2L3BA

Solution nmr structure of the bt_0084 lipoprotein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr376
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
MNDDVDIQQSYPFSIETMPVPKKLKVGETAEIRCQLHRDGRFEETKYFIRYFQPDGAGTLKMSDGTVLLPNDLYPLPGETFRLYYTSASTDQQTVDVYFQDSFGQLQQLTFSFNNDSSKEEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein found in conjugate transposon
total genus 18
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2010-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l3bA00
2L7QA 2L3BA 4LBAA
chains in the Genus database with same CATH superfamily
2SODB 4G6KH 4DAGH 4QHPA 2UZXB 4WFGD 5IKCB 1G9EA 1TU2B 2CNZA 3BWAA 3QCTL 5T3ZL 3X3FL 1AVAA 3PWPE 3SBPA 5I2IA 4DETA 1ZGLB 1MFCL 3PP4L 1X3DA 4DP5X 1IEBB 4UAOC 5C0BB 2A6DA 3NMEA 4NQED 2WINB 4OZIE 3H9SE 1MLBA 3LJ3A 3U25A 2X10A 3QULB 1NANH 2E76C 4ACPA 1G7PB 3PWUB 1FO0H 2HT3C 4FFYL 3V0DA 1G9NC 3WIAA 1LP9B 3NOIA 4JKKA 3SYAA 2VLJE 4M8UA 4Z7NE 2WYHA 4DPAX 4A7GA 2C1OA 4JO5A 3SE4A 1JN6B 4TUKH 3VG9B 2MCAA 1UD3A 4QHKJ 5HGAB 1S7RA 3KPRD 3UTSE 4RMQA 3ZO0A 2WXHA 3QB7C 3WLWC 4I8DA 4QMEA 1Z9SB 3I75A 4F20A 2BSSB 2MNWA 2TRHA 2WQWA 2PPCA 5AQ0A 1ID5I 1SHXA 2VR4A 2R2EB 2V6HA 3WY1A 5I1DB 1J8RA 4DESA 1EXUB 4ENZA 2ZSVB 4XP9L 1TDQA 4PP2A 4KROC 1KYFA 4JR9L 3P11H 1NBYA 3A21A 2CUHA 1BAWA 1T1XB 4LHUA 4DN3H 1CDCA 4XNQA 3L3DB 3QZMA 3D3VB 3QGVA 1YNTB 4WIQA 5EO0B 4IBWA 2FNWA 2NDGA 1OWRM 4IRZA 1C5CH 4KMLB 4CN4A 5L2KD 3J07A 3A4DA 5HGDA 3WKML 3ZKXB 4FMFA 5EU6B 4RAVA 5DUPH 3VWJB 3JWNH 2J7LA 4I3RH 4FXLA 2NY2C 5MEPB 2VZOA 5DVMA 3UJJH 2KYIA 5K5YA 3DETD 5CWSB 1NIEA 5E5MB 4Y89A 3WTSA 3O3BB 4HQQH 4P2OB 4EIGB 3OKYA 2WVVB 4Z7VA 1SBSL 4RIRB 4W1TA 2Z7YA 4ZX5A 2CLZA 3NIFF 1TQBC 5DJ6B 2Y07L 3BVDB 2AQ3A 2FE0A 5IB1B 1DBBH 3GLDA 1WITA 5BMFL 4WEBL 2XN0A 1D9KA 3HVNA 1KNOB 5CAYB 2CZNA 2K9UA 1AAJA 2TSAA 3B3IB 4ZZKA 32C2B 4HJTA 1U3YA 4DZBB 3L13A 3MV8B 3ARGD 4ALAL 1IGFL 2H3NA 2OW7A 3SDYL 3DX7A 4XH2B 3TBYA 1J5OH 1PPIA 5B1KA 2QDWA 1VFUA 3CFEB 4RDBA 3TCXA 5IREA 4F8NA 4DP1X 1CC3A 4YEEA 1TTAA 4X99B 1ZGLA 1JZ7A 2FX8L 4NO0B 3EF4A 5IZ7A 3V4VA 1HSAA 5C0EB 1LQBC 4EXPX 2D0FA 1S8DB 4F7PA 3HZYB 5K1JA 1OB1A 1DVYA 1PZSA 4PBVC 1DUZB 5A7BA 3S3BB 2FNBA 5AB1A 3V7AE 4PY8J 2HRPL 4X7TB 3X2QB 3SYQA 1OIOA 3DETC 3NJLA 1BX2B 3EOBA 4BE5A 3OAYH 3AREB 4N20A 3BAXA 3SEPA 5F9JA 1I82A 3ECVA 1VF5C 1ZA6A 2X09A 5FFOA 2X1OA 4KFZC 2R7EA 1HCVA 4L8DA 1I3RB 1BEXA 1A6VH 3LN4B 3P1VA 4GSUA 5F0MB 3NIDE 4X6DA 2GC4C 2JTYA 4TM9A 5IOPA 4NLAA 1NC2B 6TAAA 5HBBA 1HL4A 3GSWA 4U1NB 2Q7NA 3GMPA 5HD8C 2KQMA 3AXIA 5FX3A 1PSKH 5FO7B 1FDLH 3CVBA 5SWSD 4AL8C 2P8PB 2BVOA 4PUBH 5J89A 1NGYA 4FJ6A 5IF0B 2OMXB 5CUSL 2VDNL 2VR6A 3GMLA 3R19A 2XG5B 4P2QB 1ITBB 4Z7VE 5DFWH 5BOJA 4B7LA 4GI8A 2E7MA 4JFFD 4KZDH 5D2NA 3KXFB 1VFAB 4GKNB 3TYGL 4HBQA 2LHAA 4N26A 4NFCA 3SKOB 5CWSA 1YEIL 2CNYA 4JRXB 4WTZG 3MV7B 3DX6A 1ZWIA 1PY9A 1I9EA 2DIEA 2OTUA 4M4RB 1IM3A 1JCKA 1TU2A 4OFVA 3KPSB 5EOCJ 1N0LB 4HLJA 5FGCE 5MERB 3IVKB 1Z9NA 2H3KA 3JYCA 3NJHA 4XMVA 1HJBC 3QCUH 4JUTA 1LHZA 5FO9B 2BJMH 4GRMB 5EWIL 1HFUA 4PRIB 4JDVB 3HG1E 4RMUA 4KO7A 4NIYE 3DX9B 4J4PA 4C56A 1GKOA 4IRSA 3TN0C 1R5IA 5D7IF 4YHKH 2FUTA 2J55A 1S8DA 3GMMA 4MS8C 4J23A 2H2SD 2PNDA 1URIA 2RH0A 1F1GA 4R4NC 5E9AA 5JIKA 3WL9A 1FN4B 2EDJA 3ZL4L 4B97A 4KI1A 4BUGA 3SKNB 2XZZA 4N87A 4JHWL 5C70A 3FQ2A 4NRZA 3QQ3B 3SDAD 5A3IC 5ID1B 2NX5E 4RFEB 2D9QB 3KCPA 5JW5A 5EEUA 3UC2A 3V52H 1TFHA 3INOA 3L4ZA 2AJXL 2AK1H 3Q3GB 1KBKA 3KM1A 4YE4H 4MYWB 3FQTB 1AIZA 4KTDH 4KH9A 1Z0NA 5KVDL 3S3DB 5L2JA 2CBOA 2F8IA 4I0PC 3GMQB 5DJ0A 3VFUA 4AEEA 3ULUD 3ZIYA 1CI5A 4X4MA 3RI5F 3ILPB 3QEQB 3SYPA 2JVUA 3X1NA 3WSQH 3W1ZA 2Y5TA 4AE1A 3UTOA 2FR4A 3PDOA 1S7VA 3T4AC 1MAMH 3V4VL 4PLKD 2WLIA 5LAPA 2YD7A 5AENA 4XO3A 4OZFB 2FEEI 1MH5A 3S5LA 3H53A 2QDVA 2Z4TA 4N90D 5ADPH 5IFHL 1XF4B 3HVDA 4ZD3L 1RZJC 2NY1B 4LP4A 1EZVX 4N0YH 2YUWA 5EEYA 3OGCA 1CXLA 1GYAA 2FWLB 3ZZQA 4UT9H 1UA7A 3BFQG 2XKNB 3HMWL 4M29A 2PO6A 3FB8A 2APTA 2J4WH 4KDTC 4BBWA 4H1LB 1NBYB 3HUJE 5GS0D 3ARFD 3BPNB 5EU6A 2FSEB 4JFQA 4JE0A 2OMYA 1ROCA 3QWQB 3MUZ1 1TJGH 1DVFC 4PWJA 4B3VA 4PEEA 1RVFH 4K5MA 3FHEA 4GG8B 3KM2A 2JIXA 2IH3B 5FFGA 4HVBA 1NCCH 2BRRL 3D0LA 4UINL 1T20A 1KT2B 4L37A 1PY0A 1WT5A 3H2PA 3VH8G 3NFPB 4TKWA 4EE2A 1TVHB 4N22A 4OZGE 4H40A 4D0CA 3VE0A 5E23A 1LJMA 2WJ5A 4H4NA 4UIKL 3WNOA 2D2OA 3EW3B 3LEYH 5L9DH 2DQCH 3G6JF 2QMJA 2QJDA 4I88A 1E3ZA 3BPCA 4GRWH 4XOEA 1HXKA 3E9UA 2H6PA 4JFFA 3NDYE 1E4HA 3IMSA 3MRGB 1ZLSL 3TA3D 3LSOA 3PHSA 4RISH 5IEKB 1LEGA 3MUGB 1P7KA 4IQHA 4N5EC 5E8PA 5B1JA 5ELIA 3OQRA 4HP5A 3V2AR 2IV9A 3N0AA 1WWWX 2AXGB 1ZLWK 3GF8A 1HZKA 1CR9L 3DPDA 3BVNB 4X0KA 3RY6A 1HZLA 5IVNA 4K3EH 2HVJA 4QRQB 5L7XH 1J87A 4A2EA 4PJFF 4Y1AA 43C9A 4A2LA 2ADGA 1RI8A 2EAEA 3ROLA 3HHSA 1INEH 1ZHLA 3BUTA 1F4AA 4YXLL 4HX1A 2FECL 3M17A 5EFIB 2IALA 1U92A 5M94B 1J1OL 1MFCH 3PP4H 5KSAD 1FNHA 4FZEH 3UEZA 5B38A 3KYNB 2FWOB 1MF2L 2YMXL 5CKGA 1XB8A 1DN0A 1BBDH 4XPHH 2FECI 5CJOL 1P9MA 4OZHA 1H3GA 3TJHD 5ES4B 4EVNB 4FTVD 1CFNB 1ES0A 1MXGA 3FQWB 3S88H 1M7IB 1VRSA 3VRIB 4NHUA 1NKOA 1I8LC 3ES6B 4PJ7B 1A6AA 4Q52A 1JXKA 3S8GB 3N1QC 3VXSD 