2ED7A

Solution structure of the first fibronectin type iii domain of human netrin receptor dcc
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
GSSGSSGKPAIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Netrin receptor DCC
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ed7A00
4PJ7B 5D7LA 1KENH 4DOHB 1INDH 5FF6B 1J8HB 3VD4A 3TYGL 4ZS6C 2VXUH 2GCYB 5D1ZC 4P57A 4NGHH 3TBYB 1I8MA 5DDHB 4NQDE 1QFPA 3CVHA 3ZL4H 5IG7A 3U2SA 1IC5L 5KVDH 3JZ7A 5J9PB 3EYOB 4F7PB 3BYTA 4PJEA 5KSAC 5KSBF 2R0KH 4JPWL 3UBXI 4M48H 1PG7L 3FFDB 1PKQA 4X4ZA 4LIQL 4MNHA 5K9JH 2NTSP 3HAEG 1KIRA 1RIVL 3OF6A 3WHXB 4CU8A 1AIFA 2HT3D 4TUOB 2DJUA 3GSUB 3VFOA 2DBLH 3F8UB 3S34L 1Z9OA 2ATPA 2OM5A 4S1QH 2QADB 2HJFB 3PDDA 4PUBL 4JRXD 1TVBB 4NGHL 2CDGB 3SDYH 1KYOK 1Z3GH 1CBVH 3BYYA 4YE4L 4M7KH 4KUZL 3SBWC 2VDRL 4K71C 1WFOA 1LO3L 4JPWH 4JO4H 1AGBA 3WXVH 1C1EH 1DJSA 2NLJB 4L3EE 4PJ7F 5F7LB 4ZUTB 1BD2A 2QSCH 1CXIA 4KY1L 3K0WA 1RZ8A 4I18B 3O3EB 2VXTL 3I02B 1DN0A 5EOTB 4BSVB 5H35A 1Z9SA 4CADA 1YEGL 4XBGB 3UTSB 5C0RL 4KAQL 3OL2A 2M2DA 1QP1A 4YHPB 4FQ1L 4JFFA 1CVRA 3BGFC 4CAGA 4X6DE 2PO6C 4OUUA 1MEXH 3BD3A 4Y16D 3QIWB 3P2TA 5F6IC 2ZCLH 3SE8L 1ZE3C 3LKPB 1I1AA 4QYOA 1LHZA 3QCUH 2ZCKL 4XXCA 3OKYA 4HS6B 3IDYC 1UFUA 5TF0A 2YSSA 4ZTPL 2PR4H 2N4IA 1RI8A 4NKOB 3ARGC 4W4NA 4WWKC 3NBNA 4B0MM 3VI4E 3KPNA 3QJFB 5AG9A 3B9KA 5BVJA 4HIJA 4EBQH 4MLIA 3X14B 2UZYB 2X41A 4MNGB 4U6HB 2YPLD 4GRWF 1F58H 1FYTD 4MMXC 5DSCA 1G6RA 3LKSB 5AUMB 1N5YH 5IHBA 3IDNA 2MPAH 2I24N 5HGHA 4ETYA 3D2UB 1KIPB 1FGNL 3H7BA 1HKLH 1MCPL 2OMBA 4MJIE 2VIRB 5I1AB 4JQXA 3PWJB 4U6VH 4DZ8B 2XY1A 4PRNB 1DTUA 1A9EA 5IROC 5HYSA 1D5XA 5C09A 4L9LB 3NA4A 4JZOA 3QQ3B 4MJ6B 4AENB 3GHBL 2C7UA 5I8CA 2C3XA 5F89B 2DYPB 4M7LL 1N59A 3KLAA 3QULA 1FE8L 1WBXB 3FQUA 5GSRB 2X4PA 4PV9A 4XHQA 4CNIA 1T0NB 3BP4A 2IPKA 5CD5C 3LQAC 5HVWA 2GJ6E 1JN6A 3SE3C 4KJPC 3SN6N 1DBJH 1QFWH 2Z8SA 5EBGA 5CD3B 4JPVL 3IJHA 5I15H 3KS0J 3S3SA 2BJMH 4EOWL 4F15B 2A6KA 3QUKA 5D2LB 5E8OB 5D8JH 5EU6E 1MFBL 1SJEA 3QWOA 3MLSH 1S9XA 1U3HC 2APTA 2H2SC 1FCGA 3RVTC 4NNPH 1U2CA 4V1DB 5EZIH 5CKAA 1NC2B 1MCQA 3TBTB 2DMCA 1OW0A 4PY7B 4GSDL 2ADJB 4PRDA 5ALCH 4F58L 2YXMA 1YEFH 1UZ8B 3D3VE 4X6DA 3MRHA 1RJZA 3FMGH 2CDEB 5KSAA 1A6ZB 2VISA 3RVWC 3IETA 1QRNB 3IDGB 3O3AB 1JGLH 3OAZH 1QRNE 2Z8RA 4XPTL 5EO9A 3Q5TA 1G7LB 1GGTA 4D9RD 1NGPL 4LVEA 1CZ8H 1OL0A 2IAMB 3HUJB 4EDXB 4O02L 4WI8A 4WCYL 5DMIL 4Z7WF 5IT2L 2R23B 1G6RH 4X6EA 3LKNB 1PKOA 4AMKL 2WINA 4HUUB 5E8EB 1IAIL 4LDEB 1K8IB 1D6VL 5TFSH 4KJWD 5J9PA 2DL2A 1NGZB 5D9SA 2XZQH 1J12A 4MQ7A 4XAKD 4Y5YA 3QUMB 2MPAL 2ESVE 5E9DB 3ALXA 1WBZA 1LO0H 1FC1A 3C6SB 3F7VA 4JM4H 1K2DB 4Y2DD 5F7HA 3L7FA 3MO1A 2RBLA 3B9VA 3V6FA 3WHXA 2VSDA 2XQBH 4XI5D 4H25B 3CMOL 5C9JA 4FQIH 5EB9A 1MHHB 1WAAF 2EYTA 4GMSH 3CC5B 3T2OA 5E70A 2VL5B 5DFVC 1OP5H 2XQYG 1N8ZB 3NFPA 4LPYA 1BQHB 2D31A 4J3OC 3ILPB 3Q6FA 2BNRB 1BBDH 4U4BA 4P57B 4P5TB 2FJHA 1A7OH 5CEXB 3GMLB 1H15A 4OAWA 4AIOA 4M3KB 4OB5H 5FGBC 4OCRH 3R06B 5MEQA 4XP6H 5IG7B 1RURL 3U2SB 1G7JB 4WW1A 4ELMA 5F3HB 3DVNA 2CJUL 5HHME 5DO2C 3ARBA 1QBMH 1ULVA 3B5HA 1BEYH 5H2BB 4FQQB 1SY6L 2ADIB 3BMVA 2VQ1B 1NMAL 1KUMA 2D9CA 3OKLB 5F21B 5IBTH 4U1GB 5J11B 4LRIC 5J3HD 3P9MA 3MLXH 4OT1L 5DD6B 4XNZC 3AAZB 1QSEE 2VABA 1BBDL 4X7TB 3L6FA 1YMMD 3CDGA 1UM4L 3HC0A 4PRAA 4OZIA 5KSVA 1UC6A 4XHJC 2HN7B 5K9OB 4JQIH 3E2HC 3BVNA 3MBEB 3RWEB 1OVZA 5H8DA 3TA3B 4AYFA 3TN0B 5HYQA 1IQDA 4DUWA 3MXVL 12E8H 2J6EA 5IMMB 3O45A 1YPZA 1U8PB 3BPLB 2B4CC 5J6HA 5INCB 1U8NA 2NY5H 3UTTD 4FZEL 4JVUA 3MJ6A 1MCHA 1TJGL 2DQDH 1ZT1B 3NCBB 1R5VB 4XP5L 3K80A 3CFJA 1YEJH 1UQSB 1DUYB 4GS7C 4UT6L 4I18A 2Z4QB 3K1KC 1IM3A 3LD8C 3OB0H 1KT2B 4X7FC 4YEFA 1BOGB 1RU9L 3KPRB 4ODVH 4JDZA 3VFGH 1LMKA 5AAWA 2D0FA 3UTZA 1JWSA 2R9HD 1NUFA 4LLDA 1QHOA 1OB1A 1W72A 5IB2A 3WSQH 1T21A 1ZLVK 4NOBA 3L5XH 3VG0H 3U79A 1J05B 3PL6A 3SPVB 3TN0C 4BQCA 5HDBF 4YHLL 1B90A 2DYPA 3HLAA 4KQ3L 4FZEH 4MA3B 5D1XD 1SHMA 5DT1H 1ND0A 3FQUB 5GSRA 4HS8L 2HT4D 3SQOH 3V6OE 4XNZB 4HXBH 2E7HA 5B39G 5FECA 3NFSH 4AG4H 4Y1AE 1SMOA 5KSAD 1DBBL 3FCTA 2E6JA 4U1GC 4C54A 2VTFA 5BRZD 3TNNA 3GBMH 1LNUB 3RHWK 4WUUA 2AV7B 3ROOB 4NQXA 1FCCA 3FRUA 5HGHB 2LQRA 2XA8H 1OPGL 4M7JH 3KPLA 2YA1A 3ARGA 2AK4B 5BS0E 4X80H 4OV5B 4RIRB 4JO3L 3MCLH 2OI9C 3QWOB 1I3RA 1D5XB 5C09B 4W6XB 2HT3C 3T3ME 5FDWB 3UJJH 4NKDB 4NC0B 1C5DA 3GSNB 3QUZC 3BXNA 5KJRL 1HHGA 1OAXH 4BZ2L 4H8WH 4KK5C 4D0CB 1X4ZA 2PN5A 1AXTH 5FK9A 3HPJA 4GRMA 4PJAE 1R3IL 4H0GA 3BPOB 5ID1A 2IALB 2MQ0A 4TSCL 5C07D 3WIFA 4HK3J 5DQDL 3VI3E 1EEZA 3RL1A 4MQXC 3EYFA 2FGWH 2DF3A 2VLRA 1OT2A 2MHAB 4OCNC 5C0GA 4Z77B 5EA0L 1JWMA 2FO4B 3AU1A 2VL4A 2UWEF 1KNOA 3EGSB 1QZ1A 3QDGB 1KELH 4W4OA 1ZT4B 4U7MA 3BPNB 3C5ZA 1QNZL 1BZ9A 1CGYA 4LVHC 3G5YB 3AY4C 4PGDA 4CL7A 15C8L 3NPZB 4WNQB 3GB7B 2JJSA 3MGTB 3TNMB 2EO1A 5F72S 2OZ4H 2R56H 3O0RH 2FIRT 4MHHG 4NZTH 4PB0H 4QNPF 3BP6B 5F8RC 3S4SG 1FIGH 3AY4A 2R0LH 1QRNA 1Q9LA 1FFPB 1UWEL 3C5JB 2FGWL 3PIQA 4JRYA 1YECH 5EOCJ 4Z7VE 1CDJA 1M7IA 1GZQA 2H3NA 4EDXA 5DZOA 3GDBA 3OB8A 3B9EA 4WY7H 5E08H 3QG7H 3O3BA 2G9HA 3BE1L 4JLRB 