9A 3RZCC 1IL1B 4TNWK 1EAPA 4PJXF 2NXYC 4QRRA 1G7QA 1IZJA 3V79C 3WNNA 4QTIH 4H20L 4K2UL 2XWJA 4HDIA 1IEHA 1IGCL 4RMVA 2A6KB 3VXOB 1BBDH 4PJHF 3LMJL 5F1NB 1X5GA 4N0YL 5CJ8A 5JIHA 5I8KH 5E2JA 1OOAA 4OFKA 3OGCB 4BQ8A 2ZKHH 1MY5A 5EA0L 5L6YL 5DHYA 1MUJA 3F65A 5D6CA 4YHMH 1ZTXH 3EFFA 5C0EA 2XN9D 3MV9A 1KJ2B 1MIMH 5ECJE 5DS8B 3QDGB 2VXSL 1GIGH 3I85A 4X7SL 3VH8G 4P5TD 2VMFA 2QV2A 5DYOB 4WY7H 4O2CB 3UTSE 3UTZA 5I0DA 3OZ9L 1VGKB 2GT9B 4J4PA 4MAYA 4NGHL 3MRFB 5DUMH 4OZIB 3IVKB 1ZAGA 5DTFA 4X80L 3B3IB 2OZ4A 2K7QA 2H32A 4JFXA 1A7NL 1QSEA 2VDLL 1RU9H 3HI5H 2XY2A 2VR9A 2GCYB 1TJIH 4RRPG 1IKFL 3L7FB 2BXYA 1A1MA 2XTJC 3BW9B 4I3SH 3X14A 1K6QH 3W0WD 1IC5L 1RZ8B 2V9QA 3BKYH 4OF3A 3HZYA 3BT2L 4HUMB 2BCKB 4XC3L 3CVHL 2OTPA 3O6KH 4GSDL 5E8EA 2VLKE 5HHXL 4WO4B 4Y5XA 4DVRL 4ENEC 2CDFA 3GSOA 4KDVA 1DQTA 1Q0YH 5DD3H 5EB9A 2X6MA 4IHOA 5F6HJ 5CGTA 5DUPL 3J7HA 1G7IB 1YA5A 1UM6H 3SCMB 5KN5A 4UQ3B 2HP4A 2N56A 4Y5VC 3UJIL 4HCRA 5EZIH 5ITBH 5F6IC 3F7VB 5DJ6A 2GQHA 4NCC1 1ZVSB 3MNZA 2DD8H 4GXUN 5IMLA 1J05A 3HUJE 3LKPB 5HHPB 2EDXA 4CADB 5CZXC 2PCPA 5BOPA 4LVOB 1DBBL 5FKPB 3MGTB 4TPRH 3FQWB 2Y6SC 5J1AB 2IFFH 3JV4B 2J2ZA 3QFDA 2DQDL 2P5EA 4HZLA 4X99B 4NM8H 2E9IA 4PBVC 1QRNA 4KQ4H 5HGBA 3FONA 2QTEA 4KJQD 4LASH 3TVMA 4Z7UA 4GBXC 4EUPB 3ARUA 2WINB 4YUEH 2CLRA 2QHLA 1QRKA 1JWSA 1ZA3A 5IB5B 3D0LA 1JPTH 4R9HA 4QHUB 5LGJB 1OAZL 3FQNA 4X0KA 4PS4L 3LHPL 3DX6A 1YEIH 1WAAF 2APTA 4U6TA 3PWUB 1DBAL 5ESVA 2GUOA 5ICXA 1CICA 4NKMA 5KSAB 4PRPA 1M7IA 1FN4A 1G7HA 1I3RB 2EIEA 2VB5A 3DGGA 3MV9D 1P4IH 4M48H 5E6IA 3G08B 3GMQB 4HXAH 2J8UA 5GZND 3ARGC 2AJYH 2R0KL 5FM4A 5I8CA 1MLBB 5ENWB 2YXFA 3ET9F 5BCAA 1QG3A 5EBWB 1DQMH 1NGPL 1RVFH 3CFDA 4GW1A 3VD5A 3NCJL 4JZOA 4J4PD 1NFDE 4MAYD 2H45A 4LLQA 