2ED7A

Solution structure of the first fibronectin type iii domain of human netrin receptor dcc
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
b'GSSGSSGKPAIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin receptor DCC
publication title Solution structure of the first fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ed7A00
3RNKA 1JBJA 4MJ2A 1FZOB 3WUZA 3S4SA 1FRGL 3ULVF 3QFDA 1LNUA 2PTTB 3D5OF 4YHIB 3KPPB 4P3WA 5INCA 5L9DL 3DURB 2BNRA 3WJJA 4K23L 1UQSB 4OGAD 1RJCA 5EDXA 5DFWH 3HNTH 4HUVB 1JFQH 1CL7H 1FNAA 4PP1C 2P5WD 5I9QB 2I9TB 3MOBH 1L6ZA 4XNMB 2MKWA 3EO9H 5KS9A 2DL9A 5DSCA 3U0WH 5FYJH 2XTJE 1U8OB 4PP2B 4U6HA 2P46B 4MQ7A 4Y19E 4DKDC 3VA6A 1S7VB 3DV4A 4JRXA 4U3XA 3TLRA 3WBDA 1RUQL 4P2YA 3D69B 2UWEF 3CFBB 3ZSSA 4OFIA 4X7FC 3RVWC 5F6HJ 1PQZA 3GBNL 4ZD3H 3GI9H 3L5XL 3PGDA 1T3FB 2HLFD 2ZUQB 3RUGB 2VERN 1LMKA 1OWWA 3EOAA 4HWZB 1HSAB 1KYOK 3TBVA 3TBTB 2F54E 2P5WB 5FB8A 5ID1A 1LQSR 3AM8A 1EGJA 1W8NA 2VLRD 4NN6C 5DJ6B 2FD6H 5DUML 5IB2B 1EJOH 3BQUA 2VDPH 3PIQB 4H0IA 2XTJC 5ADOL 2JJSC 1MFAH 5JPNA 2LAAA 3G6JF 1RUPH 1HKLL 2R23A 5KSUB 5CJBA 1DBKL 4Z7QE 2JJTA 4WFHE 4AZ8A 4WWID 1OCWL 2NY3D 2YWYA 4LL9A 1Z0NA 4JFZL 3SGEI 3MRIB 5EZLB 2ENYA 1T0MA 1YMMA 1UM4H 3U82B 5GS0H 1KNOB 4GRLC 3C2SA 3MLVL 3IJHB 2N56A 3OKLA 2EDBA 2VLRB 1J1XL 1I1FA 5J1AA 5A2LH 5EBLB 4XPTH 4R90L 1XGRA 4XTRD 1K5NB 3NTCH 3OJ2C 3ZKND 2HVJB 4L9DA 4MA7H 4KRPD 3D3VD 2H8PB 4G9DB 3F6IA 3T3PE 2MHAA 3BPOB 3JTTB 4XNUH 4JFXA 1JUFA 3JV4B 2EEBA 2NY3B 2PYED 2NXYD 4Y2DC 2HT4C 4LKXA 3CX5K 3CFIC 2YC1B 2YD3A 3BGFB 4HCRA 4JM2C 4NFDA 4XMLH 3S97C 4JO4H 3I6LD 3V7MA 5E03A 1QVOB 1HYSC 1U8LA 4S1QL 5KSVB 4JY6B 4PRIE 1WBXB 1S8DA 3QJHA 4KRPB 3D3VB 1QRNA 4MNQB 2OX5A 1RZFL 1AGDB 3V4UL 2VDNH 1RZKC 4PV8A 2OJEB 3OZ9L 3L5WB 1IGIH 3P0YL 3MLUH 2PYEB 5INDA 3SY0B 2NXYB 1F11B 3F7QA 2C3VA 3SJVD 5C1MB 3CPLB 4EIGB 4LF3A 1JRHI 1C08A 3MNZB 1T1WB 1J0ZA 1V7ML 3WXWH 4IOSD 3G5ZB 4LLYB 4U0QB 2F5BH 1NQBA 3UTPD 2AW2A 4LASL 1CFNB 2APTA 5CBAA 1KGCD 5D1ZC 5C0EA 2IPTL 2VO5A 3HFML 1IC7H 5K9KA 1QLEL 4XAKD 5DQJA 5EUKB 2AEPL 1YA5A 4QTIL 3A6BL 3RKDD 5TF1H 4U49A 4XP5L 2BVPA 3VFSA 3SJVB 3TN0C 4NO5A 5EORL 3MJ6A 3V6BR 1FG9C 3NN8A 3RWFB 5CCKL 4O00A 4FQXD 4WWKC 4OTXL 5CZXD 4KMLB 4DTGL 5DD6A 1RIUH 5KOVC 4F7TA 5D2LB 3QUYC 1Q9WA 3FAXA 4M93B 4ORGA 5J06A 2LAGB 4MQXC 4JFDE 2VNCA 5ITBL 1DVFD 4YDIL 4RFEA 1Q9OA 5MI0C 3RY6A 2XIDA 2FJHB 2PNDA 1T83A 5I19L 5D7JD 4G8IA 2VQ1A 4HDIA 4WGVB 3BP4B 3EYVB 4OKVA 3HN3A 3SDAA 1EEQA 5DMKA 3WHXA 3JTSB 1MLCB 2EIZB 1QFWH 2HKHL 3PP4H 4QYOA 1G7PA 1IQWL 2CLZB 1ED3A 3BH9A 4LSVH 4IHOA 5GIRB 1Z9OA 2QQKL 2RHEA 1MFDH 4XHQA 1KIRA 4J4PD 4RNRA 4LSQH 3QEUB 5D7JB 3OGCB 3O3EA 3CNKA 3QAZC 3VMPA 4P48A 1KPVB 1OL0A 3KJ6L 4ZO8A 2X1XR 5D71H 1S9WB 1INEH 1KTLB 5CJOL 4YC2C 3SDXF 1OAXL 4LLQA 3UO1L 4DVRH 4EXPX 1NFKA 1YEIH 1Q38A 5ANMA 3KXFA 3MSPA 3B9KD 4K8RC 1AGEA 1P7KB 2Y5EA 3MUGA 1TPXB 1B0RB 5JMOC 3ARBD 5DJ0B 2DQIH 5IMKB 5CJQL 4EI5D 1SM3H 4U1LA 2YEZA 2PO6B 4Q97A 3B5GA 3DUHA 1A8JH 1YDPB 2DLHA 3BPCA 3WUWG 4GG6E 1AIFA 1ZHNA 3U46B 1NCDL 2YA2A 1NAKH 1KSRA 3SO5A 4TULH 5F9WC 4OLZL 5GRJL 3S88H 5EWIL 5DHVH 1FDLL 4EVNB 3R06B 1MAMH 2HJLB 2YPLD 3V5KA 4EEEA 1HXYB 3DTXB 2BJMH 1IZJA 1XGQA 4DUWA 1NGYA 3SDYL 3V0WL 4YO0A 5GS3A 2D2OA 3X11B 3ARVA 3GSRA 3QP3A 1C5CL 3KPSE 1OGAA 3VI3F 1KB5H 1D9KC 3NPSB 4GW4A 2Y23A 3H9SD 4FNLH 1UXWA 1MLBB 4ZUUA 3W9EB 4AM0B 4L9LB 1R3HA 4B53A 3HA0A 4HUXA 4OCMC 5D1QA 4C58B 3BDYL 3FRPA 4PJIA 3I3EA 3VXUA 2YPLB 4S1RL 1R3LB 1IKNC 4LLDB 5C07E 1ODAA 2Z91B 3GJFH 5I6XB 4HFWB 5HDBE 4YE4L 3U0TA 1J87A 3KLHD 4Z7OF 4NO0D 3H9SB 1KJ2A 5EU6D 5D7IA 2UY6A 2Y7QA 5T5NF 3S37L 4DQOH 3QDMB 2VUYA 1KTKE 1EFXA 4ZSOB 4DZ8B 3CDYA 5DJZB 1LDSA 1UWXH 5KVGH 4JDVB 4TSCH 3VDCA 4I18B 3RL1A 3RVXC 4HCRL 5FO9B 1XZ0B 3M17A 3F5WB 1JWMB 4UV7L 3AAZB 4ZUWB 3E6FA 4KI5F 5FCUL 2BNQB 2W1NA 4OCRH 4YDLC 4B5EA 2MPAH 1H15A 4LGRB 3X12A 1K3ZA 5IFAH 3QIWA 4NO0B 4YX2L 1HQ4B 5EU6B 1BEYH 1BVLA 4GBXA 3RPKA 1FAIH 5ELIA 4YHLL 5DRXA 4OZ4A 2X4OB 5J12B 2OP4L 3BD3A 5E94A 2BRRH 5GSVA 1J9CT 4L8CB 2HH0H 5CBEA 4JFFB 4OCWH 3ZT5A 4IRJC 3OR7B 5IVZB 3CU1A 4P9MH 1KENL 2LU7A 1RI8A 5A16B 5F6IB 2KQNA 4LOUD 4NHUA 1EZVX 3RWJB 3JWOH 1RUKH 3STZA 3MCG1 2EC8A 3BRFA 1HILB 2ID5A 2X10A 3O3BB 5EBWB 3GK8L 5FHAH 2EDDA 5E2UL 1LO3H 4QHMA 3VWJD 4OZFB 3ECBA 4GAFB 4CU6A 1CDIA 3R8BB 3O3DA 2GITA 4QRSA 4LAQL 5CMAA 4F9PC 1R0AL 5GGSB 2PTVA 4QRRA 4Z77A 5A2JH 3SGKA 4C56A 3S34H 4FQHB 1OM3H 3KS0J 4KKCC 3PDOB 3MR9A 4PJAB 1OGTA 5C6PB 5B8CA 1RJYB 2JB5L 1XGPB 3UXFA 2M8XA 3GMMA 3DBXB 2PKDA 1OLZA 3DHJA 4X9IA 5HYJA 1Q94B 3ZT6A 1PKQB 4BQCA 3VWJB 3BZEB 3MLYL 2FO4B 1YPZE 4LP5A 5D8JH 2D9QB 4HUWA 4X5LA 5CILL 1SJHB 4XVTL 5D1XD 2ATKA 4XCFH 1RZGB 1I7RA 3I3DA 4R3SA 4JN1H 1T03H 1NMCC 1BFVH 2X6MA 1PG7W 5HI4C 4WI7A 1QSFE 5IHUL 5KSBF 3A6CL 3D0VA 4V2CB 2YZ1A 2DYPD 4MJIE 5AG9A 5FKPA 4OFKA 2QKIB 2NY5L 1JGLH 4HGWB 2NX5E 1A7PH 4W4NA 3UTSA 2LU4A 3CX5J 2X4QA 2CLVB 5EU4A 4OD2A 3QUZC 1OY3B 1DSFL 4TVPD 4Q6IC 1Z0MA 4FRWA 1IL1A 1TENA 3BUYA 5DJCA 1G7QB 1DUYB 3PP3K 1F90L 3J7HA 5DVNA 4RGMB 3SKUD 1NCTA 3RAJH 1KTDA 1A2YA 4G6AD 