2IOIA

Crystal structure of the mouse p53 core domain at 1.55 a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
QKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription, antitumor protein
molecule keywords Cellular tumor antigen p53
publication title High-resolution structure of the p53 core domain: implications for binding small-molecule stabilizing compounds.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ioiA00
2J1ZA 2X0WA 4GUQA 2XWRA 1GZHA 1EAOA 4XR8C 5AB9A 1EANA 3VD2A 4KVPA 4AGNA 2X0VA 3TS8A 1GZHC 1TUPA 4AGPA 4A63A 2AHIA 3D09A 4IJTA 3WU1A 2BIOA 2VUKA 4GUOA 3WTYA 5ECGA 5AOMA 1E50A 3D06A 2YBGA 3D0AA 3US0A 1YCSA 2MEJB 3Q05A 3QYMA 5G4NA 1CO1A 1T4WA 5ABAA 4LOFA 3WTXA 4AGOA 4IBZA 1H9DA 2XWCA 1TSRA 2P52A 2IOIA 2PCXA 5G4OA 5KBDA 5LGYA 3EXJA 4IBYA 3VD0A 1HJBC 2BIMA 4AGQA 5BUAA 3WTSA 2J1WA 2IOMA 3US1A 2J1XA 3KZ8A 2WGXA 3WTWA 4AGLA 4IBUA 4IBQA 4IBWA 2RMNA 5AOIA 3Q06A 2BINA 2J20A 4QO1B 2ADYA 4L0ZA 1KZYA 3KMDA 2AC0A 2X0UA 5AOJA 4LO9A 3QYNA 1LJMA 2IOOA 3WTTA 2ATAA 5AOLA 5LAPA 4IBSA 4L18A 5AOKA 1HU8A 3D05A 3IGLA 2FEJA 2OCJA 4L0YA 4LOEA 2BIPA 3WTUA 1EAQA 4IBTA 2BIQA 3EXLA 5A7BA 4IBVA 2J6WA 2GEQA 4HJEA 3IGKA 4AGMA 2J1YA 3D07A 4MZIA 4MZRA 5G4MA 3ZMEA 4G83A 3Q01A 4G82A 3WTVA 2H1LM 1UOLA 1IO4C 1CMOA 2J21A 3VD1A 3D08A 1HJCA
chains in the Genus database with same CATH superfamily
1AZVA 2BP8A 1ZHLB 4MLIA 4N0UE 5C0FB 3WAKA 1QR1A 5HVWA 2BY1A 3EJRA 3UJIH 3D39B 1JGEB 1ED3A 3NJXA 3FQUB 2CRMA 2F6AA 3VXPB 2OMTA 1UURA 2H26B 4UT9H 2B1AL 3R7QA 5DD3H 2XFGB 3ZN6A 3UADA 3MRPA 4XNBA 3BESR 4M1GH 4Q56A 3HC4L 1D5MB 3GXIA 3M88A 3ISRA 2WINB 4QTIL 4LHUG 5EBGA 3DKHA 4F5CA 3JVGC 2FZ3A 5EU4A 3KLHD 4LLDA 1BG1A 1J05A 1NGXA 2ZPKH 3TO4C 4M48H 4FXLA 1SNRA 5FW8A 2Z91A 1YCSA 3N41F 4M4RB 5EU3A 3SQBA 1DJYA 4MBOA 1W0WB 1ZA3A 5DMIH 3ESNA 3FO1A 4FG6C 4NCC1 3AW5A 2QQKH 2Y2WA 1XZWA 4HHWA 4D3CH 4ZK8A 2XIDA 3SYPA 4MNQA 3UG5A 5IJKA 4BFEA 1SY6A 5ADPH 1AZNA 2MCPL 7TAAA 3QUMB 4TQIA 1A3RH 5J1AB 5F7AA 4TVPE 3DGGA 4PJGF 2YXFA 1G7JA 3GBEA 1J1XL 1SEBA 2VDQB 1OB1A 1FLRH 4FTDA 4LQFH 2OMNA 1U8IB 2EIJB 3F01A 5KSAD 4JQVA 4QO1B 2WXHA 3JBG7 1BJ8A 5EOCL 3MI6A 2EYRB 3NCEB 3NFNB 4JANB 2XBTA 4KQ3L 4QMEA 4QRPB 4J6RL 5F1KC 3FTVA 3IDIB 3VXUB 1D9KA 2ZOLB 3GJEB 2O6PA 1M2VB 3EJTA 3RBGA 5A2JH 3B5TA 4KMLB 1G94A 4P49A 1RVFH 2OYMA 4RQQA 4XBMA 3TJHC 4WEBH 4HAGA 4EI5A 5JQ6H 4DNLA 1IL1A 3V6ZA 4PJAE 3KPLA 1I9RH 3QQ9D 2ZX9A 4KKRA 4WGVB 2GIYA 4GRLC 4XP4L 4BD4A 3KDMB 2AI0L 3D9AL 4GKOA 3D8MA 1SJMA 3RAJH 1C16A 2X4UB 4U0RC 5CR8A 1NBZB 3L3OA 4U2YA 5DFAA 2V5SA 1IGTB 2AEPH 1KB3A 4P46D 1EMTL 2YPLA 4AH2B 3C2SA 4DKFL 1DUYB 1GC1H 2ZD0A 4GBXB 5CO1A 4G8GD 5CFHA 4M8RA 1NCWH 1GGIL 4JK0D 3OB8A 2LU7A 1EAJA 3B9DA 4O4YH 4L1DA 3SGJC 4NO2A 5JPMA 3ARQA 3WNOA 5JORA 1XCQA 3P11L 3QG6B 4O58L 2FL5A 3EJSA 4G9DB 2H47C 3KE0A 4PGEA 1XR8B 2O5XL 1KYAA 1DUZB 4HJGB 1PZ3A 4AMKH 3BQUD 3M8OL 1TDQA 4MLSA 3HG1E 3MLXH 2UXVA 1NCOA 3RRQA 2NOYA 2V6HA 3VO0A 3C8HA 3THMH 3VGGA 4CDHA 5DD6A 2WZ6A 4UQCA 4M1DL 1KGUA 4GJTB 2MCAA 3T8MA 5IJDC 4LAQH 3ZHNA 1YLBB 5G4NA 5L8JB 2F58L 1JFHA 2J55A 1NCHA 1I8IA 3GLZA 5F7WC 5FYJU 5F7NC 3L7FB 3BVDB 4MMXC 1B0GA 1OAZL 2GUOA 2IG2H 2QVKA 4Q52A 4OZGB 1XR9A 3PWPD 3EG9A 1NAMB 4P4KB 4RZCB 5LXGH 4MCYB 1AQDA 1RZKC 3Q8AA 1S9KC 4ADIA 2BIMA 1FO0B 1CFSA 2B59B 2B20A 3ASNB 2ZKHL 4HULB 3LN4A 4ZDHA 1FL3A 2AJVH 3BH8B 3KYOA 1GA2A 2FBRA 1XH3A 3DX9B 1P7QD 1AZZC 4FABH 1IEHA 