4JHZA 3T09A 1PG7W 4GW1A 3FT4A 1KJMB 2WUBL 3ABZA 3LRHA 5EBLA 1Z5LB 3IU4H 1T0MB 3FAXA 1YEKH 5J12B 1NGPH 3CZFA 4P2RD 1Q9KA 2VQ1A 2LTQB 2BHYA 5FOBA 1G7PB 4HGKC 1OCWH 1I7UA 5JXAL 3RBGA 1VKXA 3BKYL 3MJ8B 2APBA 1D7FA 2FECL 1K5NB 3RI5K 2OL3H 3PABB 5DK2B 3T77B 3QP3A 2FNBA 1FGVL 5D70H 5F88A 5ACZA 3G9VA 2BNRA 4DEPB 1UGNA 4PG2C 1PVHA 1S8DB 4DCQB 5SV4A 3KYOB 5I1KH 3MA7A 1R5IA 4LHUD 1U3ZA 3WIIH 1VFOA 1G7JA 3OV6A 1FO0H 4M7ZB 1AGDB 4PTTB 4P3DA 1BWMA 4F7MA 1F6AA 4NO3A 4KV5E 4EJ1C 3UX9B 2AJSH 1R5VA 3CX5K 2JCCF 2NY7H 3ZDXF 3V6BR 1JRHL 3O41A 2IQAB 4U3HA 1VADA 2H26B 5EO1B 1KT2A 1ODAA 2EDNA 1IGIH 3RNKB 1FBIL 4CU6A 3QEGH 4CBPA 2EDHA 3I9GL 2HG5B 1BAFH 4C57C 4M1CD 1W72L 4CGTA 4LLVA 2JIXA 1MRDL 4JN2A 3M8OH 4G7VL 1T21B 4PJAB 4Y5YC 3FQTA 4R97B 4MD5A 4N0RA 1SYSA 3T65B 2J5LC 3FO2B 4JM2D 3S6CA 1G1CA 1IQDB 4NYLA 1CDGA 2XKNA 4NUJB 3OR6B 1A47A 4NO2B 1LE9B 3UEZA 1Y18A 4JFXA 5EC1B 1OAYL 4OD2A 4R0LC 3VCLA 5FYLD 3JWOL 3UPCA 1QO3B 1X4YA 1E4XI 3BGMB 2C9AA 3QDGE 4C83B 4UINH 4U1IB 1DEDA 1HHIB 2V17L 1OWRM 3OKKB 1A2YB 3TLRA 2EXYD 5BZWA 1MCRA 3VE0B 4R3SB 3NIDE 4Z0XB 1U91B 4HK0B 4R97C 4RIRA 4F8TA 1YJDL 5E2UL 1CD8A 3V8CA 1WEJH 4H5SA 5AEAA 5F71A 3T2QA 1U8QA 5EUKA 5GS2H 4OF0A 1BOYA 5C0JB 3PWJA 1U8LA 1I9EA 4X8XA 3MODL 3P0YL 5J06A 2DL9A 8CGTA 4XCEB 4PJXB 3B5TA 3ESUF 1GGBL 4RRPG 4YE4H 2J8UB 5INDA 5IKCB 2X4QA 4Y19D 4HW6A 5JIPA 4M1DL 4J3UA 4YEEA 3DWTA 2Y6SC 5JUEL 3TP4A 1J18A 2F53E 1IC7L 3BQUD 3ULVL 4NKMA 1OGAA 4JJHA 4V1DD 1S7XA 2DLIA 1S3KL 1UWEH 4QXUL 1HHJA 2YK1H 5JW4N 4FQLL 2V5YA 2E7MA 3QUYD 5CUSH 1RIVH 3BPLC 5TJWK 3MODH 4NKDA 3RA7H 4M9OA 4D0CA 1TETH 4PJCA 1BQUA 4X9BA 1DDHA 4LDLB 1RIHL 1NCDL 1PY9A 3WXWH 1AO7D 5J6GB 3CIQA 5L8LB 32C2A 1UCTA 1ZA3A 5I18L 3ZSTA 2VDNL 5HHVL 3LKQA 2XTJD 3EOTL 2Y5TA 1MJJA 5EO9B 4K3JH 5C0GB 4X4MA 5C07E 3DYOA 2CUMA 4XXCC 4W6WB 4V1DE 1UH3A 3QDGD 3SGEI 1FFOA 2QSCL 5HDOA 2DQUH 2YN5A 4XP6L 4XRCA 4H88L 2NY3D 3NTCH 4HUUA 1T0MA 2JJUA 4HPYH 1MHEB 4PGDB 2YD4A 3I50H 4M6NL 3VFWA 3MRPA 4YX2L 4JFDA 2WIMA 3RNQA 5C0RH 4OFPA 1FNLA 3VMOA 1QG3A 2AEPL 1OOAA 5E2TH 1R24B 1JYNA 3V6FB 1J0IA 5IMOA 2GEEA 4RWHA 1G84A 2RB8A 4YBHA 5T1MB 5ENWA 1IEBB 3VXSE 3OKOB 2EYTB 5ACZB 1DQLL 1FFPA 3LS5H 1XCTB 4P9HL 4I0PD 3OSKA 3BPNC 3BH9A 1A8JH 3W2DH 3DO3A 1V05A 4HF5H 1S8DA 3VDAA 5E9DE 3C09C 4ZTPH 2OR9H 1QPXA 1Y0LB 1EIBA 1B4JL 3C8DA 3M8OL 1Q94B 2GK0A 5ITBH 1KXTB 3C2AH 4UIKH 4F7MB 3GMMB 5GS2D 1R5WA 3QXTA 3REVA 4N1EA 1F58L 1CK0H 3VDBA 4YX2H 1DVFB 2AJVL 4JJ5A 5E1HB 1ZHLA 3FZUD 3EAKA 3BPOC 2ZPKH 5EO1A 5T3ZL 2XFXA 2W9EL 3U0PB 1JV5B 5HYSG 2CGRH 3ALWA 3BESR 2FEEL 5DHXB 5C0CB 3BP7A 5CAYB 1TPXB 4IEFB 2WBKA 4F2MA 2F5BL 1FV1A 5I19H 4YHPA 1YZZA 3LN9A 4OV6F 2JIXB 4JN2B 3N50A 1ADQH 4JFEB 3DHMA 2OI9B 5GS1B 5IROA 1IGJB 2VR5A 4XMPH 5GJSL 4L29A 4HH8A 4F9PA 4YHYC 5F7FA 1SYSB 1XGUA 3L5WB 2M8XA 4RMWA 5KN5B 1P2CA 3QUZA 1NFKA 4WO4B 2IPUG 4NUJA 5J1SC 1YJDC 4S0SD 4NQUA 1S7VB 2EIBA 2O5YL 3OX8B 3U4BH 2WBJD 3RZCC 5DK0A 1KJVA 3NABH 3Q6GH 4IDLA 2R29L 1DANT 3EO1B 1NCBL 2Y9RT 1G6RL 3TVMC 4QKXB 3D25B 2H32B 3OG6B 4Z18A 5IMKB 4LHQB 1DBJL 3OKDA 3O41B 3KXFE 5JW3L 1PBYA 4TN9A 1UKTA 3WFEH 4MJ5B 4NJ9H 2ZUQC 1E4KC 1A0QH 3GSOA 1QYGL 2HKHL 3HB3D 1JPSH 3TO4A 2IGFL 3VGDA 5DS8B 1F4WL 1OD9A 5JXEA 4E41A 1JHTB 4E5XB 1OPGH 4KUCF 1VA9A 5EBMB 3X3FL 2RCSH 2YC1B 1CGWA 1D5ZA 1GVIA 5FYJU 1H8NA 3JVGC 3W81A 4JFOA 4UV4H 1KG0A 5LCVH 5ID0B 1O0VA 5BO1H 4Z7VA 3KLAB 3KLSA 1U8MA 1I85A 3QUYC 3SDXF 1K4DA 4TNVF 4HIHB 1J8KA 1RMFH 1ZANL 2A0LC 4IHOA 5BXFB 3P4LA 5GZNC 4NKIL 1VGEH 4KZDH 3PWPB 1EX0A 2XNAB 3GJFK 4P5MA 5HJ3A 1A0QL 2XPGB 1UZ6E 4NRZA 1MLCA 1DQTA 1HHIA 3QQNA 2H9GA 3STLB 1U8OB 3VFPA 4IRJB 5KSBB 3IXAB 3VE0A 1HHHB 2DAVA 1IC1A 4R3SA 2A6KB 4ZFOL 5T1KB 5D2LA 5E8OA 1FN4A 4GXUN 3LOWA 3ARGB 4XPHL 5DLMH 3HZMB 3ARBC 4HFUL 5FOJA 3C6LC 5CINH 4FQIL 4YBQC 3T2NL 2E8ZA 1VERA 1E4WL 4U1LA 1UZ8A 3VFVB 3A67L 2EYRB 3B5GA 1A4KA 1X5IA 2OTWA 2QHRH 1CGSH 2QSQA 4J3WA 5GJSH 4Z7QE 4OLYL 1C16B 4UT9H 1MWAL 5M7QA 3IETB 1VGKB 4MCZB 4M7LT 5IB4A 2E9WA 4NQEE 4PJAF 5IQ7L 1DLFH 2PW2A 4R0LB 1SM3L 3ES6A 2X4RA 4ETQB 1YJDH 1I9RH 1W0WA 4PJHF 5JHLH 4JB9L 3MROA 3VI3F 4QHKJ 3WIFB 3MLWL 4RFOH 3HS0B 5CZKA 2WP3T 1FVCA 3FOLA 2UYLA 5EC2B 3FFCB 4FQCL 1BGXH 1EAJA 3QEQE 3BUYA 1KTRL 1N0XL 2J5LB 4LSUH 4LSQH 3G5XB 1JWMB 3T4AB 1EFXB 3JXAA 3P9LA 4HWBA 5BMFL 4URTB 1FLTX 3OGCA 2BOCA 4MB4A 3WUWA 3EUUA 5GRVL 5E95B 2EIDA 5GXBB 1HXMB 5TQ2L 3O9WA 2VZ1A 4JHAL 1CK0L 1MCSA 2GAZA 3MGTA 5JDJA 3WFCH 1PY4A 1BQHA 1U8JA 3MV8E 4NQVB 3TESA 5EIQA 3BH9B 3S36X 4AH2B 4XWGH 1UXSB 1U58A 2BNQB 1BFVH 3SJVE 4PJ5D 4QXTA 4MSWA 3KHQA 3RDTB 3WEXA 1OAZH 1XF3B 1CU4L 5IW6B 4OGYH 2GCYA 4P3CH 5I74B 1ZGLM 4R2GD 3TBSB 4UZGA 4DEPC 3WS3B 3FO1B 4ZAKD 3BN9D 1VENA 5IQ9A 2H6PB 5DMKB 1UXWB 1IL1B 2HA1A 1S5IH 3EJYD 3LEXA 4GW1B 5IOPA 4JPKL 1CFNA 4F3FA 2OS7A 3U9PL 2VXVL 3L3DB 1Z5LA 3LB6C 3H0TA 1BFOB 1FNFA 3CXHK 1FNSL 2BVUA 1KEGH 3QFJB 3VXTB 4XPAH 1T1WB 5C6WH 4XVSH 3CZFB 4KKAC 5J12C 3SKJL 3VD7A 3DOSA 5KS9F 5HGAB 5HY9B 5KTEH 3VXUE 2E7LA 2P5WE 4YPGB 1AXSA 1T1YA 2P5WB 2YD9A 1YNTA 4N5ED 4QRQA 1JTTA 5F8QC 4NN6B 1WZ1H 1OF2A 2I9LB 5F9JB 