2ED7A

Solution structure of the first fibronectin type iii domain of human netrin receptor dcc
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
GSSGSSGKPAIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Netrin receptor DCC
publication title Solution structure of the first fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ed7A00
2GEEA 1BAFH 3FB7A 3FMGL 5FV2A 5FHAH 4P2CG 3RWGB 3SCMA 5TH2B 4XC3L 4HDIA 5KVFH 3T0EA 2GAZA 4O58H 5E6ID 4KZDH 1NUDA 1TXKA 1YJDH 4K3EH 4QHLB 2E8YA 2BOBA 1A7NH 1QLRB 4QTHA 2XQBL 4IBLT 2WW8A 1AI1L 1KELL 4HUNB 3VFRB 4U0RC 3GI8H 4NZDA 4CJ0A 3BI9X 3GBML 1JGLH 2QTEA 4JR9H 5D2LB 1MQKL 5EIIA 3BUTA 1VACA 5IVXF 3C8HA 1HZHL 4LCYB 1LD9B 2EECA 4JB9H 5J3HC 3SJVB 1MHCA 4PJEF 4F7EB 1HSAB 5DVLA 4ONHA 4U1HB 1P1ZB 1QUNA 3MV7B 3DX7A 3QI9B 4LLDB 4NWTH 1BLNB 5JIIA 2IANB 1S7TB 4R8WL 2C3VA 1MCQA 1N26A 5DA0B 4WFHE 5DVOA 3RPKA 3I2CH 5EPMA 1S7WA 1EXUB 1K5NA 3A6OA 4NQDB 5CJQH 3VXME 2NY3D 4BSVA 3S3PA 3RA7L 4ZUTA 1A6WH 1C08A 3QIWC 3BKCH 2HKFL 4CNIA 4G9FD 1UZ8B 3V6FB 5EC1A 3U0PA 4AM0B 4Z7UA 1B2WH 3SOBH 3ROLB 3NACH 3QEQD 2LU3A 4U7MA 2IAMB 5H37H 1HWHB 3NFPA 5FKPA 1KOAA 4CMHB 4ESKA 2FNBA 3MNWB 1YNLL 1G9EA 3WIIH 2AI0H 4HQQH 2FSEA 3T2NL 2JCCE 4GKSA 1E6OL 2CDGB 4G5ZL 4N0UA 5BV7B 5I17A 4P5MA 5D1XC 4OCLC 3IFLL 2D03L 1TJHL 3WE6B 4OBRA 3OGCB 2X4UB 3RI5F 1A47A 1IFHL 4KROB 5B21A 4JFFA 4PJXA 3D39D 1XFPA 1RHHB 3BE1L 3O41B 3D25A 3ULUL 5C0GA 1J8HE 1AKJA 3DJ9A 4Q74A 3S36L 3NTCL 4LVOC 3V52L 5EH1A 1FFOB 3FT3B 4N9GB 4NN5B 1ONQB 1UB5B 1EHAA 3O4LA 3HE7C 3MLRL 2NQCA 3ARTA 2MHAB 2FEEI 3L6FA 3KPLA 4HFWB 1LO0H 2JIXA 1ZOXA 2VABA 1K8IB 3QUYB 4APQA 3C5JA 2OQJA 3CH1A 2X2YA 1CFTA 4TUJB 4Y5YC 4FQQA 2B4CH 1QLFA 3EOTL 4IEFB 1A6ZA 4FABL 1FBIH 1ND0B 1WUNT 4OCMC 3W0WD 1MCNA 4JDZA 3BEVB 3SKUD 4HJJL 3OKNB 4KQ3L 1H3PL 4PRHB 1RSFA 3V6ZB 4OLVH 2I60H 5LXGL 1D6EA 1MCWM 4GO6B 4N9OB 3BQUD 5DFVC 4EI5D 5AG8A 4IMLA 1MRCL 5ICZA 5HHXL 5I74B 4CRPA 2VLMD 4Z18A 2FEEL 2OR8A 3LQAL 4ZXBC 5ADOL 3MX0A 4PJIA 1QA9B 5FB8B 1FAKT 1FLRL 5HHOD 3EKCA 5TPWH 2QBWA 1CGUA 4JRXD 3CVIH 5D7JD 1NC4A 3MOAL 3L3KA 1JP5A 5DTFA 4JO4H 3V8OA 4ZD3H 3PWVB 5GS0L 5ITBH 4HKJB 3KLHC 2F19L 3PDGA 5JXEA 3VD4A 3FRPG 3SGDH 1JIBA 3IRZA 3VXOB 4Z95H 4DZ8A 1ZLWH 4Z7WB 2YPLB 2DYPD 4AIOA 1OTUC 3PHOA 5GPRA 4JY6B 4Y4FC 4NKMB 5IW3A 1L0QA 2BHUA 3BX7C 5CCKL 3K81A 1UWEH 3VI4F 5KSBB 3KDMA 5F9OL 4AYFA 4NM8H 2EDEA 3CJJA 1FYTD 5FK9B 2EYRB 3QXAA 3CX5K 2NX5A 3Q5OA 2AV7B 4M00A 3WUWA 2AXHA 3CFDA 1UH4A 4FXGB 5J11C 2VQ1A 4H1LA 5MEPA 3EYVA 2EEAA 3DX8B 4KI1A 1DQJB 1NGQL 4E41B 4M02A 4I8DA 1BBDL 4G8GD 1U8NA 1I1AB 4ORGB 1F6FB 3MLYH 3PWUA 4RA0C 3CK0H 4M62H 2X7LA 1JRHI 2BVQA 4RMWA 5C0CD 5CJXC 1J1XL 1IAIL 3QJFB 5EULV 5D6DA 2YZ1A 2DQCH 3QEUA 2R29H 1KEML 2P5EE 3VXNA 1AR1C 1G7LB 3PWPD 4K3JL 4EVNA 3VFMB 1KULA 2ZOLA 5KOVC 2DQEL 2G75A 4P2QE 3DXAD 2YS4A 2DM3A 4UDTA 2KL6A 1IEAB 1PG7L 2OJZL 2PW1A 4KJQC 4WUUA 5B39G 3S96B 4BQ8A 2ICEB 4FNLL 4ZNEA 1JWMB 5BRZE 4P46A 4P59L 2XWTB 4OLZH 2EE2A 3C8KA 5E8EB 1RZ8B 2X4TB 2JJVA 4PJFE 3LKSA 5C0IA 2VXQH 1CFNA 2OS7A 3MA9L 5GGRB 2AAVA 1JYWA 1JFQL 4KHXL 2XWBA 3CMOL 2J2ZA 4HV8B 3TWCL 2A83B 4RFOL 4OLYL 4NO2B 1MHHB 3QO0A 3L7EB 2P4AB 1GIGH 3S37L 3RGVA 3MQIA 4LSQH 3F58H 1TCRA 5FF6B 3RWFA 2ITDB 3RGHA 5I1JH 3N0PB 4V2CB 4X6CF 5JTWA 4HIJA 4XXDA 5FYKH 3O6MH 1VENA 1E27B 1U2HA 3QNXB 4NPYA 3MODH 1ZLSH 3UPRA 1HINH 4KHTH 2VIRA 1P9MA 3G5XA 3LQZA 1MEXH 4M9PA 1AJ7L 4RWYH 4O9HH 2ADGA 4BSWA 5I1LA 3BKML 3VFNB 4PLOB 3DO3A 2IPUK 3T8XB 4WTZG 3DECA 4NFDA 3QYCA 3B6SB 3IDMA 1BJ1J 2DLEA 1G7HB 1H5BA 4RGNC 6CGTA 4PJAF 1MFBL 1P5VA 2ILLA 1E0OB 3EYSH 4Z76B 5IV2B 3P77B 1KGCE 3B43A 3RTQC 3HS0B 5DWUH 4KJPD 1MCFA 1EBPA 1YQ2A 1K3IA 4I2XB 5EU5A 4U31A 2E9WA 1N0XL 1GGUA 3DRQA 4Z7NE 4P5TD 4GW5B 4ERSL 2UZYB 4TVPL 3NN8B 3SE9L 2PCPB 1EK3A 2X4RA 4XT1C 3FZUC 3VA2C 4JFYB 5TFSL 5F93C 4NYLB 4LCWB 4LSSH 1T2QL 2A0LC 1YEIL 3MMEA 3H3BC 1SMAA 1NQBA 2VE6A 4OQTH 5DRWB 1EA9C 2VXVL 4BK4A 2XN9E 5DDHB 1EJOL 3HZVB 4TSBH 5IF0B 2BY2A 1F02I 5E8OA 3GI9L 5GRWA 1DQMH 5MP6H 3LV3A 4WWKC 2CUIA 4MXWH 1IC1A 3FO0H 2BRQA 1XGYL 1UM4H 4JKLA 1MF2H 1HOCA 4WJ5B 4HIIA 3RX8A 3Q6FB 5DMIL 5F88B 3VG9B 1U8OB 2R8SH 3TO2B 1GGIH 1W0VA 4PRPA 4YPGB 1HHIB 3TCLB 4L4VD 3VXQB 3V79C 2Z4QA 5TF1L 1YC7A 3IETB 1Q9WA 5DXWA 4DKFL 2DM4A 1A6UL 4X0KA 1C5CH 3RVWC 4EUPH 5C2BH 5JHDA 5IW1A 4XC1H 4P3CH 2O5YH 4EUPB 1HXYB 2CMRL 3QNZA 4YDVA 5HY9B 4MXVE 5CSGA 4TOYH 4KUCF 3JV4B 3WIHH 3E8UH 4ZTOL 1CQYA 1QRNB 1BD2A 3O3AA 1UM5L 3CSYB 3I6KB 4U6VL 1YPZE 2NYYD 1R3LA 2G2RA 5JQ6H 3SJVD 2VZVA 3QUXB 1T6VN 4XP1L 5AYUL 4HT1H 3CNKA 1A6TA 3AY4C 2PW2A 3DRTB 2IAND 3WIFB 1PKQE 5ANMA 3U7WL 2AXGA 1DBBL 4UOW1 3VWKC 2XTLA 4JZOA 3ZDZE 4NUGH 4Y19E 4Z7VE 4NQDD 5FOJA 5C0FB 4HGKC 1KN2L 5MENB 1JWUA 3UTTD 4C83B 2H1PH 4KI5D 4DFIA 2O5ZL 3PE9A 4G6AC 4O00A 4IRSA 2FO4A 1XF3A 4WY7L 4WTXA 5D70H 1ZS8A 2NXYC 3ARWA 4ONGL 3GKWH 4M7ZB 4UT7H 1AIFB 5EO1B 5C0DB 2BNRE 3LKNA 4X7CC 2IAMD 2VSCA 3UEZA 3QISA 3IVKB 3BVNA 1AGEB 2ORBL 3MLUH 1YEDB 2VXSH 4RMTA 3U6RB 1NDGA 4MVBC 5IKCA 3P4NA 1NUNB 4S2SA 3ELAT 4X7EC 3MRKB 1J05B 5DRZB 4D0DA 2MMXA 2P5WB 5E08H 5E2VL 