3ESVF 1RUQL 2X88A 4TRPH 1G7PB 1S3KL 3CK0H 4M02A 1WYJA 1OQOA 4M29A 2NSXA 4H88L 1KN4L 3EYOA 3AMKA 3WFCL 3CFBB 3TPKA 3CMOL 4IJ3C 4C47A 5I9QB 1OW0A 4AOFA 5EORL 4XNZC 4YSSA 3F65A 2H3NB 3H2QA 4MD5A 1KGCD 3GMRB 2PXYC 3BVNA 5ISZA 1OTSC 2JLPA 1KXVA 4LIQE 3NIDE 3K8MA 4NHUB 1LEKB 2DOCA 1XTMA 3BUBA 5F7LB 1J8SA 4JKPL 4ZD3H 4N20A 3ULSA 5MEQB 2ESVD 1UH4A 4LASL 1TTFA 1U8KB 4FKHA 3FU7A 5FCUL 3ML9A 2VISB 2CKBH 4L1BA 1BEYL 5D2LE 1WQVT 3VXTB 1RSFA 1CFNB 5CCKL 4DEWA 4H7VA 4PBDA 4J28A 3PABA 2APWA 3IMWA 4P3DB 5EUKA 4CMHC 4JUSA 4F24A 3VD4A 3HRZC 4RX4D 2Z65C 4YHKL 2H1LM 3B7TA 4UM8B 5FDYA 2J6EH 1RURH 1ZT7B 1U58B 4Z7AA 4F57L 2WUCL 4NNYB 5C08A 3GXTA 4ERSH 1QRNA 1DLHA 3IK2A 2N7SA 4PB0L 1QHQA 2IFFL 3V6BR 5GRZA 2CCWA 2YAHA 1V3KA 4KMQA 1GPOL 5D71L 1TMCB 1TVDA 3WOVA 4AJ0A 4YDMA 1N3NA 3IPFA 5IBUG 4HUUB 2QSQA 3BKYH 3I6KA 1VZIA 3KS0H 3DURB 3OBAA 1Q72L 1BLNB 3IFLH 3KPRE 1CN4A 4FMFA 4HIPA 4QHLB 4WUUB 4XNUH 2ICES 1FPTL 3F58H 5DZ9A 4HH8A 2MNUA 1IC7L 3FW6A 4F7CB 5IVXA 4NKMB 5K33A 5IY5B 3A3YB 1J9SA 1IAOA 4HA1A 2FWLB 4LKXA 1IGFH 4KU1A 5EA0H 4F8TA 3Q05A 4YBLB 3LQAC 1MH5B 4P3WA 2A9NL 1BZDA 1U91B 1TZIA 2IQAA 1WT5C 4P2YA 2K1MA 5KVGE 3DETC 1FVEA 5IROA 2HFTA 1HHJA 1S7TA 4ZMLA 4JFXB 3K0WA 3RNQA 1K4CA 5I8KL 2BVPB 4XP9H 3BUYB 1E65A 5GZNC 4HK0B 4W9HC 5DVKA 5ESAA 4AGQA 1DYZA 4V1DB 5DMGC 3L13A 4OSUH 1FAIH 1T6VN 4IIZA 3S4SA 1E3XA 2WNGA 5KVFE 3VFWA 3HMXA 1R33A 4U1JB 4X5XB 1KEGH 2R4SL 3O9WA 2IH1A 4X9FA 2DIEA 3ARWA 2XWEA 1TQBC 4PY8J 2VDKB 4LARH 1TNNA 1KJ2A 2NW2A 2AV7B 1PZDA 3I9AA 4MJ2A 1AKJD 2D31B 1YAIA 5E56A 4RMVA 2C9PA 4GG8B 2CBQA 1CD9B 5C07A 4QAMB 2PO6D 2OMVB 1KEML 2D7OA 2D7PA 1UFUA 4Z7UF 4G5ZL 1J0ZA 1A4BA 1JZIA 1F1GA 4DPAX 3KXFA 3Q6GL 1K3IA 4ZOEA 4P2QE 3PQYD 1YMMD 2LTQC 4UQDA 3HZVB 4Z7WA 1IX2A 1DN2A 5CBAB 2CWRA 4ALAL 2OZNA 4R7DB 4A7QA 3M6DA 3DSFH 1E27B 4R5XA 4I0PD 3MRJB 4OQ1A 4AV0A 3TA3B 2VR3A 2VAJA 3L1GA 3QWOB 4PN6A 3VD1A 3RU8L 4F7EA 1XHHA 3OZ9L 3S36L 2YUWA 1I3GL 3GI9L 2WTRA 4XN7A 1M05A 3KGSA 2EVFA 4GQ9L 5KUKA 3RZCD 3MV9D 3V8OA 3MRNA 3QCTL 3FONB 1KTLB 4NKIH 2VRQA 4PRAB 2AKRB 5EC2B 3QI9C 2ICWB 5FGBA 4CW1B 1RZJL 3PGFL 2VE6B 3ZRCC 1JPFA 1YPZF 4ZNCD 2YPVL 1GMIA 4OLVL 1DQLH 5GS3A 4MMZA 2AXJA 4XMPH 1G9HA 1A9BB 1S5IH 1Z9LA 3C9NA 3G6AA 3O2WL 1ICTA 3SDAD 5KYWB 4QRAA 2XWBB 3CTTA 2A6IA 4PGBA 4UTAA 2NT1A 3CPLB 4C4KO 3ZDXB 4MMXB 1KIPB 2G9HA 3EGDB 4KHXH 4OF0A 1JNHB 3FFDB 4DKTA 3LKPA 1F6LL 1TFHA 3QT2A 5I6XC 3SGEH 2X6BA 1OB0A 1OZUA 1GVIA 4YDIL 3LXBA 1K8IB 5DZOA 4WAFA 1I85A 4FNSA 2NDGA 1E2VA 3CLWA 5E95B 5MEND 4L8SC 1T4KA 1LP9B 4JZOA 4A2DA 1YN7A 5DHXB 4XC1L 5D5ME 4YXHL 4K7PX 2R7EA 5B22A 3P69A 4FEMA 3U4BH 3DX1A 3HC0A 3MCKB 4FF9A 2FECI 1C8QA 3GKWL 4TSBH 2FIRT 3SE4A 2Y36H 4Z3GA 2W0FA 3Q3GA 1I8MA 4K9EL 2D8KA 4HUNB 3NDZE 4XNZB 3MOAH 1G5AA 3ECBA 3VH8G 3FQWA 4DKEH 2PXYB 4JFFE 4JFVA 3LIZH 3V0IA 5AOIA 1L0PA 3UDWC 4WK4B 1M3IA 2CIKB 2E5EA 1UVQA 4LLYB 3TBVA 4U1SA 4YHPA 3SKJL 4PJ5B 2QVMA 2X3BA 4KTGA 5IJVB 2OPCA 3IMVA 3CHRA 4KROB 5DMJB 5ICXB 3AGWA 4WW2B 3ZKND 1S8DB 4KVNL 3TXAA 2HT4C 4ZNEE 3ZT7A 5D1QC 5CBEB 2DYPA 4LXFA 5FB8B 2DL9A 4NWUH 3CXHK 4HS8L 3VVVA 4HISA 5JOPD 2X1PA 4YDVA 3GJFA 1RZ7H 1D5IL 4G11A 3V4VA 5DEZA 2RR3A 4CMHB 4NQEE 3H53A 3HRZB 5I8EA 4DESA 1CD1A 3AM8A 3HOGA 2A2QT 4CU8A 5KVEE 3ARDD 1WO2A 2X4SB 2VO5A 5D72L 3V9CA 3V4PL 2OMWB 1KELL 3WS6A 4FYSA 3WUWG 1INQA 1S78C 5E9DA 1J1PL 1RIVL 4Y2OA 3ZKMC 1FH5H 3I02B 5TQ0L 4QD2E 1MCWW 1CR9L 1UOLA 4HBQA 1M7DA 