2ED7A

Solution structure of the first fibronectin type iii domain of human netrin receptor dcc
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
GSSGSSGKPAIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin receptor DCC
publication title Solution structure of the first fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ed7A00
3ZKSD 4YDJB 1A4JA 2R0WL 1UWEL 4OZ4B 3MRLA 1P4LA 5BW7A 3MRMA 3W11C 5B4MD 4ZPTA 3QH3A 2E8ZA 1SJEA 5EBMB 2ZUQB 4OSUL 3NIDE 5IQ9A 3TEUA 4NHUB 5D1XD 1ORQA 4H0IA 3IXTB 4LDEB 4I3SH 1JMXA 2FEEL 3N9GH 4MXWH 2DDQL 1Y6MR 2R56L 4ODTL 3EOBB 2DLHA 3EDKA 5HGAA 4P3CH 1JFQL 1W72L 3CC5A 2FZ3A 4HDIA 4HPOH 1EO8H 2VLRD 3QXVA 5EO9A 4OCSL 5JOFA 4N0YL 4HKBA 2A6IB 1HINH 1QLFA 5DR5H 3OR6B 4NZRL 4LK4A 3HMXA 4P2QD 1QNZH 4GMSL 4LL9A 5L2JA 5JR1H 3MOAH 1S7QB 5EZIH 2QQNL 2H3NB 1S5HA 5D1XB 4DUVA 3I9GH 1NAML 3K8LA 3FMGL 2OK0L 1PLGL 5C0RH 3QDGA 2GT9B 4LLQA 4N0FB 2E7HA 3BO8B 3A6OA 1CZ8L 1MHHB 5CIPA 5EOCH 3TZVC 3RVUC 5INCB 1LO0L 5CEXB 2A6DA 5KSUB 4XXDB 2J6EL 2VC2L 4JM2A 1MUJA 4NQUA 3O11B 4L8BB 2W0FB 4P2QB 2YD3A 5C09E 2D0HA 2P8LB 4X5XA 3D69B 2HP4A 5AYUL 1HN1A 1MNUL 4NGHH 2NXZD 5HTSA 3OKOA 3GMQB 4UNTA 4D3CH 4OGYL 1U58A 2H9GA 1DUYA 5C0DB 1GIGH 4HS6B 5DO2D 1BFOB 4ZXBC 3O2DH 3JV4A 1J86A 5H2BB 1G7JB 2F54D 1TVHB 4K71C 5ALCH 4PREB 1MCPH 2Z8WC 4KUZL 3L3OB 2V7NB 4L29B 2IAMC 4YUEL 3NFSH 2XQYK 2FWOA 4YDIH 1S9KC 2F8XC 3WO4C 2V9RA 3MLXH 5EC2A 4ONFH 2NXZB 4D0BA 4W4NA 5MP6L 1G1YA 5BS0A 3VD5A 1TJGH 5DF0A 1AGCB 1WICA 5JIHA 5FUCC 2KZ1B 2IMNA 3KYMB 5CEZH 4BH8A 2D31B 1ZLWK 3L3DB 1U8OA 2F54B 2XKNA 4O51B 1KG0B 2F53D 3BRDA 5D7JD 4Z8FL 4TVPD 1GGTA 1RZJL 1ZLSH 1TCRB 5CD3B 1YEGH 1RY7B 1QYGL 5I73C 4NYLB 2DYPA 1Z9SA 4J3UA 3D39D 5IHUH 3SCMC 3UMTA 1FV1A 5JHLH 1LEGB 3RUGE 1LE9B 1IGYA 5KAQF 3QFDB 3L6FA 3O45A 1U6AH 1C5CH 3LMJL 3QIWA 4XCCH 4P4RB 3EJZD 1UM5L 4KMTL 5JPNB 2R0LH 1K3ZA 4D8PA 3HI1A 3CFBA 2F53B 5E4EC 5SV3A 5D7JB 4AEHH 5FCUL 2EDDA 4PPTA 5DUPH 4M6NL 1MIEL 2MMXA 3BDXA 1GHFH 3MRCB 3RA7H 3D39B 2WIIB 4WENB 3LKPB 3O6ML 4KDTA 4TN9A 1QFWL 3GIVA 3E1F1 3CFEB 3KPRA 4RQQB 4QHUB 4JRYD 5F1IA 5L6YH 1CICD 2B5IC 1BEYH 4S1RH 1U95B 4OT1L 5IVXE 2X10A 1CFBA 1FFNB 3U36B 1K8DA 3G9AB 1BWWA 5T5FL 3SDCA 1IILE 4OGXH 5DJ2A 1CDUA 4HH9B 4HZLA 3QIBC 5FF6B 4M6AA 2Z91B 5D2LB 5CSZA 5EIVA 4JCLA 5D2LF 3FQNB 4MA8H 1D5XB 1XGTA 2CLVA 2X5PA 1TMCB 1I3UA 1DTUA 3U9PH 2FJGA 4PY7B 3G5ZA 2NNAB 4KJPC 4LDLB 5KJRL 1Y0LA 2ED7A 4JRYB 2WBWB 1S7RB 1U9KA 1H15B 4GAYB 3V52L 3PG2A 5D93C 4AEIL 2R23A 2UUDK 3M1BA 3FO9B 2CGRL 4PG9A 4MDJB 5CILH 1B4JH 3X11A 5EN2A 5IWLC 5BMFH 2DWDB 1YYML 3BP6B 2XY2A 4X4YB 5IOPA 5E8PA 5MEOA 4XNMA 3SDYH 2ZSVA 1HILB 4XCYB 3EO1B 3AB0C 4QYOB 1UYWL 5C08D 3MLWH 5TFSL 2J7LA 1LHZA 2LABA 5GGVL 5L7XL 2X41A 4HWEH 1IBGH 3A6CL 3L5JA 5ALBL 3ZDZF 1UVQB 1J0IA 3KWWA 5FO8B 1U8JA 1KSRA 2M26A 3MLYL 4NT6A 1H3UA 2W9EL 3S88H 4TUKL 4Y19D 2NLJB 4K7PX 4YAQB 4JPKH 3OJDA 4M7LT 1S7VA 4HKJB 5CKGA 1I7UA 1DVFC 3KYAA 5IF0B 5C08B 4TQEH 1UJ3C 3GSQA 2LAAA 2AEQL 3PHOA 2RHEA 1P6AB 2EO9A 4ZOEA 3FHQA 2CMRL 4DQOL 2OCFD 1P9MA 1CK0L 4YC2B 5IKCB 2NZ9C 3ULUF 4ZFOL 2BNRD 2P8PB 4JDVA 4P0DA 2NXYD 5JDSA 3T0ED 2W0PA 3WFDH 3V9FA 2DKSA 1NH6A 3UP1A 4XP6H 4J3SA 1WIOA 3VXRD 1ZS8B 4I2XB 5EOCJ 4XC1H 4F15B 2E9IA 3BH8B 2A38A 1KIRB 4KKBD 3EDDA 1BF2A 4K8RC 4HKXA 3NH7H 2AEWA 4NZDA 1GCFA 3CDFA 2J8UA 4G43B 2GK2A 5DJ6A 3RKDC 1R0AH 2XYCA 2X4NA 2VTFA 4Q9QH 2BNRB 5T3ZE 3PGDA 4X6BA 4J23A 4KPHL 3VJ6A 4X5WB 5J12B 3SQBA 1JGUL 3ULVC 3QAZB 4PJIB 5DHVB 3H9SE 1BOGA 4KK6C 4LPXA 4U1JB 1AC0A 3VXRB 5J6GA 4PJIF 2BC4B 2GHWB 1D5IH 2VISB 5K9KB 2ZUVA 2DIAA 1UA6H 3B3IB 4DGIL 2MOVA 5E2JA 1B0GB 1IKFH 4PRID 2UZIL 2EYTB 3ESUF 1V3LA 4BZ1L 2DWEB 2VDKL 1QLRA 3W11D 3ZSSA 4XVUC 2PO6A 3IFLH 2HRLA 2C3VA 4ZNEA 3KPSD 2HJKA 3CVHA 4DCQB 2XA3A 2D7QA 4RGMB 3RDTB 4R90H 5FDYA 1T1ZB 3BIKA 4OB5H 4ONHA 3MV11 3HI5H 4K3EH 1FIEA 1HIMH 3S8WA 2WUCL 1AXTH 1PKQE 3HG1D 3S5LB 4PRIB 1MFAH 4NUJA 2H32H 1SVCP 2WMPA 4GAJH 3RVTD 4MCZA 3I6GB 4HLJA 3MJ9L 5DRNA 4RFNC 4FOMA 2GSGA 1OSPL 3RHWK 4MJ6B 4H5SA 1S5IH 4UT9L 3NZ8A 3V6FA 1F4WH 3KPSB 3QXAA 4U1SB 4IRJC 4YHPB 1G9NL 5F3HA 1DQDL 1A7OL 1UKQA 5HHQA 4JZOB 4LLAA 1JNNH 1WWWX 3IDGA 1MCNA 1DBAH 3HG1B 5IFHL 3REWB 2IALA 5GISH 3TZVD 1WZMA 3RVUD 3NFPA 4E0RB 1OCWH 4RSVA 5C1MB 3DIFB 1KCVL 1FORH 1WFNA 3MSPA 1FFOA 2X4TB 3QRGL 1KEMH 4PP2A 1ZVSA 5DUBA 3BRFA 4BUHA 5CSGA 1OP5K 1BIHA 2CKBH 3OPZH 4Z7QE 3KS0J 4NOBA 4QXGH 1F6FB 4O9HL 3HAEG 1WSST 4HUKB 4Y2DA 4HUXA 3QEUB 3RWCB 1E4XH 3KHOA 5EZOL 3TZVB 3IJHB 3AVEA 1MCQA 1SBBA 2R1XB 3SHSA 5C09A 4OZHB 43CAB 5ID1A 3LQAL 3WFCL 5CCKH 4LNVA 1XGPA 1IFHH 4OZHF 3ALWA 5CFHA 3QO1B 4X5LA 3RKPA 5I1EH 2VABB 1KULA 1QQDA 5DDHA 2RAMA 4PJ9A 1XF5A 3WBDA 5JMRA 4PRAB 2A77L 1ZHKB 2A2QT 3DO7B 3V0VA 2Y36H 3RNQA 5J0BA 1YEDA 3TVMD 2DKUA 2F8VA 4I0PA 3O6FA 5AUMB 1EEZB 3EYFA 2C5DC 2VUYA 4PRPA 2ZOLB 1QRNA 5AWNH 3MUJA 4BKLB 3FN3A 4PYHA 5CHNA 5HHPA 3QISA 3IFOA 4WJ5B 3VWJD 3MUZ1 3TO4D 3CSYB 1DR9A 1FL5B 3WO4B 3EYOB 3SCMD 4JN1L 1S9VB 5FDWA 1JV5B 3PDDA 4K3JL 4TRPH 4WUKH 3ABZA 5FKPA 5B38A 3TVMB 4H20H 1AIFA 1ODAA 4ZAKD 2Z31C 1WLHA 3RUGA 4G80B 4NRXB 