4G43B 5GGUA 3RU8L 1T5XB 2AEIT 3R0NA 1AE6L 4ZYKA 3ZE0E 4KROD 3QHZH 1BX2A 3WLWD 1BF2A 3LKPA 1UQSA 3VMNA 2DKUA 3OAZK 3UO1H 1YEKL 5DJZB 3GSRB 1V7NL 1ZWIB 1A5FL 5IB1B 3BP7A 3VXRE 2EDDA 2XZAH 3X3GL 1KG0A 4W81A 4GAJH 4KRPB 5EOQL 1U93B 4OZFG 4EQ3A 1JYNA 3QQ9C 3IXTB 5LWYL 5KVEL 1DBJL 3IKCB 2Y07L 5ISZB 4GSDL 3OKOB 4HG4J 4TN9A 4Y89A 3FL7A 1FE8H 3LEVL 3QUYD 4OV6F 4LPTA 1MIEL 2HRPH 1F6LL 2JCCA 4TQEL 3LCYA 3L7FA 1GL4B 5ESQB 3TZVA 2CKBL 3JV6A 1WIUA 2F5AL 1HYSD 3SKNA 4QXGH 1GRWA 5I66B 3QCVL 2R2BA 1JYVA 4A2LA 1F3JA 4HZLB 3O4OB 1AQKH 5F9JA 2CSPA 4KKNA 2HJLA 4PRHD 5FCUH 4M8VA 4ODUA 1P4BL 4L3AA 3GJFA 5FGBC 4X7SH 1NFIA 2EIDA 3QQ4A 1J8HA 3VFVA 3VW3L 4XB7A 5DT1H 3B2UD 1HEZA 2Y4SA 5HHQB 5T33L 3AM8C 2VL5B 1OSZA 5EORH 4AL8L 4JZJA 1P7QB 3WFHB 1U6AL 2H45A 1PSKL 2DS4A 3GRWH 3CDGB 1QBMH 3NZ8B 1P6AB 3WD5L 3INUH 5CJBA 2DIAA 3D0VA 3W2DH 5IOPA 3PDOB 2VDQH 1IJ9A 4P2RB 4WNQA 1TZIA 2R39A 4X8JA 2IPUG 2NY0C 5HYJB 5JW4M 5GGQH 4F57H 1S8DB 3L3DB 1JHTB 4FQCH 4HS8H 3B9KD 4DGIH 4IMKA 2A77H 3C08H 5L2JB 5C09B 4LRIA 3H7BA 3DUUA 1MFCH 3AREC 2BOCA 1CDHA 3S5LB 4K3GA 4NP4H 5E1AB 4EBQH 3RWCA 4HKBB 3IDJB 5GGRY 2ARJA 3VI3E 1J0HA 3BZ4A 4PJAE 1U58B 4RMQA 3K2UL 4CVXA 4R0LA 3WL9B 32C2B 4X6DF 3S3JA 5FM4A 5FUCC 1BIIA 4H8WC 4MZ2A 1OCWL 1YJDL 3MRJB 4WW2A 4YHMH 1J88A 3DX6A 5DC9B 4OT1H 4G6KL 5E1HB 1FZJB 4IDLA 5KAQF 1XMWA 1FIEA 1CFSB 1YN7B 4JR9L 2AGJH 4OGAC 4PS4L 3X13B 2BVOB 1BQUA 1HNFA 3ISWA 1BGXL 2UZXB 4LQ1A 2F8XC 5K59E 5C0JB 3VRIB 1NL0H 4GBXB 2B5IC 3QULA 2JB5H 1IQDB 3ARDB 4NQEE 4Y4KA 3WO4B 2P5ED 3MLXH 4MMXC 5DD3L 2ESVB 4YNYA 4Z0BH 1T04A 5DEGA 5J1SC 1INDL 3SCMB 4ODHH 4A2MA 3T0EB 3ZZ1A 2GAZB 1OGAB 1OLZA 5CEZD 4IS6A 2BOBB 3BWUC 3BT2H 4MS8D 1FVDB 2J6EL 3NACL 4H20H 3TNMB 3CVHA 1YA5A 1H8OA 4D8PA 5EIIB 4N1HB 1VACB 2YEZA 2E9IA 1EVTC 3HB3D 3WIIL 5ADPH 1MHCB 1MLBA 3DIFB 3MLTB 3QA3A 3C60C 4YE4H 3DX7B 1KPUA 3RNKA 5A2IH 4EXPX 3FQNA 1NBVH 4OZIB 5M94B 4ZAKC 2YD4A 3ULSA 2OXGA 5EPMB 1NUGA 3M1BA 5BRZA 4BSVB 4KTDH 3TBYA 1GSMA 3OV6A 5IIEB 3DUHA 4LFHG 4UTAH 1JGUH 3BXNA 2WUBL 4PJFA 3VFTA 4TRPH 4J1UA 4LU5L 4XAKD 3K7UA 1C08B 1CE1H 5I1IH 1BPVA 4HBQA 4CNIB 1AGDA 1NCCL 2ATPA 5EC1B 3U0PB 4Z7UB 3L5WB 1ZAGA 3D3VA 2IQAA 3QZWB 1XGTA 4WRLA 4KK5D 2FR4A 2D7OA 1A22B 4UINH 2FX8H 4LCWD 1GGCH 5I17B 2V5TA 4I0PC 4P5MB 4JQIH 5T1KB 2B2XL 4K8RC 3WNLA 2ZKHL 1N6QL 1EERB 2ZSVA 2X9WA 4PJXB 2W9DH 3SGDI 2YHGA 1A0QH 5D1XA 3D25B 2PO6D 4YBQD 2Y06H 2YUZA 2IG2H 4FQ1H 2E7BA 4HK0A 2E7HA 1OARL 4UV4H 5C3TA 1G9MC 2J4WL 4WFFE 4LLUB 5TPWL 5JW3H 3O4LB 3IGAA 1I9JH 2AJSH 4WI5A 1BFSA 1LEKB 4KQ4L 5FYJL 3L6FB 3KPLB 4JO4L 4NKOA 2JIXB 3VRLF 5HYSG 2VABB 4K71C 1F11A 4APQB 4ZPTA 1J87A 1T66C 1Q9KA 3CH1B 1MREH 1WEJH 3MOBH 4Z95L 5IBLD 4G3YH 1A6ZB 1HH9A 1AC6A 1KJ2A 1FG2A 3LN5A 1MJ7H 2XTJE 4U1MB 5TE4H 2P43B 4XP5L 2MCG1 1XCQA 1BZ9A 1V3KA 3C6SA 1MJ8H 1D6EB 4AH2A 3AU1B 4OCWH 2DI8A 3MJ7A 3NA9L 4I4WB 3QUXD 4O2CA 4LVNB 1CD8A 1T21A 1U92A 4RNRA 4JE4B 4DGYL 4GKNA 3LS5H 4CVZA 3P0GB 4UAOC 4Z6AT 3OKEA 4PJHF 4KMTH 3L3KB 5FUCE 4NCC1 2GT9B 3LD8C 2GSIB 1M05A 5MEND 4ZXBA 4GXUM 4WW1B 5D2LF 2R15A 2BFVL 5T1DH 1OD7A 1OOAA 5IM7A 4R9HA 3GMLA 5IVZA 4LSUL 2R29L 3PL6C 1EFQA 1QR1A 4DZ8B 4HUMB 4KDTC 3PHOB 1HKLL 1F8TH 1U95A 4FTVE 4XPHH 4HXAH 3K3QA 4MJIA 3VGBA 3QXAB 3KWWB 4AZ8A 1YPZA 2NX5B 5I1EL 3QDHA 4QWWD 2CIIB 4H1LH 2EXWD 3KPOA 2VQ1B 4H1LB 4KI5F 1I8KB 5MEPB 3EYVB 4K3DH 5EU4B 1ZHLA 2P5WD 1LO5A 1IC7H 4IIQC 3EDDA 1PKQA 2QHRL 3T3PF 1LGVA 4RFNB 2UWEB 4CADA 2D31A 1W8NA 5FYJU 1NSNH 3F7QA 3VGHA 5B8CC 2X7LB 3JWNC 1GIGL 2DM2A 5DLML 5F6HI 3F58L 1F97A 5GGTA 5I1JL 1RJLB 4MHHG 2IC2A 3VXNB 3V5HB 5FYKL 2ZOLB 1ZGLP 4BQ9A 2IH1A 4KRPD 4GXVL 1C16A 3ARBB 1FAIH 1RK1A 4N8PA 2ENYA 1H15B 2PW1B 1U8MB 4NRXA 2R4RH 5ISZD 1KNOA 3WS3B 5B3NA 4P46B 3QDMB 2DF3A 3VU2A 1YUHA 1BHGA 5GHWL 1OT1A 3MRDA 2ERJC 4XHJD 2LVCA 3LKSB 5C0IB 1RIVL 2J5LC 1S7UA 1RURH 5BJTA 3EYSL 1FNHA 4CMMA 4HS3B 2P44B 4R7NA 4XGZA 4XZUB 1QLEH 4GMTH 1T7YA 5HGAA 4G80A 5DQDH 1T20A 3QO0B 3HRZB 2UUDK 3PF2A 3LRSB 4LNVA 3U9UA 3RGVB 5FGRA 1TCRB 3RWFB 5K93A 3GSNL 5CLWA 2QJDA 3UDWA 3ULUC 5ITFA 3MGAA 5JOPE 4NPYB 3OKMB 3VXRA 3UPRB 1P7QD 5IHBA 2CDFA 2VIRB 1G7QB 3BKYH 4PJGB 3G5XB 4M61A 4TSBL 1GOFA 1YNKH 2AEQL 3ZT6A 4RX4D 4P2RD 1UXSA 3KLDA 3QIBC 3ECBA 1UENA 5HYJD 3GGWB 3B9DA 3UP1A 2ZPKH 4N0CC 5L88H 5IBTH 1H5BB 1YEHL 4TULH 1T1XA 3VFPB 5C09D 2JTDA 4B0MM 4MNGE 3N1MC 1DVFB 5T3XL 3TGXA 1VFBB 1DE4A 2AK4E 1FNGA 1AXSA 2R8SL 4UDUB 5CJ5A 1JPGA 2QEJA 2X4RB 2XACC 4KV5F 4XXCC 1LK3H 2JJWA 1I7TA 5KN5A 2Z8RA 1BVZA 3HMWH 5FYKU 3MJGX 4OF0A 5FHBL 2P1YA 4P3CL 1A1MA 2VE6B 2ATKA 4Q58C 5GQBA 4FHBD 4YHKL 3LQAC 2EDTA 3P9LA 4HUWB 3RI5K 4Z7WF 4JJ5A 1QNZL 5E4EC 4TOYL 3WSQL 5EU6E 1F45A 3WIHL 2NNAA 2VLLA 1Q72H 5E8OB 1WBZB 1CICC 4L1DA 1ITBB 2HTKD 3K80A 2V5MA 4IJ3B 5KSBF 3RL1B 5JQ6L 5KANI 1IC5L 1Z0MA 3AB0B 3HC0B 4GBXD 1HOCB 3DETD 2IQ9L 1B6DA 1S5HA 4ETYA 2HFEA 3ARDD 4PRDA 5CKAA 1LE9A 2AERT 2Y25A 4G42A 2ESVD 1OAKL 4MD5A 1HHJA 2VR9A 1MVFA 4PJAA 1RIUH 3SCMD 1ZLUH 1HNGA 2Z4QB 1I9RL 4Q6YA 1OGAD 1UVQA 3H8NA 3O2DA 4C54A 4KK6C 2DDQL 2ZUXA 5DMKA 5IW1B 1NGYA 2AQ1A 2LQRA 1OL0A 1N4XH 5JA9A 4GW4A 