4UNTA

Induced monomer of the mcg variable domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
SALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWEQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNAVEGTGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG LAMBDA CHAIN V-II REGION MGC
publication title Formation of Amyloid Fibers by Monomeric Light-Chain Variable Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 16
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4untA00
5I9QB 4LLQB 4JB9L 2HFEB 2DTMH 5ITBH 1G7IB 3JWDH 4U0RC 5CINL 2BZDA 3G5VB 3LQMA 4O51B 4CAGA 3DVGB 1BGXL 1UCBL 4XPAL 3WV0A 3OKYA 1N0XH 5GRJL 3WE6B 2DKUA 4BK4A 2HKFH 1MIML 5C0BE 5TE7H 1R3LB 3MROA 3AU1B 4FFZH 4KTDL 4XT1C 2A38A 1ERNA 2NY7L 3SDCC 4C4KO 3OWEA 1XF3A 4YDLC 4NNPH 3FB5B 5DURD 1NCTA 2J5LB 4JQIL 4YHYB 4U1JB 3D3VB 4P59H 1OGTB 3T1FB 3W9DB 3DRTA 2FGZA 2VL5B 1CCZA 1G7PA 3ULUL 4ZXBD 5EUOE 5FOBA 3L3IA 4JFHE 4V2BA 3F5WB 1F97A 2XWBB 3EZ8A 4ODXA 4PJDF 1QNZH 3H3KA 3QWQB 5C0JA 2AK1H 2GJ6E 4NZTL 2OTPA 3UROR 3GSRB 1ADQH 5BW7C 4M43L 4DW2L 4I8DA 1NEZB 3KPPA 3ALXA 5FYKU 2P8LA 4YZFE 2BVOA 1CBVH 1RFDH 1UZ6F 5GSVA 2IQ9H 1KIQB 2I60L 2WNGA 4EBQH 2BSSB 1LDPH 4X4XA 3ZYOA 3QI9C 1UZ8B 2B5IB 4NKMA 4Z7UB 2BVQB 1Q9WB 1UQSA 3MOBH 3ULUD 1BF8A 4H1LG 4JPKL 1S9YA 1YY8A 2UVFA 2DTML 4PB9H 5ITBL 3JWDL 4P4KB 4FRWA 3GMOB 3CX2A 2NYYD 2XOTA 2Z9TA 4O2CB 1I8KB 1FFOB 3RY4A 1NDGB 3ARSA 1Z0NA 4NHCH 1Z3GH 4QNPF 5SV3A 1TTFA 4HFUL 4JG1H 4K94H 4NKQB 4NNYB 5D71H 2WLZA 4FFZL 2DM3A 3KPOB 4YUEH 2FB4H 5IB1A 4LCIH 5ETUA 2GYSA 4TPRH 1HYSC 3NPSB 1P69B 3MV9E 5F9OH 3HG1A 3KJ6H 3TNMA 4LNRB 4YDJA 1WWBX 2D03H 1SYVB 2C4XA 3SKNB 4HULB 4P59L 4G6KH 4I2XA 2NTFB 1FNAA 1G9EA 4R7NB 1NLDH 3PXHA 5BMFH 5J3HD 2X4SA 3SDXF 3G04A 3KPLA 1UA6H 1C5BH 3RI5F 3QIUD 1ZLUK 3QDGA 4TULL 3QEGH 3F62A 5DC0A 2AK1L 3GGWB 3AY4A 3BD3A 1A1MB 3UDWA 1OTSC 2B1AH 1GOFA 4CGTA 1I75A 5E5UB 5BZDB 1B0RB 1RFDL 1CBVL 2IQ9L 2P24B 4EBQL 3FOMB 3S35X 1LDPL 4PP1D 1Q38A 2GSGA 3OXRA 3P9MB 32C2A 1S7TA 2VIRB 4H0HB 3MOBL 3NBNA 3DVFA 3HI5H 3QQ3A 1UXSA 1YNTB 4NO2A 3FCTA 4ZODA 4F3FB 3KPSE 2W0LA 4PB9L 1CE6A 4NQEA 4HCRH 1ZKAA 5FOJA 4PG9B 4QRPE 4FQXA 4TTDD 2ZOKA 4JANB 3CDGB 4H1LH 4NHCL 1Z3GL 3P0GB 4YHIB 3VXTA 5KSBB 4JG1L 2PCPB 3PL6A 4K94L 1TZIB 3AREA 5DMYA 5D71L 4U6XB 4YUEL 2D9CA 2FB4L 1J7VR 4H20H 5CWSB 4LCIL 1NC4B 4TPRL 3ZSSA 5F9OL 1GZPA 1WFTA 4X98B 3KJ6L 2IMNA 2D03L 3NH7H 4AMKH 3X12A 5ID1A 2YPKA 1YEJH 4CN1A 4G6KL 1U3YA 3GI9H 1UWEH 3BUYA 4LSVH 1NLDL 4MSWB 5LXGH 5BMFL 2P48B 2ED7A 2B4CH 2WBJA 1AFVL 1U8NB 1HEZB 1UA6L 4YFEA 5EWIH 1IEAA 3JWNC 4EUPG 1U3JA 3VWJA 3QEGL 5AYQA 1F5WA 2Q3ZA 5JOFB 2V7HA 3QT2A 2Y5EA 1AXTH 4PB0H 1U8KA 1ZLUH 3AFLA 3OG6B 5JXEA 3BEWB 1RUKH 1HN1A 1MCLA 2B1AL 3SKOA 5DJAB 5IHZB 1T2QH 5EBMB 2IMMA 2IPUG 4U1GC 3RDTB 1R6VA 2A6JB 2AP2A 3HI1A 5HI4D 1G7MA 4L9DA 4UV4H 4R8WH 5DTFA 3EUUA 4KJWC 3CSYB 2BFVH 3HAEA 3N0PB 3ME0A 4EN3B 1U91B 2NY6D 3KPRD 5BXFA 1ZHLB 3HI5L 4O2EA 3X11B 3QDJE 1EGJA 4M93C 3GHBH 1MHCB 4QRTA 1J0YA 1AI1H 4GKSB 4HCRL 1OAYH 2FNBA 1HK6A 5T3XD 4PJ8D 3K3QA 2YBRB 5I8CA 1OAXH 3QO0A 1RUML 1JNHA 3CVHB 1CT8A 3LKQB 3T8XB 1Z0MA 5EU5B 4H20L 5DEGB 2J1KA 4KJYA 4OBRA 5EN2B 5DJ8A 4WRLA 5INCB 5JDJA 5E8NB 3NH7L 3QNYA 4AMKL 1JZ3A 5TGBB 4NHUA 1YEJL 3WN5B 2DQUH 2EECA 3V4VH 3GI9L 5JW5B 3IVKB 4LSVL 1BJMA 1KGCD 5LXGL 1FZJA 1BX2A 3GIZL 3OKDB 2B4CL 4WJ5A 5SWQA 4K8RH 1JUFA 2PYED 4G3YH 1E27B 4Y16D 5B22A 3GMQA 3O6FD 1AXTL 4PB0L 3WXVL 2ESVA 1RUKL 2MQCA 4MYWB 3QUZD 4U7SA 4QHLB 4EUPH 3IF1B 3RWGA 3EO0A 2PN5A 1F42A 1KTKE 3CU7A 1PX4A 5EB9A 4DGVH 4UOW0 4UV4L 4R8WL 1IM3B 4P2RD 5JMRA 2BFVL 3BVNB 2OMBA 3NFNB 4YE4H 1T4KA 4GAYA 3GHBL 2H6PA 1AI1L 4NWUL 5CD5C 5JTWA 1C7TA 2R23A 5JIPA 3PQYB 4P23D 3BSZH 4C54A 4KJQC 4RGMC 2DRUA 3PE9A 1OAXL 3SDDA 4TNVK 4D0BB 2R1XA 2X89A 4BZYA 1QSZA 4NQDD 3JTSB 1P6FA 4OLZH 4HUXA 4QGYA 5C0EB 1I8IA 1FC1A 4FTVE 2A77H 2I25N 4MJIE 5H2BB 5AEAA 5EH1A 4PJAB 3ZT5A 3NGBC 2DQUL 3ILPB 4J4PC 2EDKA 3V4VL 2VN7A 3VFWA 4K9EC 4HDIA 5IF0B 2JE8A 5C0IA 4M5YH 3ARXA 4QHNB 3RPIB 4M62H 4WWKD 3IS0X 3QEHA 1HHHA 3WFHA 4IMKA 5LCVL 3O3AB 4K8RL 4G3YL 2OZ4A 4X6CA 4MD4A 5I74C 3D69A 1C08A 3FQTA 5DWUH 3K2UH 1ZVSB 5IM7B 1ES0A 5CJ5A 4YHPA 4KMLB 2VR4A 3V4PH 5DJDB 3QXUA 4YLQT 4DGVL 2YD4A 1AIFB 4I3SH 2HWZH 1LO4H 2WIIA 4PREA 4X6EB 1XZ0A 1M71B 4JGUA 1NGZA 1X5JA 1WK0A 4MNQD 1CXKA 1FO0A 4R4FH 4YE4L 4PJ7E 4XBGA 2HFFA 5C0GB 3SJVB 2W65B 3HA0A 1D9KD 3VMNA 5AZ2H 5GGUA 3MV8A 1ZHNB 3UPRA 3BSZL 5GS1A 4NRYB 4JJHA 1IEBB 4LCCC 2BNQE 4X9HA 1JPSH 2B20A 3C6SB 5HYSA 3L3GB 2NXYD 1WAAA 1HSBB 2D7TH 3FL7A 2W0KA 2NX5A 3GMRA 4OCYL 4OLZL 4L4VB 1LEIB 4HIJA 3HS0A 4HS3B 5EFIB 2O5XH 1AO7E 3DVNA 1G0XA 3ROOA 3S6CA 2AV7B 5DJ0A 2A77L 4DN3H 1LNUB 3RBGA 1VDGA 4JDVA 4HKJB 4JR9H 4HUVB 3KDMA 5F70A 3O8XA 1FJ1B 4M5YL 3SKMA 4Z7UF 1AD0B 3IYLW 4M62L 4JRXE 1Y6MR 2YPVH 4CN6A 4CVXB 4BKLA 2FATL 4M7LH 3ZKXB 5FM8A 4OQ1A 1M6OB 4MVBC 1R5VA 2FGWH 5DWUL 3K2UL 5IBTH 4JO2H 5SX5H 4DZ8A 1B2WH 1ODAA 5EULV 3NN8B 2KUTA 1PQZA 4NQSB 5DEFA 3V4PL 4C56D 4PD4K 5D4QA 3QA3B 3O4LA 1KNOA 3EJYC 4I3SL 4YBQD 2HWZL 3CFDB 1LO4L 2ZPKH 3Q0HA 5J6GA 4OM1H 