2L3BA

Solution nmr structure of the bt_0084 lipoprotein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr376
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
b'MNDDVDIQQSYPFSIETMPVPKKLKVGETAEIRCQLHRDGRFEETKYFIRYFQPDGAGTLKMSDGTVLLPNDLYPLPGETFRLYYTSASTDQQTVDVYFQDSFGQLQQLTFSFNNDSSKEEELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein found in conjugate transposon
molecule tags Structural genomics, unknown function
source organism Bacteroides thetaiotaomicron
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
total genus 18
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2010-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l3bA00
2L7QA 4LBAA 2L3BA
chains in the Genus database with same CATH superfamily
1MCSA 1QBAA 4LDOB 2RCSH 4PGDB 4QHNB 4CBPA 5FDWB 2YXWA 3VFGH 1KB5H 1PNCA 1G7PB 2VLJD 3T1FB 1YMHB 1SEQL 1YQ2A 3BOVA 3FFCB 3KYMA 4NRXB 2NT1A 3K4ZA 3LIZL 3S3CB 5D1QA 2K4WA 2IGFL 4GKSB 2K8QA 5AYUH 2DQ6A 4GS7C 2K7QA 1P4LB 1C08A 4JFEE 4NFCA 3ULVE 5ABZA 2VDOB 5GGUA 3MRCA 4V1DB 4KK6D 3MTXA 3QNFA 4KMLB 5DQ9A 4AIXA 1NGQL 2WBXA 2YMXH 4AMKH 3CN0A 4M5YH 5B1AB 4KOCA 3PQYB 1KXQE 2Z4TA 3UJJH 1DSYA 2NW3A 1X7QB 1K85A 4MDJB 3IDGA 4ZQTA 4LEOA 4RGNE 3TYGL 3L1EA 4ISVA 5L0QC 4OLYH 5I2IA 1QACA 1AZUA 2CRZA 4U6VH 2C9QA 2ZKMX 2VOTA 2J20A 3AUVA 1AS6A 5DVLA 4PHXA 3PGDB 2G5RA 4F5CE 1VEOA 1CD9B 5C0JA 3DVNB 4PCSA 3P3RA 3TBVA 4G11A 2FRGP 5FA4B 5CBAB 2F5BH 4KZDH 1EVTC 3L5WA 1F6FB 4DPBX 3PNWA 1FJ1A 1PLAA 3L9YA 4RNRB 4GUOA 2XWCA 3LPOA 5T5NF 5FM5O 2FWLB 3PWPE 4JFZL 1CPUA 3DX0A 1QZ1A 5EA0H 1NEZA 1IKNC 1NAKL 1DVFC 4N1HB 4GAJL 3EJJX 4F9LC 2OL3A 1K4CA 2BWIA 5E5RB 4X8JB 4KDWA 3UZEC 3NCWA 4N20A 4UILH 4KXDA 1NIFA 1UD4A 3WU1A 3V6FA 1NFAA 4XT1C 2YJLA 3UXFA 3VVVA 5SWSA 1L9MA 5C0NC 2VDPH 3FU3A 4AK1A 3N1QC 3QR1A 4ZW7A 1QSFE 5KBNC 1L0QA 1GJWA 3D8MA 2IMNA 4H44C 1XCWA 4PS8A 1T1ZA 2NYKA 4J3WA 5AALA 4NHUA 3NABH 3ML8A 1JV5B 4AY0A 5HYSB 3T2NH 3WXWL 4GMSL 2DQJH 3NCYS 4GRWB 1G7IB 3WFHB 2EIZA 4HOMA 1DQLH 3I9PA 1T7VA 3ZQXA 2ZXEB 3CFJB 3OPZL 5KVEL 3D18B 1KIPB 4HDIA 3CUPA 5FIEA 2HRHA 4XOAA 1YPZA 3SE9H 4HCRL 5T5FA 4HPOL 1ZHBA 5CN3A 1NGYA 3KS0H 2W0PA 3HE7C 3CHQA 4ZTPH 4OV6F 1QFUH 1MEXL 2AEIT 3BXNB 5D7IA 3AWFA 4EIBA 4XBGA 1HHGA 2B4CC 2HUHA 5IY5B 2XN0A 3KDMB 3MJ7A 2VERA 3BQUB 4QYOA 1I1FA 1MQKL 1U4EA 3NCJH 3EUDA 3PCYA 3N44B 5ACLA 1I75A 3KAAA 4MAYB 4JO1H 2OULB 2QADB 5FK9A 3TC9A 2JIXD 1UB5B 2V5YA 3UTQA 5IT2H 4M7LL 4NQDE 3POCA 4IGBC 3T71A 1TLKA 2MQGA 3MROA 4JLRA 5IFHH 5FYLL 1A7RH 2UV3A 2J43A 4NZTH 1TNNA 2H3XC 2C4FT 2RB8A 1HYSC 3TO4C 3ARTA 2W88A 3X14B 3QBTB 1UM5L 4PJXB 3DROB 4UM8B 5KYXB 1E5UI 3VMNA 4DKDC 4QNPE 5DEJA 2E46A 1U8HB 5DJXA 4AEHH 3OKDB 3AT0A 3ECBB 1M7DB 3EGSB 5JZ7D 3DOSA 4IHBA 4KTYA 3G6JA 4KITB 5GIRA 2QSCH 3J07A 3HVDA 2FEEI 3T6XA 4FHJA 5KSAA 2ADIB 5F1NA 4AVIA 5FO8B 1JFHA 2BZDA 1TZIB 4XP1H 2DH3A 1B2WL 1SJEA 5AYTA 3WO4C 1KPVA 2NT0A 2GSGA 5IR1A 3TO4D 2QSTA 2DQTL 2K9FB 5FYJE 5L7XH 2XWRA 1OF2B 1BXAA 5C07B 5EIIG 3MREB 4RMQA 1IJ9A 1H0DA 1V3LA 5CCHE 1TQSA 4DFHA 1G43A 1SXCA 4KO5A 3T0EA 3DETD 2QVTA 2FO4B 2HWZH 2O6PA 3PAUA 4Q6YA 2CDEA 3SQRA 3OAUH 3Q44A 4G8GB 2BVEA 5MEPA 3IK2A 1NCWH 2AJ3A 1NAMH 1Z1WA 5C2BH 4MXWH 4Z7WB 4ZNEA 3CFNA 2YMTA 1JF1B 2OR8A 3H4FA 4HIIB 1EVUA 1F11A 1P84K 1UJ3B 3C9NA 3T4AB 4YQXH 1F3DJ 3AWGA 3S88H 1E6JH 3T8XB 4F7TB 1KEGL 2Z91B 4LNRA 4QIRA 1G6VK 4KKRA 3FULA 3HZKA 3RDJA 2ZOLA 3KYKL 4HC1L 5JHMA 4LCWD 5IBTL 2AQSA 3CXDH 2W9EH 3UAFA 2IG2L 1T4WA 2YEZA 3WEMA 3GSWA 3BKCH 3Q1SH 4WO0A 1GMIA 2XV3A 2MEJB 1KXVC 5EF3A 3WS3B 1BVNT 1MUJB 3V7AE 1XGQB 2X4UA 4K23H 2ICWI 1N4XL 3C5SB 1KMGA 4OKDA 3UYPA 4DFIA 5AZUA 2A9NL 4HPYL 2M2DA 2QZQA 5DJZA 4A7GF 2BFGA 2J57A 4LFHD 4LU5L 4JFSA 4QRRD 3CVDA 5E8PB 1WAAA 5LN4A 5E8OB 5GGSY 5E8EA 1JMZA 1TEFA 1KFGA 4K3EH 1F3JA 2EKSA 3LKOB 4HUWB 2NY2C 5D2NE 3T4AA 1D9KC 1RZKL 2I7OA 3V9EA 2JKWA 5EZOL 2A9BA 3OZ9L 3WIHL 2CO7B 5J9PB 4ONGL 4JKNA 1ETA1 3MV9A 3N2JA 5EZIL 2FSEA 3N04A 4MD5B 1KLUB 5CM1A 1RFDL 4M8RA 3UJTH 1OHQA 2YRZA 3APNA 3LNHA 4ZXBD 3HPLB 4NJ9H 5IHWA 3VXME 4HIXL 4PB9H 5C0DB 1M3IA 3UACA 1UENA 3M8OH 3O41A 5C0CE 1YEHL 2N7BA 4H5SA 5D5MA 3KPTA 3T6WA 1FZOA 1G7MA 3FTGA 4PRAA 2ICEA 5KS9F 3I3EA 4U3SB 3EZJB 2QKIC 3BI9X 2GTWA 5DD5H 3QDGD 1R5VA 3GKWH 1KZYA 3G5XA 2CR0A 3Q5OA 5JHDD 4PJ5D 2PPFA 3G6JB 4AM0Q 4N2OA 1LK3H 3P2TA 1F8TH 1M7DA 2AJVL 2OW6A 4JFDD 5I6PA 5K9QG 2LTQC 4LDEB 5IWLC 1NBYA 3DGGB 3QJZA 4H0IA 3H42L 3BP5A 2OK0L 1IT9L 3FSOA 4KXCA 4PRIE 2CDGA 2ZOWA 5FYJU 2PW2B 3B2VH 5E9DB 2CR6A 3DHPA 2MCPH 4BCZA 5HHMB 1B88A 2V9UA 1OAQL 4NKMB 4X6FB 2V5MA 5JTWA 3QUZD 2R2EA 1D7FA 1E6OL 1EXGA 3QUMA 3H9SA 3HC0A 3V0HA 3TF7C 1KTJA 1FYTE 1KGCE 5DQJA 5FLVA 4J2QA 1CFSA 3HMXH 3OMNB 4LHJB 5HGBA 4ODTH 2F1AA 4HCRH 2WCSA 3FSWA 4OZHE 1ADQH 4XGZB 1NGYB 5CWSB 4WI4A 3NRPA 1X3DA 2VSKB 2ZUQC 1UHVA 5GQBA 2YAOA 3VXQB 2P44B 3F00A 3MLYH 1OGAE 4HWEL 3LKNB 5JO5A 5EU6D 3GXTA 2NUTA 1TU2A 1L9PA 4NKOB 3TBYB 4R97B 3J27A 4X9HA 2KC0A 2NZ1A 4EI5B 2OL3L 4HWNA 1YMMA 2L3BA 3EGDB 1HNGA 4QTHB 3HKFA 4JX0A 4PLKD 4WFEE 4Y2LA 4Z7WE 5SV4A 5J12C 1N6VA 4IK6A 4KY1H 2XVGA 4X6EB 4HG4J 5MEQA 5FHAH 1T1ZB 4LP4A 3U36B 1LEKB 3RI5K 1DQMH 