5T1MA 4YDVB 2Z0BA 5EU7E 2VNCA 4Y16A 5A2JH 3QDJA 5DJ6A 5I71B 4LLYA 3KYNB 3RVVD 4JFHE 5F7UA 1BD2B 3U83A 4ODBD 1CWVA 3LMJL 3WMSA 3FFCE 3VWJB 4J7RA 5FEBA 2VXSL 1Q9LB 1FORH 4ELME 5F9WC 4NO3B 4EN3C 1S9VB 3P0YH 5DMGD 3VDAA 4QXTA 5E08L 2AXGB 2IH3A 4NQEA 2SEBB 4CN6A 4YHOL 2VXTL 2J88L 3WEXA 3EDFA 1S78C 5INCB 5E5UB 4LLVA 5E2JA 2CKNA 2GCYA 4DVBA 2HA1A 3AY4A 3U7YH 4MAUL 3NVQA 4OUUA 1JNHA 3RKPA 2AEPL 4U3CA 3RVUD 3MUY1 3VWKA 1XF3B 5FGCE 5ECJE 1EPFA 1ZS8B 2Y36L 3UTQA 2VRAA 1FG9C 1QBLL 5J6HA 3TYGL 3NIDF 1KBGL 3LKNB 4Q2ZB 1PZUB 2E9JA 1RUML 4NHCL 3MRLA 5EUOE 3DMMC 3EFFA 4LSDA 1NDGB 4HWBA 1FE8L 1VDGA 3PWJA 3L5JA 4M7JH 3P4NB 4LIQH 5KOMC 5E2UH 1R3IH 4GUPA 1BOGA 3GMQA 3AS0A 4MQTB 1U3HB 5T1KD 3N1GC 3H9HB 4KPHL 3N9GL 4CDGC 5L0QB 5F7WC 4N0YH 5FXCH 4WV1C 5T5FH 1NCBL 1UQSB 4XP9H 5SX5K 4OFVA 5C0BE 4HJ0D 4LASL 5JLZA 1GHFL 2A9NH 2APVA 1W72H 1EO7A 1K8DA 1LVEA 1W72B 5DT1L 3MYJA 3BP7B 4Z7NF 4OAWB 2OL3A 4I5BB 1KG0B 1CBVH 3A6CL 2EIEA 3VE0A 1ZT4B 4OKVA 2W65A 3O4LD 2EIZB 5E7FA 1AD0A 2XFXB 2P24B 5BVPH 2ZUSA 3GSUB 1KCLA 3W2DL 2JIXD 3BJLA 4APQD 3CDCA 5GGQL 3EO0A 4F3FB 4R26H 3GSQA 3EJZC 3EO9H 5C0AB 5DO2C 5F7DB 5LJYH 3TZVB 4P9HH 1MFCL 4MJ6A 3SKNB 3LDBB 1QO3A 3B83A 1BFOA 1MSPA 2HT4C 1F3JB 4NP4L 4O02L 3FN9A 4X4YA 2YRLA 4EBQL 4KZEH 5F9JB 4BFIA 1MI5E 1A7BA 4JFEE 3GJFH 4CGTA 5D4QA 5ALBH 1XF4A 1YEFL 1Z9SA 2XI9A 3GJFB 5LKNA 4BUGA 1NFDA 4ZO6A 3QQ4B 4QGYA 5IJKA 2VQUA 3VFVB 1OB1A 3DURA 4XP6L 4JKKA 4M5YL 3U0TB 1OLLA 1HEZB 3MV8A 1ES0A 1GC1L 1NCDH 1ZE3C 5K9OA 4RAHA 1NGPH 2VJXA 1V7MH 3SEPA 4YHML 3LN4A 5FGBA 3N85H 2VQTA 2J8UB 1D3CA 1X5YA 4H88L 2NY4C 1IRAY 2YA0A 5IOPB 1TVHA 1TZIB 4X8JB 4DKDC 1WF5A 3AM8A 5D1QD 2VLJE 4XX1E 1B6UA 2A38A 3TVMC 2KUTA 2Q86A 4U7SA 3H7BB 3DUUB 1ACYH 1N8ZA 2EDNA 5E00A 5A43C 1HXMB 5EB9A 4OD3L 3LAFA 5L7XH 2K1MA 1SVCP 2JB5L 3DYMA 5J12C 1ZT7A 2DTSA 4MJ5A 3MLXL 1QD0A 1Q94B 2KPNA 3AS2A 3C6LB 5DJAA 4Z0BL 3IDNA 2CO7B 3ARQA 1FRGH 4CVXB 2E27L 1J18A 1CF8H 2NX5D 4ODHL 4S1SL 4JDVB 4XRCA 4PJ9C 4PJBE 5TQ0H 4ZQKA 4IOFD 2XZQL 1GGBH 4Z7VF 4ODTH 1GJIA 3EYFA 2X1PA 5D7IE 5ESAA 1IGCH 3LPGA 4M3JA 3X12A 1IBGH 5CZKA 4H20L 4YHPA 4ZFOB 4KAQH 4PLKC 4M93B 3F62A 5I8OH 1KT2A 5HI5C 3O3UN 4PP1D 5CP3H 3OX8A 1G7PA 3I9GH 1M1SA 3RZWA 3ARBD 4Y4KB 3IS0X 1WBYA 5DGRA 4YNYB 2PXYC 4FTVA 2ZSWA 4P46D 3QDMD 1FSKC 2Q76B 4MAYB 3Q2CA 2EE9A 5CZVH 1SEBA 1J0ZA 4IS6B 4GQ9H 1JGUL 3VXUD 3A6BL 4ZUSA 3ZE0F 4NBZB 4RBPK 3AS3A 4ONFH 3UPCA 3GHBH 3H6JA 4XWOC 5F9AC 3T0XA 2A9ML 3KLSA 3BHBB 3SDYL 4TPRL 2FBOJ 3G5YA 3FQTA 3U1SH 3O9WD 4D8PB 3WFDH 2E3VA 4G8EA 3RGVD 2YEZB 5E03A 4WO4A 4PREA 4XCYB 4QOKE 4YR6A 3BRGC 1ZK9A 4U0RB 1MLBB 3VXSE 3QA3B 5I0DA 1GGCL 4KKAC 4RISL 1KPUB 3GM8A 5E99L 4OB5L 3AMLA 4JQIL 3FQNB 4J4PC 4X9BA 1DLFH 4JHZA 2B1AH 1JHLH 4OCSL 3OTTA 5IB4A 1NGZA 3UTSE 3C60A 4PG2C 5IG7A 3OWEA 3TBYB 4I18A 2W9DL 4KKCD 4JFDE 1T83C 4XPGH 1SM3H 3LZFH 3BXNB 1H8SA 4G7YL 4ZAKA 3VFTB 2IG2L 1YYMH 3HA0A 1DVFD 1AGDB 5D1ZA 2YRZA 3MBXL 5I8EB 1SEQH 3BMVA 3BIKB 1Q0YH 3D3VB 1JF5A 3MJ9A 1XGTB 2AJSL 3IF1B 3QIWB 5EDXA 5IFAL 4M6ML 4LF3A 1GZPA 3OJMB 5H2BA 3SGEH 5C70A 5T1LA 2MJWA 4NSKA 5F1IA 4QHNB 2DBLL 2HMIC 2DJ4A 2ICWJ 3MJ8A 5HHPA 2R9HC 4R90H 2C9AA 4YXLH 1RK0B 3MXVH 4HWZA 2E5EA 3TFKD 2H32A 4M7LT 4JDTH 5J0BA 5CGYC 1I3RA 5LBSL 25C8H 1FZMA 2KH2B 5I1AB 2EC9U 1OAZH 5D1XB 1MJ8L 3MRQA 4WI2A 1IM3B 1FJ1B 2OJEB 3FTGB 1S7RB 1X7QB 1AHWC 1MUJA 4HK0B 4B5EA 5C1MB 5CMAA 2F5BH 5A3IC 1Q0XH 1REIA 2PYEA 3QDGA 3E3QC 4JAMB 2AKRB 2IWGA 3IGAB 3FOLA 4XI5D 1A1NB 4KMTL 2FCBA 5E9DE 5ICXA 1X4YA 4FFVD 4LVOB 1TTGA 4NKOB 5GIRA 2A6KA 4ETQB 1F11B 3L5XH 4MA3B 4ZPTB 3H42H 2BSTA 4LLAA 1RIHH 3ZDXF 1Q9KB 4QCIA 5T1DL 1B90A 3BWAB 3HE7B 4YUEH 1RPQA 3RX7A 4XCEA 1KJ2H 4RAVA 5JPNB 5JPMA 4PJ8C 1HH9B 4N5UA 1KJ2B 1YJDC 3UBXA 1RHFA 1FG2B 3LN5B 1RMFH 1WLHA 4HHAA 5EU6A 1KYOK 1BD2D 1BZ9B 4BK5A 3C6SB 4Y5YB 3SKJL 3VWJD 4AH2B 2FH6A 2L7UA 4UILL 1OP5H 3MJ7B 5DJYA 3HFML 3TV3L 4NO0A 4QRQB 5D72L 5GZND 4KUZH 3Q48A 1T21B 3MV11 2QKIA 1U92B 4GKNB 3TYFA 3WV0A 4HPYH 4U1JA 4CVZB 4JKPL 4PY8I 1IC7L 3OKEB 5JW4Q 2P8PA 1UB6B 3SHSA 1SYSA 4M1GL 3WHE1 3I85A 3ZYIA 2K9UA 4LAJH 3CDFA 3EAKA 1M05B 1S7SA 4ZXBB 2DI9A 1NSNL 4IOIB 3ZHDA 2EZ0D 4KY1H 1I8IA 2J1KA 1A3LH 1QEWA 3GMLB 5IVZB 3QCUH 3P11L 2UY7A 4GKZA 1E28B 4XAWH 3NCEB 1QR1B 1P4LA 1HIML 2EXYC 4S1QL 1UJ3C 1AXIB 3NCJH 4WWID 5SX4H 1FAIL 2A6JA 4OZIF 2XA8H 1N64H 4Z7OE 4MJIB 5AUMB 3PL6A 5DC4B 3KYOA 4OZHE 1DQQA 3MBEC 4PJCE 2CK2A 4WTZA 4Y4FB 4NJAH 4KDVA 1VADB 3S3SA 4EI6A 3V4PH 4ELMA 1CXKA 3MA7A 1U3HD 2CUHA 1UEYA 3JSSA 3PGCA 3S9DB 4Z7UF 2EH8L 3ULVL 1EHLH 4LHJB 3S4SB 5J11B 1U0QA 1X3DA 5FV1L 3MRGA 1E4XL 1NEZG 1Y18A 1V5JA 1UWXK 5GGTH 5DJDB 3VFOA 4JPIA 4LRNL 4IIQA 2I9LA 2OTWA 3RIAF 4LKCA 1N5AA 4GRWE 3CFEB 3WUZA 2MPAL 4HLZH 1JYXA 4IHOA 2IH1B 4QHKJ 5B8CA 1JV5A 3R06B 1C16B 1RK1B 3BKYL 3GMNA 4FMKA 2RGSA 1NLDH 3D9AH 2D2OA 1YUHB 1PEZA 5EFIA 1FIGH 2EKSA 1CLYL 3N1PC 2ZJSH 3NIFE 3MRDB 5TQ2H 1BJMA 3GM0A 5C0AD 5LG1A 3ZKNC 4RIRB 2C4XA 5GRUH 3TN0C 3ME0A 5C6TL 1A6VL 3DV4A 2Y23A 1A7RL 3MLZH 5JUEL 4R7NB 4XGZB 2ARJQ 2IPTH 5CGMA 2VZTA 1NCTA 3L3OA 3PDDA 4JO3H 5F6IC 1FDLH 1WIOA 