1L9MA 4J2XA 1YYMH 4IRJA 1FLRH 4JRYB 4KKBC 2W07A 4R4FL 5F7MC 2YPLA 1AGDA 4LLWA 2NY0D 3VWKC 2HJFB 4LVHB 3ARGC 4K07A 1QYGH 2ATPA 3VXOB 4P46A 3WFCH 4FABH 4H8WH 1CD8A 1OGAB 2QL1A 3HE7C 3MLZH 2XFXB 1JPSL 5SWSD 2VABA 2APTA 5B8CC 3SQOH 1BECA 4HT1H 4PJ5B 3NIDE 3AC0A 3VFRB 2P5WE 5IT2L 2JJWA 4DN3L 1TMCB 1WBXB 2FO4A 1NBZA 4ZTPH 4UDTB 4XB8A 2J4WH 4RFEA 3VGEA 5F6IC 1S78D 5DSCA 2VO5A 4X5XA 4P4KD 2CKBA 1VPOH 4HXAH 4LHUG 5DK0B 3UTZB 1I1AA 2AEWA 3JV5A 4MHHI 1ZGLB 3IKCA 1H5BC 2DJSA 4S1RH 4JZOB 3FN9A 1YUHA 4M7LL 4GSDH 3WDHA 4ELKB 4QRRB 2FGWL 4HD9A 3TVMA 5IBTL 4JO2L 3C2SA 1B2WL 5F7HA 2E9IA 5KSBF 4Y1AB 5EZJB 4JPIA 4L8BB 3MRBA 5FYKE 2EDQA 4F37K 2ZPKL 2AQ2A 4OM1L 4U1LB 5GZNC 1YYML 3CH8A 4ZFOA 3DO3A 5A3IC 1QVOA 4GRMA 5D1ZA 5LVEA 2CLRB 3OR7A 4QWWD 3UTPD 4X6FB 5C0BD 5IVXA 3BP6B 5KSAA 5KS9E 1NGYA 5HI3D 5D7LB 2R1YB 2XN9A 1QYGL 3RA7L 3WFCL 4EI5A 3EYVA 4FABL 2AXGB 4H8WL 4PJXE 4YC2C 4XWOC 3ZT7A 3MLXH 4M6MH 4EVNB 3T08A 1QFWM 3MLZL 4P0DA 1MUJB 4WNQB 1C16B 5I0ZA 4N8CL 5CJ8A 4DWHA 4LSQH 1T03H 1MHPH 1W72B 1NBQA 3HPJB 4HT1L 3VDCA 3IXAB 5JHDA 1FZKA 4JFHD 4GQPH 5CBEA 1BZ7B 1B3JA 4ZTPL 3P73B 3JBG7 4CW1A 1DR9A 5D1XB 1F8TH 2O5ZH 3IDMB 1TPXB 1WT5A 2GJ6D 5IFHL 4HXAL 1G6RH 3O81A 4Y5XC 2YEZB 5EC1A 4I18A 3VJ6B 4Z6AT 5DK2B 3P4MA 1VERA 2V7NB 1L0YA 4FQQA 4S1RL 1U93A 1JIBA 3B9KD 5MEOB 5ABDE 1T6WA 3G6AB 4GSDL 2Y07H 1MNUH 3MREA 3PGDB 1HH9B 3CSGA 3RVXD 2PF6A 3V5HA 4PPTA 4V1DA 1JGLH 4OGZA 4D0CA 3JUZA 4MZ3A 4PJCA 3MO1A 5C0NC 1CFNA 2MQ3A 3KPQB 5CEXA 3KNBA 2AKRA 2FZ3B 1T2JA 1E28A 3TH3T 3T77A 5AUMA 3GIVA 2ZOLB 3GUTA 1QLRA 5H94A 3ZKQD 3Q1SH 1XF2B 2J8UA 5E94B 1CLOH 3QUMB 1ZA3B 4IDJH 4KUCD 3MV9D 4NPYB 2L7JA 4M6ML 5D2LE 1I4FA 1XCQB 4WFEE 3WL9A 4PS4H 1F3JA 4LSQL 1T03L 3BN9C 1MHPL 5LGJB 1KCVL 1UH4A 1SEQH 1ED3B 2F74A 3QXAA 3CVIH 3CZFB 3B3IB 3EDEA 5CIPB 5BZWA 3L5WB 2H32A 4QOKE 1IQWH 4Y8DC 4HKBA 1F8TL 2O5ZL 3S96A 4L3EA 4JPVH 1G1CA 4J7RA 1TZGH 1G6RL 4F7TB 4MNGA 3IDIA 4Y5VB 4U1HA 3WLWC 1JRHI 2GKIA 1H0DA 3UJTH 4A6YL 2Y07L 1IQDA 1MNUL 1YN7A 1A6UH 3OKLB 5GSRB 4U1MB 5D1QA 2A73B 1JGDA 3LN5B 4XGZB 3S37H 3QZWA 1IAIH 1JGLL 2RJMA 2G75B 4Y4HD 4XVTH 2VZ1A 1Z9MA 2ED8A 5HHOD 1S7WB 4NKDA 2YA2A 4QRPD 2NNAB 3LKPB 2VLJB 3QDAA 1QKZH 1EEYA 4XBEH 4GRLA 1A6TA 3GMMB 3PHOA 3Q1SL 5CLTA 5AYUH 1CLOL 3HUJB 4IDJL 3T0BA 2OJZL 3DTXA 1A4JB 1T1YA 4LHUD 5D7IE 5ANME 5FCUL 3UBXA 3KYMB 3L3JB 4JO1H 3S3JA 5KOVC 4XMPL 4NDMA 5ESQA 1SEQL 5IJVA 4GKZB 4OZIE 1M7IB 4JFDA 3CVIL 2EDYA 4OF8A 4KDTA 3LPWA 4UTAH 3ARUA 2H2PD 1FYTB 2P5EE 2X4NA 1V7NH 4XBPB 1IQWL 2Y7QA 4JPVL 3NTCH 1TZGL 3PQYD 2H26B 3VRIA 2NR6C 1KJVA 4HX1B 4Y4FD 1LD9A 3MRNB 5I2IA 3S4SB 5C1MB 1HHGB 3NCMA 1CICB 1GJIA 3UJTL 1I3UA 2GTWA 2GAZA 4G80A 2ZG2A 1D5IH 4NN7B 2Q7NA 1A6UL 2ZP0T 5DFVD 2C1PA 4M8VA 4NJ9H 3P4NA 3MRKB 5AD0B 3S37L 1JPGB 4YDKH 1G7LB 3SHSA 1IAIL 4XNQB 2WANA 5K9KB 3QDJD 4XVTL 2AXJA 5J7CC 2V5SA 1EVTC 2DOCA 2EC9T 4HWEH 3K1DA 2QR0B 5HDLA 4LMQI 4QHUB 1QKZL 4HS8H 3QEUA 1I8LA 2EYTA 5F93C 4RGNE 5D7JA 4JREC 3MV01 5GJSH 1ND0A 5FO7A 4QCIA 4QF1A 2MFNA 3QRGH 5E56A 2VITB 3RNKA 3LKRA 3T0EA 5AYUL 1CXLA 4RFNC 4WI5A 1OF2B 4XNZB 1ZT4B 1YMME 1I7ZA 3MYJB 1KIRA 3PWPE 4DK6A 2OS7A 1JHKH 4BQ8A 5EIVA 4YO0B 4JO1L 3RGVD 3WEXB 4ZPVA 2IPKA 3QBTB 5CLWA 3QR2A 4W68A 3BZEB 3C5SA 4UTAL 2CK2A 5LKNA 4XPBL 3L7FA 1VGEH 1XGPA 1ONQA 1V7NL 4I5BA 5HTSA 3F7YA 4ESKA 3NTCL 1K4CB 1PEWA 2GUOA 4X4MA 2Z93A 4JVPA 2M26A 4OZGF 3BGMB 1AHWA 1WV7T 1DBMH 3MJGX 4G8GA 3WHXB 5DJ6B 3BD4A 4LHQB 3TNNA 3LQZA 1D5IL 2ICWI 4GKOA 4JFPB 4NJ9L 4L4VD 3STLB 1FDLH 3B9VA 4YDKL 3TWCH 3DXAA 3TBYA 1BREA 2EYRB 5FDWA 5JNYA 3H9SB 3OV6A 2WQRA 4HHAA 5C71A 4RIRA 1EVUA 4LSDA 1KN2H 2ICWB 4HWEL 5TDNA 4HS8L 1KLUB 5GJSL 1N2RA 3B8SA 3KPTA 1U41A 3QRGL 5E6IB 3SBWA 3TJHD 3AM8A 3KPMB 1UG9A 1M7DB 1JNLH 1M05A 5L2KB 4FTVD 3E2HC 1JHKL 3EYOB 4JFXB 1AGCA 4OAWA 5I1EH 4GW4A 3RFZC 3I6LE 3ZZ1A 3KVQA 1K3ZA 1IKNC 2YXMA 4Z77B 3BIBX 5DHYA 4OIIH 1VGEL 3NABH 4WHYG 2VB5A 1DBAH 1FCGA 4G42A 4IRSA 4ZPTB 4H88H 4BFIA 3GSXB 3TZVB 2CMRH 3DUUA 1LE5B 1DBML 2BC4A 3VD4A 1U8HB 4Y19B 4GW1B 3ZYZA 1KB9K 5TE6H 3BESR 4JAMA 2C4FT 4U6HB 3CGTA 4N0FA 1FDLL 5JORB 3TWCL 4OZ4B 5F7FA 3ZSTA 2QKIB 3F7PC 5HGHA 4D3CL 5DQDH 5DQJB 5CEYA 1RIVH 3TO4D 5KVDH 1KN2L 1A7OH 4RNRB 1T1WA 4M1GH 4J8RB 1OM3H 2BNQD 1TDQA 3HTLX 5DRNA 4ONOA 4NZRH 3TA3D 4YHOH 5C0RH 4J3OC 4H1LB 3JV4A 3OJMB 5JPMA 1UVQA 3EFFA 1P1ZB 4OT1H 3BP4A 5FYKH 1WIUA 1AO7D 4N5EC 2R9HD 1QQDB 4NSKB 1IL1B 5JIHA 5F1NA 3UP1A 3FQRA 4J1UB 3U9UA 4NN5B 4JRXD 4OIIL 3IDNA 2HLAB 3G6JA 3M8OH 3L9RB 4X6BA 5D7LD 2FEDD 1K5NB 3MLRH 1P7KA 5IEKA 1DBAL 1LK2B 5GQBA 3BEVB 1WITA 4WY7H 1A9EB 2CMRL 2APXA 1EXUA 4UILH 1TQBC 4WHYH 1YPZB 3L5JA 1DN2A 3AMLA 5IIEA 1HXYB 5TE6L 1NH6A 4TNWF 2Z91A 3HKFA 3R1GH 3GSNB 3OAYK 4OFYA 3X3GH 3RWCB 3W81A 4R4BB 1NCBL 4OLXH 4LKCA 2AK4E 5IB4B 4LLUA 2E7LA 3SGDI 2IANA 3G5YB 4P9HH 3ESVF 1T83C 2LVCA 1RIVL 5DQDL 5KVDL 2XXCB 2A6DB 1A7OL 4LLAA 2QV2A 1UJ3B 4UIMA 5D2NE 4BK5A 4WO4C 1OM3L 4Z5RA 3BHBA 1Q94B 1HHIB 4ELME 4WU5B 1JF1A 5C0RL 5FGBC 1AJ7H 2D7OA 4P49A 3OXSA 2P5WD 3M17B 2VQ1A 1SEBB 4MX7B 4OT1L 3SEPA 5FYKL 1JHTA 3SE3C 5A2JH 1A3QA 2CLZA 1T21A 5T1MA 1B9ZA 