3QJFA

Crystal structure of the 2b4 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
200
structure length
195
Chain Sequence
QVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFQQNSRGSLINLFYLASGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAALRATNNKLTFGQGTVLSVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 2B4 alpha chain
total genus 39
structure length 195
sequence length 200
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjfA02
2ERJC 3L95B 1C8PA 1QUNA 4K94H 1A6PA 1FO0B 3PUCA 5C0JB 3QIWA 4MLSA 5DJ0A 5D1QA 1Z5LB 3B9DA 4A6YB 3GNMH 4G6AD 5KBNC 3JWDL 5HVWA 3DSFL 4PG2A 4M8QA 2XTJC 4BH7B 2NTFB 1D6EA 4DUVA 2Z91B 4KHXL 2RAMA 1RI8A 3ILPB 5C09B 5CJQH 5BVJA 5KJRL 1ED3B 4MWFA 1QA9B 2DJ4A 4OLVH 5FCUL 4HUKB 4UIMA 3QQ3B 4K71B 1FV1A 2FIRT 1CYGA 5JW4Q 4N0YH 4DK6A 4Y5YB 4MS8D 4PD4J 3AREB 1AGBB 5EU5A 3D0VA 1HSBA 2AQ3A 4JM4H 1DFBH 2UWEA 5IJVA 2FBJH 2JKXA 3MV9D 1VGKA 1UENA 4FQHA 5D7JC 3WFEH 4UTAL 1KJVA 1YYMH 1ZXQA 4X7FC 3TZVC 4TPRH 4XP6L 1U8IA 1DLFH 1LO5A 2HT4D 4O51A 4LU5L 4JHWL 5L9DL 3OGCB 2NX5E 4GRLD 4N0CD 1H15A 1UM4H 3VFGL 3NCYP 5EOTA 2VO5A 5D2NC 5TPWH 2HYMA 2M1KA 4WNQB 5F7DB 1NGXA 1AO7A 3QWOB 3TNMA 2QSVA 4CJ1A 5DMYA 3QDGA 2ICWA 4GKZA 4JFYA 4ZUUA 3X17A 3BSZL 3IFPB 4LSRH 2OX5A 5KSBB 3ZLQC 2AK4B 4K9EH 4S1DC 4MJ4A 5BZDA 1AD9B 2H2SC 1DN0B 3O3AB 1IKNA 4G80A 4HXBH 1KBGH 2APXA 1QSFB 2HAZA 3L3KA 3ARED 2PYFB 5D6DA 2W91A 5J0BA 1F2XK 2JCCE 1YNLL 2ZCKH 4PJIB 5E6IC 2YD5A 1VEOA 3WD5L 1TJIH 4IIQC 1ORQA 1WT5C 5GQBA 1DQMH 3PGFL 2MQ0A 1Q1JH 4YHOH 3K3QA 2HH0L 3F7YA 1EH9A 2AI0L 5DK0B 4HUVB 2D7MA 5I73C 3G5ZB 1TTGA 5EUOF 2VNCA 4IOSD 1KT2B 4LLUB 1M4KA 5A3IC 3RIAK 3FO0H 2Z31C 1EERB 3G5YA 4NP4H 2AJXH 5FO9B 2P7TA 1TJGL 2VXQH 5E8EB 4CADA 2E7MA 1QQDA 4UIMB 3KLAB 2DKSA 3QIUB 5IVXF 3AMLA 5CBEB 2OM5A 3MROB 4ZOBA 2IBGA 3MCLH 2EC9U 2AW2A 5DTFB 3VFVA 2ZSVB 1D6VL 2I9LB 3K8KA 3SCMA 3FT2B 3QIUD 5BJTB 1YC7A 1UQSA 4JQVC 5D72H 1BFOB 4NNYB 4R6UA 5IKCB 2V2TA 2BVOA 4D9QD 1KIRB 4LHJB 2QTEA 4E42A 5F9OH 1A3RH 3VA6A 4HS3B 3JBG7 4NQVA 2Z8SA 1MHPL 2R56H 4PJ9C 1MVFA 3KYKL 4O9HL 4KROD 3SKOB 4KQ3H 5EU6E 1C5CH 1FPTL 1HQ4A 3IB4A 3SDDB 2P5WB 3D39B 2DB8A 2DIJA 3FONA 4ZS6D 5FYKD 5C9JA 3V8CA 4RIRB 4UTBL 3LKNB 1OAZL 3C5SA 3ESVF 2MKLC 1OL0A 4LCIL 3MR9B 3QDGD 3S5LB 2UY7A 2R4SH 1U8NB 4MNQE 5CUSH 1EGJL 4H1LB 4PJAE 4XAKD 2JE8A 4I13B 4XH2B 4NN7B 1OTTD 1YQ2A 3HTLX 3D69B 4LEOA 3T1FB 4I0PD 3MSPA 4APQD 1YEFH 5F6IB 3P2TA 3DV4A 3FO1B 4PRIE 5GS2D 3RAJL 1UB6B 4QXTB 2FNBA 2ZCLL 1C12B 4Z7UA 1BWMA 1KTRL 4FP8H 4U3CA 4NQDB 2CGRH 2QSCH 4QXUH 4WY7L 2VL5A 3QSKB 3MRDB 3G5XA 3P0YH 3EFFB 4PV8A 2P5EE 5F3HB 4WEBL 4NC2B 4CN1A 4FQHB 1MREH 4D8PB 4HS6A 4QRRB 5DFVC 4YNYA 2D31B 3TPUB 3KPSA 2NY4C 4MD4B 2VZTA 4X9IA 3H9YA 2OTPA 4NKIL 2NY1C 2KZWA 1FO0L 5CJOL 1GGBH 2W92A 4QOKA 1FRGH 1QSED 2DQCL 2J6EH 4D9RE 2ZUSA 4Y19B 1LMKA 4XP6H 4UT7L 2BHZA 2UWEE 3CVHL 3GO1H 2DIAA 5T1MA 4ETQA 1JHLL 2BVQB 3OQ3B 4D9RD 3PGCA 1HHGA 4ZQKB 5F88A 4GAFB 3MRIA 1SJEB 5I8CA 4X6DA 1WIPA 2ESVA 4F9PA 2JB6B 3N1PC 5C86A 4XNZB 1NDGA 1CT8B 3DROB 5KVEH 4P5KA 3G6JA 1F6LL 2P44B 3BP7B 1QLEH 3UJTH 3SE8H 1ODAA 5GSVB 2VUOA 3CMOL 3WYRA 4YGVA 3BGMB 1K4DB 3QJHB 2ARJQ 2A6DB 3WN5C 1D5BA 3F7VB 1CGXA 3BMWA 3DX8A 3O6LH 3U7YH 4TOYL 1KIQA 5EBLB 3O2DL 3MRPA 4DKEL 3LKQB 4PGJA 1I1YA 4TTDC 5CJ8A 4APQA 2LTQB 3STLB 4ZD3H 4M9PA 2ZG2A 5LQBH 4DFHA 4PRID 1ADQH 4WFFE 5IJKA 4EEEA 4JPWL 3U1SH 4OFIA 1BFVL 2VR9A 2APVA 2IEPA 1CI5A 2VKWA 1D5MA 2EYRA 4PRAB 3O4OC 4OCLC 2R2EA 3WHXA 4P9HC 1H3VA 1W2KT 5K59F 3TT3L 1TMCB 1E4KC 4WI7A 3MREB 1FL5A 5D2LE 3TYGH 4XCCH 2ADGB 4PG2C 1DUYB 4WWID 3T08A 4RISH 4Q6IA 1CLOH 2XNAA 4X5XB 1JHKL 2AJZA 5IG7A 4LOUC 5E70A 2XG5A 4HH8A 2IADA 3RWIB 2DQHH 3BGFB 3O6FD 4NQUA 2PXYD 1GC1L 5K93A 1OTSD 4LK4A 4OZFH 3N50A 1QSEA 3IKKA 4LPYA 4X6DB 2YPKB 1ZHKA 4RBPK 4O2EA 4N8VA 4G7YL 1G0XA 3JUZA 4PP2A 5HI3C 5CMAA 2I9TA 3UO1H 4WCYL 2VXTH 4PP1C 4X83A 2MQCA 3FN3A 4X8XA 3RUGF 2Y23A 4HS8H 5DMJB 3EFDL 5C09A 3G6JF 1NDGB 3G5VB 4HPYL 1HHIA 4HFWB 2E6JA 4U1GC 2FEDD 1PZ5A 1CIUA 2HKHH 2WQRA 3CFBB 3IDYC 3ZKMD 4NWTL 4GFTB 5F1SA 1J5OL 4MD5A 3FMGH 4UV4L 5CCKL 4NRYA 3BFOA 2VDQL 4MNHA 3P4MA 2WANA 1WLHA 4OGZA 3C5SB 1I3GL 4JFXB 2AGJL 3KS0J 3RGVD 5FYKL 5F3HA 1TJHL 1G7QB 1GH7A 2WM0A 4DVBA 1EX0A 1U3HD 3HMWL 4PJEA 4KJYB 3T65A 4L8CB 1I9JL 3QG7H 1EAPA 4FQIH 2FX8H 4XH2A 1QRNE 4HK0A 5FGCE 3BKML 1MLCA 4FQJL 4N1HB 3SO3B 3RX5A 3D85D 4G9FD 1HCVA 4R90H 1H3TA 3P30H 2CK2A 5C09E 1BZ7B 4S1QH 3N1GC 4RMWA 2NY0B 4X8JB 3WDIA 1I3RA 1MI5D 5HPMB 5H37G 1FIGH 1I3VA 1RUMH 2BOBA 1XZ0B 4H0IA 4P2QA 1EO5A 2GYSA 4R4FL 2BXYA 4HKJA 1FLRH 4XNUL 4NQVB 4MZ3A 4UNUA 1AGCA 3RNKA 32C2B 1EJ6A 2G5BA 5GHWL 2P49B 5DK2A 4HX1A 3MOBH 5ADOH 2EZ0D 5L2JB 2DM2A 3CSYA 2BNQA 4UV7L 1NLBH 2H26A 2VXUH 5CP3H 1VPOL 3U30C 5GGSB 3C6LB 3QI9A 4GW1B 3ZE1F 4EQ2A 4JQVA 5I19H 1KELL 1K6QH 4DAGL 4UNVA 3C5ZC 1WCBA 3I6KB 1FZJB 3L9RB 3IETB 1U91A 1BQLL 1MCCA 5FO9A 2DJSA 3TNNA 3B9KB 2B1AL 2YK1H 5SV3A 4O9HH 1GOHA 2UUDH 4HWEH 3NPSB 4RGOL 1UYWL 1UA6L 2P43B 3U7AA 2X4SA 1H8OA 4NN6B 3AS1A 2Q3ZA 5JW4N 4OB5H 1NAML 4PS4H 1J05B 2NW2A 2FIKA 4Z7VA 4OZGA 4WU5A 