2L3BA

Solution nmr structure of the bt_0084 lipoprotein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr376
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
MNDDVDIQQSYPFSIETMPVPKKLKVGETAEIRCQLHRDGRFEETKYFIRYFQPDGAGTLKMSDGTVLLPNDLYPLPGETFRLYYTSASTDQQTVDVYFQDSFGQLQQLTFSFNNDSSKEEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein found in conjugate transposon
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 18
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2010-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l3bA00
2L7QA 4LBAA 2L3BA
chains in the Genus database with same CATH superfamily
1PAZA 5L6YL 2EXTA 1DL7H 2ITEA 3PWPA 3DSFH 4XPTL 2PCPA 2PWDA 2K6WA 3DGCR 3UBXB 1G5AA 3V95A 1ET7A 5I15H 4XAKD 1CDGA 5C0RH 1Q9OA 1SYSB 2ZYSA 3IRZA 4GXUM 2CAKA 1M05B 4OGZA 5TH2B 1D5XB 4RAVB 2XRAL 1KFAL 3JT0A 4ETQB 5L0QB 3IVKA 3FUMA 3UYRH 1A1MB 2UY7B 4V2CB 5EPMB 3SJVE 1T1ZA 4KZCA 4QRRA 1A4AA 2BCKB 1T89A 1Y6NR 4RZKA 5D6DA 1RUPL 4RFEB 3V55A 1IAOB 5EWIH 3V6OA 5EIQA 5K9JL 3BUYA 1I3RA 4WTZA 2FB4H 3BAJA 5C6TL 4E9TA 5HVFB 3GJFB 2VLME 4UOW1 1UOWA 3B2XA 4AM0B 2ZKHH 4L23A 2DM3A 2CCWA 5DJYB 1YNTA 3LVTA 4TSBH 3RX5A 3UTSA 1ZT1A 4Y9EA 1E6OL 1BOYA 1NCWH 5MEQB 5AQ0A 2AMGA 2XWXA 5EFIB 1RUKH 4BFJA 4F9PC 2OJ1A 4OZ4B 3LQAH 5SV4A 1RIVH 1YDPA 1A7BA 5IROA 4GI6A 2EIDA 2HLAA 2VUKA 3UGUA 3NEEA 1KTBA 3ARYA 1G7IA 2C3VB 3NCEB 2OX5A 3CFDA 1PU0A 2PWEA 5K1JA 2MPVA 4YXKL 2VISB 4IBSA 3DV4B 4OB5L 2C7UB 1YNKH 2EC9U 4GOSA 2BNUB 4KJYA 4NKIH 1X5XA 3WKMH 1M1XA 1HILB 4N90E 1JPFB 3ZIMA 5JMOC 3MRPA 1RUMH 4M5SA 1EVTC 3WFHB 3BPLB 5BV7H 1AC6A 3D39D 3H9SD 3BSZH 2YBGA 3WD5H 1DBAH 3VD7A 1OGTB 1A6VH 4K94H 2YD6A 4MJIE 1INEH 2P5WE 3BVNB 1T4KB 4P2AA 1NGQH 3EBHA 3MKGA 3MJ8A 4R9HA 1E42A 3ESNA 5HY9B 4IGBD 4M8RA 4TOYL 3CVHH 5DVOA 3EJRA 3GTVA 4FQXA 3VMOA 4MQ7B 4WI8A 4U2ZA 2IANB 5F9JA 4ZMPA 4NAJA 3OSKA 2PCPB 1MFUA 1J12A 4P2QD 1RZ7L 1UM6H 2JIXD 4XPFH 1A6TA 4TRPL 3UCQA 3UJTL 3V8OA 1CDYA 2X9YA 3UGXA 3FTXA 1LO2L 1R3JB 4FQ2L 4Y4FB 4Z7WB 3B9KB 5I1HH 3GFUA 4G2AA 5E1AA 3SJVA 3VSUA 3IVKB 2DQIH 4DO6A 1LGVA 1Z2KA 4QRRB 3HG0A 4R84A 1WWCA 3QUYA 4HKZA 4X99B 3IJYA 4HLEA 1DO5A 3L1FA 1RJYA 3QISA 1T04A 1WK0A 1YEFL 2WAHA 1EK3A 2M1KA 4UT6L 4AQOA 4RMTA 5CR8A 1HXKA 3KPPA 2NXZB 4DKFL 3IEAA 1HWGB 1QLRB 4WFHD 3RWHA 1CXLA 4UIKL 4M56A 2IIJA 2EXSA 3DX0A 1UXWA 4GUOA 4XNAA 1S7TA 1ZT1B 3EF4A 3JV6B 2FWOB 5M95B 2WLZA 4MKTA 3EYUH 1MAJA 3X12A 1HIML 4BWTA 2OR9H 2Z8VC 5F6HJ 2UUDK 4Z95H 5D7LE 3OG6B 4KQ4H 4NQSA 1ETA1 2XN9B 3JV5A 5J1AA 4WW2A 1FAIL 1KOAA 5I6PA 5F3HA 1YDPB 2DEWX 2HLAB 3X11A 4Z5RB 1LP9E 4Z7QB 3WNOA 2Y3AA 4MWFA 2D7TL 3U2JA 3G5ZB 3HC0B 2CRZA 3IDJB 4C56E 4ZX3A 2BIOA 5DO8A 2L7QA 1UXMA 5EDXA 1B0IA 1ONQA 5FWQA 3N0PB 6TAAA 2OYPA 2PXYD 1YNTF 2A99A 4KJYB 2IGLA 3G6JF 1S9WA 4HX1B 3RIKA 5KVFL 4QRTA 3MRPB 3PNWA 1NC4D 3B8YA 4QDGA 3V4VH 5J7CC 4KMQA 4XCYA 1C1EH 3RIFK 1QPPA 4WEUD 2F15A 5IM7B 3SOTA 3VFVB 3TU6A 2OTUA 2K3HA 5IWLA 3GXIA 5D4HA 4MJIA 3RG1C 1NA8A 4JKLA 1EEYA 1KPUA 4CVUA 5T1JA 3ULVD 3MJ8B 4PS8A 3VMPA 1KMGA 3H9ZA 4HT1L 4ALAC 1JVLA 3DVGB 4OQTA 2R0ZH 4DZBA 2NY4B 3LEYH 4KTEL 5CP3A 4JREC 4AQAA 1UFGA 1FO0L 4FLQA 4FHJA 4FQXB 5FA3B 3SZKC 3WL9A 3BEVB 3ZHFA 4NKDA 2DQHH 1F3RB 1M9WA 5L4IA 3L45A 2I24N 4LIQH 4NN6B 5BOZG 4POUB 5ANHA 5F9JB 4JDVA 5KYWA 1ZV9A 3HN3A 4MB1A 2NMSA 3KCPB 1A6TB 5CIPA 1BZ9B 2X4UA 3QDGB 4XB3A 4HHWA 4Y1AE 4N0UE 1N4XL 4J3OC 5GS2H 3JBG7 2R59A 4A66A 5E1AB 4OLYL 1DUZB 3E7JA 1JPGA 2P24A 4JY5H 5E0FA 1SRDA 4XNUH 2IADA 3GM0A 3QUYB 1MVYA 5ALCH 3IJYB 3I75A 4OZIA 1B4RA 3IDYB 2CHDA 5C3IA 3ATAA 1URZA 1GOGA 5CBAA 4N1EA 3SGDH 1KT2A 2FNBA 3OGCA 4DFHA 2I5YL 2H8PA 4XVJL 1LO0L 3GRWA 4PD4J 1BXVA 2WANA 3V5HA 1NAMH 3RWHB 3SPVA 4JRXE 4KZDH 3ZQWA 4XNMA 1S7TB 5AOLA 1UEYA 4JW3A 2YPLB 3LEVH 5E9AA 4UM8A 4LPCA 1ACZA 1ETB1 4XVUC 4HF5L 3SIKA 1E5YA 3BAYA 5LGYA 1W2KT 3C09B 3BZDA 3JSSA 4MYPA 4NQSB 4WW2B 5L88L 1P7BA 1U95B 3NJMA 1XB3A 3BGFC 1N5YH 2Y69B 4DH2A 3BZ5A 4QYOA 2BIHA 2YQ2A 4MWFB 3BT0A 4IBUA 3PWJA 1HL5A 1N67A 4KOCA 1ZLEA 3SYAA 4PLKD 4Y9CA 2D4FA 4FKHA 2WXOA 1EWHA 3SE4C 3TNMA 2AXFA 1DQTA 3E80A 1S9WB 4NN5C 4R0LC 3AITA 5T33L 1YEIL 3GK8H 4ONFH 4XCYB 3KPMA 2JQAA 1XF3B 2R4SL 3SGEI 1U8IB 3RFRA 1U91B 1BVNT 5E8PA 4J4PD 4DP9X 4WIQA 2YXWA 3ZO9A 1EXGA 2YUXA 5DJ0A 4E36A 5CILL 5AKTA 5JUEL 2QPDB 3L3IA 1FYTB 1LVEA 2LLGA 3HPJA 4DZBB 5ACLA 4AQAB 4AJWA 4TQ8A 3UERA 2HPOA 5D1QE 3HW7A 5EDSA 4TVPE 5BRPA 3L1OL 4FG6D 2XLLA 5KAQF 1HHHA 4HV8B 5LGHH 3PDOA 3MXWL 1HDMA 2X4UB 5GZOC 4RRPA 1FJ1A 4LSRL 2VDRH 4L1HA 3QNFA 1MWOA 4RFNC 5CLYA 5JIDA 1WH0A 4LSTL 5HGBB 4Z7NB 1DQLL 4XMPH 3P2BA 4MNGA 3WKNA 2GHZA 1IGJA 3KYKL 4PLJC 4QGYA 3QS2A 5DJAA 4UTBL 4OZIB 2AJSH 4YL9A 1UOKA 5IBTL 4BFFA 5CGMA 1A3QA 1KG0A 2CUMA 3QSKB 2YN5A 4JBSA 5CBAB 4HAKA 3D9AL 4IBWA 1U3HB 3Q8FA 5JIPA 2X12A 2WHVA 4MNQE 4JY6A 3CFIC 3D52A 3FHEA 1OCZB 1ZY9A 5JXAH 3NAAL 1G94A 4JRXA 3SPVB 1OF2A 3NA9L 1L3NA 5FM5O 1PMYA 3QBTB 4OCNC 2B1AH 3LPFA 4UIMA 3QXAA 4W9IC 3WY2A 4ZOAA 2MMXA 4FQLL 3PUCA 4QRPD 5DFAA 3FUFA 4P59H 1J1PL 5C07D 3R06B 8FABA 3RVWC 3IFPB 4GS7C 3T2OA 2J2ZA 5JO5A 2NY3C 2O93L 3EJTA 43C9A 3ROOA 4FNLL 2PO6A 1BVKA 