4LDOB 4NKOA 5ABDE 1KJ3H 2QHRH 4RFNC 1TLKA 1JPST 1WTGT 1AD0A 4ZMAT 5I73C 1I9IH 2AEWA 2JCCE 5DQ9A 5ID0B 3QZWG 5SWSD 1FFQA 2R4SH 1OB1B 2FBJL 5LXGL 4QHKJ 2K9UA 5DT1L 4HQQH 4P5KA 2HVKA 5L7XH 1EHAA 4DEPC 5ITFA 4JQVA 4Z6AT 5IR1B 5MENE 4WRLA 3SCMD 5JHDD 5BJTB 1MRCL 1RZJL 2Y5TB 1D5MB 3HZMA 3EYSL 5CP3A 2BSRA 1X5FA 3G5XA 1CWVA 3F7VB 1RHHB 1CS6A 5JW4Q 2IAND 5E8OA 3SPVB 3RVVC 4M5ZH 5ISZD 1ADQA 4OM1L 4CMMB 5SWSB 3T0XA 1KJMB 5JW4N 1S78C 5BRZA 4YHMH 1ACYL 1Q72H 2CKBB 3TC9A 4CL7A 3VFRA 4APQD 3MNWB 4N90E 2EXYD 4L8BB 4W81A 4XHJC 4JQIL 1Y6MR 1FYTE 2Q7NA 3SCMB 2K3TA 5JHDB 1FFNA 4Z5RB 1KJ2L 1PDKA 3KPOB 4NNXA 4MXWL 1MJ8H 2P8MA 4CMHB 3S96A 4F37K 2DJSA 3D2UA 4GJTB 3ZTNL 3BWAA 2YWZA 5BZDB 3QFJA 5ISZB 4M4RA 2YSSB 1CN4A 1SEBB 3VXTB 3LDBC 5I8OL 3MRRB 5JIIA 3OKDB 1I75A 4ZOBA 4X4YA 3BKYL 5AAMA 1JYVA 4XPGL 3VFWB 1A1MA 2VKXA 2VR5A 1E4XI 1W8OA 4JO2H 5TQ0L 3H9YA 3ARQA 4KKAC 4QWWD 3QG6A 4X4ZA 3MNVB 4AG4H 5BOPA 5BS0E 3NCJL 4BZ1L 4UNVA 2C4FT 2OJZH 4JKKA 5DJ8B 3O2WL 3MCLL 4K7PH 1JZ2A 4LCCB 2VZTA 2QR0B 5GRYA 4JFHE 1PZ5A 3REVA 1KCUL 4KHTL 4GXVL 4G43A 3UCRA 1WBYA 4BJLA 4JGJA 5FGCB 2HLAB 5I15H 3UJIH 3TBSA 4JFEE 4NM8L 1T7ZA 1B4JH 4TQEH 4XH2B 3WHE0 4HIHA 1HIMH 1NFDE 3PGFH 2EC9T 4S1SH 4L4TB 1IGCH 5HHOA 1F8TL 3PHOA 4WFGD 3V2AR 4GS7B 2FRGP 2DQCL 4ZAKD 3HC4L 4LLMB 2Q8BH 4QOKA 5E70A 3ZE1E 2Z8WC 4QLRA 3MXVH 2ITCB 3W9DA 5IEKA 5DHYB 1CDGA 4H26A 3NTCL 5JA9A 1XR8A 4KY1L 4AEHL 3L3JA 4WI4A 1R3JA 1GHFH 4EXKA 4XWOD 3CIQA 3NIDE 4M9OA 3OXSA 2ESVA 3IJSA 1FQ9C 4NQED 2HTLD 1ZTXH 3TEUA 3PHQB 3K2UL 4ZDHA 5JORA 1HYRC 3WXVL 1IEAA 4XMLL 4ZAKB 3FB5B 5T3ZD 1R5VB 2AJ3A 5JHLL 3RGHA 4R0LB 1HH6B 4Y2OA 5EB9A 3LN5B 4JRYE 5CGTA 3UJJL 3MGAA 5ECJE 5H8DA 1FN4B 3LKRA 4QXTA 3GDBA 1C7TA 4JANA 5I1EH 3X3FL 3W11C 4MLIA 1AXIB 3GSXB 3C5JA 1QSED 1P4LB 4Z78A 2VR4A 5KVFH 1ZGLA 2NY1C 4MDIB 1U91B 2D7MA 1RK1A 1OWRM 4LEXH 1FLRH 4UOJA 4R6UA 3VW3H 2EIEA 5F3BB 4K55A 2WWMD 5ICYB 1FL5A 4CGTA 3QIBA 5GGRB 3TT1H 1J8HA 3S8WA 4PJDA 5EC1B 2WBWB 3IU4L 3MMEA 1J12A 5TF1L 3Q6GH 5EOCJ 3RPIB 4R8WH 4M3KB 2OK0L 2G9HB 4WUKL 3UYPA 3KVQA 2YXMA 5CJ8A 4N5ED 2M1KA 5I1CL 4TSAH 2R4RH 3K3QA 4XI5D 3MGOA 4Y4FA 3GKZA 4WI8A 1CU4H 5AAWA 5MERB 4LMQI 3RTQC 1IC1A 3C6LA 1ZA6B 2OCFD 4QRPA 3QUMB 5FA4B 2F53E 4RRPG 4ELMA 5C92A 1WBZB 3NMEA 4EN3C 4HPOL 2DM7A 3FL7A 3JBG7 5DK0A 2XZAH 1JGDB 5DVOA 1VACB 1NC2D 1B6UA 2VDRH 3VGAC 4IMLB 4ODUA 5C08D 1QSZA 5IB5B 3RHWK 5J6GA 2FBOJ 5LAXA 3KJ4C 5T1MB 3PP4L 5TFSL 2B4CL 4OZHA 1N59A 1NGPL 3S98A 2X9XA 1PYWB 1WZKA 1LDPH 3FB7B 3T0EB 2R69H 4LSQL 5I1IH 3LD8C 1TVBA 4F58H 5C8JA 4JO1L 3LRSA 4KK8C 3WEXA 3LEVH 1JF5A 4HIIB 1NC2B 5D71L 2H9GA 4DVRL 1OAYH 5C08B 1K8DB 1E4KA 5EU7E 3HNVL 1J7VR 2JIXD 4RBPH 1BQLL 1NMBH 1KPRB 2B5IC 4B41A 1SM3L 5CSBA 4Y5XA 4A6YA 3JWDH 3WD5H 5B3JF 5CD5D 2FJGB 1YY9D 2UWEA 1A4JA 2YD1A 4P49A 1KBGH 5EPMB 2RCSL 4M02A 5DVKA 3VG0L 3S88L 4U1IB 3FB6A 4X7DC 5EU7C 4FQLL 4NKMA 1MAML 1SJXA 1VFBB 1G9MH 2BJML 3ARGD 2DJ4A 1FCGA 2PXYA 4W6YB 3WUWB 5GS1C 1WZ1L 5SWZE 4PYGA 3UBXI 3I75B 4XP4L 4LLVB 4PJFE 1OAKH 3G6JA 4FNLL 4LHQB 4TNVF 4L8DB 1G6RH 2GK2A 1G9EA 2VLLB 4FMFA 1FH5H 2ZUXA 1NUDA 1BREA 5A43C 2K7PA 3HE6A 4M1DH 3CGTA 3RWGA 1CFTA 5BVJA 3C9NB 3V5DB 3ARGB 1M05B 5HY9A 4PJ7E 3MV9D 2HWZL 1RHFA 4YXHH 4YHYC 4PJHB 1FP5A 4MA8L 4F7MA 3UROR 4NOBA 1JPFA 2D9CA 1YQ2A 3IF1B 3TP4A 5BO1H 4F57H 3G6DH 2FGWL 1S7QA 4TSCL 3TVMC 3GSUB 1GGUA 2DWDB 1NEZA 5EA0H 4L3AA 3C08H 2D0HA 5DYOB 3MV9B 4OQTH 5JW3H 5A3ID 1KJVB 3QO0B 1JNLH 3WLWC 1BOGB 4GQ9H 4D0DB 4ELKB 1OPGL 4LCYA 4PGCB 3D1MC 4HXBH 1WZLA 4M6NL 2XXMB 2H32H 1BEYL 3GSNH 1RZ8B 3VXQA 2HYMA 4X7TB 4X8JA 4KKNA 5BMFL 2CDEA 3JVGA 4RAVB 5JR1H 2QQNL 1LEGB 1RIHL 4Z0BL 2UY7A 2CDGB 4O2EB 4CVXB 4YDKH 5B39B 4A2MA 4MAYA 2VLMD 4J6RL 4XXCA 2BRRL 1A1OB 4XZUA 3V9FA 1AGCB 4E41A 1KIPA 5JOFA 2NTFB 3KPLB 3BJLA 3HC0B 5I71C 4OCWL 2NR6D 4P9ML 4JPVL 4F80A 2X42A 3Q2CA 5HGBB 1YEHH 2B7DT 4D94A 1HN1A 3I50H 4MX7A 2VIRB 1RUKL 3MLTB 1CICA 3QQ9C 2OR7A 1CLZL 2VITA 3FO2B 2VMFA 3DBXA 4H0HB 4P2OC 3E0GA 4KTEH 4O5LH 1N4XH 2WUBH 5GGUA 3ZHLA 3LKPA 5BXFB 1ZMYA 1V3MA 2QQLH 3L1OL 1GGTA 1INQB 4YQXH 1NGWB 3ILQD 4XNYH 3OGOE 5IFJB 4D2NA 3LKSA 4JN2A 2ERJB 2DBLH 1OM3L 5EO0A 4QHNA 1MAJA 2J6EH 5SV3A 3S37X 3IGAB 1ZHBB 1UXSA 1JE6A 3EJZC 2IQAB 5F88B 5BZWB 4JREB 4I2XB 4O02H 4GKSA 2HJKA 4H1LG 1KXTB 4L3ED 1YQVH 5C7XH 4K7FA 3C60D 4P3DB 3HB3C 3KDMB 1W0WA 1CGVA 2L4OA 4XCFL 3L7FA 4HUUA 3T0VA 1QG3A 5F89A 5GRVL 3FZUC 2MWCA 3CFKB 4MJ5A 1KT2A 4JZNA 1FIEA 3IDUA 2R1YB 4UTBH 4C83A 4LEOA 2E9WA 4HKJB 4YXLH 5I76B 4FZ8H 3MV8D 4KUZL 5L8LB 4QHUB 1GZQB 5FIEA 3SDXA 1A7RL 4L3EB 2FX7H 3FJTA 1OT2A 4PRHA 1ZHKA 1J0JA 2WLYA 4ZFOA 4ERSH 5E56A 4OCYH 4PRPB 4LMQE 5IJVA 5JZ7D 4DKAA 3UX9B 4B0MM 4DVBA 1U8NA 4IIQB 4A6YL 3BZ4A 4NQSB 4M1CC 4Z7QF 4C59B 3MV8B 5CD3A 5HBBA 1C5BH 2NTSP 2VR9A 4BSWA 3ZYZA 1ZHLB 1KJ3L 3VFOB 2P8LB 4ZUSB 4PRAB 1ORSA 4P2RE 4M03A 2QQQA 4PB0H 2CUIA 4PY8J 1I9IL 3MA7B 4QRTA 1MJ7H 3HZYA 4RX4D 2AK4A 5DDHA 1P1ZB 2I9LA 4Y16C 4JQXC 4M7JH 4PJCE 3FONB 4XP6H 3ZSTA 3QCVH 3O9WA 3IDJA 3W2DH 4HQQL 2RQ8A 2WIIA 4JO3H 3CMGA 4Z7WE 5E6YA 3IDIB 3MROA 5CSZB 3NCBB 4IJ3C 1YYLL 4P3CH 