4LSQL 3ORJA 2PN5A 2X6MA 2V2TB 4L4VA 4XPHL 4PJEB 3T65B 4L8CA 1KXVC 2I9LA 4NZTH 4YQXH 5GHWH 2P5WD 3H7BB 3T77B 2GJZA 4XPAH 1NAMA 3W11D 1WWWX 5E2TH 4NPYB 4LCUB 4POYA 4KJQD 4U1LA 1IZJA 5CKGA 1WV7T 2XKNA 4IIQB 5TE6H 1HDMB 4TQEL 5EBWA 4ZTPL 4C56A 3L3DA 3D0LA 3BZ4A 3FB7B 5TDPA 1U8LA 2NY3C 3VFWA 1ZE3C 4YHPA 3WNPA 4QYOA 1DVFB 4OCRH 1HHIB 2Q20A 1FVCA 2PETA 1A3LH 4CVUA 4PJFB 3FRPG 4U7SA 1RVFH 1UT9A 3LPGA 4CW1A 5C0DA 4HUWA 4OT1H 1RZIA 4M1GL 5FYKE 4F3FA 2EDBA 5FO7B 1FFRA 5D7JB 4K3GA 2NY0C 1ZMYA 3VGHA 1NCNA 2HMIC 4GG6F 2Z35B 4M00A 1PEZA 1WCBB 1OSPL 3OB0H 2WZPD 4QTHB 4YC2B 1WZ1H 5GGTH 2EECA 3QXVA 3MRBB 5B38A 3K2UH 1RIVH 4OLZH 4NWUL 2AI0H 3N9GH 1LO2L 2V7NA 3IS1X 2ZUTA 3ZTNL 1UB5A 5D70L 3O8XD 4NN7C 1M71B 4PJ5D 3MRRA 2OMNA 3O6KH 3U4BL 1T0MB 3C08H 3BT2L 1X6NA 4KPHH 4MXQC 3BEWB 2YA0A 4P9MH 1RJZA 5AEAA 1Z9MA 3HC0B 1CGVA 1FNHA 4M7KL 3C5ZB 4Y7MA 1G7IB 5DEGB 5E00B 3ARXA 4BSWB 2I60L 2VLJB 3TP4A 1EEZB 1AXTH 3D39D 1CTNA 3DO7B 3VW3L 3MBEB 3BAEH 4G3YL 4MX7B 1ZGLP 3RU8L 4EN3B 5DO2C 4PLJD 2H9GA 4J8RB 1AP2A 3LSOB 3BP4A 2WAHA 4NO5A 3HCVB 4S1RL 3NIDE 3EGSA 1RZFH 1S7RA 3PIQB 5HYJD 2OL3A 3MV9B 2AJVH 3WFEL 3MX0A 5B3JE 4JM4L 3WKMH 3KPLB 4XPTL 5LCVL 1MLCB 1CK0H 2KZ1B 5BO1L 1E4KA 4XPGL 3QHTC 3MRJA 5IQ9A 2HJFA 4J12A 4KRMB 2XRAH 5ANME 2B1AH 5GS0C 5F9AC 1WK0A 1ZS8A 3VH8G 4WJ5A 1BX2A 4LNRA 1CXFA 3UPAA 1JF6A 3LDBB 4YFDB 3BKCL 5CWSA 4PREA 4MA8H 5HJ3A 2YEZB 5FECA 3WXVL 3RDTC 4K7FA 2QQQA 1IKNC 2YKLL 3O8XB 2IH3B 3SDAB 4HWZB 3ET9F 5HI3D 5GRVL 3C87A 4IMKA 4JRXA 2UZXB 1ZWIA 4GRWF 1NCAH 3QIBD 4AMKH 3ZSTA 4IIQA 4PBWD 4Y5VB 1OTSC 5DJCA 2DMKA 3SJVA 1CFNB 2A83A 2CLVB 1N5AA 1UXSB 4Z6AT 4MNHB 2CDFA 3S37X 1IGMH 1FVCB 4P5TD 1NCWH 3I6KA 1MCBA 4WIQA 3TN0B 2Z8VC 4MJ6A 2VLME 1MCFA 4X7SL 2ESVD 4OZ4B 3RGVC 5EIQA 3Q6GL 3MOQA 4JZNB 3KLDA 4RMVA 5T3XH 1JGUL 4NUGH 1XR9A 2J4WH 5EC1B 1FFPA 1C1EL 3NIFF 4LIQH 3TYFA 4P3CH 1XGQA 5HGBB 4PGCA 2ICWI 1F2QA 5IUSA 3GHEL 3QBTB 4NC1E 4W4NA 1C5BL 1FAKT 1X9QA 2IBZX 5EPMA 5KS9B 3GGWB 2F15A 5T3ZD 1FH5L 1MHCA 4QXGH 3WIFB 3LRHA 5C0AB 2FYYA 4WGWB 4MD5B 3KNBA 2BNUB 4N90D 2X1OA 5B8CB 2YMXH 3HZKA 3QH3A 4CBPA 1KCRH 1UZ8A 1U91B 4NNYA 3WJLC 3FN0H 3GSWB 5FDWA 1G6RH 2IGFH 2YXMA 1INDL 3RTQB 4LBEA 4J6RL 4K7PL 4P2RE 2A74A 3OXRB 5I1IL 3RL1A 3LKSB 2WBWB 3MNZA 2G75B 5IEKA 1RJLA 2DOCA 4P2RD 5FF6B 3JWOH 5JOFA 2BNRE 4HWNA 1CIDA 4X6EA 3VXRE 5CAYB 1U58A 2H6PA 4ZUSB 1DLFL 3V52H 1UCBL 4BUHA 1GHFH 3LVEA 4AEFA 5C0IB 4RWYH 1T4KA 3UJIH 4PTTA 4PGCB 3TBVB 1X5LA 1WFNA 1QRND 4X4ZA 2DLEA 2A6IB 5F9DC 5KN5B 1BEYL 4EKXA 2FSEB 4LSSL 3L5JA 1LK2A 1OAYL 2KBGA 1DANT 2D03H 3T4AB 4JFYB 4I0PC 5T1LA 3CD4A 2FECI 2VL4A 4CNIA 2OP4H 1CDHA 2CIIA 1BQHA 4LVNC 4LASH 2HH0H 2YUWA 3HB3C 3BP6B 3EOBB 3CX2A 3RWGB 3D2UD 3LAFA 4XVSL 3BKJL 4FNLH 1C7TA 1CCZA 1FZOA 1S7SB 4G9FA 1NMCC 3UX9B 3CMOH 5KANG 3JV5A 2NY6C 4C58B 4KQ4H 4XX1G 1UKQA 4PJ8A 3VRJA 2YBRA 4YE4L 2FJHA 1VACB 3KYOB 3P4LA 5HDOA 5D7LE 3NCCB 1U58B 1MCRA 1U8NA 1XT5A 2VDMH 4IHOA 4Z0BL 3VI3F 4V1DE 3O6LL 3R0NA 2EC9T 3L5HA 4WI9A 1AQDB 4JQXA 4NO0D 4DVRH 5HJ3B 4MDIA 4ZFOL 4OUUB 4PJDB 5I16A 2BOCA 1CFSB 1K8IB 4LNRB 3VFVB 1X5HA 4QF1B 3SO5A 3R1GH 2AK4E 3MOAL 5GZOC 2BX5A 4DOHB 1BFSA 2IPKA 4MCZB 2V5MA 5C6PB 3X3FH 2XFXB 2DLHA 4WO4B 4RAUA 5D1QB 4DEPC 1HXYB 4WDIB 5D71L 3VFOB 3EO9L 2YD2A 4XMKL 1NL0L 4KDTA 5IFJA 1DDHB 3V6ZB 1UXSA 2UZIL 4AEIL 3ZO0A 1B6DA 3GKZA 5DQ9A 5JOPD 1JPFB 2ZOKA 5JUEL 1DBBL 1DQLH 3HPLA 4BUGA 1SJVA 3TT1H 4JY4B 5IK3B 4R2GD 4RISL 3KLAA 4JKPH 4ZSOB 2EXWC 3TJEL 4QRUA 4TNWK 1YN7B 4G8FA 3B2VL 4U6HA 5I66B 3TVMA 4MSWB 1N5YH 4EOWH 3SKJL 4JFQB 2HT2C 1ROWA 2BY2A 3DV6A 5FF6A 2X1PA 1XGPA 4F58H 1JF5A 1I1AC 5JA8B 4QXWA 4PGBB 2AEQL 4JDZB 1JL8A 1G9MH 1OAKH 1PW3A 1JHTA 1P6AB 2EDEA 2VZ1A 4JO2L 1A7NL 5ALCH 1A6TB 4LEXL 5GRUH 4XP5L 3EW3B 1QNZH 7FABH 1UA6H 3IFLL 1L4IA 1XGUB 2GJJA 5DURD 1PG7L 1KIRA 4MA3A 1DN0A 1JZ4A 12E8L 2DQIH 3QCUH 5FKAA 3MACH 2MFNA 1NBYA 2Q8AH 4I9WD 1P7QA 3PV6B 4XPTH 1CXEA 2A9NL 4KY1H 3TZVD 3DIFB 1NCAL 1IEHA 4FQXA 2AXFB 2FEDC 3ZT5A 5D7JD 2I5YH 2XT1B 5E8NB 5E5RB 2AV7A 4OM1H 4N8VG 1B88A 4CAGA 4JRWA 3MR9A 3REWB 2C1PA 1QBLH 1QO3A 5D2NB 5I0DA 4HZLB 5CGYD 4Y4HA 4LGRB 4GRLB 3DI3B 5HHVH 3T0WA 4W70A 3P9WB 1LO2H 3GMOA 2DAVA 4FQJH 3SCMD 4XPFH 4HEPG 3VXSA 1KLUB 4UOJA 1O7VA 3VXOA 3QULB 4YHIA 3R8QA 3HAEA 1W72H 3D2UB 3CH1B 3V5KB 1GOFA 4TYUA 3GIZH 3U9PH 3BIBX 1FNEA 4PY8J 2RIKA 2H2SD 5I1EL 1YQVL 3IDUA 5C7XH 1LVEA 1VCAA 3GSRB 1K85A 1AI1L 1D3CA 1PX3A 1OTUC 3VFRA 4GQ9L 3DHJA 5KVMC 2CDEB 4DN3H 1XGPB 3FB8A 5F3BB 1C1EH 1TCRB 4NO2B 3D0VB 3PHQB 1B2WL 2A6IA 3VXUE 3AVEA 3B2UD 1DQTA 1X4XA 3KXFB 4K3EL 5ICZB 3LRGA 4LQ1A 1FFOB 2FDBP 1W0YT 3PDOB 1YNLH 5CJ5A 6FABH 4PLJC 1TZHA 4ERSH 4P4RB 1QFWM 3S37H 2EYSA 4O51B 5B39B 4LHUA 1E6OL 4N0FB 3NACH 4PR5B 3OG4B 5FYJU 2F53B 2D7QA 3QWOA 1IAIL 5AYUL 1BJMA 2Q87A 2IG2L 3VFTA 1LHZA 4NGHL 2ICES 3K81A 4LSQH 3HE7D 1OGTA 2F5AL 3GI8H 3HRZB 4HV8A 5DJ0B 3VXUA 4DN3L 5EIVA 1C5DA 1XIWB 2XN9A 2X70A 1YN6B 4DGYL 3OKLB 3U4AA 1Q0XL 1WBXA 2P5EB 4N9OB 5GS0D 4XZUB 1W72B 3I3BA 2X4NB 4M6MH 2RQ8A 3S4SB 4M7ZC 4GRWH 2QR0A 2ZUQB 5A2KH 3V0VA 3MUGB 5DEFB 3O2VH 4M1CC 2EKSA 2R1YB 