2R1YB 1A7QH 1MFNA 5E8DH 3U9PH 1LO3L 3U9UB 4RFEB 1FN4A 1R5IA 1G6RH 3HG1E 2Z8SA 5C0BA 1G6RB 4C58B 1MI5D 5FA4A 1LK3L 3P9WB 3UROR 3CXHK 3FO9A 5ITFB 4KJYB 2E7LC 1L9MA 3U30C 1UT9A 3GO1L 4N5ED 2CDFB 5IW6A 2O61B 3OKDB 4R3SA 1RFDH 1WAAA 2LAAA 2P8MB 4LEOB 1UXSB 1B88A 1Q72L 4MCYA 2JJSA 3J8F7 1WZKA 2F53E 1T1XB 4MDIA 1WISA 1T4KB 4MCZB 5DMJB 2VLJD 4D94A 4PBXA 2BVPB 3F12B 4Y1AE 4JN1L 3QIBA 5IROC 3WKMH 4X6BB 1FNGB 3STLA 4RGNB 1AXSB 4ZFZA 4XTRD 2GTWA 3C6LD 4JFEA 4K23L 5D8JH 2ZUVA 43CAA 4G9DA 1JPGB 5J1AB 5KS9F 1YNTA 2H26A 3RTQB 4FFYH 4XHQA 1I7TB 4M1DL 5KN5B 1K2DB 3JTSB 2WP3O 1FNLA 3VH8B 1JTTA 3D5OF 2OTPA 3JWDL 4XMKL 3SBWC 4AENB 2P42B 4JJ5B 4P23A 5DD6A 4XXCA 2FJHB 2VLLB 3D2UB 2FDBP 3F6LA 4OFPA 3Q6GL 3HE6C 2ZNWA 4OV5B 4UT6L 2MKWA 2VDML 1S5HB 5CD5D 1CICA 1GH7A 1LE9B 4UOW0 4G42B 4QRSB 1U8HB 2OXHA 4WWKB 1DBKH 4MD5B 5C8JA 1JVKA 4MNQE 4JRYE 1U8QA 4MAYD 3QEGH 1VFMA 2UWEF 3O2DH 2DL2A 1UVQB 3MYZA 4L5FL 1EFXB 4NHUA 5DMKB 1NGYB 2APFA 4PJBA 1LILA 5K9QI 4GW4B 4J2XA 3RAJH 3LS4H 3QDJB 3O8XA 1YEGH 4FQXC 1MH5A 2H8PA 1ZHBA 5EG6C 1ZLVH 3P4OB 3MRBB 3TT3L 4JQVA 3K1KC 2Z31C 1MFAH 1UH3A 3EJJX 4M7JL 4N8CH 5E2UL 2GUOA 4NC2B 4XPTH 4QXTB 2NY1C 2VSDA 1MLCA 5JOFA 5IFHL 5CGTA 5BVJB 3OQ3B 5J3HD 3FQWB 2YC1A 1EZVX 4N0YL 2ADIB 1S5IH 4LLVB 1FH5H 4ZDHA 4DVBB 3UTPD 4XP9L 1HH6A 4OUUB 2ARWA 1ERNA 1VEOA 4OM1L 3VWKB 3UTSD 2C7UA 1CL7H 1T3FA 1FFNB 2VLKB 5C07E 3CLFH 3B2VL 2UVFA 4LCCA 5GS2D 3W11C 3IT8D 5CZXC 5J6HB 3JV0A 2JLLA 1I4FA 5AZ2H 1BZQK 2ID5A 3D3VD 3K74B 3WUWG 3CLEH 4PJGF 1CIUA 4F7TB 2XY1A 3MRLB 5CUSL 3QIWD 3MFGB 4HUXA 4HWNA 5I1CH 4HWBH 5J89A 2NXYB 2VITA 3CZFB 3NMEA 4MNHA 12E8L 2FWOA 4HSQA 2IALA 2FHCA 3G6AA 3FO1A 4UV7H 5ALCH 4NKQB 5EWIH 4XB8A 4NC1C 1IGYB 4R26L 3VXSA 3V0WH 4GUPB 1BOGB 3GMQB 3P4LA 3MRCA 4AIZA 2ED7A 4P9HL 3CC5B 1D6VL 2DQHH 4XPAL 5INDA 4Y4HA 1T7XA 4KZEL 4LP4A 2IMNA 2B1HL 3FKUS 3IFNL 5D1XD 1D5ZB 3BZDA 5ALBL 4UUJA 1DCLA 3W39A 5KJRH 4W4OC 3BUYA 4JFDA 1ZHKA 2FECI 5DQ9A 2LU4A 3TO4C 3VGEA 5TGBA 4DW2H 4BELD 3BD4A 2NXZD 3MYJB 4WV1A 3V5DA 3V6OC 5E6ZA 4AY0A 3DVNA 1NCDL 3GMOA 3W81A 1V7ML 1OP3H 1MJJA 4BSJA 1GOHA 3M8OH 2W65B 3MUZ1 5FYLE 4DKEH 1AD0B 3MGTA 1P5UA 4XVSH 4LCUB 2NZ9C 5LCVL 4QRRE 5JIPA 4XNYL 2N7BA 2YSSB 3V7AE 5AD0A 1IAIM 1LK2B 5E9DD 1RD6A 3X11A 3KJ4C 1IAKA 3HE7D 5AYQA 4S1RL 2X4OA 4MJ6B 1E4JA 2VKWA 2FECL 5L7XL 3IU4L 1BQSA 1MIML 2GJ6E 3MFFB 3WNPA 4X4YB 4HMDA 5IMMA 4XMLL 5FCSH 2VC2H 3EYOA 2BSSA 4HEPG 4CU7A 1G9NH 1N6UA 5D7LE 1CF8L 1FL3A 1NFDB 1KACB 3UAJC 5ACLA 1OB1B 4NQXA 3IDGA 1XEDA 5E94A 3MV8B 2R0KH 1RY7B 4NZUH 4JM2A 5SWQB 5C9KA 5FFLA 2DWDA 3QXDB 5DFVD 1PLGH 5FDYA 4IRJC 2VH5H 2YZ8A 1JPTH 3JTTA 4JZNB 4ZXBD 4NGHH 2WINA 4GG6A 3QCTH 1KFAL 4RGOH 3QIUC 2AQ3A 4YDKL 1N8ZB 5E00B 2B0SH 3DI3B 3D87B 1G0DA 4YXKH 1RU9L 2NY0B 1MJUH 1CQKA 1F3RB 3BMWA 2VDLH 3TVMA 5DJAB 3IDNB 3F7YA 4JREC 3M17B 1OTUD 3AREB 4Y4FD 3EOAA 5CZVL 1K4CA 4XRCB 3IJSB 4ODXA 2YMXH 1JWSA 1MCKA 1JZ6A 3LKOA 5I1DA 4RZCB 4ZQKB 5DRNA 2VLRA 1I9IL 2UVEA 4ENEC 3EYFB 1T1ZB 2DD8L 4OCYH 5ESAB 1ZLWK 3CVHL 4XVTL 3IDUA 3BESR 1ZA3B 4H8WH 4BZ1H 4PJ9A 5CP7A 4QT5A 2WP3T 3WFDL 4OGXH 2D0FA 1WWCA 2NTSP 1L0YA 2R56L 1JNJA 3WJJC 3HHRB 4F80A 5I18H 1XH3A 4BKLA 1YEEH 4XNZC 2EE6A 3GBLA 5TDOB 4WFEE 1WBYB 2HFFA 2APTA 1O0VA 3SGEI 2B1AL 4Y2OA 1AR1D 3KPRE 4LDEB 2EICA 1R3HA 2B5IB 1SEBB 1SM3L 4N0RA 1IGIH 4KJQD 4QYOB 4ZUSB 3DGGA 2DI7A 4PJEE 2PXYA 3GMRA 1YYML 4OCXL 4WHCA 1CG9B 4KKBC 4JPWL 3S35H 1BFTA 1KLGA 3LH2L 4TUOB 1ZHNA 3G5YB 4XCCL 4RDQG 1Q0YL 5CSZA 4G8EB 5E5MA 1E6JH 1FO0A 4K7PL 5J4MA 3B5HA 2JK5A 4EZMA 5ICYA 4NQTA 1LO4L 1MCCA 1W0WB 1S7XA 4M7LL 3X17A 1A14L 4R90L 4YXLL 1Y6NR 4A6YA 3KXFA 3W9EA 2J12B 5MEQA 1DFBL 2CDEA 2CIKA 3HPJA 2HVJA 3C60B 4TTGA 4XBPA 2BHZA 5JHLL 4I3RH 25C8L 1VEPA 1OAZL 3OR7A 4J4PA 4ZAKB 2PTUA 4U1IA 3P9MA 3GBNL 2OZ4A 3SE4A 2FL5A 1R24A 4PG2A 2JF1A 1OW0C 1TLKA 4UNTA 3WNNA 4RGND 3KYKL 4NFBA 4CVWA 4OF7A 3FJTA 4ODVL 2CR3A 2J8UF 3RTQD 3V6OE 5H2BB 4NSKB 1R6VA 3FONA 3L5XL 4YHIA 2CKBA 3CZJA 1M71A 1LO2L 3S36X 2H32H 4R6UA 3WXVH 5HYIA 4HWZB 3FZUD 1GC1C 2H32B 2VZUA 1BF8A 1I3RB 3L3HA 1FPTH 1P7HL 3KPQA 3V4UL 1RMFL 4AEIH 3D2UD 1LNUA 4I0PB 2MKLC 1FZMB 2A0LD 3MRQB 1CXLA 4K8RH 4O51B 3SE3C 2DQJH 2G9HA 4PTUA 1MUJB 2NW2A 4KUZL 4LNRA 5SX4I 1WT5C 1ZT1B 4NQCB 5EZIL 4ZUUA 4YQXH 4KU1A 5C7XL 2OX5A 4Y1AA 5GS1A 2PYEB 3QDGB 2X70A 4LSPH 4TSCH 1SY6A 4NN6C 4WWKD 2RR3A 1ZTXH 2AABH 4JO2H 1CGSL 1G9MH 4C56E 1G1CA 2OCFD 3KYAA 2BSTB 4KY1L 1X5LA 4QCIB 1EFXD 5D7IF 4UBDC 4KTYA 1A3LL 2BCKA 1KIQB 1CD9B 1KB5A 4RAVB 4XCEB 4ZODA 4K71B 4LBEB 4QKXB 1QSFE 5DD5L 3QRGH 3O2WH 4HHAB 3RVWD 5IB5A 2XA8L 4R4BA 4KTEL 3HC3H 3CFCH 1Y0LB 4OTXH 4NO0B 3SGKC 4HIHA 4E42A 1NMAH 3IB4A 2ICWA 3NA4A 1B0GA 2VXUH 3NCCB 3V4PL 4G8FA 3TYFB 4X7FC 3MV9D 4H0IA 4MLIA 5F7EL 5HHME 3J7HA 4ZFGH 1EH9A 2X1QA 2AJVH 3VI4E 5F96H 1LP9B 1S7SB 4JRYA 4ZSOB 4FQJL 4OSUH 2PYFB 1I8IB 4FN0A 1YY8B 5GGTL 5KSUA 4UAOB 2J3SA 1QEWB 3MZGB 5HPMB 1YEJH 3KPMA 1CGWA 2BY3A 4D9RE 2VLKD 4GKZB 4AQOA 5BS0B 2XKNA 1FC2D 1P4LB 8FABA 3LD8B 1D7FA 1X5AA 4ONOA 1UZ6F 1KPVA 3G6DL 4G6AD 3HUJB 1XCTA 1TPXC 2A6JB 3DVGB 4XC3H 3NPZB 5F1KC 3TBWA 