2P7TB 4Y4KA 5DR5L 2NNRA 1A4JA 1UT1A 4ZMWA 5GRVK 1WAEA 2D2CC 4M8QA 4M9PA 3WNPA 5F6IC 3WUZA 2N0MA 1Q94B 1E4KA 4KTYA 3UADA 5B3JF 4FFWC 4J12A 1HL5A 3C08L 1YEEH 2EABA 2OLDA 2WLNA 1U8LB 3IYLW 3BT0A 5EPMB 5FW8A 1KN2H 3N04A 1P5UA 2HVJB 5KVEL 3WIIH 2WSPA 3DDGA 3LNEA 5D1ZI 1JBJA 2C3HA 5I0XA 3L08A 3WJJC 2BSBA 1X5JA 2E6PA 43C9B 5ADOH 4L2LA 4K23L 3GBDA 2UY7A 3AXLB 1H8OA 4HYTB 1NM9A 4I77H 5A2CA 1MQKH 5HVHC 1AD0B 3LDBB 2B2XH 3CLFL 4A7VA 2Z8RA 1Q38A 4ZDHB 3DHJA 3G6DL 3QIBD 4CSZA 1S5HB 2CUMA 3IT8D 2BVEA 3UPCA 4KZCA 1E4WL 4R4BB 4NSKB 1JS4A 3ARDA 4G71B 4XXDA 2EXSA 1FAKT 5ESVB 2NY6B 3DSNA 1DSWA 1E42A 2AQTA 4TYUA 4U6HA 4UM9D 4R3SA 1WIUA 3GEWB 5DCCA 1B4JL 4UQBA 1E7UA 1CFNA 4Z23A 3IXAB 1X5YA 4YR6B 1QA9B 3RHWK 4KI5D 1GGBL 3MBWA 5HVGB 5KJRH 1J7VR 1EJOH 3PWPA 3KVQA 1CE6A 1RL1A 3G5WA 3RTQC 3TT1H 1GGIH 2DEWX 1OTSC 3ZE2F 3BGFC 1Q1JH 2NR6C 4JB9H 2UY6B 3H42H 5F7HA 1DBBL 2PR4L 2IAMA 1UTDA 5HVFB 2OXHA 5FCUL 3V6OC 3TS8A 3HIZA 3FQUB 3RTQD 1N64L 2RFXB 3MRLB 4OCLC 3V4UH 3RVUC 4X7FC 4NZJA 2G3XA 3US9A 1QVOA 4HOZA 4L18A 3G5YB 4HJ0D 1PFCA 4AT6A 3PRZA 3NIFB 1H6FA 1PGRB 1MH5B 1KIUB 1T21B 3ABZA 1GOGA 3ULUH 3F6LA 5CU9A 1JK8A 2CJSA 4FQLL 1T04A 4IHOB 3NPSC 1G7IB 1T89C 3LMJL 5B7FA 3FSAA 2ZXBA 5AZ2H 1WBZA 3AQXA 4LDOB 2A73A 2EIZB 2YWYA 2YJQA 3QYCA 5EU7E 2C3VA 2FBOJ 4BM7A 4JQXC 3H0TB 3QDJD 4EJ1C 1IO4C 2SEBB 3JWOH 4NAQA 3E2HC 1YRKA 1BM7A 4L8DB 1J1XH 2E8ZA 3BWUF 3MROA 3IU3A 4XXWC 4LSQH 3O11A 1NWPA 1A6VL 1KOAA 3HPJA 3KEHA 3CU7A 4FULA 4QHUB 5IESL 1NAML 1L9MA 1MI5D 1ICTA 4M6AA 1KBGL 4UQ3A 4K3DH 3OZLA 3OB0H 3UX9B 4F91B 1HC1A 4JFEA 3VFPB 2J6EH 5BZWB 3LB6C 4NBZB 1FRGL 1EFQA 4HDIA 1IGMH 3FO2B 4WHYG 3QIWD 3OXRA 4NGHL 4XWGH 5MP6H 4R7XA 4PJFB 4DVRH 1B4TA 1YLBB 3QXTA 4XE5B 3VXPA 1G7JB 2DLFH 2AK4E 3U36B 3RZCB 3ULVC 4HAFA 5IJKC 1KBPA 2RD0A 4DEPC 4UQAA 4K8RL 1UADC 1UVQA 2UVFA 2CPCA 5ECJE 3EXJA 1JYVA 4H0GA 2OK0H 2VXSL 1B4RA 2ADJA 4ODWA 1QRKA 3UZEC 5IVZB 4N86A 1RUAH 1QYGH 4GKNA 3X3GL 1M7DB 1IC5H 3HR5A 4U1SA 3SPIA 1P7QA 2N1KA 1I7TA 2DWTA 5T5NF 1TZGH 3MSPA 2JLLA 1AGEB 4CUCA 4G8FA 1L6XA 1F58H 4MJ2A 1IJ9A 1MJJA 4JN2B 4ZODA 3U2SB 3DX8B 2DQFB 4M7ZC 2X0UA 3W9DA 4PRDB 1LMKA 1YHPA 1LDPH 2E27L 1TETL 3BD3A 4OGYH 4NRYB 1QLRB 3TASA 4ZO9A 2IAAC 3ZTCC 2GAZB 2XRAH 3D85B 2FJSA 4XBPA 1U8JB 4BEIA 3V9EA 3VQ1C 3CN4A 1EA9C 5D7SH 5HHVL 1ZOXA 4XMTA 2G2NA 4J3VA 5GRJH 5CR8A 3KVPA 2XG4A 4L8SA 5F72S 4FF9A 5DQDH 1DYZA 1CBVL 5D4QA 1NAKH 3D12B 3RIAK 3WTXA 5H2BA 3B7TA 2R7EB 1Z9LA 2R2HB 1AYRA 1JGLL 1P4LB 2OMWB 1E4XH 3MJ6A 3TIDB 4NNYA 4OAWB 1MAJA 4KX7A 2AXFB 4ZMLA 2YPLA 1KBVA 1BD2E 4UU9B 3T77B 4QHLB 3VGEA 1FA4A 3G9AB 2WSKA 2AEPL 3Q2NA 1FE8L 1CF8H 2HCZX 1KCVL 5E6ZA 1H5BA 3L17A 1X9QA 3TF4A 2APFA 4TNWK 3T0VA 3SKOA 1DVFD 2MMXA 4J6IA 3S35X 3STBA 1IM3D 3VXRB 3WIHA 1AIFA 4JVPA 5FW7A 3OG4B 4Q9QH 5KYUB 1TIUA 3A47A 5F1IA 3EH1A 4X8JB 4DCQA 4NNXB 1PJWA 1RPQA 2NY3B 3L5WB 2WXKA 1NGYB 4MQXD 2WVSA 1V7MH 2HP4A 1AHKA 2J4WL 4Y5VB 4DZBA 3IFLH 3JTTB 5HHOA 2IAMB 4QUOA 5DJ6A 2P5EA 2FB4L 3ZTNL 4IRSD 1T83C 3D2TA 3BGMB 1QO3A 4H5SA 1N0XH 1IFHH 4IS6B 4LMQE 2I9LA 2IBZX 3ZT6A 4K2UL 1TVBB 1G1YA 2CRMA 1Y18A 3IJYA 4LLVB 1SVZA 4M8VA 4J3WA 4E9YA 1XMWA 1CD1A 5D7HA 1CD0A 3FT3B 4G8GD 1QSFA 4UIKH 1E5BA 2X53A 1MELA 3UTQB 3ILQD 2DIJA 2WOYA 1GZHC 1Q9LA 4POUB 2HTKC 4AQAB 1ZCRA 2ZPKL 1IBYA 2FATH 1S7SA 2BZ7A 4KKNA 4G6AC 4PJCF 4WEMB 5EN3A 2X2IA 1AZUA 4KI5F 4B7IA 3MAWA 5FEBA 3N1GC 3WFEH 1TZIA 3INUH 3LTVA 2DMKA 4ZTEA 1CURA 1DQQB 2H3XC 2JKSA 3HC0A 2DDQH 2R27A 4W81A 2VE6B 3S34L 2VNCA 1RZKC 4OCXH 3ZKXC 5B38G 3BUBA 2IMMA 5B1AB 1ZRUA 1RPKA 3N55A 3OHMB 3PXHA 4G43B 4P99A 5CM1A 1INEL 1PW3A 4X6CF 4K9EH 3APCA 4PVBA 1WA1X 4ATWA 1AOZA 1A9BB 1WAAE 1RQ5A 1XGZA 2AZUA 2RJMA 5DJDB 3P4OB 2X6MA 5JA9A 5E5RB 5IQNA 2HVBA 1OAYH 1AQ8A 1XIWD 5HDBB 3WFBH 4LSSL 4WUUB 4OBRA 4XVTL 3P9WB 2AERT 2R2BB 4OJAA 2AV1A 3O2DA 3DPBB 3T2NL 2MHAA 3ARTA 4R7VA 3SGJA 5B8CB 4XC1H 3BRDA 5KZCD 4JO3H 4FRWA 4NT6A 3VM7A 1YEGH 4ODXB 4CADB 4YHZH 4F37F 4RGND 1EEYB 4AZUA 4B96A 4JHWH 5TQ0L 5MEPA 3I3BA 2BNQB 4GKZB 2J1WA 2YD6A 3H54A 2WKOF 5D9SB 3X13B 2Y0SA 3KNBB 3QZWG 1ZT4A 3VW3L 1F02I 1VKXB 5IEHB 3T1WA 3RX7A 2VM4A 1W8EA 2IG2H 1UEMA 1GJWA 1NGXA 1QHPA 4ZSOB 1IAKA 2HH0L 2JI3A 3MCLH 4PSPA 3SDXA 1FO0A 2IGFH 2J2ZA 4FP8L 5KBNC 2NW2A 1L0QA 3Q6GL 4PREB 1YZZA 1KEGL 3CV5A 1HEHC 3ZMEA 2FJHA 1AQHA 1QSFB 5D7KE 4AL8L 1TMQA 1JVLA 1RJLA 3REVB 3O2VL 1J10A 4R7DA 5DC0A 4JG1H 1Y18B 4LLVA 1N18A 2DQMA 4YL9A 3IS1X 3OHXA 3N41F 3R8BB 4PB9L 4K73A 2X6CA 4Y1AD 1KDIA 4YNYA 1QO3B 4H5SB 5ENWA 4E9QA 4O02A 4XX1E 1BIIA 5TFSL 3T09A 3LKQA 4MXQC 3ZHKA 1E43A 1ED3A 5FXCH 1JIBA 3L5HA 5I8CA 3DXAB 3GHPA 1OB0A 2HX8A 4YFDB 2E7LC 4YSEA 4FI8A 2X4QA 3EBGA 3MJ9L 4YO0B 5TDPB 3ZRCC 3IE4A 3AG4B 5D72H 3G04B 4GO8A 5DLMH 3TIDA 5KYWA 4JFUA 2Q8BL 1HSBA 3RILA 4GG8A 4HWEH 1A1NB 4HSAC 2OCCB 1HKLH 4RAUB 4W6YB 3CDGA 2JE8A 2YRLA 5IGXH 1PDKA 2HTLC 1HHJA 2MEJB 2EDXA 3TPKA 5BO1H 1IBZA 1PY4A 2BCMA 4TTGA 1W0WB 3WS6C 3QZPA 1Q9LB 5I0YA 1JNHA 3P73A 4M1CC 2QADC 3RGVB 3L3HB 2F54A 2ZX8A 3KBFA 2DQTL 4DEUA 5FS5A 1U8OB 2TSBA 5AW7B 2WXJA 3LXCA 3U30C 1HQRA 3I6KA 4BCZA 1PVHA 3LKNB 4P4KC 1MRCH 4Z3JA 4TSCL 1IMHC 