1RZFL 1WWWX 5ESQB 2VDML 2W65A 5LKNA 1U8PA 3TJHD 3S5LB 3UTQB 2VAAB 4TUJA 1G1YA 4TVPD 4HUXB 5DK0B 1ZXQA 1U8HB 3DIFB 2GITA 2O26U 4HXAL 2OJZL 1XIWB 3PDOA 1OAKL 2A73A 4P2CG 2Z4QA 3AREA 1JNLH 2X4SA 4G8GE 1IRAY 4ODTL 5F7DB 5IWLA 1J0JA 1S7TB 1RZ8B 4HUMB 1KV3A 4JZNB 4LIQE 4NQCD 1JHTA 4HWEL 4LQ1A 5DJYA 1IM9A 4R9HA 3MV9E 2VDPL 3QRGH 1MHPH 1A7NH 4LLYA 1D3CA 4GRWH 2UWEB 5I1CL 2W91A 2NR6C 4WUKL 1MCOL 3WUWG 2K1MA 3BHBB 3ARED 4RWYH 3HE7C 4MNQB 4ODWB 3S4SA 1AD9B 2VLRE 3QDJB 1NCWH 4DWHA 3MBED 1FH5L 4GG8A 3DGCR 2A6IA 1E4XH 3H3BC 3VXME 4L3AA 3LIZH 3G9AB 3EO1A 5BRZB 2EDRA 4NDMA 3T2NH 3UZEA 4G9FE 2NXYD 5ADOH 4GUPB 4MJ2A 4OD2B 5K9QI 4K9EL 3FRUB 4ORZC 4J4PD 4XT1C 3BQUC 3L5XL 5E2JA 3BDXA 1XCQA 3U4AA 5MENB 3QIWC 4OM1L 4L8BB 5DC9B 5K59E 1DEEA 1I3RB 5BOZG 4OF5A 3VFRB 3NIDF 1QFWI 3SGJA 4G3YH 2E6PA 4U3XA 4RNRA 4XVSL 1CICC 2ITDB 1T7WA 4FFZH 1MWAA 3D3VD 4WUUD 1A4KB 1MCDA 1T22A 1FGVH 5D70L 4AENA 1JNHB 1TETL 5F9WB 1WZ1L 2AJZA 1YY8A 3MACH 1NMCC 5DMGD 5IHLB 2GSGB 3PWPD 2YA0A 4HFWB 4YLQT 5KSBE 5HJ3B 1M1SA 3QXUA 3OR7B 1MHCB 3HAEA 4MB3A 1FVCB 2P7TA 2ZKHL 3ARFA 4PRHD 5L2JB 3ARRA 4GAGH 1FIGL 1TTGA 2WUBH 3HTLX 2VXTH 1UG9A 1S78C 2HT4C 4ZNCD 3RKDD 2IH3A 1L7IH 3O4LA 3H8NA 1XF5A 3HG1D 4YWGL 3I9GH 5FO8A 1BAFL 4Z7UB 4WGVB 1NC4D 3QUKB 4WTZA 4F7CA 1ZSDA 2CLRB 2Z91A 2DBLL 4NZJA 2BXZA 5FKAB 4GG6B 4PGCA 1JGUH 1A7NL 3GSWA 3KPSA 4KKBC 1Q9LB 4NBZB 5KG9B 3C08L 5KSUA 2RFXB 1KCVH 1W0WB 5C2UB 5TQ0L 1C08A 5I1KL 4PRIA 2NYYD 2CRYA 5DF0A 1CFVH 3LMJL 2Q76A 3IAPA 2Q8BL 2WK2A 3TA3C 3VXRD 2EDQA 3NPSB 1U3YA 3WS3A 2AEWA 3EO9H 4HIEA 1IAKA 5A2KH 2NY7L 5CSZB 5ICXB 5CBEB 1N2RA 1FL5B 1PKQB 1BWWA 5DEGA 4POZD 4LKCA 4XRCB 4K94H 4AK1A 43CAA 2F54E 4EUPH 5FOBB 3MLRH 4X8JA 5KZCB 3PE9A 3CFCH 2W9EH 1IGTA 3FOMB 3V5DB 4BSJA 5DRZA 2VXUL 3MNWB 3SDDA 1HIMH 4CW1B 2HJFA 3DVIA 1U8JB 4F57L 1C7SA 3KYKH 3P77B 5ENWB 1FE8H 1G0DA 1SJHA 4IJ3C 4KI5E 2XN9D 1C12B 3CD4A 4Y2DA 2JKXA 4Y4HD 5DJ6A 4HKXA 1IAOA 1YC8A 1AI1H 1Q9WA 2VR9A 3DI3B 4MZ2A 1ORQB 5C2BL 2GITB 3KYMA 4FOMA 2RQ8A 5IFAL 3IKKA 3RTQB 3CH1A 1U3JA 3PHOA 3VXNB 3KYNB 1DN0B 2IBGA 4UAOC 2HT2C 4G8EB 5ERWB 3ARYA 1OD7A 4ONHA 4NO0D 5FYJE 4GXVL 1Z0MA 1K9TA 3R0MA 2AXGB 4G8IA 5DRNA 4YJZL 4WHYH 5HVFB 5D96C 4LCWA 4GG6E 3DUSB 2ZUXA 3NVQA 4S1DD 5D7KD 2VZVA 5C0AD 4DJMA 3IF1B 2WP3O 4PJAA 4ZO8A 4IIQB 4PJCE 4MXWH 4N1CA 3TT3L 4XNMB 3FT2A 3LN5A 1QLRB 4PRID 1INQA 2NQCA 3L95A 4JEGB 4OIIL 5D2LE 4CN6A 2CLVB 3ZKMD 4XTRC 4AIZA 4LCIH 4AJ0A 5BO1L 3GUTA 1TVHA 4PYGA 4C4KO 1YQVL 1F00I 1FJ1A 3C8KB 4LHUB 2VWEE 2CIKB 3BWAB 4U0RC 4PB9H 1UM6L 3MV01 3ULUC 1D6VH 4U1IA 2E8YA 1HYRC 3MXWL 1TJIL 1FFNB 4KKCD 4DUVA 1ZGLB 4NN5B 1A9BA 1FORH 2PYFB 1U3HB 3OPZH 25C8H 1N5AB 2G5RA 3QI9B 4JN1H 5D1XC 3E6HA 4KK8D 5FUOL 5IB3B 1ACYH 4ODUB 1KPRA 2G5BB 4O5LH 3B2UC 4WUUE 4Y0GA 3NIFF 4KUZH 4FFYH 5DLML 1KBGL 3V4VL 2NY6C 5F89A 4HFUH 1HIML 3FB8A 4ZG1A 5F1OB 1JZ8A 3WMSA 2X4PB 4PV9B 2X44D 2EYSB 2QQQA 4TSBL 3HLAB 3QXVA 1R3LA 1CGSL 1KLUA 4XP4L 1MSPA 1P53A 5EU6B 3SDXE 3HUJF 3VXMD 1NAKL 1S7SB 1WZKA 1WWCA 4F37K 5ITBL 1O5DT 4LAJH 5T3ZE 1GAFH 1MIEL 4AEHH 1QBML 2J8UF 4PG2A 1JZ3A 1UZ6F 3O4LD 1IAII 3MUJA 3DX8A 1EV2E 2PYEE 1T1XB 3EHBC 4XP9H 3TYFA 3QIBC 3NCJH 3MREB 2GQHA 5F9OL 2ZZUT 4K3EL 1WCQA 2V7HB 4OLZH 2CIIA 5IW3A 6CGTA 3V7MA 1OAUL 4KVNH 3EW3B 5HHOE 5CBAB 1UM4H 3UJIL 4PY8I 4DFHA 3QIWD 1HHGB 3ZTJH 4ACPA 2E7CA 2BVEA 4K2UL 4JY6A 3BKCL 4TQEL 1JTPA 1HH6B 3KGRA 3CSBA 5MEOB 5HPMA 3BDBA 2XI9A 2VH5H 4Y7MA 4PIRF 3QNZB 3SKOB 4POYA 1EHLL 1TQBB 3N1PC 4OCXH 4PJ9A 3QAZB 2X1XR 4M4PA 5E8EA 5IBUB 2ARJB 2MHAA 2DI8A 2X10A 1W0VA 1NJ9A 5ICXA 4PRPB 3U36A 2C5DC 4HF5L 4JFYA 4F58H 3EYQC 3QIUD 4YO0B 1OARH 4PJEB 4I4WB 3SE4C 1VSCA 4PREB 5F7WC 4IOSD 4JZJA 4L5FH 2V5TA 4C4KT 1JYVA 3UJIH 2AEIT 4O00A 5D1QA 2A77L 2VZOA 5IUSA 4WVRA 2PXYA 4OCYH 2PO6D 3GB7A 3L1OH 4L9DA 3Q3GA 3PGDB 1OCWL 1JI2A 5JXAH 2KDGA 1INEH 3QDME 2XY2A 2MOVA 1VCAA 1SEQL 3V0VB 1GHFH 4M5ZH 4FQLH 4UILL 5GRJH 2AJXL 4B7LA 5IMLA 1YN7B 3CFBB 3GMLA 2DQUL 4HG4K 5IP4A 4X9GA 5TDNB 1P7QB 3BW9B 3V8OA 1CN4A 3RDTA 4FTVD 5I1JL 4L5FL 1GAFL 3EBAA 3WFEL 4FQQA 5TE4L 1BVKA 1JPTL 3I3EA 1JI1A 2XFXB 3CSYB 4R2GB 3BQUA 1AJ7H 1VFAB 3MV8B 5E6IB 3ARFC 4NC1C 2A83B 1DQLH 4MZ3A 5CP3A 1P9MA 1D9KD 1I1RA 4KPHL 2FZ3A 4B5EA 1I7UB 4QT5B 4QCIA 3T4YA 3T0AA 4FFWD 1AXTL 2MNUA 5I75B 1D5BA 3MV9A 1T6WA 5IEHB 1QBAA 4ONGL 2Q87A 4CDGC 1JPSL 4QRRD 3FQXA 4K2UH 1ED3A 5BV7H 4QHNA 3LKPA 3HE7A 1TZIB 4ISVB 3BZDA 1AR2A 5F9JA 3V7AE 3BN9C 3Q1SL 5FA4A 1ZT1A 1TDQA 2CGRL 1RZKL 1MPAH 4TYUA 2EH8H 1MRFL 5CFHA 3UYRH 2CKBA 1NGXA 4KJQD 5EU4A 4P2OC 4NFDA 3W0WB 5C0DA 3LEYH 3KLDA 5CLWA 5ERWA 3IKCA 2D7PA 5EOTA 4BSVA 2DOCA 4KMQA 2B5IC 1L9MA 2YD1A 1B6DA 4JZNA 3RX7A 2A6JB 2H8PA 3QDMB 4Q9QH 5GPRA 1VACB 5CSBA 3BRFA 1KTKE 1QKZH 1RJYA 4NO0B 4M1GL 2O93L 3U46B 3B3IA 5ETUB 2NY5L 4PP2A 2VYRE 2X4UB 4DUXA 3FQTB 4J12A 3K4AA 4TSCH 1H5BC 2EDFA 3QJHB 4YUEL 5I1HH 4GKZA 4HD9A 2IADA 1HYSD 1QLEH 3ZYZA 2VZSA 4DOHE 4LHUA 2O61A 3G6AB 1QSFB 1Y18B 4WEBL 1RU9H 5CSGA 5TDPB 1LEGB 2P8MB 3L3JB 4JRXB 3RZWA 5JORA 3ROOA 4J3VA 4NFBA 4U31A 4XGZB 4A6YH 2QHRL 5EU5B 3R1GH 1DL7H 3H2WA 3VCLB 