1T1XA 2ED6A 4L3EB 3QG7H 1JNLL 1CFMA 1UZ6E 1NDGA 2VXTH 4ODWB 3S0PA 4ADGA 5IF0A 1ZE3H 2XWTB 1ZHBA 3DK2A 2HKFL 1G9MC 5JHDE 3VRJB 2VJ8A 5GGVH 1W16A 3K6SA 4Z7OB 1AGFA 2OAAA 3P9WB 2R0LL 3HHSB 1WSST 4NP4H 3LKNB 5I1EL 4DCQB 2BW4A 4QYOB 3VG9C 3GSOA 2Q8BH 4BFKA 4W81A 1MQKL 4QHUB 4P07A 4PGDA 1HZKA 1KJ3H 5D7JA 5IW1A 5IQ7L 1LO3H 1B2YA 3U82B 4C83B 1X9LA 5FK9A 4GEIA 4PW4A 5I75B 1DQKA 3D48R 1I9EA 2AEIT 2MQCA 4Q8BA 3P2BA 3NACL 3D0AA 1MSPA 2R1XB 1G9EA 1N6QL 4BGLA 1E4XI 3T1FB 3BD4A 2VDOH 3QJRB 1T0MA 35C8H 5AW8B 2A73A 4R0LB 3WMPA 4F37K 1AQKL 2DQDH 2ZYHA 1A0QH 1ZTXH 4OFVA 2ZWYA 2YD5A 3EBAA 5KAQG 5E8NB 1A6TB 1I7TA 3QDME 5HHVH 4BZ1H 3AWGA 1MJ7H 5F88B 3U0TA 3CVHA 5GS2D 2GABA 4UQ3B 1SM3L 4L4VD 2J7LA 2E6PA 3BQVA 3VG0H 4P59H 5D70L 4D94A 3M1BB 5EC1B 1DBAL 1BWMA 4FAAB 2JKRM 3T08A 5AW1B 4OT1H 3EOAA 4Q2ZA 5CWSB 4NXKA 1NBVL 5DRXA 4I3GA 2EDJA 4N2IA 4U1KA 4JPKH 5DA4A 1M71B 2P5WA 2VUOA 1MWAL 2ZCKH 3LVTA 1I7UB 4G43A 2NXZC 4ZUTB 1C5CL 2I5YL 2Y7LA 3BJ91 5DXWA 2YSSA 4Q6YA 3OKEB 1DQVA 5GGRB 3S97C 3U9UB 5IZ7A 5IGXL 5M7QA 2G60L 4D8PA 1EZVX 4GKSA 3ARSA 4G80A 5F96L 2VZSA 2C3HA 1Q1JH 3GPSA 3ET9F 3V6OE 1A1NB 5DI8A 1NPNA 4NAMA 3MLZL 4HCRA 5E2WL 5I1IL 4WDIB 4AY0A 5KSVA 3WUZA 4KZEL 1UXLA 2LTQB 3QDHA 4RCAA 2BNRA 1LEIA 5ETUA 2AABH 5AUMA 3TIDA 5KVDL 3TYGL 2WLLB 2NUPB 3C6SB 2YAOA 3CD4A 3HG1A 3P2DA 4PJDA 1RIUH 1NSNH 1TETH 3QUGA 5L9DL 4KQ0A 4UT7L 2A83B 1MF2H 3L2NA 3PL6A 5D7LD 4AVHA 1VENA 5KEZA 2NYZA 4IOFC 4NO0A 4PWIA 1T83C 4DF9A 3M86A 4E9VA 3EO1B 3KBHE 2EDWA 2GW5A 4KKBD 5IK3A 3S88L 3GMMB 1WH0A 5C0BB 3RUGB 5A2CA 5CEXA 2X89A 4U6YB 2G3MA 2Y07L 3MQIA 4KVCH 3V0DA 4LEOA 4YAQA 2J8UE 5F93C 3GNML 3BVWA 2WWMC 3LH2H 3TF4A 3DJZA 3QIUC 3QI9B 1ODAA 3GF8A 2I07B 1I75A 4YDNA 5HGGS 5L0QC 3G5ZB 3HHRB 1MLCA 1YEGL 4HQQL 3CMGA 3O2DL 4MDJB 5IVOA 1MREH 5MERB 2VLJB 1DJSA 3VDBA 3GK8L 4YQXL 4CVZB 3K6FA 4JKWA 4CJ0A 4Y16D 2BM3A 2QPSA 3IF1A 4BKLA 1J86A 2BRQA 3HZYA 2XPGA 4B9IA 4YL9A 4XPGH 3WNMA 4Q9QH 1YEJH 2HLFC 2A1WL 3ARBA 4HZ1A 3ARFD 3OQRA 4HDIA 1L3NA 5I6XB 4KTDH 1MAMH 1BD2E 3KD4A 1FNSL 5IMKA 1VHPA 2EDHA 4J3OG 1QVOB 2P80A 4R90H 4B27A 1D3CA 2H32A 3FOMB 2VKXA 3O4OC 3OKLB 4BDVB 1IIKA 4YSDA 1AO7B 3QNFA 1T7YA 2G3ZA 1SRDA 4ZTOL 4M9PA 3QXUA 1F8TH 5DS2A 1AY1L 4XPBH 2JCCA 3GINA 3NTCL 3AXHA 2BFVH 3MGOA 4IQHA 4PRNB 3NGBC 3DPBA 1CLYH 4N3TA 4MDIA 5D2LA 1OGAE 1C1EH 3MACL 1RHHA 4EOWL 3G5XA 4KY1L 4F9LC 4PLNC 4G9FA 5JIHA 3T2PA 3RY6A 1JNNL 1OP9A 4U2ZA 5INDA 3RTLA 3EJJX 3TBCA 4M3HA 1M6OB 4FNLL 4G42A 1FNHA 4AYFB 4OI8A 2CR3A 3ESUF 5FOBB 4PLJD 1NCBH 2JKJA 4LL1A 1J8RA 5AAPA 1NKOA 3X2QB 3BEWB 4I85A 2J12B 1QO3B 1MPAH 1U95B 4QRRB 4LCCA 2DLFL 3FSAA 1E2ZA 4FRWA 4NQSA 1OF0A 4UOQA 5DR5L 1DBKH 1Y18B 1EHKB 5CJQH 2A38A 3MVSA 2ZUUA 1JTOA 2ITDA 3R1GL 1MVYA 4JM2D 1DO6A 2W94A 1BXAA 1QNIA 3IXAA 3P4MA 4MHHI 4XRCB 2R29L 1EEUA 4PJHB 1E4KA 3PGCB 4MZ3A 3UFIA 1QSZA 3KYMB 3HA0A 3ZE2E 1JL8A 2GSGB 1YEEH 3H9SA 4OFDA 3SPVA 4BSWA 1V55B 4X98A 3MGTA 5SWZE 4I0CC 1U8LB 4FFZL 2DWEB 2E4TA 2EDMA 5EBLA 2E59A 3HS0C 4TQEH 2KMWA 3QUZA 4ORGA 2D2OA 2V3FA 5B8CB 2Z93A 5GS0L 1ZGLM 1YNKH 2DJSA 2RHEA 1QOKA 1PY0A 3QQDA 3D2UD 3F7KA 3ECUA 4GRWB 5HHXL 4L5FH 3D33A 4CSZA 3A6CH 5I1HL 1I1FA 1IZKA 2CCLA 5CJ5A 1HQ4A 4AJYV 5TGBB 1ADQH 3FCSA 4HBCL 4KRLB 3EHBC 4CMMA 2WBJD 3QJXA 2DB8A 3ALWA 1JXFA 3T4YB 1F13A 4NCDA 3TTSA 1XF5A 1W72H 1BYPA 1FFPB 2KLRA 2H0PA 4PP2A 4QRQB 4YHNB 5D7IB 4AYMC 3FUIA 2LABA 1H0DB 1RERA 3ZRSA 1HINH 1TCRB 