3VD9A 4RMQA 4X7CC 4XP5L 5D5ME 2WZPD 1YECH 4NWTH 4JFFB 4FA8A 3T0AA 4JY5H 4WHDA 5CGYD 4OLWH 4ZNEA 1F4YH 3W0WE 3MLRL 4MXVE 3N1FC 4LLMB 3SQBA 1IGFH 1PG7W 4W4OA 4YDIH 4M1DH 4UBDD 4ZG1A 3L3DA 2PR4H 4LGPB 4WY7L 5J06A 2ARJA 2P7TB 2RR3A 3WS3A 4A2MA 2JJTA 5I71B 1JWUA 4AIZB 5FYKD 4M61B 5DC4B 3WNPA 2FX7H 2R8SH 1YC7A 3FMGH 2G9HA 4JKLA 4GRWE 3R1GL 1MCBA 3H8NA 4JQXA 3RUGA 3X3GL 4OLXL 1J18A 1H9VA 4WV1B 3RVVD 5I1LB 3I3EA 5C08B 1M4KA 3IFOA 4P9HL 2EIDA 2CRYA 4ZUUA 1OPGH 3MRQA 4X7DC 5L2JA 3S36X 1P4LB 5C6WH 4MCZB 4PRHE 1U3HA 3G6DH 4L1HA 4MWFB 4AH2A 4TN9A 3MLSH 2K7QA 5C9JB 4XZUB 1LWRA 3DMMA 2A9NH 3QQ4A 4LVEA 3U7AA 5B39B 4NZUH 2DI9A 2FL5A 4JQVC 1AJ7L 1X5IA 5HVWA 1Y18B 5E9DE 2QLVB 2X9WA 3FRPG 4KI5E 4MAYA 2PXYD 4R2GB 1KOAA 1UYWH 4BH7A 3UTSA 3HR5B 5ESAA 1I85A 2EO9A 4ZTOH 3HCVB 1L9NA 4HUWA 5DXWA 5F21B 4GO6B 4NWTL 5F7UA 1KJ2H 3ULUC 1MJJB 1CQYA 2Q76B 4JY5L 3H3PH 4TRPL 1TTUA 1GGUA 1F11B 4IRZH 4OLWL 1OSPH 4ODUB 4XH2B 2CXGA 3WO4B 4KV5E 4RMSA 2NYYC 3JZ7A 1IGFL 5E00A 3BT2H 4YDIL 5MI0B 3RIFF 1UC6A 3IT8D 3OQ3B 2PR4L 2P42B 5SWZD 1NGQH 1WIOA 4U7MA 1C7SA 4ZUTB 4P5TB 5F88B 4LP5A 5IV2A 3JTTA 1KFAL 3MBED 2FX7L 2R8SL 1ZAGA 2VXUH 3FMGL 4PGCA 3SDCA 3Q6GH 1I1FB 5C09E 1F3DJ 5INDA 4QRSB 2VMFA 2VDRH 1CZ8H 5IG7A 3BPOC 2GIYA 2D31A 5J3HC 4PJFE 3QG6B 1OPGL 3O3EA 5KVGH 4UU9B 3QULB 5K33A 3HE6D 3G6DL 3QIUC 1W0WA 3BP7A 4N5UA 5F8QC 5D93B 1J5OH 3KLDA 1K8IB 3MLSL 2A9NL 3UYRH 4LPWA 5BW7A 1PZUB 2WMPA 2X4RB 4XNMB 3TYGH 3QIWD 4HAFA 4PJGB 4LDLB 4Z78B 1ZHBA 2EDEA 3T4YA 2CXKA 2XV6B 1UYWL 3ZMRA 4ZTOL 1OSZA 3GMNA 3UYPA 4PP1C 1ZGLM 3O9WB 3QI9A 2AGJH 4HIHA 1LVEA 1NKOA 3T3PE 1KJ2L 4KJPD 4LF3A 1VACB 4GMSH 1NUNB 4PJDA 3UTTE 5DMKB 3H3PL 3RVUD 1AH1A 1EZVY 1F6FB 4IRZL 1OSPL 1PX3A 2O26U 1L7IH 5SX4I 4JRWA 2CPCA 3BT2L 4TTDC 1TENA 1NGQL 3ECBA 2Z8VC 1XH3A 3IJYA 2EZ0D 4Q58C 2JK5A 4PV9B 5C0AE 1FNEB 2VXUL 1FAIH 3NZHH 3Q6GL 2V9TA 4K71C 5LQBL 5EUOB 4L29B 2VDRL 1CZ8L 3NFPA 4A2LA 1KIUA 1HHKA 3OAUH 2B7DT 2VTFA 4PJIA 2VKWA 3TEUA 1T7ZA 4MQTB 3VH8G 2FECI 1XGRA 4DKFH 1PDKA 2Q7YA 1EJ6A 3THMH 1J5OL 5D7SH 3MROB 4Z8FL 4NQVA 2OQJB 2FR4B 3UYRL 1YZZA 1UKTA 3TYGL 2YZ1A 4R97B 1J8HA 3OB0K 4XVUD 2P5ED 4GLRI 1OHQA 5HI4C 2APFA 4QY8B 4AL8H 3DRTB 2HKHH 3SGEH 3L3IB 2AGJL 4UNTA 3HLAA 3MUZ1 2NY6C 3WS6C 4GMSL 4ODXB 5L6YH 5GXBB 5C0JB 2R2HB 4ETQA 1IEHA 5J89A 4PJ8C 3KPPB 2P8LB 4OSUH 4ORGA 3ZL4H 2BVOB 3VRLE 5GSVB 3RL2A 4I0KA 5HDBE 1QRNA 3H42H 2XACC 4FQ1H 4LSRH 2NXZB 4HV8A 3WKMH 4X4XB 4G9FA 3BKMH 1FAIL 4NKMB 3BYTA 2CDFA 3NZHL 2OM5A 1QACA 1P4IH 5DI8A 3P9LA 1DQTA 1PG7X 5J12C 1XCTA 4RGND 1YY8B 4E0RA 4N0UE 5EUKA 5J8OA 5C07E 4LSPH 3ZYJA 3OAUL 5F1SA 1DE4A 4OLVH 3WDJA 4XX1E 2CH8A 1BBDL 1Q9KB 1YEIH 2PUQT 4KTEH 1YMMD 1KULA 3BISA 4EKXA 4DKFL 1X44A 3CXDH 1LO0H 1MCCA 1X4XA 3PWPD 4DUVA 4ZFGH 3ZDYF 4Y16C 1JZ6A 3QPQD 1QFUH 5IB1B 3O6FC 3EOTH 5ETUB 3Q5OA 4QHMA 3QUZC 3TNMB 4YDJB 2DJUA 4WENB 4ODWA 2AI0H 1CLZH 4I2XB 3QWOB 4KK6D 4AL8L 2FYYA 2NW2A 2HKHL 3KPSB 3KLHD 1P9MC 3UC0H 2X4SB 4PRPA 3MNWA 3G04B 3KPLB 1FIGL 2F54E 4JFED 4PRAA 3U7WH 3ULSB 1TCRA 5L6YL 1QFPA 3QDGB 2Z31A 4I9WE 1DN0A 2X7LA 2R56H 3INUH 4P23C 2AXFA 3KXFA 3U2SB 4GUPA 2YXFA 4OF6A 3ZKMD 3MV7E 4OSUL 1AE6H 1X3DA 1ITBB 4NBYB 3MCLH 1CN4A 5FHBH 4FQ1L 4LSRL 3WKML 3LHPH 3SGJA 3EOAA 1LO2H 3BKML 4YEEA 2GSGB 3ARFA 4RA0C 1WTLA 1C5CH 3OXRB 2BJMH 3QEQA 32C2B 1EEQA 1P4IL 2M8XA 3QQ3B 1UXSB 4NO2B 3FCTB 2CJUH 4IHOA 3J8F7 3OKNB 3QFJE 1O5DT 1MRDH 5DVOA 4LSPL 1CE6B 3LOWA 2YD5A 4OLVL 2FEEI 5TE4H 1RHHA 2YUVA 1YEIL 4FQXB 4KTEL 2ZOKB 4LVNB 4YEFA 5CILH 3MRIA 4WWKC 3DGCR 1JF6A 3FAWA 3VXTB 3CXDL 3PL6B 2H41A 2HA1A 2R39A 3AREB 4ZFGL 3P30H 4BH8A 1ZTXH 2EDDA 4HBCH 1QFUL 4HKZB 3I6LD 3EOTL 1GZPB 4JEGB 3KHQA 1SJHA 4FMKA 4GS7B 4MA3A 1RD6A 5ID1B 1JGEA 2AI0L 1CLZL 3TFKD 2QQKH 3BUYB 4LQFH 2DMBA 2VKXA 5HHMB 4DUWA 5FEBA 1IM9D 2WBJB 4M7JH 3UC0L 2O61A 4PP2A 3U7WL 3WHE0 3FTGA 1BQHA 2XT1B 3VWJB 1SQ2N 1D9KC 2CUMA 1JNJA 2V7HB 3INUL 2R56L 1X4ZA 2AJUL 1B0GA 3VFGH 1U8KB 3GBLA 2LFGA 3NCYP 3SKOB 1CIDA 5AG8A 1IZKA 4Z7QE 1S9WA 1I9EA 1AE6L 3MCLL 1RJYB 2NY1B 2NXYC 2WP3T 2A6IA 1G7MB 1NUGA 1S7XB 4M7ZB 3D85D 3LHPL 3ZE1F 4AEHH 4CU6A 1C5CL 3RX7A 2BJML 1MI5E 1SJEA 4OZFA 5BXFB 4O2EB 2KDGA 2CJUL 3C09C 3ARTA 1A2YA 4PV8A 3MBXH 5TE4L 3KYNA 3EYSH 3RWHA 2HG5A 4ZAKB 5CILL 1Y6NR 5I8CB 3QO0B 1DJSA 1U8IA 1CT8B 2DD8H 1ZTXL 2WK2A 1DUYA 4HBCL 4GRWH 4L8CA 3LMJH 4F7EA 4TSCH 3BMVA 4KJYB 1EH9A 3HPLA 1Z5LB 5DJ8B 3PDDA 2EE9A 2J5LC 1MELA 2UY6A 4NHUB 5EU6A 5C08D 5D6DA 2QQKL 3CMOH 4YBQC 4LQFL 5HBBA 2I9TA 1FZJB 2AV1A 4TOYH 1BX2B 4Y2DD 1MF2H 4NN6B 4WJ5B 5SWQB 3JV6A 2NY0C 1G7IA 1IBGH 4O51A 3S35H 2P44B 5GS0H 3GMQB 3VFGL 5DMIH 2ESVB 2NY3B 2VDPH 2P4AB 5HVGB 3RWGB 3EO0B 4LCCA 1EFQA 2BNRD 4X0KA 5A1AA 5L8JB 1QBAA 4RMRA 3SE9H 3VDBA 5DJCA 3VXMA 4AEHL 4YHZH 4X5WA 5CP7A 3JVGC 2VAJA 4PJGF 4Q9RL 4Y8AA 3B5GA 1T4KB 4GAYB 3PGCA 2NZ9D 3I2CH 3ZDXE 3UCRA 1S78C 4P4KC 4N8VA 2BY2A 2R23B 3MBXL 1F13A 1QSFA 4OD2A 4R26H 3EYSL 1N5AA 4YIQA 3QDHA 3O2WH 2XWBA 3ETBF 1ZA6A 3SDDB 4M00A 2BY1A 1Q72H 2DD8L 5JW4M 2R1XB 2FLRT 5L88H 1QSEA 1Q0YH 5HYJE 4NUJB 1Z9SA 2VISA 4ODSH 3LMJL 1EO8H 1KV3A 3QFDA 4TSCL 4NRXA 3NPSC 