1NLDL 1F6AA 3PL6B 5L2KB 2NXYD 3KYOB 4LCIH 4PPTA 5JIHA 2HWZL 1DQQB 1QSEB 3H9SE 2XQBH 1FIGL 1AI1H 1UJ3A 5IMOA 3HMXA 3H0TA 3MA7B 2J6EA 3MREA 4HUVA 1MQKH 3ET9F 1HN1A 2H3NA 5D5MF 3MBEA 2EDKA 1KPRA 3IFOA 1HZHH 3MCG1 1SYVB 3R4DA 4K7FB 2Q3ZA 5EC2A 1A7QL 1PG7X 1Q38A 4L3CA 3U9PL 3RNQA 3BGMA 3VFOB 4IIQB 4RMSA 2OTWB 4LKCB 1N5AB 4HBCL 3DROA 1A2YA 4R8WH 3ARXA 1C7TA 5C07A 2YA2A 5CWSA 1A9BA 2VYRE 5CKGA 5B8CB 3WFCL 1WBXA 4H25A 3I02B 3GMNB 3U36A 1RFDL 3BEWA 3RA7H 5D9SA 3LSOA 3OF6D 5EFIB 2EKSB 2HKFH 4JY5H 4MD4A 3S37X 2WBJA 3QQ9D 4KH2A 4LGPB 1FP5A 3LRGA 1AGCA 4U1KA 1Q1JL 2HJFA 4X6CE 4Z5RA 4UNVA 3DV4B 5IGXL 1H3GA 1EAPA 1ZVSB 1NKOA 3OKKA 1NLBL 2VZ3A 5I76A 1LDPH 2ERJB 5D7KD 1ETZB 3E6HB 2J5LB 2APWA 3T2NH 4NNYA 5SV3A 4Y2DD 2EDQA 1E6OH 4G5ZH 3TN0A 1AC0A 1FN4B 1TVBB 5JW4N 3QPQC 2GJ6D 3IFLH 2D03H 3T1WA 1TZHA 5FA4B 3BYTA 2ENSA 2MQ0A 3MV8D 3FO9B 2R23A 1IFHH 4LDOB 3D6GA 3KS0H 2J8OA 4GRLC 1J8KA 3ULUH 1AO7E 3LPWA 1PAMA 2HH0H 5D93C 1NKRA 3ABZA 5IEKA 3NBNA 2JJUA 3V52H 2E7LA 3Q3GA 5E8PA 2VL4A 4QRRA 3FQXA 4MDIB 4M5ZH 4HS6B 2X5PA 4I1NB 1T0MA 5C08A 5JXEC 4EKXA 3CFKA 4QRPA 2YK1L 3MLRH 2W0LA 1TMCB 4TTDC 3QIBB 3UZVB 3NCMA 3LQMA 4HUUA 2NY0D 4DKAA 1PFCA 1WTLA 3MRIB 1S9WB 1WZ1L 4FS0A 4ZOEA 1FCGA 4ZFZB 4OLUL 3REVB 1DBKL 5I6XC 3KLAA 2Q3AA 1YNTB 1EV2E 2H26B 1A6AA 2H2PC 3ARED 2AXJA 3QEGL 5JORB 1A1OB 4NUJB 4LPCA 4URTB 1G7JA 1A3RH 5DEFA 5F7LB 2QQKL 4HJJH 4KQ3H 3V5KB 1FNFA 3VMOA 4DZBA 1E4WL 5J06A 5DD6B 5LXGH 3W9DB 3U4BH 3LS4L 4PYHA 4QNPF 1R3KA 4I0KA 3H2WA 4YC2C 3U7AA 3QPXH 1MRCH 1PYWA 5HHXH 1IQWH 1CL7I 4LKXA 3LQAH 1CK0L 2F54E 4XCFL 1EHNA 1FLRH 1NCWL 3BH8B 4LSRH 5I16A 5E4EB 4L8BA 1MFAL 3QUKB 4NN7C 3MRHB 4N8CL 3O6LL 1OGTB 4UOJA 4EDWL 4RQQA 4OGAD 5F3HA 1CICB 4HUKB 2EDHA 3CXHJ 3OR6B 1LHZA 2FH8A 4NQSB 4N90E 1LE5A 3DBXA 3D0LB 1CDCA 2F19H 1MY7A 2BSRB 4I48A 1U8QB 1S5IL 1FH5L 1R5WB 3REWA 1JMZA 1I3GL 4M4RA 4PJBB 5CCKH 3EBAA 3ZLQC 2ZCHL 3BH9A 4WI8A 1BMGA 5F9OH 3LKQA 4XNUH 4RA3A 2HRLA 4D0CB 3LEXA 1MH5B 2H8PB 1ZHBB 5FA3B 4YPJA 3NZHL 5T5NG 4U1NA 1K6QL 4G7VL 1K85A 3ULVC 1KLUA 3IXAA 5I1CL 1SJEA 3NH7L 4GJTB 4OFDA 1NGQH 3LIZL 1UG9A 5ALCL 1CU4H 1BBDH 2EDYA 5EWIL 1ZGLA 3VG0L 2GUOB 3V0WL 3HZKA 4R7DB 1JHKL 1XGQA 3BDYH 1MLCB 4F7PA 5JOFB 1KSRA 5C0ND 3ZL4L 5KVMC 1LEIA 1P9MC 2Z31A 1J1XH 2YC1B 1IAIH 2QQNL 3C60D 3B8SA 5F9WB 1KEMH 3KPRA 4EN3B 4K3JH 4J23A 1HH6B 4LHUA 4OKDA 2DQEH 5IVXA 3HAEG 2UY6A 4ZAKD 3VXPA 5L8JB 2C7UB 1T3FB 3P73A 4PJEA 1PG7H 2LTQC 2OJZH 2OL3L 1QBBA 1ADQL 4ZS7H 1HI6A 4GG8A 4P3DA 4P59H 5T3ZD 1U3ZA 4G9FE 4DKEL 3TCXA 2D0HA 3G5ZB 2QHLA 3QEQE 1L0XA 5C86A 5D96C 2FWOB 3H9YA 4PB0L 2IALB 5HJ3B 4KHXH 3G6AB 1JTOA 3FO1B 4EOWL 2K7PA 5DC0A 2W60B 1KN4L 4RFOH 4OLYH 2L0DA 2FX9L 4AIZB 4BQCA 3DMMB 4KDWA 3C5ZA 3S37H 5INDB 3T4AB 4WI9A 4GS7C 4OQ1A 4I0PD 4W6YB 2VC2L 3VFSB 4UUJB 3RIAK 2GSGB 3BUYB 2FB4H 4Y0GA 1G9NL 5DQ9B 1NCAH 5TGBB 4K8RD 2H2SC 1AJ7H 4CL7A 4PR5A 4OLXH 4NQCD 3BKMH 4WV1B 3V5DB 1ZA6B 3DVNB 3GMOB 4DCQA 2PYED 3QDGD 1ZGLM 4OUOA 2BMKA 1LEGB 4WEBL 1B9ZA 4D9QD 3WCYA 5IFJA 1MFBH 1JPTL 3Q0HA 1CN4A 1QFUL 3V6OA 5DHYA 1ORQA 1CDUA 1I7RA 5AD0B 3ARZA 1JUFB 3X11B 4UMGA 1IGTB 4RGOL 1N0XH 2X4OB 5E8NA 1OSPL 3O3EB 3TLRA 4ERSH 1OM3H 3JWDC 4TVPH 3SE9H 1U8IA 1UKTA 4P48A 1MJUL 1T66D 5IMMB 5TFSH 2VDLL 2NPLX 4YAQA 3WFEL 3QWRA 3K8MA 3CUPA 4YGVA 3LEYL 3MLVH 3EYOB 5LAXA 3X14B 2CLVA 2BSSB 3W0WE 4PJ5B 5FO8A 1T2QH 1YEIH 2EDOA 3BAEL 2YD3A 1PQZB 2VXVH 2XPGA 3IDGB 3PHSA 1XAUA 3UJIL 3MNZA 1YMMB 4XNQA 1I75A 2EEDA 2DM7A 4JPVL 2VLME 3VGDA 2DWDB 3AROA 4R4FH 3QXTA 1TJIL 4F8QA 5CHNA 4WEMB 4BZ1L 4M7KH 2CLZA 4KXZH 5TDPB 2D7TL 1DBMH 1XGYH 4JRXE 2WINB 4GG6B 3FOMB 4X6DE 3RUGA 2P46B 5CBAA 3OJVC 4HG4K 5BS0D 4IRSC 5DMIH 2NY4B 1SBBA 2P8LB 2YPKA 1DANU 2V2TA 1WZLA 1RZJL 1RZFH 5IBUG 1CD1A 2OR9H 3TVMB 3QIUA 4LAQL 2NYYC 5GGVH 2OR7A 5CEXB 3F7YB 3PL6D 1NAMA 5L2KD 2Q7YA 3R0MA 4NC0B 2BXYA 4CVUA 1QSED 2CMRH 4UQ3A 1UXWA 5CFHA 1K4CB 4U2ZA 5HDLA 5IEHA 5J12B 1MWAL 5DHXB 1JWSB 1IGIL 2RCSL 1FYTE 5I1DB 5GRZA 3VCLA 4XPBL 2VLRB 3H9SD 1NC2D 3FCTB 2EDXA 5IESL 1UM5H 4LSVL 5EOTA 43C9A 3S35L 5I1HH 2R0WH 2W91A 4U6VH 4XBEL 2NR6C 3TJEH 3QFJD 1XZ0A 4PB9L 1MVUA 4V1DA 4PJ9B 3T0WA 4QT5B 3KYMA 4XP1H 35C8L 3V7MA 4JFPB 5AYUH 3OXSB 5J6GB 4G8GE 5EZJA 2OMBA 1E6JL 2HP4A 1DBBH 4PJ7B 4YK4C 5A40E 1XH3B 2CH8A 2XQYK 5C0CE 4DOHE 2KBGA 3OB0K 5HVHC 3BJ91 4Z77A 1KN2H 3FT2B 1JZ8A 3X3FL 3PWPE 3HI5L 4Z7QF 3WJJA 1VEMA 3O6FD 4B41A 1WCBA 1XIWC 3DXAE 3KPNA 4WI4A 4WY7H 1R3HB 1BVKA 4ONGH 5D2NE 4JANB 4JLRA 4OCNC 4UU9A 1OAQH 4PGBA 4XBGA 3OAZH 2PXYB 3GMRB 3JXAA 1XGPA 1FSKB 3PXHA 3RDTC 2BP3A 3SO3C 3MJ9L 4P9HC 3RZCA 3KPSE 3TPUA 3QEHB 1AFVL 1FO0H 4TUKH 1T0PB 1H0DB 3FQUA 1ORSA 3V0AC 4UTBH 4X4XA 2I07A 4P4KA 5E2VH 4GRWH 7FABL 5HYSB 3PV6A 3TESA 3MRMB 2AV1A 1AE6H 1FVCB 1F3DH 4D3CL 3DVFA 3KXFB 4MJ4A 4JZJC 5JMRA 5MEQB 3FO2B 2CDEB 5FUOH 3ULUD 2BVUA 2HVJB 1SJHB 2VUOA 4XBPB 1V7NH 4AEIL 1IGJA 1A5FH 3X3GH 3OR7B 2OZ4H 5IVOA 3P9MB 1IAMA 5EOQH 1Z6JT 5LWYH 5KVEH 4X6CA 1ZANH 1R24B 2Y07H 3I84A 1INEL 1T1YA 4DUWA 3IRPX 1URLA 4N0CD 3S8WA 1MIEH 1Q9OA 1KJMA 4TQEH 2AABL 4KVNH 2CKBH 3FONB 1UJTA 4R0LC 2F5AH 5BOZG 