5H37G 2N1TE 2WVTA 1CGVA 2OQJB 2XQYG 1G1YA 3LVEA 3PXHA 4W70A 5I2IA 4M7LT 4YE4H 3UPCA 3FFCD 4JFDA 2W80C 4J4PD 2MHAB 1BDYA 3WJMA 1UYWH 1KGWA 3SDXA 1H3TA 3H0TB 4DPBX 5E8PB 3UXFA 5T3XH 4JM2F 5GQBA 1G7HB 2NY1C 1DQQA 3DRQA 1WUZA 4K3EL 3CFUA 4PJEE 1HNGA 2CAKA 3EH5B 4DK6A 3ERXA 4FC3E 2ZYSA 1CVRA 4DJMA 2RCSH 2JQMA 2VR5A 5JYMA 2W9DH 3C5SA 2Y4SA 5B39B 3S34H 4PLKD 4KK9D 4PJCB 3PV6B 3NP4A 4P2QA 2F8XC 3VGAC 1SBSH 4LRIC 1KGIA 3MUGA 2DLGA 2Q6WA 1TU2B 3CN2A 2XBZA 4Z7QB 2NXZB 2XV6B 4I89A 5CIPA 1M7XA 3BN9D 1OGPA 1ZVSB 1K2DA 4N8CH 4EIBA 2DV6A 3NAAL 2NY6B 4Y4KB 4LCYB 1MCKA 5C0ND 1MFNA 1UT1A 4NN6C 4DEUA 3IJSB 1V7ML 4JHWL 2CMRH 3SD2A 1UTDA 2HFEA 2FHCA 1WAPA 2XTJD 1Z9OA 1MXDA 1UXWB 3FZUC 2CKNA 2LAAA 2QZQA 1G7QA 2VQUA 1EBPA 4JN1H 3NQIA 2R69H 1XF4B 4TNWK 1KT2B 5LG6A 3CBKB 2EH8L 1MNUL 4ISVB 1KB5L 1PLCA 2ARJA 2WK2A 3KYNA 3WY2A 2EUXA 2H5UA 5C0AD 3QEHA 4NQCD 1RUML 3BDXA 5CGYD 2AQ3A 3NRPA 3QIUB 1CLOH 1HEZB 1P6FA 1RK1B 5E08L 1I3VA 4FYRA 2VLRB 1N19A 4M03A 1T5XB 4BH8B 5I15L 1HYRC 4JL2A 1TJIH 1A7OL 5ILTL 1FF5A 2BDNL 3O2VL 4FTVB 3D3VD 5L6YL 2ZG3A 1PFCA 3I9IA 1NH6A 1WC7A 4LE8A 4NQTA 5D5MA 1CFVL 5PCYA 5BZWA 1PTZA 3RDJA 3UBXG 3IFOB 4IS6B 4ANVA 3BWSA 4DK5A 4BUQA 5L8KB 1XIWB 1S9YB 2DQHL 5IM7B 1DANT 5IB4A 1G7LB 3AREA 5FF6A 3S5LA 2Z9TA 2NY0C 4JFFA 3O4OB 1T66D 4PG9A 5T3XD 2NMSA 2BP8B 2DQCL 1P7BA 3APFA 4MRBA 1QR1B 4NN5C 3FO0L 3MR9B 4WFHD 1QNZL 2Y1AA 5F9OH 3VXSD 5AYQA 3STLA 2WANA 1ED3B 1ET8A 1FJ1A 1KOAA 3D50A 3GSVA 3TJEH 1WG3A 5DFWH 5FOJA 4ZO8A 3GEWB 1KTBA 1UB5A 2ENYA 4Y5YC 1R24B 1Z3GL 1CXKA 2QZ5A 4PRIB 3VA6A 4DZ8B 2VMJA 3U7AA 2VKWA 4XNMB 1MZYA 4M7JL 3PDGA 4AUYA 4NQEA 1P4BL 2ADIA 5EU4B 2FZ3B 4AK2A 4GAYA 4PJGE 1PJWA 4L05A 1I82A 1MCSA 1ULVA 2ALAA 3NSXA 2G5UA 4H20L 4HXAH 4Y5XC 4XCNA 1HCFX 2Z91B 5E24E 4Y19D 5EU3B 2ZAIA 1F90H 4ZS7L 2PCFA 1FV1A 4H0IA 5CCGE 4L29A 3AY4C 3H9ZA 4MJ4A 2DMBA 5DC9B 4XVJH 2YD9A 5KZCB 4MNQB 4QYAA 1XGRB 3GXFA 2M8XA 2CG9X 3QUKA 3C5JB 3S3CB 3NIGB 5JHDA 3QDGD 1GSKA 3ARRA 4QNPF 1N8ZA 1D7FA 5LAPA 3OJDA 4FCHA 4R7LA 5T1DL 2D2CC 3S96A 1G7JB 1M56B 4NEHB 4JO8A 1IQDB 1WBZB 5IW6A 4H40A 3NIFF 4H2CA 4MAYD 1NUDA 3RB7A 4ZUUA 5HDBF 2YGOA 5HJBA 1GC1C 3IJYB 2MNJB 2EE2A 3CSFA 4BFFA 1UM6H 3MU3A 1E5BA 4F8OA 2BP0A 5J9PA 2XTLA 2I9LB 4ZTPL 5HYFA 4D9RE 4KOCA 3EHBB 4AE0A 3VX1A 1PZUB 2XFXA 4P2RE 4L9LA 1D9KB 3I3EA 3D4YA 3EF4A 4XZUA 4FA6A 1LXMA 4P9HH 3Q2LA 4DN3L 3FKUS 1EEZB 3DECA 3IMBA 5A3ID 1CLCA 2D4FA 1QFWM 2HKHL 1OT4A 4DP4X 7PAZA 3KJ6H 4FQQB 4RQQB 3JV6B 1II4E 4H8WL 3AGVA 3V6ZB 3NPSC 3MXVL 1NAKH 2QHRH 3KPLB 4AENA 4AEFA 2A4EA 2L7UA 3TH2T 1A5FL 2WCPA 3ZK0A 2NY1B 4QXTA 4E41A 1E8YA 3SPGA 3QZWB 2EECA 3W39A 1GS6X 3R8QA 4C56E 4FQJL 3WKYA 5KSBA 5FFLA 3L9RA 4UV4L 4M6NH 3BSZA 4TUUA 3IJEB 2KLSA 3DYOA 4LLWB 3W81A 4FI6A 4MVBC 3TF7C 3D85B 3OSVA 4X4ZA 2XX1A 5LVEA 4NO2B 3FN0L 3T65B 1XCQB 2RA1A 3R0NA 2IH8A 2ZONA 2DLHA 3FUEA 5CSGA 3LB6C 1T22B 2FL5B 4K73A 3CFJA 3VGAB 3C8DA 3BP6B 4MA7H 4LHUD 1P4UA 1NM4A 2BFGA 4L3CA 4P2CG 4PGEB 4WW1A 5TDNA 4EBQH 2CRYA 4H5SB 4WHTB 4B9ZA 2R2EA 5I1GL 4M9OA 1SXSA 4LOFA 5DQDL 3OC8A 5CINL 4NGHL 2X9ZA 2WYHA 5EU6E 3ETBJ 4P23A 4ZSOE 1UENA 2GB2A 2CBMA 2GTWB 2H2SC 2EXWD 2X70A 1IM9D 1K5NA 3O6MH 4GINA 4NN6B 1NBCA 4PV9A 1ZWIA 2H0FA 3CZGA 1T03H 3ISWA 1BF8A 2BNQD 4FLHA 1H8OA 2Y7QA 4XPFL 4I5BB 4OKVA 5CSZA 1I8IB 2J8UA 2PO6C 3BH4A 4NQDD 5DSCA 2QQQA 4Z76B 1YC7A 1JZ4A 3VFSA 2PP9A 1XR9B 4H25A 2MOQA 3EG9B 4GQPH 3QQ4B 5EOQH 3U9PH 