4LBEB 4Y2NA 3U9WA 4N2MA 4U7KA 3MR9A 3KL5A 4N28A 3QIUB 3SBQA 1MFAL 4PWFA 1K4CA 4W4OA 5IBLD 1XD1A 2JKJA 4MHHI 4ORZC 4ELME 2P44B 2XZCL 4X8JA 3EOYG 4MNQB 4DCQB 4Z7VF 5IV2A 4PN6A 4R5XA 3T0DA 3N3EA 2QSTA 2EH7H 2CO1A 1YN7B 4IOFD 2VQ1A 1S3KH 4JMNA 4N2HA 4Y5VA 2DAVA 5F0JB 3V6FA 3BE1L 2KT6A 3QDJB 1LTXA 3RPIB 3K1KC 5IFAL 2N3JA 4WK2B 2IXQA 3F62A 3ZYIA 1ZIBA 3N0PB 1KFAH 4F7KA 5IWLA 2PW1A 1YY9D 2OQJB 2PTVA 2J44A 5JW3L 3RBGA 2IDTA 3VX1A 1FYTB 5FKPB 5E0FA 2GBVA 4NNPL 2O5YH 5CZVH 3L3JA 4GIAA 3PNWA 3KE0A 5C08B 3IKCA 4JFVA 3FU6A 3BZ4A 3ECQA 3SY0A 1MVFA 1UYWL 3PG2A 4J3TA 4PS7A 3EJSA 4JDVA 4JZOB 3VGHA 3VXMB 1ECYA 3GSXA 2E0PA 2CIKA 4YHNA 4EIZC 2XPZA 4L9LC 3EO1B 2IDQA 4PRPB 4W6XB 5BZWA 5I18H 2WBJC 3MLVL 3PIQB 1RUKH 4Q4EA 5TH2A 3FU7B 3IETB 3EKCA 3FUKA 4UQ3B 1ECZA 2ICWB 1BZ9A 1A65A 5F3FA 3SE8L 1OGTA 4I77L 5FOBB 4L3CA 3BPNC 3PV6A 3EJZD 1KEML 5C09E 1YYCA 4U1JB 3PE9A 1HHIA 3DI3B 1IC7H 3DMMC 2QQLH 3MBXL 4QTHB 1S9KC 4P3DA 4AEFA 3EOTL 1LM8V 3QUKA 4QY8A 5EF1A 2ESVE 3JWOC 3WO4C 4Y9EA 4ZAKD 4KVNH 1YECH 3QNXB 1WPCA 3OJ2C 3QDME 1W9XA 2KPWA 3SGDI 4GRLA 4IBZA 4DSYA 2A83B 2WNWA 4IU3A 2R83A 2FGWL 3S4SA 3VQLA 3B9KC 1IT9H 4Z7NF 1VFMA 1KCSH 2OXHB 1DJYA 4ZMVA 2YO3A 4LCIH 1VPOH 5E6SB 1WG3A 1JK8B 3SQBA 2CDEB 1XEDA 3ALXA 2R1YA 2W38A 4LIQL 3V4LA 1BX2A 3G5YA 3KG5A 5ICZB 3NAAL 5GGUA 3QRBA 1DCEA 3N41B 3ILDA 3OKEB 4QHLA 5FCUH 1IAII 5JIIA 1TTBA 2JB5H 2K8MA 3WOVA 2XXFA 1BMZA 4XN5A 4ZOBA 1U3HC 3N43B 4NRYA 1NKRA 4GO6B 5GZNA 2DWYA 2H1XA 2I9TB 1KTRL 2F1BA 3KYOB 1EHLH 2IADA 1ZKAA 4OM1L 1QQDB 4KJWC 5D5ME 4TPRH 3ZHDA 1KENH 4QWWD 3DC0A 1JL8A 4M02A 1FVCA 1A6UL 4JKLA 5ACMA 3T0WA 5IMLB 1SEBB 2YKLH 3H4HA 3IKKA 3BIAX 1UXSA 3C60B 3LNHA 2BSED 4Q74A 2Z8VC 5F21B 3O6MH 4D7PA 3AB0C 3HLKA 1QMUA 4GO9A 3CHXA 1NFIA 1GR7A 5EB9A 4ZYKB 5EOCH 1F1DA 3CAFA 1TYEB 3ARVA 2WIIA 3EYSL 5J56B 1A7QH 2KDGA 5K9QG 2AI0H 3DX8A 3LV3A 5SWSE 2JQZA 4ZUTA 4CVWA 5JLZA 4ZO6A 1SNRA 4WFEE 4ZJ9A 2HKHH 2Y24A 7PCYA 2K3HA 2VRQA 3ZDZF 1DDHA 5JW4M 4PJBB 4PJFA 4ODUB 4P05A 1ZLUK 3O4LA 2AJYL 4Y16D 1JRHH 5AAWA 2EZ0D 4R96A 4XMLH 4AT6B 3FUFA 4I3SL 4XNYL 2APBA 4MNGB 4PJXE 1Z66A 5BS0E 1T1YA 1CIUA 1F13A 5DZJA 3H9ZA 5HXMA 5IUSA 4RAVB 1IUZA 3VWJA 3PWLA 4GAYA 3TBTB 5I1LA 2PW2B 3X17A 4Y16C 3KXFD 3Q1EA 1QFWL 5GS2H 1INDL 1PLAA 2PP9A 1MLCB 3CQPA 3JT2A 4AQZA 4LLUA 1A8JH 1QTYT 3GS7A 5J13B 2L0DA 3MV7D 2O5ZH 3WFDL 4AG4L 1S78C 4RWYH 3ARXA 3FBQA 2F0CA 1H6TA 1MCHA 2MJWA 1EAQA 2GG1A 4S2SA 4X80L 4YDMA 1UCBH 3GXFA 1RUAL 2H6OA 2JCCE 3O3DA 1A9VA 1A0QL 4A39A 5C9JA 1KLUB 2GJ6A 2WV3A 4JFZH 5E9DB 4Z76B 1MW2A 4Z0XA 5GIRA 1OP3H 4BK5C 3PL6D 2XCMC 4OQTA 3PUCA 3Q8AA 4Z7UF 4C4KO 3SPGA 4DP9X 1CCZA 3HMXA 4EMZA 5JORA 4ELDA 1NEZA 4HGKC 2DTMH 3O41A 4LQFL 3V0WL 4ZDHA 3A24A 4P49A 5EZJB 5GGTH 1ZXQA 4PS4L 4ENEC 2QGEA 3BZ4B 5KZCB 4RBPK 3UYPB 2C9XA 4KHTL 4X6CB 5DI8B 1KPVB 4KKLD 3CCHB 3L9BA 5B39A 4GRWF 2X0VA 2WB7A 1DE4A 3LVTA 3QZWB 3EBIA 1YJDL 3WY4A 1I7UA 2IPTH 1GZPB 2IBBA 4FYRA 1OCWH 4FQQB 4F7TA 1I3GL 1QUNB 1FORH 4TL5A 2ZONA 3RY6C 4BK5A 3MZTA 4ESKA 3VXSA 3CVHH 1RIUH 1ZHBA 2O61A 4WTXA 5AAWC 5JHDB 2HH0H 1JZHA 2IH3A 3K2KA 3NTCL 4PJ9D 3Q6GH 1WFIA 4LEXL 4XVJL 4FYTA 5KSVB 1SM3L 1HH6A 4QHKI 1Z7JA 4M5TA 3IFNL 5HDQL 2ESVD 3O2VH 3DRQA 3AT0A 5HJ3B 3BCDA 3ISYA 4K94L 3FQNB 3ARDB 5D2LB 2WY3B 5E94B 2BSEA 4WFHE 3IM1A 2XIBA 5D1XE 4AW7A 2QPFA 3ZIMA 4NX0A 5HI5D 2FEJA 3RWCB 3PWNB 3PHQB 1QI3A 3QPKA 2ADGB 5GJTL 4Y1AB 4ZNEA 2BS8A 4HFUH 2VABA 4YDLB 3ARFB 2EDNA 1KJVA 5GGQL 1AG0A 4Q9RL 1NPJA 3DSNB 4U6HB 4LCCA 3LD8C 4P2OC 4GT7A 4M48L 5T3XD 1I7RB 3TN0D 3V4PA 1A9EA 25C8L 1K3IA 2CAKA 2D73A 2JKWA 4PVNA 4FQXA 1P4UA 2W9EL 1XB3A 1JAEA 1RZJH 2X42A 5G5DA 4RNRB 5IHZA 2WZ6A 1J5OL 4G6MH 2PWHA 1A7RL 2FX7L 2VLRB 3D1MC 5KSUA 3VCLA 3W0WB 2Z3FA 5DRWB 2HTKD 2YAOA 5ERWA 3OAUH 3TA3A 5CINL 3P0YH 1TZAA 3FFCB 2NUTA 3HE7A 2H0FA 4XP6L 1ETA1 4OTXH 3SKMA 1O9VA 3NDZE 3U48A 2A9NL 4HXAL 2CH8A 1BXVA 1KIQB 1MNUH 4JREC 3QWOA 4IEFB 3MLTB 5E8NB 1U8CA 1A5FH 3HLAB 2EEFA 4I3GA 1JHLL 4ADGA 4HC1H 3WE6A 1FGNL 2VUKA 3CFJB 1OAUH 2XXGA 2B08A 3LKSA 4HPYH 5F7BA 2QSVA 4GKOA 4XZ4A 4M7LL 3PP3H 4L4TE 5TDNA 4EIBA 1OHQA 1HH6B 3QWNA 5CGYD 1NSNH 2NYYC 3H3PL 1XTLA 1DQMH 3D69A 4HKBB 1JMZA 4ANUA 2DBLL 3L4XA 5JHDA 5KSAB 4F2ME 4F5CA 3TV3L 1U4FA 5DDHA 4LSPL 4AQEA 4TUKL 3IDNB 2PYFA 4WSKA 3B2VH 2UXFA 5I6XB 2CK2A 3BO8A 5D2NB 4HHWA 1SDDA 4A2HA 4TVPL 1TTUA 2KL6A 5I6XC 1JPGA 4BXSV 2ZXEB 3O6KL 5TQ0H 4GLRH 4QTIH 2OBGA 4X9FA 1MWAL 5DYFA 1VA9A 4U1IA 4JRXA 4IBSA 2WQXA 4YZWA 5CP3H 3DUSA 3PJLA 4X4ME 1IBFA 1DUYB 3VD9A 3BZEA 1BFSA 2CA3A 2IIJA 3S36L 5CP3A 5L2JB 3ENEA 5HYIA 1EQWA 5EEXA 3KPNB 2E9GA 4Y1TA 4LQ1A 4Y4HA 1PMYA 4LASL 4CVXA 3RIFK 1KEGH 5I8KL 1L0PA 3HZMA 3WTTA 3ZTEA 2KZBA 4PRPD 5JOPD 2ICEA 2Y6SC 4NZUL 1OL0A 4Y9FA 4LARL 4U1NA 1SPDA 2FO1A 4BWWA 4D9QE 4Y5VC 1E4XI 4C56B 4ZXBB 2QLVB 3JTSB 4JFXA 1UA3A 1S2EA 1I3RA 2J1XA 4R84A 3HW7A 2X1PA 5AVTB 2VISA 3MLRH 2YJLA 3B5GA 4KUZH 1DQIA 3VXMA 3O9WB 2AQ1A 2ZYSA 3EOBB 4TUUA 5CEYB 1M42A 3RWIA 3NSCA 2NY6D 4UM9B 1X7QB 3C8DA 3VFNB 4A66A 4BUQA 1C9SA 3D34A 1NBVH 4H1LA 3W5MA 2R56L 4N85A 5IWLC 4OZHF 5CHNA 3AM8C 1QLRA 3P77A 4P57A 4DN3L 3WKNA 3M07A 2ENQA 2A9ML 