4IOFC 1TVBA 1FNGB 3UMTA 1CQKA 1WZLA 1N26A 1VB9A 1MCQA 3FOMB 3QIBA 3VG9B 3ZL4H 5KTEH 1U8MB 3I6GB 2ZPKL 3JV4B 1NAMB 5IFHH 4HDIA 5J57B 2NY4D 5HGHB 2CUHA 3U4EA 5AZ2H 4R26H 4NQCD 2D9QB 3RWHB 4PJIE 5IBTL 2PW1B 5HTSA 2I27N 4CJ0A 5LGJA 2KPNA 2RCSL 3GBNL 3JTTB 3WN5B 5CD3A 1MFAH 2HWZH 4Y4FD 1ONQB 3GMQA 4DGYH 1K8DA 3BHBB 3EOAA 3KPPB 3WIIH 5JOPE 4PLOB 4WWKB 3GKWH 3OKMB 4GUPB 3DTXA 1CDJA 2ED7A 4J2XA 3QJFA 1JGUH 2WLZA 2J8UF 2JF1A 1HSAA 4QYOB 3H6JA 4WW2B 3DMMB 2F8XC 4P2RA 3KG5A 1A7QL 4LEXH 2A73B 5IFAL 5HYQB 1KELH 4Y8DC 1I8MA 3AXLA 1XIWA 2XN9B 3FO2B 5IBLC 1MPAH 4KK9C 4QHLA 3QISA 3G5VA 3O4OB 5ADPL 2R1WB 3VFTB 4PGBA 3RWJB 3WNMA 2BY1A 3ZMRA 1IFHH 4Y4HB 3ARFA 1YUHA 1YEHL 1RZ8B 1G7LB 5DJZA 2YD7A 2CXKA 1A3QA 2J7LA 3MLZL 4G6ML 3CFCH 4CRPA 1S7QA 2ZPKH 5IFHL 3OKLA 1G9NC 1RV6X 3LKOB 3OAUH 4L8BA 1NC4A 1CLZH 4HXAL 5SWZD 4PB0H 3OXSB 1A2YB 5E2WH 3VFMA 35C8H 3V7AG 3Q6GH 1JYVA 4EXKA 1UWXH 5D7LD 3UTTA 3QUXB 4J4PA 3EYFB 5E2VL 1L9MA 1M7DA 4HC1H 3WE6A 3GZKA 2B2XL 2OXHA 4LHUG 1OAUH 4LPCA 4OCNC 1G7JA 3LD8C 1MCLA 5D7KE 1A5FH 4PJEE 5SX5K 3SDYH 4FHBD 3VFWB 2DM7A 2PO6C 4KZEL 1IKFH 4NO3A 1C08A 5GS2H 2EDHA 5CFHA 4NZJA 1SY6A 5DYOB 3GSNH 1OGAA 3W5MA 1VACA 3KYOA 2AGJH 5C92A 1PJ9A 1W72L 4KRNA 2YC1B 3UBXB 3WJJC 2OL3B 2C3WA 2N56A 1ZT7B 3DYMA 5KSUA 4R9HA 3RWDA 1AGCB 3Q5YA 4OF3A 5C08B 4BQCA 1KG0A 3ARPA 1P2CA 4OQ1A 2Y72A 2BRRL 4G6FB 5E6ID 4YBLC 1WIOA 1QTYT 1GAFL 5D1XD 1U3HC 1DSFL 1L7IL 4RA0C 5ITBL 4O2CA 1NMAL 3QNXA 4U0QB 3ROLB 1LO4H 2IH1A 3ARDC 2LAGB 5I30H 4S1DD 1S7XA 3SDAD 3BUYA 4ZAKA 5EU6A 1NGZB 3LQAH 3P73B 1LDPL 1T7VA 3JTSB 1PSKL 2OR9H 5IOPB 4AQ1B 1ACYL 4L8BB 1W0VB 4EUPH 4X6CF 3OR6B 1YYML 2AV7B 1WSST 2OTUB 1JWSB 3BWUC 1AIFB 4LF3A 5DC4B 3CFEA 4ODXA 1E4WH 1CLYH 3JWOC 5JW5B 1NFIB 4PP1D 5FB8B 5DD5H 4MQ7B 5HHVL 1H3UA 3QDJD 3STLA 5I1CL 4J4PD 1YEEH 4HAFA 1Z3GH 1AGEB 2VQUA 3QHFH 1VDGA 1YEDA 1BWWA 3ZDYF 4KMLB 4WTXA 2Z35A 3V4UH 1HSAB 3EO1A 5JQ6L 3BW9B 3T0VA 4MAYB 4L5FL 1SHMA 1AQKL 3GJFH 4ZXBC 4WWKA 4E0RA 3NPZB 1CICA 5DJDB 5D1ZC 1BJ1J 3GSRA 3QNYB 3FQTA 5K9QI 3OKEB 5HI5D 1F90H 1IQWH 5CJXC 2Q1EA 4NBXB 3S3SA 5HYQA 2JCCA 5CIPH 1JTTA 5TFSH 4KTYA 4NO2A 1KNOB 1IAKB 5IW3A 3QPQC 1FYTE 4RNRB 1YMHA 5GGQH 1EEYB 5ECJE 1JGEB 1P7QD 4JFPA 4OLYL 2KUTA 2OBGA 1WFUA 2ESVE 4P23B 4OZHA 1T2XA 3MCKA 1HHHB 1PBYA 4TTDD 3CVHB 4MNQD 2FH8A 1MIEL 3BZEB 3UAJD 1JV5B 3G6JE 5F9WC 4PGEB 1B2WH 4F7CA 2BZDA 3QDGE 3CH1A 2BMKB 3DUUA 2RBLA 3I02A 3BRDA 1MFNA 3CDGB 4JAMB 3SE4A 4NIKB 1CD1A 3VXSB 3QT2A 4GQPH 5J9PA 2VABA 4OUOA 2NX5A 1OY3B 3S37L 1MHHA 4KV5E 1QSVA 3RWEA 5T1KD 3BH9B 3FQWB 4WFHE 1UM5L 1YMMA 1TQCC 2D7TH 5EO1A 3LKPA 4C55A 4NQEE 1AD0A 3GK8H 1ZT1A 1OWWA 3IDNA 4OT1L 2QQNH 4WHCA 3SDCB 2HN7B 4GLRI 4O2FA 1UACL 3OSKA 1JWMB 3CK0H 1VERA 2N7BA 4HJJH 1ZGLM 5KSAC 3WLWD 2AVGA 3L1OH 1Y18B 1CZ8H 1FFPB 3AY4A 1QKZH 2HTKC 2J8OA 3ABZA 4WHTB 1Q38A 2VB5A 1A47A 2EDRA 4MAYA 4HIIA 4YDVB 5KOMC 3HUJF 43CAB 1BFTA 2Q86B 5FK9A 3TF7C 1CDIA 2R4RL 4ODTH 3MXWH 5A2IH 5CZVL 1WEJL 1JUFB 3NFPA 4WWKD 4RFEA 4OI8A 2X9YA 3MBED 4LAJH 4Y1AD 1FG2B 4XCNA 1NCCL 1LGVA 4OF6A 1T1XB 2EH7H 2NMSA 2PCPA 1T89C 1TETH 1MCEA 4HJJL 4JDVB 3PDDA 1XGYL 5C9JB 12E8H 3LN5A 4G9DB 3VWJC 5DVKA 3IJSA 3OJVC 3DXAD 5CEYA 1CG9A 4KZDL 3GMRB 4CVZB 1ACZA 4M7JL 2Q76A 4BA8A 2E9WA 2JIXB 1EUUA 3N1QC 1IGCH 1YEGH 2NY3D 2XZQH 2VZVA 3R06B 1X5IA 1K6QL 1QLFA 3MMEB 1BIIB 4AY0A 4FQLH 4KJPD 1G7MB 3OJMB 2NY5H 2W07A 3X14B 3MFGB 3OF6D 1GGIH 1TZGL 5GZND 2V5TA 1Q94A 1JWMA 3HN3A 4BFIB 4PV9B 4CMHB 5D93B 4UDTA 1SM3H 3C09C 3MUZ1 3OX8A 2P8PA 4XMKH 2ERJB 3PWUB 1KPRB 4XNXH 3WIFA 4XNZC 5F21B 4J7RA 2E27H 4QF1A 3MV9E 5B22A 3UYRH 3EGSB 1HQRB 1S9XB 3BQUD 5HHMD 3WFCL 3VGAC 2PYEE 1M7IB 3QQ4A 2DWDB 4ZO6A 4MHHG 5E8EA 5FYKH 1QFWI 4CADB 3FO0L 1FZMA 5GRVK 1FAIL 3BN9C 1N0XH 1RHHA 1DQLL 1U0QA 3CC5B 3KPOB 4PJBB 4JN1H 4KMTH 1G9NL 3WFBH 1T7WA 5B8CA 1J8KA 1QRKA 5EC1A 3BH8A 2D0FA 4HFUH 4Z7WE 4L9DA 2YC1A 4BQ8A 2Z4QA 4MAYD 4LMQI 3S3PA 5KOVC 5HBBA 5MEQA 5L2JA 4JFPB 1Q9OA 1EZVX 3Q6FB 2P8LB 4M8VA 3UEZA 4U3HA 3GMRA 3T0XA 3HFML 3U4BH 4CVZA 3MC0A 1QOKA 2GUOA 3ARYA 1KULA 1RUAL 4OGAC 3GUTA 2ZUUA 5E9DE 4HUXB 4KKBC 2VDLL 4MA7L 3FONB 3UTQB 1LWRA 1N7ML 2ZOLB 5E0QA 4KQ4L 1WVZA 4N5UA 3MZTA 4YDKH 5F9JB 5DJCB 4OI9A 4ZD3L 1FC1A 5MI0C 5E7FA 3MRFB 4HXBL 5GSRA 5J1TC 4HWZA 4ONGH 1TTFA 3ZTNH 1AGDB 4NN5C 5JHLL 3P9LB 1CVRA 1YZZA 2XWJB 5EFIA 3QR2A 2JELH 2YA1A 3I2CL 3LIZL 3VXPB 2OP4L 3D9AL 2DQJH 2HVKB 2R2HB 1JI2A 1FORL 2OYPA 1RZJL 3CFEB 4I8DA 4WHYH 5LXGH 3OHXB 2IQ9L 1T66C 4RFNC 1GGUA 4P46A 3WS6C 3LOWA 3TBTA 3E6FB 1RD6A 4U1GB 3T0EA 4XXDB 4QRSA 4KMQA 5EORH 1CLYL 4X6EB 2XOTA 3JV6A 4M6OH 1T89A 1I1FB 4ODTL 2ADIA 4NFDA 1HWGB 4X6BB 3MO1A 2ZUVA 4U1IB 1BJ1H 5MEQB 4TSCH 2PO6B 1OT1A 2W0LA 3AU1B 3HMXA 3DETC 5T33H 4P4KD 3S97C 5D4QA 3DBXA 3ES6A 5LAXA 4ZTPH 2BCKA 4NM8H 5DD5L 4LSPL 3ULVH 1TNMA 1UH3A 2GUOB 4P2OA 5ACZB 1CGWA 1GGBL 4NSKA 3VGFA 3ARBA 3IVKA 2QADD 1ZOXA 1G7HB 3MXVL 2W9LA 3EJZD 4QRRD 3GSUB 3VXOB 3LIZH 1LD9A 2VXQL 1V3MA 2CRYA 1KTLA 4MJIE 3DWTA 1MNUH 1SJXA 5MENB 1O7SA 4F2MB 2CRIA 3D48R 5HI4D 5HY9B 1F4HA 2HRPH 3NTCH 1P7HL 4WEMB 4H1LA 4JO2H 5I1DA 2XTJD 2JJUA 