4ZAKD 1WFIA 3LX9A 2N0KA 2EVGA 4Z3IA 1SJHA 3KR3L 4BQCA 1SDDA 3WL9A 3A4AA 1PFCA 4MXQD 5I5IA 3M17B 5EN3A 2PPDA 5I1KL 5EA0L 3DNKA 2B5IB 3MNWA 3U4KA 3H9ZA 2Z8RA 1E9OA 3QG7H 5GRUL 4ZNCD 4M9OA 3D85D 1WT5A 3IETA 3VCLB 1DBKL 2HJLB 5IMMB 4Y9FA 4FNQA 4CUCA 2DQUL 3C6SA 4XBPA 1KCBA 2A3TA 2VDLL 3K8LA 3CZUB 3O8XA 4PJFE 4G8EA 1CG9B 4N0UA 1LE9A 1KJ3H 1UJ3C 5IMKA 4IBWA 3PWJB 2YOAA 1S5IL 1HQ4A 5DGQA 2Z7ZA 5TQ0H 2ZKXA 1O7DC 3N43F 1M1SA 4B53A 2E74C 1MFAL 2GIMA 1SLWA 4JFQA 1B0IA 1N8OE 4P23D 2X7LA 4BKSC 1K5WA 3K1KC 1MSPA 4X6CE 4HMDA 3U46A 3ISRA 3GMPA 2HH0L 4YXLL 2F2HA 1KJ2B 3I50H 1X7QA 2NY7L 4PGBA 5TDOB 4OD3L 5AZ2L 1PS3A 5E0QA 2W1NA 4AM0A 3S6CA 1I3RA 3EJRA 5SWZE 4AGOA 1QI4A 3P0GB 4F7MB 1NIAA 3DO4A 5E6YA 1BX2A 4KRPB 5JDSA 5E8EB 2OMXA 4L3ED 3ETBF 1PG7W 1XB3A 1Q1JL 3DARA 4Y9GA 5F9JA 2BIIA 2YQBA 1P4LA 1PZ2A 2OMUB 2V0AA 3PWUA 1G9NC 3SCMB 5IQ7L 1RAMA 4PRHD 1JZFA 4MJ6A 2C7UA 3V5KB 2JI2A 4KXZI 4AOFA 3NZ8B 4NUJB 4TQEH 1AS7A 4KHTH 2CLZB 2FTAA 2KERA 5KZCD 1IGTA 3O6ML 4BCYA 5LCVH 1BJMA 7TAAA 1Z0MA 2XT1B 1OCWL 1L9TA 1HZHH 1OHZA 3BAWA 1ZK9A 2WNWA 2E59A 4M3KB 5E6SB 4M1CD 4AQEB 4GRWE 2YEZB 2Z9TA 4NKDB 3KCPA 4XMTA 1EJFA 5CZVL 4NOFA 5JPNB 1SLVA 2VNCA 3P77A 3ZSTA 5HJGA 4ZFFA 3BLBA 4PRPE 3PREA 5AG8A 4WWPA 1D5BA 1MLCA 2ADGA 4XNMB 2P24A 5AZEL 3QCVL 4Q9RL 3GXPA 3D9AH 4LSRH 3WIIL 4HIIA 5CFHA 3LKPA 2W9DH 3ZR6A 1KN4L 3OZKA 5J4MA 1MCRA 4GT7A 2HFGH 4WFFE 1NQBA 3WDJA 3G5YB 4RGMB 4U6YB 3ZKMC 2FJGA 1BOGB 1P69B 4HX1A 4WEEA 3VUAA 4PG2C 2DDQL 2MNWA 3OD3A 5E24E 4XVOA 2PPAA 2XIIA 4AL8H 3GM0A 1FFPA 5I23A 1EA9C 5GGTA 1OF2A 2V2XA 1SYVB 5ESVB 5B22A 2YD4A 3PWLA 1FLRL 2BC4B 5E4EC 3SGKA 35C8L 1U8MB 4LLWB 5IHLB 2DM3A 2EUVA 3V4VH 2O30A 3VI4B 3MLWL 4N0YH 1IO4C 1I1YB 5GSRB 2G4EA 4PJ5B 1UGKA 2WQ8A 1TVHA 5DURB 1BLNA 1HEHC 3WY4A 4X6DE 1P4BL 1R3LB 1I31A 2FX7H 9CGTA 4BSVB 3OKDA 2IAMC 3D39E 2ZAGA 3HAEA 1A5FH 2CE6A 4Y19A 2FEDD 5MERA 2XV6B 1HJCA 5TD4A 3TJHC 3CXHK 4HIHA 4KH2A 5E8NA 3SGEI 3UTTA 1XIWA 5IOPB 4PD4K 4KK6C 3QPQD 2G5BB 1ZGLB 3U2IA 4WF7A 2CMRL 3EFDH 3GIZL 3T0BA 3LRGA 2ZKHL 1AQKH 1PFOA 2BFVL 3APMA 3HNSL 3T77B 4Y0GA 1PVHA 4P2RD 3NCYP 3OTTA 4DESA 4PW3A 5EIQA 5CZXD 4MXWL 5CGTA 3WIHA 4YXHH 1T4KB 1TETH 2VYRE 4TLSA 1BF8A 2XZQH 4MYPA 1BGXH 3RX9A 1OTTC 5KVGH 1UQSA 4AT6B 1QHOA 4AYBA 4Z77A 2Y69B 4FI6A 1QLEH 2J44A 1GGCH 3QULA 3GINA 4IBSA 1MRFL 4GI9A 3W39B 5B7MA 1JYNA 3VXUE 4Z23A 4XOBA 2BVOA 1S9YB 4FI8A 4YK4C 3QDME 3V4UL 5KYYA 3NYKA 4GW5B 4I4WB 5FO9B 1IKFH 4JHVA 4J5VA 4I0CC 2IWEA 4ANUA 1AQMA 1X44A 1E3XA 2XY1A 4WVRA 3RYMA 4TVUA 3ZMNA 4AYMC 4MJIE 3FDWA 1NFDB 2LU5A 4YSDA 2DICA 1FCGA 1EGJA 2ZUVA 4FQXD 3UDWA 2CXGA 1P6WA 2NCMA 1CURA 2IC2A 3LIUA 3FO0L 4K94L 3VI4E 1OGAD 1XGYH 1NIBA 3QXTA 2XZCH 5KS9A 2JWYA 2LQRA 4ZMLA 1QASA 3F58H 5CCKL 1IGCL 2KHAA 4OZFG 4ABQA 4F2MA 4TNWK 5TE4H 3KL5A 4IU3A 4X4ZA 5ENWB 1VFAA 4AQ1C 3L13A 5JOEA 4A2MA 1DN0B 3OJVC 3FQNB 4NM8L 4UT9H 1UWEH 1GZQA 1EEQA 4NFBA 4WV1C 3P73B 3RWJA 3VXNA 3MOBH 5D72L 1DJSA 3KJ4C 4C58B 1FI8C 5IJBC 1XL6A 2OX5A 3HS9A 4XPFL 1BFTA 1OE3A 3JWNG 4NXSA 4HUMB 2AZUA 4R8WH 3QUML 1AE6L 1PIFA 4KWUA 2JJWA 3UTZB 2P8MB 3MRFA 1U3ZA 1M6OA 2W07A 4QHLB 3K71B 3DVGA 5J1TC 4LCCB 1E8WA 3ABGA 4J27A 3TFKC 4ATWA 3QQ9C 1THCA 2D3VA 2L8AA 1GGIH 3EJYC 3KPNA 3MOAH 4PB0L 1MY5A 4XC3H 4XXWA 1MCLA 1KTRL 1UD6A 4AC2A 1D9KA 5BVJA 1ESOA 1HE7A 1CWVA 3DUHA 1YNLL 4U6HB 3SQOL 3GSUB 3CFTA 1KCUL 2J6WA 2OMNA 3ARBB 3IMUA 3FN0L 2E8ZA 2P5WB 2WTRA 4WV1A 4OTXL 5TQ2H 5DD5L 4MDJA 3LVTA 4E42A 1WK0A 3QZOA 1H3GA 2FGZA 3CZGA 3V8OA 2AABL 2BP8A 3B1TA 4KKQA 5D7EA 3VFSA 2YS4A 4BFIB 1XR8B 4ENED 4DKEL 2M26A 1X5YA 4I3RH 5KVGE 2F1BA 5GGVL 1T6WA 2LE9A 2O5YL 4FLQA 4ZMXA 4D8PB 1CO1A 2GK0A 4AZUA 2YEQA 2DRUA 4F33A 1DBJL 1SDYA 1TKWA 1G7PA 1HCVA 2JXMA 3O6KH 2H26A 4NZUH 3IVKB 1G87A 4ENZA 3VFMB 4AKOA 4EDWL 2GBAA 2HCZX 2VKWA 3BYTA 3RE0A 4FABL 3DO7A 1JWSA 1H3TA 4ZMNA 1KENL 2QPDB 2VMEA 3FUEA 4BA0A 1Z3GH 2WLLB 4KY1L 3SPVB 4KZDL 1SN5A 1QUNA 4FQCL 1JPGA 2P52A 2EDKA 3MLSH 1J8SA 2QR0B 3MRPB 4PVNA 4PJAA 2FCBA 1G1CA 4U6XB 1ETB1 3BVTA 5E94A 1TQTA 2R56H 5L9DH 5BVPL 4JRLA 4WTZG 4HLZG 3ZE1B 4FDWA 5HYSG 3D50A 4BKLA 3W9DB 3D6GA 3BHBA 4H8PA 1A3ZA 3WAKA 5C9JA 1YSOA 3HE6B 3S5LB 3NZHH 2XI9A 2DQUH 2NSMA 3I85A 3MACH 1OAZL 2E6PA 3GT6A 3OAWA 5BRZA 3ZKND 4NERA 4S1DC 4GRMA 1RZJH 1A7NL 1GR7A 5ES4B 3QDHA 2RACA 4NNXA 1UXSB 3PGCB 4HIEB 1HCYA 5CUSL 2EIDA 4X80L 4X7CC 4YR6B 2JJSC 4UIMB 3SYQA 4R26H 3N06B 4AV4A 3FH8A 4N22A 3GRBA 4DOHB 4YNYA 1U92B 1W91A 4MASA 5DMJB 3WO3B 2BZ7A 3KWWA 3FRPA 1Z32X 3DV6B 1FFTB 5IM7B 1Z5YD 3V6ZB 3WKNA 3HS0B 4JM4H 5LGHH 4EOWL 3Q6GL 4GAGL 1U6AH 4PJEF 1KYUA 3HNTL 3QIUC 32C2B 1H8LA 4M93C 3LQAL 1U8CA 1FO0H 1G6RB 5C09B 1DCLA 5T1MA 5I5RA 3KM2A 1L5GA 1A6AB 5FUCC 1IAKA 3TWCH 4ZT1A 5TGBA 5KVEE 1ZE3H 4K7PL 4Y4FC 3HE7A 4MNQE 4HGWB 4HF5H 1PZDA 3RUGA 1GSKA 2XG4A 3F12B 2N3JA 5GRXG 1KELL 3OWEA 5IMOB 2WLLA 2XLLA 5FWQA 4C8XA 2EO9A 2VW6A 1W8NA 3QXDB 3RNKB 2ZAIA 5E9DE 1P5VB 3NH7H 1AR1C 3QG6A 5IEKB 2XQBH 4NZFA 2OMYA 3A6OA 3OSKA 3LRSB 1FFRA 4WHYH 2A4ZA 5E6ZA 5CEZE 2H3NB 1KPUA 1CXHA 2A0LD 2WSDA 4D8PA 4FOMA 3WAJA 4XP4L 1ZLVH 4PSPA 4ZMPA 2WJ5A 2JKXA 5HDQH 4ZUSA 4DVRH 4JRYA 3A24A 1U21A 4Y4KD 4DH2A 