5EN2B 1T7VA 4H1LA 3L17A 3OPZH 1PSKH 1CDIA 5JQ6H 1QW9A 3FO1B 1W0WB 5CEZL 2OTWB 2P8MA 3TNMB 4KZEH 2V3DA 1SXSA 1T4WA 4KX9A 3SQBA 1NEZB 3VSTA 1VAHA 4PBVC 4KV5E 1SJVA 4EO5A 4L0ZA 3K6SB 3HG1E 4H0GA 1UCBH 2MJWA 1QNZL 2X7LB 5E8PB 5BO1H 3WTWA 3ARFA 1LP9F 3IXAA 1IBBA 3M17A 4GRLA 4P07A 4RBPK 4ZI8A 3H3KA 5FUCC 1F56A 4HAFA 2BY0A 1VIWA 1P6FA 1WG3A 2EO7A 5D1QA 3QRBA 3X1FA 1IEAB 4F15B 4PWKA 1S4IA 4PS3A 5L4FA 4X7EC 3FFCA 2HG5A 1ZGLA 1I3GL 5IMKA 4N8VG 4PRIE 5IZ7A 3WTXA 3BP5B 3PDOB 1TZIB 1S5HB 2AAVA 4WHDA 2NDFA 1F6AA 1HDMB 4KKAC 3JTBA 1NBCA 2Y7MA 3BPCA 4M3HA 4AJYV 4DVRH 1U8CB 3QGVA 2HH0L 4XX1E 2EDRA 4ZXBD 1T6BX 1YLBB 1XSIA 3NMEA 1XSOA 5ABAA 2A6DA 3F58H 1R24B 2XBDA 5BVJB 5KYUB 4FQIL 1KG0B 4QHLB 5CCKH 3GS0A 2DWSA 1ACYH 2FX7H 1VPOL 1NGZA 2XV2A 3DUSA 4ONGH 1C8PA 4NBXB 4LVNC 2CLRB 2H0JA 2UXGA 1U30A 2KQMA 2PLTA 4WUKH 5CO1A 5D2NA 5GRUH 1FBIL 5LBSA 3MLUL 1GZHC 4HS3A 4M43L 2Y0SA 3U7WL 2CUIA 4J3SA 4B53A 1CD1A 4OM0L 5C6WH 4Q8BA 3S34H 1J8HA 3HZKA 4QHNB 2FBJH 1QFWH 3V2AR 3OR7A 4C55A 1DANT 3C60D 4P9ML 3BPOB 3BFWA 2R69H 3RYMA 3VCLA 3WEMA 4QTFA 4YPGB 4NJAL 1SQMA 3LKQA 1BVKB 5IUSA 4KY1H 3ECWA 4F7EA 2VZVA 4S2SB 2AFNA 5HHOE 4MTMA 1QWNA 4BQ9A 4HZAA 3TIEA 4GIOA 2P8MB 1M7XA 3C5SB 1R3HB 1EHLH 5DS8B 2D0HA 5JHDA 5I73C 4RETB 4M7LT 1GJIA 1K6QL 1OGSA 2QKSA 3DX8A 4IBZA 3ZL2A 5JOEA 3E8UH 3IU3B 4XO8A 2X6UA 3HG1A 2MCPL 3CZEA 3BW9A 3FUEA 4XN9A 3H53A 1SLUA 2FSEA 1CLYL 3V4UH 3MRQA 2RR3A 3ARFB 4U6VL 3M17B 4GRLB 4FP8L 3HHMA 1I7ZB 5FYLL 3SZ6A 4M1DH 5AG8A 3ZZ1A 4B60A 1BM3L 1BEXA 2QZQA 3TO4A 1U8HA 2WLNA 3CSGA 2O5ZH 4WKZA 1T7YA 1L9NA 1KBVA 1F1DA 2HG5B 2V7HA 3FFCB 3MLWL 5IMKB 4KRLB 1UG9A 2VABA 1X4XA 3BC9A 4HFUL 5JDSA 1F6AB 4D0DA 2IDFA 4WW1A 1B0WA 4IRJC 5BCAA 2BY2A 1S7VA 4PM1A 1QUNB 5D8JL 2J1XA 2A6DB 2PPDA 3BHBB 4GKNA 1QO3A 2UZPA 2CO3A 43CAA 1ED3A 1U8PA 1IZJA 1FG2B 4D7BA 1KBPA 2VRAA 5HI5D 2Y22A 2DQUH 3CG8A 3JVGA 2AV1A 1JZJA 2I26N 3CDFA 5D2NB 2BP3A 3M7OA 4H20H 5K93A 3ABZA 1MHPL 4X9FA 1YN6A 4HS3B 4V1DB 4YSDA 5AEAA 1CD1B 35C8L 1AOHA 1MIEH 4GSRA 4LVOB 4XMLL 2ZPKL 3LZOA 1J8HB 2YXVA 1GGCH 3HZKB 4JPIB 3MLPA 1YC8A 3SDXA 5ADOH 4ZOEA 1J86A 1SBBA 4QF1B 2IDCA 1KB5L 4B96A 4M5YH 4RSVA 4KRNA 1MCEA 5A2FA 4X6DA 2BVQA 4LRIA 2IH3A 4PRDA 3EJSA 5IV2A 2BSEA 3VXOA 3GSQA 5CSZA 2BWIA 1XF5A 3N50A 4KO9A 4LDEB 4K5LA 4ABVA 4F7EB 3KPSB 4YO0B 3LZPA 1ZPLA 4KUCF 1SF3A 3AU1A 5AZ2H 2PNDA 2AABH 5JHDB 5T3ZE 4PJ5A 4AGOA 2VIRB 1MFEL 2WXFA 5IQOA 5EF0A 2I60L 3QIWC 1IILE 4P4RA 3COOA 2F5AL 5EZLA 1LO3L 1WBXB 3X3GH 2CJUH 3MRQB 2VERN 4WWKA 3SY0A 4MCZA 3IU4H 1G9NC 1GZQA 3N91A 4LPVA 4TNVK 2X6CA 3N43F 3VH8A 4DEPC 1BD2E 2VYRE 3DBXA 3ARZA 4WCYH 5C0BB 5JPMC 3CDZA 4JK0D 4ABWA 1KCBA 4FZEL 1DYZA 2BS9A 1CICD 1T2XA 2V7HB 2WQUA 3ARGA 1WCQA 3CIQA 5HDBE 1PGRB 3CVCA 3HRZA 4FNTA 3RZCC 5DUJA 4KV5F 3RU8H 4O02B 4ZO6A 1AGBB 3WHE0 2ZJSH 4KH9A 4OCXH 4RQQA 1CFVL 5D7JD 3TH4T 3WTSA 1UURA 4FYTA 4LK4A 2NR6D 3DTUB 4GG8B 4JFEB 1S7VB 5C0EA 2A73A 5I1KH 3NCBB 5E1HB 3ZUCA 3PQYB 3RJDA 3BKCH 1K9TA 1FZJB 2BDNL 1RFDH 3MRJB 4X6FB 1J1OH 3EZJB 4MDRA 4JN1H 3BSGA 5GQBA 4F91B 4ZFZA 3VXSE 3IJ8A 4H44C 2FZ3B 2YUZA 3I9GH 3VU2A 3WJLA 3BZEA 4LAJH 4ZW5A 4J6IA 4DPBX 4GKLA 4L4VB 4N22A 4HIHA 2YD1A 2FHBA 2VM4A 1S5IH 4BZYA 2GCYA 2G3MA 4WHCA 2EZ0D 1TMCB 3GF8A 5ICXA 3SDXB 2C9VA 2XV0A 5EF1A 3PG2A 3TWYA 3ZBMA 3O3BA 3ABGA 3P4MB 4UV7L 2JXMA 4X6DB 4JKKA 1GAFH 4PRDB 5J13C 4PJGB 5IV2B 3BVDB 3VXOB 4GI9A 3GSQB 3TVMA 1GR7A 2V3EA 4CRPA 1TJGH 1XF5B 1LO5B 1KB9J 1IGCL 2WWMC 3VGFA 3V0VB 3I3BA 2RIKA 2R0LL 3VFWA 1WLHA 3AU1B 4EDXA 1FCCA 2F7OA 2X3BA 4B3VA 4YHZL 4PJ5B 4KVPA 2DWEA 2GBTA 3ZZLA 4LO9A 3LRGA 4A1RA 3UG3A 3D85B 4O5LH 1JCVA 1UKSA 3O11A 4WWKB 4MCZB 4JPWL 3NEOA 5IHZA 3QZNA 3GDBA 3LH2H 1BD2A 1FSKC 4QT5A 1D5ZB 3O0LA 1NBZB 4UI2A 1VF5C 1MFCH 1R3IH 4MCYA 4XX1G 3DBXB 5FOBB 5DMGC 4UAOC 4X4ME 4TTGA 1TO4A 1JNLH 3NABL 5H4ZA 2YA2A 2D7MA 2V7NA 3ARGB 4L3EE 5D72L 4KNQA 4U1GC 1AGEA 5IT2H 4NNXA 5JTWA 4RQQB 1P5VA 4NSKB 4NFDA 3S5YA 5AFAA 1AQDA 1NPUA 1BGXL 3SKUD 2DJUA 2VDMB 4MAUH 5F7BA 3VYNA 2BMKA 3HTLX 2R2BB 5CJQL 4FFZH 3EJQA 2GSGA 4YSCA 1SY6H 2A77H 3EO9L 4OGYH 3RL2A 1KY6A 5J89A 3WN5A 4A7SA 1KC5L 4F7MA 2Y07H 5EO1B 5BZWB 5KBLA 3CUPB 3PWPD 3VXSA 3WNJA 4CKQA 1B0GA 2QELA 1MAMH 3GPSA 4XR8C 4OJAA 4OUUB 3GHEL 3BSZA 4BFOA 5L4MA 3BZEB 5JMRA 5JNYA 4GSUA 2NT0A 4M6OH 2OW7A 2VLJD 3F12A 3VD3A 4DUWA 1VENA 1KBKA 2NY2C 4NT6A 5IHUH 4QRRD 2V2WA 3BVTA 2OJZL 1OE3A 1U8KB 3RUGB 4YSTA 2X4PA 3FOLB 2DAVA 3DHUA 3QR2A 5I17B 2JXMB 1E6JH 1UH4A 5KYXB 4XBGB 2DQTL 2X4QB 2L4OA 3LN5A 2NTFA 4FMKA 5E2VH 3K81A 3C2AH 2OMXA 5ADPH 1OCCB 1GZPA 2YARA 4GW5B 5ALBH 1WTGT 3IKKA 1YEWA 4ZNEE 3UTSD 3K91A 3N0AA 2F5BL 5E9DE 3G5VA 3B9DA 3VQ2C 2K78A 3UO1L 2DTML 3O9WC 4GO9A 4LRNL 4NENA 5LNGA 4QRFA 1ZXQA 4A7QA 1TZHB 2DWEB 2Y2WA 5M94B 1WFOA 1JZ8A 5IROD 3F3HA 4C4UA 1ROWA 1OD7A 4LSPL 2LQRA 4BIKA 1K5NA 1PG7W 3I50L 1JPTH 4TLTA 5IHZB 2YA0A 1NWPA 5KSVB 3DX9A 4R2GB 3L3JA 2AK1L 4NM8H 3TA3B 1QD0A 3BP7B 2V5YA 5D55A 2EH7L 2N59A 3JUYA 4HJ0D 2XIDA 4Z76A 4AVIA 1AS7A 2HJKB 2RCSL 1AGEB 3U25A 3UZVB 1KWKA 3FQWB 4NNXB 4BFRA 4IQHA 1BQUA 5D7IE 4C59B 4AGMA 3T4YA 3OMNB 1AQDB 3W39A 3W5MA 4R96A 1JXFA 4Y4HA 