4R7NA 3QZWB 3VD9A 3SE9H 4NC1E 3UTQA 2FCBA 5B38G 4G42B 3IFLL 3MLXL 3D85A 4OSUH 4WEMB 4M5ZL 5HYEA 4H8WL 2Y9RT 2ICES 3D6GA 4LNVA 4NNPH 4YHML 4KRLB 3LKOB 3O11A 2J5LC 4HD9A 2QL1A 3RU8L 4P23A 2AJVL 1ORQB 4N0CC 1VADA 2P5EB 1A3RL 1F02I 2RIKA 2YA0A 3LQMA 5JLZB 1Q0YL 4WTZA 3HZKA 4KFZC 3L3GB 1MREH 4F7PB 3OKNB 4PREB 4EJ1C 4ZO9A 4I0CC 3LZFH 4FP8H 3QEHB 3A6OA 5I8CA 4NC1C 4L29A 2O61A 4OLVH 1M6OA 4OM0H 4PJ5E 4U6TA 3MC0A 4FABL 1WSST 1BPVA 3LEXA 1GZPA 4JRXE 4J3OC 3QUKB 1MCJA 4X6DB 2IPUK 4JO2L 3DIFA 1DEEA 2VZSA 3L6FB 3HG1E 4JFPA 2WNGA 2BY2A 3ALXA 3U48A 4HHAA 5ETUB 1P4BH 4AG4L 5JA8B 1AP2B 1ZSDA 1ZLUK 4H20L 3WJJC 1FGNL 1KFAH 4XBPB 1CL7I 1I8MA 3QHTC 1I1AD 1KEGH 2IADA 4IDLA 2WWKT 3CLFH 2AJXH 3MV7E 1HHJA 5CKAA 4MXQC 2FJFA 2JK5B 4YBHA 5HI5D 3NFNB 2DI7A 4YHNA 3T77B 2BOBA 3HUJF 1JYXA 2B2XH 5ICZA 4Y5VA 2F8OA 2A0LD 3PGFL 1A3LL 5LCVH 3SGDH 5I17B 2GHWB 1QLRB 1P7QD 5HGHB 3ETBF 2RFXA 2V5TA 3AM8C 1HH9B 1QR4A 1WAAE 3ZYOA 3MREA 4HC1A 3OR6B 1DUZA 3HI1A 4LKCA 3VXSA 2P8PB 2ED7A 2E5EA 3L7EB 5CWSB 4PJ5D 1UB5A 3RVWD 3IXTA 2O5YH 2JJTC 2ZP0T 1RFDL 1ERNA 4G6JH 1ZTXL 2EDTA 2V7NA 4NOFA 2F8XC 2NY0C 4FQQB 5L2KA 5EZJB 1R3KA 2H2SD 2GCYB 3TO4A 3KYAA 1P7QB 5AZ2H 3IDNB 1U8PA 4IMKA 4KTYA 1RURH 1M7IB 5KANG 2R29H 3RDTD 4FQJH 4L1DA 3O41B 1DQDL 1BECA 5IG7A 1QRNE 5I1HL 9CGTA 2DF3A 5C2UB 5IVXB 1T80A 5DGRA 4GG6F 2XWBA 3PQYD 4HWBH 5KSBA 3LY6A 4ODXA 5I1KH 3TIEA 3LV3A 4JHWH 2X1WL 2W60A 4WHTB 2BOCB 4K71C 3TBWB 3N85L 5KVFL 5ICXA 3EKCA 1ZV5A 1JI1A 4F37F 2H26A 1H5BA 1K2DA 4WHYH 4CDHA 4ODHL 3HNSH 3DGGA 1O7VA 4X6EA 1LO4H 3B8SA 5EO9B 5FV2A 2XTJB 2G75B 3F7YA 4PRDB 1OTUC 2EDRA 5FGRA 2D7PA 4RA0C 3CFEB 5EN2B 4AY0A 1H3PH 1K6QH 2FWOB 4KKLC 1D6VH 4K3EL 5KSAA 3BN9C 3B9EA 5EC2B 3RX5A 1IAOA 4R8WL 4JM2D 1IKFH 3IDMA 1AFVH 4GRLB 3D25B 3VFGH 1U6AH 4KZEH 2YN3A 3ES6A 2QSCL 1OAQL 4LCWE 3DI2B 5DFVC 1F3JB 1IEBB 1EBAA 4OUOA 2ATPB 3KYMB 5FK9B 5HDBF 1A6WH 5F9OH 4MMXC 3GB7B 1VERA 3DMMA 3V6OE 1AQKH 4HMDA 2DQDL 1YYMH 2EYTA 2ICWI 4X7SH 1RZIA 5EOTB 3CFDA 3NCYP 5EOQL 1FE8H 4Y2DB 4WO4A 1BBDH 5FHBL 2LQRA 4D9LL 1VDGA 4JM2B 2XZAL 3TT3L 1ETZB 3GIZH 3MCKA 2AABL 1BZ9B 4MSWA 1U8JA 4ZUTA 4ZS7L 4WW2B 2OTPA 2XY2A 1KLFA 3MX0A 3P77B 4Y89A 3UZEA 1B4RA 5AZEH 3I3BA 5EZOH 3EW3B 3IRZA 5IB1A 1H8OA 1TVHB 4RQQB 1CD0A 3MLZL 1B2WH 2F5AL 4NCC2 4KQ3H 3F58L 3MBEA 4LHUA 1WWCA 3RY6C 1T83C 3KPQB 2BSED 4OLYH 4GQPH 4UQ2B 3TN0D 1NAMB 5C0CE 1S7UA 3LEVL 2Q8AH 3QCUL 3SDAC 1ONQA 4DWHA 2A1WH 4M61B 4YGVA 3BIBX 4I0PC 1CK0H 3P9MA 4N0YH 4Q9BA 1QFWI 4NHCL 5D1ZB 3LN4B 1BVZA 3TYFA 2BNUB 3NZ8A 3L95B 3QNXA 5T1LA 3FOMB 3QWOB 4MDJB 3Q1SH 3AS0A 5AYUL 5J3HC 3K4AA 4ISVB 1Z5LB 2P47B 4R2GD 5FF6A 4PLNC 3TN0B 3GO1H 4XX1G 3O8XD 3ZL4H 4JM4H 1KBGL 2NY5C 5EIIA 5IJKA 3GUTB 1TETL 2ED9A 3H42H 4Y4HA 3W0WA 4WUUA 2R56H 1E6JL 4WWKB 4NSKA 2ORBL 4MCZB 3VDAA 2W9DH 3QUYB 3D87B 3K7UA 3FCTB 3F7PC 4Q7DA 1JHTA 4U1KB 1PVHA 1QSVA 1OGAE 1KPUB 2BVQB 3TESA 1P84J 4R2GB 1F6AA 5F1IA 1WIPA 4NWTH 1CFBA 3O8XB 1E28B 5DQDH 5C09A 4PJIE 3W5MA 1D5IL 4K8RD 1MAKA 2HFFB 5C6TH 5HD8C 1YPZF 2BC4B 5ESQA 1MCFA 1CE6A 2VQUA 3CVIH 4WDIA 1F45A 1INDL 2DQJH 4CJ1A 3WIHA 1SBSH 2ZZUT 4HC1L 4NQDE 4NZRH 1T4KA 4H25A 3STLA 3K1KC 1F3DH 1HHKB 2UYLA 2F19L 4O4YH 1T0PB 4GW1B 5DO2C 5IK3B 3QAZB 5D7IE 1RZJC 4NDMB 4QXWA 5FOBB 5EH1A 4G6KH 3U0PB 4YC2B 1IM9B 1SYSB 3O45A 4LIQH 2WMPA 4R4FL 4H5SA 3GSOA 3OAYK 4Z7VE 2X4NA 2Y6SC 5EA0L 3GJEA 3WFCH 5BOZG 5JO5A 3C08L 4TRPH 3QXWA 1MJUH 4OQTL 4CRPA 4OT1L 2X7LA 3VFNB 2AXFA 4GQ9L 5F96H 1U2HA 1K85A 5CEZL 3BGMB 2IC2A 3ARDA 4KMQA 15C8H 1MHEB 3S9DB 2E9BA 3FQRA 1OTSD 2NPLX 4P4KA 2AJSL 2CRIA 2XFXB 5TDPB 1ZWIA 3QI9A 4P59L 4ZFGH 2N7BA 2CD0A 3I2CH 3MOAH 2JCCF 2YBRA 1FFPA 1N3NB 4YDKL 2VXUH 1FAKT 5EU3B 3BSZH 1KCLA 5M95B 5I2IA 1JWUA 2VISA 3ULUD 4LNRA 2DL2A 3QIWC 4JEGB 3V0VB 3OB0H 43C9B 2VN4A 5L6YL 1LHZA 4PTTB 4R4BB 3BP6A 1HK6A 5T5FH 1MFCL 4GBXC 5DRWB 5GGVH 3WFDH 2AQ2A 5IEHA 3RVXD 2EO1A 4PJGE 4G9FD 5IW6A 5BQ7A 4KTEL 2IPUG 3IB4A 2WUBL 4GAGL 2A9ML 5E2TH 4UT9H 4M62H 3IXAA 4MLSA 2ZUUA 2HKFL 4XNYL 3KPSB 4C56E 1BIIA 1AY1L 2FX8L 1OP3H 1XEDA 1F58L 4N0RA 1NLDH 3HRZB 3T1FB 3UTZB 4OLWL 4N5UA 3X14A 5D6CB 2J6EL 4G6ML 5FYJD 1BFOA 1J1PL 1NC4B 1WZMA 1AJ7L 2ZOLB 2ZCKH 3LPWA 4XPBL 1U95B 1DEDA 2W92A 5C0DB 5IM7B 4UTAH 3EYFA 1NGQH 2D7QA 5CHNA 3GSWA 3NCFB 1K9TA 1A9BB 3VD5A 2R1XA 4YDLB 1CLCA 1V5JA 4WI9A 1TXKA 3G04B 1BLNA 5HDQH 4I4WA 3SGKC 4KUCD 5AEAA 2GJZB 3GGWA 3AS2A 5H94A 1DN2A 4XCNA 3F12B 4ZOEA 4GOSA 2AV7A 4FZ8L 4H1LB 1A6AA 4NJ9L 4PG2A 3RI5K 4U1MB 3UAJC 4OI7A 2VDQL 5B8CC 1YMHB 4FFYL 1VFUA 5EO1A 4HH9A 1LO5A 1A7NL 1SHMA 2FIKB 1OD9A 5IV2A 1CXHA 4O2FA 4PJ9D 3MBXH 4RZCA 1ZVSB 3GMPB 4IRJB 3VXRA 2J8UB 4MB3A 1GC1L 3VXPB 8FABB 4AIZB 3ULVH 2EKSA 3T2PA 3N9GH 1T20A 1UFUA 2YOCA 4NQCE 3PGCA 4L3CB 2VLKE 1C5BL 1OSPH 4NZJA 1E27B 2FR4A 1NFDF 1J10A 1X5ZA 3TZVA 4YUEH 4FQPA 2Q3ZA 4HAGA 2VSCA 4PB0L 5TPWH 3ZE1F 3QHFH 3WN5B 1MCHA 1MCPH 4RAUA 3KR3H 4PJ9B 3FB8B 3DV6A 4ODTL 1U93B 1UZ8B 5B21A 3I6KA 1Q8MA 2D03L 4IOFC 4PJ8A 2BK8A 2X4RB 1WV7T 2HG5B 3AREA 4M7JL 1GVIA 5FEBA 4HJGB 2VOTA 3UTTA 3W2DL 5DD0L 2C1OA 1C5DB 2GUOB 3NIDF 1MCOL 1FORH 4JFYA 1WCBB 