1I7UA 4HUXB 1MCDA 1I8IB 3VXUA 1KIQA 3ZTNH 2HRLA 2BSSA 3VFWB 2ZSWB 4HDIB 3CMOL 3BDBA 5C0IB 4TOYL 1MF2L 3WFHB 5EUOF 1UEMA 4QWWC 5ECJE 2DM2A 4X6CB 3BZDA 5HI3C 3QIBD 4MD4B 3GMOA 1IBGL 1NCWH 4PJBE 3ARGA 3D69B 5GS0L 1C08B 3FQTB 1I8KA 5DMIL 4LARL 1NDGA 1DL7H 3WJLA 3BI9X 2VDPL 1A21A 5EA0H 4YHPB 4DGIH 4NNYA 3FO0H 3KPOA 4YZFF 5DF0A 4ODHH 2WIIB 4PREB 3SE9L 1KT2A 1XZ0B 1V8HA 4YHZL 1NGZB 2QADD 1IGIH 1UB6A 1FO0B 4PRHD 1BIHA 3MRCB 4XBGB 1A7NH 4W4NA 3I2CL 5MENA 2AJXH 2FJFA 3VXRE 2KL6A 1W8OA 2VLRA 3IU4H 4E5XA 4LKXA 4R26L 5GS0D 3O2WL 4H8WC 3ARBB 3AS0A 5BS0E 3B9KC 1S7VA 3KWWA 3MRMA 1Q72L 3D2UA 5HYSB 1V5JA 4XX1G 5L88L 4HQQH 3S7GA 1Q0YL 2JIXD 1GSMA 4ODSL 4RMWA 1EO8L 3GMRB 3T09A 3G9AB 1U2CA 2K1MA 3C6LD 3HS0B 5HPMA 5BJTA 2R4RH 1B0RA 3DVNB 1MQKH 3ROOB 5DJ0B 5GGTA 2SEBA 3ZTNL 3FOMA 3N85H 4JDVB 4ONFH 3KDMB 4QT5A 3O8XB 4KVCH 1E6JH 4APQD 3P9MA 3SKMB 3C5ZB 2ZSVA 2YC1A 3RY6C 1MOEA 1XGQA 4Q6IC 5H8DA 1NCWL 1R5VB 4HXBH 2GTZA 1EEUA 1DL7L 4DZ8B 4B41A 3E3QC 5EA0L 4DGIL 2BVTA 1TZIA 1PQZB 1JNNH 1KB9J 3FO0L 1J87A 3O4LB 4U6XA 1KNOB 3TYFA 4ODHL 1U95A 1CTNA 1NC4A 5J6GB 5BOZG 1HH6A 2BXYA 1V3JA 5DD3H 1IGIL 1BQLH 1IC7H 2V5RA 4IRJB 3CFKA 5JW4R 4GG6E 2YPLB 1AGDB 3TIEB 1A7NL 4LLWB 3UTOA 1VENA 4WW1B 2EDXA 4HAGA 2ATPB 4P46B 2XTJB 3IU4L 3EZJB 4Y5XA 1J1PL 2E9JA 2H3NA 2VABB 1EV2E 5JOFA 4CDGC 3WUWA 1SJXA 5EC2A 1MCJA 2Q8AH 3KGRA 1PJ9A 3RZCB 1OW0A 2YMXL 5EBMA 1AC0A 2R4RL 4WUUE 2UUDH 1MQKL 1TQCC 3DECA 2FO4B 1NBZB 2R4SH 2A6JA 5BVPH 4PRNA 4Y4HC 3WN5C 2VQUA 4RFEB 3N85L 3QQNA 2NY4D 4ONFL 2CKBB 4KVCL 5KS9B 1E6JL 3VU2A 3CSYA 4EN3A 1NEUA 5GRVK 3X11A 5I1HH 3L7EA 3IKCB 3L1OH 1MREH 1CXFA 2YUWA 5I1KH 1H3UA 4YHKH 3KYKH 3VD5A 4U1KA 3QWRA 3P9WB 1YUHB 4I3RH 2ZUSA 4HXBL 4LP4A 3W5NA 3TVMB 1RZ8A 3ULVF 3HG1D 3UXFA 3OL2A 3CVHA 3DUSA 1JNNL 1BIIA 3MRBB 3FT4A 3PWUA 5FV1L 1T5WA 3DBXB 2NTSP 5INCA 4OGAD 3NMEA 2CUHA 2UWEE 5DD3L 1BJ1H 1BQLL 1IC7L 4ZFOB 2H2PC 1QVOB 4GRMB 2E8YA 5C0CE 3QYCA 4P2QE 3T1WA 5IVXB 5KSAB 1J0JA 1NGYB 2MMXA 4MB5A 2XN9B 1RIUL 1T04A 4EI5B 3EYVB 3HR6A 1RJLA 3DX7A 2NW3B 4KGJA 1MCQA 4Y4FC 4Y7MA 4Z7VE 2VERN 4MJ6B 3QDME 3QISA 3MLTA 4BFGA 5DFVC 3AS3A 2A83B 1Z9OA 4L4TE 1GGIH 5DLMH 4PBVC 1T7XA 4RRPG 5CBEB 3QP3A 2C3GA 5DA4A 4CW1B 5BVPL 3X17A 2KPNA 2KBGA 2OCFD 4NQED 1OQOA 4LASL 3BPNB 3P4MB 4G8EA 4PJEE 3GJFH 5JUEH 5I1HL 3I02A 3L1OL 1EX0A 1MREL 5A2IH 1NAKH 3PL6D 4YHKL 1U93B 3KYKL 3ZHLA 1NAMA 5CS7A 2YRZA 3PP3K 4I3RL 3L3OA 2GT9B 2PO6B 1DVFD 1NCDH 1QPPA 4L4JA 5T5NG 3IRZA 1F4XH 5DA0B 3V5HB 1P6AB 4V1DB 4D0CB 4QYOA 4PJCB 3LB6D 3MO1B 5C07D 3PXJA 3JTSA 1CFNB 2VNCA 4BSJA 3RGVC 3WNKA 5TPWH 2ICEA 3KNBB 2AKRB 2IJ0C 1E28B 3T77B 3GIVB 3GUTB 1QLRB 3ILPA 5H94B 1VHPA 2J8UB 4QTIH 1CD1A 3HZMA 4GXUN 4ACPA 1YN6B 4MQXD 3LD8B 1RV6X 1OAUH 4JFOA 4NCC1 1D7FA 1EMTH 2NY5H 1RK1B 3O4OB 4RSVA 4XAWH 3MXWH 3WL9B 3BE1H 2FWOA 1F3JB 4IOFD 3F12A 1MWAH 2BDNH 3VGBA 1ZE3C 1X5YA 4OZHE 4PG2A 4LCWA 1FSKC 2F74B 1GGIL 3FT3B 4Y88A 5DLML 4PRIA 3BOVA 4MA8L 2H32B 4K3GA 1T0PB 1AIFA 5GHWH 4HKBB 5C3TA 3S96B 2K7PA 4HLJA 1T3FA 4L3EB 3QJHB 3O0RL 3CMGA 3DROA 2O93L 5EPMB 1U2HA 1YJDH 5JUEL 4MNGB 5C0GA 4MXWH 3MV7D 1NAKL 4U1HB 1H0DB 4NBZB 5F97E 2IG2H 3PF2A 5JOPD 1IQDB 5GRVL 1RU9H 1YN7B 5D1QB 1NCDL 4NRYA 3TJHC 1F4XL 1OAZL 1JGDB 3LRGA 5JW4Q 4CMHC 2VE6B 2DB8A 1I8MB 4H26B 4D0DA 1SVZA 3J7HA 2HJLA 3D87B 3GSQB 1LEIA 4NBXB 5TPWL 3ZDZE 4MXQD 3VXSE 3C5JA 4K9EH 4DEPC 4GRLB 5GPRA 2CIKA 3UBXI 1A6TB 2EDBA 3PHOB 4HUVA 4BUGA 4PJ7F 3E1F1 4BFEA 2IAMA 1ZWIA 4QTIL 4R3SA 3BGFC 1AD0A 43CAA 3DTXB 1OAUL 1EMTL 1X5AA 2NY5L 2X5PA 3D48R 3MXWL 4XCFH 3BE1L 4FMFA 1MWAL 4GW5B 3UBXB 3ZLQC 2BDNL 1U8MA 1A1NA 4NDMB 5ESQB 1GXEA 5IJVB 1SY6H 4JFDB 2E3VA 3SCMD 3GEWB 4Q0XH 2HFTA 5GHWL 3CFDA 5C8JB 2OL3H 3TO4C 3VRIB 1H8OA 4OZGA 1KJVB 1YJDL 1LD9B 4FZEH 4CJ1A 2C3HA 4MXWL 3QNZA 5FIEA 3X13A 2D2OA 3KHOA 2GAZB 2IG2L 3BPCA 4G80B 2X89D 1HSAB 4Q97A 1RU9L 2C1PB 4TVSa 3P4NB 1A6ZB 1G7HA 3UEZA 4U1NA 1MI5D 3V0WH 4GOSA 2R9HC 3TLRA 3T0DA 2N7BA 2ZNXA 4LSUH 4YJZL 4O5LH 4F58L 1NCAL 1YEFH 4DCQA 4Z7WE 3HN3A 1IKNA 4K9EL 3QEUB 4MDJA 1MY5A 5J57B 5D7JB 3PIQA 2QQNH 5FO7B 2FEDC 4QF1B 1LE9B 4F2MA 3N06B 3RNKB 3LKRB 5DK0A 3T0EB 3GO1H 2X4TA 3MGOB 3CFJB 4YXHL 4G6AC 1I7ZB 3O3UN 3RP1A 4P2YA 3MGTA 5FO9A 5KANI 4I1NB 1KIRB 2LABA 4XCFL 4Y5YC 1DQMH 4D9RE 1BQUA 1KN4L 5ACMA 5C86A 3CSPA 1K4DA 2CIIA 1L0XA 1SY6L 2IPKB 4NO0A 4DUXA 3L7FB 4L8BA 1XGPB 1ONQB 2AABH 4Q0XL 4I5BB 5E2UH 4NOBA 3F7YB 2OL3L 5GZOC 3MV8D 4OLUH 4CVWA 2GUOB 4U1LA 4P99A 4K3JH 2Z93B 4KMTH 4FZEL 1MFBH 1E4JA 2CLRA 1AHWB 3I6GA 1CTOA 3KYAA 1CGTA 3TNNB 3IB4A 3LQZB 1NC2A 3FQWB 2NX5D 3GSVA 2CRIA 1IAKA 1GGYA 3HMWH 4FNLH 3SO3B 3V0WL 5CZKA 4YHMH 4DOHB 3DXAB 3TBYB 1GOGA 5FDWB 5F9JA 1W72A 3V79C 4LSUL 4RIRB 4ONHA 3IXAA 4MS8D 1YEFL 5ICXA 1KB5H 5TDNB 1U3ZA 4UIKH 2VLKA 2YD9A 3L6FA 5CGYC 2I24N 3MOAH 5D1XA 2QQNL 1N2RB 5ID0A 3LDBB 4RA3A 1NMCB 2YEZA 1U92A 5KS9F 3GO1L 5FUOL 4UBDC 3UZVB 2UY7A 1UT9A 3DV4B 4PJXF 1N0LA 1M05B 2LU7A 1DQML 4BELD 3C2AH 3QUKB 4OAWB 1G7JB 3R06B 2BRRL 4W70A 1X4YA 4KKAD 4NM8H 3SGKC 1A02N 1MCSA 5T33H 3SKJH 3ARDD 4M6OH 4R0LA 1CD9B 5IJKC 2X05A 5DHYB 3DUHA 3RVVC 4JY6B 3VFMA 