4AKOA 4OGAD 3SB3A 2Z6FA 4S0HA 1RULL 4LVHB 1BJ1J 3SDYH 3WS6A 1YMHA 1DLFL 2HT2C 1BQRA 4JLRB 2HLEB 2FLRT 3SE3A 2JKTM 4A7SA 4HW6A 3WJLA 3QEGH 4ICXA 4IS6A 3QQ3A 1B2WH 4NQDE 1C16B 1FHNA 2B1AH 3VYNA 1I4FA 1KXQA 1LK3H 4DP7X 4Y0GA 2OTPA 2FT6A 4AQ1C 3ZL4H 3RUGA 1JGEA 2DQTH 4BRVA 4HFWB 2DM4A 1LO0H 4M62L 2Z0UA 5LBSA 5DSCA 4PJAB 5JNYB 5F93C 3BH9A 3HAEH 3KCPB 2K6ZA 4P46C 3C12A 3K4AA 4UT9A 5I6PA 2ENPA 4C8XA 2GUOB 5IQ9A 2AQSA 3OMIB 4MMZC 1Z9PA 4W9JC 4TVUA 4CU7A 2UZYA 4TS6A 4NN7B 4QCIA 4LVNB 4HLZH 4JFEB 12E8H 4QIRA 4LGRB 1MAML 3V4VH 5IHBA 1RY7B 4LE8A 2W65B 2H41A 1K4DB 4DGUA 2DLEA 4UIMB 5HHQA 5I16A 3UDWC 1IEHA 1CXHA 3TWCH 2VCOA 2CHZA 5J5EA 3ALWA 3DTDA 4RFOH 5FM8A 4HUWB 1S7QA 1UM4L 4AYGA 3PQYB 2C9SA 4KDWA 2FX8H 1UGNA 3PJSA 3CFEA 3A23A 1JRHL 4K7FB 4ZXBA 2R9HC 2XSKA 4XNYH 3RVUD 1N8OE 2VLKA 3B5TA 1X7SA 1QW8A 4PRPE 4FHBD 4FFZH 3NJGA 1HOEA 1ILUA 2KLTA 5I1DA 2WXQA 3GHBH 3QH3B 3II3A 2Z31B 4M1GL 2VMFA 1VFAA 4DOHE 4FLOA 1YEDA 3ZTDC 3IJ7A 5D7LD 4U3SB 4P5MB 3B6SB 2JB6B 4WGWB 1UFGA 1ZA3A 1J1OH 1E4JA 3FTXA 5F9JB 4K71C 4XN9A 4QOKE 5I30H 4Y4HD 2KZKA 4BWUA 4HHAB 5E8OA 2C3XA 1F3JB 4ETYA 3QC5X 1G6VK 1CLCA 3ARUA 4Y5XA 2E3VA 2YEZB 4NI6A 2EXWC 1OAJA 2XFGB 3OKNB 4NFDA 4JJOA 4H0IA 4MCYB 2Y7QB 2WHVA 5CZXD 3V8CA 1BYOA 1F11A 1VDGA 3W11C 1T0OA 1NQBA 4I9WE 2P5EE 4ZK8A 1N26A 1BZDA 1KGXA 3GKZA 2CXKA 4KKCD 3P40A 3T5WA 1UQSB 1WJ3A 3OAYK 4EUPH 3RWIB 1OGPA 3K8LA 2EJ1A 4X9BA 3G9VA 3IMWA 4G8EB 5I76B 1BQSA 5KSAA 3K80A 4NO5A 3P4NB 4WJ5A 5KVDH 1R0AL 5D9SA 2VZVA 2HLFC 5KYYA 4QRFA 1DQKA 5GGTL 4P3CH 4YK4C 1JGIA 4KK9D 5JW4N 3TH3T 3LRLA 1IT9L 5AOZA 4Y7MA 3WNJA 4G7VL 4RLDA 3VFOA 3BHBA 4IM8A 4LCIL 5C0FA 3B9AA 1OK0A 4ODBD 3NSYA 4XGZA 3GJEA 3FMGH 2G2PA 3KPRA 2A4ZA 2W07A 2VR9A 3LPPA 5JIHA 3WIFB 4CVXB 3GUTB 5SWZE 2G9HB 2DYSB 3I75B 1XF3A 2BX5A 3CZJA 4HUNB 3CDCA 3ESMA 2X1WL 4KNTA 4LEXH 5A7EA 4IOSA 2BP0B 2NXZD 3MMEA 1G87A 3DRTA 1BF2A 2BHZA 5M7QA 2VN5A 3R4DA 1QFWM 5EZLA 3B9KD 5EPMA 4HIJB 4FG6C 5IB3B 2PABA 3RUGE 1IIKA 1S9YB 1BFTA 3EFFB 1F56A 2YKLL 3F7KA 2JJTA 5AVSB 3MRFA 5TPWH 4JRYA 4XE0A 1F4YH 3MRJA 4MDJA 4P2QE 4TF4A 1S7WA 2ERJB 2HG5B 4YE0A 5D2LA 4PJ7E 2D3NA 4QO1B 2WKOA 3HC4H 4WK4B 1GMIA 6FABL 1UXMA 4IJTA 3EH5B 1FNGB 2Q3ZA 1MHCB 5L9DL 4UM9A 1BG1A 1BQHA 2HA1A 3CFQA 1H5BC 1UFUA 4XTRD 5C0DA 5JUEH 4RMTA 3BMWA 3CDGB 4XAWH 1NCBL 3BAEL 3SGEH 2YD8A 1S9WA 4RISL 2JMRA 2NY5C 2ZAHA 3GBNL 2XBZA 1S46A 1XCTA 1MVUB 4U6YA 2WBJD 4GKLA 3GSNL 4R26L 2NNAA 5EZIH 1NA8A 1WGOA 3ETBF 3HJ0A 1U8KB 3PWJA 4HJIA 1YMMA 1I7ZB 4OW6A 4RFNB 3MNWA 3MYJA 5DEJA 4F8PA 2HZHA 1KGIA 4AH2A 2GCYA 4L8SC 5AVXB 2XXMB 3NSXA 4XP6H 3CSYA 5DI8A 4DO5A 4Z7OE 3AAZB 5DZLA 4CA4A 4YSAA 3WY2A 1Y0LB 5HYQB 1XBRA 5IMKB 4EDXB 2ED6A 1QFWH 1OXYA 2P80D 5JDSB 1YNKH 1HL9A 4TQEL 3O45B 2BRQA 3T08A 2C7UB 3ZR5A 3S35L 4YLQT 4NSKA 1PEWA 4N0RA 3D39B 4K5NA 2WZPD 1E5CA 1KTCA 3X1BA 4OQTH 5EUOA 4V11A 1NLBL 3U7AA 4JB9L 3CG8A 5EMYA 2WXNA 5B39B 5FYKU 3HZKA 3U46B 2AEQH 4GKSB 4U7MA 4LXFA 1CO1A 3WXVH 1KBGH 2LW3A 3MFFB 3MLUH 2WP3T 1GIGL 2AXFA 4TQ8A 2NZ1A 3IRZA 2RHEA 4FFVD 4KY1H 3IPFA 3UZEA 2R4SL 2L7UA 3BDYH 3GXUB 4HIEB 1OKEA 5E6IC 5I2IB 5DD0L 4U6YB 5C0CE 3LRSA 5INDA 3TZVD 1KELH 5E51A 5C6TL 4HAGA 1HXYB 3P2BA 4FG4A 4GXUN 4K8RH 3AWGA 4U4BA 1IGIH 2UYLB 1WA0X 5E9DA 4EN3B 1F4WH 3SGEI 3OSVA 3MV01 2OTWA 3LMJH 3I85A 1YO4A 2P5WB 3PHOB 4BQ8A 1D5IH 1QFUL 4DVBA 3L5IA 2BCKA 2X4SA 2ENSA 4JE4B 4IIQB 3D3VE 1EPFA 2BWIA 5LXVA 4GAFB 3NABL 3K6SB 4FLSA 2YMXH 4IIQC 2FBJL 4JPIA 4IRJA 4HHGA 1F86A 2BK8A 5HJDA 3EFFA 1YPZF 1HXMB 1SM3H 4TQHA 4Y19A 3VSVA 3FFDA 5I19L 3S37H 1U30A 4GW5B 2Z8SA 3QZWA 2EO7A 1CT8B 3EYOA 5F6HJ 3NCJL 1L7TL 2YPVL 3EYFA 4AZ8B 4W9ZA 3Q5OA 3U1SL 4YBHA 3ZDYB 3WS3A 3WENA 2MH4A 2YEZA 1T7ZA 3C5ZB 2JJWA 3FQ4A 3HG0A 1DQTA 2WWMC 2DJUA 3MOAL 4L1DA 3L48A 4ZOEA 4XBEL 3IGAA 3V4PH 3T0EA 2V2TA 1HHHB 3NG5A 3GSOB 3QORC 1X9UA 5A2AA 3O9WD 1I7UB 4HIXH 4UT6H 3MO1A 1Q9KB 4P9MH 4XXCC 1LYQA 1OGSA 3DBSA 4HU2A 1J9SA 5JDSA 3VFMB 4JDEA 3F7VA 4Y16B 1HTYA 3V5KB 4YWGH 1CXIA 4WFED 4ERSH 1CMOA 1CL7L 2C3GA 2V4LA 4K23H 2LE9A 4NC1C 3V4UL 1IC5L 1PZAA 1RCYA 4B60A 4PLJC 5FLVA 5E6IA 5AKSA 3DK2A 1SEBA 5BNXD 3G6DH 5MHSD 4RBPH 1WZ1L 3KPRE 3K8MA 3QAQA 4MLSA 5CZXC 2ID5A 3UTSD 3CC1A 3MRDA 2XTLA 1ZVYA 2FQDA 3B1UA 5ILTL 5CP7B 1T89A 4P2RE 2A1WL 4KJPD 2NY0C 5BXFA 3F85A 1P4BH 3FFOA 4WHTA 1CDJA 1HCYA 1N5AA 4PJ6A 2WSDA 3QI9C 5IMOA 2LU3A 4W9EC 4DIXA 5LB1A 3EG9A 1EDHA 4HUMB 3T6QC 1AR1C 4GBXC 4NNXA 4X9HA 5MENB 5IHWA 2FB4H 3QI9B 3LPWA 2YGVA 1J8SA 4QT5B 3ULUC 1S7WB 3QEHB 2QKIA 5MEQA 1WCBB 4QAWA 3PL6B 4GQPH 3CVHB 5LGHH 2ZXCA 5I1LB 1LE5B 1H5BB 3AWEA 3GRWH 1D7FA 3QORA 3FL7A 2O4EA 3F84A 4U1JA 5DF0A 1IBDA 2ZUUA 4LZKA 1V27A 3KGTA 4ZPVB 4RA3A 2DBLH 5KN5A 2F7IA 2Y7NA 3LQAL 1WBYB 1XD0A 5T1MB 2Z91B 1NMCC 1XH1A 4MS8D 3EHBD 4KZEH 2R0WL 3IDYB 4D94A 5DHVH 1XL6A 3C60C 4LLYB 1E9OB 5EU4A 3K6NA 3GZOA 2OL3L 3Q2VA 4FQLH 4WJKB 5HHNB 1HOCA 4H20H 1UD4A 3I74A 1IKNA 5D2LF 1SXBA 4WSJA 3SDDD 3MOBH 5DD5H 3K6FA 5HGBA 4OI9A 3VXUA 2E9JA 3GSVB 3ROOB 5AALA 1PZ3A 5D4JA 4UOZA 1AZBA 3ASOB 1IARB 2R59A 2J8UE 4NC0B 1YCSA 3A4EA 1AR2A 4OLWL 5EULV 4HUUA 2VW6A 4C56E 4Y88A 4YSCA 4J8RA 1TPXC 