5F7EH 1EO5A 5JMRA 3GSNH 4AENB 2BERA 3MLWL 1G9ML 4K3EL 1HWGB 2L0DA 5IG7B 5IB3B 2OTWA 3PHSA 1KN2L 5HYEA 3UX9B 1TLKA 4CUCA 5ISZB 5BJTB 5EIVA 3SQOH 1J1PL 1DFBH 3P4NA 1MQKL 1RUML 3M07A 4HIHA 4DKAA 5JHDD 4KTEL 1A3RH 4M5ZH 4LSSL 4XPAL 4NN7C 3S8WA 2EEBA 3BIKB 3KS0H 4EVNA 2LV4A 1FCCA 2EXYC 2CDGA 1IAIH 3EHBD 3UZVB 3MLXL 1F4WL 4UT6H 2VWEC 4HBCL 2QSCH 3NIFE 1ZLUK 1ZOXA 4MNGA 4NNYB 3LN9A 3GSXB 5ETUA 5I71B 3CH1A 2FSEA 1U8OB 4E41B 1RZKC 2ITCA 3O3EB 5B3JE 3W82A 5E6YA 3KLAB 2A6JA 3MLZH 2DM3A 5L7XL 3OWEA 2P1YA 3ARYA 1NLDL 3UTQA 3BKCH 3SDXE 3TJEH 3VXME 3UJJH 2OTUA 3X12A 3LEVL 5FYKD 2IFGA 4BKLA 4M6NL 4NPYB 4BZYA 5I76B 4JG0L 1F4XH 2CMRL 1I7UB 2P5ED 1BAFH 1V3JA 2XFXA 5FF6B 1WZ1L 1QRND 1XGRB 3VGHA 3T0XA 2FGWH 2VITA 3TLRA 2NY7L 1G7MA 3DMMC 4G8EA 3TVMD 1UWXK 3PGFL 3VXTB 3NFPA 2NPLX 1G1CA 3B9VA 3QJFB 3ROOA 5EU6E 2AK4B 4PGDA 5DJYB 5K59E 5IW6A 2AJXH 1QSFA 1AR2A 3O6MH 4X6CF 5HVFB 4MNQA 2NY4C 3FB5B 3KPRD 3TO2A 3D0VB 4NO5A 5E5MB 1UJ3A 3I75B 1FC2D 4QHLA 4AMKH 4JAMA 3WIIL 2AABH 5INCB 5D7IF 1MWAL 3DJ9A 1TQBB 4GS7C 1T2XA 1N2RA 1X44A 4QCIB 2Y06H 1KENL 2NY6C 4LLDB 1BOGA 2EC9T 2V7NA 1VDGA 3RDTA 5E6ID 5JXAL 1EDQA 4OCWH 3NCYS 3SO3B 3DX7B 2Q20A 2M1KA 3Q6GH 3RKDD 4XP1L 2OR8A 1CGXA 4W4NA 5I8OH 4PJXE 3RGVA 1OGAA 4QRQA 1C8PA 3C8KA 1JHLL 1M05A 1DQQA 4U1IB 5EC1A 4HLZH 4KK6D 4N0CC 4N5UA 2X4TB 4XNQB 2DTSA 5C6PB 3T4AA 4U1HA 1U8JA 3AVEA 3F58H 3QNZB 4YXLH 3R8QA 5FHBL 5GHWH 3TT3L 2IAMA 4G5ZL 4NQCB 3AREC 4LDEB 3P73B 2HVKA 1KOAA 4XXDB 3GMNA 3LB6D 1XF2A 5E2UH 1A3LL 3G6JE 2AV1A 4W4OA 4WW2C 4GH7B 2Z4QA 4JJ5A 1F8TL 3LS4H 2DQHL 3CX5K 2DQEL 1PYWA 5A2LH 1Z5LA 1ADQL 3DV6A 1JF6A 1P84K 5HDQL 2YR3A 1QNZL 3MV8B 4K07A 4KDTC 4P4RB 3VFMA 2Q1EA 3O3DB 2P5WB 2Y25A 4S1QH 2WUCL 4Z8FL 4X5LA 1P1ZA 3V4UL 1U36A 