3CSTA 4UOZA 2VMFA 2KHAA 3UTTD 5D4IA 3P3SA 4OD1H 1FL3B 1E4XH 2GBAA 5E2TH 3C5XA 4WI0A 3CN0A 3TL5A 2W88A 3VSVA 4PJ8C 2B2XH 2D4DA 4YSAA 1OARL 1CD0A 5D4HA 2Z64C 4MCMA 3HG3A 3KVPA 3LAFA 4ODHH 1CI3M 3RIAF 3SE3A 3DVGA 4R9HA 1BD2A 5LAXB 3PWPE 1MCDA 3RZCC 3KCPA 3RJOA 4OCNC 4FL4B 1IUZA 3UZQA 5C0RH 4YFDB 4H0HB 3WG7B 4B60A 2XICA 2FQGA 3WFDL 2Q0ZX 2R1WB 3QYCA 1RUKL 1LMKA 3K81A 3GYRA 4HXBH 5FUOH 4A6YB 5CZXC 4WWKA 2ZKYA 5KS9F 3L4VA 3RY4A 3SDAC 1OWRM 1OGAA 3FU7B 4Z78A 1E9QB 2OXGB 4WTZG 2NY0B 3BPLC 4DKDC 3U30B 2J4WH 2VWEE 3MV7D 4RMUA 5B1JC 1PYWA 2Z4TA 3JT0A 5EPMA 3V5DA 3MOBH 3RFZA 4CGUB 1TQVA 3U9WA 1N5YL 4KDTA 4K2UH 3T6VA 5DO2D 1FYTD 4LLUB 4Y5YB 3MRBA 4UCFA 1E5CA 3VSTA 1NKGA 2ESVE 1Q9KA 4OQTL 4HUVA 1AG0A 1A7NL 2VITA 4NAQA 4X6DF 4G7YL 1U8CA 1O7DE 3OLEA 4NQQA 2FEEL 2OMXA 3ESPA 1N3NB 2CHWA 2VABB 2O5YL 2B5IC 4MKTA 3VFNB 5SWZA 4YVUA 3L3JA 4ZW7A 3MJ9A 2PYED 3T3ME 4KNQA 2P52A 5TPWH 1IFHH 1JGUL 2DQJL 2MSPA 1B4JH 3K6OA 3KPQA 4N86A 5E2VL 4E36A 5GGRY 2VNCA 4OCSH 4UIKL 5IVXB 5L88L 2F1EA 1JGVH 3RWIB 1RFDL 4YWGH 4GW5B 4B95C 3OXSB 2HCZX 3GXNA 2J73A 1WWWX 3K6IA 4MJIB 2KYIA 4FFYA 5JPNC 2O26U 4XMXA 1ZLEA 4OJCA 1CFQA 1HHJB 2X4RB 2EDEA 2PF6A 1DBBH 4UB0L 1BQHG 3N40F 4OB5L 3H42L 2BNUA 5IHLB 2XI9A 2Z31A 5E8OA 1QUPA 1MHEA 2EEDA 4RDQG 5ESAB 2DD8H 1LVEA 2Y06H 4GUCA 1L0XA 3VFWB 1G5GA 4HV8A 1SJHB 1HDMA 2EDNA 2VDMH 4G6FB 3O9WB 3UYRL 2LHAA 5C09D 4NSKB 4XH2A 2TRYA 4XBEH 4HFUL 1EDQA 3K1DA 5ITFA 3U6RB 3KYAA 5EWIL 4OGAD 1AP2A 1KJ2B 3HC3H 2NW2B 2ZOOA 3BDYL 4HWBL 4S1SH 3GSNL 2IAMC 4CVXB 4OF7A 3H7BB 4BUHA 4H1LA 3GO1H 3NRQA 2ZX6A 3MFFA 3KXFB 1ZTMA 4KI5F 1HOCA 1A22B 3UO1L 1AS7A 5AAMC 5T1JA 2EXTA 1QYGH 1VFMA 4EAEA 1YPZE 3HFMH 5MP6H 2C3WA 4XXDB 4WLCA 2GEEA 4OM1H 5DQ9B 4ZUVA 3TZVD 1TUPA 4PRDB 3BFOA 3SDDA 4AXWB 2PR9A 4RFOL 2CM6A 3ARYA 3IRPX 2GK0B 4S2SA 4CDGC 1HQRA 2IDTA 1P4IH 1KN2L 5GZOA 1L9MA 3K2IA 4F7EB 3ABMB 5CN2A 3LEVL 1KC5H 3QAZB 1M05B 1ORSB 5B7EA 2NNAB 3IT8D 3T0EC 4XE5B 5BV7B 2HFFB 3BZ4B 1UWGL 1MEXL 1M7UA 3SJVA 3STZA 1ZANL 4C4BA 2AFNA 4M8QB 1JPFB 2XY1A 4FJ6A 2A77H 1RZIA 3FUFA 3BHBB 1QFUH 1UD5A 4I77H 3S37L 3RILA 3U0WH 2BJML 5J6SA 4OJFL 5F7EL 3VXME 4ONHB 3U6XA 3C9NB 1UKQA 3AQYA 1PCXA 5LDUA 4HMEA 3O3BA 1G6RL 1IGJA 2A6IB 4IGBA 2CDEA 4QIRA 2AJZA 1EGJH 1UB6A 1QI4A 3D0VB 4IM8A 4DK3A 5SV4A 1CE6B 2G9HB 1MFMA 2XTSA 1W8OA 2ZZUT 2DWXA 3AWFA 1IKNA 3SGKA 3LKPB 2HT3C 1DP0A 1Q9WA 5CJOL 2EO9A 3C5ZC 3OF6A 1NBYB 4XWOD 5IFJB 4HJJH 3FJTA 5DURD 2EDTA 4C55A 1VKXB 2PABA 3IU4L 4KK8C 4KJWD 2KS0A 3DDGA 1DSFH 1A6ZA 1YN7B 4H8VA 4PJ8B 1NMBL 2ITEA 1CE1H 4FULA 4A2HA 3ZSSA 1AZBA 3BRGC 3O8XA 4YXLL 1ZS2A 3NSJA 3G08A 3K3QA 5DJ6B 1PY4A 4JRYD 1BBJA 3KBFA 4K71C 2UVFA 4F8QA 3OJ2C 2W0FB 3FOLA 2P5EB 5AENA 1OP4A 3VQMA 5ECJE 1I8MB 4LVHC 4LP8A 3U0PA 3DPDA 5E5RB 1NEZA 3B34A 3ECBB 3FQWB 2V33A 4AIXA 5I73C 2BY0A 3G6JF 3IGLA 4JAMA 1O7VA 3PWNB 2IANE 4N0UB 1J0KA 1YO4A 3TV3H 1CDBA 4U1SB 4YHPB 4DGWC 4PRPE 2IADB 1ZE3C 4G6AD 3Q44A 4KRPB 4M62H 4AGMA 1WHOA 3G3LA 2DH2A 3UYPA 5AVZB 4BQCA 1N6UA 4AQOA 3WO3B 5AVRB 2O30A 2DYPB 1XF2B 3A4AA 2P3YA 3JWOC 4WV1A 5LHDA 4Y7MA 3GJFB 4JJ5B 2NNXA 3FK3A 3MNZA 3V4VB 4PJGA 2IVFC 5I8EB 1EANA 1M1SA 2C9AA 2JQZA 3VGDA 1TJGH 4F7PA 3VWJD 4AK1A 4UDUB 4Y2OB 1F2QA 1QFWL 1A7PH 1SYSB 3CJJA 3HG4A 5GIRA 5IQOA 2I9TA 2GFBA 1T1XB 4MNGA 4ZAKD 1FL6B 4BA0A 4J3TA 2QVFB 5T5FH 3TVMD 4KX7A 1CZ8L 2B5IB 3T77B 4E9YA 1ZIBA 1ZHBB 1XMWA 2V2WA 3GS4A 2YK1H 3ZU8A 3AQDA 2PN5A 