5JUEH 4UT9L 4ZUUB 4HAGA 1FFNA 2CSPA 1HHHA 3HZVB 3NACL 4TQEH 4CRPA 3HE6C 5TE4H 1FVEA 1QTYT 5ISZA 2BERA 3JTTA 3A6BH 5EZLB 1NBVL 3G08A 2KPNA 1U36A 4PFEA 4X98B 3H9SB 1NBZB 3BP5A 4PB9L 2ITCB 4YHML 4PUBH 4PRDB 3QUXC 1VHPA 4QY8B 4NQCB 1Z9MA 4N8PA 4JY6B 2CKNA 1MJ7L 1R3LB 2IF7A 5L9DH 1EFQA 1BF8A 1A6ZA 1K8DB 1NMBH 2VISB 5MERB 5HPMB 3CCHA 3HMWH 4UNTA 3ZHDA 5C0IB 1MUJB 1S9WB 2MMXA 2XTLA 4GOSA 1CDUA 4KJPD 1W2KT 4NM8L 4JAMB 1NJ9B 1Q0YH 1S5HB 1TMCB 1FL6B 3ZE0E 3U0WH 5C8JB 3HZKA 2FBOJ 4I4WA 2BCKB 4KAQH 4KVCH 3SDCD 4O2FB 4K8RC 3O4LB 3UO1L 3DO7A 4XC3L 1X5AA 2BOBB 3BKYH 4R26H 4TUKH 5GSVA 2ZCLL 4UT7L 5E00A 1DQDL 4YHNA 5HI3C 3CC5A 1V3KA 3EYVA 4K3GA 2D03L 1URLA 3WN5B 4UNVA 4M5YL 1UXSA 5TE7H 4UOW0 3VGGA 1YN7A 1EK3A 2Q3ZA 4M7JL 3CFBA 1NBQA 5J4MA 1E4XL 4HLJA 1UB5A 2JB6A 3ZYJA 1QLEL 1A1OB 5GISL 2V7NB 1FO0L 3ZKSD 1N26A 1BQLL 3BO8B 1OAUH 3F62A 1KC5L 5IQ9B 5FKPB 3MNZB 4GKNB 4P2YA 4JFYB 1WIOA 5JXED 5FGRA 1IGIL 3OZ9H 1JPGB 4R7NA 1YNKH 5CBEA 3QH3B 4P4KC 4U6VL 3T1WA 3K7UA 1GSMA 1MHEA 4M6AA 2G75A 1F13A 1MNUH 4HWEH 2EE9A 4HK3N 1FC2D 1VKXB 4PTUA 1NBVH 3RWHB 5D7LE 4ZXBB 5KS9A 5DGRA 1ZKAA 4P4KA 2FO1A 3T4YB 2NY1C 2VLJA 3D69A 1A6VL 2P42B 5FGCE 3SDDB 3CXDH 5T1LD 5D2NC 3QNXB 1U8IA 3VXPB 4E41E 2Y25A 1H3VA 5T1LA 1BQLH 2Z8VC 1WGOA 4L8DB 5C3TA 1S5IL 1G7QB 3CUPB 4MA7H 5JA8B 1QVOB 1JGDA 2FSEA 5I1CH 5E9DD 5D1XA 5L0QB 1TIUA 2QQKH 3CX2A 3LRSA 1JHLL 3W0WA 1RUMH 2JELH 3CSYA 4NM8H 3WO4C 1BVLB 4N1HB 2ICCA 5F7DA 4HIIA 4YXLL 3EZJB 3QCTL 3IFLH 3LS4L 1BFVL 3RTQA 4KZEL 2HG5A 2VLKE 4X83A 3U0PA 1WEJL 4L3ED 1L6XA 3N9GH 5ELIA 4DGVL 5ESAA 3WFDL 1JGEB 2RHEA 4WV1B 3K3QA 1JWSB 5DD6A 1LDPH 2VDOH 3BHBA 3MTRA 4U1KB 1B3JA 4KRPB 3WYRA 3RVXD 2AXFA 3IU3A 4OM1H 1RUKH 1YMHA 4UQ2B 3U6RA 2BSTB 1INQB 5DUPL 1P7KB 1J0KA 2W0FA 5C0CE 4R7DB 1ZANH 4K7FA 5A40E 3GMNA 1U8NB 1B9ZA 4FFZL 1LP9B 5B38B 4X6BA 2X89A 1GXEA 2DTMH 3FCTB 4BQ6A 3MRMA 4KI1A 4RGNB 3QUXA 3OKDB 2A2QT 3O6LH 4EOWH 3DROB 2EE3A 3P3YA 2GFBA 4JM4L 3BPCB 4HK0A 4ZAKC 3LHPH 2APFA 1FAIH 4YDJA 5KAQG 1H5BA 3HMWL 5TF1L 5E7FA 1VACA 1NLBH 2R1WB 4HKZA 1Q72L 3QEQA 5DJZB 5DR5L 5EU6D 3D3VB 4Y4FC 1LO3H 1CGVA 5EUOE 1A22B 1EH9A 5IGXH 3O2WL 3NIFE 3D18A 1CLCA 4M8QB 3BXNB 3GM8A 1BD2D 2A9NL 1FP5A 5AD0A 4LCCB 2HFEB 3C6LD 1NEZG 1ITCA 1OTUC 1JE6A 1R3IH 1MCBA 3MRCA 3T0EE 2QADD 1GGCL 3ZLQC 2X4QB 1DLHB 4CMHC 3EOTH 2XN9A 4I2XB 2V5MA 1M05A 4P5KB 5GIRB 1EEZB 3TZVD 3MC0A 4TOYL 3S8WA 4HC1H 4OCSL 4MD0A 3EYFB 4P48A 3VRIB 4G7YH 5FA3A 4NQXB 5AG8A 3TJEH 3BEWA 2ARWA 3QEHB 5DYOB 1RK0A 2NMSA 1MCEA 2GJZB 1LK2B 2UVFA 2YMXL 2ENYA 4P5TD 3PJSB 2GHWB 3TA3D 3UBXB 3SCMD 5FO8B 2PTTB 5I19L 2OLDA 3GFUA 1CL7H 1E27A 1CCZA 3P4MA 4JY4A 2VLJE 1KC5H 3EDFA 1OLLA 1LO2L 3E1F1 5KVEL 4WU5B 3LKRB 4OF6A 3TNMA 1T4KB 4LHJB 3JWOH 3EDEA 3MRNB 5LGHL 3L1OL 4PJIF 4JM2B 4U49A 3F5WB 1RIUH 2F15A 1C16A 5F7UA 3H42L 1LP9E 5DMYA 3WNLA 5LGKA 2EDWA 3AS2A 3OKNA 3HS0A 3DGGA 3UJTH 5HHQB 3K8MA 1T20A 3L7EB 5EWIL 3MQIA 4I77H 5FXCH 4YC2B 3DX7A 4LCWE 4O2FA 5GZOC 4M61A 3MV9D 1K4CB 4YGVA 1I7TA 2X4TA 1G7MA 1U8KA 2R4RH 5I8EB 3HG1E 4KRLB 2JJTA 1R24A 2ID5A 1OTUD 4P9MH 3U4EB 4O5LL 3RPIB 4WTXA 2VUYA 1IEBA 5DVLA 5DVKA 2NY4C 2UZIL 3PV7A 1U9KA 4QXWA 4OZHE 1A6PA 3VGAC 4YHLH 3TT3H 2FH6A 1YEIL 3SE9H 3PGDA 1YUHA 1T66D 1YC7A 4Q0XH 2J88H 1YMME 4JPVH 1OWWA 4N0UE 5IF0B 3MNVB 4H1LB 5I1IH 3MOBL 2A9ML 2KUTA 1U58B 3LPFA 5JPMA 4UBDC 2FSEB 1LQSR 2OMNA 5EIIA 4APQA 1ETZB 3LRSB 3BI9X 2OR7A 3GRWL 4PJ9C 3N0PB 4ELKA 4G8EA 4JDVB 4L4TB 2K3TA 2D2OA 3MRBA 2ZUTA 4G8IB 5DRNB 2V5RA 4Z7WA 4PG9A 3VGEA 3MJ9L 5HYJB 1A5FL 4DAGH 1KN4H 5KS9B 2CUHA 4J4PA 1XR9B 2DI9A 4X5LA 1CFQB 3I6GB 4OIAA 4UMGA 3D69B 4Y1AA 4JFZH 3FT2B 3MX0A 5F9DC 3RWIB 3V0WH 2WLZA 3H7LA 4QT5A 5F88B 5IBUG 5T1LB 4QHMA 4ZFFA 2BNRD 3JWOC 2X05A 1GOHA 1ZHKB 3MLPA 1PFCA 5D72H 1PLGH 5C09D 3VMNA 3B9KD 3CFCL 4K7PY 1ACYL 3S9DB 3FL7A 1TCMA 2VH5L 4HIXH 2D0GA 4K7FB 2E9IA 2PO6A 3KPNB 4M62L 3TBWB 2VE6A 4O4YL 1HHKB 1X3DA 3FN0H 3TVMD 4MJ5A 4Y1AD 3RGVB 4MNGA 4U6HA 4HIIB 3OXRB 1C5BL 2R2HB 3MJ9H 3B83A 43C9A 4IMLB 4I0PC 4M4RA 2VOTA 4IRZL 3BKJL 1DVFD 3FJTA 4Z95H 2Q7YB 4P46A 1A2YA 1N7MH 4I13B 3G5VA 3RGVC 4Z76B 1JHKH 2GK2A 5JO5A 2DRUA 3VXOA 4MCYA 3QEQB 2VLKD 3RWFA 3BAEL 1WTLA 2VR4A 4L9LA 5TE6L 2APWA 2VN7A 4W81A 4ZPTB 2A74B 2NY1D 3ARTA 4LSPH 3PP3H 1A7QL 4JRYD 4QRRE 3SGDI 4DVRH 2J6EL 1I1AC 4ZAKA 4W68A 4Q0XL 3OR6A 5E8NB 3W11C 5D6CB 5ESVB 4MA1B 3NGBC 2HFTA 5F1NA 2CPCA 2FHFA 3GK8L 5DVMA 4FQCH 1RUQL 5BRZA 3X14A 1I75A 1AHWB 4GAFB 1KTDB 2HFGH 3VFPB 2EDYA 4NHUB 3HE6A 4YAQB 2FHBA 5AUMA 4HCRH 1D6EB 3O8XA 1HXYB 4NKMB 3R4DA 1Q38A 2GJZA 2F8OA 4YXKH 1J10A 2L0DA 5IESH 4D0BA 2XWJB 4UB0H 2J1KA 1HHJB 4JKMA 4LQFH 4XCYA 1EEYB 5KTEL 2EDBA 4NT6B 2VLRD 4TSBH 3P30L 4Z0BH 1J88A 4Z8FL 1RJLA 2BFVL 3MLZH 1CT8B 4G9FA 1RJZB 4RAUA 3NCEB 1VEOA 3TO2B 3GK8H 5DXWA 4HBCL 4BH8A 1RUAL 3QDMD 4P5KA 3QFJE 1OP5K 4PJGF 2NY3C 1EERB 3ZL4L 1JF6A 2B1HL 5DR5H 5JIIA 1RZKH 4NWUH 5HHPA 5I30H 3ZTNL 4YK4C 1G0YR 3RWGA 1FPTH 2XKSA 5K9JL 1NCTA 4BH7B 4N9OB 4DW2L 4F33A 4QRPD 1T80A 3GI9L 5HYJE 1NFDF 3VFMA 5DC0A 5MHSD 2Y07H 2FDBP 5A16B 1K4CA 1G7MB 1QFHA 1U8KB 2OL3B 