1RZGB 1KPVA 4HEME 4DFIA 5D7SH 2FCBA 3C9NB 4ZDHA 4U6YB 1VGEL 2L4OA 3STBA 3I9GL 2YD6A 3FFDA 4E41E 2DKMA 4UIKH 1D5ZB 4XMPL 3ZKSD 4PG9A 4C4KO 2AXFA 1NCBL 3B2VH 4MZ2A 5JMRA 4CDGC 2NXYC 1ZWIB 2XN9D 3SDYL 1K5NA 4IOIB 3NZ8B 3Q1SH 4HKBB 1PKQE 4F7PA 5I17A 2J8UE 1Q72H 4LAQL 3GHEH 4K71C 4GH7B 4KTDH 5ITFB 1FAIH 4DWHA 4PLKC 1OQOA 3O6FB 5E95B 4GMTL 1A14H 3PP3H 4K3DL 3WFDL 4X6CA 1ORSA 2YN3A 2WK2A 1QP1A 3QIWC 3G6AB 4Y1AB 5D1XA 4JFOB 3NCBB 4XPFL 3BWAA 4Z7WA 1F4WL 1R5WB 1ZSDA 1MFDH 5TH2B 5IBTH 4Q2ZA 5BW7C 1OSZB 1S5HB 3EUUA 2FL5A 2YN5A 4V2CB 2PYEA 2BNQB 4JPKH 4YDVA 4YHMH 2BSSA 3GSQA 4H20H 4IMLB 4I4WA 5I76B 1MCDA 2GKIA 3SGKC 5KVFH 3ZDXF 4GMSH 4KKCD 3FQNA 4NBYB 1PZUB 3MRNA 1HOCA 1AR1D 2ADJA 4S1RH 4NQDD 1JP5A 1KJ3H 4TULH 2HKHL 1FFQA 5DSCB 5C0NC 2W9EH 3DYOA 5DJYA 4Q0XH 2AP2A 4OCWL 4IJ3B 3FCTB 4K3EH 1QFPA 4IDLA 1A6UH 4HULB 1KJ2B 5EU7E 3S36H 5I1DB 4PGDA 2FYYB 2CSPA 2OJEB 2XKUA 3DUSB 3Q6FA 2NY1D 4HFWA 4YHOL 5D2NA 2EH7L 1EJOH 4MCYA 3O4LA 4JM2F 1TPXC 1D6VH 4YR6A 2HFTA 4N5ED 4CU7A 5JHDB 4XTRC 3UPRB 1RK1A 4H0GA 3G9VA 1BBJB 2HG5A 1T04A 2A38A 1M71A 3FB5B 4OBRA 3UZVB 4I18A 4WV1C 4FQXB 4HIJB 5DVOA 1I9IH 4JFXA 2EXYC 2E8ZA 2V2WB 3PWVB 4U1IA 2X4NA 1P7QB 4LPTA 4LVOC 1YNKH 4G6KH 4NKMA 1J8HD 4M7JH 4LP4A 1MHPH 1ZA3A 2B5IB 4N8PA 4PRPB 5J13C 4N68A 1KPRA 4OFYD 5EOQH 2HKFL 2W60B 3UC0L 1AGDA 1FZJA 1JFQL 5EZOH 5IW1B 3GSVB 3J7HA 5D2LB 4LSTH 3BWAB 3STZB 2V2XB 4X9FA 1PLGL 1NSNL 1AE6L 1S7QB 3OZ9L 4GAGH 5C3LD 2A6KA 2R0WL 3RHWK 4OTXH 3B83A 1FLRL 3HC3H 4YX2H 3BD4A 4JGMA 4KMTL 1BIIA 1TZHB 2ENSA 5HXMA 5MENA 2BC4B 2NZIA 4UBDD 2PXYA 4G6JH 3WFCH 2FH6A 2AQ1A 3P11H 3C60A 3QDJB 4XMLL 3ULUF 5DHXB 2CDGB 3QNZA 1G7PB 1UFUA 2E9JA 3CAFA 3MYZA 3TWCH 1YMME 4NQDE 3PWNA 3ARGA 3FT4A 2DQDH 1D5ZA 5LAXB 4MQTB 5HPOA 4BELD 1HXMB 2WUCH 4OCYL 1QFUL 3DX9A 1XF4A 3PDOA 1QD0A 5GJTL 5DRNB 2BNRB 3GSNA 3IDYB 3CDFA 2XZCH 3W2DL 1N7MH 5TDPB 4JO4H 5FUCC 4KI5D 1M7IA 3QQ4B 5F7KC 2AV1B 5EUKB 2EDFA 5CP3A 5IB3A 5E9DB 1OM3L 4BZ1L 2YBRB 4ZAKD 5F6HI 2X4SB 5FA4A 3IDMA 1H3GA 2W9DL 3LY6A 2X4TB 5DEGA 4NKDA 5JUEH 2DQCH 2Z4QB 2C3HA 3OKOA 4JANB 4UT6H 1F97A 1SEQH 3FQUB 3P0VL 2R2HA 3PABB 4MB5A 3SBWA 4MDIB 4XPAL 4LCCA 1EEUA 4UT9H 4KTDL 5L88L 2OK0L 5C08D 2XXMB 4J8RA 1QG3A 1NPUA 2HJKA 4YHIB 4XC1H 4ZNEA 1TPXB 3KPNA 5FHBH 4Y16B 2DQUL 4LLMA 1GZQB 4X4XB 2J3SA 1RMFH 1XGRB 2DM3A 3LS5H 3TZVA 4OFKA 4QRPE 5JQ6H 2BVEA 1TZGH 1A22B 4JFFA 3KDMA 4NO3B 4WTZA 1JPST 4TQEH 3MRLA 1D9KB 2DQTH 4I3SH 1PG7H 2ZUXA 1WTLA 3TA3C 4EVNB 4RFOH 1HE7A 5JHDD 5DR5L 5JR1L 1C12A 4EDWH 3SJVE 5CJQL 4JLRB 3GRWA 5FEBA 4RX4A 3QB7C 1W8NA 2YZ8A 1MIML 4Y16C 4PRDA 2IAND 3BEVA 3DV6B 1B6UA 3ARGC 3OKKB 3GJFA 1U36A 4RAHA 4EJ1C 1YEFL 2HP4A 2IH3A 2VZUA 1P84K 2LVEA 3ARGD 2IANE 3LEVL 1NC4B 3NIGE 3HUJE 4QO1A 4YWGL 3W9DB 1P84J 1WAAE 4XNUH 2O5YH 1I8IA 2J8HA 2ED9A 3GEWB 1MQKL 2FB4H 1RZKL 4IDJH 3MRMB 2EKJA 2KQMA 4F9LA 3SDXB 1MCIA 2YUZA 3TIDB 3U2SA 2A74B 3RIFK 4JGUA 3PWPA 1FVDB 5D96B 4P46D 2Z31A 3WDHA 2DS4A 4JZOA 3EBAA 2P7TB 5L2KB 4XP1L 5BS0D 5T1KA 4R97C 4ETQB 1RZFL 3JXAA 1JPGB 5CSGA 3HZMB 3MCG1 2ZSVA 3V4VL 3FT2A 1MHHB 3ARFB 1BOGB 1CT8A 2QSTA 1FH5H 2F8VA 1U41A 2FD6H 3AM8C 1CZ8L 1SYVB 5C08E 3MLSH 3D3VE 3T4YA 2DYPD 3SDCA 1XGQB 3KPSB 4U0RB 5GISH 1JZ6A 2H1PH 1K3ZA 2X9XA 5I30L 3SGJA 5J12B 1YMMB 3MQIA 3KNBB 4NKMB 1BD2E 3EJJX 1KLGB 3Q2CA 4PYHA 3QO1A 3MLUH 1S7UB 2EYTB 1ZHBB 1IE5A 3K8LA 4QCIB 4KKAC 5EUKA 4R97B 2F8OA 1I3GH 4DK3A 5E8OB 5IQ7H 3IXAA 4AH2B 1AGFA 5GXBB 2H8PB 2JCCB 3RPIA 1ZEAH 1ZLVK 3V4PH 3RDTA 1H15B 3WCYA 4OJFL 1JGEA 3RWDB 3ARFD 1L6XA 4OZHB 2R2CA 3ILQC 2L0DA 3HUJB 3V79C 5E1AB 4K3HA 4GS7B 1WBYB 4PGDB 2X4QA 4UB0H 3IFPA 1J12A 2BFVH 5CP7A 5HYSB 5EOTB 1RPQA 4U1NB 3PL6B 2HLFD 2BVYA 5ANMB 1CG9B 4PLNC 5EC2B 4FQQB 1J1XH 2PCPB 5C0CD 1BMGA 1TQBB 4J3SA 1I4FA 3WL9A 3HI1A 4ZS7L 3OF6A 5DQ9B 3SJVB 2GY5A 2FBJL 1FGNH 3R06A 5I75B 4E41B 1GCFA 1LP9F 3VFPB 1T4KB 4QTIH 1XGRA 2R8SH 3D39A 2J88L 1MF2H 2AJ3B 5F93C 4LU5H 4DZ8A 4TUJB 5C0BD 1YNKL 1KIQB 4G6KL 5EBLA 4OGYL 2DRUA 2ITDA 1U2CA 5CBAA 3TBSB 2NNAA 3IDIB 4C4KT 1E4XL 4I18C 4XVUD 2AK1L 3WIIL 1OCWL 5DR5H 4FFVD 5DUPH 4PJ7E 5B4MC 1KXTB 1KJMA 5D9SA 5IEKB 3MCKB 4XC3L 1T03L 4L4TE 4QLRA 5HGAA 2A6KB 3MRJB 5IQ9B 2OJZH 3VE0A 3MUJA 2C7UB 1I8LA 4DN4L 2H6PB 1IGJA 1QSFD 4KDWA 4JKLA 2WINA 5C0RL 5C07A 3EOTL 3O9WD 1KSRA 4LIQE 5IWLA 4HBCH 4XRCA 3GRWL 5I6XB 4WU7B 5JTWA 3EDFA 3ME0A 2ZSWA 3GK8L 4U6VH 5JLZA 5GGSY 1NGWA 3VRIB 4LLVB 1K3IA 3S36X 2NZ9D 5D8JH 2MHAA 3EYUL 3VFNA 3HG1E 4QTIL 2R8SL 1TDQA 1PG7W 3D6GA 4I18B 3H42H 3WN5A 4NN6C 4P5TB 5EO0B 5EZLA 3TIEB 2G2RB 1XF4B 3HC4L 4P23A 2QV2A 4YBQC 1OGAD 3ISWA 1BD2B 1A21A 4N8CL 1YMHB 1JZ3A 1AR1C 1MCHA 4PRNA 2AV1A 1MPAL 3SJVD 3BP5A 5GRJL 1NBYB 4KKCC 5K33A 2LU7A 3L6FA 3QUZB 32C2A 3TWCL 4QOKE 3HNSL 4Z9KB 5C0CA 1MEXH 1HYRC 3QRFM 4F8TA 4KJPC 3K2MC 1MRFL 4W81A 3MJ8B 1VFOA 5C0GB 5IEHA 4X98B 3L7EA 4NQED 5GRZA 1MCOH 2AXHA 4Z76A 4GW1A 3QI9B 3MV7B 1IVLA 1IGML 4JM2A 4OQTL 4KWUA 2WWMC 3CPLA 2W9DH 4XCFH 2Q3AA 3MRCA 1JMZA 5MENE 2XWJA 3MRQB 4M61A 5HSFA 2IAMD 4X4XA 1QPXA 1UJ3B 4UTAH 3IKCA 4ZOAA 4NDMA 2OS7A 4YGAB 4B0MM 1IGIL 3QXAA 3V4VH 1AKJB 3RY5A 