5DRZA 2AABL 3A6CH 5E2UL 1WBYA 5J1AA 2ZUXA 4OLUL 1FLTX 4K3JL 4G42B 4IRSB 4KMTL 2FZ3A 3A67L 1MFBL 4BFIB 4Y5VC 2BSTA 3DUUB 1S9VA 2JB6A 3B8YA 4WO4A 4RDQG 3WLBA 5B3NA 5E94A 2FBJH 1DQDL 3QUMA 2EH7H 3O2VH 4JAMB 5FGBA 4C58B 4N0FB 3HMWL 4FNLL 1QBLL 2J6EA 1K6QH 2PXYC 1KCSH 3UAJD 3SE3A 3FFCE 4GAJH 5HGHB 5CEYB 2YUXA 4PR5B 1I1AD 4KQ4H 1KB5L 5HPOA 3SDAA 5TDOA 5ICYA 1QBMH 4UIKL 4F7PA 1BPVA 5BS0D 3MOAL 4GAFB 4ZO7A 5DRNB 1I7TA 3W82A 3LN4A 4K55A 1S9XA 5LAXB 1GOHA 3PNWA 3JV4B 3O3BB 4K7PY 3CJJA 3EFFB 1LEKA 4LGRB 5TF0A 1SHMA 5B38G 3BP4B 3OKEA 4KDWA 1OTTD 3VCLA 3VFPA 1IJ9A 5D2LF 3MBEC 4QTHA 4U1MA 3FQRB 5F1NB 3FFDA 2AK4B 4FQJH 4NM8L 3U9UB 5CCKH 3SKJL 3NCYS 5K9JH 4M6OL 2Q8BH 2Q20A 3FONA 4KUZL 2DQDH 5ACLA 5D1ZD 3IDNB 5I1DA 4LCUA 3G6JB 5KSAD 4PJCF 5D2NB 3A6CL 1P7KB 5IEKB 5K9OA 2VLJA 4ELMB 4ZXBA 1DEEB 5ITFA 3EDKA 3KJ4C 5GS3A 2AEPH 1RZIA 1EXUB 4JZJB 4NGHL 1D6VH 2GY5A 1OAQH 2EYSA 2J8UF 2CDGA 2FBJL 5IIEB 2EH7L 3O2VL 5JHDD 1LP9E 4Z7NE 3WXWH 3QIWC 4JQVA 1K6QL 1MPAH 5E08H 3VDAA 1KCSL 1NCUA 2PTTA 5DRWA 4WCYH 3L3JA 1B4RA 4Q7DA 2IANB 4GAJL 3B9DA 3MLWH 1M1SA 1WWCA 3W0WB 4KQ4L 1X5FA 1QBML 4UIMB 5BV7B 3RVUC 4Z5RB 3G5ZA 4XBPA 3BHBB 3F6LA 2QTEA 1JF1B 5MERA 3FT2A 4ONGH 1J1OH 1TVDA 2XY2A 5FGRA 1FFPA 1EHLH 3OXSB 5D6CA 1JHTB 3CPLA 1MIEH 4UTBH 2VZ3A 2EZ0C 4KRPB 3ZE0E 2B0SL 1U8PA 4I3GA 1QUNA 3MJ9H 4X80H 2UZYB 2CLZB 2F53E 4FQJL 3QUXD 5T1MB 5CCKL 1Q9LA 1TIUA 4B50A 2Q8BL 3DGGA 1G7LA 3F7VA 2DQDL 5E2VH 4J3WA 4KKNA 4HGWA 3C60D 5DMJB 2YN5A 4JM2D 1BVLA 4J23A 1NAMH 2AEQH 3QO1A 8CGTA 3ULUE 3L3DB 2AEPL 4GFTB 3QIUA 2ARJB 3BN3B 1D6VL 1OAQL 1NFDE 2VITA 4HMCA 4JG0H 3RX8A 2DQGH 3QCUL 4DQOH 5BQ7B 1CL7H 2G9HB 5GGSB 3WXWL 2VXTL 4RISH 4XCYA 4O02H 4UQ3A 3RUGB 4DFIA 2GK0B 4XVUC 3JXAA 1MPAL 1UWXK 5E08L 3RIAF 3L3HB 4P2QD 4WCYL 3IFOB 4L3ED 3N1MC 3MLWL 5E24E 5BRZD 2E6PA 4ZUUB 4ZYKA 3MRQB 5L2JB 4JVUA 3SE4C 1KEMH 1S7RA 1GH7A 3EDFA 4TQEH 1JYNA 4HZLA 5F1KC 4AH2B 4XVJH 4BZ2H 4P3DB 3DMMB 3QQ4B 3OMZA 3QDMD 4Q9QH 4ONGL 5J13C 1UXWA 1J1OL 2B1HH 1TCMA 3PG2A 2V17H 2FL5B 4L4TD 3EO9H 4WW2C 2VJXA 4UAOB 1KTLA 1TETH 3WHXA 1ADQA 4MAYB 1MIEL 4UTBL 5C09B 4BH7B 3UTSB 5ESAB 3MJ9L 4X80L 1VFMA 4HUWB 2VDLL 5HVHB 1H3WM 3EBAA 2CO7B 5I66A 4PJFB 3RRQA 3QUYB 4GRLD 5E2VL 2QHLA 4RGNC 3TO2A 1MCWW 4XRCA 1D5ZA 4KY1H 4U0RB 2A9MH 2AEQL 1LO5A 1DLFH 5E00B 2XNAA 3DLQR 3MMEA 3TC9A 3D0LA 5CJXC 5GGRB 2VXVH 4MLIA 2BVPB 2Y5TA 1MVUB 1ACYH 1U58A 5IV2B 3GDBA 3QPQC 4JG0L 4PGCB 2DQGL 4DQOL 1CL7L 2DQIH 3EOYG 3SDCB 3KPMA 4XNUH 4RISL 3D6GA 3O45A 4O02L 5D8JH 3QQ9D 4YDLB 5INDB 5KVMC 1XR9B 2ZCKH 2C7UB 5IG7B 1RPQA 4KK6C 5H37G 1KSRA 2L7UA 2D31B 2BP3A 4KK5D 1UM6H 3O3EB 3KLHC 1RULH 3SY0A 5IFJA 2AJSH 1W0WB 4TQEL 3BP7B 2Z8SA 43C9A 2HT4D 4XVJL 4BZ2L 5ALBH 2DQCH 2DS4A 4Q9QL 4FXLA 2B1HL 4TUOA 4ZPTA 5C0AB 4ZDHA 4ZFZB 3EO9L 3TZVA 3NCBB 3ZKMC 4PJ8A 1TETL 3NCEB 1ZHBB 1PY9A 1J0ZA 3T4YB 3WJJA 1U8HA 4Y19A 3GRWH 1EHAA 2Z8RA 1VFOA 3RU8H 3DSFH 3GMNB 5E4EC 4U6HA 3QI9B 5GRUH 4U6TA 5JHLH 1CG9B 1X6LA 4LF3B 1QLFA 2A2QT 5D7JD 3GMLA 1PKQA 3DIFA 3TPKA 2B39A 4MLSA 2A9ML 1SMOA 2V5YA 1DLFL 3KPRE 1ZLVK 3EOBA 3E6FB 4J8RA 5ENWA 1NANH 3K8KA 4HCRA 2VXVL 3ECBB 1W0VA 1XH3B 1TLKA 1ACYL 3IJYB 1PBYA 2JK5B 4Y16A 1MSPA 1O7VA 3ARWA 4H1LA 2HAZA 5AAWA 5JQHC 5T3XE 3F7QA 2DQIL 2E8ZA 3O6FA 3MNZB 4R7DA 4XNUL 3S36H 4MA1C 2DN7A 3VXSD 1QQDA 3QUZA 5D8JL 3VMOA 2AW2A 2ZCKL 3NFPB 1N8ZA 1IL1A 1HHKB 4J1UA 4NKIH 4PJIB 1UM6L 3BMWA 3PDGA 1RULL 4P2RA 3WNOA 3MFGB 1P9MA 3N1GC 1XGRB 2AJSL 2OMNA 2EDJA 2DIJA 2Q7YB 4G8GD 1A47A 1OOAA 4NQVB 5FB8A 5H37H 1KGCE 5ALBL 3V6OA 2DQCL 1LK2A 3ARQA 4Y0GA 1J05A 4P23A 2C3XA 1A9EA 2PYEE 2PW2B 1J8HB 3UJIH 4XB7A 3RNQA 1MCRA 2C5DC 2JJSC 3RU8L 1BD2A 5CSZB 4D9QD 2VDKL 3H9HA 4WHTA 3CLFH 5GRUL 3FRUA 3EYQD 5LG1A 3HLAB 3RWCA 4K2UH 2Z4QA 4UNVA 5JHLL 5T1KA 1N26A 4KFZC 4RBPH 3KS0J 1CF8H 2X44D 3IAPA 5DHVH 3UYOD 3MLPA 5ILTH 4FQ2H 4ORGB 5T3ZD 4BSVA 2PYFA 5FO8A 3LN9A 5B4MD 1QRNB 2VXQL 5DD1H 3OSKA 3BXNA 4HV8B 2CDFB 4MX7A 4XVSL 3S36L 3IDXH 2FBOJ 5DI8B 1XCTB 4E0RB 1T1XA 3MUJA 2HTLD 5EUKB 4NQDE 3RGHA 1X7QA 3DV6A 1DE4B 4NKIL 1EJOH 3RAJH 3TPUA 1QFOA 4IRSD 1MFAL 2BHYA 3OX8B 4MNQA 1T80A 1UCTA 2I07A 4YNYA 5ISZD 2ICES 4JVWA 4D9RD 5FUZH 4QHMB 4ELMF 4BSWA 5ACZA 3C08H 3MR9A 4ODWB 3UJIL 3L95B 2ZUTA 3RKDD 4I4WA 1NMBH 1U8OA 5HGAB 2FYYB 1UGNA 3QFJB 4PJ9D 3V7MA 2GJJA 2NW2B 4EUPA 3LEYH 4S11A 5HI5D 2BRQA 1WQVT 2UV3A 4K2UL 1XIWD 4S0SD 4PRAB 1TCRB 4WV1A 3VFVA 5D5MF 2Z31B 3GSUB 2NZ9C 1O0VA 2E9BA 3MV11 1N4XH 1CF8L 2BOBA 1DN0B 4HUMB 2X7LB 4NQCA 2R0ZH 3GJFB 3LKOA 5ILTL 3BUTA 2AXFB 4MNQE 3KXFB 4MCZA 5DQ9A 4GUPB 3SPVA 4E41E 5GS2H 5I1IH 4FQ2L 2RIKA 4MXVF 3W39A 1PAMA 3VRJA 3OKOA 5DD1L 5KAQF 2X4OB 4LAJH 1B6DA 5GGSY 3VI3E 3QAZB 5GISH 4HUKB 5HGBA 3DO7A 3QEQB 2W38A 3PGFH 4KTYA 5I76A 5F3BB 3IDXL 5EU4A 3LIZH 2OR9L 4C56A 3HR5A 1DZBA 3C87A 4ZO9A 3V5KA 5GGVH 1Q1JH 3RAJL 1EJOL 1NLBH 1I3GL 5KZCB 3RWEA 4X6DE 2PW1B 3MRIB 3GSOA 2R0LH 4ODUA 5I30H 4BH8B 3QIBC 3K1KC 1HE7A 5FUZL 3MX0A 4OFYD 1SJHB 3D9AH 3C08L 5DVLA 1JGEB 1NMBL 5SWSA 4KI5F 4P5KA 2K3TA 3TBWA 3BGAA 3LEYL 2DIAA 2VQTA 1I1FA 4X5LA 2QADC 2O61B 4FN0A 3IS1X 4JN2A 3JVGA 4PP2B 3RUGF 