3FOLA 4ODWB 4OZGE 3GMLA 5DD1L 1HXMA 4MA1C 3FQUA 2AJZB 3MRCA 3P73B 1Y6KR 5DZOA 5D7LD 5GGTH 1I8KB 2DKUA 1OOAA 3V95A 3WIFA 1VEMA 2P49B 1MUJB 3QDGD 2CK0H 1FNEB 4I48B 4MS8C 3RY4A 5FO7A 5BRZE 1BF8A 3OXRB 3UDWC 3UPAA 1JPTH 2W0LA 3MRFA 5HYQA 1MWAB 5JOPE 5K9OA 2X9YA 1KCRH 4JQVC 5C0RH 2X70B 1NCBH 4EI6A 4MXVF 2E7MA 3MRDA 5IBLD 2R0WH 5J6HA 5D7LB 3EOBA 5IBTH 1TIUA 3LZFL 2DQGH 1WICA 4I5BB 3OWEA 4V2BA 4XXDA 3QUZB 2EECA 5DMIH 3VFVB 2FDBP 4IEFB 4LBEB 2DQUH 3QDGB 2XPGA 1QEWB 2B4CC 4U3HA 3VDBA 5DA4A 2OMNA 4OM0L 4L4VD 2CDFB 4J3XA 5FKAB 5E2VH 1A4KB 3TYGH 3R4DA 5DEFA 1RAMA 2YS4A 1CBVL 4M8QA 3GSQB 5E5MB 4E0RB 1ZT7B 2GSIB 4GUPB 1P69B 4X0KA 2FLBT 1R5WB 5HHPA 1SY6L 5I73B 5KN5A 3LHPH 1CI5A 3H3PL 1I4FA 3AMLA 3FO9A 5C86A 5E5RB 5FYJU 3GI8L 5I75C 1GPOH 3CLFL 1S78D 3N1FC 1EHLH 3VH8G 5BW7A 4P57A 2PW2B 4L4VB 1FO0A 2XKNB 5E7FA 4LLWA 4QNPF 4DEPB 2Y07L 4XVJL 3V4VH 4S11A 5JXAH 4LPUA 2VXTH 4YHKL 3O4LE 3P11H 5E0QA 5I8EA 1I3GH 1S9VB 1TCMA 3GBMH 2DQFB 2OI9C 1BZ7B 1NANH 4OZFH 3EDDA 3VXMD 5F7HA 4HIEB 4OFPA 5DMGC 1JHKL 1SYVA 4Z0XA 2JCCB 1J0KA 1U8HB 2I5YH 3TPUA 4NUJB 3DSFH 1JGVL 1OTTD 3QEQA 4TPRL 1I3RA 3ZO0A 3EBAA 1FVCA 3O6FC 3LKNB 1LE9A 2FO1A 5MENB 4DGYH 1S7SB 1S9YA 3T0BA 4YEEA 2I07B 3GIVA 2AKRA 1G7IB 3B83A 3VXMB 3NCCB 3IYLW 6FABH 4UUJA 1VKXB 3CDGA 4KKBC 4U6VH 4N8PA 4LCIH 5DRNB 5AZ2L 2ZUSA 2YUWA 3H7BA 3LDBB 2EDEA 1KELH 3QQ3B 1UCBH 2JJSA 5EFIA 4QT5B 1P5UA 4Y19A 4X99A 4L5FL 3AGVA 1ZVHA 2OMBA 1WFOA 4NBZB 1PEWA 2GJJA 4WI2A 5I1KL 4G8GE 1BOYA 1N0XH 3BHBA 1CVRA 1MI5D 1B90A 4X8XA 3A67H 1EO8H 2FSEB 3HCVA 2JB6B 3CC5A 2F54A 3RWDB 3NOIA 2X1PA 1AQDB 3HLAA 3HNSL 4K7PX 2XRAH 1LO4L 1EHNA 5C0GB 5DHVB 5AWNL 5DWUH 5FYLL 1NH6A 3MRBB 1H3PL 4XC3H 1VA9A 4PJFF 2IBBA 4NCDA 4M7LH 1YEJH 2GIYA 2CLRA 1X7QA 1OSZA 3PWJA 1DL7H 1MI5B 3CZFA 4Y1AE 1S5IL 1S9XB 3U9UB 4TVPH 3VFGL 5CEYA 2CO6B 4YDJB 3P4NA 1CQYA 12E8H 4PGZA 1KF9B 1DLFL 4KJYA 4FXKA 3VMNA 3D9AL 4PJ7F 1U8MB 2ITDB 3BAEL 5ALBL 4G3YL 2HRLA 1VB9A 3DO7B 1AE6H 3MJ7A 5JW4M 4Q9QH 4ALAL 3W11D 3JWNC 3QIBC 1AQKL 2D0GA 4JFEB 1TZGH 4X7SL 4ELME 5C0NC 1FE8L 4HBCL 1N2RA 1BBDL 4FQXA 1HEZA 1FNSL 5DK2A 2NY1D 2A6JB 4IDJH 4QKXB 1IGTB 4X6FB 4FTVD 2XN9D 1H8NA 1XGUA 1A7QH 4YFLI 2CKBH 1I1RA 4DFHA 5C0BD 1EXUA 1DVFA 4CDGC 3PL6D 1T1ZB 5DF0A 4PRIA 3CUPA 3P4OA 4Y4KA 5GRZA 3MUHL 5JW5A 1E0OB 4ZTOL 3DROB 3T8XB 2KPNA 3C6LC 4NNYA 1B2WL 3UYRH 3WNLA 4HWNA 1MVUA 3BT2H 4U4BA 1QKZH 1VGKA 1AKJD 3V7AE 5KVEH 3BXNA 1FL6A 5CUSL 1JGEB 2NY1B 4YDVA 1XAUA 5HHMD 4FTVB 3PWPE 2Q6WB 2XN9B 3HS0B 3LRGA 3V8OA 4GKNA 4DAGH 1CK0L 4ZFFB 3QXVA 4Q0XL 5C0BB 3ZHDA 5D7SH 2GT9A 4PBVC 1YNKH 3PL6B 3T4AB 2ARJB 3C5ZC 2PR4L 5I66B 4G7YL 4J4PA 1ZEAH 5DJ2B 4LU5L 5ADPL 4YR6B 1A9EB 1FJ1B 3GHBH 3EGSB 5K9JL 4PS4H 4PLKD 2UWEE 3DWTA 2UUDH 3OAZH 5F1OB 1UVQB 3OPZH 4V1DD 3B9KA 5C0AD 5TGBA 2GTWB 5HHMB 4MNGE 3SDDD 4ODSH 3ARBA 4P5TD 3H42L 4N0UB 5JNYB 1DFBL 2CRZA 4HH8A 4PLJC 3KPNA 4WJ5B 4EI5A 5IMMA 1E4KC 4GAJL 1BX2B 1K4CB 1HSBB 4NKDA 3OKOB 1D5BA 4DKFL 3DVGA 3RTQB 4TTDC 2H3NA 2VXSH 4JFDA 5TDNA 4HF5H 4WTWA 4U1JB 3JUYA 1V3JA 2Z92B 4G8FB 4Y5XC 4LDEB 3K74B 2PW1A 3HUJA 4EN3B 1IC4L 3EO0A 3LS5L 4OLEA 1YEEH 3PJSA 3VFMB 3VGAB 4W68A 3G5VB 4RDQF 5J7CC 4P5TB 5C6TL 3EFDL 5I0ZA 1IGYA 3PWPD 3SKMA 1VEPA 3CVIL 5MEPA 1IGFL 1I7ZB 2PXYC 2DQJL 4OFYA 2E7LC 1AC0A 1KIQA 3N06B 3ZYJA 3MFFB 4O4YL 1K4DA 3SKJH 1RIVH 1RY7B 5FGSA 3WIIL 2HRPL 2MKLC 3T4YB 3REWB 3O6LH 3RGVA 1ZT4B 1GCFA 1U3HD 4Z95H 5SV4A 4R4ND 1FFOA 3HE6C 1J05A 4LIQL 1HE7A 3WFCL 4HPYH 3C8HA 3BYTA 4H8WC 4NUGL 4TRPL 1I8IB 4KDWA 1JNJA 1BWMA 2B5IB 3MJ9H 2I25N 2V2XA 4JDZB 4KRMB 2EYSA 1G7JA 2DWEA 1PLGH 1IAKB 1D9KA 2P24B 3GBLA 3TV3H 4GG6A 5EUOB 1GXEA 2X4TB 7FABH 5IROA 1X4ZA 4X80H 5I18H 2UZIH 3FQNB 4Q2ZA 2ZNWA 5FECB 3QNZB 1WC7B 5T3ZH 3O4OC 3P4MA 1AD9B 2Q3AA 1UT9A 1MRDH 5D2NE 3ROLB 4NRYA 2X4PA 5EULV 3ZHKA 1JF1B 1BVKA 3ARFD 1UB6B 4RGOH 3BKCL 3KPMA 2A6DB 1U58B 3ARWA 4XGZB 5GS1B 5HPMA 2VXUL 4DOHE 5DXWA 5DEGA 3QSKB 4PJCF 2AJUL 4E41E 1QA9B 3W39B 2UVEA 5JXED 1CXFA 3QCTH 4X6CE 4Z7WF 4J2XA 4XVUC 4KZDL 1H0DB 4WU7A 5EOCL 1AR2A 4Z7UE 3TVMD 4UDTA 4OAWB 1EEZB 4LGPB 3BI9X 3ARFB 5E2TL 5HI3C 4YEFA 5C07A 5GZNC 5HHXH 3FRPG 4TUOB 2QSVA 4CN1A 4LSTL 3WSQH 4MAYC 4GXUN 1ND0B 3QUMH 1RMFH 2VAAB 4XXCC 5ACMA 1XFPA 5DJAA 3BMVA 5I30L 3FQTB 5JUEL 5SX4H 3T09A 3QA3B 5FO8B 3OHXA 3H0TB 2A38A 1S7XB 3IDGB 4M6OH 4YPJA 2ZCKL 3IDYC 4GG8A 2IBZY 4FA8A 3TVMB 3MRHA 1CICC 1DQJA 1OD7A 1N7MH 1GL4B 1LE5B 5AD0B 2J88H 3S35L 3DARA 3TNNA 4XBEH 4RMUA 3IKCB 5IBUG 5L88L 3QQ4B 3T2NH 3RWHA 1OAUL 4JY5H 5F7LB 5D93B 1T6VN 5C9KA 4P5MA 5D7KD 1DBAL 5DA0B 4BH7B 1IM3A 3QUXA 3MO1A 5J4MA 1DLHA 4JZJA 2XQBH 2CMRL 1R3IH 1QQDA 4PJXA 4F33A 1TNMA 2CK2A 5IHZB 2E7HA 3QDJD 3C8DA 5D1XA 3U9PL 1Z3GH 3SDXE 4XCCH 4X5WA 1MCQA 2XQYK 4F9PA 4HS6A 1I3UA 3QG7H 3O3AB 1LK2B 3DPBA 3IRPX 4HLZH 4XNZC 5D9SA 5E00B 4CNIB 5I71B 2DYPA 4HMCA 3VFTB 4P4RA 2V2TB 4NQUA 4KDTA 3X3GL 1RK0A 2AJYL 3RVTD 3WFEL 4ZNEE 3FQWB 1OSPL 5FUOH 3NA4A 5EBMA 4DN3L 3QDJB 4PJEA 4RISH 5E9DD 1GGYA 1HINL 1QNZL 3L5IA 5E6IC 35C8L 4I3RH 4BZ2H 1MCPL 3KR3L 1ITCA 4NZDA 4WV1B 1LD9A 5E8NA 4M7ZC 1KV3A 2MNUA 1CD8A 