1F58L 1GYVA 4HJ0C 2H6UA 1ADQL 2CSPA 4Z3IA 1J0IA 2QV2A 3RVVC 4ANXA 3HS0B 2YA1A 4RZCA 4E9WA 1QP1A 1XXDC 1LDPL 4HIIA 4EI5D 5BQDA 5DD1H 2FJFA 4KGJA 3VFRB 5TK2A 5J9PB 1QPPA 2XPGA 3V0VB 1ET5A 3U7YL 2XUWA 2NTFA 4XMZA 4Q6YA 5IVXB 5E8OB 3IDJB 1NMBH 1XGQA 4QGTA 4X4XB 5IB2A 5TE6H 2MCMA 2HRHA 3PL6A 1NAKL 2W60B 5LNGA 5DD3L 3IAGC 1NGQH 2BDNL 4IMKC 2IQ9H 3N91A 4KTGA 3UBXI 1ASQA 1NBVL 3O3BA 4P2QA 4RH4A 1B0GA 5K9OB 3EO0A 5TF1H 1E6OL 4IKLA 2VDLH 5B1JC 3DHPA 2V17L 2XETA 2YC1B 2Z9TA 5F0PB 1FGVL 3FQWA 4BZ1L 1L6PA 5E70A 2BY2A 2PXYC 3RVVD 5BXFB 4PRNA 4K9EL 5I73C 2APXA 5ANMA 2DYPD 3HMXH 1RULH 4CBPA 5DR5H 3LIUA 5H37G 4WRLA 1UGKA 1T7YA 1S7TA 3RURA 3PQYA 3QFJD 3IJ8A 3B43A 3C08H 1D7DA 1WBYA 5T1MA 2WWNA 3TEUA 1UKTA 4JZNA 4PB0L 4I7ZC 1NEUA 1I1AC 2BP5M 1PG7X 2VDKB 3RFZB 2WZ0A 3KR3L 4TNVK 2PLTA 3DXAA 4JPKL 4MCZB 4P5TB 4RX4A 3V8OA 1CN4A 3FUJA 3MREB 4B9GA 4G9FB 1QLFA 2R1XA 5A40E 1HSAB 4LSRH 1KIUA 4NWTL 1WBXA 2Y7SA 3C60D 3FCBA 4OCYL 3LNGA 3PDDA 5GRXG 1U42A 4LB8A 2PCYA 4GRWB 2NT1A 3BPLB 4G72B 5HGAA 2FUQA 3GBML 3MJ8B 3MLTA 3WIHH 3BKYH 4N4YB 3OJDB 5C07E 3IDUA 5FDYA 2RIKA 1CT8A 4LDCA 4UOW1 2G75B 3BUPA 3WTYA 1MPAL 3MN8A 2DD8L 4AVHA 2Y72A 2E75C 3CIAA 1X6NA 3LS4L 2IOMA 3ZL1A 1U0QA 2ZYIA 5EDXA 5EA0L 1QNZH 1MLBB 2J2ZB 1MCKA 3SDXB 2LQRA 2IXQB 1TXKA 4R90H 4RGOL 5DJXA 1IAOA 2WXIA 3P4MA 4DP2X 1SXNA 1MCEA 2I69A 5GZOC 5CN3A 4NOBA 4AQEB 1Q1JL 2EVGA 1TJMA 1NCGA 3O8XB 4N8PA 1JZ4A 5F3HB 1TEFA 3S34H 4Y1AE 3T3PE 4B9FA 1P6AB 3KVDD 4YHYC 2ZG1A 4PCYA 5FKAB 1JRHI 5KUKA 3FZUC 1B3JA 4M93B 1FCCA 4QO1A 4KKBC 3KLHD 4NLHA 5DVKA 4LL9A 2CO7B 3GMOA 4H2AA 3BSZL 4NKMA 2XKNA 4P0DA 1K72A 4W70A 4NI3A 3OJMB 1MCLA 1AC6A 1AGCB 2EH7L 2NPLX 1P4IH 1VEOA 5BQ7B 2C1PA 4WW2A 3BLBA 4UDUA 3FT4B 3EYVA 1U8CB 1XAUA 1M1SA 2F2HA 2YGQA 2AK4D 3W0WE 3NJVA 4AQ1A 3WFHB 5IBTH 4R9HA 3ESPA 3GEFA 2DJMA 5L2KB 4FFTA 1D6EB 4G42A 4U6TA 2AJZA 1MSPA 3CDFA 5FM4A 4MRCA 2OQJA 3DX1A 2OZ4A 1R34A 3R0MA 4OFDA 1MI5E 2AV1B 1MY7A 4KPHH 4NKQB 2FHBA 4HC1A 3UG3A 1TTCA 3TJEL 5DHMC 3KPNA 4QPEA 1E9QB 4P2OD 2B3RA 1MJUH 2BERA 2Y6SD 1JFHA 1W0VB 4XNBA 2VMDA 2D0GA 5IW3A 3UBHA 3VGFA 3WTWA 1JPSL 4L3EA 4DKTA 3TN0A 2NNFA 5A16A 3DIDA 2YOAA 2IANE 4IHBA 1UA6H 4FFYH 4FQXD 5CJXA 3OMZA 3MODH 1MZYA 3FQ1A 5T3XH 2P52A 2PF6A 4LCVA 3ILQC 4XB8A 4B95C 2N56A 1OE1A 3F8UB 4PUBL 4G8EA 4K9JA 1HU8A 2EH8H 5C7ZA 1Q9WB 1T66D 1FO0B 1RP9A 1EGJH 1JPEA 3HHMA 4PGDA 4OLEA 1JZ2A 3P4MB 3GHEH 2WTOA 4PJGF 3O3AA 5EF3A 2CGRL 1QASA 1LDSA 2PXYD 3OXSB 4JO3L 3LN5B 1U8IA 3VI4E 4OR1A 5GXBB 3DOSA 3CH8A 4J3UA 4GMSH 3SE6A 1MIEL 1YDPA 3F58L 3H55A 1MJ8L 1ZV5A 4G2AA 3RY4A 4WHYH 2PPAA 2WTRB 2W95A 4HV8A 2EEXA 4X5RA 1UZ6E 4L4VB 4B9JA 1FWXA 5F1IB 2MHAB 2GK0B 3LPGA 3RTLA 5F6IB 1KIPA 2X3AA 2Y22A 4MMZA 2YN5A 5B21A 3BGMA 4R8WL 3SCMB 1E9QA 4LAQH 5BOZG 2D0HA 1MLCA 4X4XA 2IDUA 2G75A 3FTUA 1PX4A 5HHOB 4AL8H 1G0DA 4O02H 1AQKL 2DPKA 5BCAA 5A16B 3TN0B 4U1HA 2EEBA 2QZ5A 2CKNA 3NFPA 1N68A 4NQCD 2HN7A 5F1KC 3M45A 3L7FA 4JVWA 5EZIL 5DD6B 1XCWA 4M5YH 1P84K 2Z31D 3D6GA 1S9WB 5J3HD 3W0WD 3RNKA 1Y7VA 3GI8H 3AABA 4MX7B 2AK1L 2AJXH 4YE4L 2G5UA 3QSKB 4OQ1A 3FFCD 3BQVA 3GXPA 4WGKA 5CBAA 3ILEA 4M7JH 1T6BX 4XP1H 4C59B 1R47A 2FGWH 4JRXD 4IGBB 4NKMB 4APQA 1FV1B 2XWZA 3D33A 2X2UA 1P84J 5AW0B 2WIIB 2DMCA 3BDBA 1QHQA 5D7IB 1N3NB 5MEND 4NZDA 3KAAA 1E8XA 4M6OH 1G5GA 3OZKA 2ICWJ 2VUOA 1XH0A 5DJXB 3MNZB 3KLHC 5C3LD 3QR1A 5JDJA 3T04D 4Q89A 4OFPA 3TPUA 5FK9B 4YSOA 3WXVL 4BIKA 2C9QA 1RD6A 3ORJA 5H4YA 5IB4B 4KHXL 4FKHA 2VH5H 2J5WA 1NOFA 5E4EB 4KZEL 2VLKE 5KSVA 4FQ1L 4JQVA 1UASA 4PHXA 4YIQA 4ABUA 5D7JB 1KCLA 3UC0L 4FG6D 3FSOA 3TNNB 4E41E 1SDYA 2VLLB 3PAUA 2EUWA 1BXAA 4P2OA 5DGQA 3LVEA 4LCCC 1Z32X 3RBSA 4Z7QF 1TLMA 3ULVD 5IHUL 1K8IB 1F4HA 4L3EE 4UTBL 1XGPB 1DJXA 3SQOL 5FUCE 4Z78A 1SLVA 2UZPA 3TYFB 1CB4A 2VSKB 3EYSH 1A0QH 2B14A 2XQ0A 3GSQA 3BE1H 4I18A 2YPKA 2ZPKH 3NP4A 1PZBA 3D05A 4EEEA 5ALCH 3WEOA 5CZKA 2XWBB 1F1AA 3B9KB 5F7DA 5I1KH 3HN3A 2KZ1B 3NCYP 4PRAB 3VUAA 1ZXKA 1IX2A 1D3CA 5T5FL 1MY5A 4NZTL 1S9XA 3UAEA 3ZBMA 2F5BH 4YAQB 2PXYA 2Q7YB 1PL3A 1SJVA 1XQ4A 1LEKA 1EO5A 4FYSA 4Y5XB 1U2YA 5AYUH 3Q8EA 2R69A 3EZJB 5C0AB 3N2JA 5CCHE 3KS0H 1KB5A 2ED8A 3KYAA 2Z4QB 2ZOUA 3QUML 3ZYZA 5IQ9B 3PL6C 4MAYB 1EZLA 1YJDH 3MJWA 3Q13A 4YDVA 4ES9A 1CXKA 3OMNB 4JM2F 2K4AA 3W11D 3VMOA 4HJGB 1GTFA 3BPOC 1XH3B 4EQ2A 4NRXA 2WBJB 2A73B 2EIZA 3VXNB 2E74C 1G9NH 1OLLA 3VFGL 4X8GA 3RUGB 3L4TA 1U3HB 4JG0H 3RWFB 2F53D 3ELAT 2PCPB 3FQUA 2X2JA 3IN2A 2NXYC 5SX4I 5IOPB 1BECA 4IMLA 3FB6B 4G5AA 1IGYB 4E9LA 3BMVA 5A2IH 3RU8H 1IC7L 2ADJB 2BY0A 3L3JB 3VI3A 4GEIA 1T21A 3BWSA 3H9SB 3H85A 4OZIF 3C2SA 2OI9B 3DVFA 4AUYA 5AAPA 3IRCA 4R0LA 4B41A 3ZE2B 2WGXA 4X7TA 3GM0A 1OK8A 1ET8A 1LK2B 1NFDE 2D3JA 3BESR 3K6IA 5IKCA 3JUZA 1MCNA 1TKWA 3GRWA 4BWTA 5FOBA 1JMXA 3BQUD 3CZUB 4MD4A 3ULSB 3WNKA 3R06A 5EBLA 5HPMA 1MIML 4GYBA 4F7MA 3Q43A 2WUBL 4ZOAA 3N06B 3PFQA 5F2FA 2DZEA 4X6DF 5E8DH 3SSGA 1EEQA 2DLIA 1RAMA 3CVCA 3IJHA 3IJ9A 3LS5L 3MNZA 1EFXA 3HPJB 4LBEA 2YQGA 3NA9H 4DO6A 2W0LA 4P5KB 4MA8H 4G3YL 2Y25A 3HFML 1MREH 3F2LA 3U0PA 3MYZA 1DQLH 5K9JH 5H94A 1NIBA 1OCOB 1K5NB 1L7IH 2R23B 5LNDA 2FX9H 4KXDA 4UTAH 