2WUBL 3IFLL 4JKPH 3U0PB 5ACZB 2GABA 5MHSD 1PZ5B 4PJCB 4W4NA 2VLLA 3CH1B 2QMJA 3IEAA 1E8YA 4POZC 2FQFA 4P5RA 3QIWB 1G9EA 1FRGL 4KGLA 5F2FA 5CIPH 1FFOA 2AKRA 4ODXA 3VD5A 3BPCA 1QWHA 2QDVA 3OJDA 3QQ9D 1A7PL 2YAFA 3C2SA 4DK5A 4LCCC 4FFVD 3TT1H 3VRJB 4GG6E 1UH2A 2P49B 4XX1G 1JAEA 3KPPB 4AJVA 5SX4I 1A6ZB 1AO7D 3WHXB 2QDWA 2A74B 3BH8B 4WKXA 1ZHKA 3X13B 1BZ9A 4XPTL 3O81A 3MRJB 4OI8A 4PCKA 2VXUH 4R90L 4HZLB 4G1MB 4N0CC 3HE7D 2JF1A 4HJJL 5DK2B 4YHYC 3GBNL 4G3YH 4YHPA 3P3UA 1Y1DA 5D6DA 2NNRA 3H7BA 1AQKL 1YEWA 2APXA 3OKLA 4JM2A 3HMWL 1QFOA 3ZQWA 4FFVC 4KV5E 2VDNL 2V2TB 4XCNA 4LSUH 4EIUA 2DF3A 2Q20A 3IAGC 4IKKA 3VFUB 4EZJA 3NIGE 1NH6A 1C7TA 2GJZA 4D3CH 4QRQA 2BXYA 5ID1B 4O58H 3GJFB 1IEHA 4PLKC 5IW1B 5EUOA 3TCXA 2DAVA 1UEYA 5C0FB 4DKFH 4E5XG 4RIRA 4PRPD 3Q06A 3GTNA 1FNEB 4OGQC 3O0RL 3RWGB 2QLVB 5B7FA 4ZPVA 5KUKA 2JVUA 1PNDA 3ZDZF 1QTPA 3UJJL 4LGSB 1XX9C 4G59C 3DGDA 2VLRE 3SE3A 1S9YA 1DBJH 3O6KL 1OZUA 2H9GA 2QPFA 1W0VB 5HJDA 4AH2A 1J7VR 4K3GA 5GS2D 2VQ4A 2OQJA 2X4OB 4U1NA 5F6HI 5C0BB 1NCJA 2E76C 5L8KB 4NO2B 3BZFA 3ZDXF 4UT6H 4P2RA 5T33L 1A14L 1URZA 5CHNB 3T2LA 2B9AA 3H54A 5AKSA 2VW4A 2BNRA 4Y1TA 2AV1B 4XMVA 4ODWA 4PJDA 1Z66A 3MRLB 5EZJA 4JFXB 1HH9B 3VX0A 1ZS8B 3INUL 5EU5A 4KVNH 4HK3J 4MLSA 4O2CB 4WJ5B 3ZKNC 4R7NA 1WBYB 4W4OA 4NQEA 3PXHA 4MMZC 4GSXA 1S7VA 1MHPH 3IDNB 4WHDA 3BKJL 3WEAA 4PU2A 2LFGA 2EYSA 5FW8A 2WNXA 1VEPA 3L9RB 1C5BH 3L4YA 4QLRA 1URLA 3N6YA 5DRZB 3LNFA 5KSUB 3PHOA 3BUPA 1H3UA 1I9EA 3OX8B 5E2VL 3VQLA 3UAEA 4D0BB 3FT1A 4LDLB 4QDGA 3CN4A 3T6VA 3QUXA 3BKYH 1VEMA 2YFNA 3N41B 1Q9LB 3CSTA 4APXA 4OGXH 4OIBA 4YO0B 2YXFA 2XWBB 4X4MA 1MHCA 2WLNA 3IDJA 2FJFB 4NPJA 4HGKC 3ULAB 4IOIA 3FFCD 1OAYL 3CFDB 3PLYA 5GHWH 3BAEH 1ASQA 5HVHC 2ZNXA 4AMWA 2VKXA 3M1BA 2WVSA 3M6DA 1GHFH 2H0JA 3GSQA 2AQ1A 4ZD3L 4LVHC 3MLRL 4YAQA 1VFBB 4XMZA 1VAHA 3STZA 4GXVL 4WGKA 1WFUA 2X9ZA 1TTBA 4GI8A 3CBRA 4M93B 2WTOA 3OKOA 5DGRA 3FUMA 5JPMC 4HJ1A 4XHQA 3JVGA 1H3WM 3HG1A 1AYOA 5CP7B 2BOCB 1TZHA 2VABA 1E4XH 3NIDF 3BSZL 3FPXA 3QNYB 2GT9A 4NQDB 5T1KA 5DMIH 4GS7B 4G6JL 1DJHA 1PG7H 1OB1A 4L1LA 3VXPB 3TONA 1LDPH 2HX9A 4I9WE 3IGFA 2FK9A 1ZV2A 3LKRB 4BE6A 2VIRB 1KWKA 2O5YH 4KK9D 2IFGA 4PWFA 5DUBB 3ZW3A 4DGWC 5AOIA 1U8JB 4GW4A 5JW5A 1JGVH 5DA0B 3MBEB 1TEYA 2WO2B 1UATA 3P11H 3SJVB 1QSVA 3ZTDC 1S2EA 1T03H 3VACA 2EICA 3FQRA 4UINH 3CVCA 3EIFA 2FGWH 2XKSA 3DX6B 3KWXA 1J5IA 5TQ2L 3CK0L 3IF1A 3KMDA 5LLIC 4L9DA 1H19A 1CK0H 4PWKA 4JFFA 3DBXA 5DZLA 2AJUH 2Z31D 3GBML 4KY2A 2EEAA 2B59B 3WSQL 1MXDA 2OMZA 4M6AA 4W9JC 3AU1B 3W37A 2OTUA 5DRNB 4Z8FH 1JPFB 1EZVX 1XCXA 3TURA 5J6HB 2X42A 2HT2D 3ARGC 1DE4A 4L8CB 1AKPA 1JYWA 3WNJA 3AG3B 1AC0A 4NPYB 4H1LH 5GSVA 2WYTA 5DS1A 3T04D 4EQ2A 1W72L 2NQDA 1JZ5A 5IFJA 3D69A 5F9WC 3EO0A 4U0RC 2DYPB 3KLSA 4U1HB 3FQUA 2X9XA 2XVLA 1NSNL 3FQYA 1XH1A 4QRSB 1JGDB 4JDZA 1FAIH 5HHXH 1UYWL 1PSKL 2NY0C 1OB1B 2XN2A 3RRQA 1I3RB 5KAQF 2Z31C 1IM3B 2R2HA 2CRYA 5LBSH 1F56A 3W11C 1O75A 1MIEL 3LNDA 3GS7A 3SE9L 4YDMA 4EBQH 5JOPE 4JVUA 1ACXA 3WNIA 1N59B 3STZB 4HWUA 2I07A 1CGUA 1JPTH 1ZHNA 3GHEH 3QJOA 1MRDL 2X28A 3GSQB 4JG5A 2XXGA 5INDA 4P5TA 1DQDH 4YHYB 25C8L 4Z7VB 2BIMA 3RVWD 4R26L 4NQSB 3D85A 3GLZA 3I6GB 3FFDA 2C9UA 2BSSB 5DYOB 4AGMA 2BHUA 3OLIA 4NNYA 1PLCA 3QORB 2JIXB 1EV2E 5J57B 3L3DA 3MRRB 3MV8E 1OSPH 3IDXL 1GYAA 4U2YA 4OUUB 1EIBA 1OE2A 3I9GL 4MB3A 2QADD 3FU0A 1HQRA 5E00A 1XF2A 2VLRB 2YPKB 2ZXDA 3C5ZB 4G3YL 1RK0B 4OGAD 3ROLB 1AD9B 4AYDC 2R29A 3V0IA 3DLQR 4JFHE 4Q0XL 3KXFB 4OJAA 2CKBL 4OIIL 3RVWC 1ETZA 3NRFA 4WY7L 4O5LH 5D7JD 4APQC 1YEIL 5D1ZA 4F80A 4IGBB 3UTTD 1R3JA 1E0OB 2ZX9A 4LVOC 4BDVB 1J0JA 2P4AB 1F6AA 5EU6A 1EZVY 5LG1A 4EI6B 1NGXA 3VD0A 4UMGA 3MRBA 2QGBA 2BHYA 3VXOB 5K9JL 1XZ0A 1EFQA 1Q8MA 3HBQA 5GPRA 2BH0A 2EYTA 5B8CC 2AK4D 4HCIA 4XMWA 2A2QT 3HW7A 4PTUA 1OF0A 1NEZG 5IIEA 4GQRA 1D5IL 2KLTA 1SBSH 2W91A 4LIQL 3CDFA 5C07D 4FQ2H 2XBTA 4Z7IA 1TJIH 4R7LA 5K39A 5ISZB 2DWDB 3MOQA 3RDTA 1KBWA 2FL5B 2DH2A 2WZ5A 5AB0A 4DVRL 1MCWW 2BJML 5FW7A 1XGRA 3WO4B 1S7TB 4UIKH 3TH3T 2FATL 2GHWB 5CNHA 2VR4A 4P46C 5C08E 1IB5A 2C3VA 4MMYB 1D5MA 2HVJB 3DO3A 3L1OH 4DGVH 4ZW3A 4FFZH 3WS6A 4JDZB 5FO7B 4GG6B 5E8DL 3EJSA 3SDCC 3EUUA 2GTZA 1DO6A 4J1UA 4RRPA 3EJYD 2W60A 5F72S 4EZKA 5DDHA 2VM3A 1YN6B 5DD0H 4N0FA 4P3CH 3ASWA 4HHAA 2GUOB 4WNQB 5BV7H 3S8FB 1A1NB 1M7UA 2KLRA 4XVSL 1CICB 5DT1H 4GB9A 5ANME 3GXNA 1IGYA 5D70H 5EOTB 4GMTL 3TEZA 1HAUA 3QRLA 4NUMA 5AKVA 2KT6A 2NXYB 2LLLA 4K3DH 2R0KL 3RJOA 2UY6A 3N5AA 4XN4A 5BXFB 4JO2L 4PJHE 2UXVA 4KAQL 4CDHA 1PKQE 2W0FA 3QEQD 5AW5B 2J55A 2V9QA 4U4IA 3V6OC 3QIBA 3FQRB 3MFGB 6PCYA 1C1EL 2X6CA 3W0WD 4PRHA 1G7MB 3BPNB 2OBGA 3RWEB 4BGDA 1LP9B 4PLOB 2Y2YA 2CGRH 1AZZC 2Y72A 3CH1A 4WHTA 5AQ0A 4F15B 4KVCH 3PWPA 2DYRB 2HJFB 5DFVC 4OZIA 3X1BA 3O11A 4KHXH 2PXYB 3FONA 1NGQH 3BZEA 4O2EB 2BWQA 5LAXB 4YHOL 4OZIB 4NOBA 2VDOL 5E56A 4R90H 3ATDA 2WLIB 4NT6A 1E7UA 5DFWH 5EU4B 2YARA 3DDFA 1DDHB 4QXVA 2G9HA 3G04B 1IAOA 1KXTB 2MQ3A 2OZ4H 1XV8A 5JA9A 1FLTX 2UY7A 1U8IB 2NY5C 4MAUL 2OXHA 4UT7H 3UG3A 4LGRB 4G9FE 3VJ6B 3PXLA 1R33A 3WEXA 2VQ1B 2NMSA 3QG6B 2DN7A 2KI6A 3QYMA 2P48B 4FTVD 5A2KH 4JFDB 3ZKMD 3EHBB 4AZ8A 