1KEGL 1J8HD 3VXSD 4BSWA 2M1KA 5C0AA 5EORH 1G9MH 4JB9H 4EUPA 4B7IA 1E4KA 5E24E 5D7LD 2Q3AA 3KPPA 5ANMA 1EHLH 1GH7A 4UQ3B 2IPTH 5FYKE 2IMMA 4GMTL 4R4FH 4U2YA 4QXTB 3BKMH 3WEXB 1U2HA 4ZPVB 3MMEB 2BC4B 5E4IA 4WHDA 1C1EL 3ARBD 1P84K 2Y5TB 4V2CB 5EO0B 1WF5A 2C3VA 3C6LA 3K4ZA 4XBPA 3RUGF 3CFDA 3RL2A 1E6JL 1EJ6A 4NCDA 2OK0L 3P4OB 2EXYC 2V7NA 4QXGH 3V0WL 5CINL 4ELMB 4HIEB 4JGJA 4G8FA 1V3JA 3GMMA 5FKPA 3QQ9D 2NXZB 2D3VA 2HP4A 1WBZB 4XNYH 1K2DA 4OLYH 3MRPB 4RX4A 1MFCH 1I9IL 1WFUA 2BRQA 1UT9A 1XAUA 3SDDD 3IDXH 4POUB 1YYLL 4MXVF 2QL1A 4WI7A 1FG2B 1XR9A 1KIRB 3TO4D 4M1GH 6FABL 1A6WL 2DQCH 1CU4H 4MD4A 3MA9H 3MLTB 4NNXA 4DVBA 4U7SA 1XR8B 2HFFB 3HI5H 3QPQD 4WFFE 3T04D 4MXWL 2R0KL 1XGUB 3N85L 5CJBA 3C8HA 3TA3A 1MCFA 3TN0A 5DO2D 4Y5VC 5GGSY 1RUAH 2E9BA 2FIKA 3PL6C 3DIFA 4OFKA 2PTVA 5EU7E 5C7XL 5HHMB 4EI6B 1Y6KR 2BX5A 3F12B 3SCMC 4RX4D 2HAZA 1ES0B 1W8OA 3ULVF 1SEQH 2D7TH 5DHVA 5K59F 1LK3H 3TIEA 3AM8A 1I9JL 5CUSL 4Z7WB 1FNHA 2FEEI 4U0QB 4ZUTA 4FN0A 4YHZL 1NANI 3MGAA 2YBRB 2EIEA 5C0CA 2Q7YA 2KL6A 2W38A 3BP7B 4TVSa 2FEDD 1UJTA 3SO3C 1X4XA 3KPQB 3T0EB 3LHPL 4R26L 3KYAA 3RZCA 3ZE2F 4NZRL 4PP2B 5CCKH 3SDAA 3K4DA 3QDJA 4GH7B 8FABB 4JFFB 5E8PA 4D9RE 4O2CA 1A1NB 5I18H 3VJ6A 1B2WL 1OAKH 5GS3A 4JO2L 1JPST 1D9KC 4Z5RA 4AIZB 3G6AA 1Q1JL 4HIHA 5GRWA 1A5FH 3ARFD 4NPYB 5F1NB 1YMHB 5CJXA 4JKLA 3VXSA 1XF4A 1CVSC 5CGTA 2W0LA 4XGZA 1I9JH 4RZCB 1KEML 5DD5H 1AHWA 1MF2L 1VPOL 4LAQL 3QJFA 3B9KB 4N8VG 3KDMA 1FNEA 1NLDL 4JY5H 1NANH 3WKNA 2DQEH 3VRLE 3H3PH 4CJ0A 1XF2B 4HBCH 2FH8A 1NDMA 3GJEA 4E41B 4OF7A 4OV5A 4K07A 3LEVL 1I8LC 3NCJL 4LLDB 3KLHD 1U3HA 4P2RB 1JF1A 1MVUA 2MQ3A 3MV7D 3UYRL 4NT6A 3TCXA 4FABH 5CILL 3EJZC 3GSVA 4JG0L 1YNLH 4R8WL 3DSFL 1VESA 5DJZA 1KG0B 3W82A 1JMXA 2NY5C 2XACC 3MFFB 3KWWA 3I85A 4XMLH 1HSBA 5I8CB 2NY2C 1TXKA 2WW8A 5CEZH 4F9LA 1AE6L 1T89A 4P23A 1OQOA 3QULB 2C1OA 2ICEA 1QFOA 1AQDB 5EH1A 2F53B 2XZQL 1NCNA 2XPGA 2BY1A 4U2ZA 4PJBF 1R3JA 5A43C 5C0EA 5I1EL 5I0DA 1RUML 4Y5VB 4NQDA 5DI8B 4R96A 1IJ9A 3I50L 3GHBH 1V7NL 4G43B 1U8OA 4M6NH 4ERSL 4F33B 3L3GA 4O51A 4D0BB 4K94L 4P4RA 4HJ0D 1CGXA 4KK5D 4GRLA 2BY0A 4AEIH 3IJHB 3SQBA 2GJJA 3FB7B 4Y16A 1UCBH 5HHNB 4JVPA 4U1NA 4I0PA 1BECA 4KI5F 1FFQA 5IJKA 4BFIB 4MXQD 4XX1G 5F97E 2AS5M 4G6FD 4HCRL 4E42A 1AE6H 4RAUB 4WHTA 5ID1B 2ADGA 2D0HA 2IALA 2GAZB 3QDJD 2P24B 1MI5D 2C4FU 3LPWA 2R8SL 3UPAA 1A7OL 3NFNA 1KLGB 1UWGH 4JRYB 2NPLX 2PNDA 4UILH 5GRJL 4JFDD 4AH2A 1CFBA 1HI6B 5D8JL 4HBQA 1MFBH 1LP9F 3BO8A 4KTEH 4MNQD 4YHMH 2DIJA 3D0LA 3AXLA 1PX3A 3MOBH 3EFDL 1V7ML 1I1FA 4JLRA 5SWZA 3QDGA 2Z8WC 3G6JB 3VW3L 3EYOA 4F7PA 4ZFOB 1R3HA 3G5XA 2Q7NA 3VFMB 2FX8L 1F11B 2WBWB 4Y4KB 5LJYH 2G2RA 2JK5B 4OGAC 4DGVH 1IGFH 1KGCE 1TJHH 3GSUA 3MRDB 5I16A 4YGVB 5I8EA 5IVXF 4EUPB 3DURA 4L4JA 2DQFB 4JQIL 4QHKI 3FB5A 4MD4B 1KOAA 4GMSL 1ZAGA 2UZXB 3KPMA 1ZT7A 3NZHH 1YNTB 1G9NL 1UH4A 4NQVA 4YHZH 3O3UN 2Z35B 1G7QA 4KTDL 3UO1H 3BIAX 3HRZA 4QOKA 4LEXH 5BVPL 4U1MB 2Q86A 2FIKB 4XH2A 4N0FA 4YK4B 1ZS8B 4NBYB 2B4CL 2VITB 3D5OF 1PLGL 5IHUL 2G9HB 4PJGB 3T1FB 3CH1B 3PHOB 2AEPH 3VXNA 1RULL 4GXUM 4BM7A 2QSTA 1OGAD 5E5MB 2NY3B 1I1YB 3DHJA 3LCYA 4LOUC 1IL1A 4ODVL 1F4XL 1NCDH 2UY6A 2HTLD 5F3HA 2IQAA 3F58H 4XP9L 1FLRH 3BZFA 3MR9A 2P1YA 3CPLB 4R4BA 2YPLE 5ESAB 1MOEA 2UY7A 3TWCH 1J0YA 1FYTB 2Q6WA 3IDJA 4FFYL 3DMMC 5T5NG 4RGOL 4Y4KC 4K3JL 5IBLD 3A0OA 4C56A 4MNGE 4UU9A 1HEZB 5DFVD 5GGRB 4JM2C 3L95B 1YEEH 1FZMA 2R1YB 3VFTB 1D5BB 3MV9B 3BAEH 1MJ8H 5TE6H 3RAJH 4LL9A 1IC4L 3VWJD 2XKNB 4PRAB 2R8SH 1P7KA 4I0KA 3RP1A 2SEBB 4DKDC 2J8UE 4ZFGH 3NH7H 5HYQB 3O4OC 4V2BA 2R0WL 1RZ7H 3ROLA 1F6LL 1IFHL 2CQVA 2EC9T 3WE6B 4DKAA 2B5IB 5DRXB 4JKPH 1Y6NR 4JO3H 1P4LB 5IB5B 2GJ6D 3IKCB 4ORGA 1RZGA 3P40A 3RWCA 4RGOH 4IMLA 3RWDB 5D7KE 4M7KL 1QQDA 5HYSB 4P46B 2NTFB 2IBZY 4TNWK 1PD6A 4KVNL 4OCRL 5H94B 4MDIA 5JO5B 2R2CA 4AQOA 4LF3B 4AL8H 2ARJQ 5F1KC 3FQRA 4L3CB 5I76A 1KYOJ 3S88H 4LDOB 3KWWB 3MSPA 1T5XB 2WWMC 2XN9B 4L4TE 3NN8A 4Z78A 2ORBL 1KTLA 1M7DB 1F3DJ 5DJXB 1JYWA 1QSFA 5BW7A 5L8KB 1C5CH 2QQNL 2F53A 1P69B 3KDMB 3QEHA 5LGHH 1MEXL 3OJVC 2Z93A 1D9KA 3ARFB 1RZJC 5T3XE 5JZ7D 4UV4L 3O3DB 1S7XB 5CZVL 4FQPA 4ZSOE 1OAQH 4PJ5B 5FCUL 4QHUA 4OKVA 3VWKD 1L7IL 2X4NA 4DW2H 1XGPA 4R4ND 3WS6A 1S9XB 1MVFA 2BSRB 4QTIH 4WJ5A 4KVCL 1XMWA 4JREC 3AS1A 3BWUC 3ULVD 2BMKB 3H3KA 1KEMH 5DD5L 3H9SA 5JLZB 1NAKH 3OMZA 1XEDA 4PJXA 3THMH 3LQZB 3MRIA 2FGZA 3DMMD 3I3DA 3ZKXC 5SX5K 3L5JA 1TJIH 3TO2A 4PJ9B 4XPBL 2W0PA 3LKQB 1IGFL 4KXZH 2VJXA 4XPHH 4PJGE 4PRIB 4WGWB 5CZVH 3P11L 4OLEA 3MYJA 3I6LE 3O6FC 1CD1A 2I9TB 4J23A 3WO4B 1SEBB 4ZFOA 3ZMRA 5K9KA 5T1KD 4Q58C 4L8SB 5HVGB 4KQ3H 1KELL 3HMXA 4Y4KA 4XPFL 3CSPA 1TCRA 1ZT4A 2EKSA 5D5MF 3T0EC 3U7WL 3SY0A 3VGAB 2XZCL 3IYLW 1MNUL 4LLUA 2FHCA 3DO7B 3QAZC 1DBBH 1ZGLP 3MPCA 1TQBC 4WI6A 3HR5B 3FB5B 2AK1L 3VWJC 5GGQL 2ADGB 4CW1A 1HE7A 3HAEH 3PHSA 4B41A 3QUZD 1HSAB 4WHYG 3BEVA 4HWZA 1OP9A 2E7LC 5DUML 2MJWA 3HI5L 4CJ1A 3BW9A 4QOKB 3Q1SH 2EDTA 2I5YH 1Q9WB 4O4YH 1A6TB 1AKJD 2R4SL 2VRAA 5F70A 1EAPA 1T04B 3QZWG 5C71A 3VG9B 3NAAL 4ZUVB 4NZTL 4OZFG 1ACZA 1MCLA 4LOUD 3PL6D 3MJ9A 