2L3BA

Solution nmr structure of the bt_0084 lipoprotein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr376
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
MNDDVDIQQSYPFSIETMPVPKKLKVGETAEIRCQLHRDGRFEETKYFIRYFQPDGAGTLKMSDGTVLLPNDLYPLPGETFRLYYTSASTDQQTVDVYFQDSFGQLQQLTFSFNNDSSKEEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein found in conjugate transposon
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 18
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2010-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l3bA00
2L7QA 4LBAA 2L3BA
chains in the Genus database with same CATH superfamily
4JO1H 3MC0A 3V79C 1DJHA 3OJDB 4XBGA 2B1OA 5L7XH 4M8RA 1G4MA 1HQ4B 1MFUA 2XFGB 1LM8V 4HDIB 2WVTA 4UOJA 2ADJA 4U6YB 4Q9RL 1SOKA 5EH1A 4XCFH 2XBTA 3SZ6A 4HS8H 1G43A 4UCFA 1GC1L 2YEQA 3IGLA 2V5SA 2VDOL 3QJHB 1FQ9C 4HK0A 1AKJA 5IOPB 3P0YL 3RNKA 3HTLX 5ESAB 3TBSB 1KGIA 5E94B 1KT2A 5EOCH 3T4AB 5A2CA 2QR0A 1BAGA 3BN9D 2GJ6E 3LEXB 5C6TL 1KJVB 5D7JA 3BQVA 3L3IB 1UFGA 2V7NB 2W38A 5F7MC 4JHWH 1HX0A 1IGYB 3NZHH 2KKQA 3QJFA 4XX1G 1NFDE 1OGAD 1CXKA 4NM8H 2E86A 4XBPB 1H6TA 3S36X 5JHLL 2IAND 2FUQA 3KLLA 1CFVH 2W60B 3AGWA 4NKOB 5F7HA 8FABB 1Z32X 5IBUB 3UROR 1HWWA 5EU4B 3EYVA 5LCVL 3ZX1A 1RK0A 2I7OA 4L1BA 2OJEA 1FRGH 3MHZA 2KL6A 1MCOL 1UZ8B 4G7VL 1SLWA 2L04A 2CJSA 2QADC 4Y4KA 3HC3L 1YEJH 4JPIA 2O6CA 3FQTB 5EZLA 4C4KT 3M1CA 1G9EA 4NGHL 3DUUB 3T0ED 1F90L 4DOHE 4DP2X 5HI3D 3HFFA 3DXAD 3NYKA 4JZJA 5DLLA 1YY8A 1E5CA 2FZ3A 4FLSA 3D6GA 4WLCA 3W81A 3APMA 4PJEE 3CFTA 5DVNA 2BHUA 5ECJE 3QCVL 5HDBB 3IFNH 4XMTA 2WLNA 5JIMA 1G1KA 2ZP0T 1UB6A 5FOJA 1OB0A 5IW3A 2COQA 2Q8BH 4WW2B 1XEUA 3OB8A 1JGUH 1S7QA 1VDGA 1B9ZA 5TPWL 4ZT1A 1PG7L 5C71A 2NQCA 3QRGL 2VMEA 2FJFB 5J8OA 5FYLE 1M9WA 3O4LB 3SBWA 3QDJD 3ESOA 4XPFH 4E9XA 1HSBB 3OL2A 2ZP9A 3LN4A 4OZFH 2X4RB 5IQNA 1GH7A 3WAJA 2NY3B 1BG9A 2ZXWB 5DSCA 2HFFA 4Z7VE 1ZT1A 3HPLB 4TNEA 4B0MM 4OV5B 3WSQL 4ZI8A 1S7SA 5LHDA 4WFGD 4ODXB 3H42H 2DYSB 2XV2A 1RD6A 4UT9A 3U6XA 4AM0A 1HDMA 1QI4A 4IRZH 2AK4D 1ZLWK 3H2QA 4B9YA 2BW4A 4M1CC 4N2KA 4L23A 3TTSA 3C5SB 4PRBB 2XETA 4FNQA 1TZHB 2MQ0A 1G6RH 3GJFA 3MV9A 3QDMD 3KWUA 4FL4B 4QR7A 3RY5A 4XP4L 3R7QA 2VL5A 3VSQA 3ZO9A 1OP3H 3G6JA 1ZHKB 2DQJL 1M2VB 2JCCF 5ANMA 5C09B 3WJLC 1JZ7A 3HNTH 5IWLC 5KVMC 4FABH 3V4VL 1GTNA 4PJ7E 5I8OH 3MRDB 1FO0A 4MNQE 1D7FA 2QBWA 4PB9L 5GRVL 5LGHH 3U7WH 4OM0H 4RBPH 1Z9SB 1XVSA 3VGBA 3L45A 5TQ0L 3STZB 4Z23A 1QG3A 4LLQA 3KXFA 4L3ED 4NRXA 1NAMH 4NNXB 5KBKA 1A6UL 1BVLA 3AW5A 3D39A 2P8MA 5INCB 4O5LL 2VDNH 3EH3B 1B0IA 4IHOA 3LYRA 3U6RA 3W5MA 4Z3FA 4OKDA 4EIBA 4AQ8C 4XBEH 2EIZA 1BG1A 3WN5A 2YSSA 1AZZC 2FATH 3VA2C 3U4BL 4NAMA 4AG4H 2Q76A 5MEPB 4IBVA 4HG4J 1O7VA 2F1EA 4XOAA 2Q20A 4LBEA 5JIIA 1FGVH 3TJHC 4FQIL 2EDBA 4ODHH 4ENZA 1H9DA 3VXRD 1CTMA 4JJOA 5I0XA 3NTCH 4F8NA 4HWUA 2JCWA 4PWGA 5AEAA 5E8NA 4FTVA 4S10A 5JOEA 1J0JA 1JNLL 4QOKD 2N7BA 2GY5A 4MLSA 4D0BB 4PQXA 1R3IL 2BNQE 3TBVA 1JXDA 1QO3A 3ZZQA 1LD9A 3MLTB 4U1HB 2IGFL 5FO8A 3QXWA 1QNZH 1FAIL 2HPOA 2AITA 3N1FC 1QPKA 1CLOH 4LHUG 3GMOA 5ITBL 3IETB 3X3FL 4OLWL 3WKMH 1CK0H 1R5WB 5LBSH 3V0VB 1TLKA 3BX7C 3FOMA 4FA7B 1BAFH 3LOWA 2WBJD 2PETA 4NZTL 2NZ9D 5K5YA 3VB9A 3V5KA 2O5ZH 2OKMA 2SEBA 3AUVA 3L3HB 1M1SA 4L5FL 1WD8A 2R23A 1DL7H 3HBGA 4HW6A 3ATAA 1HZHH 3BGFC 3CFQA 4TRPL 4MJHA 4U1JB 4W9CC 4TNFA 4OI8A 5D2LB 1R6VA 2VN6A 3C9NA 3FU5A 2XSKA 2JJUA 1KGCD 5J5EA 3LTVA 3QRLA 1VJSA 2ZYSA 1F3DJ 5IMOB 2E27H 4ACTA 5CN3A 5CGYC 4ZO8A 4Q6IA 5ESQB 2DTML 3TO4D 5D7LE 2EABA 2X4OA 4PVLA 1OCOB 3ZMRA 2EDXA 5JHDB 1HE8A 4BWTA 4LHQB 3CCHA 1BX2B 3JWNG 1XGYL 4JFEB 1RIVH 3QQ9D 4KKBD 4LLYB 4KXCA 2DMCA 2M26A 1LVEA 3F3HA 3IPBA 2BJMH 3O3EA 4JZNB 4MNGB 1JMZA 2CRYA 3HE6C 5IJDC 4GSQA 1LEIA 3PP3H 4NO2A 3DO3A 4PU2A 4Z6AT 1KG0A 1EXUB 3IE9A 2RJMA 3OHXA 5H35A 1CQYA 1J5IA 3QRFM 2UY6A 2G2RB 2NXYB 4JAMB 4PLKD 1KC5H 3MNDA 2MQGA 1WE5A 4Y4FA 2W0PA 3QHFH 4UI2A 4XBGB 4JG1L 4G8EA 1BFTA 2ZP8A 4QJ3B 2HMID 4NQCE 2IWKA 4YK4B 1IGIL 3CLWA 2K4AA 3VI3A 3QCUH 4YNYA 2ADJB 2Y25A 2HT3C 2X42A 5JIKA 1PFCA 2COVD 4F2MA 4U1NA 4HK0B 2L4OA 4P46C 4Y7MA 3VGGA 4DUWA 1AKJB 2ZG2A 3RNKB 3KLHD 1NIFA 1FC1A 1BQUA 5KVGE 1KT2B 4WEBL 3N44F 3B5TA 1D5MA 5F0MB 2OP4H 4H8WL 2G3ZA 2D7OA 2QR0B 3QYCA 3L4XA 3R8BB 4OGYL 5D1QA 2FT8A 3QS3A 7PCYA 5D7JB 4P8QA 5ADOH 5KS9A 1UWFA 5HY9A 3Q6GL 2XX0A 1BA9A 3K6DA 2WPGA 3QJFB 1MJ7H 1TZIA 2DBJA 2V9TA 3I50H 1ASQA 4L2YA 1EJOH 4ES9A 1MWAA 3D2UD 2B5IB 2APTA 2HP4A 3L3KA 1NEUA 1A3ZA 2E7HA 2HRGA 1U3HC 4UBDC 1XCTA 4LSUL 3FQWA 3T0XA 3EJPA 1T6WA 5EWIH 5EU7C 2XC8A 3BP4A 3FB7A 1HH6A 1QAWA 2HTLC 3EYVB 1RK0B 1UWXH 4J3TA 2DJ4A 2OJEB 3N06B 2GB2A 1HYSC 4QRBA 5GHWH 3TTYA 4AYFA 4WFFE 2CHNA 4FLOA 2NDGA 3FPXA 3NK3A 2FQDA 3NFSH 3QULA 1OSPH 4NO3A 4Y4KB 4Z9KB 2FVNA 1SMAA 2HVJA 1L7TL 3T77A 4JPIB 3THMH 2IQ9H 5EZLB 1OF0A 4R4BA 5CEXA 2J20A 2P5ED 2NDFA 3T09A 4QIRA 1F2XK 3FB6A 3FT4A 5FEBA 4JZJB 1PCSA 1YY8B 2K0RA 2FZ3B 2VZTA 3TZVC 2OMVA 4EE2A 2XNAA 4W4OC 4GSUA 2WN3A 3DPBA 3S37X 3FF8A 4FYTA 3HN3A 3B56A 3IDMA 3HBZA 2VXVH 4JY5H 5F3BA 2IWFA 4BK5C 1NCUA 2IDCA 3MRPA 4K7PH 4QYAA 5TE6H 2C4XA 2FGWH 4YSOA 1UB6B 4YDKL 