5GRXG 1NSNH 4QO1A 4BH7A 1WEJL 4PV9B 1MJ8L 2XWBA 2F74B 4GXUM 4CBPA 3VXSA 3LQZA 3KLDA 2FRGP 3EOTL 2ZUVA 2VAJA 1CL7H 2JK5A 4OQTH 5KSVA 2EYSB 3MLVL 3EDKA 3BD4A 4M8QA 4ZFGL 2HLFD 1FDLH 2ZJSL 1AC0A 3EGSB 4LVNC 4M9PA 4BFIB 2YEZB 1JV5A 1BX2B 4OBSA 4U1SB 2APXA 5BXFA 4P4KC 3QXVA 3H3PL 5D1ZB 3C5JA 3HE7C 4Z6AT 5IEKA 4E9LA 1BZQK 1K8DA 2WWMD 1NCAL 1HEZB 1TCRA 1F42A 5KVDH 1QSFD 4OLZL 1ACYL 3DPBA 4X4ME 4TUOA 4MNQD 4PG2C 4HIXH 2BRQA 4XPHL 3EYQC 3VFTB 4FZEL 5IBLD 3L3GA 1BZ7B 4HUNB 4YDKH 3F12A 3TZVB 1A7QL 3G5VA 5I66B 3CXDH 3FO2A 4U05A 4F9PC 2I9TA 1E0OB 4UB0L 2W60A 3BEWA 1FYTE 4DVBA 1KIPA 3ARBC 3IJYB 3GK8H 5IMMA 4H88H 3DRTA 4X4YA 4FP8L 4Y4HA 3HC4H 3IDGB 3RDTD 2B0SH 3RIFF 1FG2B 1T1WB 1UACL 3SKOA 5J57B 1IAOA 4GAGL 4EDWL 3LKQB 3ZHDA 2NTFA 1AI1L 1FNEA 1OGAD 2DQCH 4P9HL 15C8L 2X4NA 4M9OA 3LIZL 3UCRA 4JKKA 4U1JB 5ERWB 4AJ0A 2Z9TA 1S9XA 1LDPH 2HLAA 4LSRH 2OM5A 2EYTB 2ZCKL 5CINH 1CN4A 4ZUTB 4IJ3B 4HCRL 4WI2A 1T66C 1WAAE 4HV8B 4KJPC 1A2YB 1ZSDB 3U4BH 2YD5A 4WI6A 4DK6A 1EAJA 2HJLA 2VLRA 4YPJA 2NY5H 3SDCD 4HEME 5FYKL 3WFCL 5EUKA 1KB5B 2DDQL 4HUWA 4I0KA 5I1HL 2WANA 4OCRH 5GRZA 2JELH 2V2XA 5I9QC 5C0RH 4RMWA 1IGYB 4PJ8D 3PWLA 4BZ1H 3LQAL 3NCYP 1F3JA 1G9NL 1DVFB 3LPWA 3BUYB 1PKQB 2C1OA 3OJVC 5J8OA 3LS5H 5BQ7B 1DQLH 3QFJA 5FO7A 2EZ0C 1YUHB 3O81A 5IHZB 1MCWW 1BEYL 3KPOB 3NTCH 3H9SA 4DW2L 5A16B 1D5BA 3VWKB 1CD9B 1XFPA 3BKML 4TSBL 3ZTNL 4PTUB 1QOKA 4HUXA 3VXSD 5TDNB 4IRSA 4N0FA 2D31B 1ZHNA 4Y5YB 4FXGB 4IM8A 5I6XC 3L9RA 1BJMA 4QLRA 4E42B 43C9B 3S88L 4QTIL 2H41A 3MV7E 2CRYA 4RGOL 1FIGH 5D7JA 4ISVB 4XWOD 1B0RB 3CDGA 5BZWA 1CI5A 5HVHC 1T2QL 2ZSVB 3BDYL 3OKNA 4NJ9H 5F9AC 2DAVA 3SKNA 4WENB 3RY6C 3VFRB 4DTGL 3IDIB 3VMNA 3ZKQD 3FT3A 3CXHK 3F7RA 4IRJB 1UB6A 2FJGB 4OQTA 3DROA 