4ZUWA 3BN3B 4PJDA 2CKBB 3TH3T 2Y7QA 5JDSA 3MCKA 4BA8A 5E2TH 4AMKL 4WW2C 1MFEH 4OZGA 2MWCA 3KPQB 4FQ2L 1TJGH 3VW3H 2C3WA 1TTFA 5T33H 3B9KC 2AJYH 3MLSH 1FVEA 4JPKH 4OTXL 1KIPA 3ZTJG 1CTNA 2G9HB 5HGDA 1NMAL 4OFKA 4YXHL 2F54D 2VXUL 2YXFA 2QSCL 4ZUUB 1CICD 1SY6H 1A8JH 4XWGL 5F89A 1EEZA 5BZDA 3ALWA 3WHE0 3P30L 5GS0D 2C1PB 4HH8A 3SE3A 4OLWL 1AHWB 2QADC 4BZYA 1O7SA 4JY4A 1WT5A 5IK3B 5DUPL 1IKNC 1RULL 4FA8A 1NEZA 1KB5H 4LPYA 4WVRA 4L4VE 4D0BA 5F1OB 3A67L 5FKAA 3OAUL 5IWLC 4NRYA 4ZUVB 4Y5VA 3VFGL 3K2UH 4J3VA 2V5SA 2FATL 1AP2A 3KNBB 3PQYA 1EGJL 4KK6D 5IB5B 1C1EL 5LGHH 3SDAC 4PJHE 2WQ8A 4LSTH 3CMGA 3QG7H 4GOSA 5DQJA 5GISL 5SV4A 1OCWH 4LCIL 1IE5A 3OMZA 3SGJA 1ZXQA 4PJ8B 5H8DA 4OFYD 1KC5L 4JVWA 4HIHB 1P69B 5D2LE 4E42B 2R0LL 4P9ML 3CFJA 4G6KH 2APXA 1B0GB 4G8FB 1JF6A 4YHNA 3B9AA 3SJVE 2PTTA 4FP8L 1TTUA 1RUPL 4PS4H 1U91A 2BC4B 3SGKA 2CR6A 2IANE 1BGXH 5F6HJ 4MMZC 4EN3D 4JN2A 5J56B 5KSUB 2NTFA 3TT1H 1KLFA 1WFNA 3KPMB 4NQDE 4YFLF 3BGAA 1S78D 5DD3H 3UTTE 4MS8C 4KI5E 1INDH 1OAUH 1EIBA 5D6CA 4TSAL 5E6IA 1QKZH 3KJ6H 3T3PE 2L7JA 3TBWB 3GSXA 1YMHA 3UTZA 3OG6B 4JY5L 2EO1A 1UJ3B 4DN3L 3P2TA 2J6EH 2YWZA 4FMFA 4WIQA 3QFDA 3DMMD 3RP1A 4HUVB 1VPOH 1NAKL 2VDRL 3MBEB 1KEGH 1L6ZA 1KPRB 5A2LH 4C59B 1LDPL 5JOEA 4ALAL 4L3CB 1DQLL 3G04A 3MCLH 3RNQB 5KW9H 1D5BA 4JFZH 1G7IA 2ITCB 4PRIB 1A2YB 3BPOC 4BYHA 1JCKA 2ICES 5CWSB 2XQYG 4OI8A 1WBXB 4H25B 2VDPL 2Z92A 3U36B 2C5DC 3BEWB 2IPKA 4ZOBA 2WUBH 5D9SB 2HH0L 4LU5H 2UZIL 1CDYA 1QP1A 3QEQA 4XPFL 3VGAC 1BOYA 1NCCH 3KVQA 3WNOA 4M5ZL 4OCRH 5GGVY 3V0VA 4LMQI 4Z5RB 5HVFB 4FFWD 1FFQA 1PY9A 3MJ6A 4IRZL 5FECA 3NIGF 5I76B 3OAYK 4TVPD 2XZCH 3FB8B 3EJZD 2XKUA 4L1HA 2DAVA 4NNYB 1TITA 1GOGA 2PO6C 5DO2D 3F5WA 2R2CA 5DK0A 3TN0B 1AH1A 4PJ5D 5ILTL 3L5IA 3DLQR 1TZHB 2HT4D 4U6HA 4PRHE 1DR9A 2B2XH 1A3RL 3AC0A 3D39A 1HHGA 5F6IB 4XP4L 2HKHL 2ZKHH 2R23B 1N6QH 1YMMD 2ZG1A 4HKXB 5JO5A 1D5XA 4O5LL 4QXWA 1GZQA 3U4BL 1WSST 3BDBA 3QPXL 2W9EL 1JNLH 5CBEA 2XXMB 3IDIB 3Q3GB 1HE7A 1N2RA 3U30B 1IQWL 5CD3B 3GJFK 4QRRB 1P2CA 1OARH 5F21B 5J9PA 4KV5E 2J4WH 4GRLA 5C08B 1INQA 4LSRL 2I24N 1IEBA 1U41A 1S7QB 3CFKB 2NY4D 4QRPB 5BO1L 2V9TA 4HUUB 4KQ4H 5FYJH 2O26U 1AGBA 2V7HA 3ZE2F 5M7QA 3BZFA 3SY0B 4YDLC 2GITB 3HN3A 4U3HA 1KJ3L 3O11A 4OD2A 4U33A 4Z7WE 5HGHA 5EBGA 1Z5LA 4H0GA 1FV1A 3T77B 2V9QA 2ZOKA 2F8OA 2V17H 2N1KA 3LKRB 1LP9F 5KSBE 3F7VA 5ID0A 1G7JB 2Z8WC 5J57B 2VLRD 2G5BB 1IAII 4XP5H 4DZBB 1DBAL 3BQUA 4EI5A 3SDCD 4XNUL 1KIUA 4KK9C 1R3KB 5F1SA 3NCBB 1H8NA 3NA9H 1K4DA 4PJ9D 3HUJF 4L4TA 5HHOA 1KCRL 2A74A 2CRIA 4LKXB 3HNSH 1KXQE 4PTTA 4DGYH 4JRXA 3T08A 4PGJA 3O6KH 5I16B 5CIPA 5IB3A 4QXUH 4X6DA 4L8BB 5HSFA 1CU4L 4Z0XA 2EDJA 4MA8H 3GJEA 2MOVA 4N1EA 4RQQB 5F3HB 5EZLB 5HI5D 3BDYL 5HI3C 1BM3H 5JW5A 2D9CA 2BFVH 2P48B 4KGJA 4B53A 4I48B 4K94L 5KTEL 4WHTA 1GCFA 3HE6B 4LSUH 3REWB 3UBXG 1HKLH 2PXYD 3BH9B 5F1NA 1FYTA 3ARGC 3P0VL 3LKQB 4ZS7L 5CEZE 1UFUA 2OI9C 4XNMB 5I1EH 2AJZB 4U1NB 1DTUA 2BNQA 3S98A 3IFPA 5I15L 1SJEB 3G9AB 3UYPA 4XWOD 4LGSB 5K9KA 3KPSD 4QLRA 3O45A 1F4XL 1JTPA 1T7VA 1BBJB 1XF1A 4FQXB 5ETUB 1KCVL 2QHRH 2UYLA 1QSZA 3HZKB 3UDWC 1OT2A 5C0CA 1XGQB 4GAYB 4F7PB 2GTZB 4Q6IC 2BY1A 3NIDE 1Z0NA 3QHTC 1LEIB 5DLMH 5GSRB 8CGTA 2Z31B 3ROOA 3CXDL 4LP5A 4MLSA 4KKAD 1FYHB 3KPRB 2UUDH 2DWEA 3HI6H 3LB6C 2NY1B 2Y9RT 4J4PD 4J3TA 5IVXB 3NABL 1CT8A 2FB4L 1KIRB 4GXVH 3CSPA 1RUKL 1NCAL 2C3HA 1H9VA 2VISA 4OLXL 1MHEA 4GG8B 1CLZL 4P3DB 1FCCA 4XAKE 5GHWH 1MCPL 2YXMA 3L3JB 1RIVH 4I2XE 5GGSA 4P57B 3ULUF 1MOEA 4UIKH 2YA1A 3I50L 2YUWA 5IMLB 5JZ7C 5FM5M 3TBVB 4NT6B 4FXLA 1CFVH 1FGNL 4KVCL 4LCWE 2I27N 3IKKA 5HHNB 3RVXC 1F00I 4KXZI 1OM3L 5SWZD 2HMID 3GSNH 2C1OB 5GJTL 2CXKA 4AT6A 5BXFB 4Y7MA 1HSBA 3GSNB 3VJ6B 3MLVL 5C9JA 4KGLA 5F7NC 3HCVB 1MCOH 2AP2A 2DQTH 2F74A 3U4EA 1AD9A 1KTLB 2AEQH 2VUYA 3ZKQD 4DCQB 1U8PA 3OKLB 3L9RB 4O2FA 1A4KB 1VA9A 1WTGT 2DTML 3TO4B 4R4FL 4GW1A 4UT9H 1YEHH 4MQSB 4PG9B 3GSVB 3O3DA 4LLWA 4M7KL 3K4ZA 2FBJH 4MX7A 4N8VG 4QF1B 3O2VL 5DHYB 5A3ID 1ORQB 5T3XH 1I7RB 1DBML 4P5TA 4E9LA 4KKLC 4EDXA 5TF0A 1L7TH 5E8NB 3I6GA 4WENB 2ZG3A 3BP5A 1U8IB 1SJVA 1T89C 3PUCA 2R2HB 1RZFL 4Y16C 1V3MA 2OR9L 4YAQB 4CKVX 2MCPL 2HTKC 3KJ4B 3UPAA 4DTGH 5GGVL 4U6XA 5LAXB 2XY2A 2CLVB 5EO9B 5HTSA 3TA3C 5FO8B 5FHBH 4PJ8D 5HD8C 1YYLL 2GJZA 4IOSD 4NDMA 3K8LA 1T5WA 4YHKH 2HYMA 3TNNA 2BVYA 2XPGB 1QNZH 2HT3C 3WSQH 3T2QA 1XF2B 3ZYJA 3MNZB 2FYYB 4XNQB 3WLBA 2YUXA 4K07A 3L1OH 3ILQD 3DPBA 1MCIA 4LVHC 5I1HL 2R0WL 3TJEL 1FL5A 1IC5H 3FAXA 3MV7D 3QI9D 3DWTA 4I3GA 5KVDL 2IQ9H 5EBMA 3RUGB 4ZFFB 1UKSA 5CBAB 3DV6A 2KQNA 1D5MA 2A2QT 2QQLH 5EN2A 1BEYH 4IRJB 4L4VA 5MENE 1OAKH 1WC7A 3U0WL 5DJ2A 2YPKB 4QRUA 3HPLB 3RVVC 2FRGP 1CD1B 1I9RH 3DARA 3QIUB 1HWGB 2DDQH 4NZRL 4PJHA 3VFRA 2Q7YB 3T4YA 4B7LA 4ZOAA 3UYOD 3TBTB 4MYWB 3BPNC 2EXYD 1UXWB 1CGVA 3GSWA 5IEHB 1OAQL 3VD3A 1F2XK 3LOWA 5DD0L 4FG6D 2NLJA 4JREB 4LCYA 4F7EA 4LGRB 2OTUA 5EOTB 43C9B 4XX1G 3MBED 3LMJH 4U1HA 4DFHA 1P1ZA 1XZ0B 2P5WE 4V1DB 1BLNA 2IANA 1FO0L 4TUKL 4QRTA 3RVUC 1UADC 1ZSDB 3UTOA 4HWUA 4UTBL 3UMTA 4PRID 2WBKA 3FT4B 1E4KA 4NQDA 1EXUA 4YHOH 2VXTH 