1WAAF 3MRGB 1BFSA 5GRVK 1XF3A 2ZNXA 3AROA 1OP5K 5JIPA 3LKQA 4KJWD 3MXWL 1JJUA 2DTMH 1B3JA 3THML 2UZYB 4M1GL 4PYHA 4YIQA 3DXAD 1DQTA 3T1WA 5E9DB 1Y18B 3OKMA 4WW1B 1C8PA 3I84A 1A7OH 4X4XB 4X5XA 1QBLH 2ILLA 4NQXA 1YPZA 1N64L 2ARJQ 4HT1L 4HZLB 4R7DA 4YFEA 4LDLB 3RZCA 2CK0L 4Q6IA 5F7DA 3L3HB 4LSRL 3P30L 1U8QB 4MWFA 3VFUB 1W72B 3WV0A 4L8SC 3U4BL 5FUZL 2FATL 1MHHA 4ZPTA 3INUH 2H1PH 1JPTL 1GIGH 1GAFH 3B2UD 3BO8A 4NWUL 1QSFA 3V6ZB 4EDWL 3LQZB 3S36L 2XXCB 2HTKD 4MJIA 4JR9L 2YRPA 1M71B 2IANA 2HJFB 4CAGA 4M9PA 1EFQA 2NX5A 2NNAB 5DD5H 3BPLC 2DQGL 4APQA 4KI5E 25C8H 4F2MB 3QO1A 3FN0H 1FV1A 3O2DA 1I9JH 5LGKA 2A6IB 1QO3B 1WTLA 2B20A 1BBJA 4P23C 2ICWJ 4XB8A 4OCSH 5JDSA 3DUUB 1T2XA 1XF2B 4FQ1H 1CE1H 3VCLB 1PX4A 2VSDA 1V7NL 3BP5A 4RAHA 2GY7B 3RI5F 1XF4A 4G5ZH 5EBGA 1DN0B 4U6YA 2IEPA 2CGRL 2NY2C 3LHPL 5EIQA 5F93C 3V0AC 3D39D 4KI5C 3FN3A 2J4WH 1X4XA 3G6AB 2XICA 1S9KC 1EHLL 1HZHH 2JJWA 3G5YA 3DRTB 5EZIH 5J13C 2Y72A 4XT1C 1SMAA 4HBQA 3V4VL 2BDNH 4HG4J 1U8KA 2A83A 4CUCA 4QHLB 1R24B 1I3GL 1T1XB 2GJ6D 4FMKA 4K94L 2MTPA 4IJ3B 1UENA 3BVNA 4QXUL 1N0LA 3UPRB 2HFEA 2F58L 4P2RB 3FFDB 3CDFA 4QCIB 3MRNA 3VH8B 3DVNA 3IAQA 3D39B 1JK8B 2ICCA 2QJDA 2GEEA 5F3HB 2XV6B 4PJCB 2J5LB 5FDWB 1UACH 2EH7H 4L1HA 1HHIA 2V17H 4AENB 1FYTA 4PGBA 1LK3H 2J8OA 1DZBA 2ED8A 4DK3A 5F1NB 4Y5VC 1E4JA 2R1WA 5HHVH 4HV8B 2DDQL 1MQKL 3PV6B 5TDOA 3SGDI 4CU7A 1LEIB 1A6VH 3E3QC 3NABL 2G60H 2FLRT 1GGIL 5IFHH 3ULSA 4AEIL 2B1AH 1MH5B 1XR9A 4NQEA 5CEZE 3RNKB 4GRWB 1S3KH 3QHZH 4UOW0 3S4SB 1N0XL 3QFDB 1LNUB 4N0FA 5INCB 5BS0A 2BNRB 1RUAH 2F8VA 1D6EA 3BP7A 4LFHG 3SQOL 1U3YA 1T7VA 4P2QD 5IB3A 2R0ZH 2Z35A 1A6TA 2XRAL 3I6GA 4O9HL 3WYRA 4IMKC 5KS9B 5DSCB 4OLXH 1B88A 3BQUD 4U6HB 4MQ7B 2Q7YA 3BH8A 1CFSA 3PNWA 4QXGH 1QSEA 4KJQD 3DV4B 4JRXB 2IAMC 2AAVA 1IC5L 4WVRA 4JDTH 2IMNA 2VLJD 2BX5A 4U33A 5KW9H 1PQZB 3OX8A 4Q9RL 1NFDA 1DR9A 1X5XA 3PGDB 2NY0D 2BFVH 3LIZL 4Z9KB 5L8JB 1YMMD 4GRMA 4TVPL 2G2RA 3EOAB 3MUJA 3TBVB 12E8L 4CJ0A 4OV6F 5FB8B 5ID1B 1Z2KA 1J88A 1H5BC 2XNAA 3TO2A 3BQUB 5EU5A 1XCTA 5DZNA 2CSPA 4M7KH 5JPNB 5GJSH 5KG9A 1IARB 5SWQA 1AE6L 3MJGX 3O6MH 4Q9QL 1XF1A 2R23B 1IGJA 5D7IF 5KSAC 4CADA 1X6LA 3IAGC 1NGZA 5IVNA 3UEZA 2P1YA 4N1CA 4BFIA 2NY0B 1T21A 5IESL 3DX6A 1T0MB 3FTGA 1YMMB 4NO2A 4J1UA 5DUPH 1JRHL 4X7EC 4Z7VF 3Q6FA 2GTZA 5DTFA 3OKLB 4HKZA 1I1FB 5J1AB 5F21B 5KVDL 1XGRB 2DIAA 4M5YH 4JRYA 1FG2A 1V3KA 1MCWM 5DJYA 1QYGL 2MHAB 2E8YA 2XZCL 3DMMC 3FFCE 1ZLSH 4JFXB 4K3DL 3C6SA 1JUFB 3S6CA 4MGXA 2YK1H 4WO4C 2D3VA 4LKXB 5DS8A 3S3PA 5TQ2H 4BQ9A 3GNMH 4K9EH 4DAGL 1CF8L 3LOWA 5LQBH 4KUCF 1U8LB 3BPNB 4OCLC 2VXQH 4FFVD 2C3XA 1S8DB 3O2DL 3QJHB 4AMKH 1QRNB 4PUBL 3X13A 5D4QA 4OIIH 3MFGB 3S3JA 4PV8B 4OF7A 4WFED 4NZUL 4I77L 3GHBL 1F4YH 4QTHA 5INDB 1IAIH 3OPZL 2C3VB 4W4OC 2R15A 2JIXA 4LF3B 1KCSH 4PJGF 4ODSL 5IQ7L 1C08B 2OL3A 3MGTA 3W0WE 1CXLA 2F15A 2WBKA 3OQ3B 5CBAB 1SEQH 5BV7C 4OI9A 5C0EB 1QBMH 3C87A 4G7VL 4R26L 5K9KB 2HMIC 3TA3A 3BE1H 1GC1C 5DQJB 2NY6D 1UYWH 2F53A 1GGCL 4UIMA 1W2KT 2WK2A 2DLGA 4IOIA 2BVPB 3VFSB 4PV9A 4NO5B 1G1YA 1J11A 1I1YA 5C09E 1LO2H 1P6FA 5IJKC 3NN8B 4Y4HC 4G6FD 5DR5H 1J1OH 3IT8D 4GSDL 1RQ5A 3K8KA 1L4IA 5DD6B 1UM6L 4F7TB 5T33H 1Q9WB 4OGZA 4ORGB 2DLEA 1YEFH 1MFBH 4WENB 3MLPA 2D7TH 1T66D 4RFEB 3M8OH 1RIVL 1Q9OB 3HTLX 5ESAA 4TUJA 3EYQD 4G8IB 2VQ1B 4HDIB 1LP9A 4OKVB 1FPTH 3BDBA 3EDEA 3SDAB 3O6LL 4XPAL 4GMSL 3WS3A 1EAJA 5DMKB 4G6FB 2V2WA 3WHXB 3KXFD 1BF2A 3IFOA 2F74A 2LTQC 4HPYL 3L9RA 4QYOB 1A14H 1G7PB 5JMRA 1ED3B 1IAMA 3MJ9L 2VDOL 3QRFM 3NCYS 3BH9B 5FGBA 1NBVL 4IRSD 4IHOB 3JV6A 3FAWA 1KIRB 1XGYH 2DD8H 3L5HA 4LVOB 2EE6A 4RNRB 2Q76A 3T08A 3O3EB 2UZIL 5KTEH 2RJMA 4KMTH 5K9QI 1MRDL 4LLQB 5ANMB 3KXFB 2X4UA 1AGEB 4ONOA 1BQHA 1UJTA 3NFPA 3MUGB 1QR1A 2SEBA 3TJHC 4XRCA 1N5YL 4U1LB 5SWZA 2YEZB 1ZKAA 4JFOA 2APVA 4PJFA 3BPCB 5DO2D 2A73A 1AIFB 1ZHNB 2ADGA 3ARDC 4YXKH 4OZGF 3NA9L 4I9WE 4P4KC 1F4XH 3HMXA 1BD2D 5D1QD 4HJ0C 4N8CL 4JRWA 1CG9A 2AI0L 4WU5A 2CIIA 3OKEA 3HAEA 3VXUD 3V5KB 5EG6C 5IIEB 3WL9A 4YHPA 1XGQB 1QRKA 5HHXL 4PJ7A 4QGTA 1NGYB 4UT7L 3KPRE 4YO0B 1KN2L 3HMWL 1UWGL 1RMFL 1AO7D 1AR1C 3GSRB 1OGAB 2DS4A 1A22B 4GW4B 4ZUUB 1UXWB 3MACL 1EFXD 1R3HB 2ENSA 3KLAA 4M48H 4XMKH 3BRGC 3MRKA 4HUXB 1AGFA 5JIKA 5HYSA 5D1QB 4PJIB 3ILPA 1TZIA 3SKOA 3VXUB 5FYKD 1MIMH 1NEZG 1RZKH 2EH8H 1OAZL 4KTDH 5D72H 3U0TB 3SOBL 5FAAA 3QIWD 2R9HC 1NAMH 1KJ2B 5D7IB 2Y7QB 1EFXB 2IFGA 3C60A 3QBTB 1NL0H 5GGQL 3RL1B 4P2OA 1MCLA 2GFBA 3M17B 1EK3A 1N8ZA 3WS6A 3E6FB 3EOTH 2ZG3A 1V05A 5I1JL 2DJUA 4WFFD 2Q87A 2WINA 2A77H 1V8HA 1X5AA 5D96C 1H15B 2FHFA 5FYLE 3X12B 1IGMH 3QIWB 4LVNC 5DVMA 1JP5A 1WF5A 4JHBA 3U7YH 4LSPL 3QEGL 4JZOA 1BVLB 4GBXB 4JPKH 3V6FA 4ZNCD 1NCCL 3QXAA 1TMCB 4PG2C 1BJMA 1T22A 1CGUA 4PR5A 5DRXB 4OZ4B 1JZ8A 4KK5C 3B9VA 4UT6L 4WEBH 3FO1A 1HDMA 4I3RL 5M7QA 4PBWD 4QRRD 5E94B 5GSVB 4M4PA 5IHLB 1BIHA 4GMTL 5CBEB 2WUCH 4OFDA 1H3WM 4XPHH 3EYOA 1UEYA 4NHUB 2APXA 4OF0A 5LBSH 3STZB 4RMVA 4BKLA 3TZVC 4JGUA 4DKEH 5HYJD 3NGBC 5E8EA 4QHMB 3ECBB 4UV4L 3K2MC 3DETC 1XIWC 3S35X 4JB9H 3O3DB 2GITB 4QRSB 3EJYD 1CGSL 5CMAB 5CZVL 1EVUA 3IFNL 