3KPSE 4XC3H 2QTEA 1DQDL 1E5ZA 1S7QB 5BMFL 1TZ8A 4X50A 4L3FA 4HFWA 2X09A 3EDKA 5FHAH 1AIZA 1CFSA 4Z77A 3ZK0A 3EYSH 3FKUS 2LR4A 4GAJH 4LSPL 5KSBF 2MRYA 1HQRA 4YZFE 2I69A 1JD7A 2YAOA 2DKUA 4BH8A 3IMWA 3ML9A 4ELME 4LZKA 2YRZA 3LN4B 4ZG1A 1XGPA 1GTFA 1YEFL 3UP6A 4H1LA 5DSCB 2HFFB 3D9AL 4MDJA 4B9FA 1ZT1B 1WFUA 4AIOA 2C9UA 4KDWA 2X05A 3W9DA 5EORH 2BM3A 5GS2H 1S7SB 1D9KD 2F2HA 5DK3A 5B4MD 1BF5A 3SE4A 4AM0B 1TQCB 1HDMB 3K8LA 2DQEL 3Q7JA 4F37F 5E2WH 3ECQA 3MRFA 3BPNC 5BPPA 1YY9C 5E1QA 2DLFL 3CBRA 1NL0H 1I1CA 4P23C 3V0HA 2D0HA 3GJFB 3P2TA 3MV9B 1T3FA 3Q1EA 4KZDH 4GH7B 4XBMA 2VL5B 1PZBA 2WNWA 3QCTL 3G6JB 3Q5OA 5ANMB 1B4TA 3LZRA 5AVWB 3V6OA 2YPKA 3DMMD 1QYGH 1KJ2A 3GDBA 4XMPH 4UT7H 1NOLA 4GRLD 2XQBL 1FO0B 4F58H 4HJGA 4JM2D 3PUUA 3W3BA 4NZJA 4UM9A 1JHLL 4L4TA 4LLQB 3KXFB 2X53A 3SHSA 2PTUA 4NRXB 5F70A 1G84A 5AW6B 1BVLB 2VYRE 3D39B 3BUIA 1IQWL 2DIEA 2P8MB 3MRMA 3ARDC 3RAJL 2V5TA 1T03H 4IHOB 5E00A 3VFVA 2EECA 3U6RB 3O4OB 1UURA 1X3DA 5H37H 1U8LA 4U3SA 1ZVSA 3MOAH 2EIZB 2VXUH 3WN5B 2YSSB 5J12B 4RMVA 1AIFA 32C2A 2Q76B 4M6MH 4QHNA 4QMEA 2ZXQA 4NLHA 2C34A 1MFMA 4LBEB 4Y5XC 1J0YA 3EJRA 5J7CC 1SN2A 4KX7A 1RZKH 3WOVA 4OF8A 3I6LE 4PRIE 2DQ6A 1OGSA 5E8NB 4FTVB 3K2MC 3ZE0E 3VSVA 1AZBA 5CWSB 2QJDA 4PS4L 2FR4A 2NLJA 3FU9A 3KGTA 1JTTA 3MXVL 3TBVB 4DVBA 1QO3B 1LD9B 4F20A 1DQQA 4TPRH 5FO8B 4EJ1C 3RVVC 3GMOB 1RV6X 2WKGA 4UZGA 4KKZA 2ERJB 2DJMA 5FIEA 4JPWL 3FOMB 4WTWA 1WHOA 3Q48A 3ZOAA 3JYBA 2XI9A 5T8IA 3GHEH 3HG2A 3V5KB 2K6YA 2SEBB 5IVNA 3O2VL 3E38A 2R23B 4Y9BA 3KM2A 1LK2A 4RMQA 2EUZA 5CNHA 1CTOA 1SOXA 4KBPA 4YDIH 4F7MA 2NR6C 3C9NB 3PHOA 1SMDA 5ABAA 4Q0XH 3LZFL 4N1CA 1S9KC 3FUKA 1OHZA 4V11A 4HIEA 2KLSA 4Q6IB 5T3XE 1NDGA 2IMNA 2R0WH 3D1MC 2APBA 2X4UA 3PUCA 2X4OB 3RDTA 4AYMC 2F8OA 2Z31C 3W82A 2P8LA 3BPOC 2VO8A 2BNRE 2O6PA 3CCHB 5F8QC 2CQVA 3MR9A 5IB5A 4IOSD 3VWJC 2JKJA 2K78A 5HD8D 2BOLA 3QUZA 4LRNL 1CLYH 1HOEA 2I9TA 2EDLA 3O3EB 2VLJD 4HOWA 3TBYA 4D3CH 3ZVVA 4PIBA 3EH4B 5AVSB 1LEIB 2EIDA 4NO2B 3KJ6H 3N40F 3N41B 1KG0B 3OHXB 3LQAL 5H35B 3UCRA 2NY0C 2VZSA 3B2UC 4D9LL 2OA9A 4DSYA 2UY6B 1J9RA 1PX4A 4UTBH 4YSDA 3VCLA 5T33L 5D7SL 3ARGA 2B7DT 4B7LA 2J5LC 2FJUB 4U0QB 3LKQA 1R1CA 4Y4FB 4AGOA 1FFPA 3EH1A 2H0FA 4G8EB 1E5BA 1R3KA 2UXVA 2ODHA 4OGXH 3HZMA 3CFKA 5EF3A 3CDGA 1R5VA 2ZPKL 3QIUC 4WWPA 3KBPA 1FIEA 4LASH 3ULAB 3VI3B 4DGVH 3VTMA 4ZX4A 5CGMA 5HYJE 3GBML 4YNYB 3CZKA 2D7TH 3WY2A 4KRPD 4MZ3A 1NGWA 5D7IA 4F2MB 2WV3A 2WUBH 4U1NB 1VSCA 3W0WA 3KLDA 1ZANH 2A77H 3B5GA 4P59L 4HPYL 4MLIA 3MLRL 4ZZFA 2FX9H 4W9FC 1D5MB 1U0QA 4ZYKA 2NY6C 4HCFA 1Z0MA 4FZEL 2AERT 5D1QB 5KOMC 1P4IH 3II3A 1WFIA 3VSUA 4JPKH 1BD2E 3GXMA 2R9HC 4JFPA 5KS9B 5HY9B 3OLDA 2ADYA 1OZUA 4HPOL 4X8CA 4OUUA 9PCYA 3SIKA 4QJ5B 1HNGA 2D7QA 3TEWA 5I71C 2ZG1A 4MZIA 5F9OL 1TZIB 5MEND 1IGJA 1S5HA 2J43A 2PCXA 1MWAB 4BM7A 5FAAA 5CILH 1NCHA 1J8HE 1MRCH 4TVSa 5E2JA 3L3KB 3RBSA 3VNYA 3ZSTA 4B60A 2XV3A 4BE5A 1XCTB 3FQWB 1XIWD 1CCZA 3BP4B 3INOA 3E1ZA 3FB7B 3RTQA 4CJ1A 1HH6B 3PAZA 1PZ2A 1GOGA 5C08A 1DQML 3QEQD 4LLMA 4DZBA 3TA3D 1RZ7H 4AYFB 1B0GA 3QULB 4NO3B 4B9KC 1S78C 4U7KA 2HVJB 3T77B 3SODB 1E4WL 2MOQA 4CADA 4R4BB 5CEXB 1E4XH 4AMKH 2QPDB 3AWGA 2R8SL 1KF9B 1AXTH 4JQIA 4Z3EA 3MODL 3DIDA 3NJGA 3UADA 3FB6B 3FT4B 3U0TA 3VDCA 5EEVA 5FCSH 1B88A 1NSNL 4OIBA 1HIML 15C8H 2OMVB 2Y36L 3QJOA 4U1SA 2XNAB 5C2BH 3DPBB 4PJCA 1YEKH 4PWJA 4XP5L 5A2JH 4MJID 3IDMB 5F3BB 5BXFA 1SVZA 3CH1A 3MRPB 1EFXD 1SEBA 4X6DA 2VXSH 3LEVH 5GS3A 1MAKA 2IMMA 1NFAA 2BOCA 4NO5A 5T1LD 4HFWB 5HYIA 1X7QA 4Z77B 1CFSB 4NQDA 2JKIS 2M8XA 4FFWC 1K72A 5DJ8A 1HQRB 1WBZA 3LHPH 1A7RH 4Y1TA 2EDYA 1FL5A 4A67A 3PPSA 4JGJA 4U3XA 4BH8B 1VPOL 2OSYA 1JPEA 1RUML 4KXBA 1TMCB 4I0PC 1A2YA 5CM1A 5I8CA 3TEZA 1XGPB 5KVDL 3C08H 5AZ2L 4OZIF 1W0WA 2GQHA 4H1LB 3CHXA 4MDJB 1ZIBA 3KGRA 3W9DB 5TFSL 1NBZA 1SDAB 3GK8L 2YZ8A 4N3UA 3ZQ9A 4EKJA 1BF8A 2V0AA 2WLJA 4FYRA 5IHUL 5JNYA 3W2DH 1D2PA 4QRUA 3IE4A 5E1AA 3MRFB 1ZSHA 3P73A 1BF2A 4NZUL 1JHKH 4HS6A 1ZE3H 2Y4SA 3ASNB 3BVXA 1CDGA 1L9NA 3L4UA 1LQSR 1T3FB 5E8DL 4MWFA 1JYXA 4XB3A 3RVXC 4NO0A 2DMKA 4TL4A 1OSEA 1OP9A 4HD9A 5E08L 3GUFA 4YHKH 1LJMA 5IUSA 5FUOL 4DVRL 1AG0A 2YPKB 3QDGD 4OZ4A 4XVJH 1KJ2B 2WY3B 3N43B 2DKMA 2L7UA 4I9XA 5AKVA 5C0BA 3IFLL 1A4JA 3P54A 4A7GA 1JUFA 2Y6SC 2JIXD 4ZQTA 4LU5H 3MBXL 4HJGB 2Y69B 1D6VL 4UOQA 2YMTA 3RWFA 3BKYL 4OT1L 2ZWLT 2WXNA 1I85C 2GBAA 4UM9B 1NLBL 3Q2WA 3DI2B 4L4TB 2XY1A 5TE4H 1ZLVH 1O7DE 4MKMA 4L0ZA 3MRMB 4P9HC 3WNOA 4UU9A 3LH8A 2QDVA 3FAWA 4X9YA 5E00B 3TWYA 3VFVB 4LHUA 1JZ2A 1U8LB 4JQVA 4U3SB 1ZVSB 4XN8A 1KPUA 1JV5A 3Q9QA 3QQDA 3QARA 1T6BX 1OTTC 4V1DD 5IQOA 1QBMH 1AIFB 32C2B 3OC5A 4JMNA 4QHNB 5EZPA 4L4VD 1NMCB 3ULUF 1RUKH 2JJTC 1CICD 5ADPL 5IKCA 2EILB 1IMHC 3SGKC 1DO6A 4IMKC 3QNYA 4L4JA 3GGWA 3IMSA 2APXA 1ZSDA 2B4CH 1QA9A 2HVKA 3GS7A 4AV4A 4RAHA 1KIPA 4MAYC 3CMGA 2FR4B 2NLJB 3H4HA 4KY2A 3UERA 2ETWA 3ZDZB 4DVBB 3WTXA 4IRJD 2ID5A 5EOQL 1X6NA 2YBGA 1DQQB 1A7OL 4A6YA 2ZOKA 3WD5L 1H3GA 1YEDA 2A4CA 2R4RL 1KYOJ 4AUJA 4XNYL 4LXFA 1UACH 1E65A 3L5XH 4AYSA 5AOZA 3EDEA 2YFNA 2HFGL 4NN6B 5HDQH 4K5NA 4FMVA 4JY6A 4KTGA 3JUYA 1X9RA 4M62L 3T2PA 3I2CL 