5GRVK 2EAEA 5L4IA 4EN2A 1BXUA 2DKUA 3B2PA 5DJAA 1OW0C 4Q14A 1WCQA 3BYYA 1WHOA 3TV3H 4JR9L 3IKKA 4M8QB 1T3FB 4N24A 1L5GB 1NBQA 3PIQB 1CCZA 4HHAB 4QXTB 4YHZH 2E7CA 1ND0B 5J56B 2W60B 3TA3B 4ZMWA 4OZGF 3HZKB 1H3PH 2ALAA 3IJ9A 4Z7WF 1DSWA 3QVAA 2OR9H 5IF0A 1NANH 4F7TA 5I1EH 1R0AH 1ZV9A 3QAZB 1H5BC 2PYEE 1QPPA 1A1MB 3ZZQA 5CJXA 1EANA 3VXRB 1J1PH 5I6LA 1NBZB 4PRID 2CJ3A 3DC0A 2CQVA 3TJHD 2CJUH 2HT3C 3CC5A 1YQVH 1CXKA 3CSPA 3SDDC 5MEPB 3MCYA 5IVXE 1QBBA 5EIIA 1Y18B 2HLFD 2FB4L 2VXQA 3VGAB 1G9MH 4PJEA 5HHPA 1BFSA 2NYZA 3UGEA 5I30H 4QJ5B 2TSBA 1MFBH 4TNVK 1C8QA 3C2AL 2AXWA 2QSQA 1BMGA 4Y7MA 4MKTA 5HJ3B 3KLQA 3QXVA 3WUWG 5IWLA 1OTTD 1IC7H 1XZ0B 3HFMH 4U1MA 3DRTA 5C3TA 3DI2B 3U48A 3U4BL 5E9AA 1UB6A 4XAKE 4OGYH 5LUMA 2R1XA 4QHMA 2EVJA 2VDQL 4XNYH 3VI3E 4EI5D 4JFPA 4P3DB 4X6CF 3DSNB 3MLUH 3VVWA 2VLRD 3QZPA 3NUKA 4R97C 4XXDA 5DLMH 2DM4A 4FGMA 1RZKC 4ALAL 1HTYA 3JUZA 5GJTL 4TPRH 1VKXA 5KYXA 2HP4A 3UJIH 3W56A 4WUUB 4B50A 3QEHB 4AGLA 3X14A 2NYYC 4G43A 1N10A 3T2PA 1QR4A 2DLIA 2VDNB 3RHWF 1IC1A 2ZICA 3MROB 5L2KE 1I9RH 3NSCA 4LSQH 4P2RE 2VE6B 4YJZL 2P5WE 4W9IC 3MI6A 2BNRE 4U1IA 5CJ8A 4R9HA 2EC9T 3CE1A 1H3VA 3UTOA 1CE1L 4D9RE 3QDGA 5DD6A 1Z5HA 2XPZA 3W2DH 2VUOA 5EDXA 2F1EA 1K9TA 2OMTB 3OBAA 3S34H 4EJ1C 1IGMH 1Q9WB 1I1FB 3ZDXB 3GPSA 1NCGA 4X4YA 4LEBA 5I6KA 4TQ8A 4CRPA 3BXNA 5D7IB 1GZHA 3D25A 1N5AB 2HRGA 1EAPA 1LP9F 3E8UH 1UYWH 1AP2B 2VLKB 3KYAA 1YYMH 4FQ1H 1MCWM 3IDIA 4GLRI 4R4FH 2AEOA 2XWXA 3GXUB 4DZ8B 1U8OB 1D5ZA 3SO3B 4XMUA 3PG2A 5EBMB 4AXWB 2GJ6E 4GY4A 3H2WA 4QRSA 3IJHA 4JKKA 4YE4H 1FFNB 1QKZH 3NRQA 1MI5D 4LOFA 4YC2C 1WZ1L 4ODVH 1TQUA 5IQ7H 3TBSA 3KLDA 3FOMA 3CZLA 3GMLA 2OMTA 3JT2A 2ZXWB 1W72H 5ALBH 1MIML 2FUQA 3KLAB 4LOUC 3V0VB 5B38G 1LEIA 1SLUA 1ZS2A 2AJYL 2VN3A 1FPTL 2ZTBA 2QJDA 3LRLA 3L5XL 1OWRM 3UTZA 4UUJB 2GEQA 5DJAB 1PZCA 3IDYB 5F9AC 3LHPH 1NOAA 4FZEL 2B4CL 1OOAA 4L3EE 3FFOA 1OCCB 3FQTB 1FVCB 1BJ8A 2WLKA 3C75A 3U30C 5BUAA 1CLOH 1ZIBA 2A4CA 5GGTL 3TJEH 4I77H 5EN2A 2LHAA 1DJYA 3Q3GA 3PAZA 1X5ZA 3CN1A 1J11A 3QDMB 1LXMA 4G82A 5AWNL 3FUKA 4PJIB 1OP3K 1AHWB 1KIUB 3LKQB 2IBBA 4FHBD 3MLWH 1MCOH 4LOUD 4I0PA 2LR4A 4TKWA 2HPOA 4FMVA 3KBEA 3B3IB 3SDXF 4BQ9A 3US1A 5E6RB 5I0WA 4WWKB 1O0VA 4OF0A 5IM7A 2D31B 3FQXA 3OGCB 3G9VA 2X1QA 3ULSA 3EJUA 1LO5A 4Z0BL 1GC1H 1NM9A 4MQXD 2PPEA 4H8VA 1V7NH 4JG9A 2EDTA 2H32H 4OF8A 5KYYB 5J13C 4XAWL 2W92A 3AQXA 3UYOD 4UQEA 2EDNA 3RFZB 1ZA6B 3HG2A 5E99H 2PWDA 4QHPA 3QO0B 2A4EA 4FKKA 4HXBL 5HYFA 2EDRA 2BHZA 1RI8A 1RJLB 4NKIL 1J0KA 2BJMH 3VWJB 3F6JA 1RIHH 1CLCA 5JUEL 3IJEB 3D39B 5I0DA 4KMTL 1DVXA 3O3EA 3DI3B 1SDAB 5KOVC 1C16A 1CGXA 2UZIH 4TUOA 2DM7A 4L8SC 1QO3B 4QLWA 4HUUA 4WW2A 1MFDH 5BW7C 3H55A 1T21B 1OOWA 2FYYB 5MHSE 1T20A 1M53A 2RH0A 5JOPD 3S36H 3VG0L 5KN5A 2N01B 1E4KC 2Y23A 4D0BA 1RP8A 3QPXH 3W9DA 3SDDD 3GKWL 2FBRA 1UZGA 5FLUA 4XCFH 3PIQA 2GJRA 3RAJL 1J86A 3U6RA 1DL7H 5JNYB 5CCJA 4YZFF 1IGIL 4O02B 3WFEH 2VXUL 2WXPA 4G7VH 3CZJA 2Y36H 1IBYA 1KSRA 1TETL 3D0LB 3FXIC 3N42F 3QHZL 2HN7B 3BP7A 2A9CA 2BO0A 4CGTA 1FN4B 2ZNWA 1W2KT 5H4YA 3FB6A 1T89A 2H41A 2EUWA 2MKWA 4KRMB 4QRUB 2HKHL 3F58L 2QV2A 3PL6C 2O6CA 3MNDA 1FORH 3P9WB 1GMEA 2DWDA 1COBA 4TQPA 2J6EL 4W4OC 5FX3A 2LOEA 1AOZA 3OB0K 2ZQKA 2RQEA 1SYVA 3L45A 3SE8H 1NLDL 3L5HA 3B4NA 2WGXA 4HETA 4PJGB 3P9MB 2J8UA 1EHKB 1WZLA 2BSDA 4W9HC 1GS6X 4Y9BA 4K2UH 3GXFA 3F64A 4P4RB 2F7OA 3SDXB 1NL0H 4CMMB 3LV3A 4WSJA 3CDYA 1P2CB 3RB5A 1I8IA 5EO9B 1OP5H 2QVIA 3LKPB 3FJTA 2F8OA 4QRFA 1IKNA 1DQJB 4FERA 1LYQA 4XCNB 1QLRB 5DHVB 3NDYE 4MAUH 4N90E 2CLRA 5I1CH 1M2OA 5I0XA 3B2XA 2ZYHA 3GJFH 2XBDA 1OSZB 5I71B 4IM8A 2AXGA 2VDKL 2WBJB 4MA7H 2PN5A 3F6LA 5EDSA 3MGTA 4A1RA 4HS8L 1CGSH 3CX5K 3G6JF 1B2YA 3H0TA 2J5WA 1RURL 1F4XH 1MJ8H 1E5YA 3HZYB 2QPUA 5IZ7A 1QD0A 5IQLA 5C08A 1TVDA 3ZYJA 3BH8A 4NKQB 4HHWA 4X6CB 1A21A 5KVMC 3SDYL 2L0DA 4YSAA 3B5TA 2ZG1A 4PTTA 1LEIB 2AXFA 1ILSA 4RSYA 2CHWA 5EPMA 3BDXA 1ET8A 2F5BL 3E2HB 3OKNB 3L3GA 3U4AA 4POYA 1CD1A 4N5EC 1U3HD 5SX4H 4UM9B 1IEAB 3NIDB 3LTVA 1JZ7A 3TCLB 3QIWA 4IIQC 1RIUL 3EYQC 2A83A 3BAEL 1WV7T 2P1YA 2LU4A 3HPJA 2VL5B 5DCCA 5FV2A 5DUPL 4S11A 4TSBH 3HG3A 2CAKA 1JV2A 2HG5B 1BVZA 2NQCA 3O4LD 5DTFA 2C4XA 2CGZA 5HI4C 1X6NA 2BDNL 4U7SA 4J2XA 2L7JA 2YUVA 4RISH 2X7LB 4CSSA 2IADA 4B3VA 5IFJB 5T3XH 2EDLA 1U3HC 4YDVB 1ACYH 4NPYA 4OZGE 3RWIA 4BSJA 5EPMB 1Z9SA 1Y1UA 2FIKA 4PP2B 4XNUL 5D7JC 5IB1B 1KJ2L 4QOKD 4JCLA 4DZBA 3O3BA 4OZFB 3NFSL 4XVTL 1X5XA 5KBLA 1U8QB 4Z7NB 1R19A 1OAZH 1RPQA 4LP5A 4Y89A 1C7SA 4Z9KB 5C0BE 3GIVA 1IX2A 1I3VA 2I60L 3EJTA 1SMAA 4YGVA 5D2LE 1A7OL 2VLJA 3RUGB 2WB7A 3K8KA 3THMH 1E90A 1HEZA 5IVXF 3HE7B 1HHKA 3QPKA 1MHHB 4N9GB 4MJID 3ZTNH 2WWKT 5BOJA 4GQ9L 1UA6H 2XNAA 4W70A 1RJCA 1NKRA 1TPXB 3HC3H 4ZPTB 4FEIA 4KNQA 4AVHA 4K23L 3MX0A 4PAZA 4PWEA 4R2GC 3ARZA 4Z7AA 3V0WH 2WTPA 5AB9A 5HVWA 3CFCH 1KCVL 2DJSA 3U6XA 4W6YB 3U36A 4FL4C 5DUBA 1S7RB 4V33A 1FYTB 5EOQH 5L8LB 1MJJA 1F1GA 1QX1A 5I74C 1INEH 3VWJC 1EHLH 1RUAH 1FZJA 1IC7L 3HFML 5D7SL 4TUOB 3RVUD 2AEQL 3QZMA 1AH1A 2MQCA 2WSPA 5EEZA 5HHME 5FM8A 2XQYG 1CIUA 5DMKB 3L08A 3BIKA 5CP3H 3LMJH 1G94A 3QUXC 4XWOD 5AOKA 4ONGH 1Y18A 4JRWA 4E9SA 4Q58C 