4FOMA 5T3XD 4QRRB 1MFEH 3PP3H 4Z77B 4C56B 4D9RD 3BKJH 1YECH 3AREC 2XWTA 3LMJL 3MR9B 1GAFL 1Y0LA 2NY4C 1OGTB 5B8CB 4K8RH 4X4ME 1YUHA 3GMMB 1VGEH 4G80A 4UINH 3EYUL 3UTSD 3CSYA 5HYJB 1JV5A 2PYFA 2CJUL 3W82A 3C09C 4HUWB 2DQHL 5J56B 2ATKB 4IOFD 1NCAL 1RPQA 3Q5OA 4Y16A 1Q9KA 3FN0L 4JQXA 1I7RB 1I9JL 3BUTA 3CCHA 3RJDA 1BQUA 8CGTA 4R3SB 3KHOA 3LB6C 1TNNA 1MIEH 3CH1A 4UBDD 3K0WA 1J5OL 4OCSL 3D0VB 3RUGE 5IOPA 3AY4C 2R2EA 5FKPB 3FN9A 3VE0A 2Z4QA 3PWUA 4JAMA 4X98A 2P5WE 2ICEA 3UTSB 1CZ8L 1CDYA 4WY7H 2X4QB 5EU4B 4PY7A 4OD2B 1OVZA 2VN7A 2HT2D 1KG0A 3WFBH 1IL1B 3BUYB 3IDXL 5DJCB 3MV01 2VJXA 5EZIL 1BJ1J 2FIRT 5H2BA 1G7HA 1GOGA 2BDNL 2EDOA 5CGYD 3E8UL 4Z7WA 2NXZC 2DQTL 1KTDB 1A2YB 4OGAC 4MA1B 1FL3A 4NKOB 3TJEH 1H3XA 1I1AA 1B0GA 3T3ME 3HMXL 2VLRE 4U05A 2HAZA 1AD0B 2W9EH 1T2JA 4BM7A 3BISA 5DQ9B 4U1SA 3QISA 5IWLA 1U9KA 4LQFH 1M7XA 2C4XA 1UH2A 1MJJA 2R0KL 5AYQA 1UACL 5BW7C 2EH7L 5BCAA 3MRQA 1WFTA 4P5KB 2HVKB 2XG4A 2VZ3A 4HUMB 3C2AL 4NJAH 5ITFB 4MA3A 2HLFC 3BMWA 1BM3H 1E4XL 2W65A 4HXAH 5TE7H 3HZMB 4LSSH 1NANI 4YHZH 5HHVL 2J2ZA 2BSRB 3GMQA 3RNQA 4IM8A 5T5NG 4BQ8A 4WTZG 3G5XB 5JQ6L 4LIQE 5E8OB 1T5XA 3EFFA 3MUZ1 2Q1EA 1A6VL 3QFJD 1VFOA 4MNQE 1DE4A 3D3VE 4CVZA 5I16A 3OG6B 4ONFL 5IFHL 3VGDA 2AGJH 4S2SA 5BRZB 2VC2H 3VFRB 1ZT1A 1T2QL 3BPOC 4PJ5A 3UBXA 4KPHL 3V4PL 1UM5L 4H1LH 2PYEE 2NY3C 2FX9H 4XVSH 3ZZ1A 1FFNB 1PG7H 4JFQA 4DN4H 4RSVA 2X4SA 5ENWA 4FQIH 4DCQA 4NNXB 3EJJX 4LFHD 2IMMA 3FHQA 3HG1A 5F1SA 2P8MB 3I6LE 4CBPA 3S96B 5LKNA 5IUSA 1FLTX 2YUZA 4W6WB 3RDTA 3D2UB 4HK3N 4XAWH 3BWAB 4XTRC 1G7MA 3QFJB 3RA7H 3ZKNC 1N5AA 2R0ZL 5IW1A 4UU9A 3MV7A 3PQYA 3RIFF 4ODVH 2ZCLL 3MRJA 4X4YB 2NXYC 3SJVE 1A1MB 4CN4A 2OI9B 1BAFH 1JHLL 1WWAX 1TTFA 3QG6B 3H3KA 5F97E 1UADC 4EUPA 4FQ2H 1A6ZA 5HHOD 3UTPE 1GH7A 2AEQL 1KGCE 1P53A 2NY7L 4KKBD 4XCEA 5JTWA 1NGXA 4XNQA 5D2LE 2C5DC 2CO7B 4QOKD 3KPTA 1Q1JH 4XAKE 1JYWA 1WAAA 2Z8SA 2Y06L 1PZ5B 3REVB 2W0FA 2C1PA 1RVFL 4G43B 1DBMH 4MNQD 1WBYB 4OCXH 4ZYKA 1CVSC 5B4MD 1L6XA 3TBSB 2ESVD 4HIHB 5HHOB 4YZFF 3PHOB 1JVKA 2BVUA 3CFCH 4XMPH 4RRPA 2BY0A 4QOKB 2Z0BA 5JPMA 2VDLH 3VGFA 4JLRA 3W9DB 5IEKB 3PG2A 1MWAH 4QY8A 5DLMH 4H26B 1XR8B 3RKDC 3D0LA 4KROD 3L3JB 4TSBH 3VWKA 1R3JB 3WDJA 4WCYH 5DMYA 1ZLSL 1UA6H 3OXSB 2V9RA 2ESVB 4MHHI 4OV5A 3IJSB 5ALCL 1A5FL 2YK1L 2YKLH 4ZDHB 5JORB 1XMWA 4FQXC 1QLFA 5CZXC 1IEAB 3K81A 4KDVA 2AJ3B 4P9HH 4Z8FL 1NUNB 2R2CA 5HVWA 1DVFC 3OF6D 5D7JC 3O2VH 2X5PA 3LKRB 3NIFE 4Y4KC 4KROB 4QXTB 3QIBD 4JANB 4E9LA 1J8HD 3E2HB 4TNVK 4F7EA 5E7BA 4X6CF 3C5JB 4Z78B 2BHZA 2R2HA 1YJDL 1RJZA 4Z7UF 1ZGLB 4XP9H 1CD9B 1JMXA 4Q58C 4FFZH 3DHMA 1RK1B 4LCWA 3Q3GA 4OIBA 4Y4FD 1LO0H 1SEQL 4ZQKA 3HI5H 1NLBH 4J4PC 1FL5B 3GMRA 3C6LD 3VFPA 3VI4E 3UC0H 2R8SL 3QIBB 3BKML 3BE1L 3V6OA 1J8HB 3GM0A 4QRPD 1UYWL 4PJDB 2GY5A 3WFHA 4FQCH 3LH2H 1U0QA 3MMEB 3HUJE 3MLRL 2IALA 3P0VL 1KUMA 3B9KC 2NW2A 2YPLE 3OB8A 2BHUA 4UDUA 2OTWA 4NIKB 3ARBC 4I0PA 5TE6H 5FM4A 2AXGA 2X1QA 1J1OL 2K1MA 2NW3A 4EI5C 3MGOB 4Y4FB 4HEPG 4PRBA 3P9LA 4AIXA 1DBBL 4F8TA 3H9SE 1YEFL 3C6LB 2PO6D 1I7TA 4ZSOE 4QRPB 4ELMB 3Q5YA 1HQRA 4M6AA 5C70A 5DK3A 3T04D 2IFFH 2P43B 2VDMH 4RMWA 5DZLA 5DK0B 5C0CA 1P6AB 3ULVD 4HLZG 5DJDA 2O26U 4ODUB 4ONHA 4PLJD 1KCVL 5I6XC 5J6GB 4OJFL 5LAXB 2YD2A 1YEKH 4X9FA 4OZHB 1N59B 4XWGH 2DQEL 2GSGA 3QPXH 1QHPA 3HR5A 3CVHA 5EU6E 1L7IH 4UI2A 3O6KH 4POZD 3NAAL 4O58H 3VXOA 5HGAA 1WT5A 1XF5A 1D5XA 1TVBB 1BGXL 5C8JB 2XA8H 3LRSB 3SO3B 4ZFZA 3WEXB 4XC1L 5J57B 2H9GB 2E27L 2EDLA 3RGVC 5TE4L 2CIKA 3B4NA 2YA1A 4YFLF 4PLOB 4LP4A 2ZJSH 2GAZA 4CVWA 3KLHC 2PXYD 3PF2A 3GRWH 2NCMA 5DD3L 2JELL 3NFSL 3BZFA 5T1DH 4Y5XB 1C7SA 4A6YB 4UIKL 3BD4A 2IQ9H 3IJYA 4KVNH 2UWEB 1MRFH 1A4JB 5IROC 3QDMD 5IKCA 3VRJA 2P45B 4JKWA 1FZMA 3CXDH 3SQBA 3FB6B 4YAQA 4NKMB 5IGXL 2BNQD 3QNYA 4LSUL 5BVPL 2PXYB 1F2XK 3VA2C 3R8QA 4PJAE 3RVUD 3BEWA 4NQDA 5F6IC 5TF0A 3LQAL 5J1SC 1FNGA 3G6JB 2HT3D 3KYKL 4G9FA 3DYOA 4AQOA 4K94C 1PKQE 1MCCA 5KJRH 1I9RH 1G84A 3ARUA 3HE6B 3FT2A 1BP3B 2OQJA 3RWGB 1E4WH 1CFTB 5GHWH 5BVJB 4Z7VA 1JZ4A 4HGKC 4NN5B 5HY9B 1MIML 5E08H 3PDDA 4ZTPL 3L3DA 4LOUC 1X5IA 3U6RA 5L8KB 4JFFD 4F7MB 5B39G 1JPFB 1KN4H 1NCWH 1RZ7L 4HIXH 1NAML 5IB4A 1UJ3A 3L3IA 3RZWA 2YRLA 1OARH 4XVUD 2YPKA 3RX8A 4WEUD 3TWCH 4PJXE 5IMLA 1S7QB 5LVEA 4YJZL 3MLSH 1EVTC 1NEZB 4KK6C 5GSRA 1HNGA 1PAMA 3EOTL 3U79A 1HHHA 2QTEA 5GZND 1T5WA 3RWCA 4MAYD 1FGVL 5LWYH 2BERA 3U30C 1CTOA 2YRZA 3U1SH 4LCYB 1QOKA 3FHAA 4JHAH 3QUXC 2Y36H 1F2QA 4JZJC 4JPKL 1HHGA 2B8OT 3VXQB 2HN7A 1DDHA 5IVOA 4BK4A 4X8JB 4PJEE 4TVPE 4PJGA 5D1XC 3CX2A 2AK1L 2CDEB 4OGXH 2IG2L 1MCDA 3V52H 2LABA 1NBYA 4DOHB 4MAYB 1ZOXA 4XZUB 4E41B 5JOFB 1KIPB 3HE7A 1YY8A 3H8NA 5CP7A 4KAQH 2DKSA 4XPHL 4KDTC 4JY4A 2OL3H 4H88H 2IF7A 1R5IA 4MX7B 2YD5A 5LBSL 3IDYB 5I1LA 4B50A 3KYNA 1CICB 4QRUA 2OXGA 2VITB 2V5MA 1F4WH 2IPKA 4DKEL 3CU7A 5SWSE 5GGUB 3HC3H 3L3OA 3LKPB 4BQBA 3I9GL 3JZ7A 3MTRA 2EDNA 2XZQH 3LKSB 5JHDE 1YECL 3TIDA 4JN2B 5E4EB 3HHRB 5EO0B 4G6AC 4QHNB 5B38A 5GRUH 3QJFA 2OZ4H 2IWGA 3CK0H 3RWEA 1UXSB 2MCPH 1JNNL 2L7JA 2IANE 2Z8RA 4K8RL 4GKSB 2HJKB 1HOCA 4OLUH 2FB4L 3QH3A 5C9JA 