1N8OE 1LK2B 3JBG7 1YAIA 2FWOA 4HP5A 5AWNH 4F7MB 2H6UA 2JMRA 2FBOJ 3PHOB 4DP4X 5IJKC 2AXJA 3SN6N 4O58L 1AVAA 4LP4A 4XVUD 4HIEB 5EC2A 5KJRL 3SPIA 2DICA 1Q90A 3GZOA 1NDGB 3U0PA 1S9YA 2X4UB 2YGQA 3RDTB 2YPLA 3PXLA 1KXTA 3L1GA 2PO6C 2P8LB 4FRWA 3MQIA 5K93A 2VRQA 2WUCL 3MR9B 4M7LH 5IB5B 2D0GA 5L2JA 1MFBL 3QUZB 4P3DA 4HC1A 5DEGA 3SPVA 1A64A 1J5OL 2I9TB 4MMYA 1EHAA 3TBYB 4EIZC 1G7JA 4YPGA 3PDGA 2LU5A 4Z7NB 2IJ0C 1YUKB 1OARH 1XL6A 1NANI 4FQJL 3AG4B 3VCLB 4FXGA 1R24A 3ARGB 2IG2H 3ZGIA 3S98A 3LKQB 3P11L 1WUNT 1FFPB 2JJSA 2FJHA 2QKSA 4I2XA 4APQA 1R3KB 1TPXC 4KHXL 3HZMB 3CFKB 4OJAA 3CDGB 1R5VB 2OJZH 1IBGH 1U8IA 2NYYC 1FYTA 1KFGA 1NGWB 2BRRH 3UTPE 5D7IB 1F1GA 4ZFOA 1LMIA 35C8H 1G0XA 3BDXA 4IS6A 3W0WB 2OZNA 3RUGE 1W72A 4GAGL 1J9SA 5JPNA 3QPQC 1IC5L 4ZYKB 5L6YL 4U1IA 3ARTA 1VIWA 5E2TL 4BV1A 1HAUA 4XZ4A 2PCYA 4JFPB 3BKCL 3VFMA 2AJUL 4AEFA 2WM0A 4HEME 4OUUB 3T1WA 2Y07H 4WIQA 4YDVA 5I1KH 5IUCA 4PJIF 4QTIH 3P3RA 3GMQA 1IGJB 2VR6A 5ALCL 1S5HB 2XWRA 3I9PA 3AROA 2R2CA 5D96B 5B8CA 3AM8C 5BOZG 1J1XL 1OL0A 4GOSA 1LE5A 3F04A 1A47A 1OCWL 4GB9A 1NCIA 5FLVA 4WUKL 3EYFA 3WJMA 1O6SA 3RTQB 2YGPA 2CJTA 4XMKL 1F11A 1GC1H 5C08B 4LLMB 2VDOH 4DZBB 1EO8L 2K9FB 3P0YH 1B0GB 5DJ2A 4N0FA 1SBBA 4HWNA 3GTTA 1BYOA 3ECVA 5HI4C 2Z8WC 3X1GA 4PJFF 2R7EA 3EJJX 4CADB 3FT9A 3IDIA 2EVIA 5C6TH 4QRPD 1W16A 3P4OA 1PGRB 3U0TB 3MDJA 1MIEL 1UUNA 1G7MA 4FQXA 1FZOA 3U1PA 2Q3XA 3ZQXA 5J1AA 2MNWA 4U1SB 4KVPA 1QUNA 4PJCB 3QYMA 1G1YA 4LLUA 5IQ9A 3FO0L 5SX5K 5JHLH 5BXFB 5KYXA 1KXQE 2QGCA 3CH1B 1IB5A 1SEBB 3C75A 4R84A 1P5UC 4P3WA 4X6DB 3D09A 4I9WD 3MFGB 3TN0A 3ZN6A 1INDL 3KH3A 2BOCB 3G5VA 4NO5B 2J6EL 1X7QB 1N6VA 1H8SA 4NQDB 2J8UE 5DJ8B 1KGJA 3AGVA 1WBZB 2K70A 5LCVH 1FL5B 2ZOOA 2XXCB 4AK1A 1DHKA 5I0YA 4OBSA 4JY4A 1MCOH 1TITA 4G7VH 1A2YB 2HRPL 5I8CB 1NFDA 2WIMA 4TTDC 3HC3H 4JKNA 4LLAA 4TULH 1V3KA 1W0WB 5GRUL 4EZJA 1BQRA 4L2LA 1NBZB 3SGEH 3VXMD 4NGHH 2BX5A 3FUEA 2CO7A 3GI8L 4P4KA 5IVXA 3WTTA 1IC4L 3D0AA 4GKOA 1N12A 4W70A 4N68A 5JNYB 4QRUB 2JNZA 2CH8A 4QF1A 2UZPA 5E1AB 3P73B 5DHMC 3SYAA 4HS6B 2PPEA 4DKTA 2A6DA 5JIDA 3O3AA 3QCVH 1JHTA 1QNIA 2YK1L 4MWFB 2MCG1 1GPOL 5EU3A 4NO0B 1WT5C 1BFSA 1ZTXL 5TPWH 5L0QC 1ADQL 4OZ4B 2MQ3A 1XO8A 1PG7H 2AAVA 1BEYL 3LIZA 5C0BB 1NCBH 3QRGH 2P5WD 1A4JB 5F1NA 1JUFB 5BUGA 1IBYA 4ODVL 4WNQA 4B5EA 2CUHA 1E50A 4RGOH 4N2DA 4GUCA 1Y7VA 4PJ9C 4OJFL 3RWFB 4DK5A 3G5ZA 3WL9A 3BAJA 2WVVA 4CMHC 2QVMA 1KGWA 1T6VN 3GLAA 1OQXA 1DUYA 4PJEA 3UG4A 4UU9B 1QUPA 1ZDQA 4LHUB 4KU1A 4ZOEA 3WSQH 2K4WA 1W9XA 1X6LA 1KPUB 1JV5B 3QQDB 5DJXA 1IM9D 4F9LC 2UV3A 5F7BA 1IEBA 4N2NA 3T6ZA 4R7XA 2ITCA 3NAAL 4V33A 2H2PC 2W5PA 2IEPA 5A40E 5IKCB 2YSTA 2WSDA 3PE9A 5D2NC 3JYCA 3NK4A 4OLZL 2E6PA 3QNYB 3LXCA 2O93L 3GGWB 1JS4A 3MA7A 4OF6A 4XP4H 1ZSDB 4KJWD 1QA9B 2HVKB 3WTVA 5DVOA 1KIPB 4GT7A 2DQJH 4Z7VA 1ZJAA 4ZAKD 4ZUTA 3WNNA 1ACXA 4IRSD 2X0WA 3OKOA 5TDPA 3L9BA 4A2DA 4A6YB 2ZOKB 4CKVX 1L0PA 1A14L 1KXHA 4PB9H 3UG5A 1YEDB 3BZ4A 2C7FA 4HUXA 5TQ0H 5CLYA 2ZX9A 3NCFB 4GG6A 4UMSA 4X7EC 1L3WA 2IQAA 3ZIYA 1A6UH 2ZAHA 5A3IC 3Q3GA 3R1GL 3PL6D 5M7QA 5C0AD 2ZQKA 4O5LH 2VM4A 3IFPA 3ULUC 4R90L 2H32H 4JY6B 1OM3L 1X5YA 4OFDA 3OMIB 3QPXL 1ET5A 2E9BA 3U4BH 2FWOB 1IGFH 4AL8C 1H5BC 4NQTA 4IBSA 4FQIH 4IDLA 5I1IL 4F1ZA 4PJ5D 5EC2B 1FJ1A 3S48A 1ODUA 5KSUA 3LS4L 4XZUA 4EDXA 3TA4D 1R3HA 1GKEA 3U0PB 1S9YB 4ZMYA 2YPLB 1KXTB 2VAAA 1JNLH 1AOZA 3MUZ1 4LSQL 3IFOA 4N2MA 1R3IH 1DO5A 5L2JB 5CEZL 2CUIA 3ZRFC 4P3DB 4JFFD 1XL4A 1XAUA 2IGFH 5DEGB 1WS7A 3SPVB 1XMWA 4MMYB 1FAIH 4XR8C 1G7JB 2VDMB 4YPGB 2PMZA 1MG3C 2OAAA 5ITBH 1CE6A 4N0CD 2A9NL 4C55A 5AW5B 1AGCA 3LKOA 4MJ5A 1TR7A 1IILE 2ISDA 4FXGB 2Z8RA 4L3AA 1S8DA 4Z76A 1UD4A 1R24B 4FD0A 1XEDA 4I2XB 5HYQA 2FJHB 1W72H 2JK5A 4APQB 4L5FH 1PX3A 3SJVA 3SKMA 3P4NA 5DUBA 1P7BA 4AZUA 2XWJA 4I3RL 4TRPH 5DS1A 2BNQA 2BP5M 3C6EA 1U8IB 1FYTB 5HVGB 4HUVA 4MBOA 4QGTA 3EH5B 3WS3A 4ZFOB 1AR1D 5F2FA 4IS6B 2DTMH 3AB0B 4TQIA 5K9QG 5KVFL 1AHWC 4POZC 1AR2A 1W72B 3CX2A 5JPNB 2C9QA 2UYLA 3CLEL 1X4XA 1CGYA 1XGYH 3FU6A 3QXAA 1BZOA 2ATPA 4U1IB 3TONA 1GGIL 4PJGE 5CGBA 4JKLA 5HGHA 3CQQA 4D9RD 2XZQH 1ZDSA 2O72A 2WB7A 1JXJA 2MOGA 1TQBC 3VFMB 3OXSA 3QWOA 3D48R 4YDVB 2XA8H 3WNIA 3GMQB 1AC6A 3FUHA 2WLLA 2F18A 4MAUH 3TCXA 5B8CB 2HG0A 1DN0A 2WQXA 2QQNL 5D7LA 2FBJL 4JG1H 4NT6A 3ALXA 1LE5B 1VFMA 1XH3A 2DAVA 1IGIH 4A63A 1GCYA 4EN3C 3EYFB 4ZW8A 3WJMB 3DGCR 1WWCA 2PF6A 4D8PA 1O6SB 3VU2A 5C0IA 1I1YA 3E2HC 5CD5D 1NIEA 1F11B 4N2FA 3U36A 4OCXL 1A66A 4H5SA 4ZW7A 2LW3A 4RIRA 1WGVA 1WBXA 2NXZC 5DJ2B 4N0FB 1EEZA 2X3AA 2WGXA 4WEBH 1PCXA 3V0AC 4PJXF 4QRRE 3SDDC 4FP8L 1WA2X 3RL2A 5JOPE 2R7EB 4WWKA 4OGYH 4OH2A 4J4PA 2YAMA 3IDIB 3SDCD 4J8RA 1FVEA 3MSPA 3P4OB 4ZTEA 1GVIA 1KXVC 3Q6GH 5AVRB 4FQXB 2YAPA 1G7MB 4PR5A 1FZOB 5J1AB 1F4XL 1QUNB 4S0TD 3AITA 2WXFA 1DBKL 4DN4L 2CK0L 4LLUB 5IQ9B 1HXMA 2V8MA 1PIGA 3D05A 4GKZA 5GJSH 1DQLL 5HHOE 3RG1C 5KYXB 4WTZA 5TF0A 5GGTA 3N9GL 3TN0B 1KEGL 4J2XA 3WXWL 3BQUC 3FB8A 4LSUH 3UEQA 3G5VB 5F88A 2W92A 1CXHA 4HLZH 1RZ8A 2X6UA 5IV2A 3RL1A 4M61A 1MCJA 3I9GL 1ZA6A 3S8GB 1SOSA 2HLFC 1RMFL 3V95A 3ILQC 4JY4B 4AQAA 1JBJA 5HPMA 1N4XH 1NFDB 4NHCL 