3VWJB 2R2BA 4EUPA 4M61B 3TO4B 2ZG1A 5C0IA 5ID0A 4P2QE 4LLMA 4LKXB 4PJ5D 5TF0A 3RHWF 4X9BA 1G7QB 3SCMB 1P1ZB 1AR1C 3P30L 2F58L 4QO1A 3WKNA 5H37H 5HHNB 3HRZA 1OF2A 4WFHD 4C4KT 3BP5A 3QIUB 1GC1C 2PYEA 3NTCH 4HWBL 5I1JH 4ZAKB 1PZ5A 1FVDA 2XICA 3C5SB 4MDIA 2MQCA 1NCAH 1CGUA 3JWOL 1P2CB 3QJHB 4URTB 5DQDL 5E4EB 4FTVA 2IWGA 4LSQL 1MCKA 2VXTH 2D9CA 3L5XH 4XPFL 4PJ5B 4NDMA 4RGOH 2VL4A 4JCMA 2GCYB 2W9LA 5IVXA 3GHEH 4KJPD 4GMTL 1FRGH 1YQVL 4R7NB 1A6ZA 5FB8A 1IL1A 1FNAA 4Q0XL 4R7DA 1NUDA 4M1GL 3ARYA 2RCSH 2F5AL 4BFBD 4ETYA 2AAVA 3GDBA 1PGRB 4XBGA 4KZEL 2R2HA 2X4QB 4OV6F 1IAIM 2F54E 4KUCD 2BVQA 4DVRL 5E24E 3KXFD 3L1OL 5SWQB 1MFDL 3FQXB 3K46A 4JFFA 1SYSB 1G6VK 3BP4B 1T7ZA 3S36X 5JIPA 4F7EA 2X9WA 1UCBL 3I6LE 4YDKL 2DJSA 3CFCL 1D6VL 4PJ8A 3SGKC 3WJJC 1ZLUK 4AEEA 5BVJB 3KDMB 1SBSL 2FD6L 4NN6C 4NO0D 4WWKA 2FGWH 1C12A 3GRWL 2FL5B 2W59A 4JFYA 2APXA 1YECL 1KPRA 4K7PY 4JFQB 3BGFC 5D71H 3U46A 5BV7L 3AXLB 1P4IH 4TSAL 1FBIH 3CU7A 2XRAL 4PTTB 1XF2B 5HHME 3E6FA 1WFOA 4TVPE 2RBLA 2QQLL 4GQPH 2LE9A 1IAKB 1WBZB 4LPTA 2AK4E 3AB0B 1DVFD 3BPCA 3IFPB 4BQ8A 2R1YB 2YN3A 1U3JA 4FXLA 3VFRB 5CEZE 5C92A 1FSKC 4I48B 4NO0B 1EGJA 4NNPL 1CDJA 3ZT5A 2KQMA 2APVA 2NZ9D 4QRTB 3SO5A 1TTGA 1PD6A 3TF7C 3V7AG 1G7PA 5CZVL 1KF9B 3O3BA 5D2LE 2XACC 1A6VL 3GGWB 2IADA 4JY5L 3Q48A 3RI5K 4I0CC 2F5BL 3U9UB 2NY3C 3WXWL 1JZ5A 1DVFB 2DQEH 1AQKL 2YRLA 4I3RH 4K8RD 4L3ED 5KANI 1MELA 1UJ3B 5DWUH 3CX2A 4JRYE 3S35H 4KKCC 3D87B 1HQ4A 3MCLL 2CD0A 2PTTA 5D8JL 2Q7NA 5I8CB 2P5EE 4HS3B 3H9HB 3QWQB 4X80H 3FFCD 4U3XA 5K9OB 1SJHB 4ZTOL 3MNZB 1YEEL 2VXVL 3ULVD 2GAZB 1F90H 4KK6D 1RK1A 1QKZL 2GSIB 2AABH 1CLYL 3UTSD 3RU8H 2IQAB 1RQ5A 1UB6A 5T3XL 1QZ1A 4WHTB 4X6CB 3ZDZE 2AJ3A 3CZFB 2VKWA 5E4IA 1UH4A 4X6CF 5DD1H 4LRNL 4GQ9L 2EH7L 2F19H 5DXWA 1CLZH 5F7DA 4PJFE 3FFCB 1HYSC 1OGAD 2YK1L 1HXMB 4XVUD 1WV7T 1RK0A 4G42A 4DN4L 2OR9H 3IJYB 3BFOA 4G8EB 3UTSB 4HFWA 1K8IA 1UM4H 4PIRF 1MJUL 2ZOKA 5JLZA 4QHNB 4FMKA 3RP1A 3VRIB 5T33H 3ULUE 4FFZH 3QNYB 3RVWC 1KJ2H 3VU2A 1IGJA 5ESAA 1BBDH 1OGAB 3LH2L 1JYXA 4H8WH 4TYUA 4EEEA 5TDOA 2W0LA 4IRJD 2GUOB 2D9QB 5DQ9B 3VRLF 4CN6A 2ITCA 4BK4A 4ELME 3O6KH 3BKCH 5C0JB 3F7QA 1OARH 3EGSA 2P44B 4H1LA 2YUXA 1OTTC 1HHGA 4ZQKA 4AENB 4PTUA 1NFKA 4Q9RH 3NCJL 1JRHI 4N68A 5IMOA 2W65B 2BNRE 4RFNB 5FYJH 3OAZH 1TZHA 5J56B 1PQZB 2A74B 3GJFH 5GS0L 5TJWK 1JN6A 4AM0A 4YHOH 4IRJB 1MQKL 2UWEB 3FOMA 1EHXA 1X5YA 2H6PA 4LNRB 1J1OH 2UWEF 3RI5F 3BDYL 1FC1A 2UY7A 1IGFH 1AGFA 4XHJD 4Q6YA 3SGDI 4KHXH 2ZSWB 4MAUL 4Z7NE 5IIEA 2CJUL 3BZFA 1GZPA 3ROOB 3BD3A 1S7WA 5DK3A 5GS1C 1HHHB 4X7SL 2AXHA 1RZFL 1ZANL 4H0GA 1G7LA 4LSDA 4E41D 1CU4H 2NX5A 3BWAB 4XRCB 4XMKL 2HWZH 4ODSH 5DMGC 2CDGA 2X4RA 4GXVL 4ODHH 4V1DD 3BPNC 1M7IA 3OR7A 3ZKXC 4OCRL 2OTUB 3CVHL 1EK3A 1HI6B 1NCDH 3C6LC 3TBYA 4J6RL 2E7MA 4Z0XB 4UI2A 5CINH 2W0KA 2XQBH 4PYGA 2JELH 2ARJA 5IJVA 3PL6C 4GAGL 2Y1VA 3C2AL 3F12B 4RX4D 4E41B 3UO1H 2HFGH 1I9JH 3IXAB 4N1CA 4HUUB 3MA9L 3MA7B 4QEGA 1C7TA 2CLZA 2QKIA 1T22A 1YA5A 1F2XK 4HIXH 3BIAX 3HG1E 1QSFA 4NJAH 1IEAB 2CK0L 3W0WD 2R0ZL 1E4JA 2Z31D 1FZOA 1NMCC 5E03A 3J8F7 4IRZH 4MLSA 4BZ2H 1OPGL 3GIZL 1MFBH 2Z4QB 1IARB 1NSNL 4TSCL 4XNYL 4G7VH 3NMEA 1A6WH 4WI7A 5F3BA 5JOEA 1DBJL 1R5WA 3LS5H 4MAYC 3GSOB 3VG0L 4WHCA 1ETZB 1MCIA 2DD8L 2AEIT 3F7YA 3QI9D 4XPGH 7FABL 1U93B 1NFIA 2DQCL 1QFWM 3ARWA 5DMJB 3W0WB 1ROWA 3LRGA 1IJ9A 4UV7L 2Z31B 3HUJB 5K9JH 3GM8A 4X98B 4XCEA 1OWRM 4PGBA 4OZHE 1YEIH 3HUJF 4DTGH 2EKSA 1VGKB 1KB9K 2BHUA 4PS4L 5FK9A 2JKXA 2Q86B 3GMRA 4M8QA 3ZO0A 4UT6L 2J88H 3A67H 4OKVA 3PDGA 1XCQA 1XF4B 3GJEB 4LCCB 1QPXA 3UBXA 3QI9B 3DV4B 3QWRD 4S0TD 2H26B 1A6UH 3TPUB 4K7PL 4N8CH 4NO2A 3GMNA 3LKRA 2X1PA 4L29A 4X6DB 1IT9H 2Q3ZA 2QQKL 4PB9H 5CMAB 2IJ0C 4UBDC 4X6DF 3P0YH 2D2OA 1QP1A 4ZO9A 5I30H 1ULVA 3WFZA 1NLBH 4HXBL 1QACA 1JPSL 3C9NB 3OKKB 1AGCA 1U41A 4U6YA 1C1EH 1LK2A 4FNLH 2AKRA 1LO4L 1DLFH 1FGNL 5D7LD 1BP3B 1MRFL 3CPLA 4L8SB 5C0AD 3X3GH 3FRUB 3KYKL 3PGFH 3BMVA 1FVCB 2AJYL 2VWEE 3HAEB 1FPTL 3QQ3B 2VXQH 2Y06L 4X0KB 5FOJA 2OQJA 3MV8E 4J4PA 1D5ZA 4G6JL 2V5MA 3S4SG 4ZSOA 1AY1H 2HLAB 1J8HE 4RISL 3T2NL 2B8OT 3P73B 2A9ML 2BXZA 2XIDA 1A7NH 1EDQA 4QTIL 3O2DA 1E4KA 1IAOB 2GTZA 3QUXD 1O7SA 4NN6B 4HJJH 4MQ7B 3GSRA 3BGFB 3W2DL 3AGVA 4JKPH 5F88B 5DJ8B 5IM7A 3WUWA 5JXAH 3L5HA 5IG7A 3MRCA 5MENA 5D7KD 1QLEH 5JTWA 3PHSA 4UOJA 1A6AA 1RVFL 2B2XL 2AK4A 3BW9B 4BQ6A 2A83B 3P77A 5BZWB 1BWMA 3CSBA 3WLBB 3QHFH 2EH8L 3D2UD 4PJ5E 4KJYA 3WFBH 3O6LH 4YXLH 2NY3D 3W5MA 4JHBA 4IMLB 3QUXB 2E6PA 4JKKA 4FN0A 1NGPL 1DL7H 4HH9A 4WFHE 4KKCD 2Z91A 3FB6B 4KH2A 5BOPA 2BJML 1P69B 3WUZA 4N5ED 1FCGA 3D6GA 5GQBA 2AJSL 3MRBB 1DQLH 1HEZB 4KJWC 4XT1C 3ZTJH 1KBGH 1CWVA 5HDQH 2ORBL 2ZCHL 3D2UB 3R0MA 1S9YB 1FZKB 4JGJA 2NY3B 1U8NB 3VFUA 4TNWK 1WFUA 3ARBC 4MDJA 2P5EA 1QO3A 1A3LH 1K2DB 2ZCKH 5E5MB 4R0LB 4HK3N 1CI5A 4Z7OF 4UIMA 2X1OA 3ILQC 3VXMA 4L9LB 1S3KH 4YFDB 5JW3L 1HYSD 2UV3A 4LCUA 4R8WL 1NMBH 1KPUB 4G9FD 4P3WA 4ERSL 3VI4F 5EU3B 2VH5H 2VR4A 4FQLL 4M43L 2YRPA 1L6XA 5FO8A 5FXCH 1JZ6A 1ZV5A 4PJFA 5AD0A 5AZEL 2XFXA 1MAKA 1UH3A 5EU6D 4O2FB 1DFBL 3MV7B 3RVWD 2GKIA 