4QRUB 4PJHA 3HLAA 1HKLL 3KWWB 4PRIA 3QJHA 5CS7A 5I1AA 4OZIA 5KVDL 4PJ5B 5JXAL 4PR5A 3KPQA 3U7WL 2BOBB 4N8CH 3OKMA 4ZO7A 3KHOA 4POZC 3QEQE 1BBDL 4GKOA 1S9YA 2YOCA 3AROA 3FAWA 2QSCL 4GRMB 4QXUL 1JZ7A 3WXWL 4FQQA 3NTCL 1MWAL 4LSRL 1YPZB 3U9UB 4EDXB 3CZFA 4JFDA 5IB3B 5ESAA 1OGAB 1J88A 1NAKH 3MV8D 4KI5E 1G84A 43CAA 4OFYA 1BVKA 3AXLB 3HR5B 1FL3A 2H3NB 3VXRA 1H3PL 4OZFA 2X4UA 2GSGB 2HFFB 3LPWA 5ENWA 2ZOLA 2ZUQC 1NFDE 2F54E 3PQYE 1YY9D 2RCSH 1ES0B 3WFBL 1X5YA 2Q8BH 1J0JA 3QCTL 1DSFH 2UYLA 5C8JB 2XG4A 1RZKC 2EIZB 4Q97A 1T20A 3M1BA 3NA4A 2IBBA 3V0WL 1ZHKB 4AM0A 5KS9E 2D0HA 3PL6D 3QDJE 1IILE 3VGGA 4OZIF 3G08A 2AJXL 5I2IA 2WWKO 3RBGA 4HDIB 3TO2A 4IM8A 5EOCH 3VXTB 4PJ9B 3UTZA 5A40E 3LEXA 1LEGB 5HDLA 4XRCB 4PLKD 4UDUB 3H9HA 1NANH 3TC9A 3N85L 2UZIH 4AEIH 5E03A 1A14L 4JFFE 2OL3H 1HHKA 1ETZA 3OJDB 4M5ZH 3U36B 4GAJL 2X1XR 1JGLL 4PJ8C 1PX4A 5KW9L 4NO0A 1UB5B 3IKCB 1KB9K 1MF2L 2P46B 5FGBC 3FQRB 4WW1B 3RGVA 1P5VA 1JNHB 35C8L 3DHMA 4X6CB 5JLZB 4EOWL 1N2RB 4NQSA 2V7NB 1C16B 3QI9C 4CVXB 1XF3B 1KLFA 1IT9L 2BSTB 4QHUB 3HC0A 5DK3A 3JSSA 1WBZB 2RFXB 3TO4D 1I75A 5KVGL 5I66A 3IFLH 3LN4B 5C1MB 3RP1A 4NCC1 4PJBE 3MLVH 2WSKA 3SDCC 1OM3H 1GJIA 3UZQA 5H35B 2QKIA 3O0RH 4JO3L 4Z7WB 5A2FA 2MPAH 4JDTL 4LVNB 5J3HC 2O61B 5I1GL 3S35X 3CVIH 1T5WB 5I18H 5HD8C 4WU7A 3WJLA 2D7NA 4H8WH 4U4BA 1NJ9A 1Y6MR 2J12B 1X3DA 3SKNB 2VZ3A 4V1DA 1KT2A 4K9EL 5IVNA 3BO8B 1AY1L 3QDHA 2UYLB 5D7KD 5BV7B 4MJIB 5BS0A 3NABH 4LSPH 3NBNA 2Q8AL 1JNJA 3E0GA 5SWSB 4NHUB 3WL9B 4IMKC 4XZUA 4YBQD 3NFSH 4L4VB 5F1KC 3W82A 3MXVH 3DRQB 1DZBA 2L7UA 3DXAA 1Y0LA 1FO0A 5K9QG 1F45A 3AGVA 2MTPA 5KG9A 2Y7QA 2HTLD 5LGKA 2BSED 5DLML 3WUZA 1NLDH 3H9SB 5BRZA 1R0AH 5INDB 3SGEH 2F53A 2CIKB 1P7KA 4HK3N 1G7HA 2Y06L 5AZEL 3JTTA 1OAQL 3GI9H 4JHBA 4N0FA 3WNOA 3WV0A 4BK4A 5B38G 3TJEH 5ADPH 1Q9LA 2X4OB 3V7MA 1NAMH 1MUJB 1UWGL 5E8DL 4WEUD 3L3KB 1U8JA 3QXDB 2WV3A 4YIQB 3DJ9A 5GRWA 4NKOA 2W0KA 5MI0B 1A9EB 1NFDB 2F54B 3DBXB 4XPBH 2CUIA 1W72A 4KI5C 5HHOA 4OGYH 1NL0H 3PE9A 5DYOA 1J0KA 1SY6L 3KLHC 1XGUA 3P30L 5J12C 4L4JA 1KC5H 1JZ2A 4J3VA 1I4FB 1IQWL 5FUZH 1EGJA 4NYLA 4DN4H 1NCCH 1H9VA 4LKCA 1UH4A 1IGFH 1T2QL 5JIHA 3PQYA 3T3PF 4AT6B 3O45A 3EDDA 5ADOL 1GPOH 1UCBH 2NXZB 3SPVB 3QWRD 4WTZG 2FR4A 4R7NA 3FO1A 1UGNA 3AFLA 5GRUL 3RVWD 5ISZD 1D6EB 3GMLB 2X09A 4FQXD 4PJXF 4PPTA 3TBSA 3MA9L 2FWOB 4XWOC 1QR1B 1ZTXL 3CSPA 3F7VA 3I6LE 5C0BA 3VMOA 4L3CA 1A7RL 1SEBB 1FZKA 1I8KB 4LNVA 3UJJH 2L7JA 1CXLA 3HZVA 1AFVH 4NNXA 1J0YA 3MJ7A 2XICA 3HZYB 2MMXA 2VXVH 4OFPA 5DJDA 3PHOB 2A83B 1VKXA 2UV3A 4GBXC 4XGZA 3U1SL 3MLSL 2XWTB 4FQPA 3WS3A 5AWNL 1FG9C 4ORGA 2B0SL 4ORZC 1ZVHA 4XNXL 3GSVA 4XCFL 3WLWC 4L9LC 4QOKB 2Q86A 4I3GA 2ZJSL 3TA3A 4MQ7A 3MLTA 4ZQKA 1BZ9B 2GCYB 1BREA 3VXMA 3T2QA 3QFJB 4PREB 4Q7DA 4GRMA 5CZKA 5EO9A 1IEAB 3RL1B 4KK5C 3NCJH 3VFSB 1F3DH 5I15L 4QHNB 3R8BB 3NCMA 5JHDA 3D18B 3M8OL 3FJTA 2VLKE 2DKUA 1NEZG 1TJHH 1H5BA 1UJTA 1A7RH 2X4PA 1A7QH 5DFWH 3GMPA 2X7LB 2E7CA 5CEZE 2VLJD 5E2JA 2IANA 3MMEA 4Q74A 3IFOA 5CEXA 4NC0B 1J8HB 2B7DT 1E4XI 1IAKA 3UTSA 1CL7H 1YEIL 2N4IA 1KN4L 1B9ZA 3L3IA 3A0OA 4ZXBB 5AG8A 2FR4B 1KPUB 2VQ1B 2VLLA 4LCWE 4YAQA 3DRQA 3WIHL 1UKTA 4ODUA 5DSCA 5J11C 4JZJB 3I50L 3LRSB 3QUMH 4OM0L 2VDNL 4P2OD 3U6RA 1YYLH 1KTKE 4LMQE 1HHHA 3GRWH 3DV4B 3GSOA 1GZPA 1I7TA 3ILQD 3QUYA 3MNVA 3UDWA 1YEEL 1XR9B 4V2BA 4JZNA 1FHGA 2OJZL 4Y4KB 1EGJH 5I1HH 4H88L 3RX8A 2NX5B 2Y06H 5AZEH 4UINL 3BJLA 3MREA 2WBJA 3IAQA 4OD1H 4PB0L 5I8KL 1OAYH 1LP9E 2O5ZH 4DKEH 1FZMB 1NBQA 1N5YL 2XKSA 1I7ZB 3HMXL 4YXKL 4FABL 4Z77A 5M95B 3SGJC 2DQUH 3VWJB 2E9IA 4K2UH 1T1XA 5HYJA 2WUBH 1RMFL 5ETUA 4KK8D 4Y0GA 1BM3H 4XXCA 4YGVB 1OAQH 4DOHE 1G7PA 5TE4L 1Q0XH 1MHEB 4I3RH 3U82B 5C6TL 1N59A 1MLBB 4JJ5B 4X99B 1Y0LB 1R5VB 3QCVL 4HC1A 4MA1B 3TA3D 1PY9A 5KG9B 1MRFH 4WI8A 1NUGA 1Z9OA 4DVRL 1NGZA 3P73A 4ENED 1OTUD 3NOIA 1N64H 5FYKU 4NUJB 4JFDE 3SDAC 3WIHA 1FIEA 3OL2A 5L88H 3X14A 4K07A 3LKSA 1CGUA 4GKNA 1FGVH 4Y4FB 3TVMC 4JM2D 2NPLX 1ZS8B 3QXDA 2JJSC 1T3FB 5IVOA 1KYOJ 3RU8H 3H9SD 2CR6A 4YPGB 1RULH 1J86A 5HI4C 4FP8L 5HYFA 4WO4A 3VGDA 1HHGB 1P9MA 2QHRH 3TYFB 1QHPA 3G6DL 3GB7B 1L6ZA 3HNTL 3K46A 5HY9A 5L7XL 3IJSB 4RGND 5D1ZD 4M02A 4EI5A 5EG6C 4ELMA 2DICA 3MGAA 4PTTB 3I3DA 4OUUA 4WI4A 2C3VA 3B43A 2XY2A 1FNFA 3C6LC 2I9TB 2R0WH 5MHSD 4GAYA 3RTQD 4NQDA 3UPRA 5B3JF 3QP3A 1PFCA 2Y6SC 3NGBC 4OZGB 4WU5B 3QAZC 3B5GA 4MA8L 5AUMA 2W60A 1PGRB 2DQFA 3B9KC 3NN8A 4KJWD 4Y19E 4CVXA 1CDGA 3SDDD 3N1MC 1S7TA 1X5JA 5MEOB 2AEWA 2OZ4L 3VG0H 2MNUA 2R39A 4K9EC 1RVFL 1FNSL 3QA3B 1MFCH 5H35A 1BQHB 2V6HA 1U8JB 3TN0A 2WLYA 4JG0L 4UMGA 5EUOE 1EV2E 1R3HA 3ARDA 3V5DB 4DGVL 4X80H 3DX6B 3UTSB 2WIIA 4AMKL 2V7HA 1CICB 2CLZA 4OLYH 1XGTA 2VDKL 1CXIA 5J1AA 3G6JB 4UTBH 5IIEB 3DARA 1QFWH 4HGKC 4RGNB 1BZ7A 4QRQA 4FNLL 3MRIB 4HLZG 4G8FB 3C60B 3QDJA 4X9GA 4FQLL 2VAAA 1OSPH 1F90L 2GITB 4JHAL 2GW5A 2BNRA 3GSNB 3VGAB 1R6VA 3HA0A 3QNXB 1KJ3L 5DQDL 3W9EB 1Q0YH 2JJSA 3V6OA 5E2UH 5F7EH 3A6CH 1QA9A 2VIRB 1QYGL 2XTLA 1F11A 1DANU 1UWXK 3Q0HA 3WHE0 2Y5TA 4MYWB 5BRZB 5KAQF 5D5ME 3NFNA 5IOPA 1QFHA 3SE4C 3FHQA 5DJ6A 3HZMA 5DGRA 1MJJB 