2AJZA 2PKDA 3HE7A 2CZNA 1O6TA 4PJHE 1L7TH 1NC2A 3L1OL 1NMAL 1E2ZA 1KCUL 2CO7B 4LMQE 1BYPA 4HKXA 5E8EA 3CFNA 4P4KB 2A6KA 3DHMA 3TH2T 3JVGC 3U1QA 3X1EA 5IVXB 4JFUA 2VLRE 4QF1B 3DDFA 5EZIL 1NM4A 1LO3L 4QXGL 2P43B 5BCAA 5D1XD 4WV1C 3BSGA 2A6DB 2CHWA 4GRMA 3O3AB 1KWKA 1JHTB 2DH2A 1EHNA 1CVRA 3HHSA 5EU3B 5FYKU 4YDKH 5A2FA 4R8WL 1DQDH 5BMFH 2LT9A 4EQ2A 1NBYA 4LSPH 3T6WA 4RDQG 5F1NB 2YR3A 1XB3A 4DOHB 4OGAC 4KNSA 4WNQB 3T2OA 5AFAA 2HKHL 5E0FA 5K59E 4X7CC 2ZX8A 5EU6E 3LN9A 5D2NE 1TT6A 1C5BL 3G5ZB 4JFHE 3WL9B 5E51A 2WVVB 2WXOA 1FLTX 1QZ1A 4RZKA 1YEFH 5KBPA 4J3OD 1DUYB 2CALA 4PJEB 4RA0C 3D9AH 1INEH 1DSYA 2IADA 1R19A 2ZZUT 3AUWB 1VB9A 5CEZD 3DECA 5GGSA 4PJ8C 5DJXB 4CC0A 3KPSA 2DQEH 2EIEA 3G6AA 2ORBH 4UF7C 3OJVC 3C5ZD 1IEBB 2C5DC 4ADJA 3ZTCC 1DCLA 4BXSV 1DLHA 2ZKYA 2ITCB 4N2CA 4DP0X 3DX9A 1KIRA 5C0JA 2OMXA 2VAJA 2OR9L 1NLDL 4ELMA 3TOPA 4X8JA 3MA7B 4P4RA 1H9VA 4HPHA 2FO8A 1P6AB 2QGBA 4C47A 3GC3A 4MS8D 4Z7VB 4ZUTB 3GXFA 4L3CA 3MLSL 3OKOB 4J7RA 5TDPB 1RXLA 2XTSA 4OCWL 5SWZD 2X40A 1JDCA 2XQBH 3MVSA 4KI5E 3WLWC 4N5ED 1X5HA 3BZ4B 2CDGA 4K9EL 4HUXB 2CNYA 4HZAA 4KDTA 4GG6B 2NZ9C 1JHLH 3QB7C 2IQAB 3Q3GB 1IQWH 3RAJH 2R51A 5IT2L 3IFPB 3NQIA 1BQSA 5DRXA 4AQEA 5E03A 2Y7OA 3SDAD 3KLQA 1PY4A 3QHZL 4PVNA 1MAJA 3B7SA 2NTFA 2RA1A 1MAML 4QAWA 1MELA 2P28B 1NCWL 2DYPD 2EE3A 2UUDH 2VR3A 4G72B 4OFYD 1UKQA 3TCTA 2W81C 1FJ1B 1RU9H 3P2BA 4GLRI 5KSUB 1EGJL 3NZ8A 2VT0A 4XZUB 1R3HB 4EDXB 5SX4H 3DWTA 2NY5C 2VAAB 3E1F1 3N3EA 2OSWA 3L3JA 4PS4H 3HRPA 4N22A 5FFLA 3IFOB 3UBXG 3MXVH 1IRAY 5D5ME 3DOIA 3LZPA 4BINA 3BKML 1DR9A 1MY7A 3I3EA 1CE6B 3HI5L 6CGTA 1AI1L 1AGCB 1NCDL 2R69L 3LKOB 4MJ5B 1LE9A 1ZLUH 4JPWH 3HS0C 4TUUA 3ZKXC 1KBPA 5HDBF 4ODSL 1S8DB 4K15A 4Z76B 3U30C 3E3QC 4EUPH 4LQ1A 4PRIA 4AI7A 2BVPA 2IXQA 4HUNB 4F9PC 2HMIC 1W8NA 1YEWA 2ZOTA 2DI7A 5HYQB 3HR5A 2JK5B 4XB7A 4PMEA 5DMYA 1SFDA 4HIIA 3NGBB 3SJVB 3NIDF 3P4NB 5DUBB 3SKMB 2BSSA 3L6FA 4GBXC 5GZND 2XWJB 4RX4D 2WGNB 2BNQB 4I1NB 5DHXB 1PS3A 3LZFH 5IVZA 4HUVB 4OCNC 1AO7A 4ZW3A 5AVZB 2AEIT 3QP3A 3WS3B 4YN3A 5KSAD 2FWUA 4ZXBD 7FABH 4XPHH 1K8IA 2ICWI 3RE0A 2UYLB 4Y16A 1T7ZA 3QXAB 2ATPB 1RFDL 2HTKD 4N5UA 2WTOA 4U31A 3IJ8A 1GS8A 4NUJA 5FA4A 5HGHB 4LRNH 5DQJA 2YPVA 1IBFA 3B9KD 4G80A 2JLLA 3OXRA 3OXSB 3QWOB 1L9OA 5DYOA 2G9HA 1VA9A 3FOLA 1U8QA 3LQAH 4PGZA 5HGDA 1SY6A 2NY1D 2RD0A 5T33H 4D9LH 1KB3A 5D7SH 2WLLB 3CH8A 2GHZA 3HZ3A 4XC1L 4ZS6C 1DN0B 1E2VA 1SXBA 5D7LB 3ULVC 1WD9A 3QR2A 4NT6B 4WK0B 3BRDA 3DV6A 1XH3B 4FFZL 2BNRA 5J6HA 2ZPKH 1EV2E 3DUSA 2KZBA 3GBMH 1K9TA 3IGFA 4NS0A 4D8PB 5IR1A 4FXKA 1I1YB 3PWPE 5C0IB 5DURD 3U36B 2QZ5A 3I9AA 1E3ZA 4H5SB 3FT2A 3O6FA 4RIRB 4NC1E 3GTNA 4O2FA 4P59H 3ARBC 4HPYH 4K71C 4C56D 1WBXB 5JW3L 3BJ91 3MV8D 5C07E 1EEZB 1NZRA 4MB5A 4N86A 3MLRH 4UQDA 3ZTJH 4MA1B 1YLBB 2FBRA 4RGNC 5A2BA 1OT2A 4FZEH 4HXBL 4WWKB 1WPCA 5DMKA 3RL2B 2Y0SA 3GI9H 3F7LA 4J27A 4J8RB 1FVEB 2CO1A 2K9UA 1CQKA 4OR1A 4PJFE 1N6QL 1S3RA 1ANUA 3RQ3A 4HPOH 3MU3A 4PR5B 5DFWH 1ACYL 5I73B 3FBQA 2GIXA 5CZVL 4B3VA 5F9OH 1E9QA 3GLZA 4F91B 4MMXC 1CF1A 1HXMB 1M05A 4GKZB 4KRMB 2HKAA 3S0PA 1LEKA 2AJVL 4XPTL 2ICWA 2EDHA 3P69A 3CN1A 4P2OD 2MEJB 3FB8B 3FQRA 3KYKL 3ZDYE 1IGCL 5F88B 3WIHA 5AAWA 3FC8A 4H0HB 1RZ8B 4QLWA 5IV2B 3RL1B 1BD2A 1U3JA 4M61B 4MXVE 1ZA6B 2MNJB 1DQMH 2Z8SA 3SKOA 4AQAB 1DJIA 5LG1A 2ATAA 4GKLA 5BJTA 5HPMB 2AJZB 4WF7A 3HE7B 3ZKNC 5LB1A 5I0VA 5B4MC 1NC2B 4PRAA 3FDWA 1E4WH 1N5AA 3ARPA 4XN9A 4LB8A 1FL6A 4IW4C 1J8HA 3WEXA 2R8SH 4LEBA 1XZWA 4N0YL 5E8EB 4HKXB 1ESOA 3MODH 2A6KB 4KKPA 3KVPA 5D2LF 4NOBA 2Y9RT 2AQ1A 4NXSA 2ZXBA 4IBYA 1REIA 1NSNH 3HN5A 1HIMH 2KDYA 2Y36H 4R3SA 2FIKA 4XP5H 3BI9X 1HKFA 4HOXA 3C87A 4KK9D 4GRMB 5HDWA 2IAAC 3FUMA 2Z64C 4XN1A 2PP9A 4HV8A 3HHSB 1T0MA 4FS0A 4NXKA 2HUEA 4J2QA 4ANWA 4Q8BA 3BD4A 1NBYB 1I3VA 5FV2A 3K1DA 5E6ID 3UPAA 2BOBA 1O6VA 2YIHA 4ADIA 4IGBD 1P7QA 4Z7AA 1VPOH 1MI5D 1JZIA 1RUMH 2PYED 2M2DA 1PZAA 2ADGA 5KVDH 1N2RA 3QHTC 5AZ2H 2OM5A 4UZUA 3S37L 2WXHA 4BWWA 1QBAA 5TFSH 2IADB 1JJUA 2DQDL 4LSTL 3FF7A 3DX3A 3GK8H 1ID2A 3QQNA 1EJFA 5I2IA 5K9QI 5GGSB 4U49A 5LXVA 3ERXA 3KPSB 4QRSA 1HOCA 3G6AB 3MV7D 3LMJL 3K1KC 4KVNL 2FO4A 4XXDA 5IHUH 5MHSD 3AFLA 4NZUH 1CLZL 1DLHB 4HMDA 3VUAA 5KAQF 4X6CE 3DX9B 4JO2L 1KIRB 2BSEA 3HIZA 3PWLA 2JI3A 2OMXB 4I85A 5AW1B 2OMZA 5C0JB 3A3YB 3EO0A 4I3GA 4ELMB 4X8JB 4P4RB 4LDEB 4UQ2A 2Y7NA 2WNKA 4UNTA 2IGLA 4QTFA 1PFOA 3FRUA 3LXAA 3T3MF 2X70A 2ZKXA 2D4DA 1TVBA 5FUOH 4DVRH 4L3CB 5JYMA 3IJEA 1NPUA 1X5LA 2IV8A 1AGBA 4H13C 4LCIL 3IFLH 5FYLL 3IMRA 4JR9L 2XN1A 3MBXH 2X38A 3S3DB 1D6VH 2MHAA 4M4PA 4PJ6A 3BKYH 1WGOA 2CDGB 4OT1H 2ZF9A 4UYPA 2OCFD 3CU1A 4P57A 5JQHC 1SYVA 3CN0A 1EIBA 3MBWA 2XTJE 2AGJL 2XLLA 1I3UA 4K2UL 4H8WC 1WZMA 2P48B 5DRXB 3BYTA 3QWRD 5E4OA 4HZLA 2LABA 4AQEB 4JFDD 1BQ5A 2DL2A 5FYKE 4TN9A 5J13B 4F2FA 4B9IA 5IESL 3H8NA 2NTFB 3EFOA 3T4AC 1JXKA 2R1WA 1MF2L 3T8VA 3OKLA 4HU2A 3EADA 5F6HJ 1HEJC 4FI6A 5ADPH 3GD1C 4NAQA 2AJYH 1MPAL 1UJ3A 3NZ8B 3P0VL 3TIEA 1CURA 2QTVA 4A7SA 2A0LD 5EFIA 4EQ3A 5JQ6L 5CLWA 4LPCA 2ZUXA 3H9ZA 4HGMA 2XZZA 3L3JB 1H3VA 2CMRL 2YJLA 5FYJE 2WCGA 4PV9A 5CJ8A 5EOQH 4QHPA 4RSYA 1A7OH 4WI6A 