1L9OA 4GT7A 3B8YA 2CHXA 4ZMPA 4P0DA 3E3QE 4JDEA 5C0IA 3TOPA 4DFHA 2Z1KA 3MOQA 2K7QA 4PJBE 3RWFA 2VXQA 2CD0A 4XNYL 4F8PA 2DQUH 5JYLA 3NCCB 4F20A 4FXGA 5E99H 4PGDB 1NICA 4DTGH 5IMOB 5IW1B 4FEIA 1DL7L 2NCEA 3PJNA 1UD4A 1X6LA 5FK9B 5DFVC 3TONA 2AJ3A 3W11C 4DUXA 4JE4B 1A9EA 2ZF8A 3FC8A 3HUJF 5AW7B 2RGSA 2APXA 3LCYA 1KENH 3HI5L 4OI7A 1ITBB 5L2KD 4JRWA 4V2CB 3O3AA 3WTWA 3VWKC 4DIXA 3H85A 2RJMA 3SE6A 5CP3H 4PRBA 1IT9L 4PJAB 4HUMB 2VDNH 3BIKA 5KSAA 3DI2B 1KPVA 3U0TB 3CVHB 4FMVA 1E6OH 4KHTH 3CGTA 2OCCB 4XVUD 1XEUA 4MJ5B 3ROOB 5HYSA 4LVNC 1LD9A 4KKAC 3CH1B 1YY8A 2BMKA 2YD1A 4M8UA 3N2JA 3MV8D 4OGYH 4TUJB 4XO9A 1AS8A 3F6IA 1XCWA 4NDMA 1CLZH 4U1KB 5DHVB 1C5DB 1GZPB 2IAMB 3QEGH 1S5HA 4NJ9L 4WO0A 1Z9PA 2VQ4A 2Q7YB 2NY3D 4U7SA 3SQOH 4L0YA 2IWKA 2KQNA 4G80B 1KY6A 4IBTA 1OPOA 5DI8B 1QSEE 4UTBL 3GEFA 3N44B 2ITCA 4JO3H 4X6BA 4OAWB 3PAUA 3ZKSD 1K8DA 3AFLA 3MBWA 4J4PC 4R7VA 1LEIB 4AQ1C 2CO7A 4P46A 1EJ8A 2OW7A 4JG1H 3N04A 5EU6A 4ZQTA 5HHQB 3HG1B 5IMMA 1OTTC 1YMHB 2B14A 4ODSL 1MJJB 2AK1L 5ALBH 3ZIYA 3PL6B 3DX4A 1IBFA 1FFRA 1BFTA 3H6JA 4IU2B 1H8LA 4BZ2L 2D7MA 1W9XA 2L7JA 5IK3B 4QEGA 5IEHB 1U8JB 3MXWL 5KG9B 1ZCRA 1MLBB 1UQSA 5IWLC 3PNWA 4Z0XA 2ARWA 2G30A 4HKXA 4LEOB 4RH4A 3N43B 2LAGB 4AW4A 2WLIA 1TVHA 4B6ZA 3BQUA 4UOW0 2OL3L 4LPVA 3LSOB 4ZODA 5EF1A 5C0JA 3QFGA 4KDVA 3FCGA 1QPPA 1SDDA 1UJ3A 1KCBA 4XCCH 2OYKA 3KPSE 3SIKA 1HS6A 3FQNA 4DW2L 2FJFA 1YYMH 3WFEH 5IEKA 4Q6IA 2HLAB 4J3OH 3HZYB 2L7QA 2WWKT 3NN8A 5IHZA 3TN0C 1DBJH 1G0XA 1OF2B 4JQXC 1KCSH 4B0MM 3PWPA 3C5ZB 2XA8L 3D25B 1ZLWH 1KBGH 2YARA 4IBLT 5IMKB 1X6NA 4FZEH 3P9LA 3N1FC 1VB9A 1A6PA 4TPRL 2EVHA 4EZKA 43C9B 3NVQA 2GT9A 4L3FA 1IV8A 4KO5A 4NFDA 3VRIA 4JQIH 5IB5A 3TV8A 1P7QA 3B6SA 2ZUYA 4YHIA 5K9QI 4ZOCA 4OM0L 2XV2A 1KCLA 4QLWA 4XHJD 4OUOA 3WFBL 2GJ6D 2XG4A 1LM8V 4J3BA 5IOKA 2WLZA 4MDIB 4LVHB 5D2LB 3L7EB 3KHOA 3C2AL 5I73B 4LGRB 3Q8FA 5E1HB 3UTPE 1KCKA 5B3JF 3QO1B 2X1WL 3D12B 2CGRL 3I74A 3E2HC 4P5RA 5E8EA 3FB6B 4G42B 3HB3B 5JXAH 5FUZH 1ASQA 3NDYE 12E8H 1HAWA 3BYTA 3QWRD 4W6XB 1U3YA 2BY2A 4LCCB 2AJXH 4NQSB 5J6HA 2ESVA 1ZTXE 2AERT 2QQNH 4DZBA 4XX1G 4C59B 3LS5L 1Z0NA 3AU1A 1NOAA 2HTLD 3GRWH 3P4MB 4APQD 4ZPTB 4PJXF 2EVGA 3MNWB 3ZVVA 4YSQA 3SPVB 4BSWB 3KPRB 6FABL 4X98B 5TF1L 3MGTB 4KI1A 4ONFL 3N1QC 3QFJD 3OPUA 3HEIB 3WY1A 5EBLB 1YNTF 4XNXL 4GUQA 2WUBH 1ZLWK 3OKMA 4J8RA 1YQ2A 1JMZA 3QUZB 1X7TA 4ORGB 3I3DA 1BQ5A 3CFQA 5HHOE 4MJ6B 5BVPL 3FO2B 3KR3H 4HJ0D 5J57B 1P9MC 2QADB 3QQDB 1A4KA 4WI7A 4G7VH 5D7EA 2PUQT 1I1YA 1QKZH 3C09C 4E5XA 3VGHA 5H37H 1E30A 1ERNA 1TFPA 5HBBA 2FWUA 1HQ4B 4XMKL 3QEQB 3ZYOA 3FCSB 3K1KC 4EDXB 3LZOA 5HYIA 4G72B 4J3VA 3CFEA 3UABA 1R3HA 2HPOA 4K5OA 3CVCA 2VRKA 4KZCA 3CDGB 3SCMD 3HMWH 2PPAA 4HPOH 2DQEH 1PKQE 3I75A 5I2IB 4U1GB 4Z7UA 4NS0A 2PR4H 4KC3B 5DK3A 1MCBA 1NCIA 2G9KA 3RLSA 1UM4L 4HC1L 2W60A 3UTQA 1NCCL 3KS0J 3DROB 3WJMB 3BVVA 3EJZD 4F7TB 1D5BA 2PTTA 4HJTA 4J3OD 3EGXA 3DUHA 5FKPA 1KYFA 4FDWA 2J2ZA 2KPWA 3HNSH 1U9KA 2MKLC 3VXRE 4EUPB 3K8KA 1MAJA 3DX8B 4XCFL 3W2DH 5DRNA 5KVDE 2WQUA 4GP8B 2WLMA 2LGNA 1AFVH 1FZMA 1TJHH 2J1WA 2L4OA 3V0GA 4HHAB 3VGFA 4DGIL 1DDHA 1OQXA 3FFCE 3C8KA 1S7RA 1HCZA 1EVUA 1XEDA 3V6OC 1E6JL 1L6PA 3VI3E 2CO1A 15C8H 2WZAA 3LKSA 3LMJH 4Q89A 3WD5H 3LZRA 4P2QB 4QR7A 5IB3A 1G84A 2X2IA 3MDJA 1MCPH 2AJYL 2ROXA 3MRFA 3N42B 4HHGA 4J1UA 5FHAH 5I74C 5JQIB 3MUGB 2Q6WB 2YKLL 1IC5H 3OTTA 1YPZA 4WU7A 4X9BA 4NFBA 2OZ4L 1OHZA 