3UTTA 2J88H 3HC4L 4M6OH 4FFZL 4A6YL 1MPAH 3BO8A 3FB6B 4XVUC 4FQHA 3VXMA 4MAUH 3DUSA 4ELKA 3V6FA 3MRPA 2AEPH 5FUOL 4HK3N 4AM0A 4XNZB 3ROLA 4NRZB 1BVKB 5HDQL 2Y36H 5TDNA 2HJKA 1QBLH 4JLRB 5E5RB 2IAMA 5SX5H 3TYGH 4L3EB 5ISZE 3BZEA 2OZ4L 4XBGB 2RJMA 4KRLB 1KBGH 1UEMA 1RUMH 1XGPB 1XIWA 4NHCH 1ZANL 1NMCC 2I5YH 4XH2A 4DUVA 3N06B 3R1GL 3SDXB 4CU6A 3MV01 4BFGA 1GXEA 1YZZA 3WHXA 3FQUB 3WE6A 4J8RB 2HFGH 4PUBH 2X4UA 4ZS6C 5SWSB 3RDTA 1CZ8L 1TNNA 1C5DA 4KVNL 4OJFH 4P49A 2AV1B 2BY0A 5IJKC 1F4WH 4KPHH 3N9GH 1G9NC 2W0PA 3O41A 3IJHA 2D7NA 1ROWA 1NCBH 5E2TL 1UH2A 1MFEL 1DL7H 4LASH 1A9EB 4ORZC 1GHFH 4Y5XC 1TJGL 3ILPB 4MHHI 3H7LA 2AJYL 3MLSL 2J7LA 4JPKL 3A6CH 5C08D 4P2RE 4NQUA 4QRPD 1MNUH 4HFWA 5HYJE 2QR0A 1K8IA 4PBWD 3QUYA 4X4ZA 1T1YB 3ZHKA 2EDBA 3V8CA 1SY6L 5C09E 9CGTA 5FYJD 4TUJA 4X6EB 1T0NA 5GZOC 1N59A 4LARL 1EO5A 1Q9OB 1KJMB 3I75B 5HBBA 2XTJC 2E9BA 3BEVA 4M6AA 3ETBF 1X5FA 3OKNA 2YPLD 4ZUWB 4PJDB 4W6XB 1XGRB 3RVTC 4O02H 1GPOL 3MCKB 1KB5L 4GG6F 1MRDL 3EO1A 4BM7A 4HFUL 7CGTA 4OZGB 1J5OL 1YEFH 4F8TA 1FFPA 5D1QC 4XP6H 3EOYG 4M5YH 5LGHL 1KB9J 1MCRA 1GC1H 4LSTL 3QG7L 3EJYC 1KIPB 4E41D 3ZDXE 1TFHA 5LGJB 4PY8J 4H88H 3BD5A 1I1AD 5FM5O 1QG3A 15C8L 3B9KA 5F89B 4HGWA 1B0RB 5CJOH 1RZJC 3ESVF 3ZT7A 4JFQB 1IL1A 2YKLH 2RFXA 3HE6D 3FQRB 5IQ9B 3VFUA 2ESVE 1NCNA 4NO5B 4WFGD 4OD3H 1NEZB 4Z78A 4NN6B 3TT1L 2A73A 4D0BB 2D4FA 3FB7B 4NRYB 3T0EE 4PJ7F 2W59A 5KVGL 1OGAE 4YBLC 2E27H 1OAUL 1QFHA 1IKNA 4S1SH 3PQYB 1PG7W 1QKZL 5I9QC 3JBG7 3E0GA 4HDIB 3DX8A 3KJ6L 4MA7L 4GLRH 2D3VA 4OIAA 5IWLA 1G0YR 2CJUH 2XZQH 4WO4C 4QTHB 3EUUA 3HMXL 1PY4A 4FQXD 4ORGA 3CFJB 3Q5TA 1IKFL 1JF1A 3SDAA 5KZCB 4JFXA 1CR9H 5F97E 5E70A 1VPOL 3BN9C 1G7LA 5GJSL 1KEGL 4H26A 3VFMA 2OP4H 1JN6A 4J3SA 4OZIE 4ONHB 1ZLVK 4JN2B 2QQQA 1IEAA 2NY1D 4Y88A 2P5EA 2X89D 2IADA 5TE6L 3JV5A 3MCLL 4I18C 5FYKD 3S96A 5KW9L 2W9LA 4JFZL 2ICEA 5LGKA 1JWMA 2GY5A 4P2QA 4XMPL 1UACL 2C3VB 2X4TA 3AVEA 3QT2A 1IVLA 5D1ZC 4ZO9A 1C12A 1S7WB 1K5NB 4WEUD 4FQPA 4Z7UE 1YMHB 4NOBA 3A6BH 4ZUTB 3DHMA 3UTZB 2EC9T 2A83A 3W11D 1EO8L 5CZXD 6FABL 3V6BR 1QTYT 4DEPC 2A9MH 2EE3A 5AWNL 2GJJA 3O81A 4M48H 1TPXB 4PGZA 3SDYH 3QFDB 4X5WA 4R2GC 4TPRH 3S88H 4OCRL 5HYQA 5FF6A 3NFPB 2M1KA 5FKPB 3MTRA 2LU7A 1DSFH 1BJ8A 4TNWK 2XZCL 3TBSA 4KKCC 3QNXA 2FSEB 1OF2A 4GKSB 4N0UB 4RISH 2VOTA 3GUTA 1JJUA 5E99H 4OB5H 3VFNA 4MZ3A 3ZHLA 2CQVA 4WI7A 1VGEL 2DB8A 4WU5A 1BVLA 4YHLL 4I9WE 3B6SA 3T1FA 4OCSH 5IHUL 4KK8C 3PNWA 1M4KA 4JFFB 3LHPL 5FYLL 4MQ7A 3P77A 3TO4D 5I8CA 2IPKB 4OFIA 5C0GB 3HS0A 1UA6L 4G7YH 1AKJB 4JEGB 1EUUA 4EJ1C 3G6JF 4I2XA 1JNLL 1WQVT 3O4LE 3MLWH 2DN7A 3OL2A 2CRYA 3MBXH 5T3XD 2Y6SD 4AEFA 3VD9A 4JFYA 2NZ9D 4NYLA 1CXHA 4LCWA 5IFAH 1FL6A 4M6MH 3I3DA 1BFVL 4IM8A 4JKWA 3QWRD 3C5JB 2DBLH 5DK0B 2OQJB 5DRWA 1CFTB 3HZVA 3D48R 3GNML 4Y8DC 2D0GA 5IF0A 4FQQB 1QLFB 2V17L 2CXGA 5JXAL 2ZG2A 1FQ9C 3D39B 4RGMC 1G84A 4JDZB 2XN9A 2PO6A 3RL2A 4JHWH 1MRFH 2MSPA 5JO5B 1D5XB 1MHPH 1QRND 5LBSH 1QFWL 5A2KH 3UAJD 4L8CA 1BWMA 5CBEB 4IMLB 5ICZB 5JDJA 1QR4A 2VN4A 3Q6FA 1KCUH 3NAAH 1V3JA 2FD6H 3NOIA 5J9PB 3HNSL 1U8OA 4PJIB 1CDIA 4RRPA 4GRLB 3O6KL 3N50A 4IRJD 3VXQA 1II4E 1QOKA 4QXUL 3PGFH 3KR3H 3DTXA 1NC4B 1MCDA 2E8ZA 5D93B 1OPGH 4MA8L 4Q9QH 5DTFB 2VZSA 1CGYA 3GHEL 5E6YA 5EU7C 1BM3L 3O11B 4EUPA 3QIUD 3T3MF 1HXYA 5HGHB 1Z5LB 3BYYA 4S0SD 4PRBA 4CAGA 5GZNC 2ZOKB 1YN6A 4DQOL 5ID0B 4JHBA 4JO1H 1CGTA 2NX5E 2V2XA 3HAEA 5AG9A 5I6XB 2WANA 3KDMB 3PIQA 3SKJH 4F9PA 4UILH 3HFMH 2B8OT 4V1DD 3TV3H 5D72H 4S1DC 3G9VA 3DRTA 4L4TB 3WUWB 2FX7L 3CFDB 5HHOB 4XNXL 2XNAA 2WIIA 4ENED 4PTTB 5CIPH 4C57C 3PJSA 5I73C 2UWEE 4JKPH 2XA3A 3F6IA 5CIPB 5IB3B 2FO1A 5C0FA 4DJMA 4YC2B 4Z0XB 4M1GH 4DK6A 3FN3A 3GJEB 1U8NB 3PWUB 5F8RC 4Y19A 4Z7VA 5JW5B 4K9EL 4HXBL 2BVQB 3F7PC 5E95B 5EO1A 5C0DA 4NN7B 3P11H 3QEUB 2OMNA 2BDNL 4EVNB 3HI6L 1HIMH 4L3ED 1UWXH 2G75B 1FGVL 3QDME 3IVKA 4S1QH 2IBGA 4UDTB 2BNRA 3RWHA 5F72S 1JE6A 1FYTB 1YEDA 3C9NA 4WUUB 2W38A 2LE9A 3U6RA 3VXUE 2IMMA 3U79A 1PW3A 2AJXL 1DP0A 4WCYL 3C8KB 4MXQC 5MHSD 2P5WA 2BNQB 1XT5A 3MSPA 2Q8AL 1T5XA 3ARGA 1J1PH 2FGWL 5K9KB 1CFNB 5SWSD 3CU1A 2NY5L 5EOCH 1IC4L 4UIKL 2XWBB 4XVJL 5D7SL 5BZWA 2UYLB 3QG6A 5DUBA 3ULVH 2EH8H 3OXRA 1NEUA 1CFVL 4AIXA 3IDXH 1E4XH 1U9KA 3GSRA 1FC1A 3ROOB 1GGTA 3RY6A 4LRNH 1Z9OA 2HTLC 5DJCA 4PJGE 2EH7L 4HIJB 3MRFA 2MPAH 2DWEB 2FEDC 2R1XA 4XXDB 3IXTA 5F3BA 3JZ7A 2ADFL 2JJSC 1CT8B 4Q6IA 4HIXH 1ZVHA 5ISZA 3LQZB 1MCOL 2DQTL 2ADGB 2P7TA 2VISB 4BSWB 5I1LB 2D7QA 2Q1EA 1N7ML 3ZYOA 5EBWA 1CLYH 3IDMB 4BZ2L 3WDJA 4JVUA 1L9NA 4UT9L 2LTQB 1OTSC 5GGSB 5EBLA 3RJDA 5C6TH 4HZLA 2VKXA 1A6VH 5DZNA 1U2CA 3SKMA 4YFDB 4HC1L 2FBJL 1A7RH 3G08A 1M7XA 5JUEH 4JGJA 4N5EC 2GFBA 5EU5B 4X5XA 2VZ1A 1L7TL 3DRQB 1LO3H 1QBAA 5D96B 5A16A 4UB0L 5HHQA 3QSKB 4R4ND 4P23C 2WM0A 4AT6B 1HSBB 4DTGL 2EDRA 4JG1L 1H3VA 3ARUA 4KMQA 2RAMA 4QHMA 3CDGA 3NZ8A 5F7HA 3GO1H 3GRWA 1EAJA 3MMEB 4GS7B 4X5LA 3U4EB 1W8OA 5HYJA 1MCEA 5DVKA 1U8PB 2YN5A 4OF6A 4XTRC 1Z9MA 5L2JA 2XWJA 3L1OL 4O2FB 5C09A 3WNMA 4OF8A 4GW1B 4QTIL 3LV3B 1F4AA 3S5LA 3O3DB 5E1AA 3UYRL 4LLWB 4MX7B 3IDJA 1A4JA 3CU7A 4JN1H 