4G6FD 1NAKL 3CX5J 4E9YA 4F7MB 2P52A 1Z5LB 4KVNL 3SGKA 3IMWA 2ZNXA 1FAKT 4FXKC 3GBDA 4IOIA 1F45A 4XN1A 1LK2A 4UQ2B 2VR3A 5DQDH 2BVOB 3BOVA 3K46A 4H0IA 5BV7B 5HHQB 3A67H 5HDBF 4L4TA 4U6HB 3ELAT 2OSLB 4GYBA 2DDQH 4QWWC 2ZOTA 3F12B 4OD3H 3JYBA 3TCLA 3EYFB 1CU4H 3SJVD 2QVMA 1A7QH 1I9JH 4XN2A 3MLVL 1LL1A 5DHYA 4Y2NA 3THML 2X2IA 5DMIL 4R97B 3CVHB 2X4PB 4P9HL 3TV3L 5DJZA 2ICCA 2DTSA 4G3YH 4JFHE 1BAGA 2VLMD 2LR4A 4W9JC 2E7LA 4FQHA 2NTFB 2EE2A 2A9NH 6FABH 4PBDA 4ZNEA 3NIFB 4X5WA 5TJWK 5GJTL 5LXGH 5TE4H 4NKOB 2RA1A 4PGDB 4R4NC 1BJ1J 2UZIH 5E9DA 5E7FA 4EN3A 3WFCL 3MGOB 1N64H 3WTUA 4PMFA 3IS0X 4NENB 4GXUN 1FORH 1XR9A 3HMWL 3FQRA 2VDNL 4MD0B 2UVEA 3BP6A 2BNRE 4XC1L 4A2LA 3BIKB 3MLZL 1JF1A 4AMKH 2O61B 5IESH 2DQGL 4ZO9A 25C8H 3DUUB 4URKA 1RHFA 4FQ1H 2CK0L 4AV4A 1K5NB 1KGYE 4BE5A 4N0CD 4ZYKA 3SSGA 3DX9B 4M6MH 1J87A 1SYVB 2CALA 2Y4SA 3FQ1A 3W2DH 2N7SA 2GSMB 2ADJB 2ADGA 4UT9H 4N90D 1QI5A 3DKHA 5A43C 2ENSA 2OP4H 2CGZA 3L3OC 4BK8A 3EOTH 2CO6B 4XTRC 5IB5A 3ZYJA 1RK0A 5D7IA 4YX2L 4G83A 3K6NA 3O4LA 2XKUA 2P5WD 4MJID 1E7UA 2CBPA 2YSSA 3C9NA 2ED7A 1OSPH 1PFCA 1VJSA 4R96B 4Y4HB 1HZKA 3E9TA 4WLCA 2A4EA 4LDCA 2F53E 2MH4A 1KCLA 4JY4B 5F89A 4Z8FL 5CU9A 4IOIB 4YHPA 4GKZA 2BVEA 4GQ9L 3V4VB 1R33A 3VXUA 1KCUH 1KY7A 4DGWC 3CXDH 1P7QD 5EBLA 3NFPB 3GI9L 5LWYL 1N12A 2VUYA 4DESA 5GS0L 1ZANH 3WE6A 5ICYA 4YQXH 1GPOL 4F37F 2VDKH 5EBWA 2EABA 1DBJH 3NZ8A 4QTHA 4KMTL 4JRLA 1GRWA 1WHPA 1XF2B 4P2CG 5AVQB 3J8F7 3D25A 4W1TA 4KJWC 5C9JA 2MEJB 3G9VA 4JO1L 2EACA 2Q76B 1VFAA 4K55A 1SHSA 4D9RE 4OLVH 5IP4A 4JFDB 1DQMH 4DEWA 4YR6A 1MQKL 3C12A 3KLAA 2O5YH 4MXWL 4XP4H 5HVGB 2B15A 4APQA 3QS3A 1A7NL 3ME0A 4X5WB 3VTTA 5GRZA 4OD2B 4KXZI 4LMQI 5DZJA 1AH1A 4D2NA 5DCCA 4EN3B 4JO4L 1HEZA 1WZAA 3WNIA 2BRRL 2R29H 5C7XH 2WO4A 2ZKMX 1QI4A 1HH9A 4RBPH 1U93B 1NIDA 1XR9B 2EYTA 1BQLH 4HIEA 1FVEA 1INDH 1EAPA 5AWNH 4OBRA 1IM9A 1QX1A 4XCFL 4PTUA 4AGPA 1NAMB 4J8QA 1PD0A 1DHKA 3RPBA 5C3TA 2AI0L 2WVSA 2EEBA 4MLSA 3HRPA 3TJEL 1OTSC 4I2XA 2BJMH 2ADGB 2XTJE 1MY7A 5FYKL 1QACA 2XG4B 3H7BB 1NCCH 3FT3B 1F4HA 4JGMA 4LAQL 1MHCA 4DP7X 3M86A 3S96B 3VDBA 2QDVA 4UT7L 5IB5B 2GJPA 1RK0B 2XFXA 3QIUA 4OJYA 4YL4A 5C86A 1Q0XL 3WS6A 2JKTM 2GUOA 4APXA 4XP1H 4JUSA 4IKLA 3KWWB 3P3YA 2YSSB 3BH8B 4JVWA 3A24A 3G6AA 3ZTNL 1IQWH 5SWSE 4FTDA 3FUHA 3PWUA 4HLZH 3PJNA 3KHQA 2F53A 3TNNA 4K3DL 2HFTA 1XWVA 3SDDC 3VTMA 1AFVL 1O7DC 1XZWA 3UG4A 2MRYA 5LCVA 3S4SB 4YHPB 1JS4A 1I8LA 2EDBA 4JJHA 3HZYB 2P47B 3I6KB 4OKVA 5IB4B 3VXUB 3QWOA 1N7MH 3K74B 1C8QA 3VFNA 1U41A 2MPAH 3U4BH 4AX3A 4G72B 3K8MA 4HUNB 4Y1AD 1JG9A 3FUKA 5D7IF 3CC5A 5EU6A 5I1GL 1WA0X 1RP9A 1XCTB 4LF3A 4LP5A 4X6EB 1KTLA 4HKJA 5IQLA 1S78C 5CZXC 2XPYA 4JKNA 1XGPA 2FL5B 4IJTA 3D25B 1PZ3A 3GMOB 5G4OA 3X1BA 1CZ8H 1G9ML 2B2XL 2PTVA 1VFAB 5JLZA 2EXWC 2PWHA 2LFGA 2ZXEB 2NOYA 4ZFFA 3FAWA 1UUSA 1U21A 1NGYA 3U46B 3RZWA 5K9QG 1HHKB 4JRXD 4APQB 2VDRB 3U6RA 2XXMB 3MUZ1 4PWFA 2XWTB 4ZSOB 1M4KA 3FCUB 4UDTB 5F1IA 1DVTA 5I74B 2EC8A 5KJRL 1HEZB 1AKPA 2R1YB 4HXBH 1LEGB 2JV6A 3BPNB 3MNMA 4IRSB 3BMVA 3SB3A 2EDTA 1EPFA 3ES6A 5IVXA 1XCXA 1AQKL 3RAJH 1QVOA 4ZFGL 3QC5X 1FVEB 1UM4L 3OBAA 3RGHA 3CMOL 3MRLB 1T5XA 3CFKA 1IM9B 4G6JL 5BJTB 4TTDC 2E9IA 4PG2A 2OXGA 4DW2H 2A74C 2X9WA 1EDQA 3UYOD 2PO6D 4YN3A 2PTTB 3R4DA 1MCKA 1JK8B 4WAFA 1X5KA 3HUJA 4I2XB 4J8RA 1MFDH 4NAMA 3OX8A 1JIBA 5E4OA 3SE3C 4M4PA 1MHCB 3T0BA 5T5NG 4YWGH 2BFVL 5E9NA 3U0PB 4PS7A 1JFHA 4S1DC 4ZTPL 1LE9A 5E70A 1PLBA 3QIUB 2OI9B 2R69A 2C9UA 3QNXA 1SJEA 5J0BA 5HHNA 2HTLC 4TUJA 4GAJL 2HT2C 1IC0A 1O6SA 4GRLD 4ZMAT 1OAXH 2CRMA 4A2GA 5ID1B 2VXQH 3P0GB 1T66C 3EH5B 3PWUB 3NGBB 3BLPX 1D7DA 4E9RA 1DFXA 2XVKA 1F58H 1OM3L 3O45B 3DMMC 5D1QD 5ELIA 4TVPD 3F7PC 2YBRA 4U6TA 5D5ME 1NGXA 4NHUB 3EHBB 3B3IB 4HOWA 5DRNB 3D2TA 2XPZA 5JPNA 3KJ6L 3O3EB 2AP2A 2DJSA 3CC5B 1FSKB 1GY2A 5EMYA 4ZMNA 3CCHB 3DHJA 2GKIA 2VWEE 4OQ1A 3VI3A 3GBNL 1KTLB 4M1CC 4OCYL 1OAZL 3CVIL 3RI5F 2DMHA 1DBML 3ABKB 1ZA6B 3P3SA 1JYNA 3QHFL 4P2OA 1Y7VA 4ANXA 3B7TA 3MREB 4M8UA 4MNQD 3SHSA 3HOGA 4NRXB 4P4KC 5T1KA 4GUQA 1MH5B 4LOEA 1ZLSL 3QWRA 1E9OA 2XJLA 3U6RB 3OAZK 4FFYH 4KUCD 3X17A 2CM5A 5FEBA 4Z7WE 3HB3C 3KJ4B 2FHFA 1DE4A 4OFYA 1JPSH 3MA7A 1JV2A 2Y7LA 4N9OB 3PDDA 1PW3A 1QVOB 2VOTA 5IVZA 4NZ8A 4YXHH 3OLDA 4BGLA 1PKQE 4J28A 3HZMB 4XODA 2F58L 1IC7L 2OXGB 4RAHA 4XPHH 5L2JB 4XAWH 5BMFH 3AS1A 2CLVA 1RIHL 5T5FL 3QUZA 2WYHA 3RTQB 3HUJB 4J8RB 4NRYB 2HJLB 4N25A 3FONA 3OX8B 4XO5A 5FDYA 2V5MA 2WBXA 3CQQA 3VGHA 2GBUA 2KUTA 3ULUE 2X4RA 3GMLB 5IVXF 3HG1D 1MEXL 2K9UA 2GJ6B 2XN9E 3H3PL 2EIBA 4B41A 1SJEB 5HHNB 1LWRA 5JDJA 2X4SA 4S1RH 4Z7QE 2ZG1A 2ZXAA 1H5BC 4AH2B 2F7RA 4YE4L 3QWQB 5HI4D 2LGNA 1YC7A 4N2CA 3HAEH 3NIGE 1T0NB 1QQDA 2ZWSA 3H55A 3F7LA 1OKEA 2DRUA 1KLGA 2LTQC 4ZFOB 4QRBA 1ZLUK 3TO4D 5MP6L 5D5MA 2Z31A 5D7HA 1CGSH 1E65A 1H0DA 4CVWA 4RRPM 1VGKB 3OD3A 1J10A 3RURA 4BEIA 4ZMOA 2BOBB 3KLLA 3BIBX 5HDLA 1KYFA 4KJPD 1ZHNA 2CIKB 4I4WB 2VXVL 4PLOB 4BH7A 2W81C 5FECA 4AYID 5ETUA 1CLZL 2HVJB 2BW4A 2V9RA 3L2MA 3BAEL 1MQ8A 3AREA 4J1UA 1CPUA 2WMPB 1KIUA 1GS8A 2IAMB 4TLSA 3OC5A 5T1KB 1A21A 1CL7I 2WIIB 5HSFA 3IMUA 3WAJA 1NUDA 5FFLA 1R34A 