1MCLA 1YNKH 5MI0C 4TUJB 3S3PA 4JVWA 1EGJL 4HIEA 1PBYA 1F4HA 4AQ1B 2YEZB 3FB5A 3QCUL 1T7VA 3P9MA 4G9FB 3LCYA 2R1WB 4P59L 1M6OB 1I1AC 1CIUA 1MCBA 1A9EA 3QDJD 5IKCA 3QQ4A 1H0DA 2FGZA 5DK0B 4HGWB 3WEXA 1FNFA 1H8NA 1F5WA 5EU6B 5GPRA 3PDOB 3OG4B 3NABH 3V6OC 4JDZA 1Q72H 2PW2A 4NHCH 5EIQA 1KIPB 1A3QA 1RFDH 4ELMA 2EDYA 2R29L 4D0DB 3GMLA 2VO5A 2APBA 3EO0B 3QXWA 1FNEA 3H42H 1LVEA 1RUQL 3QDHA 3QDJB 5EB9A 2ZG3A 1KB5H 1NBYB 1FCCA 1N3NB 4U6TA 1HZHH 4R4FH 2DMCA 5H35B 4IDJH 5F89B 3U79A 2GJ6D 4X6CE 3VMPA 2F74B 1WC7A 4Z0BL 3GBMH 3GSUA 3EYVB 5T3ZL 4UU9B 3D85A 4BJLA 4OF8A 1SJVA 3OKMB 3W9DB 3DUSB 4YWGL 1PYWA 4NWTL 2BVUA 4JFZL 1VPOH 4OLWH 4XGZA 5DMGD 3B2VL 1NUGA 4M7ZC 4NNYB 5IB1A 4ZDHA 3UTSE 2CDFB 1CFNA 4RRPG 3MBEC 4LCIL 2BFVL 3PP4H 4TNWF 2GJ6B 1I3GH 4UQ2B 4OIBA 4RMUA 5F7LB 1DQQB 1X5HA 1IZJA 3PL6D 3PWNB 5ICYB 2RQ8A 2NY6D 5GS1B 1RULH 1JGLH 3MLTB 1OGAE 4FZEH 3MJ8A 3QEQA 3C5ZC 2E9BA 3VRLE 2FHBA 4YGAB 4OCWH 2YA2A 3K7UA 3S5LA 5K9QI 1OB1A 3WHE1 5KG9B 3BPNB 4NBYB 5CJQL 5FUOL 3L7EB 2B1AL 3JV6B 1YZZA 3X3FL 2EE3A 3QEHA 1KB9J 5DJXA 2EDWA 5LGJA 1IEBA 1NBZB 2AXFB 3PL6B 4KV5E 4QT5A 2NY6B 3JZ7A 1M71A 3O2VH 5I0DA 5I8EA 2GFBB 4MD0A 4MAYD 3QG6A 5IVZA 2JE8A 3IETB 4CDGC 3QXDB 2N56A 2X40A 2WUBL 3BZDA 2UWEE 1ZT1A 5BZDB 1DQJA 5GGUA 1LE5B 1T0NA 3S36L 5E6IA 1LDPL 3IDMB 5D6DA 4A6YL 3MLVH 5IB2B 4WI9A 3W39A 4FQJL 4BZYA 3AM8A 3QULA 5DMIL 4G3YH 1NMCB 2EE9A 4H26B 2YSSB 2G9HA 3FONB 5IV2B 5IFJA 1X44A 3BKMH 5BO1L 1KLUA 4XNZC 4BSJA 4NKMB 4OD2B 3HC3L 4MAYB 4NN5B 2CIKB 2DS4A 1AP2B 2H32A 1DLHB 4OUUB 1W0VB 1KN2H 1MCWM 2WBJA 3FJTA 1SMAA 4J3TA 5FECB 1RIHH 1YC8A 3SY0A 4KTEH 5DRXA 1J0ZA 3GHBH 2PYFB 3T2QA 1QSVA 5ACMA 4TTDC 5IW6B 4G8GD 2MPAL 1INEH 1FNGA 3UDWA 1J1PH 2W38A 3QO1A 5EOQH 1VGEL 5EWIL 5JW4R 3LPWA 3Q0HA 3S98A 4LSPH 3PP3H 4HJ0D 2C9AA 1MJ8H 1KN4H 3G6AB 5DK2A 3MUGA 5DRZA 1MWAH 2C3GA 1A64A 1FL3B 4E41E 2BVEA 1CGTA 4XVJL 2FDBP 1CVRA 4RWYL 3R1GH 4RZCA 2R4RH 4UV4H 1KT2A 5IBTH 3GSWA 5TE6L 2QSCL 3ZHKA 2JJTA 1I1YB 1NKRA 3TH3T 1SM3H 2XZQH 5IUSA 5AG8A 4MHHI 1M05B 5DVKA 1I7RB 3LHPL 3HNSL 3B9KA 1L7TL 2CKBA 3CSYA 4G8GB 4LQFH 5DC4B 1KELL 2O93L 1CFVH 3L5WB 4WI5A 5IHZB 3TN0C 1INDL 5C0GB 2A6KA 1M7XA 1QFUL 5CGMA 2VLJE 3UTPD 3FN0L 2N1KA 3LKNA 2ZUYA 1AGBA 4P23C 1HHJB 1BFSA 4FQ1H 4XBPB 1C08B 1YC7A 3MV8A 1CD8A 5T1LB 5C0FB 3UJIL 1JZ4A 3HE7C 1TQBC 3IDUA 2ATPA 1LMKA 1J8HA 3T09A 3DGGB 3HI6H 3C08H 2MKWA 4TUOB 1SYVB 3W0WE 1IM9A 1ORSA 3RTQC 1JGDB 5GGSB 1WTLA 4X6EB 2HH0L 1CXKA 2PXYA 4YNYA 2ZUUA 1RIUH 1G7HA 1MHEB 4Z9KB 1U91B 4LHUD 5JHDD 3LPGA 4KQ3H 4EQ2A 3S35X 3RPKA 1HE7A 4HGMA 3FZUC 1YPZB 3QIUA 3NBNA 2YD7A 1HDMB 5IROC 3SPVB 1BD2D 3G5VB 5ADOH 1YPZF 2WSKA 1FQ9C 4P3CL 4EDXA 3FKUS 4XBEH 1EO8L 3IDNA 4M4PA 4W81A 5J06A 3F5WB 5I75B 4X6DE 5HHVH 2D4DA 2BK8A 1DN0B 1G9EA 1PVHA 1XCTB 3MOAL 5EZIL 1JHLL 4LHUB 4PJGF 15C8H 1NJ9B 5JHDB 1RMFL 4JO3H 2BSED 1DN2A 4XXCC 1GPOL 2FIKB 4XCNB 4WDIA 1FVEB 5C0RL 4XPHL 1KIQA 2L7JA 3QO0A 5GRVL 1BD2B 3Q6FA 3BGMB 4FZ8L 2X4QA 2CQVA 5EOCL 4DGYH 4U1GC 3TBVB 4HUWB 5SWQA 3FQXA 3GI8L 1KEGL 2JB6A 3LN4B 5L8KB 5IHLB 4YHML 3K4AA 5L2KD 1CT8B 1NDGA 1JNLH 3U0PA 1HNGA 4L4JA 1A6TA 4O2EA 4X9HA 4YX2H 2W9DL 2I27N 4AQOA 3KDMA 3KNBB 4NGHL 2XNAB 1WCBA 2QR0A 3OXSB 2IMMA 4JFQA 4ODXB 1LEIB 3CDGB 1S78C 3QHZH 2HJFB 4KY1L 2DQHH 1GIGL 5D1QC 4QLRA 1T1WB 1S9XB 3RY6C 4QHMA 1YUHB 4YFEA 4XNQA 2VXSL 5L2KB 1MCPL 5E08L 3LD8C 4XPTH 4IRSC 1J0HA 2AV1A 1YJDH 1XZ0A 4Y5XA 5TDPA 1EMTL 3ZE0F 2GJZA 4TVPL 1MCWW 4U1MB 3KYNA 3AY4A 2BY2A 5E2TH 3HPLB 4JN2A 3NGBC 3MUY1 4YPJA 2NYYC 3WD5L 4MA1C 3KR3L 3AFLA 4JB9L 5CEZL 1UCTA 2J4WL 4JHAH 1OGTB 5HI3C 1J0KA 3F58H 4JFPB 2V2TA 4OGZA 4F7PA 2R39A 3JSSA 4RFOH 5DJDA 5IB3B 3PQYA 2NW2B 2E3VA 4OI9A 3HZYA 4N9GA 1N8ZB 1CXHA 5MI0B 2B4CL 5EH1A 3FL7A 4W68A 1X3DA 1YEGL 3S4SB 3ALPA 4P46C 1NCUA 3DI2B 4YR6A 2XXCB 3GSNB 5IHUL 4RMTA 5ANMA 2EDLA 2EIDA 3DX7A 3ARGA 3L3GB 3WL9A 2R4SH 1U6AL 2Z0BA 4JHZA 5ESQA 2QHRH 3EYUH 4M7JL 4FS0A 4XCCL 5KVFL 2FJFA 2VLKD 5T1MB 2R0LL 1I8LC 3RL1A 1Q9LB 5D2NC 4Z7OE 2FBJH 2AP2A 4C54A 2HVKB 5DTFB 4AEHL 4RFEB 4QRUA 5DJ0B 3UC0H 5DUPL 1LEKB 5LBSH 5INDB 2EXWC 5F1OB 3VI4E 3QA3A 1I4FA 1AD0A 3BXNA 1ZAGA 1EJOL 2WNGA 4F58H 2XZCH 3LRHA 2O5XL 4P57B 5L6YL 3MNWB 3MBED 1HHKA 1BEYL 4S1RL 3MZTA 1IGCH 1RJYB 3QPXL 2X2YA 1T3FA 4N9OB 4K7FA 4GS7C 4PJXB 3UYPA 1GOHA 2RGSA 1RZ7L 4GKOA 3NCBB 3MV7E 1OHQA 4OGXL 3MREB 3DHJA 3T77A 2OJEB 3TBSB 3RWGA 3LQAC 3SKJL 4F2MB 3C6SA 2DQIL 1I8KA 2P42B 3GMMB 3D25B 4RGNC 5FA4B 4ZODA 1QBBA 4KHTH 1L0YA 2I9LA 4K55A 1MI5A 1QR1B 4XX1G 1IGMH 5IT2H 4M7ZB 3VRIA 5DSCB 5I1LB 1FIGH 1EPFA 3MBEB 1WBXA 4U1HA 4O2CB 2R0KL 4Z7VB 5DD0H 2ZG2A 3SGDH 3CFKB 5HJ3A 5C0BD 5CUSH 2G75B 4Z7VF 5DD5H 5CILL 4RMQA 6FABH 3ULUL 1L9MA 5LGHH 1N5YH 3MRFB 1MAML 2I25N 1CXIA 4PR5A 3DRQA 4MJ5A 4N1EA 4Y16A 4L5FH 3V5KB 3SDYL 4YE4L 4CVUA 3FTGA 4I1NB 4LKCA 3RIAK 1U8QA 5J1SC 3V6ZB 4D94A 4U6VH 5TQ0H 1C5DA 3B43A 4HWEL 3MJ7B 3OKEA 5C0BB 1DCLA 2AS5M 1IAII 4XH2A 3NPZB 5ILTL 4LAQH 1PY9A 4XNXL 3WS3B 2VZUA 4C83B 2O26U 4JQIH 5KSAA 1OAQH 5E95B 5C6TH 1WIUA 1OAKL 1JIBA 3KJ6L 4JZJA 2VDMH 3BEWB 4HCRL 1AJ7L 32C2B 4JM2C 2VDLL 3WSQH 