3S5LG 1U8QA 3MRJA 2AJYH 3D3VE 3FTGB 1BQHB 4WU7A 4WFFD 1EFXB 1N4XL 2R29H 2R0ZL 5FF6A 5GGQL 1MRCH 4KV5F 5GGRY 4AQ1B 3P2TA 5I1IL 5GS0C 1S9WB 4RGMB 1PG7H 1PEZA 5EORH 1P7QB 4LSTH 4X9BA 1AC6A 4S10A 2A6IB 1WSST 2GW5A 1RK0A 4CMMA 4IM8A 5GISL 3V52H 2CRZA 2X4PA 3C6LC 4PJGA 3PGFL 4KROB 1SJEB 4I77H 4OZFB 3LIZL 1MCWM 1R5IB 2V5TA 1JHLH 1JCKA 3ULUH 1A2YB 5GGVL 1Q1JL 4Z7UE 4APQC 3KYNB 1NLBL 3IJHA 3RWHB 2HG5B 1N64H 4FFVD 4PJFF 2ZZUT 3S3SA 1H3GA 1MHEA 1U8IB 5GS2D 2R0LL 5I30L 1ZLWK 5C0BA 1DUYB 3SDYH 4WEUD 5I74B 2P49B 4L8CB 4X7FC 4F7EB 4N0CD 3HPLB 5FM5O 3I75A 2NY2D 4FXKB 4HGKC 2QSTA 3D9AL 4ZSOA 1Q9OA 2FX8H 1OLZA 5EU6B 4FQPA 1CDHA 2F19H 2WQ8A 3H6JA 5IW1A 4FOMA 2DKSA 2AV1B 2JJVA 5IMKA 1S9KC 3WFZA 5EUOA 1U3HD 4L29A 3JV6B 2AJYL 1H3TA 1Q0XH 3AROA 1F6AA 3T3PF 2HYMA 2R29L 3PWNA 5C7XH 2GJ6A 4FHBD 1QR4A 1MRCL 3K80A 4LPYA 5HYJB 4CKVX 5CZVH 2YZ8A 3UTPE 4HFUH 1EERB 2UYLA 4WTZG 1PG7L 5EORL 4LCCB 4MAYD 1BVKB 4LSTL 2OQJA 2FR4A 3BKJH 3UTSD 4X0KB 4PYHA 2H2SD 4XPTL 5DJCB 3V52L 3VXMB 4X5WB 5CP7B 1SM3H 1HWGB 4ZSOE 4I77L 4YDVA 1X5HA 5DFWH 2XKNA 2X10A 3ESUF 3EDJA 5I6XC 2OR8A 3PGCB 4QY8A 1JHLL 3Q6FA 5I8KH 2WLYA 2NY4C 4N8VB 1QSFB 4OD2B 1J10A 2LTQC 5IWLC 1N5AB 4YIQB 1N64L 3C8DA 2IBZX 1ZA6B 3FHAA 4TULH 2Y4SA 4MQ7A 1YEGH 3RY6A 2R2HA 2Y1VA 3SDYL 1TNNA 1QSEB 2VUOA 2VISB 3LY6A 3QFDB 2F53D 2ZJSH 4NRXB 1I7UB 5KSBE 1FNFA 4U2YA 1DQQA 3MV9A 3VXUB 2FX8L 4KC3B 4OBSA 2F19L 3Q5YA 5CBAB 4OGAC 3VXRB 4HUUA 1Q0XL 2VXSH 3MRFA 4XXCA 1Y0LA 4UT7H 3H7LA 3ARGB 2JJUA 5C7XL 1Q9KA 3UDWC 4YAQA 4PJIF 5CZVL 3HE7B 2CQVA 3CFBA 1GCFA 5IB5A 1GAFH 4UUJA 4BZ1H 1KXTB 1FG2A 4LQ1A 3BKJL 3VRLF 5B8CB 4YFLF 1YMHB 5HDBF 1GYAA 1KT2B 1CWVA 4KVNH 3E3QE 1SM3L 1UB6B 4EOWH 2F8XC 3MLVH 3QWOA 5MENB 5I8KL 5F6IB 2FJFB 3KPSA 1AFVH 2VLRB 4E5XB 4LKXB 4LVNC 3ULSA 4QRPA 3R0MA 3NCFB 4ISVA 4Y4KA 4HWNA 3PL6C 1H5BB 1G6RA 1JL8A 1S7VB 3KWWB 3MRMB 1A3RH 1F2QA 3D2UB 1ZSDA 4J3XA 5T3XH 1YEGL 3RY5A 1NGWA 3U2SA 1MJ8H 1DVFC 2KH2B 2ZJSL 3NIGE 1AQKH 5HPMB 5BJTB 4WGVB 5DHXB 1JYXA 4LHUA 2SEBB 4J6RH 1B6UA 3RL1A 1AGFB 3LB6C 2MKWA 4QT5B 5JQ6H 1KC5H 1QD0A 1KCLA 3O6MH 1E4KA 3A0OA 3OKNA 2ZSVB 2XRAH 2VXSL 2YC1B 2YD3A 4N1EA 3V0AC 1XGQB 4UT7L 1W2KT 5HHOE 1H3VA 1DCLA 5DGQA 2GTZB 3P77A 3M07A 2DF3A 4YC2B 5I19H 1H8SA 4MQXC 4L9LA 4PLJD 2YD1A 1YNLH 1RUMH 4Y4FA 3D39D 2GY7B 5T1DH 1GAFL 4BZ1L 4IOFC 4WUUB 3BRGC 5ERWB 3TYFB 4HKZA 3UX9B 1U95B 1TITA 5FK9A 4IOSD 4KVNL 1HH6B 4TVPL 1QFWH 2DYPA 4EOWL 3CFKB 4HS6A 3MLVL 5I16B 3QDJA 5E5RB 1AGBA 3DURB 3RTQD 3GIZH 2OR7A 4Y5XB 4WIQA 2DL9A 2BY3A 2H3NB 1A3RL 5T3XL 2V2XA 4EXKA 5GIRA 2OXHA 3PQYE 5EC2B 1REIA 3WUWB 2D0HA 1HINH 4G9FD 3WXVH 2H1PH 1MJ8L 2AERT 2XWTA 1AQKL 3HNSH 4GQ9H 1RJYA 2I9LA 4TVPD 2UWEB 4PRNB 5AZEL 4J6RL 1Q8MA 2ZUQC 1S7XA 1MCKA 5HY9A 5C0CB 1T7VA 1HQRB 5JQ6L 1KC5L 3IETA 4DTGH 3RGVA 3QRFM 3O6ML 4MXQC 2AJZA 3WIHH 4WEBH 3L7EB 4PJAE 2ZUYA 1FAKT 2XRAL 4U1KB 2H45A 2XPGA 1XF4B 4NWUH 4R90H 1KUMA 2BVYA 4BM7A 2AQ3A 4H25A 3V95A 1RZ8B 4ZAKA 1UADC 5I19L 4OM0H 1ZHKA 2ZCLH 1YNLL 3DUSB 5T1DL 3ARYA 1CIUA 1BIIB 4Z7QF 3FT4B 3PWUB 4N9GA 3MRPA 1T5WB 4E42B 3V8CA 1Z5LA 3NPZB 2X4UA 4HK3J 1QFWL 4PRPD 3SCMC 5C6TL 4S1DD 3FN3A 4PJEB 4XAKD 2Z31D 4G43B 2YD8A 2G60H 3VGFA 1NEZG 1T04B 4FXGA 3MUGA 1RJLB 3DX7B 2DQFA 3EO1B 3KXFD 4LLDA 4HWZA 5JOEA 1BBJA 2DICA 5LCVH 3MGAA 1ROWA 3SJVE 3TJEH 3HC4H 3CZJA 4JFYA 2BHUA 2NY5C 5CUSH 3MLTB 1HINL 2H1PL 2PTVA 3ARFD 1IGMH 3QXTA 5E2TH 3JV0A 4B53A 1K9TA 1UH2A 3HNSL 4GQ9L 5FA3A 2EH8H 1PD6A 3U6RA 1NL0H 1BOGA 4FTVA 4MJIA 3ROLB 3T2NH 3F58H 1EK3A 2LAGB 4L4VE 2RHEA 2QEJA 4D9LL 4DTGL 5DZLA 1A7QH 4RAUA 4G8EB 5IMLA 3WIHL 4WEBL 3I02B 4IMKC 2J2ZA 4XP4H 4ZO8A 1YJDC 1NAMB 4FFYH 4XTRD 1UB5A 5L0QC 4AEFA 5T5NF 4R90L 2QSCH 3L3OB 5FYJE 1TNMA 5JR1H 2BERA 2AXHA 4NKOB 3PWLB 4OM0L 2ZCLL 4WDIA 4XPHH 4QYOB 4NUJA 1RURH 4NCDA 4OCYH 4M02A 3T65B 3WNMA 2YD7A 3DOSA 2ICEB 3TT3H 2YHGA 2YRPA 4PJ7A 2ZSWA 1RVFH 2G60L 4I0PD 3FB7B 1J11A 4R4ND 2X6MA 3LS4L 3HZMB 1CD1B 2HJKA 3N9GH 5IBUB 4JRYE 5GS1C 4JFOB 1D3CA 1EAJA 3D5OF 4U4BA 3TJEL 1C1EH 1NSNH 2FATH 3HC4L 4CUCA 2FWOB 2BNQA 1Z6JT 3F12B 2F8VA 2WM0A 5CUSL 1S7UA 3BPLC 1MCPH 1FH5H 1OGAE 2FSEA 3TA3A 1WEJH 3UO1H 4LCWB 3DYPA 1IGML 5E2TL 4HSQA 3FQNA 4KROD 4R96A 1X5LA 1OP9A 4PRIB 1SJVA 2EH8L 2C9AA 4HK0A 5T1LB 1AO7A 1NL0L 4PJ5E 3T2NL 4XP6H 3F58L 1T3FB 4MS8C 1V05A 1LEGB 4U7KA 3VGAB 5MHSE 3DROB 1A7QL 1MVFA 4E41D 3MRCA 4WI8A 1YEHH 4XP4L 1EHNA 4JRXA 4FFYL 1GRWA 4JREB 3LRSA 2QSCL 4YBHA 4JO4H 3DSNA 1X5XA 3STBA 4LLVA 5M95B 5JR1L 2XQBH 4RFNB 2YKLH 4JHWH 3TN0A 5L8KB 4PJBF 1FNGA 5L9DH 3ARBA 4XPHL 4NQTA 4OI8A 1RZ7H 2D7MA 3CFIC 4D0DB 3FO9A 2F5AL 2HJLB 3QCTH 4Y5YA 5EOCJ 3VGDA 1G1YA 1RURL 3C9NA 4KKAC 3TV3H 2A0LD 5IT2H 1JGVH 3ARDC 3SE8H 4M4PA 5ICZA 3C5JB 4Y1AE 3TT3L 2CIKB 1RUAH 1RVFL 4CVUA 1CGWA 5B3JF 2IAMB 1ZWIB 4Y89A 5JXAH 4R3SB 3N9GL 3MC0A 5HYEA 43CAB 3C5ZA 4S1QH 5KBNC 5A2FA 1C1EL 1NSNL 5D7LE 3I6KA 4UZGA 1U8MB 1D5BB 1MCPL 1FH5L 1UM5H 1A1NB 2PKDA 2VR9A 3MRRA 1WEJL 3UO1L 2EO1A 3TBSA 2P5WA 2Y25A 5K9QI 3A6BH 3QHFH 3D3VD 4EI6A 4POYA 2VLMD 4N90D 3UAJC 2P8PA 3UJJH 4XP6L 5IP4A 3FQUB 3HB3D 4EIZC 4M6NH 4OZGB 1P2CA 1I1AC 3NFSH 1A5FH 