3RWIA 1SLVA 2BWIA 2AEOA 2MCMA 4RSVA 3U82B 1I8AA 1T4KA 3QC6X 3IBEA 3NPSB 1J18A 2CWRA 4XNYH 1V3LA 2V5RA 2VXTL 3S34L 1LE9B 5TTRA 4IOFD 1LO5A 3MN8A 4JDZA 3QZWG 3RIKA 4IBUA 3FH8A 2HFGH 2C4FU 4ZDHA 2KPNA 3SB3A 4PRIB 2BVPB 2IXQB 3LDBB 3HR5B 3HG1D 4M62H 4HIIB 4WU5A 3HAEH 1F4YH 3EHBD 1RZQA 3I2CH 5DZAA 5FHBL 2BSSB 3L6FB 4G83A 2WNXA 1TIUA 3T0BA 1SJEA 5HYFA 3EJTA 3SBRA 4HKZA 3W57A 4U7MA 4XPBH 1IX2A 5IVZB 1IAII 2PWFA 4JPVL 1AO7B 4JS7A 4O58H 5D7KD 5DC2A 2XZAL 5KJRH 1EJ6A 4F93B 4WEEA 1VCAA 4WFEE 3WY3A 4LARL 3ULVE 1K8IB 2EDOA 1BM7A 2O4EA 3G5YA 4Y16B 3REWA 1T7VA 3EO9L 2WUCH 1CGSL 5GGRY 1O0VA 1W0YT 5D1ZI 5FA4B 3QQ4A 1NAKL 4NUJB 2IBZY 5CN2A 2IAMA 4UTCA 3WIFA 1J5OH 3CNKA 5DQJB 4OF3A 4G80B 5L8LB 2VDLB 2J7LA 3V4PH 4WW2C 2P7TA 1VESA 1Q0XL 3OXRB 5DYOB 2G9HB 3FOLB 1U8QB 5HGDB 4X98A 5C0RL 4FQJH 3RY6A 4IDJL 4ZMVA 4P2RD 3B6SA 2FQGA 3P11H 2GJ6D 5CCKL 2K7QA 1TOXA 3G6JF 4HUUA 4DNLA 4UB0L 2PR9A 3N1QC 1GJUA 1P5VA 3PAYA 5FV1L 4KHXH 3DV6B 3QK0A 1FN4A 2BNRB 3P77A 5J6HB 3SKJL 3S3PA 2NY3C 3DUSB 1M53A 1MCWW 1AH1A 5IR1B 3Q0HA 3FZUD 4FXKB 3HJ0A 1T1WA 4Q58C 3KWTA 3NJKA 3FS9A 3M6DA 4LCYA 3FT2B 3O6FB 5DQ9A 1VERA 4O2FB 3NCYP 4GAGH 4CUCA 4F37K 1ZLWH 2ITDA 5C0CD 1IC5H 5L6YH 4UOW1 4KUCD 4KKCC 5DMKB 3QIBA 1YJDC 1NUGA 5E2TH 2AABH 1T5KA 4JVWA 3EF4A 4BFJA 5LNGA 4FL4C 2YUZA 5D9SA 1L9SA 4IMLA 2NW2A 1UVQA 2AJUH 4YDJA 5T5FL 5E4AA 4CU8A 3B5HA 3VRLE 4FQ1L 4PEEA 2E56A 4QHUA 4HJIA 3Q6FA 1E9QB 1SXCA 2PPAA 1M05B 3A67L 5EOTA 5LGYA 4BGLA 5JZ7D 3DTDA 4OY9A 4WHYH 2YKKA 1F56A 1LEKB 3APDA 1OHQA 1J1XH 2ICWB 5EUOE 3RUGA 2H0EA 5FF6A 4JHAH 4YHZH 4B9ZA 1OCWH 3FQRB 4RETB 1O5DT 3MLVL 5D1ZA 4WUKH 3C09B 4R5VA 4Y19A 1SBSL 3CAFA 2X1OA 4XMKH 1F8TL 4ZMXA 1BD2B 1B6UA 2A4EA 3KZ8A 4R4ND 1EO8H 4HEMA 5E2UL 3SKOB 2VXQA 1MSPA 1HE7A 3NFNA 1MREL 5BJTB 5KVGL 2FL5A 3W38A 3NIGB 2IPUK 3GBNL 1WUZA 4BHUA 4PRAB 1N5AB 2O6FA 1FL6B 1J8HB 3WEXB 1MCHA 5FYLD 3SGDH 2FD6L 1WFJA 2X3CA 5IEKA 5LBGA 3FW6A 3M88A 5M95B 4G5ZH 1MIEH 4JFWA 1LMKA 1GZPA 2NY4D 4R3SB 3UBXI 1GYUA 1QSFD 2FIKB 1TKWA 1V7ML 4ZPVA 4PGDA 3FO0H 1XF5A 3NSJA 1X5GA 3DVIA 3ARUA 1CDUA 1Y18A 1T0MB 2KQMA 3ARRA 4HV8B 5A2LH 1ETJA 4M9PA 4V2BA 2XKNA 1LWHA 1INDH 3SCMA 5GISL 4YBQD 5L88L 4DAGL 2J6EH 5IFJA 2ENQA 5DVKA 5GZOA 5F0JB 1I9JL 3LSOA 1HJCA 2BOBB 3CX5J 3N41F 1MCFA 4PSRA 3RGHA 3PCYA 4KTEL 3S2CA 1P7QB 3DK2A 4A7TA 2VDPL 3CHOA 1N59A 5MEQA 4HCRL 5TJWK 2HRPH 2ADGB 3GBEA 4AEIL 1N2RB 4DUVA 3CFIC 4FJZA 2CA3A 4NLAA 5DVPA 5GRUH 8PAZA 1KXQA 3LRKA 4HGKC 4XNBA 1EO5A 4ACPA 5I2IB 3AS3A 3KVDD 4OZHE 3GIZL 3VI3F 4QRSB 1HOCB 4K5PA 1IC4H 2X6AA 2AXWA 3BUQA 2FO4B 4XXDB 3H9SD 3M46A 3T8XA 3QFJD 4AJ0A 3WU1A 1ZY9A 5JHAA 1BJ1H 2PR4H 2YEZA 2ZCZA 3PGDA 3PWLB 2FNBA 2RR3A 2OMZB 2DWYA 2JTDA 3EO0B 2YK1H 3MRLA 3MZTA 1GPOH 3T08A 2WXIA 1ZTXH 4UQ2B 1EEYA 4KGLA 4W9EC 3RI5K 3FRUB 2NXYC 4HT1L 4JE4B 2X70B 2XVBA 3CMOL 1TVBB 2AKRA 3IJEB 2ED9A 1BEYH 1XB6A 1DTUA 3X1BA 1AGBB 5ID1A 5KS9F 4ODVH 2MKLC 1YMMA 3EOAA 5F7NC 2MHAB 2BSBA 4QO1A 4OJFH 1I1AA 4YK4C 3QT2A 3UBXA 2JVUA 1J10A 2NY2D 4P57B 1SYVB 3MBWB 3CHQA 3E9TA 2EYTA 4JHUA 2ALWA 3C6LA 2VH5L 1XWVA 4UAHA 3LHAA 2IDTA 3R19A 4HZLB 4DO6A 1G0YR 2QT6A 3ETSA 5CU9A 3K4DA 4ZTPL 3BUBA 5HXMA 1J05A 4QXTA 1CXFA 1RZJH 3EFOB 2R1WB 2EICA 3C60D 3OLGA 3NAAH 3OKLB 2FEEI 3DX7A 5H4YA 2DQGL 1H19A 5EEWA 1CBJA 4M93B 5D7JC 4GQZA 2X7LA 1RUQH 1HHGA 4KROD 1UJ3B 3KG5A 4OLZH 4PP1D 1F2QA 3TIEB 5BV7B 1OD9A 3F05A 5EFIB 2VDKB 4KGJA 2J25A 4PRHE 3H0TA 2E7CA 5D7EA 2MCAA 3HBPA 1BVZA 4Q9CA 4PV9B 1BOGA 4K3DL 2B5IC 3TVMA 1T5WA 2E7LA 3BZEA 3RWIB 1FP5A 1A14H 4ZFGL 1VKXA 4KWUA 3V7MA 1T4KB 2PPDA 3PWVA 1NIDA 4GFTB 3O2WL 4I7ZC 4WTQA 2E7MA 2EINB 2Z7UA 5IP4A 5E7FA 1CC3A 2F1BA 1FCCA 1FNLA 3JWDC 4JDVA 5DUPL 1LO5B 5GRZA 4JDZB 2PUQT 3R1GH 1N19A 4OSUL 4ZDHB 4RMRA 1QATA 4XHQA 4R90H 1OM3H 5F97E 5HDBE 1SJMA 1HTYA 2LVCA 3QPXH 4WU5B 4IIQA 4Y4KC 1I9IL 4AMXA 2PW2A 2Z0UA 1JZDC 1SJEB 4KKAC 4XXWA 5GIRA 2X2JA 4HOMA 3MV01 4HKZB 2KMWA 4YSTA 1QLFA 5DHYA 5I6OA 3POHA 1YCSA 3GRGA 1IKFH 3IDGA 4L1TA 3LS4H 4JFQA 4G8IA 1JWMA 4JZJC 4JCLA 4NQCD 2DYRB 4J3OH 3RVUC 1MFNA 1RERA 3VYOA 3G5YB 3REWB 2H47C 4LSQH 4ELDA 4GIOA 3BSZA 5CEZH 2EEFA 1L6ZA 3N1GC 3QQ4B 3GSQA 4YAQA 2IAMB 3CU7A 3WIFB 2JWYA 3IKKA 4R6UA 4G42A 5I1DA 3S97C 2P7TB 2A9NH 3E9UA 3CK0H 4TLUA 4FZ8L 4X98B 5C6PB 4GO9A 3BUPA 3MZGB 4NUGL 1WIPA 3ABKB 2VIRA 3IN2A 1ADWA 3B6SB 3SBWC 2UZIL 1DSWA 1M6UA 2BRQA 2R0LL 4ZMPA 5PCYA 4HUUB 4JG5A 2BS71 1P5VB 4OBRA 1FN4B 4FLHA 4PG2A 2G60L 3P77B 4WKZA 2FHCA 3N43F 4I3RH 2FSEA 1S5IL 4I0KA 5C09E 2QADD 1MY5A 2Z0BA 2NTSP 3CQPA 1T1WB 3IJ7A 3OMNB 2QEJA 4LCYB 1TQCC 5DQ9B 4CL7A 5HHNA 3IF1A 5IQMA 5KVFH 5ACMA 3TT1L 4G6KL 4IM8A 3RB5A 2ITDB 4ZQKA 5AUMA 1AHMA 1F00I 1H3TA 5GS0C 3TF7C 2KT6A 4TLKA 1GGIH 3RPKA 1KFAH 3QIBB 4A68A 4F7TA 2VUYA 3HVDA 1U41A 3TBBA 4EKXA 5D9SB 3CBKB 2NW2B 2YGNA 4IMLB 3UDWC 1UVQB 4EN2A 4YDJB 4K3HA 2AJSH 1RLBA 2F5BL 4BE6A 4QHUB 1UWGH 3Q6FB 3QUML 2BCKA 4K94L 5JA9A 5JXEA 5EOTB 4DFHA 3CDZA 3UJIL 1QLRA 2IWGA 2A5UA 2H9GA 2QQNH 3KM1A 2FBJH 5FKAA 1RP9A 3RUGB 5FF6B 2GPZA 2Y3NA 1IAOA 3IXTA 3ZDZF 5EUKA 1ZD6A 4GAYA 3MOQA 5D1ZB 1HCVA 4PJGA 2P42B 1OAXH 3RGBA 3O4OC 4Y19B 3GMNA 3PQYE 