5A7EA 2OZNA 5EEXA 4TYUA 3AFLA 3S35H 2IAAC 1NAML 3QWRD 4JFHD 2AGJH 3P02A 3QXUA 4PWJA 4Z7UE 5DK0B 1S5HA 1DLHB 2WWMD 1U8PB 1K8IA 4KOBA 3FU9A 4WI6A 2HX8A 1RHHA 1RVFH 2B1HH 3SDAC 3SHSA 1NFKA 1A47A 3IBEA 4FQQB 3BSGA 7CGTA 5L7XL 5EEVA 3GB7B 2YPLD 2QQKH 4MFHA 3QDJD 4MZ3A 3ZRSA 4KJPC 4QRPD 3OX8A 2G9KA 1P4BH 3VWKB 1KULA 4JFUA 3DX1A 2AK4E 4LL4A 4NWUH 1R4XA 3VFOB 1GYUA 1YUHA 2VN6A 1SN2A 1PPIA 2ADGB 2C34A 3NFNB 4AMXA 3RVTD 1E28B 3DOIA 3VXMB 1DQIA 3MBXL 4PEEA 3JXAA 1AIZA 1HHKB 1AI1H 5IEHB 3S35X 3WMPA 1FYHB 4MJIA 1DJXA 5DD3L 1Q94A 2R15A 3VTMA 2R7EB 3RGHA 1QRNE 4PV9B 4XN5A 4HJJH 4M7ZC 3HAEH 3FL7A 4WUKH 1EO7A 1QPXA 4NENA 3BJLA 4V11A 5D2NB 4H0LC 3X1FA 1ML0A 5T1LB 3ZRCC 2Q7YB 5AL8A 1I82A 2IALB 1MVUA 1W8OA 3LH2L 4RETB 1AXSB 2DIEA 2G9HB 2IGFH 2Z1PA 1U8JA 2DL9A 4NM4H 3TYFA 43CAA 3OR6A 4DP5X 5IB4A 3W3BA 1QYGL 2IDFA 2H2SD 4RMWA 1BX2B 4PJBE 2AJVH 2JKTM 4AXWA 3BC9A 3PJNA 2IFFH 2BK8A 4OLWL 4JQVA 2WYHA 3RX8A 3TJPA 4DP0X 1R3HB 3O4LA 1BXVA 1F3DH 4J3OH 3CG8A 5I16B 5EF1A 1LP9A 1W0WA 1A3LL 3KW8A 3OKOB 4OCMC 4Y4KB 4PRHB 2HT2C 3ARGD 4HWEH 4B9PA 4IMKA 3RG1C 3UTSD 2XQ0A 3QJVB 4GUPB 2X2HA 5JHDB 1L7IL 1MFEH 1N6UA 4Z3GA 4RLDA 3U0TB 3QDGB 5DD6B 5J1AA 4ZMVA 1IUZA 4RVBA 3KHOA 1XH2A 3ZXAC 2X0UA 2YRPA 3WJLA 3FQ1A 4YO0A 2L7EA 1MJ8L 1N0LA 2E27L 1UKQA 2E6QA 1MNNA 4JGJA 2X4UB 1XGZA 2NR6D 3SOTA 4G8GE 2WIIA 4JVWA 1V7NL 3P73A 3WY1A 1SQMA 3P4MA 4KKNA 3FT3B 4XPHH 2XA8H 2IPTH 3V6OA 1J8HA 3GBNH 3MOBL 3PHSA 5D72H 2EH8L 3HUJE 4P8QA 5IQ9B 4GO8A 2HLAA 4IU3B 5C07E 3RWDB 3ZYOA 4PJ9C 5F7DA 4PIBA 4WTZA 5IJCC 1H8NA 5AKTA 4PRDA 4R4BA 4LRNH 3MLXL 5I16A 1GXEA 4JG0L 3MRLA 4N2CA 3SKJL 3GDBA 2BY3A 2KQNA 4WGWB 4KQ4H 2VT0A 3EYSL 5DEGB 4AYSA 1MDTA 3MR9B 3GBLA 5ETUB 4YUEL 5F3HB 1JGLH 4X0KB 1OP4A 1KGXA 1NCCH 2X4QB 3LQAC 4EEEA 4DERA 5BV7B 1KPUB 4CVXB 1RY7B 4PJAE 3SPCA 1TQCC 2GBTA 4PJXE 4OCYL 3EOAA 4M4RB 1JNLL 2NNCA 3F8UB 5LQBH 2EECA 3FU7B 1JRHI 1OEZW 5AFAA 1VGEH 4HJ0D 3ZE0F 1BG9A 5IB2A 4Z77B 4PBDA 3MN8A 1QUPA 3AM8C 5IV2B 1XR9B 3ROOA 1JGUH 1XBDA 4NO3A 5D1ZD 4N2LA 5F6IB 1M71A 4EIZC 3NMEA 3O2VL 3C5JB 5I74B 2PLTA 4FS0A 1OE1A 4TTGA 1FCCA 1YEEH 3PUUA 4FF9A 4X8GA 4TNFA 5TGBB 4NQCA 5GS0C 5HDBF 1A6VH 3IPFA 1UXWB 1R6VA 4QXTA 5DZOA 2CO4A 1RU9H 5T1DH 3FYEB 1CU4L 2C3XA 4YDIH 3T09A 1SEBB 3IU4L 4KKBC 4R3SA 2DY2A 2GIXA 2ZUSA 2NW2B 3RL1A 3QARA 3EH1A 1AYRA 4LPCA 5DYFA 5T3XE 1RUMH 1UWFA 2IPKB 2CRMA 2FYYA 4JR9H 2OL3H 3UIYA 2C4FU 4XBEL 5D7SH 2V33A 1K8IB 1KB5B 3BDYH 2ORBH 3EW3B 3MJ9A 3UO1L 1SY6H 4MMZB 4OQTL 5E6UB 4ZW5A 1JK9B 3SDAD 3NA4A 4IW4C 4PG9A 4AUUA 3O2DH 1U95B 1AIFB 3N85H 1MNUH 3NJMA 3QEUA 4KJPD 1NCTA 3BH9A 1T04B 2X4PB 4F2EA 1M56B 2VM4A 1KENH 2AAAA 1OTUC 3T0WA 5MEOA 1X5GA 1I8MB 3BIKB 1T66C 3OAZK 1HZHL 3TF4A 4Y2DD 4GG8A 1NCAH 4L29B 2MOGA 3CUPB 1YQVL 5AVZB 2VGLM 4O2EA 1QFHA 3GXIA 4XP5L 2HWZL 4W93A 1MF2H 2F58L 2Z92B 3GMQA 3WSQH 2W9LA 2FJGB 3FBKA 1JI2A 5F7LB 4MD5A 4Q9CA 5GRYA 2K6ZA 3O0LA 4U1HA 1Q9OA 3MXWL 5L2KD 1PDKA 3RA7L 2X40A 3TYFB 1EHNA 2CO7A 5FR3A 5HYJA 4UQ2A 4P9ML 1GKEA 5FUZH 3MX0B 3F2LA 3E1ZA 5DHXB 1BM7A 4X9YA 4YDJB 3FCUB 3S4SB 3I3BA 1KIUA 1D6VL 1FA4A 4PJAB 4IRZL 3E3QE 4WU5A 5DJ2B 5B3SB 5J3HD 2Y5QA 2PWEA 2AK1H 3I6SA 3Q3GB 4RRPM 2J21A 2FECI 3ECWA 5I8CB 1CK0L 4PGCA 4BWWA 1V54B 1NFDE 4MJIB 2PR4L 4HEMA 1MDAA 1TYJA 5D7HA 4EUPB 3MBEC 1PZAA 4Z7QF 1FFQA 3W0WB 2CO6B 3PQYE 1E28A 12E8L 3HG4A 1FNLA 1YPZE 3V0VA 3L5WB 1NKOA 4WK0B 2FWSA 3VXUB 1KG0A 4OIIH 5H94A 1WWCA 4N0FB 5HPMA 4KHTL 2D0FA 1NMAL 4X6BA 5C6TH 4MWFA 3VMPA 3HLAB 1XSOA 2A73A 3NH7L 2XYCA 3EF7A 4LEEA 4WI5A 2C9PA 3JWDH 3T6ZA 4DUWA 1AO7E 2WLYA 1N2RB 2VXQH 3PF2A 3I02B 1D5MB 1MHEA 2HVJA 1FNHA 1RZKH 3MSPA 4PY7B 3BEWB 1HS6A 1F5WA 1RLBA 3LNEA 4PJFA 3CLWA 3CZNA 4HLZH 2AJ3B 5CN1A 3VRLF 4DW2H 4Q56A 1TO4A 1C12A 5JA8B 2Q0ZX 2EQDA 3HNSH 2CKBA 4F93B 3RWCB 1HOCA 1YEGH 5GGUB 2KMWA 1ZJBA 3OXSB 1CYGA 3KVQA 7FABL 4GKSA 5IB3B 5HY9B 8FABA 3REWA 3PHAA 1P6FA 5DO8A 5IR1B 1CGYA 4JQXC 1EFXB 4ZQKA 1HILB 3PDOB 1BZEA 4KROD 3C6SB 4XBPB 5JDJA 1SJEB 1CS6A 2IPKA 4OLXL 4HPHA 3GSOB 1X4YA 4B7IA 2HT3D 5I30L 3PL6D 5PCYA 5IBLD 4HEPG 2BSTA 3PHOB 5DVPA 1SEBA 5EC1B 3V8CA 2EH8H 4BEIA 1D7CA 1JHLH 1TJGL 4NQED 5FS5A 2EH7L 1J10A 3QJUB 5E94B 3DURA 2APWA 4XPTH 1ZE3C 5FCUH 3EJZC 4IRSC 1EBPA 4YE0A 4JFPB 4P3DA 1IQDB 4XVUD 2APVA 3VU1A 2AQPA 1IT9H 4XOEA 2VLRA 5TK2A 1SEQH 3S4SG 1M2VB 3LIZH 3LV3B 1LL1A 4BRVA 3B2UC 3UBXA 4UNVA 5IV2A 4R5TA 4DEWA 1UFGA 4UV4H 3BUIA 4UOJA 3O3BB 3CHOA 1HKFA 5F6IC 4EI5C 1MREL 1XF3B 2VB5A 3LRHA 1NPNA 1CJYA 1F4YH 2WV3A 1XEDA 2M1KA 3VXQA 4PRPA 1HH6B 5J89A 2BVQB 5I0YA 1DUZB 1O6VA 2GC4C 3GGWB 4XBGB 4P2OA 5F3HA 2A7BA 4DKFL 2AK4B 4JO5A 4JHUA 4HIXH 3MR9A 3QFJA 3UGUA 3M8OL 5E6IB 2GSIA 2VLME 2FLRT 3FB6B 5F1OB 5DSCA 3VXRA 2EDFA 2X2IA 2C3HA 1M3JA 4KKLC 1YJDC 3P3SA 4FN0A 4M61A 1KZQA 4P4KA 4XCEB 3UZEA 2B5IC 3E8VA 3HBPA 3S37H 5E8DH 1IQDA 2NY6D 1P9MA 1QW8A 6PAZA 1WF5A 4Z7UB 3RZCB 3Q6FB 3NDZE 3T2NL 4YK4B 5ESQB 3AREB 1TVBA 2I9LA 3DECA 1KBBA 3DA0A 5DMGC 5B39A 4L3FA 4UBDD 4P5TC 5DK2A 4GQZA 1LM8V 4AYFB 4KKAC 4ODSH 2IOIA 1EERB 3OV6A 4KDTA 3WD5H 4JFFB 4R7DB 1WH0A 4XE5B 1T0MB 4YDNA 5HY9A 3MLYL 1HXYB 2ZOOA 4JQVC 1K4CB 2I5YH 1IAIM 1JFQH 4B41A 