2Q7YB 2R23B 3NIFE 5GZOD 4HKBA 3D2UA 3QDMB 1A1OB 1RUAH 1OF2B 1YC8A 1MCPH 2FHBA 3UROR 4R2GB 1TFHA 3VCLA 5DC0A 3THML 4HZLA 4ZYKB 5BV7C 2VE6A 4KKLD 2AXGB 1FCCA 1V3JA 4XCEA 3FB5A 3B9KA 5IT2H 4MD0B 3LMJL 4YFLI 1XAUA 2EIBA 1JF1A 1IM9A 5IB2B 4MNGB 3ZE0F 1KGCE 5JZ7D 5EU7C 1IJ9A 1C7SA 4OGXH 3HMXH 5L2KE 1P4IL 1WQVT 3LSOA 1PKOA 1WEJH 4GT7A 1DEEA 2PTTB 5E99H 2P4AB 3H3PL 3M17A 1XMWA 4XWOD 1SVZA 5C6WH 3IFNH 3MRBA 1IAIH 4FFZL 2DWEB 5IEHB 5DURB 5C07B 1U3ZA 2ID5A 2VN4A 4BFIA 4Z76B 5SWQB 4JFHD 1SQ2N 1ZVYA 5I15H 3ROOB 4DCQA 3S88H 4U6XB 2EDXA 3S6CA 2R29L 3HI6L 3BUTA 5ALBL 3C6LA 4WGVB 4G43A 4H1LH 5TDNB 2FECL 3KS0H 1A1MB 1H8NA 1QHOA 4Y5XB 5FGRA 4ZNCD 2NY5L 3WO3B 1MWAB 2GJ6E 4OLWH 1FL6B 3QG7L 3BGFC 1UVQB 1RZ7L 5EZLB 4G8EA 1HEZA 4JFDB 4JFFD 3TEUA 3QPXL 3HC4H 2I24N 3OKDB 5FA3B 3DX7B 5FXCH 5L8KB 1AJ7H 3EO0B 3QQ3A 4JB9L 4R8WH 5DTFA 15C8L 5KANI 4HKZB 4GO6B 4PJBF 3EOTH 2HVKA 5ENWB 2FX7L 5IHLB 2NTFA 4DGIL 1OAZH 5DD6A 1O0VA 3ILPA 4IOFD 5EU5B 3MLTB 2DYPB 2YPLD 1EVTC 3ARWA 2FL5B 2VLMD 5HYSA 4YBHA 5DQJB 1BOYA 5TF0A 5EZIL 2AKRB 2DQHL 3QJFB 4NQTA 4HBQA 3KPLA 2LTQC 4LCUA 2A77H 3CDCA 2XZZA 4XVSH 3D1MC 1IGJB 4R26L 3ES6B 5T5NF 3CPLB 3VRLE 4ZG1A 4LLDB 4O00A 5ICXB 4JFEE 3TFKD 3MRNB 4AG4L 5E8DH 5KAQG 1X5GA 2BSRB 3VD5A 2GJZB 1KC5L 3AU1A 3BMVA 2ZSWB 2FATH 4NSKB 1MIMH 3EJZC 1AXIB 2JLLA 3ALPA 5FM4A 1A4JB 2VLRE 5DEFA 1AKJA 2PW2A 4AIZB 3RGHA 1BIHA 3U4EB 4TUJA 4D0CA 2O5ZL 2XPGB 5E4IA 4H26A 4OQTA 1MLBA 4X99A 1ZLSL 1EO7A 3L5XL 4LSVH 4BKLB 2B1HL 1NCDL 2JJVA 1UEYA 2VLJA 1KJMB 5D9SB 1X7QA 1IGFL 1RZ8A 2NR6D 2J88H 3P4NB 1WC7A 3IXTA 4Q9CA 3FFDB 3O4LE 3B8SA 3BRGC 3UJTL 3GSOB 4PJXA 4XXDA 3VRLF 5HHXH 3DECA 3DX6A 4AQOA 1T1WB 1SMAA 4RWYL 3FN0L 3AS2A 2NXYD 2XN9E 3SDCD 1ACYH 2BSTA 4QHUA 1BVLA 2E6PA 5JORB 2FGWL 3QUMB 2CRZA 4HJ0C 2VDLH 2NXZC 4MA7H 4Z7NF 1X5XA 4X6BA 3VFRB 3HRZA 3DRTB 1N3NA 3NCJL 4TVPL 1RJZB 4E41D 5ESQB 1F58L 2OCFD 3CU1A 4K8RD 3M1BB 1IAOB 4OD3H 1LP9B 4ZXBD 1FIGL 5BV7L 1U8OA 3MRMA 4LHUD 3O3DB 2E7BA 3QIBC 4M4RA 4DKDC 4P4RA 3PNWB 4FZ8H 5HGHA 2BHUA 5EOCJ 1F8TH 3E1F1 1BD2A 1U8MA 2NR6C 3I6GA 3F12A 4TVSa 5ICZA 2DQEH 2VUYA 5ID1A 1FSKC 2ITDB 1BVKB 1OW0A 2ESVB 4F37K 5DHVA 2EDWA 1KV3A 2YZ1A 25C8L 1P4LA 3QULA 4OZHF 3S3JA 3A6BH 3QQNA 4Q9BA 4P4KC 1K2DA 3VXQA 1IAIM 4TTGA 2D0GA 1CFTA 1JPTL 1N8ZB 2B4CC 3RAJH 4MAYC 2MOVA 2J8UA 4LARL 3OWEA 2XACC 4P48A 1A9BB 1YY9C 5BQ7A 1EPFA 3GSWA 2C4FT 3NA9H 1UYWH 1FNEB 2E27L 3H2WA 5EOCL 3RKPA 1BHGA 2ARJA 5IB1A 1T66D 3LV3A 2WW8A 1RQ5A 1JIBA 2CJUH 5C0AD 3P0YL 1KN4H 1YEIH 1KCLA 2DTMH 3EYSL 4TUOB 4M43L 4NWTH 1UWEL 1NDMA 3KJ4B 2D9CA 4IEFB 5JIKA 5EIIB 3HE7B 2Z92A 1V7MH 2HT2D 4R96A 2W65A 4LHUB 4RRPG 5FFLA 1DQDH 1J9CT 2IPTL 4HQQH 1QSFA 5DD0L 3X3GL 3L6FB 1JZ8A 4ZUTA 4OD2B 3RI5K 4QRRA 1BPVA 3U0PA 1NQBA 4X0KB 5T3ZH 5TDOB 3NGBB 1P69B 2PO6D 1NEZA 3QO0B 2IAMC 3QEGL 4GAGL 1PLGH 2KQNA 3MNWB 1X4YA 3EFFA 4PV8B 3FQRA 4WW1A 3X12B 4GLRH 4L1DA 3KVQA 4PJIA 3UYOD 1JVKA 1Q0YL 2EEBA 1ND0B 2N1KA 1F6AA 2YD4A 4PY7A 2AXGA 2H2PC 2P47B 5CZVH 1WC7B 4X9HA 4MXVE 2R56L 5FV1L 5C0EA 1OW0C 2HJLA 1JYXA 1KUMA 2PTTA 1SEQL 4JY6A 1FNAA 4JKPL 3F65A 4I48B 1RZJH 2ZUYA 2BXZA 3LV3B 4OCWH 3GM0A 4NKOB 2DBJA 4HJGA 2VSCA 4PGEA 1MY5A 3G9AB 4JR9H 3FQTB 2ED8A 2IJ0C 4IHOB 1R5IA 3ARBD 3QZWG 4E0RB 1BVZA 5C0IA 3ARTA 3SDDA 4K3JH 4WY7H 4EVNA 2NY2D 2BOCB 5FHAL 3IDJA 1IBGL 4R3SA 4M6ML 5MERB 3V7AE 5CEZH 3DXAB 4H26B 4HAGA 1T0PB 3JTSA 4YC2C 4R4BA 5F1OB 4GW4B 1IGTB 1J87A 4JCMA 1M6OB 4MD4A 3B6SA 3F5WB 4JO1H 3TV3L 4O2CB 4NOFA 5SWSD 3UTSD 2R0KH 2YPVH 5F7HA 2SEBA 2CLRB 4WUUD 4BSVB 1UACH 4Y19A 1T1YB 3I84A 2FJFA 1W0VA 4MHHI 5FYLE 5BS0B 5F8RC 1Q72L 2AKRA 2CDGA 1PQZA 1F3JA 3LKPB 4RMQA 5GRJH 3UAJC 3PWPB 1CU4L 4JQIL 3IU4H 1S7SA 1GZQA 3MBEC 3CUPA 4WWKC 1A1MA 2AJZB 5IG7B 5HYEA 5J6GB 3O11B 5DJXA 4W6YB 3ULVC 3LCYA 5GSVA 1ITBB 4U6XA 1GHFL 5CJXA 4YX2L 5D2LA 4K2UL 5H94A 1JE6A 2EE6A 3KDMB 3TBYA 1E6JL 2FEEI 1UH2A 1IARB 4CN4A 4C59B 5IVXE 5T1LB 3SGEI 4W68A 1HINH 1KCSH 1INEL 2K7QA 2FSEA 4KHXH 5MP6H 2ATKA 1C16A 1KCKA 3PHSA 1MJ8L 4RDQG 1V7NL 4XCYA 4BFGA 1T0NB 1L0QA 5D7LB 1AC0A 5MEPB 3RNKB 4U1MB 1Q9KB 4NZRH 4ZUTB 4RMSA 5GS0L 4RMRA 1YY8B 1Q9LB 1J11A 3B9KD 3IRPX 4G8IA 4F57H 4PRAA 3PABA 5DD0H 5C07E 4TOYH 4JJHA 5ACMA 4KI5F 1ZLSH 3IFOB 4MCYB 5L6YL 4L5FH 4OIIH 4XBEL 2EYSB 5B39A 7FABL 4X0KA 1MH5A 4HK3J 3B2UC 5CIPA 5J11B 4HBCL 5F7YC 3VGBA 2EDDA 4NCC2 4OLUL 1OAKL 4F33A 4X6DF 3GSNL 2YHGA 3DROA 3CDGA 1MRDH 4JAMA 1T1ZA 2BNQD 4XB8A 4ZUSA 1A4JA 1C5CL 1FPTH 4KZEH 2X4RB 1S7XB 2FJFB 3MGTA 4JRYA 1KEGH 4OJFH 4OF7A 3MJGX 1ES0A 3MBXL 4KVNL 1X4ZA 1B0RA 4U05A 4Y5YC 2RGSA 1NDMB 3ZZ1A 5FYJH 3F7YB 4LQFH 4F3FB 3V6FA 3MLWH 1G7MA 4TSAL 4UAOB 1F6FB 4RQQB 4QHKI 4YH6A 5I6XC 4DW2H 3VFGH 3CX5K 4U3XA 4GSDL 3L1OL 3K8MA 3TN0C 4YEEA 3BD3A 3NCEB 1CD9B 2B8OT 3EHBC 3HI6H 4ENEC 4PJ9A 4ZODA 3TPKA 2VERN 3LHPH 4U1LB 4PRHB 2XQYG 3DGGA 2ICEA 5HGDA 4P46C 1E28B 3ZE0E 1TJGH 4L4VD 1J1OH 1YMMD 5DJ8A 1U95A 5I71B 1U8KB 1INQA 4Q6IC 1FQ9C 4OF8A 1WFTA 3QDGB 4J1UA 3PXHA 3VXNB 4M7LT 2GTWB 1ZTXH 4G8IB 3S8WA 4OV6F 4H5SA 4IRSA 3EZJB 2YPKA 1HH9B 4GXVH 2OI9B 3K0WA 1Q9KA 1TJIL 4XI5D 4HT1L 5ILTL 2X4QB 