2CHXA 4J12A 4OCXH 4UIMA 3WN5C 4CGUB 5J12C 4YZWA 1K5WA 2WZ0A 4HHGA 1OVZA 2XA3A 3U2SA 3UMNA 3NFNB 5CBEA 2FL5B 3VI4A 4G7YL 2ADFL 5JR1L 5LGJA 1S7TA 2H8PA 4M1CD 4FP8H 5TD4A 1EPFA 3BUTA 2YD4A 2HFEA 3QQ3A 1XSIA 3MRCA 5IEKB 5F6IC 1NEZA 4J3OF 4LMQI 1UOLA 1I7TA 4HWBA 4GNKB 4UZSA 4XO4A 1WZLA 3RURA 5BOJA 1MJJA 3CHPA 5FS5A 1B0RA 1GZPB 1F4XH 3KD4A 5D2LE 2HWZL 2YD8A 5AW2B 4DN4H 1DBKH 2Q86A 1TKWB 5ID0A 2CK0H 4ZPVB 4PGDB 5EEZA 1XF5B 3IAQA 1DQLH 3NSFA 1IKOP 2IBZX 3L5HA 4HJEA 3K6OA 1Y18B 2ERJC 1U6AL 1CFMA 3SE9L 5H4ZA 3N9GH 4CSPA 2NQDA 1KEGH 3WXWH 1MCKA 2XUWA 2XKNB 4FN0A 5JHDE 3SCMB 5IK3A 5IFJB 4QRRA 4KO6A 4K5OA 1UEMA 3QEGH 4M7ZC 1DYZA 4DTGL 2YMOA 3LSOB 1MHHA 1EVTC 3I9GH 4Z7NF 1N59B 5MEQB 3MUUA 5BW7A 2VLKE 1ZT4A 4NHCH 4XP1L 4ZX5A 3BFWA 4I3SL 4HH8A 1F97A 5HHOA 3L1OH 1I1FA 3S36H 3APCA 3G6DH 3GNML 1NMAH 1CD0A 2VL4A 4M8QA 4Q6IC 4JNXA 1KCUH 3TJHD 1PVHA 4P2QD 1FE8L 3UPRA 2EKSA 3DIFA 3T8XB 4RWHA 5EZIH 1I8LA 1UUSA 1LO3H 5D7IF 4QXGH 2Y23A 1RIUH 5FGBA 1TF4A 2YEZB 1WIOA 3PGDB 5IB4A 5E2VL 3PV6A 2GIYA 4FEMA 4OGQC 3MRLB 4KITB 3SQBA 3OHXC 1JP5A 2GJZA 4ZJ9A 5I1GL 1EEYB 1FIGL 4R8WH 4F7PA 4Z3HA 4PJHA 1DLFL 2IV9A 2AKRB 4XOBA 4CDGC 2WJ5A 1ICTA 4Y4FC 5ID1B 5F3FA 2V7HA 1S46A 4Y2DA 2HKHH 1YMMB 3EOAB 3MBEA 3R4DA 4QO1B 3NSDA 1I1AB 3ZT5A 4OLXH 4EDWL 1C5BH 2VLRA 1EQWA 3UBXB 3RZWA 3HPJA 1VCBC 3FL7A 4QAMB 3WUWA 4LEXL 3B37A 4F33A 2EYTB 4HG4K 3C6LB 1WO2A 4MX7A 5L2KD 1GL4B 1HC1A 4JL2A 4MRCA 5C0FA 1J8RA 4G8GD 2ZX7A 5CGTA 4E9YA 3FK3A 2ZD0A 3BWSA 4NDMA 1OLLA 2C3WA 3QZWA 1J05B 2HCZX 4QXTB 5CGYD 2YEVB 5I15L 1AQ8A 2TSBA 3TH4T 4U6XA 1A6TA 1LP9E 4XHJC 5D1QC 3DX7B 3ARWA 2D2OA 1NFIA 1FHGA 3TASA 4GXFA 1H15A 2B1AL 1HHGB 2OR9H 2X7LB 1NLDH 4WK2B 4X9BA 1OTUC 4R0LA 5B39A 1U8PA 3OBAA 2PXYA 3HE6D 1QFWM 1HEZA 3H0TB 2G5BA 1NKGA 3MLSH 1CL7I 1ERNA 1BOGB 4J3VA 2FRGP 4OCWH 1T5WB 3TVMB 3BZEB 2W9DL 2WBXA 3UJTL 1VKXB 4MXWL 4WWNA 5HJBA 4LSRL 3PWVB 3DHUA 3GZQA 3RGVA 3RHWF 1AZNA 4K9EH 5ELIA 2PYFA 4JO3L 4PJCF 4JDVB 4NKDA 3HS9A 2AI0L 4MD5A 4X7SL 5IT2H 4X6DF 1OAKL 4XPAH 3ULSA 4C54A 3F7RA 3B1TA 2EADA 2HT3D 2JKNA 4HCIA 1Q9OA 2D3NA 4KUZL 3QHZH 3JWNH 4IIQB 2G5UA 4X99A 2PW2B 5GIRB 1PPIA 4LBAA 4P46D 4OLYL 1PAZA 4PI2A 5AB0A 3H9YA 4JZOA 1NCWH 1QLFB 5HHQA 3KAAA 5DHYB 3BFOA 4XCCL 3QIWA 3CDCA 4IU3A 5C0EA 3IDGB 2DLIA 1EGJH 5F7EL 4JFQB 1PZDA 4G8IB 1JWMB 2F54A 3VXSE 2Y7SA 2QL1A 3MCLL 1DFBL 5HYJD 4QKTA 1XF2A 2VSMB 3DJZA 3GSQB 4YAQB 4KJPC 3BKMH 4G42B 4ZZKA 5CUSL 5I1DB 4KTYA 2YWZA 2WB1A 3DDGA 3HI5H 3DOHA 2YC1A 1Z9NA 1QR1A 1AI1H 3GRWA 2R69H 3MJ9A 1G7PA 2VKXA 1U3HD 4UBDD 1RK1A 2VIRB 4X42A 5DJAA 4KXDA 3OTTA 2F19H 4Y8AA 1QLEB 1UCBL 2Q3ZA 3MV9E 1NH6A 2HTLD 3V10A 3V6FA 1NUFA 1PTZA 1QBBA 4XN2A 4WKZB 5CINL 1HYSD 5AYTA 4M00A 2FSEB 2BSTA 2IBBA 1SXAA 4A7GF 4AIZA 5HHVH 2W59A 5INDA 3SE4C 3NCEB 1TMQA 4FCAA 4YHLL 5HHNB 3IF1B 1S7WA 1KYDA 3NZSA 2B9BA 3PDOA 3R8QA 4E41E 4PS3A 2AMUA 4ZQKB 3TS8A 5AUMB 4KVCL 3KXFE 4B9GA 3ZE1B 2W0FA 4EI5A 1KCBA 1BBJA 5F0LB 4H2AA 3TZVD 4F7TB 3B34A 2Y2TA 3FO1A 4F57L 1U2HA 4RFOL 4DPRA 2AXFA 5E24E 4YOKA 3TH3T 4MHHG 3V6OC 2DQUL 5CKGA 3V4UL 1ILUA 1UXMA 2EVJA 2BCKB 3UTQA 4F27A 1DVYA 4XC1H 3KBEA 4NBZB 3CDZB 4UWQB 2ZWNA 3F83A 1QLRB 5IQLA 1R9FA 2H9GB 3OZKA 5CZXC 5F3HA 5FKAB 1INQA 5CR1A 4PRNA 3IXTB 1IAOB 2D9QB 4FFZH 5EUKB 4GAYB 3QG6A 5DHVA 1U4EA 4YSPA 4PJGB 2XACC 1YQVL 1WFMA 4WY7L 3MCYA 1A3LL 1CE1L 4FFYL 4OIAA 3GMNB 5I1HL 3OF6A 2YAHA 4UIMB 4MJJA 2CIKA 5E6SB 4Z0XA 4Z7QE 3U2SB 4KRNA 2G0KA 3GFUA 5CBEB 3VI4B 1NMCC 3MV11 5JXAL 4MA3A 4DCQA 5KSVA 5LGJB 4DP9X 4KDVA 1S7TB 2H8PB 4JRYD 3A23A 3LX9A 4HXBH 5D70L 1P4BL 3VQLA 1AZVA 2HFEB 4X7TA 4LPVA 3QQ3B 3MRCB 1NEZB 3UTTE 4GAFB 4P23D 1NANH 2BWDA 4PW9A 1I7TB 1N6QH 1X4YA 1MJJB 1ACYH 1B0RB 3FFOA 1KJMA 4N87A 1WBYA 1FL3A 4M48L 1E7UA 2BMKA 3PWPA 2Q86B 3HFMH 2ZWZA 5ID0B 3KPRE 2VMFA 3QI9A 2AJVH 4XPTH 1ZV9A 5C07A 5DTFA 4LSSL 3LZNA 5HJ3A 2C9AA 3KYKH 2ZUUA 1QHQA 1IGCH 4PB0H 1R47A 3K6IA 4NN6C 5I9QB 4QRRB 5IK3B 3E6HA 2OV0A 2ICES 2XN9D 2B0SL 2N0MA 1NDTA 1MHHB 4M7JH 4Z3GA 5LXGH 4HFUL 4ERSL 1L9MA 1ZLEA 1ZRUA 2GABA 3AY2A 3S5LA 5JW4N 1J8SA 1ZT4B 2DTSA 2AQNA 3ILEA 3BGMA 3D3VE 4UQEA 4TQEL 2YMXH 5HHOB 4MQSB 1I1FB 5BVPL 1E8XA 2ICWJ 2V4LA 5TK4A 4M8QB 3WO4B 1CB4A 5F7FA 4N0YH 2FAUA 3RDTC 2RB8A 3UPRB 1QFWI 2EKSB 4NQED 5D4QA 4PGEA 3DIFB 4JE0A 3K2UL 2OI9B 1YPZA 5E4IA 3RFRA 3QUZC 4HETA 4LESA 2PCFA 4R2GB 1D5ZA 3Q8EA 5IB4B 3PV6B 4OKVA 5DUJA 4WDIA 4XMUA 5BQDA 3SQBB 5AB1A 2GJZB 4F7PB 4PJHB 3RVVD 2QV2A 5ICXA 4WWOA 4XPGL 3ARGC 3ARVA 2V37A 2MCPL 2V7HB 4Y2DB 3WNMA 3MBEB 3UO8B 3N6YA 5AKTA 1GSMA 4GT0A 2VLRB 3HPJB 2NX5D 3QZBA 4KC3B 3ARYA 3WUWB 4AJYV 3S37H 4F33B 3TPUA 4MX7B 3MLXL 4NWUL 2Y5QA 5C0FB 2NR6D 4LSTH 5MI0B 3K46A 4FNPA 3SQOL 1OZTG 5I1AA 2PWDA 1CBVL 4L8SA 1XB8A 4NDMB 1I9EA 2YZ1A 3QZWB 1J9CT 1FCGA 1IC1A 4KVNH 3LMJH 1B4JL 2QPFA 3MAWA 4NP9A 2ESVE 1CLZH 1RZGA 5GRWA 2Z31D 4NB7A 4U6XB 1UZ6E 1A6TB 3KLAA 4P9HL 2P80A 3NJNA 5GRXG 4JO2H 3QGVA 1NFIB 3UYRL 3VWJD 1H15B 5K1NA 1CMOA 4F5CE 4AQZA 2W07A 4N9OB 2Z7ZA 1BHGA 4R0LB 1U8PB 4XO5A 5F96L 3U6XS 3X12A 3GSNA 4YQXL 2PXYB 2HJFA 3O9WA 1HEZB 2CGRL 2MKWA 4I87A 3UAEA 2G5BB 5D96C 2NY0D 3B2UD 1G7QA 4LCIH 5FYLH 