1D6VL 4HWEL 4JFWA 3D4GA 3HHSB 5IMLB 5TGBA 1F3DH 4E5XG 3BD4A 2E6QA 2YJLA 1DE4B 3BUDA 3DIFA 4JANB 2OYKA 1FVCA 1PIGA 3MA7B 4N2KA 3VI3F 5F7EH 2CKBH 4UV4H 3BVWA 1EIBA 2XXFA 3MQIA 3OL2A 1PKQA 5IVZB 4M3JA 4ZMQA 5DD0L 1O0VA 5JR1L 1IC5L 1S7RB 2HFEA 1Z3GL 1B88A 2XY2A 4IMLA 4KX8A 4PJIA 5A2LH 3N1GC 2WNGA 2P49B 2BSED 3DJRA 2FJHA 3RVTC 5HHOD 2YD4A 3QDME 2H4EA 4R5XA 4U1KA 5GGTL 3HFML 3JTSA 4B9KC 5F9AC 4PREA 3NH7L 4M03A 2YPLE 1AMYA 1JXGA 1VFBA 2EVFA 5KVGE 5I82A 2EE0A 4PJ5D 7PCYA 3LNHA 2F08A 4GBXA 4K7PX 2HKFH 5EEWA 1J18A 3P73A 3JXAA 3RKDD 2VZ3A 1JI2A 2ZCZA 3L95A 4N2BA 2K7QA 2X4SB 4OT1H 3BVVA 2Z1KA 3HS0A 3FSAA 3FB6A 1WAEA 5B39B 3K72B 1HINL 5J3HC 3KZ8A 2Z4QB 3N42F 3WDJA 1MLCA 4BDVA 3K0YA 4K71B 4Y5YC 1AHWA 3FU5A 1ZGLM 5LN8A 3BCFA 3P1VA 3UTZA 2OL3L 1NBQA 3V7AE 1UJ3C 1H0DB 1UD4A 4U1LA 3BUBA 3M88A 3RA7L 2A9DA 1OLZA 1LO4H 5C97A 1ZHNB 1BM7A 2L3BA 3UBXG 1JGVH 3O6FD 1KGXA 1V3JA 4P9HC 1C08B 3L3OB 4JEGB 5DUPL 3DHMA 5TQ0L 3UAJA 3X1NA 1FYTE 3V9EA 1E8ZA 3AREB 3ARUA 1KIUB 2WWKO 1EDHA 1VGEL 3LNDA 1EZLA 4Q6IC 7CGTA 2BINA 4L1TA 5IF0A 5D5MF 4F92B 3W3BA 2CSPA 3MBXH 1I1CA 4RZCA 1JHTB 4FI8A 4TSCH 3RVUC 5BS0B 1P2CA 4I18B 2MNUA 5F7MC 2XPGB 5C8JA 4F8TA 1CG9B 3BAIA 1K8DB 1NMCB 4M5TA 1FVCB 2UYLB 2GY7B 3FU9A 4FFZA 1XIWA 4I89A 4PIRF 4WNJA 4EI5A 3Q06A 3GSXA 3KVDD 5E4EB 3IFNH 5ESQB 1JDAA 3VE0B 4DFIA 2F8XC 3I6GA 1BG9A 5C0NC 3MNZA 3FB7A 4PMEA 1E27A 4IMLB 5CWSA 3FB5A 1H8LA 4I5BA 4JMNA 5C0GA 2D9QB 4GQQA 3AADB 4YLBA 3KLHD 4ADJA 1KCVL 3HNTH 3TVMD 1WGVA 1MRCL 2Q9OA 2P43B 1KTRL 1U2CA 2FLBT 2XETA 1BF5A 2APFA 2G60L 2B9BA 2H6PA 3EYQD 3P11L 5EORH 3N1QC 5F0LB 4B9YA 5I16A 1L5GA 3JTSB 5CLTA 3PAZA 1WZ1H 1UGKA 4JFVA 4Q6YA 4ZZKA 5T3ZD 4GUPB 1IKNA 4JM2F 1VADB 1A9VA 1URIA 3WEBA 5AVYB 3P73B 1OIOA 4ODUA 1A47A 4WK0B 2Q10A 1R5WB 1HQRA 4F3FA 1NBVH 4PJIF 4W9CC 3HS0B 5I1CL 2AXGA 2QSCL 2J56A 3TZVD 2A0LC 4R5TA 5HGAB 2JB5H 1BD2D 5TFSH 1MLCB 2X1PA 3PYCA 1CURA 1FPTL 4GH7B 1RZQA 4X5PA 2G0KA 2R23A 5I0VA 1HS6A 4U1LB 3ULUF 2XV3A 5GS0C 3A22A 4N0FA 2Y06L 3H9HA 4XC3L 4XWGL 5D9SB 3ZQ9A 4BRVA 2NPLX 5L6YH 5FYKU 2FX9L 1Z6JT 2NXYC 2WO3B 3VA2C 1ZS8B 2EDNA 2GJJA 1S46A 3M46A 1OT4A 1BBJB 4XPAH 2HTKC 4O9HH 5KOVC 3FO0L 2AANA 3NIGF 3WEXB 1KFAH 1RU9L 3K2MC 3NCJH 3Q2NA 4I9WD 3UP6A 1EH9A 2QQLL 1NKOA 3VXSD 2XIBA 4ZS7H 2Y7NA 4L5FH 3GZKA 1HL9A 3IN2A 5E5MB 1IAKA 2X70A 3ARQA 2HRHA 3WAKA 4CSZA 3B2UC 1DVFA 1RUPH 3BEWA 4DERA 3CXHJ 5C8JB 3DX3A 5DVMA 1CL7H 4Z3EA 2YPKA 5E8EA 4ONOA 5AYUH 4EI5B 2CU9A 4ACTA 3JWOH 3V5KB 3GSXB 1G5GA 4NQCB 1A9BA 4EUPB 2K70A 3E9UA 4L3CA 3I6GB 5D7KE 3MNZB 3FB7B 1PY4A 2YWYA 3PE9A 4ORZC 5E24E 3BDYH 4IS6B 5CWSB 3FB5B 3U9WA 4I5BB 5F1NB 3D6GA 3HBPA 5C0GB 4DIXA 3OM3B 2NT1A 2O6CA 5E8DL 1HCYA 5FYJE 5B3SB 3SKMA 4M8VA 4NQDB 5IBLD 1QSFE 3VXME 4LEEA 4M8QA 1KV3A 2CBOA 2NY0C 2V9TA 4KUZL 3MA9H 3ZE1B 4BKTC 5I16B 1GGIH 3VI4B 4KK6D 3BN9C 4MBOA 4HU2A 4QAMB 5B1JA 3GBML 2ZSVA 3QYCA 4YXKH 3UC2A 1J0YA 3MJ9H 1ZHLA 4ODUB 2R0WL 2BVYA 2DPKA 4OB5H 4QGTA 1IE5A 1NEPA 4FZ8L 3O6KL 3VGAB 5L2KA 1FUNA 3OJMB 4G8EA 4KAQL 3DV6A 3GI8L 3BZFB 3QJFA 5ENWB 4EDWL 3DX4A 5AOKA 1BYOA 2P5EA 3IAQA 3KE0A 2FIKB 1REIA 1UKTA 1E4KA 2C26A 5CZKA 1KLFA 2K0RA 1E5BA 2P7TB 2Y24A 1TENA 4JQXA 2FJFA 1XH1A 4JG9A 3F84A 1OK0A 1WUNT 2QADB 3EO1B 4L3ED 3TOPA 1U3JA 4YPJA 1BFSA 4LHJB 1TNNA 3UPCA 1FZKB 2FCBA 4TOYH 3H9HB 3QG7L 5DO2D 4HK0B 2WGNB 1MCRA 4Y0GA 3FQXB 2VTFA 2X1OA 2E76C 3LS4L 4P2RA 3SO3C 5FUOL 2R51A 5CZVL 3L3GA 2E7HA 3VSQA 4DP1X 5J11C 4NO2B 5BOJA 1G9MC 1KGJA 1QFHA 1RZ7H 3AG1B 3DX1A 3QAZC 4JB9L 3WJJC 3LS5L 4K5NA 2VGLM 3UJTH 3RIFF 1Q0EA 5L9DL 1W15A 1TVBA 1HZLA 3WEAA 5K9KB 2DI8A 3B7RL 3MV9B 3GLDA 2AJVH 4Z0XA 1IAKB 3QJRB 4IHOA 5TF1L 4L4TD 2ZYRA 1T03L 4BCYA 5AVRB 1DVFB 3V7MA 4CJ0A 4HCRA 4NAQA 2CMRH 1IRAY 1UD2A 3QPKA 1BYNA 4Z1PA 1AD9A 5I8CA 2UVFA 2W65A 4QXUL 1OW0A 3H0TA 1A9BB 1FL6B 5CGYD 3ZDXE 3QFDA 2A9MH 4UIKH 2DLHA 1J5OL 4WVRA 2XZAL 2EXYD 4YLQT 5DWUL 3TIDB 1KN2H 1QTSA 3M1BB 4ZUWB 1T0MB 2BWDA 3N06B 2XA8L 4X4ZA 1S3RA 1HIMH 1OY3B 4L8SA 4LLMA 4N5UA 4N9GB 4X8JB 1QSFA 3RWCA 3T2NL 2FGZA 2GEQA 3HE7A 3PGCA 4JZOA 1EBAA 2AK4E 3QI9D 4Z7UB 3HMXL 2W8CA 2GC7C 4HWZA 1A7PL 4WJ5A 1FAIH 3NDZE 3D4CA 5E9DD 4V1DE 2X38A 2XKSA 4WFFD 4EN3D 5IIEA 3MMEB 2YEZA 4G43A 2D7TH 4NNYB 4P5MA 1UATA 3DO7B 4L9DA 1TCRA 2ZSVB 2GJZA 2J43A 1F4XL 2H2SD 3BQUA 2KLSA 2YS4A 4G9FB 2AERT 3FN0L 3V7AG 1AHMA 1BVLA 4NO0D 1CGVA 1PZ5B 4HP5A 4EI6A 5L2KB 2X2YA 1MCPH 3DV6B 3FO2A 1GTNA 4LLYB 4KOBA 5C0JB 1N0LB 1LD9A 2P5EB 3JWDH 1JUFA 5GGSY 5ERWB 2XG5A 3KPSE 5F0PB 3NPSB 1QFOA 3LKSA 3F5WA 4FG0A 4WI0B 3VWKC 2JCCB 1WA2X 4WUUE 3IPFA 2WW8A 4HT1H 1FFRA 2YD5A 4K2UH 2ADFH 2J6EL 1GY1A 4WRLA 3O4LD 4CN4A 2D0GA 3ILDA 3Q6FB 4P2RB 2WQVA 1UKQA 5C0IA 1B0RA 3HC4H 3L3GB 3S5LB 2HFFA 5DYFA 3U0WL 1E28B 4F9PA 4WEBL 1EUTA 2B3IA 2PYEE 4GMTL 5B7FA 3TFKC 2R56H 3X1EA 2Z6FA 1N4XH 1AOZA 4JFUA 3TL5A 4KX7A 3MRIA 1TVBB 4PHXA 2C9AA 1KXVC 3SYQA 3OXSA 2DB8A 5DRXB 2W60A 1NANI 4IHOB 3BKML 5FK9A 4GY4A 1E8XA 2WKGA 4XGZA 2K9FB 3SCMD 4HJTA 1H6EA 3FKUS 3F7VB 4FCAA 2QHRH 1QSVA 4OD1H 1OB0A 5HJ3A 5I8CB 2JJWA 3U9UA 1LO0H 1R1CA 5B21A 5EU5A 2KT6A 3PQYE 4DP4X 4CNIB 3PWNA 2Y1YA 1FA4A 3US1A 1BZ8A 