4MB5A 4UILL 3W81A 1HCVA 1KJ2A 3ROOA 1FLRH 1T1YB 1JZ3A 1YEHL 1ZA3B 4G5ZL 4JPIB 2W60B 4TTDD 2GJ6E 4K94H 1B2WH 5DMKB 5HHXH 4RBPK 3D3VA 2AEPL 3GI9L 1L0QA 1WWCA 1VEMA 1MHCB 5E8OA 3HMWL 1ZSDB 4XNZB 5TE7H 1QSED 4KAQH 4X7TB 2BDNH 3PIQA 4XC1L 5C2BH 4JO2H 4XI5D 4JG1H 5E8DH 2VQ1B 4Z0XA 4QOKE 3RZCC 2ATKA 2DLEA 3NH7L 5KVEH 4W70A 4YXKL 5HYQA 3MRHA 1N0LA 4Q58C 5EU7C 3GJFA 3NCYP 3F12A 1MF2L 4Q9QL 4LF3A 5C3TA 3TN0D 2AJUH 4B7IA 3RPIB 4WEBL 3I02A 4XPBL 3WN5B 5GRXG 5EUOF 5I1GL 2CH8A 1QSEB 3BJLA 2NY1C 3EO9L 5KVGH 2VIRB 3MZGB 1FAKT 4P23D 5CWSA 1EFXD 2EC9T 1B9ZA 1Z9MA 3HE7D 4M7LH 5KW9H 3RL2A 3UTTA 5TDNA 3MOBL 2DQFA 2VLJA 3B8SA 5BV7C 3ILPA 5BRZD 4GAFB 2OTPA 4XC3L 1WTGT 4WFGD 3RTQD 2UYLA 3TN0B 2IH1A 3V79C 2A1WL 2JB5L 1NMAH 2EIZA 3QIWC 4AIOA 3L95A 3ARSA 1GOFA 1P5VA 4O58L 4OB5L 4GT7A 4WU5B 2I60H 3FZUD 2R9HC 3GMPA 3HLAB 4M5ZL 4P23B 5IW3A 4K3HA 1LP9B 4OBRA 1EFXB 3EJJX 5GGQH 3O41B 3HE7B 1YY8B 1LP9F 1TQBB 1MFAL 3JWNC 3I84A 3RIAF 5IMKA 4H88L 2H8PB 3DV6B 1V5JA 4GAJL 4HHAA 2UZXB 4KDTC 4WFFD 3UYRH 5BRZB 3CXDL 3STLA 1JF5A 1HHIB 4LSVH 5C9JB 3RTQB 4OF7A 5DHYA 3KPNB 2OJZL 5F1KC 3D0VB 4KDWA 1TETH 1MQ8A 1VFAA 3JXAA 2BSRA 3M8OH 4KVNL 5ERWA 1JNNL 1ED3B 2VLMD 4DKDC 4JKMA 2AI0H 4DZBB 1CBVL 3KLDA 2BRRH 5GISL 1D9KC 3S96B 4C4KO 1ZWIA 2XV6B 3KPTA 4WW1B 3LAFA 1MEXL 4AL8H 1NGZB 1FORL 3HA0A 5GJTH 1NCCH 5EZLB 3VXTB 1SVZA 3OJ2C 3OPZL 5B3JE 1WQVT 2E7BA 4M48H 4RNRB 4U6XB 1FVCA 5HVWA 2IPKA 3HAEA 4NM8H 5CZKA 5DJZA 1KCSL 4Y0GA 1YEKH 2UZYB 4G6FD 4JGMA 2NR6C 1YDPA 1G7IB 2Z92B 1S78D 4UIKH 4M5YL 5D1QD 1HH9A 4LSRH 5EOTA 3V6BR 2OXGA 2Y07H 4NWUH 4GRWB 3LEXA 3O3DB 2V5RA 3DPBA 2CLRB 4GRWF 1AD9A 4JJ5A 1IFHL 1V05A 4IRSD 4WU7B 4U1NA 2V5TA 3RWEA 4QHKI 5I1EL 3F7RA 3DBXA 3OX8B 4WTZG 3UTPE 4DW2H 2XZAH 2N7BA 3NZHH 1G6RH 3FQTA 2Y36L 4G6FB 5F88A 3BZ4A 1U3HB 5D1QB 3FO1B 5HI3D 1KCRH 1XR8B 1K5NB 4LPWA 1XGYL 2LFGA 3QWOA 2MCPL 4M93C 2IFGA 4BUGA 4UDUA 1K3IA 2EKJA 4P5KA 3SE4A 3WLBA 1ADQL 3LD8B 4AMKL 5IJKC 4IRSB 4FFYH 2EE6A 4PJGE 4F7MB 4CL7A 1GZQA 4P46D 4OLUL 5DJYA 1JI2A 2Q6WB 3FQUA 1P9MC 4X4XA 5JHDE 4KI5C 1ZHBA 1JPTH 3NGBB 3PABB 3OTTA 5FA3A 4IDLA 4TRPL 1T4KB 5ESVA 4OCYH 4MNQD 1N7ML 4LLUA 2CSPA 3PWUB 5JZ7C 3HZMA 4EOWH 3IU3A 1F8TH 4YDLC 5AZ2L 1FZJA 2VR9A 5F8RC 4JDTL 4KKNA 4NFDA 3KLHC 3DVNB 4QRSB 5CGYC 4D0CB 5DJCB 5F9OH 3TO2B 4P46B 4WCYL 4PV8B 3V4UH 1T6VN 4LVHC 3SDDA 3F8UB 5ETUB 1X5IA 1J05B 3K2UH 5DUMH 4R0LA 1KLGB 4MNQB 5B21A 3VW3H 4HWZB 4M3JA 2YBRB 4WEMB 1B90A 1CE1H 1S8DA 4ZG1A 3PWPE 4NQSB 3TWCL 3NTCL 3T08A 2DICA 5D2NB 1FNSH 1NCAL 3LIZH 5J9PA 2E7LA 3HE6B 5L2KE 2DTSA 4KQ4H 3FO0H 2ZPKH 1TZGL 2VJXA 2YPKA 3L5XL 2AK1H 1I85C 4AEFA 5HVGB 4OAWB 4R26H 4BFIA 1OQXA 3FQRB 1T5WB 5C7XL 2DMBA 4M6OL 1FRGL 1A7PH 1T66C 3BE1H 3MV7A 1RU9L 2PO6C 1QFWI 2AJXH 3QCTL 4GKNA 2VQTA 2PN5A 4GS7B 5B38G 3MLRH 4Y8DC 3QUMA 4OQTA 1NAKH 2BMKB 3MLPA 1UQSA 1B0WA 2AXGA 3V4PL 3HC0A 1A4JB 1WIPA 2OZ4H 4EUPG 1NGQL 4K23H 1KCUL 2HMID 2CRYA 1NC4A 3FAXA 3MRLB 1P4LB 3MRMB 4ZPTB 3E0GA 3QH3B 1SJEB 5FGBA 1EHAA 5IQ9B 1HWHB 4XP4L 1DEDA 1ORQB 1CTNA 3Q1SL 1KGCD 1NBVH 3JTTA 1D5MA 2DBJA 1NBQA 3QDGD 4X8JA 4LBEA 3K2MC 5HGAB 4AG4H 1DP0A 2EIEA 1BIIA 3CC5B 3SE9L 2FZ3B 2P5WE 4HDIB 5MEQA 5EO9B 3BT2H 4AT6A 3MRKA 4NPYA 1DBBH 4PUBH 5JOFB 5LXGH 2VLRA 4HKBB 4JM2D 4M6ML 1QLFB 1MRDH 2VYRE 4K8RL 5L2JB 5FHAH 3R8BB 2BVTA 3MRIA 3I6KA 3GO1H 2XKUA 2Q20A 1S5HB 2P49B 3U1SL 4Y2DC 4I18A 3QFJA 4OIIL 4MZ2A 2E27H 5D9SA 3QDGB 4OF3A 1FE8L 3KPOA 5E8NA 5CIPB 1IM3A 4JO1L 3E2HC 1R3JA 1F4XL 2ZUTA 3IU4L 1N6QH 1BREA 2VRAA 2R8SL 1BQLL 2A6DB 2FB4L 4JM2B 1MUJB 1ITBB 3PNWA 4NZUH 5DWUL 2JLLA 4XAKE 5C07E 4EI5B 3S35L 1W8OA 4X5XB 1Q1JH 4Z7VE 3DTXA 3BOVA 3HFML 2K9UA 5DVMA 4OZGE 1AE6L 4S10A 2BERA 3HZKA 3ARPA 3EOTH 1WWBX 3OKOB 5BS0D 5I18L 2EDTA 5TPWL 1U58B 2H9GB 1DUYB 5E5UB 3G6JE 2Y5EA 4I0PC 4QOKA 1KB5A 2DQGH 3O6FC 1HSBA 3NCYS 4C56B 1F90L 2OP4L 3JV4B 2QADC 1U8IB 2NY1D 3ALXA 3VGGA 2HFFA 2AABL 5FM5M 3RU8L 4OI7A 1E6OL 4WY7L 3R06A 3DHMA 4MA7H 2EYRA 4P2OA 1R5IA 3C8HA 4CVWA 2FWOB 2E9JA 3SE3A 3DX8A 5I76A 2DYPD 3P11H 3UTZA 4Q6IA 3T2PA 5EC2B 5C0BE 4HT1L 4D0BB 3WIFA 2LQRA 2PW1A 1JK8A 2KL6A 4BH8B 3QIWD 5BZDA 2VDPH 1CFQA 2NY1B 4Y5VC 1U8OB 2XKNB 3CGTA 4TSBL 3I75B 2R9HD 5DLMH 1A3RL 4FQQA 4NNXA 4ZPVA 3RGHA 3P4MA 4M03A 4LEXH 5IV2A 5F7FA 1W0WA 5LAXA 4QY8A 2DYPB 4NM4L 4XAWL 3WNOA 5LWYL 2XTJE 5BVPH 5BV7B 1FV1B 5JQHC 5KVDL 3KPRD 1IGYB 1KJ2L 3TGXA 5F93C 5JQ6L 3L6FB 3OQ3B 1BBDL 3O45B 1RZKH 3WCYA 3ZTNH 1S7UA 3OZ9L 3OMZA 3QIWB 2AW2A 5CLWA 1AXSA 5I1AA 4U1LA 4F3FA 3MO1A 3SDCD 3QB7C 3HI1B 4PRDA 3CFBB 3O6KL 4L8CA 4DOHE 1OARL 1LNUA 4POYA 1FO0H 3UXFA 1Q9WA 3HN3A 2ZJSH 1GAFL 3GIVB 3IF1A 3KPRB 2FRGP 5DFTA 3FFDA 1XGUA 5F1IB 1RJZA 1YNLH 1Q8MA 4ZD3H 5EUOE 3VRJA 1UZ8A 4ZUTA 1K8DB 1CICA 1CXFA 1QSEE 3SDCB 1L7IH 3OKYA 2BSTA 4L3CA 5CP7A 5DJ2B 2A6JA 4HZLB 3SOBH 2NR6D 1G0DA 5CSZB 4HMEA 4NBZB 4F7TA 3TV3L 5FCSH 5IHZA 5GZOC 1BZ9B 1XGTB 5T3XD 2CLVB 3TBWA 5JUEH 2FJGB 1EVUA 4FXGA 1Y0LB 1I8MA 1FYTB 2DLIA 4MNGE 4WWKC 2R23B 4Q9CA 3M1BB 5C0FA 3QUYA 2HWZL 4PG9B 1F00I 3X11B 5EN2B 1IQDA 5A2LH 2X09A 1FH5H 1LP9E 3S37H 5IOPB 1TCMA 5E8PB 4G9DA 