1ML0A 4APQB 1B4JH 4K94H 4HUKB 4QRAA 4GKSA 3FRUB 2EICA 4S1SH 5CLTA 3L9RA 4HXAH 2ZUTA 5GS0C 1CI3M 5EU7C 1ACXA 1DQVA 2QKIC 2PWFA 3WKYA 4H8WH 1AD0A 2HPTA 4ABVA 5FOJA 1A5FL 1WD8A 2V9TA 2OYKA 1A9EB 2VKWA 5DC2A 1YN7A 1A3LL 3IBEA 4ELKB 3ISRA 3MTXA 3H42L 1O6SB 1ZIAA 2DQDH 1OANA 2PCPA 3DHMA 3MLWH 4UZSA 3UJJL 4BSWA 3OGOE 3AAZA 3QORB 1UCTA 2DRUA 3PHQA 1I75A 4RX4D 3QXVA 4B6ZA 1W72A 2N7BA 1U95A 1CDIA 1V3LA 2J8HA 2NDFA 3L3KB 3VQ2C 4M9OA 1J05A 2AJYH 2C34A 3DKHA 4FQIL 4JQIA 5IBTL 1J12A 1YJDC 2JXMB 4K3GA 5DD1L 3SGKC 3T3MB 3L16A 1I85A 1EAOA 5C8JB 4JQIH 1OGTB 1GS8A 4XPBL 2UXTA 4HK3N 4Q7DA 5IVOA 1RJZB 1CVSC 4FG2A 3DUUB 4AWJC 1MHHA 3PIQA 1BLIA 3IJEB 2VM3A 3BKMH 3GMNB 4WV1C 1LVEA 5J13C 2O5ZL 3WFDH 2B5IB 2WW8A 1ACYH 3GSXB 3TBWB 2XWBA 2YAEA 4PJEF 2FSDA 5I1JL 1L5GB 4U4IA 4FKKA 3T0EB 3GTTA 4PWHA 3WO4B 4YR6A 3B4NA 3PLYA 4M1DH 5ESQB 3EDJA 1OAXL 2B7DT 5FM5O 2IO5A 3MLPA 2VSMB 2F53A 2DI7A 2C9VA 3WUWG 1SDDB 1RUML 4F8LA 5AW9B 5AYQA 3VWJC 1K8IA 3V0FA 2DKMA 5HY9A 4CNIA 2MQ3A 5C7XL 1YMMB 1VZHA 1IGTB 4M03A 1UD2A 3DUHA 3US0A 4PAZA 1B9KA 4NUGL 1X5LA 4P3WA 5FLUA 2WBKA 4GQZA 2VLLA 1DBKH 1R19A 4M43H 2MTAA 3LSOB 2V2XB 4HLZG 2DMGA 1AH1A 4HIPA 4PJIF 3QQDA 5K59F 4HKBA 5HYQA 1JPST 3QJQB 1EMTL 3Q1SL 1NDGA 4KHTH 2P5WE 3UAJC 3D8MA 2FQFA 3HG1A 2ILLA 4I89A 2I7OA 2ZG2A 1ACZA 4EVNA 3GLEA 5IBUG 4DGYH 3WUWA 5E2TH 2APVA 4LLQB 5T1KA 2EP6A 1NAMB 4E2OA 4ZAKA 1T1ZA 2G5BB 2JELH 4HZ1A 2BSCA 3K7UA 1A4JB 1P7BA 2HRGA 3NTCH 4UNIA 3SCMD 5DYOB 4XVJH 2WO2B 4NO3B 2YQ3A 2WLYA 1PLGL 3KLAA 4TNWF 2AJUH 1QI5A 2ZOLA 2I85A 1PD0A 1VGEL 4ODTH 4GW4A 3VGAC 4ELKA 5DMIH 1HH9A 2IQAB 3QA3B 4GP4B 3UO8B 2XFXB 1WQVT 5GZNC 5IB5A 4QEGA 4L1LA 4JREB 3CN0A 1DDHB 2YAPA 1XF4A 5EORL 3QCUL 3HG3A 3ZE0B 4MJIE 2DQ6A 3H1ZA 1DFBH 2UY7B 3AXLA 3QG6A 3ZDYF 4DWHA 3AACA 3L5XH 1IAOB 5HYJB 5KVGL 4MD0B 5I8OL 1Z2KA 2YGPA 4I48B 2BNUA 1KLGA 4K8RD 3WDHA 3MFFA 1ULVA 3HI1A 4QXTA 3A5VA 4LPWA 3MRNA 5LBSH 2BNRD 3SDCB 3UTZB 3LZLA 4XPGH 3ZDXB 1BVLA 2FDBP 1BAFH 1ED3B 3DGDA 1DQQA 2IFGA 5GRWA 4NAJA 2MQGA 3EJJX 4GRLC 1UZ6F 2L4OA 3K72B 4L37B 4XHQA 1SEQL 3GJEB 1ZK5A 2WUCH 2UVEA 2VXQL 1R3KA 2J5LC 3ZMRA 4FE9A 2DIBA 1SYVA 1KLUA 2GJ6B 2Y7QA 4MD4B 4OF0A 5EOCL 4Z76A 3QJUB 3ARBA 2VH5L 4OTXL 1YPZE 1F4XH 4FQ1H 3W56A 1H8LA 3GHBL 1ZWIB 2OTUB 3V7AG 4HK0B 1M4KA 4NJ9H 1E2WA 3WXWL 2DYPB 5IFHH 2ZCHL 1N0XL 4LLUB 4FI6A 2IWKA 4ZD3H 1T5XB 3PYCA 4WQOA 4L9LA 3KW8A 2E7LA 3HPLB 4EN3D 2ZG3A 4L4TB 5I30L 1YEDB 5ISZB 1LILA 4BSWB 5IF0A 1VEMA 1X4XA 5JNYA 3UBXB 1OPGH 4PJAA 3RZCC 2QVKA 5AZEL 5FGRA 5FFLA 2HVKA 5EHFA 3H9HA 4AGMA 5GGVH 4BQ6A 3MDJA 4GUOA 5GGSB 3DDFA 3MCKB 1MQ8A 3FH8A 2HXAA 4A37A 5J0BA 4Z8FL 1ZT7B 2HAZA 3VFTB 5DK0B 1TVDA 4XNMB 4UCFA 4PJ8B 1JWMA 4G9FD 5I1KL 1J9TA 2B20A 2CGRH 5GJSH 3UL4A 2OMXA 1FZJB 5D2NC 5C09D 1JWSB 3MNVB 3HI5H 4PJ8C 4JO2L 1MWAB 2IOOA 2GSMB 2X4OB 3WFEL 1LXMA 1GS7A 4ZO7A 1OAQL 4YX2L 1E30A 5TH2B 1FQ9C 4CGUB 1EZSA 4JKWA 3WL9B 5IVZA 4UQDA 3HZYA 3DO7B 1S9XB 4PRHA 4OCNC 1WCQA 5C1MB 5F7KC 3K0YA 1R5IB 1QR1A 4W4OC 4IRSB 3ZKND 2X88A 1FBIL 1SFHA 3FQYA 2ZAIA 3DURB 4XGZB 4P4KA 8FABB 2ZP0T 4O02L 4OJFL 4EQ3A 2FT7A 1J0YA 1FCGA 1QFWI 1TETH 3SGJC 5CJ5A 1FJ1A 1GC1C 4J3XA 4IBLT 3DNKA 4FQ2L 1QW9A 4H1LH 5F7FA 2VN3A 3FTGA 3U6XS 4NO0A 3RU8L 4Y1SA 4DZ8A 4M62H 1RUQL 1RZKL 5D7JC 1NGPH 3LH9A 3V6ZA 1K8DB 3L1EA 2R0ZH 3EJYC 4HHAA 5DMJB 4KUZL 3E3QE 1NOAA 1C7TA 1FORL 1UQSA 2D3VA 2EC8A 3CIQA 4WLCA 4FQCH 4YHMH 5TE7H 3NRQA 2HFGL 1RZ8B 2G0LA 3V6FB 4FERA 3VXUD 3OSKA 1P7QB 1MRFH 1JXJA 1T2QL 2WLIB 3QO0A 1RZFH 5EC2A 5D7LE 4MXVF 1GCYA 5E7BA 4A04A 1QTSA 1DJIA 1MRDL 3VFUB 5HDQH 3H9HB 4WJG3 1VERA 2G3ZA 4WW2C 1SYSB 4WTQA 4FTDA 2X4PB 2CK0H 3RDTC 1NC2A 5HJGA 5KSBE 2B1HL 1CTNA 4XNXH 5CEYA 3AUVA 1CGWA 2YWZA 4XTRC 1UM4H 2ZUYA 4XVSH 4KITB 3N44F 3BYTA 1RFDL 1IAIL 3G6JB 3IF1B 3HAEA 1HESA 2CJ3A 4QNPE 3VDBA 3VVVA 4HBCH 3VMNA 3SZ6A 4B5EA 4CJ0A 3Q8FA 2EDOA 4UIMA 5HHQB 1O7DE 4UTCA 3NBNA 4JO1H 3RX9A 4GP5B 3B34A 2C26A 3DMMD 5F1SA 4MDIB 4ENED 5GGUB 4X8CA 3MV8E 2FYYA 1J8HB 4FN0A 1KJ2B 3L9EA 5IQ7H 1M05B 3B9VA 1T5XA 2I07A 5J06A 1IFHL 4TN9A 4OF6A 2Q2EB 1ORQB 4AM0A 4CJ1A 5B7MA 3RDTA 3C6SB 3VD4A 3BZFB 3SDDB 1FH5H 4L8SB 4NN6C 4YDIH 5AAMC 1T1XA 2F19H 4DPRA 1FPTL 5ABAA 1K2DB 1CE6B 4L29A 1I8AA 4TLSA 4XMXA 5ANMB 5TF0A 3ZX1A 5IGXL 1QFOA 5IW6B 1R24B 3P4LA 2YGOA 1VIWA 4QCIB 4GRLB 5KAQG 4GW1B 2B0SL 1BZQK 1QSFD 4WI0B 2R69H 3MRNB 1II4E 5DEZA 3QUYA 3WMPA 4N24A 2W5PA 2F53E 4P3DB 3BZEB 4IW4C 1UH4A 4XAKD 3P2DA 1DQJB 1JN6A 3G08B 5DJCB 1GGYA 4P4RA 2BW4A 1BQ5A 2F5BL 3E1F1 4L3CB 3NA4A 3ZVVA 4G1EA 4CMMA 1OAUL 5FUZH 4TSCH 3CD4A 5T5FA 4N9GA 3FUDA 4OV6F 1TQBB 3LRMA 4KO9A 3T0AA 5H8DA 2Y2YA 4OD2B 2XBDA 3FU5A 3ZN6A 5HHOD 3QUMH 4U3HA 2Y5QA 1R3IH 1E27A 4RQQB 1QFUH 4CKQA 4WI2A 1YNKL 5LG1A 5LBGA 3WBDA 2GW5A 4F2EA 1CG9A 3AVEA 3QUMA 1BFOB 4WY7L 5H35B 4FOMA 3UYRL 1I9RH 4PJIE 3B2VL 4JO4L 3SY6A 4NM4H 1Q94A 2IWEA 1KN4H 3V5HB 5BRPA 4FXKA 3RWEB 4EUPA 4P4KD 2DYPA 3FO0H 2OZ4H 4U05A 4LHUB 4LEEA 3ARPA 1O6VA 4WCYH 3NACH 2AKRB 2O5YL 3PWPD 4P2RA 3U0WL 5CZVL 1HWHB 5IQMA 1ZSDA 1SUJA 1UOLA 4B3EA 1JZIA 5KUMA 2ZSVA 1JZDC 1RZ7L 5D5MB 1FNSL 4AGOA 5HGDB 2CBPA 5JO5B 4PJDB 1KTBA 