3BQVA 3CQPA 5EF3A 5AUMA 4JFHD 2NUPA 3QO1A 3DWTA 1NCUA 1V05A 2F54B 3EFDL 4L8SB 4ENZA 4ZTOH 3HE7B 3ARTA 5GZNC 4N6RB 3OG4B 4AYFB 5J06A 5EUOE 5LAPA 2AMUA 2XQYG 4JFYA 5AOIA 3EYVA 4UQIM 1RLBA 4L4VE 4XCEA 3RY4A 3NCMA 2ADYA 3C5ZC 4G43B 4WHYH 4OZFH 1P6WA 1FNSH 5AB9A 2ISDA 1O7VA 3VXTA 3BQUB 4EF3A 1J9QA 3QDJE 1IC4L 1MCJA 4IYKA 1EO7A 2DYPA 3K2IA 2OMZA 5DTFB 2AQ2A 2JH2A 3G6DL 4ZUSA 2WBJB 1NEZG 2ZXBA 5T33H 4PCKA 4HD5A 1YEEL 1YEIH 4PJGE 1WFNA 1ZLWK 5EHFA 1TR7A 2BSTA 4Y2DA 2R4SH 5A1AA 3LKSB 4UILL 2DIBA 2YAMA 3NK3A 4LASL 2OFQA 4OV5B 1CDHA 4YBLC 4JG1L 4AG4L 1XB8A 2CBQA 2C3HA 3BZ4A 4DZ8B 5JUEH 3K5SA 3IMBA 1NQBA 3F62A 3QNYB 4D9QE 5F7WC 4IJ3B 1OQXA 1VCBC 4NO3A 1TITA 1MFBL 1B0RB 4PJ7B 3T5WA 4RRPG 2WUBH 4DPCX 1FH2A 1O6TA 2F53D 1LK3H 2R39A 3CFBA 3MXWH 4OH2A 4MXQD 5DEFA 1FLRH 4CW1A 1EFQA 3BAXA 3QUXC 3AROA 5FGRA 1PJWA 1ZTXH 4EKXA 3OAZH 4KKBD 3MRIB 4LSTH 4E41E 2XN2A 3ETBF 2VDPL 5H35A 2W60B 5LUMA 1LEKA 3DRQA 4IDLA 2EIKB 3QZPA 4ZAKB 4UTBH 2OMVB 2QKIC 4XGZB 1EFXA 5FK9B 1GHFL 4N2FA 5IBTH 1J05A 4PW3A 3O8XA 5EOCJ 5EU6D 5BRZE 4ANKA 4F2MB 3JTTA 5B3NA 3D9AH 3DX7A 3VFPA 5GGVL 3MLXL 2VXQA 4IDJL 2ICWA 2FATH 3L5HA 2Q6WB 2Y2YA 4MS8C 5EU5B 4LHQB 1F4AA 3FTSA 2RGSA 5D1ZI 1B2WH 1CB4A 4XZ4A 3NA9H 3IMSA 4AENA 2R4RL 3QO1B 5TK2A 5FCUL 5DFVC 3ZTJG 4FQLH 4OFPA 3MHZA 1UA6H 2VDLL 3RX8A 2DBLH 5EUOA 1J1PH 2ZOWA 3EGSB 3GXDA 4JG0L 4NZFA 5F3BA 2PR4L 5EEUA 3Q2VA 4J3WA 4XPBH 3MTXA 2ORBL 2VLKB 2CGRL 4X98B 4LLAA 4YC2C 2WWNA 3RUGE 3QDJA 3VXTB 4Y19B 2BIPA 3ZDXF 3STBA 1VZHA 4KRPD 2W94A 5CEZH 4RMQA 1O7SA 4U1NB 4QEGA 2QSQA 3T0VA 1TJIL 1YJDC 3QQDA 3OB0K 4OSUH 1ZLUH 3T3ME 2AXWA 1DSYA 5IK3A 4FFYA 4WU5B 4Y2DB 2XTJD 3QH3A 1RPUA 1FGNH 2APWA 2PMZA 5FM8A 2DQJL 4XCCL 1U58A 4G6MH 2ZOOA 3SDYL 1N10A 3CNKA 5EH1A 3BZ4B 2NY7H 1SMDA 3VAEA 3TBTA 1PL3A 2HT4C 1NC2A 1QA9A 2YD9A 4P46A 1M6OA 4EZJA 5CLXA 4NO3B 1LXMA 4JE0A 3FQTA 4PV8A 5CFAA 4R4FH 5SWSD 1ET8A 1I3GH 3IFLL 4UM9A 5CINH 3VD1A 1JWSA 2J1KA 2FBRA 3A4AA 5FFOA 1BFVL 5LO7A 4ZFFB 3ORJA 1EX0A 3CFBB 5DEFB 1FVDA 1PQZA 4E41A 3CV5A 1F3JA 1PCSA 1Y0LB 4HUMB 3OQ3B 4B7IA 5J1SC 1MJ7L 3QJHB 4JQIL 4NPKA 4ORGB 1AR2A 2YFOA 2GFBA 3DRQB 4H8QA 1Q9LA 2Q3AA 4BHUI 1EFXB 3POHA 2GY5A 4ECNA 1J05B 4N68A 1KTDA 3O8XB 4FQIH 4PJDB 4U4BA 3KVQA 4IOFC 5E6RB 1MFMA 1T1XA 1YMHA 2NY5H 2ZICA 4XWOC 3SE4A 2MHAA 3VFPB 1VPOH 4DP2X 5I8OL 1QR1A 4PJBA 2G9HA 2ICWB 4R0LA 1OT2A 3HAEA 3VXRA 5C9KA 3KPOA 3RNQB 4P2OD 3QZWA 2XI9A 4X80H 1D5IL 1FBIH 4X4KA 5IJVB 3MLUH 4G6AD 4JZNB 3QCTH 1S7UA 4M43H 3BUIA 2NSQA 1WWAX 4OM0H 1EANA 3L5JA 1NM9A 4NOBA 2PPEA 1KENL 3OKOB 2EDOA 3N1FC 1NFIA 3VG9B 3FZUD 2Q3XA 3MBEC 3QWRD 3ZE0B 1A6ZA 2HLFD 4YHOH 4P9MH 2XWZA 2DL9A 4JJ5A 4M5ZL 4PTTB 5KVEL 4PCSA 2J4WL 3MRGA 4NJAH 1A66A 3DOSB 3F85A 4I3SH 3MODL 1S3KL 4HALA 3CVDA 4U0RB 1DBBL 4DN4L 3WKYA 4JFOA 5JZ7D 4IBQA 3LIZA 1CFMA 4LSQH 1EUUA 1CXEA 4MZ2A 5IK3B 1C5DA 2Z65C 2EDDA 1BPVA 3QUZD 3OKDA 2K3TA 2MCPH 3BH9A 3QH3B 1HESA 5EUOF 4IKJA 3SQRA 4U6VH 4URTB 4XNQB 5KW9L 4G7VH 1U58B 2CKBA 2BOCA 4HSAC 3EH3B 3TBYA 1K3IA 4X5QA 2P1YA 3WEOA 5FV1L 1PCXA 4FNSA 1MNUL 3UTPE 3Q6GL 4RGMB 3TBTB 2OXHA 3B2VH 1JGUL 4CUCA 1BM3H 3SBQA 5IGXL 1I4FB 4P46B 3B7UX 3E6HB 2O1AA 1BWMA 4J3OF 4OZGE 4PV8B 2B5IB 1YQVH 3MLWH 4UM9B 1MCWM 5TDPB 1Z9SA 4EKJA 4O4YL 1WWWX 2HX7A 3KBFA 1PNCA 3L7FB 5IG7B 5K9QI 1FVDB 1PQZB 5DA0B 1SDYA 3GTNA 3WO3B 1CD9B 2Z31D 3PGFL 4KROC 4IK7A 3D2UA 4MDJB 3ZSTA 1BIIA 1RK7A 4CN1A 1ES0B 1GOFA 1P4IH 2NYYC 3TPUA 4JPKL 2WK2A 3ZYZA 5FM4A 1YUKB 1T1XB 1R6VA 2OS7A 1YMHB 3RGVD 3S37L 1M7DB 2BWQA 4Q89A 3LD8C 1BQKA 1KGUA 4PJBB 1QSEA 3KW8A 4HPOL 5T8IA 3V0FA 3HAEB 3VXRB 3HR5B 3RDTC 4TQIA 1KNOB 4OCMC 3IJ7A 4UQ3A 3CH1A 3QZWB 2I9LB 1N68A 4J23A 1XBRA 4PB9L 5HYSA 1A1NA 4KKLD 4AVHA 35C8H 4MLIA 5DJXB 3INUL 3W1ZA 3C8HA 2PPCA 5GS1A 4IIQB 3KNBB 5EOCL 2DQCL 4LVEA 3JWNG 1EZVY 1RIUL 4S0SD 5J6HA 2QVIA 3P2DA 3VMNA 3ULSB 4QXTA 3FQ2A 1UA3A 1XZ0A 1OP5K 4FE9A 1M7IA 4XMUA 4JM2D 4QXWA 3NBNA 1Z32X 1HCZA 3HZVB 4E9LA 1G7JA 2UWEE 3P77B 3DI3B 2EO9A 4D9LL 3FCTA 3QEHB 1ZIBA 1I53A 3AWGA 4JAMA 4K0OA 4RNRA 1FGVH 5IW6A 1MFEH 4KI5E 4L37B 3OKDB 3BH9B 1T22A 1NL0L 4EVNB 1QR4A 2WVUA 4I7ZC 3VFMB 1QFWM 3TJHD 1YYMH 2CKBB 2BOCB 5AW0B 1BEYL 1WUZA 1FNEA 3B9EA 2VKXA 4GBXD 2FR4B 5CN2A 4JPSA 1KPRB 4XHJC 2JQMA 5HYEA 5INDB 4AGNA 2WYZA 1MF2L 3CFJA 3X13A 4RESB 3T3MF 4XP5L 1RJZA 1Z9SB 1TYRA 1HSAB 4G8FA 5E2JA 3VUAA 4Z7OB 4M61A 3PU7A 2VMCA 4J7RA 1QBMH 1UT1A 2XZQL 3H56A 4EZKA 4DQOL 4ZT1A 1S9VB 2ZWNA 5C08B 3FSWA 2HFGL 1XQ4A 2H3KA 2BDNH 2YUWA 1AG0A 3TPUB 4AQ1C 1G7MA 2BX5A 2J8HA 3EH1A 3FQNB 5TE6L 1IX2A 1FFNB 5I1AA 3DRTA 1FWXA 4PGBB 5DC9B 4MCNA 3WUWB 3UAJD 3FO9A 5IQMA 3FF8A 3OZ9L 3CH1B 1QRNE 3DROB 3HI1B 2EDEA 4B97A 1Q9WB 5B1CA 5E8OA 1DANU 3G5YA 4LCWA 5F7NC 5D7SL 4XB8A 1TQWA 3DURA 2WLMA 2HB0A 1OE1A 5GS1B 1OSZA 3G08B 4OCRL 2NUTB 1H19A 4WI4A 4AV5A 3PL6C 2Z0UA 5DVNA 2JJTC 5J6HB 2Q86B 1DQJA 2H7WA 3GMQA 4QXTB 1OCOB 4MCMA 1AR1B 1JZHA 2KC0A 1XIWD 4MGXA 4G9DA 4EI5D 5EF2A 1FCGA 3MROB 3Q8BA 4QHKJ 2UWEA 1ZHKA 3TF7C 2X4NA 4YZFE 1TCMA 3UGEA 1IGCH 3HI5H 4AMWA 4CVXA 4MD5A 1P84J 1GSMA 3FQYA 1JOIA 1XCQA 4IRJA 4JAMB 4M93B 1HOEA 5DQJA 5IEHB 4MYWB 1T2QH 5D1XA 