1DCLA 1ZTXL 1A6AA 5IESL 3E8UH 4LPCA 2BNRB 5FKAA 3RPKA 1NCCH 4OCLC 4OI9A 3UTSA 2IBZY 5DA4A 5GGUB 2QEJA 4RFOL 3M8OL 1RK1A 1GZPB 3AAZB 2H9GB 1BMGA 3GSUA 4I48A 3E0GA 4HKXB 2CIIB 4ORZC 2EDYA 5DUML 4KGJA 1OP9A 4XPGH 1L9NA 4C59B 2Y36H 1HSBB 4LL9A 5JOFA 2G9HA 2A73A 3S5LA 1U3HA 3ZT5A 4KMTH 4XCEB 4LCUA 1RJLB 4FQLL 1WICA 4WVRA 2OK0L 4R4ND 1YY8B 2VZUA 3HI5L 4D8PA 4OSUL 5DJDA 5MENE 1JHKL 4ZFOB 4X6CE 5C09B 3BKJL 5EZOH 1F3DJ 5FK9B 4Y1AB 3ZYZA 3PWVB 2NR6C 1TVHB 4ZOAA 3DUUB 3MRIA 4M43L 3GHEH 2F15A 4YDVB 3TCLA 5DJAB 2VLRD 4WUKH 1BZ9B 1FLRL 4DFIA 5MP6L 4I18A 5CD5D 4PJFF 2ICEA 4JGMA 1T5XA 5D2NB 2X40A 1KNOA 2P48B 3IAPA 4PYHA 5D4QA 2EH7H 3QH3B 3QULA 3HUJA 1NEZB 3TV3L 1JGDA 4HWZB 1P7QD 5FB8B 4O00A 2XZQH 3CFJA 3MRKA 3HAEH 1I1AC 4NNXA 1R5IB 5T1LB 1LP9B 4ZS6D 4PJEB 1S7RB 4AL8H 4OD3L 1FNHA 5I1EH 2VISA 2FWOB 2V17H 3H9SD 4R90H 3ARRA 3MA7A 5B4MC 2BNUA 4X7DC 4KROC 4P46B 3BP4A 4IRSD 1P5VA 1KTLB 3OHXB 4LASL 4OLXH 4KHXL 5IFAH 3B2VH 4UT7H 1TQCB 3STLA 4WHDA 4J7RA 3T09A 3STZA 3DLQR 3U2SA 1BWMA 3NACH 3RWDB 4LPTA 7CGTA 3GIZH 3RIAK 3CMOH 5IB4A 5F7KC 4FZ8H 2VDMH 2J88H 4M5YL 1H3VA 4ETQB 4I1NB 1D9KC 1A6TA 3X11A 3CPLB 1PLGH 5DJCA 3JXAA 3VWJC 3MUJA 3O8XB 5DMJB 4NM4H 4UV4H 1ERNA 5GISH 4OV5A 4WW2F 1DBJL 4ZODA 3UTSD 4FQ2L 4HXAL 2DQIH 4R4FH 5KS9B 3RWEB 3VG9C 4K94C 1CFSB 4UOJA 5T5NG 2R1WA 4KJYB 5L9DL 4EUPG 2VSDA 3O8XC 5T1MB 4WEUD 1INDL 1A47A 2YPLA 1TZGL 4V1DE 5TDOB 4PBWD 5F7HA 4L3EA 2KL6A 4BELD 3QDGE 4ZXBC 4ZD3H 2Z31A 2XQYK 3AS2A 3F7YB 3B43A 1U3HD 1A9BB 2YUXA 2JB5H 3WS6A 4K55A 5JLZB 2BDNH 2YD4A 3MYZA 3MXWH 3TYFB 3BPNC 1PD6A 5IWLC 2Q7YA 4FQXA 3VI4F 1W2KT 3QQ9D 2ZCLL 4JR9H 4O51A 3U46A 4U1NA 4J3SA 2XTJE 1I8KB 3O6FD 4X83A 1J86A 4F2MA 4PUBH 3RBGA 3BYYA 4OZHF 5JW5A 1VB9A 3LEXB 4M5ZL 4P48A 