3UMTA 3K8LA 2IO5A 4NBYB 4QTHB 3T2NH 1H6FA 1RZQA 1AKJA 3B2UC 1T0NA 3OWRA 5AZUA 3UAJD 2XQYK 3DTUB 4PGCA 3IBEA 4YX2H 3HE7D 1MHPH 1TQTA 5DVLA 2M26A 5LQBH 1T04B 1MI5E 3MLVL 1ACYH 2BVOA 5BO1H 5I0ZA 3PQYA 4AQ1B 3OR6B 1YMMA 4OZIB 4YFEA 3PJLA 5C6TL 7FABH 2HFEB 1AHWC 4XO5A 5FO9B 2XBDA 2HVKA 5E00B 5TE6L 2FB4H 4IMLB 3UGEA 2AJSH 4N8VB 4Y8AA 2A74A 3HBQA 4BKTC 3U1SL 3NZ8A 2NSQA 4CC4C 4M6OH 5DDHB 4B9KC 3HN5A 4I0PA 4F58L 2WKOF 4NBXB 2OTWB 1YG9A 5GJSL 4EVNA 4NNPH 2KBGA 3DC0A 3KYNB 4GSDH 4Y2DC 3RPIB 3TBYB 3BZ5A 3UIYA 4LCIL 4N8PA 3VX0A 4BFIB 2JKXA 3VD2A 2J6EA 1K6QL 1NGZA 4OF6A 5HYJD 1NBQA 1JGLL 4O02B 4Y5VA 2X2HA 4HU2A 3KPPA 4JG5A 4W1TA 2UXTA 3D09A 1GAFH 2Q2EB 2BCKA 3IPBA 4WHYG 1HXMA 1MIMH 4X9HA 3BSHA 1C12B 2QJDA 3HG2A 2DLTA 1CDIA 3NCBB 3KVQA 2D3LA 2G2RA 2C26A 2P46B 4X2UA 1F0LA 4D7PA 1LEGA 2MCMA 4B9GA 4BE5A 3CHSA 1WZLA 1WC7B 5D5MB 1IAII 2EEAA 3NJKA 5E5MA 4GAJL 3D06A 3TN0B 5HHNB 1BM7A 2FATH 3X14B 3AMLA 1NUGA 2CU9A 2N0MA 1MFAH 3WYRA 1WGOA 4KITB 3CXHJ 5KOMC 5I66A 2QSTA 4L5FE 1YNLL 4JFFB 2VR9A 4HCFA 4KKCC 1U8OA 3WMSA 4PG9B 3WMQA 1WZAA 1QP1A 2IANA 2NT0A 3BZFA 4AYSA 1QQDB 1W0YT 1GOFA 1XXDC 2ENQA 4UNIA 4XB8A 5I0VA 1HH9A 5MENA 4PRPA 4TLKA 5J3HD 1I8AA 3K46A 4ZI8A 3T6XA 4M6MH 3OLIA 2WQ8A 1BFVL 3T8VA 1FJ1B 1ES0A 3GSVB 1INDH 2PKDA 3QRFM 3V7MA 1TZGH 1FYHB 2VLKD 3ZIMA 5KJRH 4Y9EA 2CLZA 2K4WA 4ZMVA 4TULH 5CZVL 2AK4E 1N70A 3GQFA 1AQHA 1NIAA 2WWOA 1E4WH 2Y24A 4NQEB 1J12A 3OAUL 4QNPE 2ADIB 1M57B 3F8UB 2XZQL 5I30L 4XCNB 4WFHE 2W1NA 5FHBH 5D6CA 5HDBE 3VXSE 5L2JA 4N9GB 2CR0A 4JFED 4YGVA 2PCFB 5BRZE 5HGHB 3ASOB 4M61B 4EDWL 2VDLL 5CHNA 4A2EA 4OKDA 4YZFF 4L29B 3CHXA 2I60H 1MVFA 2XJLA 4XGZA 1NWPA 4Q7DA 3W56A 1DCEA 3GXUB 1R3KA 4Z8FH 3P77A 1MDAA 2J6WA 3ARDA 4JR9H 4WWID 5JHDB 1JZ7A 4JO1H 1H15A 1RULL 1N8ZB 2VAAB 3RWCA 3CBRA 3OJDB 1QEWA 3S96B 5GGUA 1EO8L 3QQNA 1MZZA 3MLWH 4KFZC 1TJXA 3GHEL 2V17H 4R8WH 3RKPA 2XQBH 4GUPB 2QKIA 5EZLA 1M42A 1P7HL 5DUML 5IT2L 3C09B 2WXLA 3BMWA 3KYKL 1CICD 2CO6A 2XFXB 4IIQA 1UOVA 3HC2A 2KZ1B 3EOBA 5C2BL 2ZXCA 1OIOA 1FGNL 2IPTL 3QDGE 2M83A 5L7XL 5AVXB 5A1AA 4ES9A 1F1DA 2BSSA 2VGLM 1JV5B 3BCFA 1U3JA 4WCYL 1TZHB 3EDFA 1FGVH 4FJYA 4WI2A 3REWB 1VCAA 3FF7A 3T9WA 5C97A 3QDMB 1RUAL 1SF3A 1JWSA 1G9NH 2BSRA 3ARTA 1LWRA 3AQZA 3BISA 5D1XD 1A4JB 3S3DB 1M2OA 1KCVH 2AEOA 3MLUL 4FGMA 1N5AB 2CR6A 3HAEB 4QXWA 3WDIA 1KSRA 1FVDA 3E1ZA 5HXMA 5EU7E 1HEHC 1JCKA 3FT1A 4AV4A 4PP1C 2F61A 2O5NA 2H1PH 4AJWA 4HWEH 4MB4A 4TF4A 4Z5RA 5I1CL 3WHXB 4P2OC 4DGYH 3DO3A 4PVBA 1KGXA 5CILL 4QKTA 1OAKH 1W8NA 4L4VA 4BQ6A 3L4UA 4WW1B 4RVBA 4L3CB 4DPCX 1BFOA 4GAAA 1WA0X 5AZ2L 4ZXBC 4PJIF 1R6VA 2R0ZH 3E8UH 3OX8A 1FNEA 4MZ2A 3HPLA 3GSWA 1QUNA 1B90A 4WNQB 4AGLA 4IBQA 2D03L 3WI9A 5D8JL 3ULUL 3H7LA 1NPJA 4GW1A 3AUWB 3ZY7A 3SY0A 1K5NB 3ZYJA 4QI3A 1B4RA 1DJXA 5DJ8B 1O7SA 3AACA 1SPDA 3MLTB 5FYJL 2B15A 4FQPA 4YXKL 1LYQA 1I3RB 4AL8H 5DUPH 5B4MC 1NMAL 1AHWB 4OKVB 2EDKA 2J8UB 1J11A 3GNMH 2WVUA 1SHWA 4MB1A 4W9DC 3ZBMA 5DSCB 3TX4A 4PB9L 3M07A 2WQRA 1KCUL 2A6DA 1CK0L 3CVBA 4TLUA 4XVTH 2G75B 4HT1H 3SE9H 4PV8B 4MAZA 1EAQA 2OR9L 4QHMA 5D7LA 1OAYL 5TE7L 1CLVA 3W57A 4OLYL 1M6UA 1JHTA 1MIEH 2AXWA 2IGLA 3BW9A 3LRHA 1UXSA 4WI0B 4Q9CA 3L4XA 5A16B 2DQGH 5KS9E 3U4EB 1RJLA 3SDYH 5F7FA 5DD5H 3VMOA 1FFTB 1JUFB 2DMKA 4FLSA 4KKLD 4N25A 1B0RA 2BOBA 4I3SH 3QIBC 3QEUA 1SXBA 1WAAF 3SBWC 3KCPB 2OJZL 2ZOKA 3IKCA 4U3XA 3CLEH 5CF3A 1KNOA 3EJQA 3CXDH 4Y16A 2MOGA 3DLQR 