4D0BA 4JHAH 4CGTA 1RZJL 4PJ8B 1X5MA 4BELD 2E7BA 1LNUA 3STZA 4K23H 1RULL 2M26A 4OW6A 4X6CA 1T22B 1F18A 2MNWA 4ZSOE 4HDIA 1CFTB 3PXJA 2J12B 3WFZA 2FQFA 1WIUA 4JPWH 5DMYA 1FNEB 5AOMA 3EW3B 4YHKL 2V5RA 3HE6D 4QHUB 3RVVC 2ZWLT 2OR7A 2A9AA 3BUTA 3CN1A 3CFJB 3U1PA 1I1AD 1KCWA 3GUTA 5E6IA 2BSRA 4DGVH 1ZJAA 1MCSA 1WT5C 5D72H 3SEPA 1RJZB 4P06A 4NCC1 2Y5TA 4H25A 3TT1H 1CF8L 2C9SA 4MMXC 3D3VA 5KSBA 1AZVA 5I6OA 4QO1B 1BGXH 1S7XA 1OL0A 5AYTA 2E4FA 1BA9A 3QPQC 3HFFA 3AUVA 4KZ0A 2D8KA 4OGXL 3T6QC 3MJ9A 5ICZA 1SBSL 1LDPL 5GSRA 4BFBD 1SDDA 1G7MB 4YHLL 2EDWA 4V11A 5I18H 5I1AB 3KR3H 3LKRB 4ISVB 4EBQH 4NUJA 5KVFE 3ZDWA 2CPCA 4OZGF 5IBUG 3QIBC 3VD4A 3QXDB 4LBEA 4PG9A 1QRNA 5BQ7A 3LKPA 3GSWA 3GMPA 4XCNA 1MPAH 1KPVA 5CF3A 2DWDB 3WFDL 4Y16A 1OARL 3L08A 4CC4C 3DURB 1Q38A 4ZOCA 1HOCA 3PP4H 12E8L 1CI5A 5CN3A 1P9MA 3SYPA 3KEHA 4WHTA 5H2BB 3PWLB 1U92A 4OIIL 4JL2A 3AB0B 3QWNA 4PRBB 4Y5VC 3SKOA 1GGTA 3GMQB 1MCIA 1Z0NA 3MGTA 3FW6A 1EJ6A 3S3PA 3IBEA 3U4KA 5JPMA 1LJMA 3Q5YA 3NP3A 5EC2A 1NJ9B 1OGAE 1UGNA 1MHEB 2AITA 5AAMC 3RZCA 3CSFA 3TFBA 2JB6A 5D2LB 2AVFA 2FT8A 3W0WA 5C92A 2G2NA 2ID5A 5C09E 3T0WA 2OQJA 2CJTA 5D1XB 3MJWA 4D0BB 4U1IA 2WSPA 3STZB 4X6CB 2EILB 5AW9B 3U36B 4U3XA 3B4NA 1NFDB 3IDGA 1XR8A 1SJHB 3US9A 2NZ1A 2ALAA 4LSPH 3T4AC 2PW2A 4DHLA 5IHHA 4BFGA 4W9ZA 3ASOB 2HUEA 2UWEF 5E2UH 3CHOA 2AK1H 1WWBX 2OMNA 4I0PA 3EFFA 4FXGC 4XVTH 3NG5A 1W72H 4NWUL 4J6RH 2N01B 5L2KD 4JFPA 2NY1C 5E6IB 3RWIA 4AUYA 3GTTA 3KYMA 4ZMTA 5HHMD 3AQXA 4JDEA 5EZOL 5I0ZA 2DKUA 4HJ1A 4H25B 5FXCH 3GJEB 2YAQA 3MRCA 3S3BB 3F7RA 5KSBB 2I07A 2H6OA 3AWEA 3D3VB 3CN4A 5DI8A 5GHWH 4DKEH 5J9PA 3PLYA 1NPJA 1TEYA 3OKMB 4DUVA 5E8NB 2A4CA 3NA4A 4FAAB 5ICZB 4PI0A 1GOHA 1NAKH 5GSRB 2J1ZA 1T20A 1SDDB 5BXFA 3FYEB 1CLOL 4KVNH 4R3SA 5F72S 3HG3A 3WDHA 1E4JA 1JWMB 4AVKA 2YD0A 3IBOA 2CXKA 2P8LB 5BQ7B 4AQZA 4Y88A 1WC7A 4OI7A 3WXVH 2YN3A 3SDCB 3G04A 4Y16B 5KZCB 1IEBB 3DETC 4J12A 1UXSA 3MLVH 1K72A 5AB1A 3T3PB 3FH7A 2WXPA 3EJCA 5DMIH 2FHCA 4WHTB 5DHVH 3UIYA 5G4MA 1U92B 1FO0A 3FUIA 5J4MA 1U2YA 32C2A 3TV3H 5D1ZC 5TQ2L 3N44B 1JZ2A 1VACB 3PPEA 2EUZA 3TBVA 3ZT5A 3GSNH 2XDHA 3Q3GA 2OMWA 4H8HA 1OGAA 5D7KD 1I82A 5I8KL 1ZLWH 3LHPL 1JZEA 2IGTA 3A0OA 3PWVB 4A7TA 2JB6B 2ERJC 4P23C 2YMOA 1GC1L 1NLBL 5GGSA 5GJTH 4YUEH 2PABA 5TPWL 3VM7A 3W0WB 3FT4A 1P5UC 2OQJB 3GRGA 3M07A 5FYJD 3T0EC 4HEME 2EDJA 4U1IB 4Q56A 4AGQA 1QSFD 3HMWH 3VXMD 3H42L 4RDQF 2WTOA 4RGOL 2B16A 2DQGH 3C5XA 1JGIA 1TSHA 3U2IA 3SBRA 2CK0H 2Q7YB 3B83A 3DECA 3M45A 1CI3M 1A6AB 3D69A 4YZFF 3Q9PA 3MRBA 1LMIA 3MJ7A 5EC1B 1HX0A 2F9BT 4PJ9C 4KO5A 4ANVA 1IFRA 1I7UA 4ZFQA 4ZQKA 3MUGA 2H2PC 3RWIB 3UP1A 3EOBA 3DLQR 1FDLL 2Q8BL 3ASWA 2J8UB 3MCKA 3QORC 4UU9B 1LTXA 2MNJB 1RSYA 5C0AE 4YX2H 1E5CA 1L6XA 3RBSA 2I07B 3VACA 5J9PB 1XGQA 4W6XB 1RHHB 2KERA 3O2VL 3EYSL 2NY6C 5JW4Q 2BC4A 4E9WA 2CDGB 2Y23A 1L9SA 4N3TA 5EB9A 5F88B 4NKMB 4BQ8A 3S4SG 4TULL 1T20B 1AIFA 3OAUL 3L4UA 1PZCA 5J57B 1CFQA 3GKWL 2E27L 3FUJA 1L9OA 5DK2A 3MCG1 3OHXB 4KI1A 4RDQG 1FFOB 2EIMB 3CN2A 5IHBA 1E0OB 4JQVC 1X5LA 2D03L 1HH6A 2IWGA 3GI9H 5LWYH 5EU4A 5ITBL 5MENE 3K6DA 5SV3A 1I85C 1AG6A 4LSSL 4OFQA 4P3DA 3G04B 1GPOH 5MEOA 2DLIA 2AJUL 2AXJA 4OLWL 3O3AB 3S7GA 4KMTH 3BE1L 3L4XA 4DSYA 3GMNA 5JHLH 3IJ9A 3KPRB 5B3JE 4EIZC 4LHUB 2OSWA 5EO9A 1D9KC 2YRBA 4F7KA 4L1SA 4QXGH 2R2CA 3Q3GB 1MQKH 2W5PA 4OLUL 3NCFB 3OB0H 5MEPA 4GXVL 2QSVA 2EJ1A 3TN0C 2WLHA 1A7NH 4PPTA 4I77L 4YBQC 4NNPH 1DP0A 1ZTMA 2A6KB 2JVUA 4M7KL 4Y4KC 4BRJA 4JO4H 3L4VA 5IY5B 3QFJE 3GSRA 5DR5L 4UTBA 1JXDA 1W80A 3GD1C 4U7SA 2AK4D 3OKNA 2P9RA 3T1WA 2ATKA 1OP3K 1GGBH 5HDWA 4X6BA 4ODTL 4M9OA 3OWEA 4FXKA 4XCFH 3IKCB 5GPRA 5BZDA 4NKQB 2AI0H 5ECGA 1CE1H 3D69B 4AYDC 2HKAA 4WNQA 1IL1B 1MN4A 2CDFB 1N0XH 2DYPD 2J71A 3DPBA 4NI6A 3T8MA 4R7LA 1RMFH 4U6YB 4Q9RL 4ELME 1Z5YD 4HUKB 1I7UB 5HVHC 4LAQH 1JVOA 4QRSA 2WGXA 4ZPTA 1MW0A 3D5OF 4LPWA 2YZ8A 4UT7H 1A4JB 1S8DA 1TEGA 3PPSA 2GK0A 3MYJA 4CSPA 3RWJB 3MCKB 4D8PA 2E7MA 3BSHA 4RH4A 4Y2DD 2RMNA 1Q0XH 3F7YA 4YDLC 5F6IB 2H0FA 1WE5A 3DXAE 3QEUA 4OZFB 3IM1A 4PJCA 5I30L 4PAZA 5FHBL 4WUUD 3ZTNH 2BC4B 1PY0A 3DDGA 2HG0A 4QRQB 4NQEB 4WO0A 1YMMB 1AS6A 4DO5A 1CFQB 1UZ6E 5HHXL 2PYED 1F00I 1R19A 1HH6B 1V7ML 4MA3B 4WI5A 4WV1C 1LM8V 2LW3A 5EU4B 5MENA 2YXMA 3OR6A 4R7DA 3T9WA 1UFUA 5I1GH 2W0LA 4P3DB 2N4IA 2XX1A 1SFHA 3MLYH 2XXCB 2IPKA 4R90L 3BXNA 5FYLE 2N56A 5A16A 1EXHA 1J0IA 5EUKA 5FHAL 5FPIA 1L0YA 1NKGA 4MMZA 3O8XD 4QLWA 1G9MH 1G6VK 1GA2A 2B2XH 4AYGA 4W81A 2OZ4L 1IGIL 1JZ4A 5EIVA 4ZD3L 5MEPB 2PP7A 2ZYHA 5TDOB 1GJUA 5F8QC 5KN5B 4X0KB 4FLHA 4LL4A 3WFEL 2OA9A 5KJRH 3QFJA 4NP4L 3RJQB 3GSRB 4LSVL 3NFNB 4AK2A 1AQKH 5GRVK 3KLQA 1CVRA 1UM4H 3SKNB 4UNIA 3M1OA 1U8JA 3CMOH 3IRCA 3ISYA 5DU7A 3V5DB 4D0CA 3ZL4L 1E9PA 3UAFA 2YAPA 1XH2A 5AVSB 4OIBA 4MBRA 1YY8A 4F1ZA 2QGBA 3P4NA 3N40F 3QDJD 3EJZC 4HJEA 4KWUA 3MV7A 2JI3A 3VA6A 4BE6A 1JWUA 4J3OD 3AG2B 4MA8L 5DHMC 4KDTC 3ILPA 1BJ8A 2YLKA 2VCOA 1NLDH 1P7KA 4NQVA 2BVPB 2BFVH 2OW6A 2IQAA 2A83B 2X05A 5DD3H 4HEPG 5IFAH 1JXKA 1H15A 4GLRI 4D8PB 1NFKA 4AWJC 4XNZB 1JYXA 3ZE1E 4HOMA 4IGBA 5IJBC 3VI4E 2D73A 1PLAA 1NCDL 4PJCB 4DN3H 1R5VB 1MREL 