3D39A 4Z7VA 3ZMRA 5T3ZE 1ERNA 1RJLA 3ILPB 4FTVA 5DI8B 3W38A 3CN2A 2CLRB 4OFDA 4PJGF 2DQJL 3CX5J 4L1SA 1EDQA 3U4EA 2R0ZL 4GNKB 1E4JA 2FBJL 4UNUA 5E08L 3VX1A 1WFMA 4PY7A 1GS8A 2R69A 1IM3A 2R2HB 1KGIA 3WFDH 1FORL 4M3JA 4LAJH 2Q2EB 4RMSA 1VZGA 4V2BA 4AGNA 1VF5C 5FFGA 5T5FH 2YK1L 2CJUL 1D6EA 5E4IA 2EP6A 5HJBA 2LT9A 1TZHB 2VABB 2X1WL 4OJCA 1JNJA 5GRUH 3M7FB 4X6BB 3BPNC 3NSXA 4QCIB 2NX5A 2X6UA 3BSZH 4PLJD 5C7ZA 5G2NA 2EEFA 4L8CA 3TBBA 4N3TA 4LLVB 1JNHB 1XSJA 2GJ6D 4U3HA 2CBPA 4FTVB 4XWGH 1K5NA 1QSED 1AHWA 1KGYE 1UZ6E 3AU1A 3CNKA 3FO2B 4H13C 2QLYA 2ED8A 4M29A 3ULVC 5JPNA 5IJKA 1UT1A 5I28A 4IQHA 2V4LA 1HINL 2ZCHH 1LEGA 1ZTXH 2LV4A 3ZN6A 4R7DA 2OP4L 2UZPA 2XWBA 3HJEA 2W5PA 2ZKWA 3QDMD 5GGRY 3RVUC 2BVUA 1ORSB 4LKCB 1HHHA 3HRZC 5E9NA 4ZSOA 5MI0B 4WI0A 1OCWH 4A38A 2UWEF 3O4LE 1RK7A 4ZS7H 2XN9A 1A6AA 1YUHB 4HWBA 1BBJB 4S1QL 3AS1A 2GUOA 1KLFB 3V5KA 3QFGA 4A2HA 2JSFA 3P4OA 4AENA 3L5IA 2FDBP 3TNMB 4DPAX 4CC4A 1ZRUA 3SDYH 2Z92A 3DHUA 1MW3A 3T0VA 3LB6D 2VXQL 2W38A 3CVBA 4MCYB 1A7RL 1UJ3A 1D5ZB 5T1KB 1F2QA 3SOBL 2AJSH 3VI3F 2BVTA 1KXVA 2BOCA 5EUOF 3BZDA 2H6UA 5E6IA 5ECJE 5D1XC 3IJEA 3OPUA 3H7LA 3LKSB 1W9XA 2HH0H 3FB8B 1U36A 3QIUA 4M5TA 4PRIB 4UDTA 4YXLH 4A66A 3ZL4H 5ISZA 5K39B 3T0AA 4HT1H 2BC4A 5JXAL 2Y7OA 3CIAA 1T04A 2X4PA 3X1GA 5BW7A 1AS8A 1U95A 1JXDA 3HTLX 5C07A 1EFXD 4OLUH 4FQ1L 4RCAA 2WXJA 2WANA 1ANUA 2FJFA 3NZHL 5K1JA 3D30A 1LO5B 4RISL 5DC0A 2CG9X 2DJUA 2Y24A 5JIPA 4Q89A 4Y5XA 4L2YA 2DMCA 4Q9QH 3GJFA 3SE6A 3GJFK 4FRWA 1X6LA 3FCTB 5C9JB 2XU9A 5BZWB 4DO4A 5FO8A 2EO1A 2XX1A 4G1EA 2E7HA 4WQOA 5A7BA 5HTSA 5JHLL 3QH3B 2ADIA 3UYRH 2IG2H 3VFPA 3RHWK 2CZNA 3HB3B 1JWUB 5C0CB 1NGZB 2JE8A 1N8ZB 2VMJA 3FTWA 3CVHH 3IDNA 4YSEA 2KZ1B 1RERA 2P5EB 4R0LA 4ZO8A 4BGLA 5BCAA 5CBEB 4QTFA 1G4RA 2RJMA 5L88L 1JSYA 1S9VA 1T1XB 3QQ4B 1S3KH 1Y07A 2OLDA 4JLRB 3H85A 1BWWA 3L3DB 2IEPA 3RJDA 1IM9D 3QSKB 4KKLD 4RGOL 4K7FA 5DO2C 4YXHL 2Y7MA 3JV0A 2G2NA 3QEQE 2YGPA 1ICTA 4DP4X 3ULVL 1A6TB 5J11C 1FO0L 5INDB 1P53A 3LZPA 1HEJC 1INEL 1I85C 3I6LD 3T6QC 3WJJC 1X5KA 1Z9NA 4NLHA 3L54A 3NPSB 4F9PA 5JQ6H 3S5ZA 2OMXB 2XTLA 4MMXA 3ZRFC 3PV6B 3LZRA 2MTAA 3MGAA 4IRSA 1B6UA 3GRGA 2PCXA 3BRFA 1XGPB 4FQJH 2ZG2A 1DLFL 1S9WB 5ACZA 3U0PA 3I02A 3V4UH 1SJVA 2I7SA 2OI9B 2CBMA 1I3GL 1PX8A 4HAKA 3KGTA 4UOQA 4WV1B 4ERSL 1N5AA 1B9ZA 4O4YL 5E1GA 4BZ2A 2V7NB 2R8SL 3IDMA 4ELMB 4PQXA 3RWDA 4JFQB 3BDBA 1MCBA 4JFEA 4RSVA 4OY9A 5DA4A 1UFUA 2H3NA 4UYQA 2K6YA 1J8HB 2ZUUA 1XGUA 3AUWB 1BZ7A 4NUGL 3WNOA 1MZZA 4FA8A 1F1AA 1KXQA 1PLBA 2CM6A 3HFFA 5CILL 2NSXA 3NAAL 4DNLA 3ZPDA 1H9VA 3P2BA 4MB4A 3VM7A 4LOEA 5F0LB 1DHKA 2VUYA 2KDGA 2BW4A 4OD2A 4JFZH 3KLHD 5EHFA 4TSAL 3OXRA 2X87A 1AO7B 5JXEA 2N1KA 2DBLL 3DXAA 1WUZA 2Y07H 4N2AA 4WIQA 3L17A 1TJGH 4AITA 3ATBA 4PWHA 2YIHA 4UQ3A 5G4NA 4PLJC 4GSUA 3N0AA 1U8IA 2UY7B 4WEUD 5ERWB 2VDRB 2P47B 1IAOB 2IOMA 3ZZLA 4OW6A 3X3GH 5D96B 2W81C 5EU4A 3ULUE 5C0JB 4DAGH 1QFWL 2DOCA 3MNVB 3O41B 1J5CA 1UB6B 4R7XA 1ZVHA 3G3LA 2F8XC 3CQQA 5KVFE 3KWWB 3SDXA 1I7RA 1KGJA 2EJ1A 2NNAA 3KNBB 4EDXA 1U92A 4GMSH 4K5OA 2OMVB 4X8XA 1DZ0A 3HHMA 4ISVB 1ADQL 3IT8D 3ZTJH 4F7PB 1NFDA 3R4RA 4L3EB 3ATFA 1O5PA 4S1RL 5JMRA 1MREH 2MPAL 3QRGH 4GG8B 4I0KA 3GK8L 4CVZB 1BVLB 4BCXA 4GW5A 5HHQB 2RAMA 4JRXD 4XAWH 5CJOH 2WOYA 5AW2B 3TZVC 2C1PB 3FTUA 3HMWH 3TTYA 1E4WL 4I3RL 5I5MA 1USZA 2JJTA 4YHNB 3W5NA 3B8YA 1S7WB 4EMZA 3T2OA 5T1JA 4PV9A 4GQPH 4LO9A 5FUOL 5DC9B 4ZTOH 4YVNA 2HFFB 4XPAL 2NY6B 4Z7OE 3F12A 1S7QA 4XCYA 5TDNB 1DFBL 5F9OL 1WS7A 5B1JC 3B9DA 5KBMA 5ESAB 1LO0L 1N0XH 2WNGA 2Q8AH 3C5ZD 4YMPA 2Q8BL 2YA2A 4NCDA 4PD4J 2DTMH 2NW2A 3RL1B 1N5YL 4KJYB 1GS7A 4P2QA 1P4IL 3ZL2A 1X9LA 2FLBT 2EYSB 1BAGA 1FYTD 5D7IE 5CEXA 4X42A 2H4EA 2H6OA 3MZTA 3ZHKA 2MCMA 4JJ5B 5MENE 1N67A 2D7PA 4ACPA 1H5BA 1YY9D 1X5AA 4L8SB 3V6ZA 4WJ5A 4ZK8A 3O6FB 1I7ZA 1EO5A 3UTPD 2CO1A 2DEWX 4QKXB 4B3EA 1S9XA 1TJHL 1A6UL 3GSVA 2AV1A 3IMSA 3NJKA 3TNNB 3BVUA 1U91A 5BJTB 1IFHH 1X9RA 1BZDA 3OAYH 1JWSB 2BNRD 4HOWA 5IJDC 3FB5A 3CFEA 2DQIH 3LEYH 3ZKXB 4LDCA 3NSDA 2XV2A 2ZSWA 3T0EB 1N9PA 5KSAC 3NACH 1YUKB 2DKMA 4JL2A 3MMEA 4GLRH 4TVSa 4XO9A 1GH7A 2ID5A 5LXGL 4C4UA 4XBMA 1ZPLA 1RV6X 4KC3B 3DSFH 3TBTA 3VI3B 1E67A 1FGVL 1I7RB 4EVNB 4AVKA 1XWVA 1MFCH 3MJGX 1KGUA 4M6OL 2CUIA 3PUCA 2DBJA 3G5YA 3MJ9H 4FJ6A 1AGFB 1SF5A 2D03L 1OAYH 1YNKL 3C6LB 4A7SA 4GUQA 2QHRL 2AERT 3QZNA 4TRPL 5F89A 5IOKA 1M9SA 2Y2WA 5FF6A 1HL5A 4QWWD 3SO5A 3QWOB 1LO2L 4HWBL 3OKLB 4JM2B 3KGUA 4NO0D 3KPLB 3L8QA 5GS0L 2WLZA 3QB7C 3VYNA 4OCWL 3MRPA 1URIA 1MHHA 4PG2A 4X7SL 3R1GL 3DVGB 2B0SH 2DI9A 1CYXA 3QRBA 1BXXA 5BXFA 1ROWA 1FVCA 2I60H 1RIVH 1S7UB 3DVIA 3ETBJ 4JN2A 4P9HC 3DBSA 1ZANH 3MV7E 2B14A 4JN1L 3BP6A 1F4XL 1ZHKB 3Q05A 2EDHA 4NNYB 3VXRE 3ESVF 1IBHA 1RU9L 5T1DL 1P1VA 1MUJA 3V10A 5LB1A 1A6ZA 2PYEB 4HU8A 5FK9B 4M1DL 2NY1D 2GJ6A 1Z9SB 1S7SA 1UUNA 4V1DE 4J39A 1ACYL 1VFAB 5GJSL 4NRZB 4E9TA 4DQAA 4JFEB 2OJEB 1CL7L 1INQA 1LQSR 2F53E 2P45B 1UC6A 1UJTA 3BPOC 3GS0A 3RPIB 4F7MA 1KY6A 4MSWA 4I3SL 3SYPA 3B7SA 1I1AB 4WGVB 3FHAA 4WTWA 1RZPA 3TIEA 1KC5L 2VL5A 3CHRA 3EOYG 4UB0H 4ZFOB 4YGAB 1I7TB 3ZSSA 4XZUA 2MPVA 3R0MA 4P23A 3CBKB 2XIDA 1WG3A 2ADFL 