4F9PA 5MEOB 4XNMB 1D7FA 4OLEA 4XNUL 1MWAA 3BEVA 2ZSVB 3OSKA 1X5LA 3CK0L 3NACH 1HKLH 5F8QC 4N90D 3IDXL 3MRPA 1N6UA 5IEHA 5F7YC 4POZC 3SE8H 2HFGL 3F65A 4WI2A 1I1FA 1I9JL 3U7YL 4HFUL 4KI5D 2VAAA 4FQ2L 3H6JA 1J5OH 3KWWB 5EDXA 4PGCA 1U8JB 2X70A 4XVSL 1REIA 3W82A 4NT6B 1I75A 1IC5H 3NCFB 4HIXL 5D70H 1WITA 3PV6A 4MS8C 4B5EA 4PJGA 5JPMA 5JZ7D 2OR7A 4M93B 1UWGH 4IRZL 3ZHDA 1T89A 3OKDA 3OJDB 5KVMC 1S7VB 4LCWA 4TNVK 5EBWA 1I7UB 1N6VA 1HYRC 3KLHD 5CEYA 5F7MC 3GSQB 5CGYD 5FAAA 1OAUL 2L4OA 3PHOB 4NRYA 1OD9A 4YHNB 4HUWA 4JDVB 3WFEL 4KI5F 4XPGL 5JDSB 2VERN 4M7KL 1MAJA 3M07A 3G04A 1T04B 4YHKH 4XTRC 3H8NA 4M1CC 2JJVA 2VLME 3BAEH 1I7ZA 2VUOA 3DUUA 1A6PA 2OLDA 4ZFFA 2IGFL 4YDLB 3WIHL 1YEIL 4DTGL 3LKSA 3A6BH 3OWEA 4HKXB 4YBQC 4KTDL 3IGAB 1BMGA 2J8UB 4LVHB 5DJ6B 2VDNH 4P3DA 2J8UF 3PWPA 1S9XA 5C6WH 1LILA 3PGDB 2FX9L 4X6BB 3VJ6B 1T66D 2PO6D 3IFNH 5IGXH 2DAVA 1J0JA 3INUH 2DQDH 1BGXH 5J6GB 3VXSA 3HNVH 4Z18A 4PB9L 4WHYG 3P0YL 4GRLA 3ULSB 1WISA 5I30L 4CBPA 2IFFL 3RAJH 1H8SA 5E9DA 3E8UL 4LASH 1VA9A 3VFOB 5AAWA 3TCXA 4KK8C 2Y7QA 1QLRB 3PGFL 1TTFA 2D7TH 3P2TA 3EKCA 3BZEA 2PO6B 3G6DL 2VXQL 1PZUB 2C3VB 2IPTH 3BIKB 4ONHB 1WGOA 2DKMA 4WV1A 1NLDL 5F9JA 5GGSY 2A0LC 3WHE0 4JZNA 4NUJB 3GK8H 1A7NL 3JBG7 5DZNA 3VFSA 2DQUL 4MCZB 2V17H 1LO5A 3HB3C 3IKCA 2GSGB 5DEFA 5DQJA 5FGRA 4H5SB 5D5ME 4DZ8A 3NZ8B 3HTLX 4MNQE 3RX5A 5I15H 3V6FB 3QXAB 3UBXG 5F3HB 2P5WA 4ODWA 4Y2DD 5HHQB 3IDGB 4KZDL 3VDBA 2YD8A 1OLZA 2IALB 3MNWA 3NFPB 2HRPH 2Y23A 3MFFB 3WFBL 5C09D 5D1ZA 4QGYA 1RUAH 2C7UA 2VNCA 3GSXA 1S7XA 1FFOB 1NGYA 4PP2B 1KXVC 3I3EA 3MR9A 1ZVSB 5DUBB 4YXHH 1IC4L 5KOMC 4PJ9D 3MCG1 4KVCH 4G6KH 3AU1B 3D25A 4HUXB 1FP5A 2XY1A 4I0PD 4QRPE 3O6FD 4ZOAA 1MY7A 1XF1A 4NN7C 1KBGL 3DNKA 3P4OA 4MXQC 3E2HB 5C07A 5HDQL 4PRPD 5I71C 1QRND 2QADD 2ZUQC 2OL3H 5C09B 4ZXBA 5CBEA 5ID1B 4JANA 1FDLH 3QUML 1E28A 4OQTL 4PJBA 5KSBA 1R3KA 4OZGA 4QCIA 5IB5A 1RUKH 4JQXA 2BOBA 2O5YH 3KLSA 5DA4A 4XMPL 3G6JA 2ZCKL 1QQDB 1UACH 1UB5A 5DDHB 4PJ9B 2IAMA 2V9QA 1U2HA 1XF5B 1KTDA 3QZWA 5FKAA 4B50A 3DARA 3V0VB 3RNQB 1YEDB 3U0WH 4LVEA 4I0PB 3O6FB 4M1DH 3LZFH 4PRPB 1QRNB 2QADB 1EUUA 1P7QA 1F2QA 1XGQA 3MJ7A 3BPLC 5CHNB 5HHPB 4ZUSA 3BI9X 3D18A 3IFOB 4HWUA 1U8HA 1HXYA 1MCDA 1JPFA 3VGEA 1UH2A 1XT5A 5FDWB 3OBAA 3TYGH 1YNKL 1KGCE 2ID5A 4JY6A 5EUKA 5FKPB 5B38B 4IHOA 5IHBA 3BKJH 1ZHNA 1AIFB 3TH2T 1UEYA 1VFBA 3WKMH 2PYED 3U4EA 2WW8A 4R4NC 3CFJA 5GHWH 3V0WH 1FFRA 2BNUA 3RUGB 4PLNC 4FTVD 4D9RE 1A7RH 4EUPB 1N4XH 3RUGF 1D6EA 4LLMB 1JL8A 3F7PC 1MHCA 2WV3A 4OLZH 1A9BA 1ZSDA 2X4PB 3G9VA 1I9RL 4HQQH 3HRZB 2A73A 1CD9B 1OF2B 3BD4A 5CD5D 3BP5B 1MPAL 2PYEB 1T2QH 4ZFGL 4C56E 4BSVA 1PZ5B 1FVDB 2AERT 4MDIB 3H42L 5J11B 2OI9C 4JHWH 3H3PL 4FTVB 1TIUA 2NXZC 3X14A 1HZHL 4JFFD 1C8PA 2Q76A 4Y89A 3T65A 3BN9D 3QIBA 3ZYJA 5GZOD 4NDMB 5EUOA 5IVXB 2CR6A 4PJ8D 3MYJA 1NEUA 1LO2H 2R0WH 3K4DA 1V3JA 3DMMA 4UTBH 1UWEH 1A6ZB 1IL1B 1K9TA 4WWKD 3HC4H 4J8RA 5KSVA 1TNNA 1W0YT 4EQ3A 4OSUH 2G60H 4J4PC 4XBGB 3ME0A 2R2HB 2ESVE 2BVQB 4RRPA 4WNQA 4NP4L 4JFFB 3OJMB 1WCQA 2I26N 2ITDA 4GKZA 2DDQH 2R56H 4ODTH 3AMLA 4XX1E 5FEBA 5SX4I 4MNGA 4F7EB 5JW4Q 1E4KC 1JFQH 1W72H 2VDOH 2GI7A 3DVIA 4AJ0A 4PJ8B 3V2AR 2QL1A 1C7SA 5DI8A 4OCSH 2DM2A 1JGLL 4N0YH 1T80A 2EEBA 3HLAA 4WWKB 4FZEL 1C12B 1X4ZA 4POZD 4JFYB 1KPRB 3U46B 1LP9A 4OCWL 4GMSH 3O41A 3B9AA 2QQNH 5LVEA 2B20A 3Q5YA 1NAMH 3FMGH 2OK0H 1TITA 3E6FB 5EBLA 5GSRA 4S0SD 4MS8D 1CZ8H 4DKFL 2JCCA 2M2DA 3C09C 3BPCB 3KPRE 2YOCA 3D9AL 3O2VL 2P48B 4PBXA 3MMEA 1O7VA 5J57B 2B4CC 1NL0L 2J6EH 1M4KA 3ECBA 5AYUH 1JGVL 1G7PB 1NGZA 3NA9H 3O3BB 4XTRD 3MLVL 4M1CD 1YMHA 4LIQE 3MRQA 4OGYH 2FLRT 2IADB 4U3HA 5J3HC 4CMHC 2QTEA 5T1KA 3BUTA 1BJ1H 4S1DC 4YBQD 5T3ZD 4YDVA 1FYTE 3MLSL 1ONQB 4KUZH 1HQ4B 5FYKD 4YUEH 4KKAD 2PTTB 3SKNA 3VFNA 2FIRT 2ENSA 3ZKMC 5LCVH 4IM8A 3B4NA 1RIHL 2N4IA 1ZVHA 3CVIH 3GHBL 1Z0NA 4JPWL 1JWSA 1RK1B 4WU7A 1OQOA 4F33A 3HPJA 3HR5A 4YH6A 4NC0B 2P47B 2ICWI 1S7SA 5D6CA 3WIIL 4LSPL 5CP3H 5EO0B 1KN4L 1UB6B 3HR6A 1XGRA 4Z8FH 1KV3A 3OB8A 2AJ3B 1RZJH 1U3HA 1MCSA 3H7BA 1QYGH 3R1GL 4KK8D 1OAXL 5F7DB 2WLZA 4P9MH 2EDEA 4FQPA 4D9LL 3TJHC 3N1PC 1RK0B 5T5NG 1OAZL 3L3IA 4G42B 3LMJH 5HYJA 3WE6A 5D7IA 4ZS6C 3O81A 3QHTC 4JKLA 3RJDA 4DK3A 1PX3A 1UM5H 4KMTH 3SO3C 2GITA 3UX9B 4ESKA 2XI9A 3ULUC 1K8IB 4YC2C 5J6HA 4OLXH 2ZOKB 5JLZB 3SGJA 3KPPA 4C58B 4HEPG 4LSSH 4M6NH 3KYOA 1NANI 2JTDA 5FV1L 2YPLE 4KI5E 3HB3D 1FZMA 2IANA 1IGJB 4ODUA 5ESAB 5F1NA 4JR9L 3PGCA 3MRGA 5TDOB 3HI6L 4M8VA 3C08L 3B9EA 3VCLA 1A5FH 4KWUA 4HIIA 4HS8H 5HGDA 4OT1H 5IR1A 4APQA 3OV6A 4PV8A 5T5FH 4ENEC 3MRNA 5I1KL 3VFTA 5F44A 3EGSB 1JHKL 4PV9A 1O0VA 4WW2A 1HHGB 4ZQKB 5D5MA 1EXUA 4PTUB 4F9LA 1BFTA 5IMOB 35C8H 3LS4H 2E6QA 3H9ZA 5KJRH 1QBML 2FECL 4AK1A 3HE6A 3TLRA 2NX5D 3FN9A 1JNJA 1JN6B 4AM0B 1IMHC 4MYWB 3V52H 2LAGB 3BVNA 5J8OA 3FOMB 2H6PB 4L4TA 5HHVL 2CGRH 4CRPA 3AS3A 1JHTA 3B6SA 4NKOB 4CAGA 4WUUA 1T5WA 1YYMH 1CR9L 4MXQD 1V3MA 4GW1A 4JO3L 1JF6A 5IIEB 3BZFB 4J1UA 1GZPB 1S7WB 2IBZX 4FXKA 3RDTC 3JVGA 3EZ8A 1UYWH 1A1NA 2KBGA 1MCCA 1G7LB 3ELAT 3UJJL 2NX5B 2NY5L 5I6XC 4QRPA 5L7XH 1LO3H 5GRJL 