15C8L 3ZLQC 4JHWL 1U8QA 1RERA 4D9QD 4C4KT 5I9QB 3H4FA 3IJEA 4P2QA 5EOTA 1NC2D 2JIXA 2EKSA 1M71A 2NNAA 3C60C 5E99L 4UMGA 4Y89A 2CJSA 1JN6B 1CIDA 1M2VA 3CQFA 3ILQC 3NJXA 5EOQL 2ZTBA 3AXLA 3DO3A 3WHXA 4XVUD 2CHWA 4BZ1L 3OR6B 4E41D 3Q1EA 4F93B 4F9LC 3GBNH 1XGUB 3BXNB 4OCYH 3D48R 1OAZH 1OP5H 3VWJC 4OI9A 1QWUA 4PVMA 2ICEB 5F7DA 3MZGB 4MA1C 4XOAA 1YEKL 4MMZB 1YEDA 2EDLA 3LVEA 4CMHB 2BSCA 5E7BA 2OM5A 1T5WA 5LLIC 4UYQA 1G7LB 1TETL 2DKSA 4MRCA 2R15A 1M56B 4G71B 5F7HA 2X9ZA 2F61A 3L3KB 3CFUA 2WBKA 4LVHB 3MFFB 5H4YA 4HS8H 3F05A 4GSXA 2C7FA 2XQBL 3P0VL 1RZJC 5D6CA 4FS0A 3FU8A 2HVKB 4DP0X 2G75B 4P3CL 3CVBA 2WPGA 4FJYA 3ARBC 3WO4C 2GJRA 1L9RA 1MXDA 2AQTA 2V2XA 5B8CC 4LSUL 5FUZL 1UTDA 1U8JB 3LEXB 5B3JF 4QXVA 3TO2A 3CU7A 4A55A 4D0CB 1E9PB 4MZRA 3FXIC 4H2CA 1SHMA 1C5CL 2PXYA 3QQ3A 2ROYA 2Y36L 3KS0H 5D71L 1EO8L 3BLBA 3T6XA 3P4NB 5C0FB 1RIHH 5D70L 3HS9A 5DSCB 3LDBC 5GZOD 2D7QA 2ATPA 1JWUB 2I69A 2WJ5A 1FZMB 3H9SB 4IEFB 1VKXB 2F8OA 3ZDZF 3ILPB 2FEDD 1UD8A 4YXLL 3SN6N 5HI5C 1P7KB 2N0KA 4NQVB 3IETB 4PLJD 1MVUA 5CLZA 2E9JA 4P5TC 1W91A 4Z7UE 4GKSB 2FYYA 1MEXH 4WKXA 3H3PH 1U8MA 5CUSH 3K4AA 3T2LA 4IGBB 3EH2A 3AVEA 3BKYL 4MAYC 2JI1A 3KYOA 1EMTL 3LSOA 5B39G 1SN0A 5IKCB 4PVLA 4YE4H 1IVLA 1GMIA 3MNVA 1ANUA 3V4LA 5JXEA 3IJEB 4P2QB 5IMMA 2JIXB 4IMKA 5EEYA 4ODXB 2NNAB 3LRKA 5MP6H 4ELMF 4R4BA 4LBAA 3WU1A 3D4YA 3EFOA 5FR3A 1HHIB 1JBJA 2YRZA 4HGWB 3NTCL 1WS7A 2PPAA 4HUUA 2YRLA 4U05A 4DAGH 3NRQA 3UTTE 2IV8A 1RZKH 4QOKA 3NUKA 3RVWD 1E3FA 5I2IA 3RILA 2NY3D 3RFZB 2PWFA 2BY3A 2A74A 1FL3A 3D2UD 2V8MA 4FNUA 3BAEH 3QHTC 3R0NA 5IFHL 5F7DB 1NGWB 5F8RC 4HMDA 1HKFA 4IKIA 1ZK5A 3GLZA 3LN4A 1QSED 1UZ6F 1AGFA 3KPNA 3U2SA 5B7EA 4HWEH 1D6VH 1UA7A 2GITB 2UZYA 2VLLA 1FV1A 1L3WA 4FULA 4K7PH 4NO5A 5D6CB 4XMKL 3KEDA 4H8WH 2ENQA 1P0SE 1KFGA 2BIMA 1CICC 1ZVSA 3UC0L 3UMNA 1GW6A 4PB0L 4BUQA 5DD0H 5JR1H 1BQ5A 1IC5H 1WCBB 2KZBA 2XHNA 5C3LD 2N7AA 3DMMA 1AR1D 4M6NH 4FYQA 2PXYB 3RP1A 5CJOL 5I19L 4EZMA 1N18A 3UTQB 2QVTA 1UWFA 5AKVA 3RE0A 1NC4B 4OGAC 5MI0B 1JGLH 3HFMH 3L9YA 1PTZA 1XTLA 1YEHL 3NDYE 1EZUA 1KIQB 3NH7H 4QTIL 3EUUA 4XP9L 5TE7L 3U0TA 3V0IA 2F54E 3L9RA 1G1KA 5E95B 3MXVL 5GGRB 4C4BA 1HCVA 2YK1H 2X41A 3I74A 1HYRC 4M48H 1S9XB 2ARWA 1JERA 2P44B 5L0QC 4GAGL 3KYOB 4GLRH 1R0AL 2ZG3A 4F37K 4P4KA 5GRJH 4I1RA 3VXQB 2EZ0C 2UY6A 2Z0BA 1A14L 4GMSL 2G4GA 2MKLC 2PP9A 2RH0A 4HK3J 4WGWB 2FGWH 3RVXC 2OL3H 4R4BB 1SXAA 2EYSA 2IXQA 3MRNB 1IGMH 3VYPA 1OO2A 4HUUB 3K1KC 1R3KB 1RV6X 3UTTA 3ZZQA 2DN7A 3KMDA 4LU5H 5ILTH 4QOKB 3QARA 2AEPL 2HMIC 1E2ZA 2WB7A 4YDJA 5LBSL 4W9DC 3NSXA 1YEJH 5DYOA 4TLUA 1FL3B 2K8QA 1KIPB 5TQ0H 1KELL 3ZDYB 5FGCE 4AL8H 1F11B 1VGEH 5SWQA 3Q7JA 5EA0L 3BCDA 3IGLA 2QQKL 4ODWA 3B34A 4LSDA 2RB8A 3QQ4A 2XBTA 2XVBA 3KBHE 3QEQE 3RIAF 2VJ8A 1ETJA 4OI8A 4LCCB 1T3FA 3U2SB 1GC1C 4QRPA 3ENEA 2UZYB 2CUHA 4K3EH 3MACL 4LCWD 4KMLB 3AQYA 1KZQA 5HI3C 4EUPG 4FA6A 3EG9A 3PIQB 4TPRL 2WVVA 1WJ3A 4KNSA 3BPLC 2ZZUT 1JZGA 2DZEA 4RISH 4F2ME 2VWEC 3HCVA 4L8DA 3VVVA 1DQVA 3OJVC 3MRKA 3MRMB 4NX0A 1MRCH 1C12A 3KPLA 4KBPA 5DJ8B 4UOZA 3EDKA 1Y07A 2CA3A 5GSVB 3UCRA 2VE6B 1O9VA 1RVFL 3HNVH 4IRJD 3RY5A 4F5CA 1HXYA 4MB4A 3CZFA 4U1SA 4Q4IA 5CBEA 3U0TB 2IH8A 5D1XD 3QUKB 3TESA 2LLLA 3SE6A 3TT3L 5AALA 3P4OB 5IR1A 3IDIA 3L4YA 5EU3B 2COQA 4F58H 4PUBH 4CDGC 4MJ6A 3VRJB 2XV6B 1P4LA 3D0AA 5IQ7L 3OKKB 4Y4FC 4O02L 4AIEA 1TQSA 1X5JA 3B9KC 4HH8A 4WK4B 4AZ8B 1AXTL 5M7QA 1QLEH 2WKLA 2JF1A 5KBNC 3REVA 3B56A 4P5KB 3DSNB 5DD6B 3KGUA 2V9QA 3UACA 1A7RH 5KBKA 4OY9A 2YGOA 1U8LA 1T89C 1VLXA 2PWGA 3WIHL 3DYPA 1EGJL 4WK2B 4ZUTA 1WV7T 1B4JL 3FTVA 1HVXA 1ODAA 2XZCL 3RWEB 2BHUA 4U6XB 2DM2A 4L9LA 1IKFH 3W9EB 3ZXAC 1ND0A 4FQCH 2Y06H 4XC3H 4XWGH 3SOBL 1OALA 3P2TA 5I8EB 3K3QA 2QVFB 3RNKA 5IQ9B 3T1FB 4XVSL 4NPYA 4YDJB 3VG0H 4AQEA 1E5UI 1FIGH 3M8OH 3AQDA 1Z0MA 1P53A 3FO0H 2AJZB 2W9DL 2JELL 1Z3RA 3BWAA 5SWQB 1KLUB 1RU9H 3PHSA 5DF0A 5AVZB 3SY6A 4H1LH 2QQLH 3E6FA 4BZ2L 5KVDE 3QEQA 1K8IB 3D34A 3P30L 1F6LL 2MOGA 2IH1A 1FNHA 3QJQB 1QRND 5AD0A 1K4CB 1ZJBA 4ZMVA 4QRPB 4MX7A 3BN3B 2DMBA 1U8NB 3LZNA 2K4WA 3HPLA 3L5IA 2APSA 4NWTH 4X5XB 3U9PH 1QKZH 4HWUA 5KSAA 4GXFA 2PYFB 4Y1SA 5C07B 1N5AB 4WU7A 5AW8B 4G70B 4AMXA 1ORSA 3O41B 4KKCC 4O51A 3KWTA 3EG9B 2IALB 4R8WL 2PUQT 3BD5A 1F4WL 4G1EB 2WVVB 3JV4B 2P80A 1XL4A 4YSPA 1YPZE 1J0HA 2AEQL 3DJ9A 4L8DB 2WP3T 4Y5YA 2WXNA 4LEBA 4AYSA 1KCRL 4JO5A 5JOFB 1G43A 2MQGA 1UJ3A 5FF6B 4N2OA 1FFPA 2MQ0A 1MRFL 3KPLB 4TVPH 4YEFA 3MOAL 3RZCD 2DYSB 4K7FA 2NY4C 5DRZB 3LMJL 6CGTA 2BS71 3OLEA 2DEXX 4FQXC 4IBYA 3CZFB 4U1SB 5CBEB 4NN6C 4PY8J 5DHVA 4BQCA 1DLFL 5AW6B 4J5VA 2F8IA 4ODHH 3IDIB 3ZRCC 3IB4A 3APDA 4PJAA 3ZE0E 1V54B 5F7FA 1P4LB 1RZGA 4BKLA 4Q6IA 4LGRB 3RWDA 1SXNA 1SMOA 3O6KH 4FZ8H 3CN3A 4HWNA 4EDWH 2LVEA 3IPBA 3RI5K 1BF8A 2D7PA 2G4EA 2VDML 3QUYC 4ZO8A 5I1IH 1TU2A 4GEIA 4HHAA 2O6DA 3IDYC 4S0TD 4I0PD 1DN0A 3GS7A 4A6YB 4GKOA 3GDCA 3VRIA 3GMRA 3QT2A 2Z34A 4E42A 3IXTB 2D0FA 3WY4A 4L9LB 3ZN6A 1MFAL 3T65A 4ZXBB 4B3EA 1UM5L 2ITCB 1ND0B 4Z78B 5DURD 1PZDA 2XYBA 3P0YL 4JL1A 1MY5A 2BRQA 4GT0A 1G84A 2WCGA 2GAZB 3LS4H 4DT2A 3S5LG 2AEOA 1ASOA 1JPST 3I84A 3V4PL 2WP3O 3ZX1A 