3SDDC 3B5GA 4HIIB 5KS9E 2QQLL 1BEYL 3WS6A 1QRKA 3I6GB 4K23H 3BP5B 1W0VB 4PRPB 3EYQC 4U49A 4LQFL 3W5NA 2CRMA 3PQYD 1U36A 3O8XC 4M1DH 1Q9WB 3MRJA 1ODAA 2X1XR 4UBDD 3T0ED 1NAML 1VHPA 4NM4H 3VFWA 4X0KB 1RUQL 5JHDB 3JWDH 2NZIA 2GJZB 4XMKH 3Q1SL 1OTTC 1OQOA 1BD2E 1T5WB 4GFTB 3QNZB 1T89A 4JQVC 3TNNB 4HWEH 1I8MA 1CFSA 1YN7A 4FZEL 5C2UB 4PV9A 4F7CA 3X13A 5KZCD 2XICA 5E2WH 3TA3A 3O3AB 3MUGA 3V7AG 3T2PA 1FL5B 3VXTA 4GBXA 1R3LB 2G2RB 2WUCL 4OD1L 3DO7A 1IQDA 3ARDA 2LFGA 3Q6GH 4K94C 2ESVA 1TETL 4UT6H 1A6TB 2VDMH 2VR5A 2PW2B 4X7DC 2ZCLH 5EBMB 1QYGH 3DV6B 5ANMB 1D5MB 5EN2B 4L4VB 1WC7B 4JZOB 1VERA 2QSQA 2HG5A 3DNKA 5DJ2B 3O0RL 4QRUB 1OGAA 1JI1A 4M6OL 4LCCC 1MPAL 1JWUB 2AK1L 3MACL 3UXFA 4L5FH 4PJHB 2AQ2A 4IRSB 4UNUA 2FO4B 3T4YB 1X6NA 1FVDA 3TNMA 1P53A 2Q6WA 4Q9CA 4ZNCD 3GSWB 4X80L 3HLAA 2NLJB 4MWFA 2OTUB 4LPWA 3DIFA 3BVNB 3MLTA 1RZGA 4NNXA 3BRFA 2I5YL 3TT3H 4LIQE 4Y4HC 5IKCB 4OZIA 4QRTB 4S2SB 2HFGL 4PUBL 4D0DB 3TF7C 5IFHH 4OJFL 5GGUB 4CW1A 3UTTB 2DKMA 5IIEA 1F4WL 4ZYKB 2Y72A 1BX2B 3BO8B 4JFFD 5F7YC 1M6OA 3LKPB 3RKDC 4FQHB 2VWEE 3VXMB 3DUSB 4I9WD 1DL7L 1IAOA 4ELKB 3MRPB 3DOSA 4OM1H 4YK4B 1AKJD 4ZG1A 4DVRL 3L5WA 5TDNB 2HJKB 3B2VH 2V7NA 5HVHB 3BZEB 3QZWA 1ADQA 4K7PX 2V6HA 2R69H 1MNUL 1XIWB 1GAFL 2X1OA 4RMVA 5BV7H 5CUSH 5C0AE 4XH2B 2HT2C 4MB3A 12E8H 1NPUA 2DQIH 1T7WA 3WHXB 5JQHC 3TPKA 4Q97A 1CLOL 2JCCB 4CBPA 5ERWA 5T1KA 3L7FB 3RDTB 1C5DB 4NCDA 2NXZC 3JV6B 1L7IL 1YY9D 3SO3B 1D6VH 1NJ9A 2R2BB 4XPAH 1OY3B 3IJHB 2B1HH 2HJLB 4ZPVA 3QPQD 4LHUG 4JM2C 3IFNH 4ODUB 3GIVA 1WWWX 2DJUA 1NFIB 1QPXA 3EW3B 1J8HB 4LLUA 2J8UE 3H3PL 1OSZB 4GRLD 1IMHC 4M8QA 3WDIA 4JZJB 1LEKA 2NY7L 2VDNH 4HPOL 4Q0XH 2I26N 2QR0B 1NC4D 1J9CT 4Y5XA 2D7PA 3HKFA 3D0VB 3K46A 3KHOA 1T22A 1G6VK 4WNQB 4GLRI 1F90L 5LCVH 2P49B 2BZDA 1T0NB 3CFIC 5L6YL 2KZWA 4XNYH 4U2YA 3ALXA 1N59B 1SJXA 4N1CA 5CJOL 5JXED 3EYUL 3DHJA 5I19H 3BPLC 3SKOA 2YKLL 4TTDD 1TVDA 4S1RH 4U1MA 4ODSL 4D9LL 2ADJA 2BOCB 3IU4H 4PD4K 1MIMH 3U2SA 3RWCB 1QPPA 3AU1A 5GRJL 3EO1B 3RUGF 4XMLH 2ARJB 4I4WA 2H2PD 3BZ4B 5CILH 4Z8FL 1N5YL 4R0LB 1J0KA 1FFPB 3NFNA 4L4TD 3BRDA 2VAAA 5I8KH 1BIIB 5KS9A 2CJUL 4WW2B 4JVPA 3DX6B 3HR6A 2GT9A 1UM6L 2GSIA 3ZT5A 2VN7A 2ZNXA 1U42A 5D1QA 2GYSA 4WW1A 1JPSL 4FQIH 4WGVB 1CR9L 3B9KB 4HGWB 5CAYB 3C5SA 1KFAH 2OP4L 4ZOCA 1IL1B 2QV2A 2RFXB 4YDKH 3CSBA 3VFUB 5BMFH 4KJWC 4JGUA 5B3JF 1MAML 3TIEA 1X5ZA 1QFPA 4I3SH 1RU9H 1WV7T 3N1FC 3QULB 4Z78B 2VDKH 2A73B 2CO6B 5GGSY 3KWWA 4WUUD 1TZGH 2QADB 1T04B 2CIIA 4MB5A 5DEGB 2DLTA 1I8KA 3EDEA 3ARSA 5EU4A 2BNQD 4IDJH 4NWUL 5LQBL 1MWAA 1I9IH 4NJ9H 2EYTA 2UWEA 2DD8H 4JG0H 3T09A 1EUTA 2YD7A 2X4NA 3CVHH 3GEWB 4M48L 4XVTH 2X9YA 3AMKA 1JF1B 2WWMC 4DAGH 4QHUA 3SDAB 3CVHB 4JFXB 3S88L 3ULVD 1RJLA 2AJUH 5E0QA 3AUVA 4AEEA 3V5HA 2RQ8A 1UZ6E 4H26B 2R56H 2X10A 1DSFL 3QWOA 1JN6B 2EDFA 5ESVA 3SDXF 1EBAA 1DUZA 3ARBA 2P5EB 4P2OC 1H15A 2IADB 2N4IA 4JM4L 1U8MA 4ZTPH 4J3UA 3RNKB 2NY6C 3WS3A 1P7KA 3ZKMC 3QDMA 4P2QB 3HTLX 4Q9BA 3UTPE 3ZE1F 1SVZA 1RZ7H 5CEZH 3SE4C 3ULSB 3E2HC 2X6MA 4AEHL 1C12B 3VD5A 3VXUA 2CD0A 3M1BB 3AXLA 5BRZB 2JKXA 2R4SL 1TENA 1QHPA 5D5ME 4M43H 4YHYC 1JRHL 4HS3A 4P2YA 4PJFB 1TDQA 4XZUA 4J1UB 3D3VE 4OCXH 3TP4A 2C4FT 3MLWL 2ATPB 4WU7A 4JPWH 3HRZA 3LRSA 3O9WA 5HHVL 2OK0H 1HQ4A 3LH2H 4X5WB 5D71L 1SBSL 4XCCH 5HYQB 2IQAB 4YIQA 2FR4B 2DQGH 4K7PH 3TBSB 3OKMA 5DZOA 1LO4H 5I1KH 1G7QA 1OF2B 4PJGA 1EEYA 3GUTB 4FOMA 4M7LH 4UZGA 1A14H 5FAAA 1A7PL 3LY6A 4WU5B 1BVLB 2E6JA 1DFBH 3GGWA 4PJDF 3SQOH 3T1FB 1RAMA 3PNWB 2ZSVB 1KCSH 3RFZC 4JHWL 1MRFL 3VFPA 5JHLH 1T6WA 1MHPL 4MQ7B 2XV6B 5GS1C 5KG9A 4WDIA 5CINL 5I8CB 4OZGF 2H2SD 1DVFA 1VFBA 3BPOB 1AGFA 3GBNH 4U05A 1WWAX 4TNVF 1RZKL 1KCUL 3NAAL 4MNGA 2DQDH 2FD6L 2R0ZL 3EIFA 4RAUA 3THMH 5L9DL 4YHZH 2K7QA 4UDUA 1B0WA 4LLMA 3KYKH 4EXKA 2AK4A 3PGFL 1FZKA 3KR3L 4G6FB 4ODVH 4PRPD 1OPGL 1FL6B 4Q9QL 3VGAB 5ACMA 1RUAL 3DYPA 4RWHA 3DSFL 1PDKA 5JHDD 4HUWA 4NNPL 1R3JA 2O5XL 1LO2H 5DRXA 4F15C 3KPPA 2BVTA 1YECL 1WBZA 4JO1L 3C2AL 3QUMA 1Y6MR 2AXFA 2PO6B 2XN9B 3RL2B 3RL1A 3V4UH 3D18A 1XCQB 3PABA 3HC0A 4L8CB 3JWOL 5C6WH 2A6IA 4O2CB 1ZMYA 2DLHA 2W0FA 4RNRB 5EZIH 5GSVA 4Z9KB 5C7XH 2MFNA 3H9ZA 3QO1A 2RBLA 3DTXB 4HF5H 4WHYH 1CGSH 5EIVA 1CVRA 4QNPE 2JJTA 4YBHA 4IRSD 5IM7B 1BZ7A 4PRBB 4YEFA 3O3BA 1YN6B 3V95A 3HNTL 3KYNA 4MJIE 4YDLB 3HAEH 1E4XI 4AQ1B 1U95B 3LRHA 4DUXA 5DD5H 2V2XB 3HAEB 3VWJA 4YDIH 4M1CC 5EO0A 1HHHA 1Q9LA 1EGJA 4KTEH 3PIQB 1BQHG 1J10A 4NO3A 1T2JA 1YPZB 1S9VA 3FFCA 3T0AA 4ZO8A 2XNAB 3KPOB 2WIIB 1D5IH 2SEBA 4LHQB 3PJSB 1J1PL 1ZHLB 1TIUA 1LO5B 5INCA 5EOCL 2NR6D 1TNMA 1PKQB 5F7EH 4HIEA 5DR5L 3NPSC 4WFHD 5DEZA 2D31B 4CADB 3D1MC 4FQJH 4Y19B 4Z7VB 3VXMD 3IDXL 3VRJA 1PVHA 3UCRA 1X6LA 1AQDA 3EGSA 1U3JA 2VB5A 4F2MA 3BKJL 4Q2ZA 3MXWL 4YX2L 3FN0H 4HIXL 2PR4L 3G6DH 2BNRB 2WBJC 3RWHB 3CPLA 1XIWD 2JELL 3C9NB 1K9TA 5MI0C 4NRXB 1KNOB 5KSAC 5EUOA 2HWZH 4X9GA 3OKYA 4PJXF 3BP4A 1U3HA 1OAYH 2NY2C 1S7UB 3H9HA 3ARGB 5BJTB 3TZVD 3RDTD 3L3GA 2OI9B 4CMMB 4N8VA 1DQDL 5BZWB 3QG6B 5DUBB 5HGAB 1I3VA 3OXRB 4G80B 1T20B 4Q9RL 4CN4A 3QWQB 5I30L 5FIEA 1DEEA 2A6DA 4RSVA 1W72A 4OAW<