5ISZE 3U7WL 2Q20A 4PRHD 1C12A 4K7FB 1ZANH 5DI8A 1W0WB 3RZCC 3L7FB 4XNZB 4HUUB 3WKMH 3ZKQD 5F89B 3CVHL 1CFVH 4R9HA 3VXNA 4MJ5B 3HZVA 1KT2B 1W0YT 3N0PB 4JZNB 2ICWA 4C83B 4LEOB 4NQCA 3GSVA 2VLKA 2E3VA 2ADFH 2QEJA 1QFWM 1CQKA 3SDXB 2FL5A 3C5SA 1A6UL 3AVEA 4PRHB 4WY7L 1ZHKB 3GKWL 4ZFOB 4TOYH 4CKVX 2ZPKL 4APQC 4M7ZB 4U7KA 2AK4D 4NZTH 2EXYC 4GAYA 5IMOA 4I3SH 1QFOA 5FGCE 5HVHC 5IJVB 2VL5A 3UDWA 1PKOA 3O9WD 4DVBB 1U8NB 2E9IA 4GXUM 5GS2H 3BZ4B 3LS4H 3UJTH 1NMAH 3LEYH 4UB0H 5CD3B 1P4IH 4F3FA 4OZGA 4OB5H 4BSWB 1HWHB 1JGUL 2KBGA 2PUQT 1F6FB 4OQ1A 4I13B 3SDCA 1ORSB 1WEJH 4LRIC 1T1YA 2R2BA 2W9EL 4JHZA 4Y8DC 3VJ6A 4QRTB 3EO1A 3HZYB 2AK4B 5DDHB 1G7LA 3ULUL 1CLOH 1TJIH 4U1GB 2I9LB 4AJ0A 3QRGL 3Q48A 1OF2A 3O9WB 3IDJB 3QR2A 3QYCA 2WIIB 4M8VA 4U6XA 1CD1A 2R0LL 1CFQA 2DLFL 4FFWD 4WFGE 3TH3T 3QPQD 3MROB 4YLQT 1YEGH 5TE7L 1ZLUH 4YHZL 4R7NB 3BPLB 4KRNA 5F7WC 3IETA 3B6SA 3UTQB 1ZAGA 4RIRA 3HNTL 3D85B 1JFQL 1CL7L 3MOBL 4QEGA 3SKNA 2BXZA 4J7RA 3EO9L 3M1BA 3O11B 3UP1A 3NACH 3U0WL 3MZTA 5FYJL 1TTGA 3QIUA 1WWBX 5ESVA 4P23B 4NQEE 1CDUA 1VADB 2FX9L 5T1KA 2COQA 5L9DH 1PG7L 3HZKB 4K23H 1X4YA 3AMKA 5T3ZE 3BIAX 4ZD3L 3GI9L 5HHQA 2NY2B 4L4TD 3WE6A 5I8CB 3RA7L 4L29B 1PBYA 5E2WH 2O61B 3MRLA 5J89A 1M6OB 1RUQH 5DEZA 2FD6L 6CGTA 5J13B 4ODVL 1EJOL 2VDPL 4XWOC 1TTUA 4YNYA 3O6FA 4ZXBA 2A74A 1MFAL 1QSEE 3GBNH 3L5XH 5CIPA 3LEXB 1GZPB 3FQXA 1KB5A 2Z93A 1L9NA 3O4LA 3U4EA 4GO6B 2C3GA 1RUPL 1WITA 3DIFB 1DEEB 4LPCA 4N1HB 4JFPB 3SBWC 4D9QD 1S5HA 4HHAB 3E6HA 1ZSDB 3MYZA 4FQ2L 4CN6A 5DUMH 3B3IA 1UM4L 5GS0L 5ADOH 4RGND 1I8MB 4F8QA 4MVBC 2AERT 2IADB 2XG5A 5ACZA 2NZ9D 1HHJB 3GJFA 4XPTL 5KAQF 2EEDA 1HKLH 2FJFB 3K80A 5L2JA 1DBKH 5E6ZA 3MRMA 1F3DJ 2CRYA 4MA7L 2DLIA 4OCXL 4JFZH 1JWSA 3S5LA 1EX0A 4YHNB 2BOBB 1NDGA 4POYA 3PWVA 5ICZB 1AI1H 4XNUL 4Y5VB 5LGJA 3MLVH 5M94B 4PGDA 3TF7C 5E8PA 2IGFH 1J1XH 4U0RB 5L2KD 4R90H 3TO4D 1Y6NR 2EKJA 3N1MC 4RGNB 2O93L 1W72H 4GW5A 4D0BA 2RFXB 2VDLL 4JO4L 3RBGA 1L9MA 2J1KA 3MREB 1JI2A 1GOFA 2CR3A 1DUZB 3HI1B 4LKCB 3ARSA 4B7LA 1CGWA 3VXSB 1ZK9A 4TSBL 2VDNL 1II4E 1UB5B 3IXTB 4BH8A 1IGIL 2D4DA 4N5EC 4WNQA 4G8GA 2X05A 5C08E 3MLUL 4OD1H 4MXVE 2V7NB 5J9PA 4XI5C 3TCLA 4BSVA 5L2KB 4DW2H 1R3KB 3TO4B 3ZE2E 1I7UA 5FM5M 4J8RA 1U2CA 4P9HL 1JYNA 1U8PB 3WXWL 3NIGE 1RZFH 2FEEL 5DJXA 2WSKA 2F5BL 4MZ3A 3OZ9H 1AKJA 3P0YH 43CAA 5IG7B 4LPTA 1IC7L 2XWBB 1YEDA 4R96A 5KSBB 3KWWA 4ODXB 3TIEB 3LV3B 2W60B 4Y1AA 4LASH 3CJJA 5ICXB 4EQ2A 4XP9L 1U36A 3IS1X 1HNFA 2H26B 4GKZA 1ZLVH 1H5BB 3BWUC 1K2DB 4ZPVA 3DGGB 3HFMH 4X6EB 3AU1A 2NYYD 1QLEH 3CSPA 4W6XB 4Y8AA 4NQTA 3F7YB 4NO3A 4QTIH 1NLBL 1RIUL 3A6BH 4XP5H 3DX8A 4V1DA 3ZKXC 4FXGA 5C0AA 4QNPE 4Z18A 3DMMD 2C3HA 5EORH 3SDDA 5KSAB 3D18A 3LH2L 5I1AA 3WNPA 3T0ED 1M4KA 1MSPA 1IAOB 1IAII 4Y5YA 5CCKH 3R1GH 3BZDA 1MCRA 1G0DA 3IU3A 1GSMA 3IDMB 4OTXH 1EA9C 4DTGH 2X89D 3ES6B 1KLGA 5ITBH 2N7AA 4YDIH 1KEMH 2GK0A 3K46A 3C5ZA 4PJHE 1QFWL 4TNWK 1YN7A 1ZE3C 3F8UB 5I19H 5CD5C 3EAKA 4LSVL 3DMMB 5HJ3A 3TA3C 2CXGA 2EYTB 1MFDL 3MBED 1RZIB 3VMOA 3CFDB 4WO4B 3GEWB 3HR6A 1LP9E 1FSKC 1B6DA 4BYHA 2HKHH 4HZAA 3MCKB 3PWPA 5TJWK 1INEL 1ZA3A 1IQWH 4MQSB 3ARGC 3WMSA 2D31A 3MV9E 1U8JB 4MJ6A 4MSWB 4ZUTB 2OR9H 3TPKA 2QLVB 1YEIL 2J8HA 1FNLA 1O7SA 3ARTA 1DQQA 4RMQA 2DQIL 2CKNA 1I85A 1XH3A 2APWA 5IB1B 4GRWH 3ALPA 4WI3A 4QGYA 3KJ6H 3ARXA 2DM3A 3QXUA 3MBEB 4NQVA 4LHUB 4M43H 5CJOH 1U3HA 1OAXH 3UO1H 4X6BA 4DFIA 2XA8L 1NAKL 1S7UB 4TULL 4MNGA 2EYRA 1ONQB 5CJQH 4YGVB 1L0QA 4WUUD 1M7DA 4HGMA 3P9MB 2AVGA 5JDJA 1T7YA 1A7BA 5BV7B 5TH2A 1PY4A 3TYFB 3NZ8B 1A1NA 3GRWL 3QNXB 5T1LB 3WLBA 4D0CA 2E7LA 2ADJA 5FGBC 4H0GA 3PWNA 1JNHA 3L5JA 3TNMA 3DVIA 1KB5L 4HKXA 4OLZH 4KVNL 5GRJH 1MRFL 5FF6B 5EWIH 1FDLH 1TQCC 3VG9C 5EIIB 3EDJA 3ZKSD 1EGJH 2OTUA 3CXDL 1ROWA 1S7WA 4Y4HB 4WUUB 3W0WB 2VLME 4PJBF 2H2PD 5A3IC 4NSKB 1C5CH 4ZUVA 5JXEA 1JHTB 5HTSA 2FZ3A 1S7TA 3MYJA 4I2XE 4EUPH 1OP9A 1F6AB 3BDYH 5F1IB 4DQOL 3A0OA 1CXIA 4S1RH 4OD3H 2QADC 3DI3B 5C09B 4FG6C 3ROOA 2YD9A 5KVGL 3ARPA 1AC6A 2EDWA 4YE4H 5ESQB 1CE6B 3LCYA 4WDIB 5D5MA 2ERJC 5GISH 2NR6C 2OBGA 4OCRL 4HULB 2MPAL 1T4KB 4H25B 3STLB 2Z31A 2UYLB 3OG4B 5IFAL 5MHSD 4HIXL 3IAPA 4HCRH 3RUGF 5ERWA 4L3EE 4P4KD 4KJPD 4YK4B 4HKBA 5FCUH 1OQXA 3QI9D 4KK9C 1FAIL 4NN7C 4HJ0D 5D2NA 3OJVC 5F8RC 3CD4A 3O45B 4AH2A 1JZ6A 4H5SB 3GSOB 3IFPA 2X4NB 2AXJA 3GJEB 5JO5B 4Y0GA 1Z6JT 1AR1D 2X7LB 5J0BA 2AXFB 2HH0L 3MV8E 1JPGA 4YHLH 3BEVA 3ARDB 4X6CA 3FQRB 2Y36L 4P4KB 4MQTB 2X9WA 1C16A 1ZWIB 3JWOL 3QI9B 3C60C 2BVOA 2OP4H 4Z7UA 3T3MF 2QHLA 3KYOA 3QWRA 3PXJA 5FHAL 5DGQA 4OGXL 1LO3L 2YBRB 1FFPB 3WS6C 4UMGA 3DYMA 1RD6A 4JJ5A 1KENH 4IIQC 3FMGH 1DBJH 2A9NH 5I2IB 1JWUB 2VISB 3RX7A 4LNRB 5HXMA 3S34L 2R9HD 4U1HA 3DVFA 1FZKA 2YXFA 3GK8H 4S1DD 4TVSa 5E2UH 3BP6B 2NLJA 3FT4A 2EZ0D 4L4JA 4D8PA 5IEHB 2I27N 4LAQH 1R0AH 1F4WL 5IW6B 1ZS8A 5BQ7B 1U41A 4P2CG 3HC3L 4F7CA 3BW9A 5D8JL 3IXAB 2RGSA 4LLUA 3PWLA 1SMOA 1AHWA 5C0JA 1BIIB 4PRPD 3DXAA 2IH1A 4ENED 2JB5H 4JN1L 1T03L 4LVEA 2XWJA 3X14B 1BFVL 1UCTA 1BFOB 1A6PA 2AQ3A 3MLYH 3GMOA 2C3WA 4OLUL 4XVTH 1JGLL 4X9BA 1TQBC 1A7PL 4DZBA 5E6IA 