3LS5H 4Q9CA 2WWMD 3C09C 1W72B 5AB0A 5FYKE 5IREA 2CDEA 2WVTA 4WW2C 1I8KB 1SF5A 4HKBA 4ODBD 2R2EB 2Z93B 1DSFL 4MDIA 1DL7L 2A6IB 4TXVB 5TF1H 1KJ2B 1QZNA 5I15L 1T03H 3L7EB 1KGWA 3CFEA 4OVUA 5CCHE 4NYLB 4WU7B 4O2FA 3LB6C 4QXUH 1A4KA 1ZS2A 3FMGL 3LRSA 4G7RB 2DLFH 4O2CA 1A6WL 2EIZB 1J5OH 3MV8A 5DWUH 5HDRA 4G5ZH 3LRLA 2MIZA 2FX8H 1PVHA 2Z7ZA 4Z23A 5DMGD 1K2DA 3QCVL 5EWIL 3HG4A 1PD6A 4DCQA 2YD3A 2XA8H 1OGAD 2FB4L 5E2WH 3LXBA 4ZW7A 3BESR 1T1YB 2ODIA 4K7FB 4Z18A 5DHXB 1MG3C 1XF4A 1A7PH 2ZKHL 4TQEH 4Y2OB 3FQUB 4KK5C 5LB1A 2H32B 3RL1B 3R1GL 1QPKA 4H26A 2QPEB 4MD4B 5JHLA 1RUKL 2YAHA 1DCEA 4FFWC 3T77A 3FN0H 3LQAL 1RIVL 3GSNB 4NOFA 5T1LA 3RWDB 5CM1A 5KS9B 1J7VR 1I1RA 4HIPA 3FTGA 3K2UL 5A3IC 3SD2A 3F7QA 1F1GA 1TU2B 5ESAB 2DLGA 3TEWA 3AW5A 1BCIA 3VFRA 3GMRB 3MVSA 4L3FA 3JV0A 5E6SB 1U3HC 5DA4A 3J7HA 3QUMH 3UJIL 1NMAL 4RGNB 2X2JA 2J6EH 3OJDA 3ZKNC 5BV7L 2EUVA 1DBAL 5T3XE 5DJ6A 1A6VL 1BLNB 1N3NA 1ZOXA 2E9GA 1A3RH 2OKMA 3ERXA 4JJOA 4HUVB 4NLHA 3EGXB 3TH2T 3APFA 3U0WH 4KKZA 1EAJA 1NGQL 4GMTH 3GRBA 1TQVA 2F7IA 3RX7A 3KXFA 2K4AA 2FBOJ 3CVHL 4HPHA 1SEBB 4POZC 4UZUA 5F7UA 1KN4L 5FS5A 3UMTA 2CO7A 5HYIA 1X3DA 2B7DT 2K1MA 1LHZA 4PV9A 1HXMB 3BKMH 1SJMA 1THAA 1PPIA 1X5IA 1UM6L 4HHGA 4XPFL 3C8DA 2Z92A 2VZTA 2KBGA 4HLZG 3NIDB 4CADB 3PAYA 4GQRA 4OTXH 5I1HL 5I0DA 4EIUA 1EJFA 2DQIL 3I3EA 4PJEA 5C08E 3AWFA 4HIIB 4S10A 3ZYIA 3MV8B 4B0MB 3FH5A 3EDJA 1A8ZA 1TZAA 4OF8A 3WS3A 4PRHE 3EFDH 4Y5XB 4QMEA 1G1CA 4NJ9L 2VDQB 5D7EA 4WY7H 3PXLA 1BIHA 2Q2LA 2WXGA 4GIAA 3MI6A 3OKEA 1JD7A 4LLVA 4F15C 5FIEA 4JHUA 4HVBA 3S88L 1R5IB 2H3XC 1IAMA 3DVNB 1AJ7H 1N6VA 3L5WA 5CEXB 4PY8I 2DMGA 1IC4H 1LYQA 4LLQB 3T77B 1YPZF 2FECI 4Z95L 3HJEA 3G6DH 1UZ8B 3DIVA 3FTGB 1YEEH 2WINA 3GGWA 2OMTA 1W16A 1RLWA 1A9EA 3G5XA 2VH5H 3KYNA 3QA3B 4QWWD 5JORA 5K59E 4LASH 2VLRA 5D7JB 3ZW3A 1OT1A 5AW7B 4A39A 1EEZA 3QQXA 1GCYA 1DJSA 2FECL 4L1BA 4AG4H 1CFSB 5DK3A 2BHZA 5C0AD 1KTCA 3V4VL 5GGVY 3RWFA 3OJDB 3FU7A 5C0CE 1NDTA 4R6UA 3RKPA 1JZDC 4LDOB 1FLTX 4LFHD 5H37G 1MFBH 4PGEA 1BVZA 1TLKA 3E2HB 3FOMB 5D93B 3BFQG 2NNFA 1RL1A 5CEZD 5FOJA 2R0ZL 2Q20A 1HFUA 5EV7A 5J12B 1LDSA 1SM3L 1NUNB 4OZHA 3WLBA 3BPOC 4R4ND 4YK4B 2VLJA 4ZPVB 2Q8AL 1TTCA 2DQHL 5HYQB 2CGYA 4ZMWA 2IWFA 2ZKXA 4PV9B 3TBCA 3REWB 2XTLA 5MEND 3HI6H 5T3ZH 2Z92B 3SGDI 2NQDA 4ZUUA 1RZPA 4EEEA 3GIZH 2W59A 3MLXH 3OGOE 4IDJH 3GMMA 4JY5L 5ANMB 5HYJE 1C5BH 2NZ9C 3I85A 5ALCL 3P3RA 3ZL1A 3NJIA 5FM5M 2ZWZA 4MNHA 2BSSA 5SWZA 1GYWA 3LV3B 2OBGA 2R4RH 4Q74A 3ARFC 3G6JA 3O4OB 3UROR 3WS3B 1CXKA 4GRLC 2W80C 4NQUA 1H3PL 3QRGH 1FP5A 4LARH 2C1OB 5HDOA 4XTRD 1H8OA 1NUGA 4CMMA 2F18A 3VFTA 1NAML 4JG0H 3X14B 2PR4H 1ML0A 3OKEB 3SGJC 4KZDL 1TKWA 5I5MA 1JNNL 3QFJD 2BP0B 3FRUB 4DO4A 2XVLA 2ORBH 3CLWA 1BBDH 4FG4A 1OAUL 3LEVL 2CGRH 1DQIA 4HUWA 3L5WB 1XGRB 4A7UA 4XBEL 1AO7A 1FNLA 3CD4A 4PJEF 1J8SA 3ISWA 3SQOH 4HJGA 2IWEA 4RWYH 1TJIH 1M53A 3GKZA 1LEIA 1YAZA 3QPXH 2NX5E 1KXVA 2ZCHL 1MCDA 5KSUA 2DQDL 2WINB 2FQDA 2KS0A 4CKVX 3MV7D 3OV6A 4YSAA 1ITCA 1MSPA 2DQJH 5LQBL 4I3GA 4XCCH 4XNYH 5JORB 3II2A 4OLXH 3KW7A 2V17L 1LE5B 3SPIA 2LABA 3RJOA 1RPQA 1OPGH 1X44A 1BQHB 4NGHH 5C0CA 1F86A 2WN3A 5D2NC 4KJWD 3DXAD 1BVNP 2JNZA 1G9NL 1MW1A 4X2UA 1AS8A 2VZUA 1CGTA 1CD8A 3E1ZA 1XSKA 1F4YL 1I9RL 3PWPB 4LVOC 3B43A 2VZSA 5T5FA 3GNMH 4CA4A 2GTZA 5KJ7E 3GIVA 1Q9OB 3KG5A 3NJKA 2KYIA 3UFIA 2VLJB 3GB7A 3C5ZA 5KBPA 2YD2A 1MJ7H 1AIZA 2IQ9H 4JQIH 4X8XA 2NW3A 1L9QA 4C54A 5B7MA 4K9EL 1T1ZB 2Y2TA 4M3KB 4G7YH 2O26U 2A38A 2O4EA 2VDRL 3HAEG 5T1DH 3MRDA 2YC1A 5FYLD 1CFBA 4XMPL 1UQSA 3BUYB 1I3RB 3QZWG 1YCSA 4PS4H 3UPRA 5DJDA 5EULV 3KGSA 1NCBL 1D5IH 3BDBA 4MFHA 1OTSD 2AJSL 2W07A 4XT1C 1AP2A 1T2JA 1YNTB 2F68X 3G6JB 4OZHF 3UTSB 3FTZA 3Q8CA 4G8GE 2QV2A 3BKJH 3C75A 1OTTD 1P4BH 2NNRA 2BP5M 3NRPA 5HI4C 4GSDL 5PCYA 2E6PA 4JFZH 2DH3A 1HK6A 2MTAA 3CSPA 4M5ZH 3HNSL 1HE7A 1IM3D 1AZRA 1JNHA 1WTLA 2COVD 4FLSA 5BW7C 1G7IB 2OX5B 3CFDB 4YDIH 4DN4H 1DBBH 4E9QA 4RAUA 4P59L 5KUKA 4HJGB 3QUXA 4BYHA 4JFTA 1NBYA 5KANI 3H2QA 3HC3H 5TTRA 1M1XB 1GXEA 4GRWE 2R27A 3L6FA 2QKIA 5PAZA 4PBXA 3FUNA 5JQ6L 3TC9A 5KW9H 1OTUC 3S97C 2P5WA 5BOPA 5L4JA 5CZXD 3JVGC 3U30B 2IG2H 3Q6GH 4GSQA 1KCSL 1JGUH 4I1PA 2VW7A 4G6FB 5D96B 5AZEL 3DX2A 1F5WA 2J6WA 1L7TH 4FTVE 1UCBL 1QFPA 3WNPA 2ENJA 2EXWD 3P3UA 3UYPA 2YAOA 1TOXA 2R8SL 5JXED 3GIVB 1P7QA 2XWBA 2H47C 2CIIA 1MJUH 4JKPL 3VFOA 2AZUA 3L5XH 5CD3A 2FJGA 1ZIAA 3PGFH 3JWNC 4LRIC 4GO8A 5K59F 3FT2A 1Q94A 3HLAA 3SJVB 2NW3B 3U79A 2ZUQB 1GH7A 4HKZB 1UWXK 2IGFL 2W1NA 3AJ7A 3BX7C 1RJYB 4N8VA 1T04B 4QOKD 3SYOA 3SO5A 5E4IA 5JHBA 3WUWG 3MRDB 4TTDD 2YC1B 4DVRL 2NCEA 1M57B 1E4WH 2PPFA 4HPOH 4HC1H 1UQSB 4CN6A 3QAQA 4BFIA 3ZY7A 4X9HA 2WTPA 3KPPB 3D30A 3F58L 1CQYA 5EO0A 5IB3A 4EXPX 4PWHA 4Z77A 1HN1A 4OGQC 1AP2B 2OL3A 4PEEA 2CXGA 1UXWB 2L7UA 1ACYL 1JHKH 2FX7L 3INUH 4WWKC 1QFWI 4ONGL 4TQPA 2OAAA 4ZMYA 5C1MB 1WDAA 3K2KA 4S1DD 3X12B 1Q4NX 4WUKL 1COBA 5D7LA 3TBWA 1ZCRA 5J1AB 2HTLD 5E08H 3KLDA 1OHZA 2HT2D 4OJFH 5F3HB 1LP9A 3X11B 2MOVA 3GM8A 1I31A 1IJ9A 3ARGC 4K8RL 3ZE2E 4C56A 4BA0A 1G6RH 1T66D 3S34L 3FSVA 4N2IA 2IDTA 1LWJA 4D9LH 1JZFA 3KWXA 5CMAA 4JR9L 2VN6