1OWWA 1Z1WA 4YHML 2X6BA 4JR9H 3PP4L 3LKSA 2I07A 2YARA 4WENB 5F7YC 3RGVB 4R96A 5B1BB 1E4KA 1WZ1H 4JRXD 4AENA 5KUMA 2PYFB 2G5RA 5C3TA 4NKDB 2IO5A 3RTQC 2VDRL 2AGJH 2F8VA 4K2UH 2KZKA 4XMLH 3ARFA 4MD5B 3QIUD 4X6CA 1XXFC 2DDQL 4A7UA 1EA9C 3EFFA 2H1PL 3ULSB 4NQUA 1KCVL 1Q9OB 4JQXA 3U83A 5EO9A 1RUAL 4X99B 1TYJA 3A4EA 3W11C 5IESH 3FCTA 1E9PA 4JZOB 1MF2H 5GGVY 3FFCD 5HVHB 5HHQB 3CZGA 3QIWB 4JRWA 4BZ2A 5C0EB 1AGFA 2H2SC 2NY6D 4AKPA 3VX1A 5AAPA 1MPAH 3P0VH 1NFDF 3T3PE 2E8YA 2F54B 3NCYS 1UA6L 3I84A 5JQ6H 3FSAA 2YD0A 2AZUA 2R9HD 2CMRH 3C2SA 3FT3A 4OU3A 1HI6A 1SLUA 5SWSE 1XF2B 4AV5A 5GSRA 5D55A 5IVXF 4JO4L 5SX5H 2VW4A 5BVJA 1XCXA 4M43L 1YC7A 4FNSA 1KLUA 3FONA 4GXVL 2YC1B 3O3BA 1QR1B 3FBKA 1K2DA 2VXTH 3S34H 1G7PB 3DBXA 2X44D 1SHXA 2VLLA 1NUDA 1RK1B 2OJ1A 2HAZA 1Z3RA 5DJAB 3MUY1 4NZRL 3WEBA 4UTAA 5I6PA 3B8YA 2CLZA 3V6FB 2D03L 1EDHA 1MHEA 4MJ2A 1U58A 5DYFA 1LYQA 3IYLW 2ZUSA 2FDBP 2FEEL 3QISA 2BSTB 4XTRC 4AIZB 2XU9A 3L2MA 4MQXC 4JPVH 2ZX5A 1S78D 1CDCA 1QLEL 2XZAH 1FNFA 5INDB 1CYWA 4XH2A 4GS7B 1S7WB 5ERWA 1DQVA 3PDOB 3F8UB 3VAEA 1TFHA 4BRVA 2AEQL 4PJEF 4LGSB 4BKTC 1ACCA 2W94A 1CGSH 3ETBJ 2W0FB 4WTXA 4YHYB 1YEIH 3TYFA 4EI5B 2CUAA 4WO4A 1BBJB 3VXUD 2B14A 1NAKH 4CA4A 4HGWA 3F85A 3FO1B 4TTGA 1G1OA 3NFPA 2AXFB 3HB3B 1TJXA 1UH3A 1Q0XH 4FMFA 1SF3A 3DKHA 2XICA 4R4FL 5GGQL 1T89A 1OGAE 4FQHA 1MZYA 4IDJH 3KPTA 1EDYA 3HCVA 4BSJA 4DGUA 1BCIA 4KY1L 3T6QC 2X1WL 3UL4A 5CCKH 4FFWD 5F3HB 3TLRA 2IANE 1INQB 4Y4HA 4PRNB 4Z7VF 5GS1A 5DZPA 2XG4A 4LCCA 4XN5A 4B53A 3H1ZA 4WJ5A 4YXLL 3EBHA 3SKJH 1TXKA 2XIBA 3QG6B 4WI0A 3WFEL 5DHVB 4PCYA 4I0PD 4JQVC 4KO7A 2XWBA 2ZNXA 1NCAL 3SO3B 5DFTA 4GG6F 2CIKB 4Z0XB 5GJTH 3LB6C 3WFBL 2MIZA 4OCLC 4AC4A 5JMOC 3M8OL 4EOWL 1P7HL 3JV6A 4MA3B 1NEPA 3SKNA 4DCQB 5KSVB 3MNMA 5IMMA 4Y9GA 4TVPL 3ML8A 1UWEL 3T0DA 4X7TB 1M4KA 4OCRL 2VOTA 4GUPA 1WA0X 3AWFA 1QACA 2H5UA 3JXAA 5T5FH 3DSFL 5B7EA 3UAJA 3DXAE 2VDQB 2C26A 3K5RA 25C8L 4FQ1H 3ISRA 1KJMB 3RVXD 1WBYB 4BUHA 1FL3B 2BMKB 3PWPB 2XY2A 1M3JA 3A67H 4LKCA 5F9JA 3QI9B 5C7ZA 2BFVL 1FF5A 1KUMA 3V0JA 2J1WA 2Y6SD 4UNIA 5EMYA 2OL3A 5C07B 5DTFB 1RHHA 5KVEL 5HJ3B 5D4JA 2AQ2A 1NWPA 2EXSA 4UT6L 5FUCE 2PABA 1KB5A 5T1DH 4Z78A 4RCAA 3E6HB 4JBSA 1XR8A 5BO0D 1YNTA 2AEPL 3QH3A 1SBSH 1XSKA 1F8TH 2GSIA 1UADC 3KW7A 3TBTA 4G9FA 1JV2A 2DZEA 1NC4D 5E2UH 3S5LB 5KVGH 1MREH 3V0WL 1OTTD 3BGMB 3GBNH 4JHZA 1TZAA 1FNHA 2GI0A 3RWEA 2OSLA 4CC4A 3LPPA 4JKKA 5EUOA 2FD6H 4WFGE 1MHPL 4HK3J 4ALAC 3DBSA 1A3QA 4M5SA 4PGEB 2VR9A 4QPEA 3VRJA 2AK4E 3KS0J 3VFRA 2DM7A 1ZHNA 1JZFA 1YPZB 1JFQL 3C5XA 2F68X 2PCFB 1V7MH 4MAYD 1D5ZB 4KJYA 4FOMA 1QW9A 2F7RA 2DQTL 4OKVB 3QORA 3LKNA 4WDIB 1C9SA 4N85A 3QDME 2GUOA 2HA1A 2QHRH 2JB5L 4ZUUA 4KO5A 1KCSL 4FXGC 4P06A 4QRFA 3HI6L 5GISH 2F53A 4DAGH 1QEWA 3HZKA 5L88H 5ICXB 1A7NH 2CJ3A 2WXKA 3GKWL 1I9JH 5C97A 3NRQA 1IE5A 2JJSC 1V54B 4LF3A 4APQC 2ROXA 3VG9B 1IBBA 1W6WA 2NYKA 2VC2B 4HF5L 4KTEH 3MRRA 2FLRT 2VDPH 2WZAA 1MRDL 3ECWA 4HCRH 3GB7A 4F3FA 5H37G 4AEIH 4WHTA 2X89D 3VRIA 2XJKA 2VUKA 4L3EE 3TPUB 4B27A 4JGMA 4XWOC 4Z3TA 2F08A 2YD6A 2BWQA 2Q7YA 5I1AB 5ABZA 3AB0C 3TJEL 4L8SB 1MCNA 1CS6A 1QWHA 3I6KA 4WAFA 1G7HA 4LCWA 3X2QB 1HFUA 2G0LA 1E42A 5JPNC 1TTCA 3CXHJ 3O0RH 5BZXA 4DPCX 2ZNWA 2EE0A 2OZ4A 2N1TE 1COBA 4GRWH 1RZGB 2D2CC 3B83A 2PO6D 3KLAB 2BVQA 2WTRA 4HLJA 3VXRE 1THAA 4POUB 4IQHA 3HOGA 1AXSA 2W07B 4BBWA 5FDWA 3X12B 5DWPA 2MPAL 4PGBA 2HJLA 3GSNB 4A1RA 2HJFB 3O9WB 3V6BR 1KYOK 4HT1H 4MHHI 1JMXA 1XH2A 4AM0Q 1JWUA 3CMOH 4QOKE 1K8DA 3G9VA 1DJYA 5B8CC 1R4XA 1G7QB 1WYJA 4M5ZL 4H25A 5FXCH 2OMNA 1V10A 4OZHA 3LKSB 2I07B 4IOFC 4R96B 4AENB 5CIPH 3AXLA 1N70A 4HUMB 2W65A 4OFPA 1MJ8L 4JN2A 4OQTL 1HK6A 1KBBA 3ARFB 4X6CB 3UABA 2VH5H 4OD3L 3GXTA 1A7BA 1E5YA 1Z2KA 3CN3A 3EHBC 1WWAX 3EFFB 2NYYD 5B3SB 3ZHDA 4IKLA 4UYQA 1E8YA 1Q8MA 2A3TA 4X6DE 5EO9B 5T3ZH 4GUQA 4ZTPH 5J1SC 3VTAA 1P69B 5F72S 4EZLA 4L18A 3FCTB 2R4SL 1C8PA 1E9PB 2K8MA 3E0GA 3IDNA 1JSYA 2AK1L 1TEFA 3QPQD 4X80L 3OKKA 3ULUL 2DQGH 3H3PL 1AGFB 3N42B 3B2VL 1T66C 5DXWA 2O6EA 4FQXC 4RBPK 3E80A 2TRHA 4S1RL 5C70A 3FYIB 2XTJB 1SPDA 2B3IA 3KHQA 3FT3B 3KGSA 3F64A 5F7WC 4UTAH 1HI6B 3VXOA 4K3DH 1E9OA 5GSRB 4ANUA 2DB8A 4S1DC 5BVJB 1ILSA 1PZUB 4ZFGH 3ARDA 2QZQA 5AOIA 3TN0C 1IT9L 1KLUB 1VF5C 4ILDA 3FONB 3O2WH 4C83A 3O3BB 5G55A 2I7SA 3JTTA 3B9DA 1K2DB 1A3RL 1SJVA 2B77A 4FERA 3DBXB 5DUPH 3MXWL 4OSUH 2VLLB 2XDHA 1CIUA 2MTPA 3US9A 4K8RC 2YAEA 4PPTA 2A9ML 3Q8FA 1YEHL 2V33A 4DGYL 4TVPD 1PEWA 1VZIA 1YRKA 1URIA 1RJCA 1D6EA 2CLZB 3QUGA 5HYEA 3QUXA 4XNQA 1MHEB 5CSBA 1U58B 4PRHA 1I9IH 5HJGA 3HG3A 4OJCA 3VMOA 5BRZD 1Z9MA 2PN5A 1GY2A 4RISL 1ASPA 4O2EA 1OP4A 4BWUA 3HN8A 5LNEA 5HI4D 4P4KC 4UQ3A 4OVVA 1NBCA 4XH2B 3MUJA 4EVNA 2VABA 5ERWB 2F6AA 3PRZA 2CD0A 5E8OA 5C9JA 2XWCA 4WUUD 5DI8A 3TEYA 3PWNA 1LO4L 3B9VA 2EC9U 3CFCL 3TYFB 2X3BA 1K4DA 4WO4B 2C4FT 4AYBA 4ZUSA 2WYHA 4HGWB 3NIFE 1RLWA 4M1DL 3KEDA 3NFPB 3WV0A 1A5FL 6PAZA 3UZEA 1LLAA 2F15A 2R29L 3LIUA 4FJYA 4GG8A 3CFEA 4YZFF 2W9EH 3O41A 4FZ8H 3QVAA 4GQ9L 1L7IL 2ENPA 1JXGA 4NUGH 5EF1A 4FQHB 2OR8A 1CVSC 1R75A 3HCVB 4ELMF 4HWZA 2UZIH 2ENJA 2R0LH 5DMIL 5C8JA 2HT2C 4Y4HB 