4GI6A 2H47C 4WFGD 2ZX7A 3RIKA 3BISA 4N1CA 1Q9KB 4X5QA 1NFIB 4ZS7L 2NNXA 3LQZB 4L5FH 1AXSA 3MLZH 3V4VL 2E9BA 4PJ9D 1H0DB 1DE4B 1CD8A 4UQDA 4IRSD 3WS6C 3E38A 3I3DA 5SV3A 1GOGA 4GOSA 2OJZH 5MEND 5D9SA 5F93C 5D7LE 4AT6A 4JGMA 3L4TA 5EBLA 1ZLDA 1BF5A 3QP3A 3MBWB 5IQMA 4Y8AA 1BQHG 3IF1B 4HGWA 3SKOA 1UOVA 2ZX8A 3F62A 4AYID 5AVWB 1WAAF 3HC4L 2J71A 4AG4L 3QHFL 2VSCA 3ECBA 5C0CA 3TZVD 4L0PB 2VO8A 5CSZA 1U8CB 3O8XC 3E80A 2PP7A 2XCMC 3TV8A 5AB2A 5JIDA 1FUNA 3MGOB 1XIWB 1VFOA 5B4MC 4X6EA 2AVGA 4WI9A 3DV6A 3EGDA 4QTHA 3TTSA 4HOXA 4K5MA 2XZCL 2BIOA 1LHZA 5AKRA 4APQA 2YZ1A 3VW3L 1RZFH 3KH3A 3CZEA 4LLYB 4MBOA 3DRQA 3PNRB 4FMKA 4YNYB 5E1IA 3TWYA 4AQOA 2HVBA 2ZXGA 2NY6C 4P2OD 4KJWC 4F58H 4P3CL 1FQ9C 4O58L 2KPNA 4DP2X 2O4EA 2V5RA 2G30A 3EOBA 5DMGD 4OLZL 1FG9C 5IGXH 3U9UA 2AS5M 2KH2B 3TEUA 3JWNH 2P7TB 1ZTXE 3QEGL 3S37X 2XACC 5GGRB 2YBRB 3M1BB 4OLYL 3ARPA 3H9SD 1MPAH 3QUMH 4X9IA 4AUYA 1JVOA 3FB7A 2VQUA 5HDOA 3V0DA 3CCHB 2G4GA 2H8PB 2DQEL 1FNAA 2EABA 2JKLA 2MCPL 1G7QA 3MNZA 4N8VG 5SWQA 5FEBA 3FK3A 2NLJB 3D33A 5E9DA 2PP9A 4FMFA 4DP6X 3BKML 3JWDC 5KSUA 2ZAHA 4WFGE 3F7PC 1BFOA 5GS3A 2COQA 4B9IA 1L6XA 4BQBA 2DTSA 1CQKA 3LZNA 4FYQA 4WJKB 2QTEA 4L1TA 1VA9A 5DR5H 2J5LC 2UWEA 1S6NA 2XPGA 1A6UH 1ZPUA 4G42A 4K94H 4HU2A 4OF5A 1NCBL 1Z3RA 2WZAA 2LABA 1PX3A 1BZ8A 1NBCA 5CHNA 4NO5A 3OG6B 4OAWA 5T1LD 3VWKC 3BZFB 2J4WH 3CX2A 3CXFA 1OP3H 1UZ8A 5DLLA 3QA3B 4RNRA 3MKKA 4NZUL 1V7MH 2IBGA 2WVTA 1CBJA 2XDHA 4MS8C 3OKKB 3ALXA 3G04A 3BIBX 4KMQA 3KXFE 3TBCA 3RWGA 3EBAA 2CD0A 5C0DA 3CFMA 3QIBC 3R8BB 3VXSD 5CILH 5LNEA 1QTYT 4J8RA 1BWMA 5IVZB 5DTFB 3MXVH 3UBXI 2NXYC 2DI8A 1OK8A 5D2LB 4AM0B 2NX5D 2YUZA 4GW1A 1ZJAA 2EIKB 4XI5C 4P06A 4BJLA 3V0JA 4I18A 5A6LA 3S9DB 2MPAH 4E42B 3MV7B 1AXIB 5EUKA 2XA8L 1S8DB 4BHUA 5G5DA 2IDUA 2EILB 2UZXA 4I0PB 2NCEA 3II1A 3L3OA 3ABKB 3TM6A 2EKSB 2D3JA 1YNLH 4PFEA 1CD1B 3NGBB 1JNLH 4F8QA 3L5JA 3NN8A 2BVYA 3X3GL 4JHZA 4JAMA 5JLZB 1T5XB 4Y7OC 4PTTB 4DO5A 2XHNA 1VJSA 4WAFA 3A4EA 3OHXB 3ARGB 1Q1PA 2RBLA 1DBBH 1BEYH 2F74A 3SDCA 1IAIH 2VXVL 3HJ0A 4KNSA 2YJQA 1NA8A 3F7YB 2DWSA 1GPOH 2H1LM 2NY3C 3QUYC 4OSUH 1I1AC 1DFXA 2DTML 4A2DA 2R23B 3J7HA 2XXCB 1RK1A 4OV5B 3CLFL 2EC8A 4GRLC 1RZ8B 3RDTC 3US9A 1RURH 2V5SA 2QL1A 3ZE0E 3LSOA 2JCCF 4WTXA 3T0EE 3EG9A 3RY6A 1UH3A 4G7YL 4ZUUA 3KPQB 4XRCA 3BMWA 4JFXA 3ZYZA 3ECVA 1E3ZA 4I5BA 4LSRL 2BSED 2ED6A 2F8VA 3HRPA 3OB0H 3VH8G 3WJMA 4XPGL 5TDOA 3MLRH 5I1CL 2O72A 3EFOA 2NY3D 3QUYD 1TT6A 4Z0XA 3LQAH 1I8KA 3MTRA 5F1IB 5G4MA 5J6GA 2OQJB 2X4OA 1F90L 4KUZL 1TU2B 1DUZA 4GBXC 4ZOAA 3GQFA 2NY7H 3AGWA 3TWCL 5EBWA 2R56L 4U1GC 4X98A 3VXRD 3MPCA 1ZT7A 5MENB 4U4BA 5I1HL 1J88A 3FU5A 1RZGB 3S0PA 3EBIA 5LGYA 1XSKA 2XG5A 4JDTH 1B2WH 3VQ1C 2R4SH 1P5VA 2BS71 4R0LC 4NQTA 2J7LA 4PRNA 2XPYA 3FZUD 1ECZA 2GFBA 4UZSA 4DUVA 4JGNA 1UACH 2R0WL 2ZWZA 1GL4B 2R2EB 3O6MH 3SODB 3UBXG 3MNWB 3KYNB 2EZ0C 4JZJB 1SDDB 1T7XA 4NB7A 3BFWA 5KYUA 4Q6IC 4F8PA 1XMEB 4JFWA 4ABUA 5F97E 4A6YH 4HF5L 3PHQB 5LCVA 1M4KA 3OMAB 2VWEE 1OM3H 3UBGA 1HU8A 3D4GA 3HAEB 3BUBA 3DJRA 2VC2L 2JIXA 5FM4A 4AJWA 3WNNA 4Y19D 5EC2A 5IQOA 3WHXA 1QKZL 1SHXA 1QLFA 1A8JH 25C8H 2BCKB 2NUTB 4H26A 5BS0E 1G1YA 4BFJA 3Q1SL 5GRVL 3QQ3A 3DKHA 3TIDB 4I3GA 2OXGB 3TEWA 3WTYA 5E1AA 3UTTE 5ICYA 1AKJA 3FTGB 3B3BA 3GKZA 4XP4H 1UWXK 3LEXA 1ZAGA 5LBSL 5I66B 3ESPA 4JANB 3QRFM 1KTLA 2HYMA 3LN9A 4BK4A 2G0KA 3IFLH 4JKPL 5C0AD 3ABZA 1KIPA 2XXFA 1CLOL 1QA9A 2FECL 2GW5A 1CDYA 3H9SB 5EBWB 3CFJA 3ZL4L 1ET7A 2HTLC 4RDQG 3MRQB 4H8QA 5IROA 3OGCA 1MCCA 1FL3A 2ESVA 3UBFA 1T1YA 1HNYA 2F7IA 4LL1A 4P49A 2UXTA 1WZ1H 3MJ8A 4K3EL 2CO2A 2QGDA 2F0CA 4P9MH 5CO1A 5FUZL 1K2DB 1U41A 2A6KA 1LJMA 2RMNA 4GYBA 5B38A 3GMOA 1GGBH 4N8VB 1RXLA 5IQNA 2AEQH 4HLJA 3K81A 1CTOA 2H6PB 3UAJA 1JWMB 1LK3L 1LK2A 1VHPA 3A23A 4KUCF 2X44D 5EU7C 1VZIA 1JUFA 1PD0A 3MRDA 2O5NA 4AQEA 1F02I 3FQTA 5ITBH 2IH9A 3H2PA 1JYVA 3H9SE 4FNTA 2GTWB 2GBVA 3DX6A 4I18C 4XCFL 5AWNH 4PJCF 4LHUG 3SKMA 2LU7A 1IBFA 2CDFB 5T1MB 1IKOP 2FX7L 3AAZA 3FOMB 3R06A 3FNKA 3OHXA 1RIHL 2IJ0C 5JUEH 5JW3L 4JO2H 4Q2ZA 3F7QA 2LAAA 4I48A 5I19L 1EZSA 1QP1A 3OC5A 2KZBA 2CHXA 43C9A 1Q9OB 1WFTA 1XQ4A 5FFOA 2VR7A 4P5MB 5BS0B 4F37K 3BZEB 3PAVA 4AGPA 4Z78B 1ZLEA 2YLKA 3N9GL 3U82B 2Z1KA 3O45A 5L2KA 1YMME 5FM5M 3LZOA 3QR0A 2WKLA 3PP4L 2XICA 4ZUWB 1BJ1H 4NSKA 4G8GA 1KB5L 3GSUA 1BG1A 4KK8C 2XZQL 5FCUL 3VMOA 4ZX3A 2WVVB 3DYOA 2VZOA 1U2YA 1JNNL 5D1QD 1TTFA 4Y2DA 3DV4A 4ZXBB 2X2UA 4ZMQA 2NOYA 4A39A 4Q2ZB 4FLSA 4DGIH 4U1IB 1RUKH 5IFAH 1BVOA 3WFZA 1EHXA 2V9TA 1A6PA 2VJ8A 1RQ5A 4IU2B 5E2JA 1DR9A 1G9HA 4E9WA 4ZDHA 4JFOB 3ZDZE 2FO1A 4IS6A 2HFTA 1DQLL 4HEPA 1CICA 2CNZA 4XO4A 5J7CC 2Y7QA 3BKJH 3Q1EA 4WNQA 5DS2A 4UWQB 4GFXA 3QAZC 4M5ZL 4CNIB 1BM3H 3GSWB 2Y2TA 1UASA 2WIMA 3IMVA 3QJFB 3ARUA 4F7KA 2OS7A 4XCCL 1GJUA 4FG6C 5E2VH 3ZDXE 1PQZB 2VDMH 5JW4M 4F2MB 1E4XL 4HS3B 1QVOA 2OYMA 2PR9A 1WBYA 2EEXA 1RZIA 2YPLA 2H6PA 2JJVA 2QR0A 3BVXA 4FFWD 4LNRB 3MRMA 3QGVA 4LSTL 4TSAH 2FH8A 1GZHC 1BQHB 1SZNA 3ZE1F 1LEKA 1DJGA 1FL5B 4WO4B 4FADA 4EN3D 3E1F1 1TOXA 3DX7B 3VGAC 4RWYH 1CVSC 4LRIC 3L7FA 1XR9A 4JPQA 5TE6L 2LTQB 3INUH 4KUCD 2JLPA 4FXGA 2ENSA 3QAQA 2Z8SA 