2WIIA 4X6FA 4GRWE 3KYNA 1JPFB 1T83A 2ZSVA 4TRPL 2V2TA 4PJBB 3FT3A 3MFGB 2AXGA 3ULUH 3UTPE 5DD1L 4WCYH 4NHCH 3QG7L 1PZ5A 2O5ZH 4JM2F 1F2XK 1J1PH 3EIFA 4UU9B 2HH0H 5JHDA 4GAYB 1P5UA 4KROB 3M45A 5K9OA 5D71L 3S37X 1N4XL 5HGBB 1YN6A 4YHOL 2WWKT 4G6MH 4JKWA 4TVPL 1ZLWH 3T77A 1P1ZB 4YHIB 1HDMB 3O45B 4J8RB 4XC1H 1CBVL 3PWVB 2XKUA 4JZJC 3DX6A 1RUQH 2HTKC 4IRSC 5E5MA 5LXGL 1NCAL 5D1XB 1Q0YL 5F9AC 4LCYA 1KN4L 2GUOA 3QI9C 3EYUH 4EXKA 5DRXA 1XH3B 4NN5C 3UDWC 1WZMA 4PP1D 1XGTB 3D85A 4I3GA 2EEDA 1KJ2B 3B43A 4MQSB 1PKQE 3AS3A 4LEXL 4Z76A 5BVPH 3ULUE 3QDHA 2FD6L 5H35B 1T3FB 25C8L 4Y16C 1RJYB 4NO0A 1OHQA 2YC1A 4EXPX 2DMKA 4FMFA 5MEPB 5IB3A 4HKJA 3IDUA 5H94A 1F3RB 4GAJH 3MV7E 2CUIA 3VFTA 1P84J 5IFJB 2JE8A 4P2QB 3EJZD 4Q9RL 5E2WL 1WJ3A 3IU4L 2XRAL 4OCLC 4N0UA 3TC9A 1EDQA 2YRZA 4FQHB 2D9QB 4ZO6A 5FUCE 3VXQA 1QD0A 3ZE0F 4UV7H 1HKFA 4ZTOL 2ZKHH 3FQWA 1IGCH 4GAGL 4JFZL 1BX2A 1L0YA 3HE6B 1P9MC 3O6MH 4UDTB 1EO7A 3TPUB 4YNYA 4RZCA 2ZUYA 2FD6H 2DLGA 3O8XC 3KNBA 4P3WA 5HHMD 1NCWL 2CO6B 5DJ0A 1BF2A 3MREA 3H7BB 3A6CH 1GRWA 5AAMA 4JFOB 2QKIB 5EZJA 3LQAH 4MA8L 4NHCL 1JF1B 1PSKL 5DJDA 2YPKA 4OUOA 3C08H 2P45B 2JB5L 5C07B 2F9BT 4GRMB 4XB8A 4Y4HA 4JCMA 3C60B 4N8CL 4BH8B 5AD0B 2QSVA 1N4XH 2I07A 3X11B 1ZLSL 4YHOH 3TM6A 4J3XA 5EU6A 3NACH 1IC5H 5KVDL 3LV3A 4ZO9A 2FECI 4I2XA 3NGBB 3SKMA 3SJVD 1WFNA 1A21A 3ARQA 3EJJX 3RWGB 3WJJA 5FDYA 1KNOB 1X9QA 3EGSA 2HT2D 3IRPX 4MJID 3IDIA 4GXVH 5DYOA 3ZDZF 5MEND 4Y5VA 4R96B 4FFVC 4G6FB 4K3HA 1NBYA 3KG5A 4X99B 2AJUL 3K8LA 1I3UA 5HDQH 3UTTB 1MI5B 4Z7NE 3DYMA 2V7HA 4ZFZB 3G04A 1HZHL 3NPSC 3WUWB 2VLLA 4P2QE 4EBQL 2R4SH 2XZAL 5B8CB 3IFOB 4P9HH 5HHNA 4RSVA 4TPRL 1HQ4A 4WU5A 1OSZB 4F8QA 4YIQA 3HC4L 3EYSL 4PJCB 5GRZA 3S36H 4JM2A 5EIVA 5JQHC 4DFIA 1LO5A 2PYEA 4I1NB 3GKWH 2JTDA 3D39E 2IBZX 2VZUA 5I0ZA 1G7LA 1E4JA 5E99H 3MNZA 5EOCL 5SX4I 4OLWH 2Y07L 4YQXL 1ZVYA 1KFAH 3FT4B 2R23A 2H45A 4R7NB 1UXWA 2V9RA 1K8IA 4TVPH 4NUGL 3QXWA 3SJVA 3I6LD 2CMRL 3SY0B 4G8GD 1F4XH 5B39B 3QUMA 1JZ2A 4KK9D 4PJBA 2FCBA 5TQ0H 3A6OA 4WFGE 3LMJH 4AY0A 3Q3GB 2DICA 1T1YB 5LVEA 2PR4L 1WICA 4RBPK 1NMCB 2B0SH 2GYSA 4XZUB 5I1DA 5SX4H 1FO0A 3RAJL 2PUQT 1KIQA 4PR5B 5CGMA 3DX6B 1EAPB 3MCG1 4OQ1A 1AY1H 2VNCA 5F96L 4PRHA 5EIIB 2CMRH 2H6PA 5DMKA 4BUGA 4PJGA 1AGFA 3OKEB 5LAXA 3T3PE 3WDJA 1F8TL 4KDVA 1ZHBB 3MRQA 1HILB 3BQUB 3I6KB 1EO8H 4LLQB 5EUOF 5HI5C 4XBGA 3RY6C 4FTVA 5JW5B 1UKQA 3BJLA 4GW4B 1T3FA 4G6JL 1AGEA 1CF8H 3N85H 1LO2H 4K7PH 1EZVY 4FQXD 1IEAA 4HKJB 4QCIB 5E56A 1FV1B 4YC2C 5JOFB 3T3MF 3WDHA 4LLMB 5KVGH 3EO9L 4KZDL 4LPXA 4XBEH 3ZT7A 4LIQH 2QTEA 3S35X 2W65B 1NGYA 3HE7B 3OZ9L 3PNWA 1CXLA 3PWVA 3S88L 3FAWA 2EKJA 2XWBB 2E7BA 5HHXL 3W39A 5J8OA 1EZVX 3IS0X 5D7JB 2FLRT 1XIWA 3MLYH 3L3JA 4JRXA 4HMCA 3BRDA 1R3KA 3U7YH 5BW7C 1QSFE 3IDNB 4FQJH 1ZTXL 1WC7B 3LDBB 3GI8L 1MELA 4U1JB 5CGYC 1H5BB 4LU5L 4QTHA 2OZ4A 2C4XA 5E94B 3RRQA 4JE4B 1F4YH 1K3ZA 1G9MC 1FVEB 2O5XH 2F54D 4PJIE 4GBXA 2PF6A 2EDKA 1DQQB 1I1AD 4L3EB 2YD8A 2KQNA 3FO9B 4RFEB 2VDQL 3M07A 2A38A 3OG4B 1UM6H 1SM3H 4MDIB 1IM9D 1P4IL 1SBBA 1UWGL 4QNPE 1KULA 1CLOH 3SGJC 1J86A 2YZ8A 3FQWB 2Y72A 3IS1X 4GFTB 4HUKB 1KSRA 3NN8B 3VRIA 1JFQH 4CMHB 3GI8H 4KKLD 1N3NB 3KVQA 1NLBL 4LCCC 3DUUA 1NSNH 2C1PB 1EXUA 4HKBB 3BOVA 1KCKA 1FPTL 2KKQA 5JOPD 2K7QA 4OM0L 1DEEB 4KI5C 2I60H 4Z7UA 5EN2B 4HCRA 2ITCA 1NQBA 2VXQH 1YEIH 3QDJE 2XZCH 3DECA 1S9YB 1BPVA 3MV8D 4NNYA 4RGNC 1MIEH 4E0RB 4YPJA 2AQ3A 1QFUH 3C60A 1KLGA 3MUGA 4D3CH 2D03H 1X7QA 2ICES 4EIZC 3MRFA 4OGYL 4P3CL 4XNXL 4L4VB 4KKAD 4D0DB 4HIXL 1CXKA 1J1OH 5D96B 1I8IB 1MJJB 4HV8A 4OD3L 4ZYKA 1FAIL 4X7SH 4XNQB 5DUMH 1RZ7L 3IB4A 5SWZB 3SKNA 1JGVL 3PQYD 2B0SL 4QXGL 2V2XB 3RJQB 1EHXA 3MYZA 1NFDA 5ACLA 1I7TB 3MLXL 4PJFA 3ORJA 3VU2A 3MJ7A 1KGCD 1JZ7A 2MKWA 3QH3A 3FFDA 3U4EA 4DGYL 5GJTH 4PD4K 5EBWA 2Z91B 1FVDA 4KJYA 2EC8A 5IMOB 2ZP0T 1T66C 3JV0A 1ZVHA 1AIFB 1LE5A 3O9WD 3MLVH 1RZFH 3QQ4A 2Y06H 1SMAA 1B0GB 4LSUL 5E2VL 4YBQD 1XT5A 1A6UL 2RFXA 1IC4H 3SDXB 5L2KD 2AW2A 3K8KA 4AQ1B 3AB0C 3DX9B 2X5PA 1C12A 1DBAH 5IVXA 4HJJL 1ZS8A 4MAYB 5F9OH 3LKOB 2XQYK 2DLFH 3B4NA 3MGOA 1BQHG 3N06B 5K33A 5EO0A 3C6LB 2A77H 3PGFH 4XBPB 5E08L 4X4ME 5AZ2H 3CLEH 4LBEA 4PRPD 4WRLA 4RAVA 3U0TA 3EYSH 5FYJD 3U1SH 1OTTC 1KJMA 5DD0L 2I26N 1NEZB 1MFEH 4I9WD 5I1LA 2NY1B 4M48L 5B39A 1QSFD 1IKFL 1RPQA 4PJIA 2DDQH 3NZHL 2UUDH 4NQEB 3U9PH 2ESVD 3NCYS 2GY5A 1M71B 5E5RB 2AI0H 4JFEA 3FT3B 4P4KB 2NXYB 5IJKC 1X6NA 5TFSL 1UACH 1K5NA 4J3TA 1ZHKA 1F5WA 1AXSB 1SJHB 1PG7X 4IOFD 3QUYB 3VRJB 3KPRE 3LPGA 1IE5A 3VMPA 5LWYH 5CGYD 4F7TA 3F6IA 5DEFA 3Q5OA 4ONOA 3WV0A 5A3ID 5C86A 4J8RA 2APXA 4PRPE 3PF2A 3WIIL 4K94C 3GRWA 4N9GA 4LGSB 4OI7A 3QXAA 3C5ZC 2DTML 4HG4J 4Y19B 3VH8G 2LU3A 3C5ZD 4LCYB 5FCUH 4JDZB 3AREB 3NCFB 1ZGLA 3RWDA 3GJFH 3H3PL 3RNKA 3C9NB 3VXOB 1XGTA 1KIPA 1N5AA 5IM7B 4RQQA 4OQTH 2BFVH 5CHNA 1J7VR 5F9WC 4LLMA 3WFBH 2MQCA 4XNUH 3RZCB 4L3CA 3HFMH 3GHEL 3DRTB 4ZD3L 2HVJA 3THML 4C56D 3QIWA 1NGYB 1NMBL 4JFPB 1T5XA 5T3ZH 1A14L 1OY3B 5GZOD 5AZEH 3S4SB 1M7DA 1T89C 1FJ1B 5DJXA 5GS1C 4HEME 5I1GH 3GMNB 2CKBL 2B39A 2EDEA 2P8PB 3FZUC 5T5FH 