2CDGB 3K1KC 2X4RB 4HH8A 1T2XA 3A6CH 5E70A 5ALBH 3T0WA 2MSPA 2DTMH 1M7IB 3OR7B 4XMLL 5EBGA 1PG7X 1AFVH 1PAMA 4PJCB 3TBYB 1QSFD 4NN7B 4N1HB 5I71B 1RZ8B 4PJCF 3GSNL 2ARJB 2R2EA 5IJVB 1F45A 3HZVA 4TUKH 1BZQK 2NZIA 3RWHA 1FHGA 3D5OF 4LMQE 4PJ7E 4DKAA 3MV01 4FQXA 2ADFL 4RWHA 3QEGL 4XVTL 2AEQH 2YC1B 4OM0H 4ZTPL 2CMRH 2D7MA 4DQOH 4HKZA 1CK0H 5GGRA 5E6IC 2OSLA 3RVTC 1NUNB 2CLZB 2QKIB 1T22B 4U4BA 1KTLA 2FX7H 5D6DC 1QSFB 5FO7A 3FT4B 3AM8C 2NCMA 4OTXH 5E2TL 1FZOB 4R4ND 2VXUL 3K81A 3BPLB 2EC8A 3BJ91 2XOTA 2PR4L 2D0GA 5F3BB 2B1HL 5F7EL 4TOYH 1R5WB 3V95A 2J8OA 3SKUD 2BP3A 1YMMA 1U8MA 1ZE3C 2OZ4A 2WWKT 4IEFB 4KXZI 5DVLA 1YEFH 3F7YB 4GKSA 2WBJC 3CH8A 1GXEA 2CKNA 4YFLI 4M9OA 3IAQA 1F6AA 1NFIB 4H0HB 4KPHH 3ETBF 3VFWA 1U42A 4EI5A 3UDWC 4XCEB 4I0KA 1IEHA 1EJ6A 5H37G 4G8FA 1AR2A 4PGBB 2EKSB 4QXUL 2QHRL 5FK9B 3JV0A 3TM6A 3GMRB 4M8QB 3OB0H 1BJ1J 4OBSA 4DGIH 2G5RA 2ADIA 3CFDA 3UTQA 3EYSH 4NO5A 4MB3A 4OKVB 1RZGA 2FBJL 1XCQB 4RAVA 4C56A 4BZ1H 4MLIA 3UBXB 1U8IA 2XWJA 1MFCL 5GGTH 3EHBC 2JJTC 4EDWL 5JOPE 4NO2B 3QWRA 3GMNB 3B9KC 3LKRB 5LG1A 1R3IL 4J4PD 4PRPE 1QRNE 4DFIA 4U33A 4QRRA 1DSFH 2OI9B 3I6LD 1IGCL 5HDLA 1SY6L 2VWEC 1TFHA 3NIGF 4U6YB 3TVMC 3QPQC 1LK2B 4RMVA 2AKRB 5J13B 3CPLB 4GW4A 5JNYA 1WFTA 5GIRA 2C1PA 2ESVA 2EDBA 3UPRA 3I75A 4ZYKA 3AROA 4GRMA 4X99A 5HHMD 1OSPH 3VWJC 3MLZL 2OQJB 4UT9H 3TO4C 2VITA 1IGML 1D5ZB 5MEND 4Z76A 2YD1A 4L9DA 3MRDA 4NC1E 3Q2CA 1G9NH 4LCYA 4ZSOB 2AK4D 1DQDH 3MGOA 1A7OH 2PXYC 4C59B 1UXSA 3FOLA 5CEZD 4ZO7A 3T0BA 5IFHH 1A7QL 3N06B 3QIUC 3L9RA 3OF6A 4ZAKC 4UINL 2GTZB 8FABA 1MFEL 4GG6E 1KCVH 4L5FL 4ELKA 3QRGH 3GSRB 5HHMB 1A02N 2PYEE 5IM7B 3WUWB 5GGRY 5IG7B 5MENB 4Z5RA 4E5XA 1A6AB 4GXUM 2AK4B 4O9HH 4FTVE 1PSKH 4JEGB 3P77B 4MJIA 2Z35A 2ZNXA 2YXFA 3C5JA 5JA8B 3TNNA 1UT9A 4KJYB 5J3HD 1WEJL 3C09B 3MYZA 3JUYA 3TNMA 4ONGL 4S1DD 2P5ED 1YN7A 4LGPB 3LQAH 4DK6A 1H3GA 3U4BH 1OAQL 1QHPA 3BP7A 4PGDA 2FX8H 4GG8B 4YK4C 4PLOB 4MMXC 1BZ9A 3PHQA 1X4YA 3ZKMD 3VXMD 5GXBB 4LARH 5HPMA 2FHCA 4UDTA 4JFFE 3MRJA 3QNZA 1OTSC 1FYTA 3PWLA 4EXKA 2V2XA 4K94L 5GS2D 1CXLA 2OM5A 1TJIL 4GLRI 3VFUB 4CMHB 3KGRA 2P5EB 1JNHA 4Z7WE 4LLVA 1QO3B 5TE7L 1FO0A 3MBXL 5E94A 5E8DL 4UIMB 3VXMB 5HYSA 3SBWA 4L1DA 1JWUA 2MNUA 4LCUB 4K3JH 3TJHD 5HY9A 3ZSTA 2XN9E 5JXEA 1NGXA 1MCEA 3AY4C 2PUQT 1XR9A 3GZKA 1KCKA 5I16A 4ZS6D 3VI3F 1KNOB 2J2ZA 2ED8A 3ULUD 4JFOA 2AJUL 1QTYT 5K33A 4PJFB 5AD0B 2XFXB 5E99L 5KVGL 2CXGA 4PJFF 5E2WH 4G7YL 4JKWA 5KTEL 1JYWA 4EI6A 3P30H 2EECA 2LU4A 5HI5C 4HIEB 4TTGA 2F58H 4M7LL 3T8XA 5KW9L 1TZIA 3FB5B 3P9MB 3VXOA 3NCEB 1V7ML 1ZT7A 1A9EB 3SO3B 4HWBH 2MWCA 4ENED 2YPLA 1QR4A 3QQ4B 1H0DB 3CU1A 3LQZA 4YHNA 3JWOH 4HIHA 3WEXB 5B3NA 4LSQH 3QG7L 1TLKA 2EIBA 1T04A 2I60L 1T7WA 4JDZB 2PW2B 3P9LA 1U92A 3D85D 43C9A 3VXNA 4ELMB 4NUGL 5GGQL 4QF1B 2NY2B 3VXPA 3GMLB 4ELMF 4GMTH 1YQVH 4PBWD 3NCCB 4Q0XH 1J1XL 3IGAA 2IBZY 1CTOA 4ALAL 1FNEB 1WZ1L 4ZO6A 2F5AH 1CF8L 3O0RL 5TE4H 1FL6A 3DECA 1RJLA 4E42A 4P48A 3L1OH 2HG5A 1TETL 5DURD 3TJEL 3G5YA 3ARDA 5FYKE 1WC7B 5C6PB 4KTYA 2XTLA 1QFHA 3GSUB 3AS0A 4LQ1A 5CJBA 4EBQH 3RDTD 3D85B 2K7PA 4LSUL 3KPLA 5DZOA 1D6VH 4HZAA 1ZA6B 1PYWB 1BAFL 3QEQD 1U36A 4U7SA 2SEBA 3FQWA 3ULSA 1SBSH 1LDSA 3VFVA 4XGZB 3MACL 3GRWH 5B39A 5GJTL 4JREC 2F8OA 5IB1B 4ZDHB 3P40A 4TSAH 4NZTH 3VFOA 2P7TA 2YS4A 1CFNB 1NCCL 4U1KB 4N5UA 4Z7NF 4FP8L 4UUJA 4OQ1A 4C55A 4M48L 2WINA 3CLFL 5DURB 1ZGLA 3C6LA 2NW3A 2GQHA 3DRTA 2QQLH 3QYCA 3UZEA 4Y16C 4LSRL 3MJ8B 3QEQB 2GYSA 4HG4K 5I6XB 4O5LL 5MEPA 5ITFB 4NNPH 5IEKA 1OB1B 4GO6B 2YWYA 4Y4HA 3AAZA 5E6ID 1VKXA 1AI1L 3BKYH 4WTZA 3EDFA 1CDGA 3QEHB 4PJ7A 5CZVH 4K3DL 3UPCA 3ZL4L 2D7OA 3DWTA 5DJXB 3VGFA 4PP1C 1RHHA 1SQ2N 4JY5H 5LGJB 1A4KA 1IEBB 4QT5B 5F21B 2AV7A 3OAYH 1M71B 2F5BH 1DQTA 1KCRL 5I8EB 4MD0B 5L0QC 3QG6B 1AQDA 5IVZB 5IVNA 3S3JA 1ZKAA 4JZJC 1ZT1B 3MCLH 1OP3H 1DQJB 4F8TA 2WBJD 3L3JA 5GGUB 3MFFA 4P2RA 1T0NB 1U8LA 5T5NF 5E6IB 4FFYL 3CUPA 1T5XA 5IB4A 2VLLA 4PRBA 4NQDE 1KTRL 4H8WC 5EG6C 4EJ1C 3WXVL 3W39B 5HBBA 4G6ML 3AREA 4ZTOH 5ACLA 3QULB 4MD5A 1TVDA 3TPKA 1YEEH 2VXVH 3QDMA 2G9HB 5IFJB 1QKZH 1DJSA 4OCYL 1CLYH 1KLUB 4FQIL 5F70A 3AU1A 3X13A 5HGHB 3RZWA 2NX5E 1F8TL 5T3XH 4A2MA 1MLCA 3IKKA 2H32B 4XHJC 5ADPL 5EO1A 2WBJB 3FT2A 1SEBB 3EHBD 3SY0B 4LRNH 1Z3GL 5F9OL 4GQ9H 2EH7H 5DRXB 3TFKC 5D4QA 4PJCE 2YK1H 3B9KD 3O2WL 1FNGB 5IFAL 3L3HA 4P9HH 5DUML 1N2RA 3I50L 3TESA 3VW3L 2X89A 3OKNB 4Q2ZA 5DK2B 4MSWA 5CJOL 1MSPA 3MUGB 1CE1L 5DRZB 1IGIH 3EFFA 1MJUH 3QPQD 1PKOA 5F7NC 3U0TB 4RZCB 1GYAA 2BOCA 1FLTX 2L7UA 3MV8D 3PWVA 1KT2B 3B2UC 4KQ4L 4KRMB 3GSWB 2X9YA 4M4RA 2Z93B 1WWAX 1J8HD 4R96A 1PW3A 5ABDE 3LH2H 3IRZA 1N59A 1QSFE 4R26L 3B9KB 5I1DA 2CKBB 5EIIA 1IM9D 1B4RA 1U3ZA 3U6RA 4CVXA 2EDQA 3BE1L 2A6KB 2PXYD 1J0YA 2AJXL 2GIYA 1OWWA 1EVTC 3HMXL 3VFGL 3LKNB 3FCTA 4NCDA 3TT1L 1QA9A 3FB7A 1AGBB 2PNDA 3QIUD 5CAYB 2OL3A 1OSZB 3JWDH 1NFDA 3MV8B 3NCJH 2B0SH 1IVLA 1NAKL 1WVZA 3LRSA 5FO9A 1CE6A 3BH9A 2ATPB 1UKTA 1CFTB 1J8HB 1N64L 1DQML 5DZLA 4K23L 2WBKA 2WWMD 3FRPA 1IM9B 1LQSR 1ORSB 4PRHA 5GS0H 4ODVL 5DT1H 1WAAF 1MQKH 2QJDA 3U2SA 4KDVA 5F97E 2PXYB 4YNYB 