1YZZA 3EYFB 1Z9LA 1FC2D 5CHNB 3GSWB 1ZANL 2R1XB 4GLRH 3WO3B 5SX5H 1VFAA 2UVFA 1BLNB 3A6CH 3AXLA 4I4WB 4X6DE 3VXRD 5GZOD 1IQDA 1CFVL 3GGWB 2NY5H 1X6NA 1MNUH 5H94B 1P84K 4XCNB 2WW8A 2AV7B 3ZKMD 4ZNEA 2Q86A 1A6AB 3RAJL 2V5RA 1DSFH 1F6LL 3IKKA 2FGZA 2QHRL 5EO1B 4HH9B 1LO5B 1MHCA 1NDMA 3RY5A 5D2LF 5IV2B 4OUUA 4O2FB 4RZCB 3DRQA 4KC3B 1CIUA 4PJ8D 4RFOH 4I3SL 4L8SA 2BCKA 1CR9H 2R4SL 3VXRB 1EMTH 3T65A 1YNTA 3UTTD 4MNHA 5L7XL 2EKSB 2JLLA 3LS4L 1T20B 1NMAL 3LEYL 2P5ED 1RJLA 3PGCB 2ZSVA 1QBAA 2FR4B 4Z76A 1YJDC 5I1DA 1BFTA 3TZVB 4U1NA 5FFLA 3RWIA 2BHYA 5CS7A 5LXGH 2O5XH 4RAUB 3DV6B 1A47A 3I6KB 1CLOL 4PJ8B 5I1GH 1JN6A 2N4IA 1UGNA 3AREB 1T0NA 1Q72L 1MRCH 2GJ6A 4LPWA 1RZJH 5F7FA 4XCYA 3UTTB 2C1OB 3W81A 4JFYB 3FOLB 4NT6A 3GMLB 3PABA 5D70H 1HXMB 4C4KO 1TDQA 1YEGL 3FQUB 3MRCB 3AB0C 1I1AC 2DOCA 4OM1H 1MJ8L 2FH8A 1ACYH 3C09B 2LVEA 3WIFB 1MHPH 5IF0A 4NYLA 3WNKA 5IWLC 2FNBA 4JQIH 5FO7B 5IVXE 5HI5C 4NRXA 3GMNA 1KJ2H 3NACL 3SE8H 1FVDA 3NIFF 2BSTA 1EAPA 3MRFB 4MXWH 4DGVH 4J3UA 5HYQB 5K9OB 2A0LC 4P46A 2NXZD 4AIOA 4EI6B 3ZTNH 3MRDB 5HHNA 4AEFA 2FECI 1IILE 5J6HB 3EOBB 5FYKH 5I8OH 5A40E 4XXDB 3RL2A 3F7RA 2OJZL 4ZS6D 1U8IA 2XPGB 5E2WL 4K7PL 3BKYH 2BSSA 4XPGH 3PQYE 5TQ0H 4K7PY 3P2TA 3VI4F 4ETQA 4POUB 1FZJA 3NCJH 4BZ1H 2G5BA 5DEFB 2NXZB 5E99H 1AGBA 1G6RA 5I15L 4M8QB 3UJIL 2A6KA 2H2SC 1UZ6E 5HVGB 3O2WH 3MCLH 4TQEL 1B4JL 4P2QA 1HIML 5IP4A 4S1SL 4X0KB 1IGCL 5HHPB 5KN5B 1OHQA 3K4DA 5FA3A 3RDTC 1KCUH 4KHTH 1I4FB 3FO9B 2Q8BL 4GXVH 4PP1D 4R97B 4XBGA 3QEQD 3MXVL 5CEXA 4P57B 2E6QA 1FO0B 2MOVA 2VLJA 4LLWB 5F7YC 4NM8H 4MCYA 1HI6A 2ZG2A 5I8EB 1F8TH 1GHFL 1NBZA 32C2A 2MMXA 3BRDA 1AI1L 2DQCH 3HC4H 3FRUA 2IGFL 2BMKA 2F9BT 1SYVB 2DMCA 4Z0XB 1W72L 3TPUB 3NVQA 1ULVA 4KY1H 3UZQA 4AEHH 5DUBA 3X17A 4PRNA 3U36A 3QEQB 2ADIA 1I3RB 4FHBD 4OQTA 2XTJD 1FCCA 1FVCB 4Y19D 1NJ9A 3BGAA 3LQAC 1LE9B 2IAMA 2VABA 3K2UH 2ZOKA 5IQ9A 4JPIA 4MD4A 5I1EL 1S9YB 3WXVH 4OBSA 1PG7X 2H32A 1H3VA 3GSNA 4QF1A 5JHLH 1AXSA 3GIVB 3JUZA 1UWEH 5C0FA 4PY8I 2AKRB 4OD1L 5HDOA 5IHBA 4WW2C 4UUJB 2MQ3A 4DW2L 3CDGB 4GRLD 2HP4A 5T3XH 2AS5M 3UJJH 2F54D 2JF1A 3OJDA 3H7BB 4NN6B 4LEXL 1FLRL 4HIJA 1W0VA 3X3FH 5A1AA 5C0IA 3VW3L 5EFIB 3HPLA 3B5HA 4Y19B 4X99B 3SHSA 3TT1L 5C3LD 3VWKC 1P7HL 4EBQH 3PDGA 4WFHD 1FC1A 3KNBA 3BHBB 1KB9J 3Q6GL 4Y2DD 2HT4D 5D6DA 3HCVB 1UG9A 1EEUA 3CC5B 2F54B 4TSAL 1HYSD 4NRZA 2FEEI 2R4RL 3HLAB 2OM5A 1VFMA 4YBQC 3T0AA 3R0NA 3QULA 1BJ8A 4PJAF 3IU4H 1CU4L 2GI7A 3BIKA 1EPFA 2OK0H 4M6MH 1T04A 4WUKH 4E42A 2J6EA 2OSLA 1WUNT 2NMSA 2YPVH 2CLRB 1X7QB 5I1CH 1OSZB 2FYYA 3PWJB 3R1GL 1EJ6A 3CZFB 4HFUH 2YD4A 1TZHA 2VDRL 5CEYB 3DNKA 3P4NB 4QRQA 4KJYB 4FXKB 1KEML 4LGSB 4YGAB 5D1ZD 1KLUA 2P44B 4JVPA 4PRID 4Y4KD 4HPOH 3MJ7B 4R2GC 2P4AB 3O8XC 1BMGA 3V6OC 5CP3H 3FFCA 3DX7A 4AT6A 1LDPL 2R69L 5I1IL 3CFJA 3QXDA 1N2RB 4F58L 4PJXF 4FQXB 4W4OA 1HEZB 1DANT 5DK2B 5TFSH 2B4CH 2VE6A 2AV1A 1ADQH 1NGPH 1XGUB 1OAYL 2OR9L 2IH3A 3QXTA 3I02A 4WWKD 1EXUB 1DVFB 3TBYA 4PRIB 1P9MC 3CUPB 3P4OB 3QUYD 1NMBL 4Y4KB 1TCRA 5JW5B 4MQXD 3HPJA 5DRZA 4JO1H 1A0QH 4NNYB 3WNMA 5MEQA 2EIDA 2XTLA 3FT3A 1MVUB 3JWDL 3WD5L 4M43L 1VGKB 4PG9A 4IS6A 1ZXQA 4UNTA 3LSOA 3JV0A 3BXNB 3HNVH 3K8LA 1FL6B 1S7RA 4YDVB 4UQ3A 1BQLH 4HS3A 4PJEF 3WNNA 3BJ91 4GKNB 4IRSA 2GT9B 4YPGA 1XCQA 1PZUB 3W5NA 1G9ML 4BZYA 1LILA 3K1DA 1SJEA 4JFDD 1MQ8A 4PGEA 3SE3A 2RCSH 5MI0B 1OAKL 4LRNH 3VG0H 4PTUA 5E24E 1WT5C 3ELAT 1G6RL 1ZLWK 3B9KB 5KANI 4FQLH 5TGBB 3ARBB 1EGJL 1FH5L 1IM9D 1FIGH 3NCEB 5IMMB 4EI5B 1WZ1H 1VHPA 3KPNB 4M1DL 4XP4H 4NKDB 3ULUE 1D5BB 5CIPH 3DVGB 2D7OA 3CDCA 1ZVYA 2H3NB 4OFYD 4YXHL 4JFDB 5TDNB 1OTSC 2PW1B 1UH4A 2PCPA 4J3VA 3HUJB 1BD2A 2J7LA 2OYPA 2W0KA 4G9FE 3EO0B 3PJSB 5BO1L 3V5HA 4F57L 3RGVD 3G6DL 4OD3L 4HEME 4X9HA 2HWZH 3DX9A 3MJ8A 4OKDA 4ETYA 1F42A 1AO7A 3MRPA 4MD5A 4MA8H 1IGYB 4XB7A 3SKMB 3ULUC 5MEPB 4RWYH 2VTFA 5GISL 2LV4A 5FYJE 5JW3L 1Q9LA 2EE3A 4TNWF 1KIQB 1JNLL 1X5HA 2OXHA 4LARH 1K4DB 2WBJA 2FGWH 1D9KD 4ESKA 2C7UA 4HXBL 5E1AA 5DC9B 4DJMA 3GSNL 3RGVB 5F9WB 5C3TA 2OS7A 1SY6A 1FFOB 1J05B 1QTYT 1OPGH 2H45A 2EE9A 5JR1L 2V6HA 2J8UE 4HX1A 5AUMA 1A64A 4M6NH 2V2XB 2DI9A 4D3CH 1BQHG 2EYSB 3U2SA 1K8IA 1G7JB 3KPSD 3L3KA 4X83A 2DWEB 1D9KB 4GG6B 4LCUA 1UJ3C 4Q2ZB 5BMFH 1YEHL 1NC4D 3G08A 3I50L 4TTGA 2QQNH 3P4MB 1RIHH 4Z0BH 5MEOA 4NRYB 1ES0A 4J6RH 2X4PB 3TFKC 2CXKA 3QDAA 4O5LL 1N4XL 1BVKB 4CW1A 3DUSA 3KPMB 1U92A 5C07D 5HPMB 2QQLL 4ZOCA 4JPVH 5DEGB 3KPRA 3HAEG 4YQXL 3FMGL 1DBJL 2A9NL 5HGDA 1UKTA 4NBYB 3N1GC 2DBLL 3O0RH 1CLZH 5K59E 2V7HA 1F4AA 4Z7NE 2YR3A 4NPYA 4WU7B 1CTNA 1KYOJ 4O02L 3WN5C 3L1OH 4UDTB 2EDXA 4PJ9C 4OZIA 4KK6D 1ACZA 5GS0C 4EDXA 1YQVL 5C7XL 5H35A 5HYSG 5C07B 5FUCE 1PSKH 4HWEH 5F9JA 1DANU 1XGTA 3VRIA 3P40A 1QP1A 5DJAB 1MCKA 1D5ZA 3H9HA 3HE7C 3NH7H 4IRJD 5A2FA 1DQMH 2JTDA 3D48R 4HWBA 3QUXD 1ITBB 3OHXB 5D7LE 4N9GA 4UTBL 4HS8H 4YXLL 2XKUA 2GYSA 4GG8B 3MRHB 5DC4B 1DQJB 3QDGE 4JVWA 3U7AA 1NFIA 4HK0A 2PETA 1AH1A 2VZUA 2ZSWA 2HA1A 2FX7L 3DO3A 1CDJA 3TNNB 5FUCC 1JZ3A 4ERSL 1OP5H 2P7TA 3U30B 3RWHB 1I9EA 4OCYL 4KUZH 4P5MB 2CRMA 4KKCD 2H6PA 1MNUL 1IM3B 3QUXB 3MO1B