1S7SA 4KHXL 1NFDE 3VXSB 3QSKB 2NZ9C 4LFHG 4IRJD 4NQDD 5CIPB 2B8OT 1J0ZA 3OTTA 1WIUA 1KPUA 35C8L 1FG9C 1MCIA 3JTSA 4M43H 3BPCA 5E94A 1CXFA 2FJFA 2AEQH 4AIXA 4XC3H 1ZVSB 3NH7L 3B9AA 3O0RL 1ZLUK 1DQQA 2OJEA 1IT9H 4JQXC 3L3OA 4U1HA 4KMTL 2YXFA 2WQRA 3BD5A 3BJ91 5A2IH 1U8LB 1UA6H 4M8QA 4PY7A 4G6KH 4PRBB 2C7UB 3VI4F 2EYSA 2QQNH 2BNUA 5GGVL 3EFFA 2DI7A 2C4FT 2CDEA 4UAOB 1K6QL 2X1PA 4JFDE 2P5EA 3REWB 3RTQC 5ABDE 1SQ2N 1JGLL 5HHPB 1PG7H 4ZYKB 3WL9B 3B8YA 2ILLA 3CFEA 4J2XA 1NC2D 2XZZA 1RY7B 4OLXL 4Q9QL 4KTEL 3IFPB 1YY9D 1UWXH 4HPOH 5T33H 2WINB 1LK2A 4MQXD 3OHXB 5I71C 1WVZA 1UJ3B 3BZEB 1YPZE 1B4RA 3ZDZE 4OJFL 3RX5A 5FB8A 5JQ6H 4PLOB 2DMBA 3HCVA 3L3IB 4F7EB 3ULUL 5IR1B 3H9HB 3O2DH 4AEEA 3UTTA 6FABH 4YBLC 1CFTA 3ZDYE 1MI5A 1NEUA 4V1DA 3AGVA 4Y4FD 3NAAH 2MFNA 3CXDL 2Z92B 4NN6C 1QSZA 2QEJA 4KU1A 3IFOA 1B0GA 1UADC 4HMEA 4ZOAA 3MUGB 4JHBA 4ZD3H 2C26A 1HH6A 5L7XH 5J6GA 4CVWA 1NGQH 5IMLB 4BZYA 3H9ZA 3MNVA 4H1LA 1JRHH 5HHVH 4EVNB 3HUJA 3MOQA 2ARJA 5CZXC 4BFEA 1AC0A 2D7TL 5T5FL 1H15B 3DGGB 1CLZL 4L1HA 2X7LB 4H20L 4DQOL 4YZFF 3DVNB 4RFNC 2MCG1 1GGBH 3MJ7B 4UIMB 3ZE2E 3I75B 2AK1H 3ZE1F 2R1XA 1DQMH 1CE1H 3BZ4A 3ETBF 2BDNL 3IGAA 2X4TB 1FVDB 2OSLA 2A83A 4NOFA 3RDTC 5HVHB 4QLRA 4OKDA 4RCAA 3T8XA 5HYJA 3MLTA 3CK0L 1LD9A 5E6IC 4K7PX 5JHDB 4WI3A 3GGWB 3PV6B 3QUMH 5AYUH 4YDKH 3KXFA 5FO9B 1P7HL 3IRZA 5DRWB 2FATL 2CXKA 4C55A 3QUYA 4OZIB 4LSRL 2ZJSL 5T3XL 2W0KA 4MAYA 3KYKL 1C8PA 1KACB 1RJCA 2FYYA 1I3GH 2IFGA 3QHZH 2HJKB 3CFIC 2KZWA 3MRRB 3X3GL 5CEXA 3K46A 4Y2DB 3DETD 3O2DA 4M62H 3L3HA 1RSFA 3ZT6A 4PR5A 4APQB 5IVOA 1QOKA 4RAVB 3U0TB 2IG2H 1ORQA 1NGXB 3CX5J 1RV6X 2ADFL 2DQJL 4NFCA 3UTSD 1AH1A 3EDDA 4Y19A 2ICWB 3CFJB 4MHHI 3F7RA 5J0BA 2O5ZL 3CDFA 2X6MA 2IPTL 1ZHLB 2W9LA 4FQJL 4ZTOH 3MRQB 5CWSB 2Y6SD 4HX1B 3T0EA 4XCCH 2YOCA 1M71A 2CKBH 1CICB 5KVEH 3V7AG 5JW5A 4KDTA 2WSKA 1NCUA 4FZ8H 4G8GA 5C2BH 3LQAL 4MA8H 1FHGA 4LSRH 5J57B 4OZGF 2NX5E 3SDAD 4H88H 3HC0B 3QIBD 3FQXB 4XMLL 2P5EE 3NA9L 3QBTB 1MAJA 1ZLSH 1A3LL 2OP4L 5GS0L 1I7ZA 4N0YH 1MAML 1K3IA 1J1PL 1I9IH 4ZS7H 4PJHE 5H37H 5FECB 1WZLA 4WTZG 4NM4H 3GIVB 5HHOA 3QHFL 5C0NC 4K3EH 1KF9B 2RR3A 1NDMB 3AMLA 4NSKA 3HZVA 4QOKE 4U6TA 5JPNB 1S7WB 3D39A 4P2RA 3K74B 2OR9L 5ALBH 1RUPH 3TN0D 2AGJH 2EIZA 2X40A 3OPZL 5C0BA 2XZAH 3QI9A 2YPKB 5FM4A 2NNAB 3BKCH 4OFIA 1D5ZB 1KB5H 3ARUA 3UJJL 3M17B 5F1IA 3GSNA 2VDLH 1IGCL 4PJDB 3TIDA 2BVPA 5IEKA 4C58B 2AJUH 4N90E 4ZUWB 5ILTL 5IKCA 3FB8B 3JUZA 4EQ3A 2O61B 1W72H 3QFJD 4TULH 1OTSD 3ARWA 2AKRA 4U6YB 1MUJA 1QRND 3W0WE 2AQ2A 4LPCA 4NQDB 3IJYB 1X5GA 2ZUQB 3HE6D 1QEWA 3VA2C 4NRZB 5D1QD 2EDJA 2VC2H 4JG0H 3TCLA 3WD5H 5KSBA 1NFIA 4IRSA 3O6FD 4EDWH 1BZ9B 4U1HB 1X5LA 1TQCB 3JWDL 1FN4B 4G6JH 4DN4H 4YQXH 5D1ZA 1Q1JH 5BOPA 1RQ5A 4HC1L 1BFTA 2IC2A 2P24A 5KS9E 5ANME 5FYLH 4KDWA 1MF2H 4TULL 2FX9H 2BZDA 4UQ3A 2HWZL 2H2PC 4JGMA 5KVFL 2Y06L 4X5XA 1BJ8A 3KJ4B 1J8HA 3U82B 2B4CH 4JN1L 5IHUH 2OP4H 5GS0H 3GZKA 5DHVH 1DUZB 2VC2L 1PSKH 2ZPKL 1D5MA 1U92A 5B38G 5F96H 4X6CE 4DN3H 4PJXE 1N64H 3PWUA 4OZHA 5DEZA 1QFWM 3OHXA 3DSFH 7FABL 5I6XC 2ZJSH 5T3XH 1EO8L 2A9NH 4IIQC 1JNNH 3T4AA 2V2XA 4XTRD 3DTXB 5BS0B 2G75B 1OSPH 3C09B 5CEZL 4BSWB 2WBJA 2DDQL 2BSSA 4OZFB 4NWTH 4ZXBA 3QG6B 3KR3H 3TF7C 3QZWB 1FG2A 5JA9A 5KANI 4IOIA 3GGWA 3QPXH 1J0HA 2BVYA 1XCTA 3DRQA 3VXMA 5D72L 1Q9OA 3DBXB 3QIUA 4G6AD 2GY7B 5FUZL 2QJDA 3V0VA 4I77L 3GO1H 1HSAA 2YN3A 2QQLH 1CF8L 3V4PL 5FEBA 1MCJA 3SDYL 4RBPH 1N64L 4GSDH 2L7UA 5ALCL 2HFGL 1MCCA 1BP3B 3MV7A 5HI4C 3OF6D 3L3HB 4IJ3B 2Z31B 1KCUL 1LDSA 2NYYC 3O8XD 2X7LA 2H1PL 5LAXB 3D0VA 3D87B 4NO3B 5DJ2A 2X9WA 1BVLA 3GJFB 2R1XB 4F9LC 1MCWW 3NA9H 1ZHNA 2MSPA 1N6QL 1DLFL 2BRRL 1A3LH 4YDVB 1RIUL 5FGSA 4HGWA 3ARGD 2X42A 3JSSA 2JCCA 3NIGE 1HN1A 5SWQA 3H0TB 4WW2F 4YDLB 4KTDH 1KFAL 4Z7OF 3SKJH 3IVKA 4OCWL 4Z7VF 3N1GC 3V4PH 1YQ2A 1AFVH 8FABA 2YUZA 3GBML 1SVCP 1IILE 4UUJA 1ZEAH 3JUYA 5DHYA 5ESQA 1M4KA 5IV2A 3KPOA 4QRTB 2ENSA 2NXZD 5F1SA 5AZEL 3RWJA 5ITFA 5EC1A 1ES0A 4HHAB 2BRRH 3J8F7 4QO1A 4F57H 4GBXC 4RISL 1RZGB 3BISA 4UB0L 3TO4B 5DS8A 4ENED 4XWGL 4R6UA 1BBJB 5DK3A 1HOCA 2YBRA 1QQDB 3OKKA 1MJ8L 2HTKD 2IAND 3KS0H 3Q0HA 4GBXB 3GJEB 2E5EA 1CICD 4Z0XA 3C2AL 5DQDH 3RKPA 2VDPH 1MRFH 4OUUB 2NW2B 4WFFD 4Y4KD 3MOAH 4KMTH 3SDAB 4LVNB 5I1JH 4JZOB 2AXFB 4HUVB 5M95B 3SE3A 2ZCKH 4QYOB 4Z78B 3DRTA 3E2HB 5EA0H 3MRCB 4EDWL 1X5FA 2DIAA 2Y7QA 4NKQB 4KV5F 4XAWH 4NKOA 1HSBB 2D7QA 4F80A 2JCCE 4HJJH 3ZDXE 4X0KA 1ZK9A 4YR6A 4XMKL 5SV3A 2XG5A 4JFXB 2FR4A 1N7ML 2OQJA 4JQVA 3TVMB 2ZUWA 4NN7B 5E6ZA 4P23B 2AK4D 4FZ8L 3FKUS 1ORSA 4FMKA 2GW5A 3OB0K 4YDLC 3GIVA 5HHOB 1EXUB 1V5JA 1JGVH 2X1OA 4NCC1 4UINL 1BM3L 2X4OB 3ZHKA 4APQD 5EU5A 5JPNA 1IC7H 2DWEA 1GPOL 3L3GB 4YHKL 4Z7WE 5EU7C 1IKFH 5D1ZD 1I8LA 5DQJA 1T03H 2WLYA 4DGYH 3R8BB 4UT7H 4ESKA 5JLZA 1MVUB 1YMMA 2Z31C 1PW3A 3QRFM 1LEIB 1EVUA 3LQZA 1M7XA 4GMTH 4R4FL 1NBZA 1WT5C 2KZ1B 3MFFA 4XI5C 3UDWA 5JMOC 3ES6B 1JNNL 4ETQA 3DV6B 4L8CB 1D5IL 3WNOA 1MJ7H 2D7MA 3B2UD 4J4PC 5DTFB 2D4FA 3D1MC 1PYWB 3GKWL 3SGKA 1DBMH 4ZSOA 3TV3L 3WFZA 4O02H 2B2XL 3LKNA 3BEWB 2NW3B 2P7TB 4L8SA 