5GS1B 4IIZA 2XG4B 4LCCB 4YXKL 4WJ5B 2G60H 3AREA 3H6JA 1ECYA 1S5IH 4WI0B 4LAQL 5AG9A 1D2OA 5CLXA 1RZPA 4GLRH 4TLSA 2NPLX 4RQQA 3JWOC 4TTDD 4ZOAA 1M7IA 2IC2A 2XWBB 3QEUA 1QSZA 4G8FA 3AU0A 1QHOA 3O2DA 4R5XA 1AJ7L 2F7PA 2X2UA 3IJSA 3OHMB 4G6KH 1P84J 1QWNA 4BSVA 3JV6B 2CR0A 3SKNB 1F58H 4F92B 5IMMB 3U48A 4OZFA 3TFBA 4A2EA 4KQ3L 5JPMA 5DO2C 4X5WA 2Z7YA 3QUYA 5IZ7A 1BJMA 2H3KA 2P5EE 1EWHA 4GUPB 3G5WA 3Q8CA 2CRZA 1K6QL 1TJIL 1GS6X 1BXXA 1T2JA 3U4EA 5JQIB 1OXYA 2F5BH 5JW4Q 3VWKA 3O11A 3QUMH 4MVBC 4BDVA 4JL1A 1E7VA 1R0AL 3FTUA 3GMLA 4K94H 4LKCB 4H1LG 2JV6A 5F9JB 1AS7A 3UJIH 4YE4L 1G6RA 2QSQA 4FNRA 2OL3B 1RHHB 2YPLE 4PJ9D 1UD8A 1KB5B 4Z78B 3GPSA 1QD0A 4PVMA 3NQKA 1XR8B 1YNTB 2ED8A 4GP4B 1GW0A 3L17A 3QH3B 3LVTA 2GSIB 3SPGA 3TBTB 2Q6WA 4G9FB 1JV2B 4GUOA 2BY3A 5E9DD 4MKTA 4GI9A 1FSKC 4G7YH 2WOYA 2ADFH 4PWHA 4YDLB 5JR1H 1MIML 1ITCA 1NAMA 1XTMA 2TSAA 4MJ4A 1WTLA 2DLEA 5F7UA 3RWEB 2OSLB 5KANG 1LWJA 4H2CA 5EUOB 3L4VA 5IEHA 5EU6D 2G2NA 3VRJB 1GCFA 3VFRB 2Z6FA 1ZHNB 1VAHA 2K6ZA 4C4UA 2GUYA 2QGDA 2HWZH 3HMXL 4DP5X 4KJYB 3PQYA 3BRFA 5JIQA 1QSED 3QORB 3LKNB 5JW4R 1GIGH 3HJEA 2Y1YA 5KUKA 1U6AH 2GUOB 4WJG3 3SE9H 4ZUUB 3OG4B 4L5FE 5FPIA 1OPGL 2F53B 1QEWB 1YYCA 4HZ1A 1AOHA 4DTGH 3JT2A 5A3ID 3DJTA 4LF3B 2FT6A 3NGBC 2RH0A 3ULUD 3MRRB 1PY0A 3PFUA 3UBHA 1TTRA 3UGXA 4G8AC 3GB7B 4F3FB 2VSDA 4IKJA 4WHTB 1KBWA 2H6PA 3VRIB 5LBSA 4LGPB 5CFHA 2AQ3A 4YX2L 3GNMH 1KDIA 1DVFA 2Q7YB 4WW1A 4XMXA 3UFIA 5I6XB 4RMTA 1KN4L 3I6KB 4I8DA 1G7HB 1E27A 4LCWB 4ELKA 1FE8H 4ZO6A 5J9PA 5BRQA 2E46A 3GBLA 5J3HC 1JYVA 1BVOA 1A4CA 1OV8A 4NAJA 1HN1A 2BVQB 5DJYA 2WTRB 4PSPA 5E2VH 3IPEA 2OCJA 3CXDL 2LGNA 1EAOA 3A4FA 1AXSB 3DURA 5DS8A 5FDWB 2CXKA 2VLKA 3KBHE 4PGBB 5I1GH 2HJLB 4LFHG 1FIGH 3RZCA 1JWUB 2DM4A 1DLFH 1K8DB 4AY0A 3GJFK 5B1AB 4EO5A 4H25B 4Q7DA 1KLFA 5F7AA 3I6GA 4OZHB 2V17L 4O02L 1H8LA 2HKFH 3CFMA 1N64L 1OB1A 1T04A 2FUTA 4UAOB 4HHWA 4UILL 3AXLB 2IDUA 3D08A 1DJXA 2W65B 4EDWH 2KI6A 4YPJA 5CJ5A 3MRQA 4LEXH 4AYDC 4JN2B 3TJPA 3GS0A 3CSGA 3QE5A 5J06A 3HZYA 4Q14A 1QFWL 2XJLA 3EH2A 2B08A 1E5AA 3EG9A 5DA4A 5BZWA 1QRNA 4I4WA 3B7UX 5D93B 2ARJA 5I15H 1ZGLM 3K2KA 1WITA 4POZD 4MA1C 1GYWA 3IDNB 3ATEA 1JI2A 5EBLA 4J4PC 3ZZSA 3GXIA 3OKKB 3MOBL 2CHZA 2B1AH 2WP3O 2XOTA 4R26H 5I76A 3MGAA 1DBML 1NOAA 5I73C 2ARWA 1AS8A 1BGXL 3BPLB 4OF7A 5EV7A 5KZCB 3D51A 1B6DA 3VXOB 1ZWIA 1E9OB 5E5RB 4I1PA 1MEXL 1S7XA 2FQEA 2W9DH 3UJTH 3ARDB 3MLYL 4MXWH 4LSRH 2VLJE 4LEOA 1U8JA 1BXUA 4W9GC 5IVXE 1S6NA 4C83B 3JTTB 4JO3H 3K4AA 1OLZA 2NY5L 4KK6C 1LP9A 4OCSL 1T80A 2AI0H 3V9FA 4ECNA 2YQ2A 4EN3D 1KV3A 4X7SH 1OAKH 2O5NA 4RDBA 2CKBL 1D6EB 3D4YA 5I16A 2BSRA 3QUXB 4HSAC 4PWEA 4KUZH 4XNQB 4KX8A 4PRHB 2V5YA 3HE7C 3QRBA 4X4XA 4MASA 4OLYH 3SY6A 4NJAL 1EZVY 2NXZD 4O2EB 4TSBL 4R7NA 3VVWA 1ET8A 1JZ4A 1LO0L 4DO5A 1JRHI 4XCCH 3QXVA 2Q0ZX 2VRKA 4UQ3B 4XE5B 3SDDD 4DEWA 3X3GL 2VABB 5G4NA 4EVNB 1LNUA 4H7VA 2Z4QA 5E8OB 5C9JB 3ALPA 3ESUF 4XNZB 5FYJL 2YQBA 3MCLH 5B38A 2J1XA 4LVOB 1DFBH 2OTPA 3IN0A 3PWNB 3K80A 5DI8B 4I5BA 5EZOL 1K4DB 4KFMA 4ZUSB 4YH6A 4PAZA 4G6ML 2R56L 1CFTA 2I9LA 3TX4A 5CUSH 3ZU8A 3GPEA 2CBPA 1ORQA 4GG8B 3CFEB 3O41B 4KMTL 5I23A 3BQUD 5MENE 3T0WA 4HWZB 3O2DH 1UCBH 5LVEA 3UBFA 3VXSA 1MQ8A 3IGAA 5C8JB 1IZJA 5ISZD 1WH0A 4DGIH 1A22B 4PJBE 5CINH 3AREB 2AQPA 2HLFD 2BY0A 2VGLM 3ILQD 1AC0A 4QTHA 3CC5A 2BIOA 4RQQB 2DQIH 3EXJA 1M7IB 2ZICA 3QEUB 4YHLH 3OWRA 5A2KH 1G0DA 4G8FB 3ULVL 3QEQE 1O5PA 1RPKA 1RY7B 3IJSB 2RCSL 3B7TA 4G6FB 1Z0NA 3AWEA 3RRQA 4BSVB 4ZODA 4GG6E 4OUOA 4KHTL 4ODTL 4KVCH 4FYQA 4WRLA 4PY8I 4OZFB 1QI5A 5JPMB 2HB0A 3FCUB 4R7LA 1UA3A 2OMWA 4X5WB 3QUYB 4LPYA 4X0KA 4X9IA 4F57H 1EAJA 1A7PH 4PG9A 5BS0A 3HC0A 1J1PL 3DETC 3U4EB 5IROA 1S9VA 3GYRA 4HIJA 4ABWA 3BN3B 5FW6A 2DQUH 3VWKB 4B9CA 3H9HA 3V4UH 3O11B 3KBFA 4BDVB 1WF5A 1GGBL 3GMLB 4MJIE 2WCPA 1MVUA 3DA0A 3RWHA 3TU6A 1NGQL 3V8OA 4AKOA 4N2HA 4TF4A 5I6LA 1G6RB 4X2UA 4KDTC 4P5TA 1U95A 3WY4A 4OGAD 4E41A 2XKSA 4QWWC 3OSVA 1R3JA 2WXGA 3BH8A 1J0ZA 4YR6A 3JV0A 1KWGA 1YQVH 2TRYA 4D7PA 4WY7H 4WJKB 1A3LH 2MQCA 1GOFA 5JYLA 1CE1H 3EJZC 4FFYH 4PBDA 4UOW0 4HOZA 5I1HH 2X4PA 1UFUA 2Q6WB 1AYOA 3F12A 3JTBA 5J13C 1SJXA 3X17A 2WWNA 4NWTL 4CN1A 3FT1A 1E28A 4PJ8D 3UIYA 5JXAH 2EUXA 2WO3B 1XGRA 3MRNA 1NAMB 4Z7OE 5D70H 4H8UA 2QSCL 2F8XC 1P4BH 1CXEA 4LL9A 2VDNB 3BMWA 3NJHA 1JGIA 5H37A 4YLQT 3WMQA 4BCZA 4DESA 3PNWA 5IEHB 3SJVE 3O6KH 1UOWA 4FNUA 3O8XA 3QUHA 4M48H 4TUJA 1WVZA 5JIPA 2ZYHA 3PQYB 5HDOA 3PREA 2P1YA 3D12B 5AVUB 1F6FB 3N44B 1GSKA 5C7XH 1N5YL 4QKXB 3NPSC 1KENL 3WELA 2LV4A 2WYTA 4BQ6A 2X4NA 3QZLA 3HC4H 4NC0B 1VEPA 3WLWD 4TV3A 1YSOA 2H0PA 3LPGA 2IFFL 3H55A 4JB9L 2HVBA 5E5LA 5KYYA 4NRZA 3LDBC 3QDGE 4U05A 5B1CA 5C92A 2B0SH 3FPYA 1MHCA 2JKLA 2Z9TA 5DLML 2WQRA 4HFUH 3L3OA 3UTTA 4ERSH 2WYIA 2DQCL 3NDYE 5DC4B 1U4FA 1Z5LA 3B2MA 3IGUA 3TURA 3OAYK 2H6PB 4TQEH 3KPRA 4MZRA 5BVPH 1KTDA 1QPXA 2ZOWA 2A9CA 1DVFB 1TCMA 4WW1B 1J1OL 4NJ9H 5I74B 4DQOL 5IHBA 3UG3A 1QQDA 1E27B 3OLEA 1SXSA 3RWJA 4V1DE 4ELKB 1M42A 4LIQL 5J9PB 4AE0A 1JI1A 4Y16C 2WCSA 3K2UH 2WWKO 1XGUA 2FLBT 4GO8A 3EJSA 4Z3JA 4ODUA 2WLMA 5DJYB 1HXKA 2K3HA 4L0YA 1TZGL 1IM3D