2W07A 4LCCC 2G5BA 4NC2B 5SX4H 3TT3H 1G7HB 2X4PA 2I24N 3QI9C 2KQNA 4GG6A 5SWSA 1GGUA 4OZFH 5ISZE 1PFCA 4JM4H 1Q94A 5IMLA 3IDJA 4EDXB 1T1XA 2DI7A 4FMFA 4Y1AE 3IDNB 3GKWL 4X7SH 1RZFH 1ZANH 1P7KA 4PUBL 4UMGA 3EZJB 2DQJL 3QQNA 3DURA 4L8SC 3HHRB 4GXVH 4P4KA 4IIQA 2Q8AL 3VD9A 3NIGE 5E5RB 1OTSD 3CVHH 1PEWA 2DLGA 3MJ6A 4LPCA 4WDIB 5CBAA 4ZS7H 1KIQB 1ZTXH 4OLVL 3QO0B 5C70A 3Q6FB 3LEVL 1BVKA 3ZTJG 1I8IA 3KPQA 4P5TA 3MGTA 3OHXA 3ARBA 4GAGH 3UZVB 3O8XA 1NEZA 3C2AH 1N6QL 1K6QL 2JB6B 4YK4B 1HWGB 4EN3A 2VZOA 3STZA 1NDGB 3U0PB 1KJ3L 12E8L 1A6TB 4O2EB 4NZUL 4PGJA 4ZSOE 5DRWA 1JZ8A 1ZEAL 2HKFL 1VFMA 1EX0A 2APTA 4Z7WA 5SWZA 3BD5A 3S34L 1WCBB 2QR0B 3MODL 1FGVL 2CK0H 3EOTL 2HT2C 2VZVA 5BCAA 2R0ZH 5DEGA 5C9KA 2BHZA 1E6JL 1OPGH 5IMMA 4OKDA 1UENA 1UWXH 5C71A 2XT1B 4QHMB 1KC5H 1JBJA 1NSNH 4TSCH 4XNYH 4R6UA 4EXPX 1MVUA 3PQYD 1DBJH 2XN9A 4XNQB 2ADJA 3VG0H 3SE4C 3FO2A 4MA7L 2DD8H 5MENE 4J12A 1CGWA 5HI5D 1WF5A 2AV1B 4Y5XB 1XZ0B 2CXKA 5TDPB 2GJZB 5A3IC 3QUXC 7FABH 3KYNB 2DQCH 1N26A 2B39A 4JN2B 4KJQC 1UFUA 1W2KT 1I1AA 4UV7H 4OLYL 2DLFH 4XP5L 2VDPL 2V2TB 4F7PB 4RDQG 5DJDB 5A1AA 5FUZL 3PQYB 1FYHB 2MHAA 1UC6A 1W72A 1BBJA 2RIKA 3HZYB 4N9GB 1PG7L 4MXVF 2DOCA 2AQ2A 3LPFA 5AYQA 4LIQL 3BWUC 2HFEA 4YR6B 4Z7UA 3F7VA 3LQMA 5ANMB 1ONQA 3DX7B 3ARGB 2XG5A 3WL9B 5D7SH 4HX1A 4R0LC 2DBLL 5ESQB 2QQKH 5IQ7L 3QNXA 1OT1A 4TULH 4N5EC 1JI1A 2FJFB 4L9LC 2D7PA 2DRUA 4HXBH 5TQ2H 3RL1B 1TJHL 1JF1A 2E7LC 2CIIA 2I5YH 2VE6B 4R4BA 4QRUB 1FGNH 4HG4J 4U0RB 3VXME 4DN3L 1EHLL 4MQSB 2YHGA 3VD7A 3KYKH 4Y5YA 2AJYH 2J6EA 3QA3B 3VI3E 5EO0A 1I4FB 1EO5A 1MI5D 8CGTA 5EA0L 1AD0B 2DIJA 3BXNB 2VL5B 2WAHA 1HHKB 4O4YH 4G6JH 4N8VA 4DGVH 1XH3A 3OAZK 1U8KB 4MA3A 1URLA 1T3FB 4Q74A 4K7FB 1M1SA 3GJFK 4RISH 4KGLA 1P53A 3T2NH 3TIDA 3P9WB 3MXVL 2A9MH 4JY4A 4JFEE 5EZJA 3T77B 4HUVA 3SOBL 4QTIH 3RWGB 3HRPA 4DVBA 5I74C 1BZ7A 3C6SB 4Y16D 4OV5A 3BDBA 2EDKA 1I8KB 1ZLVH 5JUEL 4XP9L 3B83A 2I9LB 4HF5L 4MNHB 1MI5B 4JREB 3C5ZA 2O61A 3HCVA 4LEOA 1MFNA 4XCFL 1WBXB 4U1HB 4B41A 1KYOK 1FFPA 4HLZH 4ONOA 1EAPA 2B2XH 5HJ3B 2QHLA 2X7LA 1B88A 1T7XA 5TGBA 4XPAL 4PP1D 2X1QA 2EH8H 4PR5B 3DRQB 4MJ5B 1XF3A 4Y16B 1R24A 1RAMA 2IG2L 5CP3A 5KSAD 4GUPA 3VMOA 2OTWA 1NGPH 4PBVC 2FO4A 3FTGB 1F3DH 3SDAA 5ITBL 1VACA 5GRUH 4LKCB 2BJMH 5SV4A 1U8QB 5GRZA 5LQBL 4L8DA 2XG4A 3SN6N 1YNTA 1C5DB 4I77L 4QXWA 3OKEB 3AS2A 4KV5F 1DBKL 2WZPD 4XH2B 5E8EA 2ORBH 2ZCHH 1G9ML 1EERB 4LSTL 1IC5L 2EXYC 5D70L 5KSAB 4OGAC 5L0QB 4NKOA 4OCNC 4NQDA 4TPRH 3UEZA 4JZJB 4UB0L 4WEUD 1CD1A 2H1PL 3EFDL 1EV2E 4UT7L 5I2IA 3DOSA 4YBLC 3ARXA 1KJ2B 4CJ0A 5FYJD 4JVPA 3TFKD 2PTUA 4R8WH 3BQUB 3JTSA 4ERSH 2C26A 1HSAA 3D3VB 5E8OB 1H3WM 4YHKL 1QEWA 4M43H 1FG9C 3ARTA 1OT2A 5C0EA 3QEQE 1F02I 3PIQB 4KXZH 4LHJB 1P4BL 2EEAA 4PJCA 5C0CE 1BLNA 1DFBH 1OVZA 1S7TA 1RZ8A 2ATKB 3B2UD 1EEYA 3CSPA 3VXUA 5IBLC 2P1YA 3SE3C 3EOYG 3RWDA 5HYQB 2NY6C 3MRHB 3I2CH 3UTTD 3DJ9A 4Q6IC 2VLJD 2VDNL 3GJFB 1QBAA 5EFIA 4IMKA 4PJDA 4EIGB 3QCUH 5H94A 3SKOA 1CL7L 3BUYA 4P59H 4LF3B 2YC1A 3FAWA 3I02B 1MJ7H 3ARRA 2EYSA 1RUML 1OW0C 5EU5A 1T03L 1V3KA 4NOFA 4FFVC 3GSVA 3FT4A 4MQXC 5MERA 5CWSB 5DGQA 5E7FA 2QV2A 4JVUA 1FAIL 3V8CA 3RL2B 1BOYA 3SKMB 5TDNB 3UTTB 2DQFB 2VLJB 5HD8D 2R29H 3OKLA 3ILPB 5DFVC 3RY5A 4LPUA 4NN5C 1Q9KA 2UYLB 2UY6A 1GGCL 2IH1B 2EIZB 1CDBA 1ITCA 5FGCE 2VZ3A 3L95B 4QXTA 2ERJB 2IPTL 2BXYA 4JRXA 2OYPA 3OL2A 3GMPB 3F6LA 3BHBA 4U7KA 4CJ1A 1CVSC 4Z0BH 4GFTB 4WI6A 3DVGA 4YWGH 5IMKB 3V4VL 3QXTA 4HHAB 2V17L 3H9YA 3STLB 2J1KA 4NWTH 2UVFA 1KXTB 5M94B 2NY0C 1NDMB 5ISZA 3HS0A 5DHYB 1H8OA 2FEDC 2ICES 4NQCE 3B2VH 4ZFOA 2F9BT 4BA8A 4I5BA 1VFAB 2BFVH 1LWRA 3R8QA 4Y1AA 2BSRB 5ERWB 3U48A 4XXCA 4ZFZA 1H3PL 3IS1X 1CGSL 1V7NL 5CJXA 3L3KA 1HNFA 5FYLH 2ZUSA 4UTAL 1ZWIB 4HJ0C 3T3PE 2RB8A 5DD3H 2Y9RT 4KRNA 3QJFA 4Z95L 2ILLA 2OBGA 1JUFA 1KJVA 4WI4A 4OCXL 2FCBA 3GMOA 1VSCA 2XA8L 5CJQH 5SX5H 1ACYH 1RIVH 3QUYC 5FUOH 4LLDA 3RWJA 2B1AH 2IPKB 4KVCL 5DJZB 1CGXA 4LU5H 5CJ8A 3X3FH 4MJ4A 4QKXB 3ES6A 2YWZA 2HT2D 3MROB 2VDQL 2AJVL 4ODBD 1YDPB 4CADA 2FJHA 1HH9B 4H1LH 5EOTB 3DXAB 4F9PC 3LEXB 2C3HA 4DFHA 1WAAE 1RUPH 5TH2A 1AD9B 4JJ5B 4FQCL 2P4AB 1IAMA 1RHFA 1RUKL 2IQ9L 1WJ3A 3BPOC 4NCC1 3U82B 4U1NB 1F42A 1I7TA 5GGTA 3RWEB 1A0QL 1HQRA 4PJHF 1G0YR 2OXHA 1UACL 2V7HA 4GSDL 3DBXB 5EORL 5KOVC 5A3ID 1OD7A 1T83A 1DE4A 3GBNL 4GLRH 4A6YH 1GGIH 4BSWA 1FN4A 3FQTB 4KJQD 5DMIH 3U0WL 3BZ4B 5CJ5A 3EUUA 5I75C 1VEOA 4M1DL 5F9AC 5BO1H 3QWOB 1T89C 4UDUB 4P5KB 3HC3H 4FABH 5KS9A 5I1CH 2MTPA 3IVKA 3B5TA 1GZQB 5DJYB 3SDDD 3ET9F 3SJVA 3FQUB 2CO6B 4X4XB 5E2UH 3M17A 1ZHBB 5FA3B 5ESVB 1I1RA 2MPAH 3BYTA 4GG8A 1QVOA 5EWIH 1JPGA 4ZNCD 3BKJL 4LLUB 3WKML 4JE4B 3HZMB 1CG9A 4BFEA 3IU3B 1Z0MA 2ZZUT 4I13B 3V0WL 4OZIF 1FZJB 3WJLC 1A7RL 4XVJH 1ZK9A 4RWYH 3WFHA 2ADGB 2X4UA 1X9QA 2GW5A 2QSCH 5TE6H 3SDDB 5KBNC 1KYOJ 1HOCA 5B8CA 3LHPH 4HQQL 4LPYA 3MV7D 1L7TH 4LLYA 5I8OL 1KELH 3OGCA 3QZWG 1KENL 3E6HA 1S8DB 2FATH 1INDH 3MXWL 1U8PA 2Y6SC 4FFWC 5JO5A 1N5AA 3H0TA 4JHWL 5J9PB 3ZKNC 4OI8A 3MCKA 1KNOA 2YPKB 2YD4A 1G84A 1HK6A 2BSSA 4AIZA 2EEDA 2Q7YA 2NY5C 1K4CA 4BFIB 1NC4D 4NQVA 