3M1OA 3RVXC 3ZE2E 3ZBMA 2EYRB 2OR9L 3H53A 1V10A 4E41D 4WUUE 2XWEA 4GXVH 5C8JB 3UTSE 1BYPA 3HEIB 4FG6D 4YZFE 4IBZA 1NJ9A 2BSCA 4IJTA 1XB8A 1Z5LB 5IHUL 3ZE0B 2GC7C 2E27H 5CWSA 1RUPH 2LGNA 2EYTB 1OXYA 2IH1A 4ZUVA 4Q6IB 1WBXA 4NDMA 4S1RH 4G6ML 1IV8A 1HDMA 4G6KL 2HTKD 4MCZA 4NAQA 5TDPA 1BVKB 1G1KA 1U33A 5BVPH 4I85A 2YLHA 4XPBH 2OKMA 4P04A 4BFNA 1T4KA 3RVXD 1F2XK 3CZFB 4D0DA 3N50A 1W16A 4X50A 1UH4A 4X6FA 3TCTA 2ZUQB 1KEMH 2K70A 4JW3A 4EXPX 5IUSA 2VR8A 1NMBL 1M05A 3GNMH 2J1ZA 2R4RL 4YL4A 3SKJH 1Z3GL 3TPKA 5IQ9A 2J72A 3NP4A 3SE8L 4FE9A 3FT0A 3ZDYE 4JPIB 4G1MA 5IVXB 4ODSL 4XP9L 4DJMA 4Y19B 4RGND 2HTKC 3BCDA 3NEEA 1DJWA 2QBWA 1NLBH 3ARFD 5H35A 1CF8L 4X80H 3KPRD 2VZ1A 4M9PA 3RZCC 4GEJA 3V5HA 1FVEA 1VESA 4DN3H 3P69A 4UM9D 2CCWA 3HN8A 1GAFH 4CVUA 5JHDA 1DQDL 3OKEB 4M7LH 5F0PB 5TFSH 3CZKA 3SO3C 1QWNA 1R5IA 2E7LA 4ZMTA 1N26A 2Y06H 4N25A 4PRNB 1BBDH 4UINL 1HHGB 2DEYX 3MRHA 1KXTA 4IRZA 5AW9B 2GCYB 2WBJC 2O93L 1PKOA 5KS9B 4A6YB 1A66A 2AC0A 4FQXB 3O2DL 3D3VD 3P0YL 3DTUB 4ZYKB 3MRKA 4U33A 2ZCHL 5G55A 3AGVA 1RD6A 2DQDL 4JE4B 2WINB 3LQZA 1NPJA 1KTDB 1HWWA 3BP4A 4LHQB 4RRPG 4JHWL 4JM0A 1AFVL 3SBWC 2MNUA 3B7YA 1A02N 1OT2A 1YDPB 2BP5M 2VMDA 4U6TA 3WCYA 3BP4B 1PEWA 3ZOAA 4CC1A 1JRHL 1SFHA 3RJQB 1NZRA 5A2BA 5KYNA 3FN3A 1CD0A 2AGJL 4JUSA 4PI2A 4KRPD 1MF2L 4XWGL 5T3XD 5IEKA 2CH8A 4NHCL 1B0GB 4NENB 3LN5B 4S2SB 3ULVF 1FBIL 4FP8L 2JELL 2F54E 3P54A 2XKNB 2YSSB 5DFAA 4F91B 2XY2A 1KACB 4X83A 2ODHA 4HZ1A 3B2MA 4GIPD 4A37A 2E4FA 1UT9A 1D7DA 3EJPA 5AAPA 1BMWA 3D3VE 4EUPG 4UTBL 3RWHA 5DJDB 2WMPB 4F57H 2OCCB 4KQ3H 1KCSH 1NGWB 3PGFH 2RIKA 3LVEA 5DWUH 3X1NA 5SWZD 3CVHL 1B3IA 4IKJA 4OBSA 2D2CC 2J2ZA 1RIVL 4L3CB 4G5AA 2JJSA 3D12B 3L4XA 2A99A 2J1KA 4I77L 4UF7C 5HD8D 5HHVL 2RTTA 5ICUA 3CGTA 3HZVA 1CFTA 4LMQE 4GG6A 1WBZB 1CE1H 1IVLA 1BZOA 4LCWA 1PKQB 3DHMA 2APFA 4DPRA 3C9NB 5IESL 5CMAA 3V5DB 1S5HB 1H9DA 3QNYA 4LXFA 4NQDA 1KNOB 2XTJC 3QDJA 5ALBL 3CWGA 3ZZ1A 1D6VH 2K78A 1AG0A 4C57C 4NQXB 2O61B 2AMUA 2JKIS 3D0VA 4JRXB 4N8PA 3WELA 2XRAH 3ETTA 4PCTA 5IK3B 2VC2B 2VMFA 5LN8A 3L4VA 1T80A 4FCHA 4XNQA 2OK0H 3BPLB 1EEZA 4A04A 1YY9C 4QYAA 3QT2A 3IGUA 1G4MA 2EXWC 1MKFA 4M7KL 1RZQA 1S3KL 2ICWA 2X4SA 1XGYL 3FPYA 3KYMB 1BD2B 1BW8A 2BIHA 3L9BA 3TO4A 1FE8H 4IOSD 2Z35B 5C7XH 5HPOA 1QBLH 5D4JA 2ADYA 1ZT1A 2HA1A 3H3PL 5LGKA 1YG9A 4R83A 1U58B 4M5ZH 2IBZX 4F27A 1AR2A 3ZYIA 1IKFL 3OL2A 5AYQA 4P46A 4PJBF 2OPCA 1JPST 4C56A 2WWKO 4Y16B 2X05A 5FYLD 3MA7A 3S36L 4R7NB 3VG0H 5LJYH 4LPTA 4MAZA 1QI5A 5FFLA 1A7BA 2VLJB 1PW3A 1MRCL 2OSXA 1DEDA 3NFPB 4PJDB 1J87A 4I2XA 1NPUA 3HC4H 5LGJB 1AZNA 3MRRA 1QOKA 3KCWA 5H37A 1YEJH 1A7QH 3QORA 4Y5VC 3SDAB 2VDNH 4RGOH 4IDLA 5C0BA 5DJDA 3V6BR 2JCWA 4Q4IA 4FNLL 1CXIA 2WO3B 4JY5L 5DD0L 1S9KC 2EDOA 4JQIL 1N64H 2OZ4A 3PWUB 3A22A 1ECYA 3AT8A 2FEDC 1EEZB 4CW1B 2B2XL 2EUXA 4Y2DB 4NUGH 4UAOB 1L9RA 2YBRA 2EIBA 3JYBA 3WXVL 1TQWA 2P7TA 3QPQC 3GMNA 1BA9A 1YPZB 4GXUN 4C55A 1NMCC 4OKVB 5JIQA 3EOBB 3T1WA 3FBQA 2PXYD 3S7GA 3P2DA 4JO3H 3CU1A 4MCMA 4JQIA 3UADA 4H4NA 3MUY1 5I17B 3D18A 4HDIB 4XN9A 4YUEH 5B21A 2X3AA 4HJEA 3O3DB 3RKDD 1HCZA 1NCCL 4UT6A 1AHMA 1OAKL 4H2CA 2YGQA 3K74B 3AXLB 4LSUL 3KDPB 1FNGB 4KKCC 2ZOKB 1OKEA 4X6DB 4XNAA 1YC8A 4PS3A 2AQRA 4U1JB 3ULUF 4J3OD 4Z7VE 1HQ4B 3S3JA 2A6IA 3VFTA 2WCPA 3WKQA 5L6YL 4DAGL 3GRWH 4QAWA 3V4PA 1LO4H 4UYPA 4ZZKA 3JWNE 3GZQA 3NJVA 1U3NA 3BD5A 3F7LA 4LBEA 4PBWD 5ADPL 3HZYA 4QHKJ 1U3HA 4FQCH 1BZ9B 1HKLH 2F18A 3B56A 3FSVA 3SKMB 1CF8H 2LW3A 1LO3L 3QW9A 3A0OA 5KZCB 4N28A 1R5VB 2IO5A 2XN1A 3D08A 5C08D 3L95B 3K2UH 3WFEL 3IYLW 2WZ6A 2HB0A 4RBPH 5INCB 2Z93A 4JK0D 1FIGL 1A14H 1WA2X 2PTVA 2YPVA 3SGDH 4YBQD 3LN5A 4KRPC 4IIQA 3JV6B 1FFOB 2AKRB 1MI5A 1L7IH 1MFEL 1SXNA 2DLFL 2FX8L 3QFDB 4N2IA 4XC1L 3SE4C 3QZLA 3VFTB 3KJ4B 5HSFA 3SCMC 1GHFL 4PM1A 1K2DA 4YLBA 5DUJA 4LPUA 1RZ7H 3WG7B 1NFIA 1A4BA 5FGCB 5HDBE 2OYPA 5LNDA 1AHKA 3BZ4B 4B60A 5T3ZD 2J8UB 3AXLA 3N40P 1BFVH 3RKPA 5A1AA 2KZKA 4I4WA 2PNDA 3BKYL 5FYJH 4H0HB 2R27A 4S0SD 4K94C 2C9RA 2HFEA 2F7RA 2WXRA 5EH1A 1A2YB 2TSAA 4YSRA 4MMXB 3SJVE 4AQAB 3DHJA 1CT8B 4XP5H 1NC2B 3BJ91 2GUYA 1EEUA 3HBGA 3OKEA 4TQEL 3GJEB 3MXWH 4XNUH 3D0LA 3N1GC 1KN4H 1N19A 1OP5K 3IJYA 1CN4A 4PREB 4XNYL 1FVEB 5SWZB 3FCSB 3IRCA 4FL4B 1U0QA 2CUMA 4YIQA 4KJWD 3L3OC 4YHML 2YAEA 1SLXA 3RTLA 4NZRL 4PJ8B 1JGEA 1II4E 1TQCB 1BEYL 3QQ4A 4U31A 3PJSB 1NM4A 1J0IA 1X5HA 1Y0LB 4HCRA 5T5FL 3LEVH 4Y1AD 5KYUB 4HH9B 5FGSA 3ARQA 1C8PA 3JWNC 3C8KB 3DTXB 4L0ZA 2EVIA 4HUUB 1TJHH 2ZWKA 3U4BH 4FNPA 1F11B 3P11L 4JRYE 3LDBC 1U58A 3KYNA 4RMRA 2VAAB 4C56D 1R3LA 4EF3A 5K1NA 1ZT1B 2KBGA 1T03L 3FMGL 4LLDB 3IPEA 2R1YB 1DBAL 1Y7VA 5TDPB 4Z95H 3RL2A 1WSST 3ILEA 2J8HA 4KQ0A 4X9BA 1HINH 4IOSA 3EAKA 4BH8B 3O6FC 3DK2A 3GSNH 1MCEA 2CPCA 5K69A 3NCMA 4KJQD 4A7VA 2Z7YA 1Q72L 1K6QL 3A6BH 3HUJB 3GMRB 1SGKA 3CHSA 3OR7A 4KI5E 3D4CA 5LO7A 5LDSA 4YE4L 4E0RB 5DQDL 2XQBL 3Q2NA 5GXBB 5IJVA 4HUXA 3CC1A 1FZKA 4E9VA 1YY8B 1D3CA 1N18A 3L6FB 1F6LL 4WW2C 1MFNA 3G08B 3M46A 4YDKL 4Y16D 3DX7A 1EHLL 1CIDA 4YSQA 4LCWB 1OTSD 3JTTA 3PS6A 4WFHD 2DYSB 4UZGA 4M7ZB 3X1EA 5M95B 3LZFL 3NIFF 3O6LL 3B9KB 1VSCA 1NEPA 3QE5A 3P4OB 4NRYA 4PJXA