4TSBL 4MJ4A 7PAZA 4XNZB 4ONOA 4LL4A 5GSRB 4I2XB 4PJGA 5DJAA 1S7XB 5TPWL 2A7BA 3LRSB 2IG2L 1SF5A 3P4OA 1M71A 1MVYA 1HK6A 3EADA 4PSRA 4PI0A 1HX0A 4ZZFA 4MJ6B 2YZ8A 3GIZL 5EH1A 4BSVB 1IGTA 1ZMYA 4HG4K 4U1HB 1D6EA 4EUPG 4X98A 1RUKL 1Q0EA 4BQCA 5DHVB 1MHEB 4Q0XH 3ETBJ 2VE6A 5I74C 3OWEA 3KPTA 4ZS6D 3L2MA 1FVEA 5IJKA 3IK2A 4AQ1B 3AC0A 2YXFA 3SE8H 1FG2A 1QSEE 2BIOA 2QL1A 1N59B 2R4RL 4DP8X 1JWMB 2NX5B 1ETZA 1HI6A 1TT6A 3D85D 4UT6A 4N2GA 4KV5F 1B0IA 4DVRL 2Z7UA 1AGCA 1SGKA 2XJKA 2C1OB 5ICXB 1M3JA 2KI6A 4AVKA 2P5ED 3LKOB 1BLNB 3FONB 4AUUA 5ILTH 3HC3L 1CDHA 1AC0A 2WZAA 4MS6A 2DQJL 1UM6H 1QYGL 3LN5A 1YEFH 2UUDH 1TQWA 3RJDA 2B15A 3DSFH 4E5XB 1NIAA 3TVMC 1CYXA 1Q90A 1ZANH 4NZ8A 1WS7A 1IKFH 1N8ZA 3D3VA 5EZPA 3LN9A 4DUVA 3FQNA 3RYMA 1W72H 4AOFA 2GJJA 1NWOA 2IALB 2E9IA 3VI3F 2B1AL 4TVSa 5T1DL 2ARJA 4LL1A 5IMMB 5D1ZB 3UTZA 4KRLB 3OB8A 2AVGA 4Z7WB 4XPAH 2C3WA 1EANA 4XPGL 4EI5C 1ZVHA 1XDTT 2BHUA 2AK4A 4PLKC 4XNDA 4K71B 4NB7A 4RGNC 4Y8AA 4I48A 1IBBA 1JTPA 5EUKB 2RQEA 4D8PA 3C6LA 3O41B 3ARWA 4S10A 5ETUB 1IGCL 3HOGA 3IGAB 3RGHA 2EVFA 1SOXA 5I6KA 5G4NA 4FL4B 4OCSL 2A1WH 1QI4A 3FN0H 1IGIL 3BPOB 3PWUA 4ORGB 3LCYA 3UYPA 2NY6C 3S2CA 4NQSB 1IQWL 1U36A 1YVLA 1CQKA 5DHVA 5KVFH 3L3OA 4ZX4A 4GJTB 3SDDC 4G83A 3MI6A 2F53B 1SMOA 1SHSA 2R2HA 3J27A 3U2JA 3TCLB 1A6PA 1TTRA 1PG7W 3SZKC 4MJ6A 2AI0L 4Z3EA 2DQIL 1U8NA 3KGSA 4JKNA 4A68A 5LGHL 4WNQA 4HMEA 5EC1A 2YIHA 4WO4B 2A0LD 4NN5B 2E5EA 5JW3H 1M1XB 3QA3A 3ZKNC 4APXA 2MNJB 1GW0A 4MD5A 1M6OA 4A1RA 1TTFA 1Z3RA 3QQNA 2AQ2A 5C0FB 15C8L 3LAFA 1OWWA 3RVTD 4DNLA 1NGWB 2VABB 2F74B 5BPPA 2CU9A 1DSFH 3DTUB 4NJAL 4PRDA 5TE4L 1H6UA 4K8RC 2VKXA 2NRDA 4S1DC 4NM8L 1XGQB 3U4AA 1NMBL 1XR9A 4OIFA 4PJ8D 2DJSA 3GINA 4Q9BA 2VDPB 4RAHA 2AABH 2DJ4A 4IU2B 4J6RL 5EBWB 5FO9A 3JWDC 3GDCA 1CXEA 4AG4H 5I18L 3D0VB 4PTTA 4YSRA 5KBLA 3V7MA 1OAQH 5T1JA 1COBA 2V17H 4S1DD 4A2GA 4MCYA 4BUHA 3QJXA 4NPJA 5I1HH 3TBSA 3O4LE 1Z5LA 3U7WH 4Z7UA 2F1EA 1MFEH 3BP7A 1DANU 1HYSD 1HCFX 1QKZH 1LL1A 4WZ9A 4AIXA 3SJVE 2BXZA 4JRYD 1UWFA 4ZTPH 3G5VA 4LVOC 5EOTA 3LQZA 2E4FA 2ZXDA 4GUQA 4KVNL 4NHCL 1A2YA 1VHPA 2Y1VA 1KB5H 2Y36H 2Y23A 1FFPA 2J8UB 3ZOAA 5IR1B 3NCJH 3VXUE 4UU9A 3T77A 1LD9B 1CFVL 4X5WB 3UAJD 1UACH 2PPEA 3O3DB 4AH2B 5BW7A 4XOBA 4X6BB 3T3MF 4P8QA 4UT7H 3N50A 3V4PL 1ETB1 2R0ZL 2D7MA 1QWNA 2LU5A 3FAWA 3UBGA 3V0JA 1HHGB 4NQCE 2IAMC 4L1TA 3ZQ9A 2ATAA 1FUNA 1WWCA 2V5TA 1KCRL 3UIZA 4PRAA 4N8CL 4L8BA 2FEDD 4A7TA 5C0JB 2NY5H 4GQRA 1MCBA 2G2RA 3VH8B 2YPKB 3BQUA 1IVLA 1E8WA 4MVBD 1CL7H 4X4KA 4WDIB 2P49B 3SY0B 3T71A 1FP5A 3QDHA 3E1ZA 4EXKA 1CFSB 3CFKB 4YDJA 1EZVY 2JLPA 4F7MB 4U2ZA 3KD4A 4HZAA 4KK5D 3DX6B 1W16A 2VDOL 4OF3A 2Q6WB 2CDGB 4ZMPA 3G6JA 5HJBA 4E9XA 4ZMYA 3PFUA 1UWYA 4DFIA 1B6DA 4F2FA 4D9RE 4H8WC 4W4NA 4ZTOH 3AU1A 3AG2B 2GY7B 3MCLL 2YR3A 5AL0A 1CFQA 4POZD 2FCBA 5F71A 4L3FA 2Q1EA 5JPMB 3TIEA 4JGJA 4JPKH 1IGYA 1L0XA 2YMTA 3ME0A 4DKFL 5CCKL 1AZRA 5FIEA 1BJ1H 1BV8A 4CKVX 3BVUA 5FHBH 1UH3A 1BMWA 2V0AA 1I1YB 1YMMD 3BP6A 4NBXB 3TX4A 2HWZH 4L8BB 1RK0A 3WDJA 1ONQA 2RACA 1E28B 3PPEA 1ZSHA 4RRPA 2L3BA 2PO6C 2VO8A 4UTAA 3TT3L 1KG0A 1EWHA 2F74A 3O4LD 3BP4B 2NY0D 2Z4QA 4YBLC 5TDOB 3MA7A 4PJHB 2B8OT 2DD8H 2X6UA 3TCTA 1M2VA 5C0EA 2CPUA 1DFXA 2FL5A 2Y3AA 2XN9D 3G5VB 4QRRE 2K6YA 5EOTB 4NUJB 4FL4C 3KPPB 2ITCA 1ODAA 3KJ6L 5EU4B 3TJEH 3T8MA 4DP6X 4OF8A 1ZT1A 2IQ9L 1WISA 3FJTA 3HE6C 2UWEA 3ETSA 4X50A 4MB5A 1UOVA 3L3OB 5ID0B 5A43C 1OP9A 3PNWB 1C5BL 4KRMB 2OMNA 4LP5A 2YMOA 5E5LA 2QTVA 3GUFA 4PPTA 3U9PL 4KDVA 2O5XH 3B2PA 4UV7H 2D31A 3TM6A 4PRBA 4MNGE 3D4ZA 4X6FB 5G55A 1YAZA 5C08D 5D93B 5ANHA 5KYNA 3OKKA 1I1CA 2A9AA 2Q6WA 4NXSA 3R1GH 3DMMA 4NM4L 2WNXA 4XI5C 2YEVB 1A7OL 1D7BA 4HGMA 5F89A 3RHWF 3TNMA 4H2CA 5L4FA 3VFTA 4YDJB 3B9EA 3H2QA 2C4FU 4PJXA 3BT2H 4LCWB 5DA0B 2FD6H 4IBYA 4O9HL 5HYJD 2X05A 5KSAC 4WGVB 3PJNA 3VH8A 2H5UA 3L2LA 2BWQA 1NL0H 3U0TB 1EGJA 5LGYA 2ALWA 3SO3B 5E6UB 4QRPB 2MOQA 3LHPL 4O51A 3QUKB 3D7PA 4QY8B 1IQDA 4OCYH 5AW1B 3NABH 4L4VA 3FKUS 5E00B 1U92B 1FNFA 3TC9A 1N7ML 3IDNA 1VLXA 3NFSL 1OP5H 4BINA 5FAAA 2RQ8A 3TFKD 3MLZH 2OSWA 3BEWA 5DS1A 2GSGA 4UB0H 2BNQA 4WWOA 4XN7A 3EJRA 5ESVA 2EDEA 4GAGL 3MODL 3U1SH 2DWSA 1CQYA 1U8IB 1V3KA 4U3XA 4GUPB 4F7CB 4YHYB 4J2QA 5KSBF 1JUFB 2MKWA 3MV9E 4U1GC 4WWKD 4XBEH 2NY3C 3G04A 4R90L 4PGDB 1LO4H 4ZUWA 2FJGB 4Z7UB 5GS1C 4UT9L 3VWKD 4JCWA 1AKPA 5DZNA 1XSJA 3IKCB 2AMUA 1EV2E 2ED9A 2IMNA 4JZJC 5DRZA 5C2BL 3L7FB 5CNHA 3RB7A 2K4WA 1VADB 3EUDA 1M2OA 3KR3H 4X0NA 3WKQA 1RJLB 3REVA 4Z7OF 2AANA 1KJMB 4I1NB 4NENA 1P5UB 2APSA 5IQ7L 1KTJA 4HUXA 2XZAL 4QWWC 3CFTA 4HWBA 3T4AA 3O9WC 1N8ZB 1NMCB 4LSUL 4EAEA 3UDWA 4AXWB 2JFCA 1SLWA 5EUOF 2VR7A 1VB9A 4JY6B 4P2RD 1DJSA 5IEHA 4Z7VB 2CG9X 3QUZC 4ZI8A 2ENJA 5SV4A 2F5AL 2Z92B 1OE2A 4KTEL 4MB1A 1QBAA 3K46A 3MGOB 5EU3A 3T4YA 3IU4L 3MRKB 3OKMB 4PJ9A 5DFVD 3TBBA 4XMKL 4F9LA 1EAJA 1MPAH 1CD9B 1OZTG 4L5FE 4HCIA 2DMHA 4YFLI 5A2KH 3LXAA 4OFYA 3FSVA 3TH4T 3CLWA 4P46A 5HDLA 1W0WA 1GY1A 1KCSL 1MUJA 2FQGA 5FGCB 4LOVA 3NIDB 4UUJB 3KMDA 2CHNA 4J28A 2R1WA 4HSQA 3VI4A 1MNUL 4Y9GA 1PZUB 1EERB 3CFBB 2XA8L 2VC2L 4OF5A 4XP4L 1D5XA 3NZHL 4IRSC 5GGRA 