1GGYA 1LO2L 2D03L 3RX7A 4UTBL 4YHLL 4JFEA 3MRRA 3HC4L 4GKNB 2HH0H 4L4VA 1NGWA 2G60L 2I07A 2ZKHH 1C16A 3PQYE 4WV1C 4MXVE 4NQXA 4IOIA 2FR4A 3QUMB 5I74B 1CQYA 1UQSB 2AXGB 3HC0B 1IKNA 5F96L 4YPGA 3CXHK 5IESH 5GRWA 2VDOL 3RWIA 5ANME 5M95B 5F7KC 1NC4B 5CGTA 5DYOA 1E4WL 4LVNC 4MB4A 4NKDA 2LTQB 4OD1L 1T20A 3ARUA 4HXAH 1YJDC 4YJZL 5ECJE 4QF1A 3JTTB 1JHLH 1SEQL 3QFJD 1RMFH 4Z78B 3WHXA 1D5MB 4CVZB 4WRLA 1GPOH 4X8JB 4LBEB 1BQHA 3D0LA 4M62L 2Q8BL 2BCKA 2EXYD 4XPHH 1BIIB 2P24A 4OGAD 2RR3A 5MEQB 1JWMA 4FZ8H 4AT6B 3MRKB 4QNPF 3U7WH 4NPYB 1OTUC 2G2RA 4CU6A 5D1ZC 1BFVL 2VLRB 4G6AC 3UAJC 3GI8H 1KEGH 4YHMH 3RX8A 2ZCLL 1IC7L 3MRIB 3I6KB 2ARWA 5GJSL 2W9DH 4OF0A 1QUNA 1ZA6A 5FYKL 1RD6A 2PCPA 4I18B 3QFJB 2P8MA 2P46B 2JF1A 5D9SB 2FLBT 4HWBA 1FNLA 3NA9L 4QOKD 3SGEI 5DJAA 4RDQF 3KPOB 2YD5A 5E8NB 1IM3B 3K1DA 1R3JB 4FRWA 3R4DA 4U1KA 4KY1H 3GM0A 1J88A 2WP3T 2Y5TA 1MI5E 3E3QC 3PNWB 4YBLB 4P2OD 1EBPA 2VXSH 4JQXC 3OXRA 3K74B 5IBLD 5E08H 3KPMA 3QSKB 3RZCA 5I8KH 3DTXB 3ISWA 4RIRA 4JFDA 1EMTH 4TVPH 3HZKB 1D5BA 5DS8A 5LCVL 3VE0A 5FGSA 4OJFL 4HW6A 5ITFA 3K3QA 5C0CA 3CH1A 4QOKB 1KB5B 3CVIL 2RFXA 5I1HL 1HSBB 2Q87A 1T0PB 1KFAL 3WD5H 3KR3H 3LKOA 4DUXA 4XB7A 4JB9H 2M1KA 2J4WH 3O4LA 1Q0YH 2HFFB 4FFVD 1MJJA 3R06B 2EYRB 2PKDA 2XPGA 4MQXD 3VGHA 4P2OB 3PP3K 1R5IB 3FB8B 4NKIL 3DX8B 2B4CH 5I76B 3UTZB 3QR2A 1Q0XL 1OM3L 4Q6IB 3C60A 4QWWD 4J3WA 1BX2A 5DFVD 1QBLH 3GRWA 4QRQA 3RWFA 4LP5A 3WIFB 3OJVC 4P9ML 2PW1B 1JK8B 3LEYL 4OFYA 1L0XA 4NKQB 3KJ4B 1CFQB 2BY1A 1IQWH 4K9EL 4M7JH 3BESR 4DWHA 5KVFH 3GB7B 1VDGA 2XTJC 1QOKA 5BXFA 4ETQA 2V2WB 4FQQB 4OLXL 1MREH 4NNXB 4ZPVB 3P4MB 5K59F 4OD3L 1GGBL 4QHLA 1W0WB 5LAXB 4P5MA 4QY8B 4LSSL 2HN7A 5HGHA 3VFPB 1OAYH 3P0VL 2NY0D 2VSDA 2FEDD 1S7UB 3D3VE 3ROLA 1EJOH 2O5XH 1AXSB 5I1AB 1SEBA 4U1LB 4F3FB 1A5FL 3KS0H 3MO1B 3QPXH 4HS8L 4AH2A 4PRDB 5GS2H 4NQEE 1X7QA 3O4OC 3OGOE 4PGEB 2YUWA 4QTHA 4L8CB 1ZLWH 2WWKO 3QUZA 1LNUB 1RZ7H 4IS6A 3SQOL 4NQCA 1Q9WB 4PJEA 3UTOA 3SKJH 2IC2A 5FYJE 1CLOL 5L9DH 2DQTL 4YHZL 2W92A 3OKNA 2DQIH 3WN5C 1D9KA 1WT5A 2DI8A 35C8L 2BY0A 5DD6B 3IF1B 5E1AA 3T1FA 2NY0B 3DMMC 3LS4L 3FFDB 4JFXA 1XGUB 1RJZB 4I3GA 4XI5C 2VMFA 3U0TA 3VRJB 1CFSA 1UZ8B 5ELIA 4ZUTB 2FYYA 1Z9OA 5T1LD 3QUYD 1CICB 2HA1A 4JO4L 2YZ8A 2R0KH 2Z93A 2BSTB 4L3CB 5CP7B 2X9XA 5HHOA 4K94C 2A6JB 5AAMA 1C5BL 3ULUH 3QT2A 2CUHA 1Z5LA 4Y4FA 4F7TB 1ZGLP 1R5VA 1MAMH 2GTWA 3TBWB 2P43B 3UTTE 5I17A 4GBXA 4OM1L 2CDEA 4FQHB 1FG2A 2OS7A 2VN4A 4GW5A 3UJTL 4FXGB 4YE4H 5D72L 4KRLB 5B3JF 5F71A 1I8MB 1J10A 4ISVA 4HUNB 4X9FA 1OSZA 1H3VA 1DZBA 5T1DL 3QUYB 1LO3L 3U30C 1CFTA 3ZDYF 1IQDB 2DTML 1WAAA 2YUZA 1EBAA 2JIXA 2R69H 5I0ZA 5ILTH 1AFVL 4XNXH 5FOBA 3LOWA 4G9DB 1BF8A 1MWAB 3BEVB 3B8YA 3OG6B 1I9EA 4U49A 4LCWD 1MH5A 1DEEA 5DHVH 1OAKH 1INQB 3KJ6H 3MRPB 4I3SL 5IEHB 3N9GL 3BPOB 4HCRH 4MXWL 1AJ7H 2R15A 2VDLH 4UILH 1I1FB 5IJKA 4GXUN 1YEHH 2VAAB 4OM0L 4G5ZH 1BVLA 4HPOL 4PGCB 3GUTA 2UUDH 4NSKA 2X70B 3PWJA 5IK3A 5ICZA 4B7LA 2C3XA 2FX7L 4LRIA 1HINL 3P0GB 2AEPH 3GI9H 5DR5L 3PV6B 5LKNA 4PJGB 4OTXL 5JPMB 1QNZL 3HMWH 5JR1L 4PY8J 3OKDB 4LCWB 5EBWB 1J18A 1R3LA 2A9NH 3I9GL 4Y19B 5CEYB 5JDJA 4NRZA 3RIFK 2HJLA 4TOYL 2H45A 5J1TC 1ERNA 4NRYB 5CZXC 3PWPD 4N0CC 4YXKH 1AGDA 5A16A 1YEFL 1QRKA 1AO7A 4LOUD 1MF2H 3FT3A 3G04B 4B53A 2NXYB 3T0EB 3V0AC 1I7ZB 2R2CA 3DXAE 2V9TA 5I1IH 3DUUB 2OR8A 4ZFFB 4WEBH 2Y6SD 4XPBH 4FFWD 3VXSD 5I1GH 2E6JA 3LSOA 3TBTA 1EZVX 3EO9H 4OZFA 4GRLD 3ZKND 3LKSB 2BNQE 1MCOH 2WQ8A 3U83A 3CXHJ 4PJHE 1EEUA 5E9DD 4D3CL 4U3CA 1U3HC 4X7CC 2FSEA 3EYSL 1NKOA 4P3DB 3PWPB 1I85A 4XP1H 1Y18A 3O2DL 3MOBH 2NY4C 5GGTL 4UQ3A 2X4SA 5ALCL 4XC3H 1Q38A 2JK5A 5FYLE 3QBTB 3LN5A 2A1WH 2JB5H 3MV9A 1RZIB 2QQQA 3NFSL 4YDIL 3VXSB 3VD3A 4MCYB 4CW1B 1DSFL 1A7BA 4F57H 1CYGA 3MLXL 1UM6H 4O58H 3VA2C 4GRLB 4ONFL 4M5ZH 2VDRH 3SGJC 4X6FB 3O9WA 3T0XA 3VG9B 1E27A 4PY8I 5E9DB 1TJGL 4HWNA 4LLWA 5FM4A 2NTFA 2VZ1A 2Y7QB 2GJJA 5IVOA 2K3TA 4H88H 3CXDH 3WLWC 2BVPA 3BZEB 1I9IH 3SDXB 3X12A 3ZLQC 4OZIE 1LK3H 4Y8AA 5DVOA 4ORGA 1UJTA 1ZLSL 2P5WD 2OJZH 4APQC 3SDXF 4WV1B 3EOAB 5F9JB 5JHLL 4HIJA 1VFUA 2FH8A 4KVNH 4WW2C 4JZNB 2XWBA 4F9LC 1C5CL 1CBVH 1OTUD 3VFSB 5D1ZD 1LO5B 4G6AD 3UAJD 1QPPA 1JMZA 3IKCB 4LVNB 5DEFB 5DQJB 1MEXH 5BJTA 3DYOA 3HE6C 4JPVH 4DZ8B 1MOEA 5K9QG 5A2JH 2VE6A 3WNNA 2P5WB 1GHFL 3RA7L 4ODWB 1RJCA 5EU4A 2ICWA 2NTSP 1KCSH 2HLFC 4HJGA 1PSKL 3V5HA 4YIQA 4XAKD 5C07D 4ZUVA 2VL5A 4M5YH 2CO7B 3DX6B 3RIFF 2ICEB 4MVBC 3KLAA 5D1ZB 1U8KA 4ZXBD 2C7UB 3GSXB 1ZGLM 1JRHH 1S7XB 3JVGC 1NGYB 1AGEA 4MJ2A 5A40E 2AJZA 3MR9B 3U4BL 1GRWA 3GNMH 2FX8L 2IAMD 2Q1EA 1KJMA 5DEZA 2C4FU 3T3MF 5F6IC 4MA8L 3NN8A 4LARL 1CXEA 1AHWA 4MNHA 3U9PL 1G0XA 1PG7W 4KMQA 5HVFB 3P4OB 5BW7C 5C07B 1F4YH 3T4YA 3CLEH 1P7QD 1XGYH 4ZXBB 5CBEB 4JANB 2MCPH 1E28B 4J7RA 4PJBB 5KSBB 1R3KB 4OZGB 4QCIB 5IB5B 4DKEH 4K71B 1B4JL 1AH1A 4PJBF 5KSBF 1ADQH 2BOBB 4OZGF 3EDEA 1IRAY 1Z2KA 5BMFL 5HGBA 3CDCA 3G6JB 4FQXC 1UB5B 3VH8A 4AMKH 2IAMB 3QZWB 1KTDB 5FKAB 1P6FA 3G6JF 4OLUH 3W9EA 3ZDXF 1OP5H 3CMOH 2HMIC 5I66A 3MLWL 1IGTB 3C8KB 4GOSA 1AKJA 4QNPE 2XWTA 1DBMH 1N7MH 4UOW1 5ACZA 1P7QB