1F3DH 4OF5A 5EO0B 3V9FA 1YEHL 3TIEA 3BW9A 3QNZB 3TGXA 2X40A 3X13B 4WW1A 3BPCB 3RA7H 4JO4L 2DBLH 1F4WH 2XQBL 2YKLL 4JHWL 1G7HB 4DVRL 2LVEA 1E0OB 5L9DL 4U1NB 4N8CH 1RZ7L 4ODTH 1OTTC 5FECA 1KPUA 3QCTL 1XF5A 3TV3L 1OWWA 3RHWF 4DCQB 3RZCA 1ZVHA 5K59F 1JGVL 1DUZA 3G9VA 3SE8L 2OLDA 2W91A 4KRLB 3BZFA 4MDJB 5D1ZC 3PIQB 5KSAC 3DHJA 4GG6F 1RUAL 5IFHH 5KS9A 3GI8H 4F2MB 5ADPH 2X4TB 5JXAL 4KZDH 2C26A 4PJXA 4X83A 4PJHE 12E8H 1JTOA 2CDEA 3MGTB 4S1QL 5FO9B 4UINH 4LRIC 2MOVA 4FG6D 3ALWA 4N1HB 1UM5L 1K4DB 2CIIB 4RMUA 4U1IA 5FUCC 3MCG1 4NQXA 2APBA 1F2XK 4NO0B 3NZ8A 1NUDA 3A6BL 3QHFL 4QEGA 1F4AA 2PXYA 3CFEA 3V5DA 3DBXA 4OQTH 4HLZG 3UJJL 1WT5C 1FFQA 1CR9H 4NNXA 2VLRD 4I18C 3BPNC 4M6NL 5FCSH 5GJTH 2Y06H 1A5FL 3NFSL 4F80A 4PGZA 4YXLH 3I6GB 4RX4D 3NVQA 3WD5H 2IWGA 4KZEH 1NC2B 4JM2F 2DBLL 2NW3A 1F4WL 3GSVB 3PP4H 1IAKB 5I15H 1FVDA 4X8JA 4QLRA 4ODTL 4YBLC 4MJ6A 5F9JB 1FGNH 1KCVH 4FP8H 1I9RH 4ONHB 2A83A 3MBEA 3QUXC 2WUCH 5ICXB 1HKLH 1YYLH 3ISWA 4OFVA 1DBKH 4U3HA 5M7QA 2VLKB 3BIKA 3L6FB 5HJ3A 2UWEF 3C60C 1A22B 2VLLA 4BQ9A 5IHBA 1CDYA 4WI6A 4JM2C 5ID0B 2AQ1A 1BFOA 3B6SA 3GI8L 5ADPL 1U92B 2ARJQ 4KZDL 5IFAH 4KGLA 4OCXH 4P2OA 3HE6A 12E8L 3H7BA 4MNHA 4G8FA 4UINL 5D2LA 1TQBB 4L3CA 4A6YH 2GT9A 4LDOB 2PO6A 3HUJE 1NC4D 4Z7VF 4R0LB 5SWZE 5F44A 4IIQC 1I3VA 3MRLA 5DRXA 2ERJC 3VFMB 5DRZB 2APWA 4XCCL 4OQTL 1WBYB 3P40A 4QOKA 5J1AB 1CR9L 3OGCA 5GJTL 2Y06L 1FYTE 1WWWX 4JM4H 4TSBH 1WZMA 2BSTB 1S9VB 2JB6B 4PJEF 2HH0L 4YXLL 4G6FB 5I18H 4WO4B 3WD5L 2J3SA 3WLBB 4HLZH 1FP5A 3WNLA 4Z7OE 4KZEL 3P0YH 2I27N 1JZ4A 4F7MA 1YN6A 2OJZH 3PP4L 4IJ3C 1F6LL 5F96H 2Z92B 1RK1A 5I15L 2DQJH 3BJ91 4JO3H 5FCUH 2WUBH 3GM0A 3RDTD 1N3NB 1FFNA 1FGNL 1N6UA 4FP8L 1I9RL 4XMPH 3MA7A 1KTDA 1FZMA 2WUCL 3FT3A 1HKLL 1YYLL 1JV5B 5AWNH 4EN3D 4HWBH 3SDAB 2H8PB 1DBKL 5TDOB 3REWA 5ICYB 4F7PB 4GRLC 1DLHA 3QWRD 1I7TB 5I8EA 3LN4B 1S9XB 3QJHA 1KJ2A 2DLEA 5J0BA 3PNWB 5EPMA 2E27H 1NBVH 3IKKA 5IMMA 2VZVA 5IFAL 1LEKB 4OCXL 4F15C 3OKEB 1DTUA 3VCLB 3VFPB 4LAQH 5D7IA 5ANMA 3AAZA 1JYVA 4NC1C 1AD9A 4QTHB 1WICA 3FFDB 4LLYA 4KXZI 3T0VA 3VXPA 4OZHF 3FONB 4LMQE 2VE6A 4OZIA 1TJIH 3QQ9C 4H26A 3TCLA 1I8MA 1HIMH 5DURB 1FG9C 5EOQH 4LCUB 4ORZC 5I1DB 4F9LC 2P5EA 4X7SH 3GSQA 4TUJA 2GI7A 4GKNA 2R0WH 4KK5C 5K9OB 4ZXBB 5ITFB 2HVKB 4JM4L 4TSBL 2CLVA 1RZIB 1R3HA 5I18L 2HT4C 4L8SA 1WWAX 1YDPB 2EYSB 3F7RA 2CDGB 3P0YL 4AZ8A 2WV3A 2P8MA 5F96L 1FVEA 1KXQE 2DQJL 4JO3L 4WW2A 5EDXA 2IADA 2WUBL 1KENH 4GW5A 3KYOA 1CGYA 1KJMB 1R3KB 2PTTB 1YNKH 5DRWB 2DQHH 3WFEH 2EEDA 1BZ9A 5C3LD 1HOCB 4GBXA 3FB8B 5HYQA 5AWNL 2EKJA 3MODH 4HWBL 4K3EH 4XPBH 4QRQA 2XA3A 1RZKC 3OPZH 5D7JC 4G6MH 3H9SE 1D5XA 3GKZA 3G5ZB 4QHKI 1NPUA 5FYJH 3ZTJG 5C8JA 1CVRA 5MERB 3FT2B 3T0EC 2I5YH 3FRPA 2HT2D 2OP4H 2V2WA 4PFEA 2E27L 2E7MA 1NBVL 4MHHG 4HIXH 1FFPB 1QLEH 5D6CB 4JDTH 1YMMA 1PW3A 1P5VA 3CPLB 4LOUD 1HSAA 3VFUB 4LAQL 1UWGH 3PWPA 1U8PB 5JIKA 3GNMH 1A6ZA 1Q9LB 4QO1A 4JLRA 5F3HA 5L2KE 3DGGB 4UDUA 5JO5A 2C3WA 3F7VB 1TJIL 5FGCB 4M48H 4Q9CA 1HIML 2XKSA 5EOQL 4HGWB 1PLGH 1NCCH 3UTQA 4X7SL 1HZHH 1BVLB 2R0WL 4NQUA 3QO1B 3H9ZA 5C6PB 1UH3A 4F57H 3FB6B 4CVZA 1PYWA 3DVIA 3QIUB 5C70A 1LE9A 5DVNA 3GJEA 1I9IH 5I1JL 2NZIA 3MGOA 3S5LB 4Z0XA 3CFJA 4LCWD 1RIHH 3MJ8A 5IGXH 1VFAA 4XCYB 4UQ3B 1R3IH 1JN6A 3SO3C 1KENL 1A7BA 1T89A 1X5ZA 2EDHA 4PTTA 1YNKL 1IARB 2Z35B 2DQHL 4K7PX 3WFEL 5C0DA 3D18A 1EEZA 4F9PA 5HYIA 4ZYKB 2HT3D 3DX8A 3MODL 3EYQC 3BKYH 4K3EL 4LDEB 1S7RB 3OPZL 3SJVD 4G6ML 4HZLB 4Z7WF 1KEGH 1INEH 2Q86A 4X4ZA 3O6LH 5FYJL 2I5YL 1UXWB 2OP4L 3KLSA 4JFEE 2MPAH 1QLEL 4HIXL 3AM8C 5EBLB 2VN4A 1KTLB 5KVEH 4JDTL 2BCKA 3ZTJH 5B4MC 5JW3H 1UWGL 3FQWA 4X9IA 1CVSC 3GNML 5FAAA 1D6EA 5I66B 1S5IL 2J12B 4M48L 1PLGL 3TO2B 1NCCL 2HTLC 2ZKHH 4HFWA 4XRCB 4D3CH 1HZHL 1D5ZB 5E8EA 2IAMD 5BOPA 4TNWK 1CFTA 1LO5B 2DI8A 5FYJD 3W2DH 2XNAB 4IRSC 4P5MA 5CSGA 3MMEB 1IM9A 4LCYA 3D0LB 4KWUA 4F57L 5DO2D 3MOQA 5EU7E 2Y5TB 2D9QB 4PLOB 1U58B 1I9IL 1R24A 3MTRA 4HKXB 2RGSA 4OGYL 4XPFH 3LSOA 1BHGA 4OTXH 5A40E 1RIHL 5IGXL 4KKCD 1LMKA 3DV4A 4YHNA 3CNKA 1R0AH 3O45B 1R3IL 1B4JH 1YPZE 3EYFA 3KLAB 3RKDC 2G5BB 3QUKA 4HH9A 3VH8A 1G7JA 3R06A 2ADIA 4PJ9C 2DJ4A 2JJSA 3V6FA 2KKQA 4DKDC 5HI5C 1RAMA 1MJUH 4JRYD 5HDOA 3UMTA 3BKYL 3SY0B 1XIWC 5IFJB 4JCLA 4URTB 4JY6A 43C9B 1KEGL 1INEL 3LPFA 3O6LL 4AYFA 5CZXD 3R0NA 1FPTH 1OGAD 1I9JH 1NMAH 2EXWD 4TUOB 4ZDHB 1QBBA 4N0YH 2MPAL 4C57C 5KVEL 1CDBA 4PJ8B 5BCAA 5F71A 5JW3L 4LPVA 3L5HA 4PJ5D 4HGMA 2GSIA 4C83A 1ORQB 5MHSD 1NDMA 1QHPA 2UZIH 1CDCA 1NCBH 3PHQA 1QLFB 1H3PH 2Y36H 2ZKHL 3GMLB 3WCYA 1PKQB 3DIFB 4HW6A 4PR5A 3I3DA 1K3IA 3W2DL 1AQDA 3QPXH 3EOBB 4HJJH 4Y2DA 5ENWB 5EZLA 4NC2B 2GJZA 1W0VB 2GFBA 4XNYH 4F8TA 2ADGB 3DRQA 4POZD 3PABA 5LAXA 4QRRD 4Y16B 4JKKA 35C8H 3QXWA 4XPFL 3BO8A 3O3BA 4OTXL 1K8DA 3O6FB 4R7DB 1R0AL 1VGKA 3QUZB 4JFQA 4Y1AD 3E6HA 1B4JL 3GM8A 4S0TD 1N8ZB 4S1SH 5E7FA 2E7LC 3KPNA 1H15B 2AK4A 5CIPH 3QHZH 3S4SG 4XP5H 1EBAA 1MJUL 4P2RB 3OF6A 5GGVY 1BLNB 5HSFA 3WKNA 3KR3H 1FN4A 4W6XB 5C08E 5D2NA 3IFLH 5FB8B 1NC2D 3BAEH 1FPTL 4PIRF 1AXSA 4ELMA 1DEEA 1J05B 1I9JL 1NMAL 4G6AD 2BOCA 1W8NA 4P23B 4N0YL 3IDYC 