5CP7A 3AY4A 4PJ7A 1JWMA 3T2QA 4F7EB 5JORA 4AEIH 1WISA 2BC4A 2QSCL 4Z0XB 3C8DA 4FRWA 1BHGA 4L8DB 3PNWB 5FGBA 1XGQB 1WVZA 3SDXA 1MI5B 3VXMA 3UEZA 3MOBL 2F5AH 3D2UA 3DXAE 4S10A 5HHVH 1EEZA 3HA0A 1LILA 4Y2DC 1U95A 4RIRA 4ZYKB 4YJZL 1FNGB 4XNYH 2W9DL 3WJJA 2NY2C 3VXQA 3HRZA 1Q1JH 4XX1G 4UOW1 5IK3B 5EU6A 1F4XL 5D2LF 2YD3A 2X1XR 4MNHA 2C3VA 4QRPB 4ZNEE 1C08B 4XZUB 3IDXL 5TPWL 1ZT1B 5F9JB 2EDRA 1YEEL 3VFVA 3HAEA 1D5MA 2AXJA 3QEUA 3JV6A 1CD8A 3HR5B 4IRZL 3MRGA 4Z7OE 3TWCH 5ALBL 1A1OA 3O3AA 5E7FA 3H0TA 1HYSC 2ZUXA 3SE9L 4IMLB 3VFPB 4OF5A 1MHHB 4K8RH 4PJGA 3V0VA 4PJ9C 1DLHA 2FJFA 2R2EB 3CCHA 3WXVL 4PJXA 4GKNA 4FFWD 4GRWB 4TSAL 1XF4A 4MXWH 4KAQL 5CBAB 4U2ZA 2XRAH 5F9WB 1CG9A 4PJHA 1NAMA 2XZCL 1KTRL 3LKSB 1CD1B 5CLWA 1BFTA 1TDQA 3IDJA 3IDMA 2HFTA 2YPLD 3TNMB 5DJ2A 4ELKB 3HB3D 2RIKA 1IGML 2NY3B 1JZ7A 5T3XL 2Z31D 3IU4L 2VDPH 1EH9A 4I77H 1YY9D 2YD6A 3SY0A 4IS6B 5D6DA 1YYLH 2N1KA 3O3BB 1PFCA 2ED7A 2B1AH 2WLZA 1UKQA 4FQXD 3I02A 1RMFH 3VFNA 3QHFL 5C0AA 5I30H 2YKLL 4PG9A 2FZ3A 3LS4L 4YXKH 2CDEA 1FNLA 5B8CC 4U7SA 2P8MB 4PJ5B 4DQOL 4ELMB 4NKOB 4LCCA 4UNTA 1PEZA 1DR9A 2VWEE 5LQBH 2DYPD 1A4KA 2IG2L 1INQA 1HHGB 4JE4B 2R1XB 4H8WH 2XZZA 1VFMA 2FJHA 5J1SC 1RJYA 1KIUA 3VXMD 3T2NH 3WUZA 2AJ3A 3D2UD 3EO0B 1QLEL 3FQTA 2CLZA 3FQRA 3KPNB 4HPOH 3BQUB 2YPKB 3RL2A 4OZGB 3GSVA 4E41E 3PHQB 4FTVE 5D1XB 1MFCH 3ARFA 4JPIB 4WWKA 3VGBA 4LARL 5H94B 2WBJA 3JVGC 5EU6D 3D5OF 4X4MA 5IGXL 5DHVB 4ZAKA 3HPJA 4GW5A 2I9LA 1JI1A 3ALXA 3MROA 2COQA 5H8DA 3FHAA 3ZZ1A 3LSOB 2XYCA 5IFJB 5KVDL 2QL1A 2DL2A 4P57B 4NQEE 4ODHL 1PX4A 5AZEH 1BIIA 1H3UA 4B50A 1VGEL 3MBEA 4LSQL 4XWGL 4Y88A 2NY0C 1LK3L 3THMH 2A74A 2CR6A 3SPVB 1DE4B 2ED8A 3PIQB 5AWNH 5JXEA 4WW1B 3O11B 3DETC 3KDMA 5SWZE 1NC4A 4KI5C 1ZHBB 