5ESQA 5ISZB 1XF5B 4B53A 5J4MA 2AJUL 4JG1L 4JLRA 3BP5B 3VG9C 5FO8B 5D7IE 2Y25A 3BN3B 5EN2B 2NY6B 5GS1B 4JREC 5FM5O 3S5LA 4MNQA 4ODVL 2CO7B 4OI7A 1F4XH 4P46B 1RZKH 4TRPL 1J1OL 1SBSL 3D18A 2CR3A 5J56B 1BLNA 5JPNB 1H8SA 3W39B 4TUKH 2VDQH 1KB9J 3WEXA 2EDKA 3OKOB 1HI6A 3KXFD 3LHPL 5F97E 1AO7D 1A7PH 1A7NH 4GMTH 1RU9H 4JKWA 2XA3A 3QO1B 4LLYB 5F1NB 3WFHB 5F1IB 1NMCB 5T1DH 2Z91A 4XHQA 3UBXI 1KIPA 5KSAB 3ARBB 3IVKB 3BXNA 4NHCH 1VADA 1OHQA 1ZLWK 4KU1A 1S3KL 3NZHH 5E2WL 3EYVB 4ESKA 2P1YA 3VI4E 3OXSA 3L3DB 3QHZH 3VFMB 5H94B 3GBML 3ZHKA 5F8QC 1OP5H 4TNWF 3RWHA 3REVA 4NHUA 2LAAA 4DVBB 2SEBB 1HH6A 3VD7A 1J1PL 4YO0A 4LVHB 3L3OA 2R0ZH 4GKNB 1BFVH 1I3RB 4XP9H 4HUWB 3WE6B 2WWKT 5IVXA 1QBMH 1HZHH 1OF2A 5D5MB 1X5ZA 4XC1L 2GTZB 4X4MA 4D9LL 2KL6A 1YN6A 1TVHA 4P3DA 3MYJB 1PQZB 4S0TD 3VXRB 3KGRA 2F74A 2VDNH 3C6SB 5DHYA 4RFOL 5L0QC 1U42A 3GHBH 3HNVH 1GC1C 2CDEA 5IM7B 1EFQA 1G6RB 4I77H 4NPYA 5J1AB 2PR4H 4Y88A 3TGXA 1N5AB 3T8XA 2D4FA 5HYJB 3BQUA 4GBXD 2JIXD 1NKRA 1ZGLA 4HIHA 4QHMA 2VAAB 5DFTA 3CXHK 3KJ4C 2FJGA 2NY6D 1KB5H 5EFIB 1AD9A 1J1XL 1JCKA 3CFJA 3LEVH 4YWGH 1MY7A 2H26B 1JN6A 4KRPC 4LLYA 5F1NA 1MCWM 1HKFA 1CFVH 3WUWA 5IJKC 3C5ZA 2EDLA 4G43B 2GIYA 4FQ2L 2EE2A 5D7JA 1TXKA 3MXWL 4DCQB 1IBGH 1C5DB 3RVWC 5C0DB 4C83B 2YPVL 3TNNB 3DYPA 1X5FA 4YHZH 4U6YA 4U1KB 3NACL 2EC8A 3T2NL 2OZ4A 1ZV5A 3L5WA 1OLZA 2NY7L 2VYRE 1INDH 4IOIA 1MAML 2VZOA 4FXGA 4HUNB 1AI1H 1FFNB 2BDNH 5F89A 4WW2A 1TQBC 2QLVB 3BX7C 4XNYL 4XNMB 4YXLH 3BKMH 5DS8A 4Y4KA 1WICA 4IRSC 1E28A 1MI5E 1SMOA 3EJYD 1RUKH 3U30B 3DGCR 1CBVH 2F5BH 3BOVA 1OCWH 3L3OB 2NTSP 1FNGA 1JNNL 4KRPB 2H32B 5JA9A 3P9MA 4HKXA 3TBYB 1I85C 3V6BR 4ACPA 1EFXD 4G8GB 1A0QL 5F3BA 5SWZB 4HWBH 4NQCE 5EBGA 2OMBA 4P5TA 2EYTA 2DWDA 5DXWA 4KROC 4MJID 4PRNB 4BYHA 1S9KC 4OLZL 1KTLB 3SEPA 1MFBL 4QKXB 4M62H 4OZHE 5AD0A 3V0WH 3F8UB 5E00A 4BSWA 2Z93B 3E6HA 1DVFA 4M6NL 1NJ9B 5GJTH 4P2YA 1OSZA 1S5HA 3D25B 3RIFF 3E6FA 3OAYK 1A02N 1KEMH 1I9IL 2APBA 5DWUH 3OHXA 3OKNB 5I19L 1T1YA 1UC6A 2WBKA 2EE3A 5SWSA 5CIPB 2AK4D 2IPTH 2F9BT 3SCMC 2C3GA 3AY4C 2VXUL 1MRCH 2R4SL 2AEIT 4GAJH 5I1HL 5K9JH 3RY6A 4NM4H 1JJUA 1T83A 1I1FA 3HE7C 3GKWL 2FX9L 4F7PB 5I17B 4M62L 4OBSA 4QRPD 4M4PA 3EYVA 4ODWA 1LQSR 2PNDA 1BQUA 2ORBL 3JWNC 1K4CB 5IQ7L 4HWEL 2BC4A 2JJWA 4BH8A 1IT9H 3NAAH 4X5WA 4YDIH 2VDPH 2VABB 1PSKH 2K3TA 5I1AB 1MFBH 2D7PA 3VXPA 2X1QA 4L8DB 2VLRB 1NKOA 4G8GA 1OPGH 1GGTA 2NY3B 4ZUVB 3MTRA 5H37H 5HYSG 5F96H 3BZFA 1E4WL 4MMZC 1RIUH 3P77B 1XF3A 1S7VB 1RJCA 2AEPL 3V9FA 1IGIH 4PRPD 1A3RL 3GDBA 3L5IA 1JNHA 1KNOA 1RFDL 4NQCA 1U8PB 2HLAB 3C8HA 4IRSB 4O4YL 1YJDC 4MD0A 1RUML 1JPSH 2CDFB 3VFUA 1YPZF 3U0TA 3O9WA 3PV7A 1IL1A 3QUZD 1DP0A 3C5JA 5DA0B 3KPMA 4DZBB 3LKNA 3PWLA 5GGUB 3QAZB 3LEYL 2A6JB 3O41B 2MCG1 3W2DH 5CGYC 5LVEA 1DDHA 1TVDA 1E27A 3JVGA 3KLSA 4ETYA 3BP7A 3VD9A 5J9PB 1IQDB 4ZOCA 4P59H 1DE4B 3KXFE 4PRHD 3E2HC 1SJEA 1RJYA 4BZ1H 1A6AA 5HHXL 4BZ2L 3GJFK 4TSBL 4XWGL 2PYED 3T2NH 1W0WA 1AD0B 5FUOL 2YEZA 3I3EA 3BQUB 4UNTA 3HE6D 2FJHB 2VC2H 3BT2H 5TJWK 2B2XH 2ICEB 4MQXD 1TENA 1YPZE 2I07B 3BKJH 1UM4L 3IDMB 1EBPA 2F5BL 1RHFA 4PJ7F 4PIRF 4F7MA 2IAMB 2YR3A 1MCKA 4RNRA 4MSWA 4HMCA 4D0CB 4JG0H 4BFBD 3O3EA 4Z8FH 4E5XB 3QUKA 4N0UE 1MCOL 4PRHE 4D8PA 3B3IB 2P24A 1SYSB 3IU3A 5IHZB 4XT1C 1HK6A 3BPOB 4HKZA 5ETUB 2VQTA 5FYJE 5FGBA 3GMMA 1UJ3C 2V9RA 1T2QH 3EOBA 1MAMH 4JRYE 4GXUM 3QFDA 3QXUA 4NHCL 3W0WA 1UZ6F 3O2WH 3BEVB 3EJYC 4IRSD 5DRXB 4PJGF 4MX7A 3GBMH 3OKKA 1T2JA 2HWZL 1VENA 3HNSH 5L6YH 3U2SB 2XNAB 5EZOL 4KVNH 2VITA 5IK3A 5FV2A 4UIKL 4XMPH 5TQ0H 3EFDH 2F19H 3LDBC 2V9QA 2F53E 1ZLUH 1I8IB 1MJUL 1F4YL 3AM8A 3SE3A 1B4JH 3E8UL 5C0EB 4F57L 1IRAY 1ND0A 3V52L 1MRDL 3PQYB 4NFCA 4I3RL 2MQ3A 5SWZA 5JNYA 5DRNA 5E5MA 5IFAH 3UJIL 4YK4B 2WQ8A 5GGVY 4FFWC 4X7TA 1HXMA 1G9MC 3DSNA 1UVQA 4TN9A 3CFBA 4KUCD 3P4NA 5AYUH 2CRMA 1BGXL 1XCTB 1XF2B 2I07A 2PR4L 5BVPL 4JDTH 3ROLA 3MNZB 4EUPA 3HG1B 3SBWC 2ZUWA 4XVJL 3J8F7 5KVDH 2HT3C 2DI8A 1R5IB 3T0BA 4GMSL 3BZEA 1VFAA 4JY5H 3SKJH 4C83A 2X4OA 4JREB 1NLDL 1E4XH 3GBLA 4JQIH 1MFEH 4UDUA 3FQUA 4WUUB 4Y8AA 3BIKB 3U83A 4UU9A 2XQBL 4R7DB 5I8OL 3EO1B 3ZKNC 4CUCA 5C2BH 2P24B 5DGQA 1UADC 3HB3D 3ULUL 4M1DL 4OV5B 3T0AA 3N06B 4GJTB 3UYPA 4KJQC 1BF8A 2G9HB 1FP5A 1EHXA 5IB1B 4LCWA 4AZ8A 1HIML 3SHSA 5D1QD 4P57A 3TPUA 1JPSL 5IMKB 3EDKA 2UZYB 1IQDA 4TUKL 3HPJA 3RPKA 5A3ID 3MFFB 4IBLT 1LO3L 1KOAA 2R69H 4ZFFA 5FA4B 2P5WA 3O6ML 4D0BA 4KK6D 4Y4HD 1P4LB 1EEYA 1GGCH 4L29B 2IF7A 1S9WA 2VLKA 5IVZA 1UG9A 4R0LC 3P77A 5DD3L 4GKSA 4XVUC 4L3CB 2YPLA 3UTPE 1A6AB 1EXUA 4EQ3A 5DMIH 1FJ1B 3E6HB 1CL7L 1HHJA 1F3DJ 4RCAA 5FUOH 3FRPA 3DUHA 3LN5B 4UB0L 4LRIC 4M5ZL 5CWSB 2OQJA 3KYMB 1D7FA 4MQSB 3C5ZD 1NBVH 4PJAA 3MJ7B 3GGWA 4MAUH 4O5LL 4ALAH 4P5MA 4LLQB 5ALBH 3V0VB 3B3IA 2EDYA 4FA8A 1WITA 1KPUA 1N3NB 1CK0L 3WXVH 3F6IA 3HZKB 3FMGL 3QH3B 4UV4H 4PJ5E 4XCYB 4P59L 3MBXH 2P8LA 1UQSB 1CL7I 3RWEB 1TZIB 3BYTA 4EIGB 4RX4D 4PG9B 3MNVB 3QEUB 4EI6B 3EOAB 1MRCL 3BHBA 3EAKA 3O3BB 2BP3A 5FCUH 4QEGA 4GUPA 5CINL 1FCGA 2C5DC 1II4E 3MRGB 2JTDA 4MNGA 3N1FC 5F9OL 3OR7B 3DURB 4I0KA 5D6CB 3JZ7A 2EICA 1QFOA 2OSLA 