1E67A 3UC0H 3VFVB 5BRZB 5D7IA 3OLIA 3RVXC 1BREA 5CSBA 5J12C 1ZGLP 2Z35A 1PYWA 5LHDA 2AEIT 1FH2A 5HYJE 1JPSH 3EJQA 1UB6B 2BH0A 4NQSA 5DWPA 1N5YL 3QISA 2VRAA 1GC1L 4MDRA 3LZPA 1KJMA 2E6JA 2OKMA 5LGJA 3P3YA 3SE3C 4UDTA 1TQSA 2AITA 4H8HA 4W6WB 3TO4C 2GIYA 3U1PA 3SODB 3TV3H 2HKAA 3IGKA 1I9RL 4ZO8A 3QQDB 1XF1A 4LPVA 4AXWA 5JW5B 5BV7C 5K1VA 1MI5A 2OSLB 3G6AB 2ZYHA 4D7BA 5FYJU 4AC4A 5D1QC 3R7RA 2PN5A 2GUYA 3NK4A 2NY7L 5LKNA 4WO4D 2I60L 1JTTA 4P07A 3VD2A 1LP9A 1MIEH 3LOWA 5I6LA 4YPJA 3D3VD 4ZFFB 1IL1B 1OF2B 3BX7C 3OPZH 1KCWA 5ABZA 3RLSA 1JGDA 2WGNB 3QPXH 4QXUL 2AKRA 4IKNA 1JZ8A 3KLDA 1SY6L 2ROYA 3DX9A 2ZOOA 4HK3J 5DHXB 2JIXB 3UO1H 3KWWA 3WHXA 4F2MB 4UQIM 4XPFH 4HG4J 2AABL 2CO2A 4LOUC 1MZZA 4N25A 2QEJA 4ZUVB 2VDRH 2HMID 1N6UA 2C1PB 3BWAB 2YUVA 4ZS7L 1EJFA 3OKNA 1AMXA 1L9QA 1IFGA 2ZUSA 5KS9E 1Z6JT 3Q06A 2HT4D 3FOMB 4N8VB 4LMQI 3IJYB 3I6SA 2YN3A 1CFBA 1EFXD 4BDVA 1HDMA 3W39B 2Q76A 1OALA 5EU3B 1T5WA 4QTFA 1CJYA 3T4YB 5IEKA 4PRHD 3TBCA 4KJQD 1FL6B 3NQIA 1DEEA 1DL7H 3FQRB 3DHUA 1F97A 5HHXH 4OKVB 1BGXH 7FABL 4ETQA 1A64A 4N2OA 4U7SA 4LEOA 1TJIH 4KK6C 4NN6B 1JP5A 2WQVA 3TBTA 5SX5H 2E9BA 3ZPDA 4D0DA 1IBHA 1MJ8H 5FO8A 3H8NA 4HUXB 1A4AA 3NJFA 4DJMA 5MHSE 4FCHA 1AR1D 1ZANL 3PJSB 4JY4B 5CN2A 3L9YA 5KYUA 1W8NA 4N2FA 3HC0B 1RSFA 1YEHH 1FIEA 1GGIL 4DK5A 1JYNA 5D1XD 1F41A 1Q1PA 4NO0D 3DTXB 4KWUA 2EXYC 3TA3C 3K5RA 3PAYA 2NY2B 1UXLA 2K1MA 5G4OA 1GAFL 4M93C 3VXSE 3C2AH 1KWGA 4RGMB 1ILSA 2NY4D 2X9YA 1PTZA 3RVTC 1EH9A 2BSTB 3R4RA 2ENYA 4ANWA 2BC4B 1PKQE 4U1GB 4F7CA 4X4YB 4FQXC 1PYWB 3BJ91 2IC2A 4JM4H 2WLJA 4ATTA 2V9RA 1HILA 3HAEB 4P5RA 5B22A 5GZOA 1AXSB 4Z5RA 4AYSA 3QC6X 1IFRA 2IPTL 4UDUB 3CBKB 2DQFA 1OCWL 4ZPTA 3RKDC 2VRKA 1T1WB 3UEQA 1EXHA 5AOKA 4YDZA 4R4FH 1NC2D 3NSDA 2DEXX 3FK3A 1RIUL 2CWRA 4Q4IA 4KQ0A 3HE7C 2H0PA 3DJZA 5E94A 2BLFA 1A22B 1F11B 1F4YL 2GJ6D 2EC9U 4G7QB 2GAZA 4HEME 5T33L 2JCCA 3LNFA 1D9KB 3DYPA 3J8F7 5HPMB 1C16A 4FA8A 5B3NA 3W9DB 5KN5B 4GBXB 3F01A 5D71H 2EEAA 1MW3A 5KSBB 3QXWA 1G6RL 4JM2B 1CFQB 1CICA 3CSGA 1MCDA 3II1A 3EJTA 4CSTA 4KXBA 5TTRA 2WVVA 2I26N 4N68A 3SPHA 3GSNH 3FTGB 3NIDF 3QEHA 1JFQH 5CF3A 1M3IA 5AW2B 2NY4C 4FXTA 4L1BA 3P54A 1R24A 3D06A 2VLKB 4ELMB 4J3OG 1L7IL 3WV0A 3HFFA 1RZIB 4H8VA 1K6QH 5F7EL 1OTSD 3DV4B 4WI3A 2ZICA 5HYSA 3QBTB 3FT2B 3BKCL 4NZRL 3U4EB 1IKOP 2XX0A 4L8CA 1I1FA 4E68A 1J0ZA 1NOLA 3UTTA 1DLHA 2HPOA 1T5KA 1QD0A 1TQCC 1J8HA 3LRGA 3OB0K 1KPUB 4UILL 5DVOA 2EE2A 4FEIA 4KK6D 4X6BA 5INCB 2IH1B 4NQEB 1ZV2A 4LVNC 1V05A 1QBML 1WBZB 2FEEL 1OAXH 3MA9H 4OCRH 4XBPB 4UV4L 2B4CH 3NYKA 2EIDA 2X1XR 3MA7B 3QNFA 2P45B 4BK4A 3S5LG 3U9UA 3NGBB 5IR1A 3AXHA 5ALCL 1BXUA 1YUKB 4JDEB 5FYJL 2ZX9A 4DPCX 3GSRB 1J86A 1R3HB 2YRPA 4S1RH 1KJ3H 3BDYL 5GGTA 4NP9A 5IB2B 1N4XH 1Z9MA 3CXHK 5E6IB 2BVOB 4HISA 4JRXE 4X5XB 3BRFA 3S3SA 3KWTA 3MRQA 2XV0A 2X4TB 3F3HA 3ME0B 3WJMA 2EDTA 3DARA 4Y16A 3HA0A 3F7QA 5IK3B 4EIUA 3ULUE 1AJ7L 3RA7L 2A4CA 4TQPA 2XQBL 1I1AD 2KHAA 2VDPH 5HVHB 1F42A 3D9AH 3ULAB 2WM0A 5MEQB 5E2VL 3MRHB 4JNXA 3NIGF 3FTVA 3MJGX 3QG6B 3LS5H 1OCZB 2FIKB 2VDKL 3BAKA 4QHMA 4WI9A 3AY4C 1J0HA 2AAAA 3W81A 1R5WA 1NUGA 1Z5LB 2KC0A 3ZSSA 4DK6A 3NZUA 4ZUTB 3JZ7A 1AKJA 4K7PL 1QA9A 2WLZA 5ECGA 1RURL 1QX1A 3ZMNA 5CILH 3M1BA 4B9YA 2DLGA 2QGCA 4OF7A 5I6OA 4AQOA 3GPEA 2ZUVA 4CC4A 4HPOH 4UAHA 4WDIA 3SPVA 1ZT1B 3ZDWA 3O6FD 1OGAB 1W91A 3AB0B 1BAGA 3ZKSD 2DKSA 1PZCA 1Z3GH 1ZS8B 3EH4B 5HHNA 1K5WA 1I1RA 2OR7A 3MV8A 3VRLE 1L6ZA 4JHZA 4KH2A 3MROB 4HIHB 4JS7A 2O6FA 3L3OC 4F58H 5IHHA 1KIRA 2XZQH 1G9MC 5JZ7C 2TAAA 4MWFA 1GYUA 1OD9A 3RVXD 3SPCA 3TA3B 4XXDB 4MQ7B 5HYJA 3HJEA 4ERSL 4DQOH 5JUEL 5FO2A 3T6XA 3T3PF 1MFDL 1OTTD 2YSTA 3H4FA 4O2EB 4QXTB 2X4RB 4BCYA 1DSYA 1ESOA 2NSMA 3C5ZA 4BZ2A 1FFNB 4BJLA 3QXDB 1PNCA 4FABL 3EIFA 3NSFA 5J6GB 3GSOA 2EIMB 4BZ2H 4LK4A 2BMKA 4LCCB 2HVKB 3V6OA 3LXBA 1YYMH 3Q8BA 3GDBA 2AP2A 4FHKA 4PW3A 4Z7WA 2X9WA 4WI4A 4HA1A 4NEHB 1O5DT 2ATPB 5FA3B 3BIKA 1WCBA 1YY9C 4GW5A 1QR4A 5EIIG 1REIA 5HTSA 4OT1L 5EU6E 4AYDC 4JKPL 2JI1A 3UJTL 1BXXA 4ANVA 2VR5A 2B59B 5GRVL 3CUPA 4PGBB 5BRZD 2CLRA 1JJUA 4G1MA 2WZPA 3VQMA 3OHXB 4Z1PA 3WU1A 1JV5A 4IJ3B 3P0GB 4NKOA 3KL0A 3HHSB 5C0ND 1WWAX 43CAA 3U4BL 1V3MA 2WQSA 3L81A 4PBXA 4UQCA 4WF7A 3G5ZA 1QEWA 1BQUA 2X9XA 4FI7A 2D3LA 4M6NH 3VXME 5DO2D 2BVQA 2R0LL 2YSSB 2ZJSH 1M6OB 1KTKE 3R1GL 5BVPL 4YHNB 3HLAA 4G11A 3QWRD 4NUGH 5EEVA 1SXZA 4M5ZH 2XWEA 3IDIB 4BKSC 1L9NA 1U95B 1T22B 3FOLA 4WNQB 5D7LB 5INDB 2EECA 1HI6B 4FG0A 3E6HB 2BZCA 4JFFB 1S9YA 5IHUH 5JW4Q 1G7PA 4H20L 5F7MC 1MHCA 1V7NH 4HD9A 5DRNA 1EJ8A 4C47A 4E5XG 1FVEB 1P5UC 2D8KA 4AKQA 3K91A 1NL0L 3TONA 1BWMA 4I5BA 3ZLQC 3H9YA 4WFHD 3FUEA 1V5JA 2H1PL 4GAJH 5D1QE 3ZSTA 1G4RA 3QUZD 5TQ2L 4A55A 3GMNA 1LEGB 5SV3A 2O1AA 3UO1L 1OV8A 5AFAA 2K7QA 1AGDA 4F1ZA 4P9HC 1EHXA 1I8LA 3D2UD 4AIOA 5C07B 1JPFA 4KRPD 4PRID 3SBWC 3DX2A 4DEWA 3HBPA 4U2YA 3RP1A 3MFGB 2BCKB 4WU5B 1A02N 3SJVA 3VRIA 1D7CA 4K07A 2ZNWA 1RUMH 2J56A 3DJRA 4OUOA 4JG1L 3C6LD 4F9PA 4YHOL 1YEJH 1BP3B 2GJZA 4ZQKB 2MWCA 3HC2A 2IGTA 4MB4A 5L4JA 2GBAA 2EUXA 3GJFA 1JNLH 4MMXB 2AQQA 1AGFA 4UWQB 3QQXA 4HIEA 3UROR 2Q8AL 5I0DA 2Y07H 4NQQA