3HRPA 3HMWL 3BO8A 3HTLX 1ONQB 4GOSA 1YC8A 1N59B 5ADOL 2CJUL 1NLBH 2XNAB 3BD3A 4L8CB 4AM0B 2F54B 4HK0B 1E4XI 1WAAA 2DQCL 4YXHH 4L4VB 3VD7A 2BSRA 2EDDA 2VDNH 1I4FA 4PJCF 5ICZA 2PW1A 1KTKE 4O2EB 2BP3A 1M7DA 1NCTA 3JWOH 3VA6A 4WFGE 1FNSL 1L7TH 4JJHA 1HSAA 1MCJA 1F00I 4EN3B 4U6XA 1YEDB 4ORGB 4RDQF 3TO4B 3ZTJH 3N1MC 4P23D 5TE4L 4LHUA 2EICA 4QF1B 4UINL 5C0AD 3RWFB 1CLYL 1NMBL 2G5BA 5DZNA 1OLLA 5C9JA 2NZ9C 4LNRA 4NZJA 1RZIB 2FLRT 4LRIC 3CH8A 4NQCE 3FFDB 1V05A 5FV1L 3QJHA 5GGTH 2F53B 1DP0A 2AJUH 3BPLB 3MREB 1UM4L 1NC2B 4RGMC 1GGUA 1AD0A 5D7KE 3CFBB 5DJ8B 3QIUD 2AEIT 3R1GH 4UAOC 3BI9X 3NIDE 4JN1L 5E8PB 4NWUH 1E27B 3FB8B 2RCSL 5I1DB 2FLBT 5TDPB 1OD7A 3B5TA 3MV8E 4Y4FC 1IM9A 1MRCL 3BFOA 3MV7A 4MQSB 1KB9J 3DGCR 3SHSA 5BV7C 3ARDA 3ZYOA 4NFBA 3VI4E 1C16A 2X4RB 1IMHC 1HYRC 1H3PH 4AEHL 5JDSB 4ODXA 2QKIB 1QEWB 4MA8H 5FO9A 3ARFD 5DMGC 3DSFL 5EBLB 5F7NC 4Z95H 3ULUC 1IC4H 3TBTB 4L8SC 3QPXL 4NSKB 4OZHE 4Q2ZA 3WDHA 4NJ9L 1S8DB 2YRLA 4ZAKD 4ODWA 3SGDI 3U7YL 2EE2A 4G6FB 3MCKA 2P44B 2VXTL 1OTUC 4LBEB 4PRBA 5BVPL 4FFZL 3FFCA 3RA7H 1NDMB 1FYTD 4R3SB 3G6AA 1JRHI 4YHLL 2D0GA 2VXUL 4HJJH 4NWTL 3W9DA 2IPTH 1OGTB 3ULVH 2QADC 5JXED 2IGFL 4PLNC 1HHKB 4MA3B 1DANT 1NC4D 2GYSA 1WV7T 4QGTA 1WJ3A 1B0GB 5K9OA 4F7PA 5DK3A 2HVJA 1CFQB 2Q76A 4LEOB 5KOVC 2UZXB 4PGCA 4PRIE 4S1RH 2H1PH 5DURB 3S7GA 2OL3L 4WDIA 1MAKA 5JOPE 5E2TH 5HYFA 4Q9RH 1WBZB 1E28A 2J4WH 2XA8L 4R2GD 4UMGA 4X6CA 4C55A 4WJ5A 1UT9A 2ED9A 4POZC 4NCC2 3BSZH 4X8JA 2ADIA 4JLRA 1GGBH 3IXTA 3B8SA 4K8RD 4XCYB 1MCDA 1ROWA 1SBSH 2BVPA 3UYOD 3GUTB 1YNLH 2OJEA 2Z93B 3WN5C 2PO6C 1ZVHA 5D7IA 4XNMB 3GRWL 2MQ0A 5DRNA 5BW7A 3HLAA 4MA1C 1XAUA 5C0BA 2X1QA 3N1QC 4RAUA 5EU3A 4LHUD 2BNQB 3QEQE 1HHHB 2MTPA 4F3FB 1KTDB 4HAFA 1CIDA 