2A73A 3OGCA 4NNPL 5HHQB 5K9KB 1HQRA 1S9XA 3SQBA 3ULUE 4RGNC 3CUPB 2ADFH 2LU4A 2GAZA 4J3OC 3RVXC 2F19L 4K23H 4ZFZA 2H32H 5FCSH 2P5ED 1XGYH 2OR8A 4FN0A 4KROB 1I8MB 2OXGA 2YPLB 5ACZA 1DQQA 3AREC 2Q6WB 1NGXB 2J2ZA 4JM2C 2VDPL 3O9WB 3TNMB 3VJ6B 4B7IA 3FB8B 5JPMB 1D5XA 5KSVB 2BSRA 5FECB 3CJJA 2GY7B 5HDQH 4RZCB 1F11B 3K1DA 5TF1L 4N0UA 2BY3A 3BI9X 3FFCB 3I75B 5IBUG 3U7YL 5IMLB 1R24A 2VISB 2PF6A 1RUPH 4G42B 3HNTH 1M7DB 1RUKL 3R4DA 5E9DD 1JNLH 1YECH 1H3WM 3O6KL 1KPVB 3D85A 1KIUA 4WUKH 4XP5H 2CPCA 2W9EL 1A1OA 1Q9WB 3QZWA 1YDPA 3BPNC 3HKFA 4PJCF 1A6ZA 3BPCB 2O93L 3QG6B 4FQ1H 2H45A 4ZUVA 3L3HA 1OGTB 1EUTA 1XR8B 5F9JA 4S11A 1KCRL 1MH5B 4YHZL 1EBAA 3VFPA 4NRZB 2NQCA 8FABB 2CKBB 3RVXD 1FBIL 1KJVB 3ULUD 1D9KD 3LQMA 3SQOH 1PD6A 1SEBA 2XA8H 3CNKA 1NBZA 2PXYC 4BH7A 4X80L 4Z7NE 2X5PA 3KXFA 3R1GL 4GQ9H 5C71A 4BZ2H 3RDTD 4JR9L 4JN1L 4S2SA 5ICYA 3ULUC 5IKCA 1S5IH 2G60H 3DRTA 1XF2A 2AJ3A 1WWCA 2ATKB 3EYQC 4Y1AA 5H2BA 5I74C 5JIPA 5MEOA 5IV2A 4I0PA 3GO1L 1AGBA 1M1SA 4RSVA 2IPUG 4RRPA 5JPMA 3DVFA 4LRIA 6CGTA 3CVIL 1F8TL 3V5KA 1LO0H 3JWDH 2WUCL 4U1NA 2QQLL 1NC4D 3TV3H 3S9DB 3O11A 5DJXB 1RIHL 5I71C 2DMCA 5EBMA 3T1WA 1WBXB 2P5EA 4HLZH 1P4BL 4G42A 1Q9OB 1NGWB 1SBBA 4L4VE 3VRIA 3OMZA 5IJVB 1BM3L 5IW6A 3RL2A 4G9FE 1GVIA 3T4YB 4PJXB 5C8JA 2G2RA 5DO2D 4F7TB 2E5EA 3G6DH 3HR6A 1N6QH 4PJXE 3L95A 4P2OB 4GAYB 4XBPB 1AGFB 3E2HB 3WKNA 5IVXB 3TBWA 5IM7A 3D39E 4AENB 3JV4A 3EZ8A 1S7UA 1TZIA 4OAWB 4CKVX 3W11C 1QVOB 3GMNA 4MGXA 3F7RA 3PGDB 4E5XA 2E7LC 4HPOH 5T5FH 2DIBA 5HHQA 2DTML 2A9NH 4HUMB 3RA7L 5F9WB 4DAGH 5TQ2H 2CUMA 1A2YA 1V3LA 3KPRB 4BZYA 5IB4B 3LB6C 1JHTB 1NBZB 2P45B 5LWYH 1A6TA 5TE7L 1VA9A 3BIKA 4P9HL 2HFEB 4TSCL 4XB7A 4AEHL 3FQNB 2A2QT 2MCPL 3MO1B 5CINH 2YXFA 1IAMA 3RZCB 5CMAB 3DGGB 4Z7VF 2X70B 4M6AA 1JN6B 5KSBF 1AC6A 1L7IH 3CH8A 3I85A 4NDMB 5T3ZL 3NZ8A 1T1ZB 2DI7A 4N0RA 1LO4L 2PXYB 4BQ6A 3IRZA 5CILH 5EBWB 3MRCB 3VXNA 5JW5A 4Z5RB 3TM6A 2VDOH 2EDJA 4LKXA 2NW3B 4HX1B 3H8NA 3QUML 4OM0H 4PJ5A 3VDBA 1AHWA 4PFEA 2OZ4H 5DC9B 3VG0L 1ED3A 1U93B 1JGVL 3BP6A 3HPJB 4MXVF 2QSQA 1T04B 4PJHB 4HLJA 43C9B 1ZT4A 4OQTH 1DVFC 3MRGA 5T5FL 3T3ME 5BOPA 4Z7UB 3BDYH 25C8H 1CR9L 3U7WH 3MRLB 4PY8I 4NQEA 1DN2A 1I9JH 2VC2L 5CHNB 2YA2A 2C9AA 3KYMA 4KJYA 1BJ8A 3MUHL 1ZHLA 3GMNB 3PWVA 5HGDB 1HHJB 1HH9A 1DEDA 4JN2B 1GGCL 5CCKH 5FM5M 4JQXC 5L8JB 4R0LA 5GS3A 4ZS6C 2ILLA 4M5YH 3RWCB 4MMXC 4B41A 2XTJB 2R2EB 1IC4L 4RDQF 4JRYD 3S4SG 1I7UA 5I73B 3WHE1 3VXTA 3DIFA 3KYNB 3S5LG 1LK3L 1Z6JT 4HC1L 2ENYA 5JW3L 1AO7E 4ELKA 1LEIA 1EMTH 4R90L 5DMIL 1M6OA 1QBBA 3LZFL 5DVLA 2R23A 4JGJA 3WEXB 1CD1B 3DURA 2HJKB 3VXRD 5IVZB 4MB4A 4IRJB 4ZPVA 2Z31B 1MUJA 1OD7A 3ZKMC 2BNRD 4LFHD 4LSSH 1QSEB 3HPLB 4M1CD 5E99L 1BQHG 3GJEB 5JOEA 3C2SA 3WDJA 3QEQB 2EZ0C 4OKVA 5DJ2B 3S35L 1EZVY 1SY6H 1OP3K 5DHVH 5FOBB 4Q9QH 4O2FB 4ZPTA 4LSDA 1FL3B 2H3NA 3WNKA 1KN2H 1LK2B 4C56E 1I1YB 5D96C 3TYGL 4N1EA 2ARJB 2QL1A 5F70A 2XQYK 1BF2A 4YNYB 1ITCA 4NZUH 4PRDB 4CNIB 2C4FU 2GTWA 1J0IA 5FKPB 1I9RL 1UZ6E 2BERA 5FAAA 1U95B 1WIUA 4XBGB 3P4MB 1I1CA 2EO9A 3MRHA 3IJYB 3QNZB 4L3EB 4RFEB 3QXAB 4RGOH 1A6ZB 2GEEA 2XIDA 3BPCA 3FB6A 3FOLA 4KH2A 2DN7A 5GPRA 5FB8A 1JRHL 3WO4C 3TESA 3PWJB 4AYFA 3RVUD 3FQXB 4RWHA 5IROC 4ONGL 1U6AH 1YEKL 4U1HA 4PJ7A 3IDXH 4NJAH 3QUMA 5EWIH 4UT7H 4WENB 3O0RL 4JO3H 4TNVF 4YZFF 1DBKL 4DJMA 3TO4A 3K4ZA 3KPPA 3UPCA 4Q9QL 5ERWA 5B39G 1RAMA 4PRBA 5GGVL 1KJ2L 2DQJL 1OP9A 1OARL 5EUOA 3WUWG 2BNQE 4MB3A 2A6DA 1WGOA 2W65B 2HN7A 4KUCF 4X6DE 1JHLH 3MPCA 4RIRA 3IDNB 3VFSA 1DE4A 2BVPB 1KLUA 2QQKL 5ESVA 4L1HA 4F33B 4NGHH 4ZAKB 4OCXH 1GOGA 4Z5RA 4MS8C 4Y2DC 3ESUF 5EORL 3MV8B 4N9GB 5ID0B 2AK1H 1H5BB 3BRFA 2RHEA 2X4PB 5DLMH 3O2WL 4V1DD 5LG1A 1CQYA 3UDWC 1JGDA 2CIIB 3I02B 4RA3A 4ZPTB 1QLRB 2BVQA 3TFKC 3O6FC 2J8UB 2JELL 2P42B 4QXTA 1CS6A 3V8OA 3KPSE 3C2AH 4MVBD 2Y36H 4PJCA 3UTZB 1ZHNB 3IFNL 2WBJC 2JK5A 5F6HJ 3RBSA 4XNQB 1TCMA 2JIXA 5CGTA 2IG2H 3WIHH 1I7TB 1CXKA 3VFUB 3RKDD 1AXSA 1IAII 1IC5L 1U92A 4FXKB 5DA4A 4R0LB 4POZD 3DX9B 2R29H 1W8OA 3LMJH 1D5IL 3GMMB 2R0LH 1U93A 5KS9F 1CE6B 3QNYA 2F53D 4WI5A 3W5NA 1NCWL 5F6IC 4WFFD 4R7NB 2HFGH 2EH8L 1QLFB 2QHLA 2VMFA 3SOBH 3V95A 5HPMA 4LBEB 1JGLH 4Q9RL 2OLDA 4BSJA 2IMNA 3D3VA 1FVEB 1BP3B 3AC0A 2M8XA 3N85H 5E94A 4F15B 1I1AD 1UKSA 1BQLH 3B9VA 4S1SH 2WBJB 4JFEB 4H25B 1R3KA 3WKML 2WWMD 3MUY1 2IFFH 5FYJD 2VXSH 4U1SA 1N6UA 4LCYB 1ZHLB 2DL2A 4UQ2A 1G7LA 1A64A 4NN5B 3RRQA 1CICD 4XPGH 4BM7A 1JK8A 4OZ4A 3WO4B 2EXWD 1F42A 4X4ME 2AJSL 4ODSL 3ZTJH 4U1JB 5AZ2L 1U9KA 1DQJB 3QUYB 4OLUH 1GGYA 3OJ2C 3VXQB 2NXYB 3CC5A 3KPOA 4PGZA 4D9LH 1OTTC 4YAQB 1K4CA 3A6OA 4OIIL 4XBEH 1FDLH 1ZT1B 2FO4B 2FB4L 4AJ0A 2WP3T 4NYLB 3BUYB 3LPFA 1T21A 2P48B 3QWRA 4CU6A 1MSPA 1ZAGA 1AR2A 3BH9A 3RWFB 3IT8D 4LKXB 5DZOA 4XAWL 1BZQK 4F2MA 4BH8B 1E4JA 1GRWA 1OAXL 4LARH 2RJMA 5JZ7C 5GGRA 2VJXA 3BZFB 2XPGA 3TT1L 5JXAH 4PV9A 1D9KA 4CMMA 1QYGH 3GSXB 2NZ9C 2PKDA 1JTOA 5C0BB 3RHWF 2C3VB 1ZHBA 4JHAH 2UVEA 5DEZA 1U3HA 3VA2C 3ZDYE 3PGDA 2FWOA 4YDIL 3UBXG 4YFEA 2X7LA 2CIKA 3N9GL 3CFCL 4G6MH 1ZT7A 4NOBA 5E2UL 4NJ9L 3TH3T 4JFED 3SDXE 3P40A 2DM4A 1FZOB 3BGAA<