5DI8A 1AC6A 1NC4A 2OCFD 2ERJC 3BT2H 4PJFB 3BX7C 1R3HB 2YK1L 4P4RB 4M7ZC 1I4FB 4S1QL 3DJ9A 1IBGL 4YFDB 5C08A 3GMQB 4AM0A 1NH6A 3F7VB 1JFQL 3VD5A 1LVEA 3O9WB 3CVIH 2CRZA 4I9WE 5DWUL 2VLLB 1L0XA 1T1ZB 4JO1H 4A6YL 1DR9A 4CVXA 3ZDYF 4XXDA 2CD0A 3B8SA 4AEHL 2BXYA 4KTYA 4S1RL 1TENA 4PGZA 4PJCF 5TH2B 3T0WA 4YHNB 3TV3H 5EU3B 1FZKA 4RGMB 3FN9A 3MZGB 5EPMB 1CLYH 2LU4A 1CGTA 5E4EB 4P5TA 4U1MA 3WKMH 3QEGL 3MV7B 3A67H 1UEYA 4TUKL 2DTSA 4QTIL 4HMDA 3ULUF 1K85A 1MY5A 4CN1A 3QIBA 1T20B 1OP3H 1JPFA 1AFVL 2V6HA 2EICA 3MLZL 1QACA 4F3FB 4F15C 2CJUH 2NX5B 2YUXA 3HMXL 1FDLH 1FL5A 5J7CC 1QR1A 2N7BA 2P8LA 2YD2A 4JJ5B 4P59L 1FLRL 2Q8AH 1CG9B 2X70A 3U9UA 1JWUA 3EDKA 2EDXA 1HWHB 4MS8C 3ZE1E 1EEUA 2ADIA 1X5KA 2ED8A 3CPLA 1PZ5B 3SOBL 3ESVF 3T0BA 1IGTB 3TBVB 3IVKB 1S9VB 2DLFL 3V52H 1Q9OB 3DBXA 4LPWA 4RISH 2YPVH 4EEEA 2ED9A 3ZTNH 4D9QD 3IFNL 5FHBL 3HHRB 5DQ9B 3PGFL 5KVGL 4QHLB 1P4BH 3BVNB 3MBEA 4XCNB 3ZZ1A 4LKXB 3W9EA 1FNGB 1FRGL 3I2CH 4WO4A 1R6VA 3WIHL 2LE9A 1FNAA 12E8L 1TVBA 1YPZB 3JBG7 3MLVL 2GUOB 2FYYB 4OLXH 2VE6B 3CU1A 3NCCB 4G9DA 3KYMB 3PDGA 2ERJB 2D7NA 3D85B 1DE4B 3D25A 5EULV 1DVFA 2APVA 5CJ8A 1JHLH 1HINL 5FFLA 3MV11 2CRMA 4HQQL 5CP7A 5AWNL 1HOCB 4KK6D 3IFLL 3LS4H 1BOGA 3P4NB 2GIYA 4GKSB 1FYTA 2C3HA 2Q6WB 3CLEL 4BYHA 3U46A 3NCMA 3B3IB 5ETUA 2ZUVA 4C56B 5DWUH 3INUL 1U95B 1A3QA 5DJAA 1BM3H 1AD9A 3TFKD 3HC4H 4L29B 4QHMB 2IANA 4XVTH 5JOFA 5IHZB 1QBLL 3QPQC 5E0QA 4JFFE 4FQHA 5ID0A 4N68A 1P2CB 3QUZB 4KZEH 2YD6A 4Z7UE 1KJ2H 5IMMA 4POZC 3MLRL 2SEBA 3WBDA 1K4DB 4S11A 2YRLA 3GKZA 2PO6B 4BJLA 2EZ0C 5DUPH 3GUTB 4JFQB 1VGEL 2C3GA 4ELME 1HINH 4R7DA 2VQTA 3RVVC 4OGZA 3RKDC 5D5MB 4WHCA 4KGJA 4PS4L 3QQ9C 1Z3GL 4H20H 4DQOH 4X6BB 4LNRB 3NCYP 4ORGB 4IRJA 4ZO7A 2XWJA 4QTHB 2OJEB 3WNMA 5JW4R 1A9BB 3X3FH 5EZJB 5KW9L 4IS6A 2ITDA 2EH8L 5C07A 1LILA 2R1WA 4N0CC 1OGTA 4KROD 5B3JE 4NQCA 1YEHL 5KBNC 3ALPA 3O6ML 3TEUA 3O2WH 4LVNC 4Z7VB 3SDAC 2Y7QB 3QQ3A 5D6CA 1F3JA 1RK1B 5IB4B 4D3CL 2OTPA 2OQJB 2YA2A 2DJ4A 4RMTA 1RULH 1PYWA 3CZJA 1M05B 2IPKB 1I1CA 1IT9L 4RWYL 2Z93B 3FOLB 2H9GB 3V9FA 5A3IC 4PBWD 2C1PA 3SDCB 4GAJL 2FBJL 2ZUUA 2A0LD 1J8HE 1QNZH 2AP2A 2WMPA 4RFNB 2QHLA 3HCVB 3RI5F 3DVGB 2BSRA 1IGYA 1XGYL 5ICYB 4ZNEE 4BKLB 1K6QH 2YR3A 5GSVB 5C0FA 1OSZA 1T1ZA 3MBEC 4YIQB 5D1ZB 4X7CC 3VFNA 4HGMA 3MRIB 1TTFA 1EFXD 4J6RH 5CEYA 1FZKB 3T0VA 4I5BA 1YYML 5HHXH 2DQGH 4ZPVA 2X4RB 4JG1H 5T33L 1XGQA 2WNGA 2H3NB 3DPBA 1YEGH 1I8MB 1IAKB 2QQLL 2NW3A 5CSZA 4TNVK 5DGQA 5E4EC 3W11D 2BNQE 3SJVB 1BHGA 1MRCL 4LKCB 4PBVC 4YHYB 4RGMC 2DB8A 2P8LB 4XP4H 1WCBA 2OL3A 2OSLB 2YWYA 4GQPH 4KDTC 4L4VE 3HE7D 1F2QA 3WLBA 4M61B 1TPXC 5DRZB 4ZS6D 1T7XA 4P9HC 5EBWB 2VDQH 3UBXG 2NY2D 4OCYL 3HR5A 3O9WC 3K1DA 3EO0B 2YS4A 5DRWA 3UP1A 4I48B 1DVFC 4LGRB 1AQKL 4G42B 4I3SL 4HQQH 5AWNH 5EFIA 4B50A 3ULSB 5HGBA 4L4TD 3J7HA 4LKXA 3O2DL 5HGDA 1C5CL 2R4RL 4Y5XC 2C3VB 1MAMH 3KYOA 1GOFA 2GI7A 4DK3A 3QEQD 2YZ1A 5IK3A 3LZFL 4GLRI 1KCSL 1HILA 1OAQL 3EJYC 4OD1L 2NX5A 1QR1B 2OJZH 1KCVL 4JFED 2QLVB 2VB5A 3QUML 5AYUL 4JDVA 5F6HJ 1Q9KB 2IAMC 5GISH 4DZBB 4DN4L 4BUHA 4RGND 3VFSA 3NIGF 4NQEA 5MENE 4G8GB 3L9RB 4PGJA 2HKFL 5SWQB 1GL4B 2CH8A 1X5YA 4OQTL 4YPGA 3UTPD 1I3VA 3LN5B 3MRLA 4K8RL 4U3CA 1DZBA 4O2EB 4O2CB 1AO7E 1OARL 4Y1AB 4P59H 4DCQA 3HNTL 2BSTA 3CMOH 5GGSA 1N0LA 2AK4E 4EI6A 2EE6A 4UV7L 5BVJB 4WENB 5IV2B 1PEZA 4X5WB 2E27H 5FYJH 1LEKA 2HRPH 4P23C 4CDHA 4UBDD 4WEUD 3MRMB 1HCVA 1WC7A 3RWJB 5C1MB 1UB6A 1EGJH 1A6VH 3SE9L 4AEFA 1REIA 5CLTA 4NSKB 3WUZA 4K9EH 1YEEL 5E03A 5C0DB 4PJ9D 3I84A 3D2UA 3OXRA 1S7TA 3QCVL 3P4NA 4PJEF 5BZWB 3OAYK 3AROA 4U33A 5GZND 1BBJA 1I85C 4DZ8A 1XCQB 4E9LA 2ZNWA 4XPTH 3KPRA 2EEAA 5I2IB 1KB9J 3GSVB 4MMZC 5HGGS 9CGTA 2IANB 1GC1C 2BVPB 4ZOBA 4QRPA 3O2VH 2XXMB 3SDCC 4AMKH 1HWGB 2ZSWB 1KLUB 4XWOC 4MQTB 5FIEA 4L9LC 1DLHA 1LE9A 2F5BH 4HUVA 2EXWC 4PD4J 3TO4C 5L8JB 1EGJA 1ZTXH 4GS7B 3TH2T 4GG8B 3WFHB 4U6YA 1MAKA 4CVZA 1X5ZA 1OM3L 4NDMB 5ESVA 2P8PA 4JHWH 2P8MA 4C83A 5JORB 1MHCA 2FX9L 2E3VA 3PXHA 2X2YA 1QFWL 5T5NF 1OGAB 3BIKB 3CMGA 4LK4A 4P23D 3LSOB 4LCIL 4J6RL 2HLFD 2NY0D 5EG6C 1BVZA 4FQ2H 2Q1EA 4P2OA 1D6EA 3UAJD 3UPRA 3LN4B 3RX8A 4QRUB 3TYGH 2IQ9L 3VFRA 5JQ6L 3LQMA 1NAMH 3W9DA 3G08B 4UI2A 1S9YA 3MBXH 5J11C 4NJ9L 4Z0BL 2VZTA 1MI5E 5J89A 1MCKA 2Y36H 1G7HA 1BJ1J 3AB0B 1F3JB 2CLZA 2WZPD 3TT1H 3W5MA 3PWNA 2DQIL 1FZJB 1DUZA 5KW9H 1H0DB 2VLMD 5DFTA 1SYVA 1AJ7L 3AXLB 5IT2H 4Z8FH 3ARDD 3WL9A 5DUBB 4M6ML 4I18C 4P5TC 5C92A 3SDCA 2BY2A 3CGTA 4O51B 3C5SB 4RDQF 4JAMA 2OL3L 4MQ7B 4Y5YB 2IH3B 4OBSA 4NUGH 3HC3H 2P48B 5BS0A 1CS6A 1FYTE 4P2RE 5DJCA 4K71B 1MREH 4XB7A 4OZGA 5GHWL 3GEWB 3G5YA 2LVCA 1KCUH 3L3IA 4F7EA 3QWRA 3JV6B 4JPIA 1MHHA 2AJ3B 5B8CA 5FKAA 3VFNB 1I7RB 4NWUL 5I30L 2DQFA 4PGCB 2QV2A 3MCKA 3P11H 2QADC 4X9HA 4WHTB 3GSRA 4Q2ZB 4S1SL 1GC1H 4M1CC 4HXAH 4XVUD 3O2VL 2JF1A 5C0CD 1ZA3B 1ZEAL 5I6XB 3LKOA 3JWDH 1P7QA 5H37G 5I1DB 1LWRA 5DJ6B 3MMEA 2VITA 2Q76B 4OCWH 5GGTH 3P30H 1EPFA 3DXAD 4WFHE 1MWAH 1NEZA 3CFDB 4IDJL 2BNQD 4LEOB 5ADPH 3REVB 3GJFA 3V4UL 3BMWA 3TPKA 3S35H 4PYHA 1GPOH 1QKZL 2G2RB 2JK5A 4GRWB 2QR0B 4FQ2L 2LTQC