2WP3O 4JZJA 3HFMH 5IQ9A 1ZOXA 3RNQB 3PWVB 4U6YA 2R2EB 1BD2B 3TCXA 1U8LB 4DGYH 3H9HB 3RIFK 4WHTB 3FRUB 1JRHH 2UZIL 3QG7L 2Z4QB 1MEXH 5D5MA 1H3PL 4M5ZL 2BNRE 5D1XD 5T1KB 2Y36L 2OTUB 5J1SC 5GZOD 2DWEA 4OI9A 4KXZH 2XQYK 3W0WA 1OB1B 4W4OC 3QPXL 3U46A 3AB0C 2F58H 4HJJL 4FFVC 4WWKB 1F00I 4BSVB 4IOIB 4XNYL 1GPOH 2PYFB 5FO8B 5EO1A 35C8L 3BXNB 3LZFH 4N0CC 3CAFA 1JTPA 2NY2C 1LP9F 5IB3B 1J88A 4Z7NF 1T1XB 4S1SL 1UM4L 4K23H 4C59B 1T22A 1X7QB 3DV6B 3DYMA 3QHZL 2PETA 1JPFB 3TPUB 3AGVA 2IH3A 4JFZH 1U3HC 2WSKA 4TRPH 4MNQB 1WIPA 3GMPA 4PRHA 1G6VK 3KR3L 2I07B 4XMKH 4YNYB 2J88H 3IFLL 1D9KB 1I1YB 3BAEL 5CD3A 3JWOC 3BQUA 4BSWB 5JLZA 1CDUA 5ACZB 5KG9A 4UAOC 3U0TA 3MR9B 3HFML 4MAYC 4RFOH 3WFBH 5E9DA 4I4WB 1KFAH 1U8OB 3P4LA 3S88H 5BQ7A 2H2SC 5GGSA 4EUPB 4DGYL 3ZE0F 2JIXA 3T0XA 1MH5B 4WVRA 1JRHL 3SDAD 3C6LA 2GK0A 3RKPA 1MEXL 1WZ1H 1AGEA 3L3HA 3VFVB 2GITA 3TH4T 4M7KH 2E7CA 3C09B 5CMAB 1HNGA 3OAYH 2BOBB 4NQCB 3LKOB 1AKJA 4XI5D 5E2JA 3RWFA 4APQA 5DQ9B 1DBBH 3SPVB 2F58L 2RCSH 1BFSA 5HGDA 3W39B 4ZNCD 5ESVB 3ULUF 2Q87A 4P3DA 1GPOL 3VRJB 2JCCE 3OKOB 5C0FA 1CFVH 1MLCA 2AJ3A 3U4AA 3LZFL 1NFDF 5HGBB 1IC4H 3DO7B 5I76B 4MD0A 5EU4B 5C09A 3EJZD 5C2BH 4C56B 4K23L 3V5KB 3IGAA 1SMAA 2EE3A 1NCNA 3EJJX 2VLJD 1MAML 1QA9A 1MCEA 4PJFA 3RWEB 4JFZL 3QUYA 2YK1H 1CDJA 1O7SA 3GSOB 4XMKL 1YA5A 1CGVA 2J88L 2NY0B 2FCBA 3OAZK 1D5MA 4N1CA 1KPRA 4OF0A 2VR5A 3NA9H 5GGRA 2HLFD 2BVPA 3DI2B 1MVUA 4RFOL 3WFBL 5DZNA 2FHBA 1CFQB 5SWSB 5I75C 1GL4B 4P5KB 3M1BA 3S88L 2RQ8A 1MFCH 2DLHA 3TBWB 4GXVH 4XC1H 3VE0A 4JGJA 5CEZE 4RWYH 5LQBH 1FYTD 1XR9A 4JN2B 1U8QB 2C7UA 3MRJB 4D2NA 2R1WA 1WZ1L 5ADOH 4WU7B 4M7KL 3UTTA 2MCPH 2WBKA 4QXUH 5FF6B 2BMKB 1DBBL 2RCSL 1FORH 1CICD 5IWLA 1IVLA 1N0XL 1P84J 3OKMA 2HKFL 4Z8FH 1RHFA 2OI9C 1CFVL 5TE7L 5TQ2H 1RK0B 4CMMB 5C0AA 1Z2KA 4ZFZA 1IC4L 3ABZA 2X4PB 3U79A 3RWJA 4NNPL 4XCNA 4WI9A 5C2BL 1QEWA 2X41A 3MFFA 1CG9A 3IJHB 3U30C 3VD7A 5MEQA 3DWTA 2YK1L 3FQXA 1MHEB 4W6YB 5C0BB 2P47B 5CKGA 1QNZL 4N0RA 4HWUA 3IXTA 3CH1A 1ADQL 4U3XA 3E6FA 3QCVH 3I75B 4L8DA 1JWMA 3NA9L 4PLJC 2ATKA 3OAZH 4ZSOB 1Q9OB 1PVHA 1QG3A 4FS0A 1MFCL 3EAKA 5IW1B 4O58H 4GXVL 3HG1E 3MNZA 4XC1L 1OCWH 4K3HA 5IMKB 4RZCA 4RWYL 2DMCA 5ADOL 4I2XE 1F6AB 4RAVB 2MCPL 2VUYA 3RTQC 3PWNB 1BBDH 4QXUL 2GJ6B 3QHTC 1ZS8A 4ZOBA 1JWSA 1UJTA 4YX2H 1FORL 2UYLB 1HI6B 3QDGE 4UB0H 4D8PA 3B9KB 5TQ2L 3W5MA 5KOMC 3AVEA 1DVFA 1JGUH 1VADA 4G8IB 5FA4A 2PW2A 4YDVB 2XKNB 5M94B 3H9SD 4L1DA 3Q6FB 2W0FA 4N0UA 5CSZA 5C07A 3O6KH 1FIGH 3OJDA 3SO5A 5HHPB 4MGXA 1C5BL 3TM6A 1XR8B 3BH8A 4NQEE 4YWGH 4MQ7B 5E6ID 4Q6IB 1DANT 1DDHB 2JLLA 3ULVE 5HGGS 3KAAA 1VESA 3O2DH 2ZCHH 2DQTH 3QCVL 2WWKT 1IFHH 1RJCA 4HC1H 1CGUA 5DUMH 1DQQB 5L2KD 3I84A 3MV9B 4N8PA 5DD6A 2OYPA 4O2FA 1SYSA 3GSNH 3S98A 5IVZA 4PGJA 1BP3B 4O58L 2IPUK 1OCWL 1PZ5A 4NRZB 15C8H 4UMGA 5CGMA 4HZAA 1QHOA 4HUUB 5EO9A 1U36A 4S1DC 1EA9C 4I0CC 3MRFB 2F54A 4U1SA 2Z31C 5B39G 1Y0LB 5FM4A 5HHME 5CHNB 4YAQB 4DKEH 3OX8A 1ZT1A 1JFQH 4YX2L 3TZVD 3T3ME 3L5XH 3CFBB 1F90H 4MA7H 2W60B 5IB5B 3SGDH 3G5XB 4UUJB 3MV7A 4UB0L 1N6VA 1FG2B 4Y19D 4JZNB 3VXQA 4CN4A 3SGJC 3QAZC 4OIBA 1HXMA 3LEXA 4OKVA 3NA4A 1IZJA 3ARFC 5JPNA 1JGUL 1FIEA 3L95A 3MRDA 3F8UB 1MCNA 1TQCB 5HGAA 1S8DB 3TIDA 5J11C 4Y4HB 3QFJA 3RVWD 2LQRA 3OB0H 3S8WA 4WEMB 3O6KL 1UWEL 4PGEA 5EOTA 4PRDA 5HHOB 5E8PA 1KCRH 1B90A 3GHEH 4OGXH 4QRPB 4ISVB 4Y4KB 1OD7A 5H35A 3GSUA 1G6RB 4LPCA 4R9HA 2BNUA 5EWIL 4XTRC 4NO3A 1J9CT 3FO1A 2ZUVA 1ZSDB 2VDQH 3QNXB 4YWGL 3EIFA 1NGWB 3HRZA 3GJFA 2AJUH 5IKCA 2IFFH 4NCC2 3O2DL 2ZCHL 2DQTL 4HC1L 1TZHA 1FVCA 1IFHL 5DUML 4A6YB 1T2QL 4LHUB 2OTWA 1YQ2A 4Q74A 5JOPE 2X4OA 3RL1B 3GSNL 2DBJA 1U9KA 4G6JH 15C8L 5F3BA 3AXLA 1GGTA 4Z9KB 3SCMA 1A7RH 2ADFH 2DWDA 4I0PC 2VL4A 4UT9H 4R4NC 3CDFA 1JBJA 3HC0A 1CFSA 1OAYL 2PW1A 3P77B 2XKUA 4DKEL 2A6KA 1JFQL 3MZGB 4L9LB 4Y4FB 3L5XL 4MA7L 1F90L 4MB3A 1V3LA 2NQCA 4P2CG 4QKXB 5F7NC 4IMLA 1BD2D 2G2RA 2ESVE 5FK9B 3X14A 2FO1A 2IH1A 5F9WC 3MJ7B 3AS2A 3STZB 4IS6A 3VI3F 1CI5A 1MWAA 4KROC 2IQAA 2DYPB 3V0VA 5IOPA 3G08A 4HS6B 1DQJA 1MI5A 4ERSH 5T1KD 2YOCA 3QDJB 4RCAA 1AGBB 6FABH 1FZOA 2W9LA 1KCRL 3GHEL 4EEEA 3IFNH 4PYGA 4OGXL 3VFOB 4X6DF 4YK4C 1EFXA 2VDQL 2V2XB 5GIRB 5SX5K 1G0YR 1IAII 4RRPA 4YXKH 3CCHA 2IFFL 2XWTB 4LVOC 3Q5TA 1KPVA 4MDIA 5F1IA 5F1OB 3P3YA 2CR6A 1P7QA 3NCJH 2I9LB 2YWZA 3VI4E 4MD5A 1FHGA 5HY9B 5D6DC 2BXZA 5CP3H 4MCYB 1MFDH 3AMKA 3IETB 2A0LC 4G6JL 3RGVB 4Q9RH 4JFFD 2AJZB 4BQ6A 2EDRA 5I9QC 1R5IA 1A7RL 2ADFL 2XPGB 1FGVH 4J4PA 1T7WA 1WTGT 4H25B 4UT9L 4K8RD 1VCAA 4AENA 4P57A 1ZHKB 5D9SB 2YD6A 4X6CE 3WBDA 4LU5H 3TBTB 4ZUWA 3ZKNC 4N9GB 4JJ5A 3MRPB 2IF7A 4ZFFA 3HMXH 2X4UB 3T4AA 2DMKA 4FXKA 1FSKB 1WVZA 4HUNB 1RZJC 4YHYC 4ERSL 4Z95H 1C12B 1SY6A 3FO2A 4NQCD 3OKKA 4FXGB 3MUGB 3HB3C 5EG6C 2DQFB 4ENEC 4LLDB 4HWZB 1VFBB 6FABL 1BBJB 1IRAY 5A16B 3IFNL 5T5FH 5MEPB 2OL3A 4JFYB 5CJQH 3MV8E 4ZS7H 4YXKL 1CD0A 1HDMA 4LARH 3MSPA 5HYJA 1RJZA 1GGBH 3B9AA 5FA3B 1BVKA 3NCJL 4CMHB 3U6RB 4R2GD 1BOGB 1KCKA 1WAAE 4FTVB 4MJIB 5DVKA 3MUHL 4UQ2A 5SX4H 3ZE2E 2NX5E 2B5IC 1MFDL 4NO5B 4RAUB 1LHZA 4MJ4A 4DZBA 5IK3B 3ARDA 5IMLB 2CRMA