4GAJH 3ARZA 4TQEH 4L4TB 5F70A 1ZGLB 1EPFA 4K3GA 1LWRA 3QCVH 1WQVT 4JM4L 4LLUB 1Q9LA 4FFVC 3U30B 5EOCH 1WWWX 3ZE0F 3ZO0A 2R4RH 1KACB 4KZEH 3WLBB 1J5OH 1R5WA 2FECL 3BPCA 3C6LB 4JANB 5I74C 3VCLB 3V0WH 1IM9D 3GKWH 3MV7D 1VEMA 3QZWA 5GGTA 3ARDD 3QUYB 5IB2B 2GSIB 4ZOCA 5C92A 2CRIA 2I60H 1LE5A 1LO3H 1BVKA 2H3NB 3MUGA 3V6FB 3C6LC 4GW4B 5GRUH 4PB9H 1QQDB 5KJRH 1LVEA 3MMEA 5I1JH 3PJSA 1A6UL 4MQTB 1CLZL 1NEZG 2ZWLT 3SGKC 1HNGA 5I1LA 5IMOA 4YEFA 5IP4A 1NAML 2DBLH 2N7AA 4DGIH 1F4YH 1NGYA 4HFWB 4NUJA 5KOMC 1QFUL 1SYSA 3S97C 1NGQH 3CLFH 4IIQC 5D7SH 3EO1B 1CF8H 2QLVB 3AROA 1CFVL 2ZG1A 2PR4L 3MLTB 3PWPE 3TBWB 3MR9A 3FFCD 4Q0XH 5J6HA 1EHLL 3E6FB 2AS5M 4V1DA 1W72B 1PEWA 2ZNWA 1RULH 4C56B 4DK3A 4MQXC 4R4FL 5E8OA 3TPUB 2EIZB 3VA2C 3SGJA 3T8XB 2O61A 2NW3A 2UZIL 1TMCB 3W11C 4HKBB 2BNRE 4G42B 1EGJH 4JO1L 4JFFA 2E6PA 2BRRL 3L5IA 1PX3A 5CCKH 4L3AA 3MRDA 5EOQL 2WWKT 3LN5A 1CFNA 1A6WH 3DV4A 1ZHKB 3DX9B 4G8FA 1C5BH 4KPHH 3RGHA 5SX5K 4MXQC 5K9KA 1FO0B 1UA6L 4F7CA 1O0VA 1PQZB 1S5IH 3LV3A 1CU4H 4WUUB 2RB8A 5E1AA 2KH2B 4V2CB 2VKWA 3CC5B 4EJ1C 5C0BD 3T08A 3BAEH 4OGYH 1LEIB 2IQAB 3TIDB 3P77A 4JDTH 1A6VH 4MSWA 3DXAA 1YMMB 1G6RH 5C09E 2O5XH 2P24B 1KLFA 4DN4H 1ZLWH 2ZUYA 1NBVL 1N6UA 5C7XH 3I6LE 1BECA 5DJ0A 1AXTL 2VDQH 3G04B 1JGVL 4OGAC 5I18H 4MD5B 4ZG1A 2DJSA 2BOCB 2J8OA 5C6TL 4KJWC 4FA8A 3U9UB 5CLTA 4YH6A 3EUUA 1MH5B 5ANMA 1OCWH 5D2NE 1Q0XH 3L3IB 5C8JA 5HHOB 3QPQD 2X4SA 1MCQA 4KI5F 4ZNEA 2AXHA 3RZCD 1Q1JL 1WITA 2Z92B 4GBXA 2NXYD 3BGMB 1V3KA 1VKXA 2YUZA 3C60B 4X9IA 5B21A 2RFXA 4LCYA 3X13B 5BOZG 4G80B 5TJWK 1WC7A 3M1BA 1U8NA 3MFFA 2VLMD 3OL2A 1HWHB 4MJ6A 3TYGH 3TF7C 4JO4L 3GNMH 1NDGA 5EH1A 2GTZA 4WI8A 3FO1A 2YMXL 4WHYG 2V9RA 5IVXE 5JIKA 5F88A 1T1ZB 3NZ8B 4HXBL 2H8PA 4U3CA