2JMRA 4JLRA 1GCFA 5J6GA 4HG4K 5ICZB 1E8XA 1LQSR 2AP2A 4WWKB 4X6DE 3EO9H 4A7GF 3ARFA 1OGAB 5CN1A 1EJOL 2CLRB 2IEPA 4G1EA 3I9GL 3MYJB 1N6VA 4BQBA 4ZFQA 2WLYA 1LK3H 2Y5QA 3ZDZE 3F62A 4R2GD 4U1IA 1PYWB 3HI6H 1M9WA 2ZCLH 2GSIA 5EPMB 3RVWD 3RFZB 3AAZA 1EEQA 1YEKL 3T1WA 4L4TE 1M1XB 5DJDA 3BGAA 2SEBA 1MJUL 5HHPB 2W65A 2IIJA 5DR5H 3MRBB 3N85L 5CKAA 4JPQA 3CC1A 1P6AB 3HZKA 4DUWA 3KJ4C 4X7SH 2OSWA 2XZCL 2LLGA 3L1OH 1YEWA 4BZ1A 3CFKB 4W4OC 4HF5L 2OMXB 2WVVA 1DEEA 1DCLA 1QFPA 3MV7E 1ACZA 3ZE2B 5FV2A 2MCG1 3QORD 3IU3A 3LRSA 4LSVL 5SWZB 3K72A 4R7XA 4K8RL 5C0EA 2P42B 4LCVA 3B2PA 1FORL 3WKQA 3KPQB 4HK3N 5HHOA 5DLMH 5DD1L 1I7RB 1FVCB 1WBYA 1HIML 2AMUA 4G6AC 4JRXD 1WGVA 3UBGA 5JUEL 4JM2A 1YDPA 2VR4A 3V0WH 1CIUA 2ZXGA 4AQ8C 1EZLA 2R2CA 3FMGH 4X0KA 1EHNA 4FQLL 5DK0A 3K80A 3S35H 1CFTB 3U2SB 2OK0H 3V8CA 2F7PA 4PUBH 2PYEE 4XWGL 2GJZB 1E9PA 2Z31B 5E8OB 1MWAA 1LHZA 4ODTH 1LO4L 4PS7A 3H6AA 2OMYA 3ULUD 2NZ9D 1IBGL 3L3GA 3GMOA 1EDYA 4IRSD 4IU3A 2EH7L 4Y2LA 4A7SA 4KI5E 4HV8B 3RNKA 1HDMB 2BHZA 4K5LA 4WGKA 3TCLA 2O4EA 5CLTA 4IRJC 3CQPA 2MQGA 3HMXL 2WBJA 43CAA 4PJEB 3IRZA 3PRZA 3CWGA 2FUTA 3VFTA 3PFQA 4XBPA 5LN4A 3PDOA 1Q94A 1QLFB 4KO6A 4PWKA 4X99A 4JY5H 1BXVA 1AGCB 3V0VA 1RPQA 1KYUA 3X12A 1IZJA 3FFCA 3PAVA 3OB0H 4AE1A 4H1LB 4YDJA 3TFKD 2GVYA 1XDTT 3FQTB 3CDFA 1IMHC 3JWNG 2W9EL 5EO1B 3VJ6A 1RCYA 3KBEA 2B77A 5CZKA 1NCTA 5JIQA 4HAKA 4P2OB 3BI9X 1UZGA 3SGDH 4R26L 1A3LH 1TKWB 4I3RH 3QC6X 4S2SB 5B39G 5AAWA 4KH2A 3UGXA 1NCDH 3O2DA 3ZJAA 4HEMA 1FNFA 1HQRB 2OP4H 5ENWA 3CCHA 3ULUF 2FGWL 1BJMA 1HZHH 4EF3A 1A2YB 1U30A 4MA8H 3WS3B 4IEFB 4UINL 5MEOA 4XVUC 1YJDH 3C60C 2P28B 1TEYA 3GSXA 3R06A 4MRCA 1JN6A 4LQ1A 2MJWA 2UY7A 2VM3A 4CU7A 3APDA 4K94H 2BC4A 2TSAA 3LY6A 3BPNC 1F4YH 3NA4A 4HGWA 1V10A 3LEYL 4TOYH 2OS7A 4ZW8A 3MMEA 1DQIA 2X42A 3OPZH 3QHFH 1IGJB 5JHBA 3MRCB 3F2LA 1GYCA 1UB6B 2EACA 2X9XA 2ADJA 4L37A 1VFBA 5C0DA 2H9GB 2UZYB 5IFAL 3G6JE 5I17A 1LO2L 1T5KA 4UTAL 1Q9WB 3OB0K 1LO0L 4XC3L 5DMKA 1C5BL 5DUJA 3DRTA 5FDWA 1T20A 5I6OA 3QS2A 2V3EA 1M3JA 4DAGL 1JPTL 3IBOA 1DANU 4KY2A 4M5YH 5C0AA 3ILEA 3T0VA 4EI0A 1ANUA 5B1BB 1SBBA 4G8EB 1EPFA 5E7FA 1USQA 3EIFA 3GLEA 5CM1A 4Y9BA 4TMPA 2A7BA 2BK8A 2Q8AH 3QIBB 2VMDA 3QIWD 3VXQB 1IFRA 2F7OA 1F3JA 3U7YH 1AXSB 5DJAB 5AD0B 4JAMB 3D3VA 2VWEC 3MBED 3N41B 3I2CL 3F00A 2EIDA 1DVFD 3FTUA 1I1CA 3D7PA 3RTQC 4M7ZC 4CSPA 5K69A 4OV6F 3ZPDA 2ZKXA 4FFZA 4G59C 5IBTL 3N40P 3QUXD 3MC0A 3PHQB 5C0CD 4NENB 4FQ2H 1AE6H 4F2EA 5D93C 3SDCD 2F5AH 3WEMA 3S3PA 5F9JB 2W92A 2WNWA 3X3FL 4X5WA 4RMBA 4P04A 1O7DC 4JN2A 1G43A 4U6VH 1L6XA 2PLTA 4N0YH 1MCJA 4PJGB 3JUZA 2R1YA 3QULA 1XVSA 1IC1A 3IB4A 1R9FA 1ZVNA 3MX0B 1UA6L 4MMYB 4N2MA 4F7PB 1WZKA 2XACC 5AVQB 3VXSA 5F1OB 2UY6A 4X7TA 5BRZA 2P24A 4JJOA 4O5LH 2HJLA 5GIRB 1ZLDA 5LGHL 2R9HC 1TPXB 4KAQH 4KX9A 5AEAA 5DZPA 2GFBB 2Z7UA 3CFTA 3P0VL 5DJZA 1U8PA 3KLAB 3HUJE 3C6EA 4JZJC 3GBMH 4IOIB 2ZWSA 2WYTA 2J25A 4JMNA 4IBYA 1OSPH 1E5AA 3T6WA 1JV2B 1QAWA 2Z92A 3ZL4H 3QXVA 1P5UA 2A6KA 3QUMH 4GS7C 4Y19A 4TUKL 3FTXA 4PS8A 4JO4H 1D5XB 1AMXA 3ZYIA 3N91A 3IVKB 2VDQH 3ATEA 3Q2NA 2BS9A 4GAGH 2XN9E 1S7UA 2G5RA 5DC0A 4QJ5B 3TO2B 4RGND 1P2CB 1IAIH 5IQ9A 3NFSL 1H3XA 4P2RB 4Z77B 1A9EB 1HT6A 1HHIB 1SMOA 5E6ID 3DJSA 4YO0B 1JZGA 1NC2B 2WC7A 4APQC 3QDGA 2ITFA 4TNFA 4QY8A 1OP3H 1AC0A 3HTLX 1ZS8A 2E7LC 2Z8SA 3O3AB 4NZUH 2FTAA 3CSYB 1U36A 2XDHA 4MAYA 5BJTA 3WSQL 3MROA 4NQXA 4Q4EA 4BWTA 1QSVA 3NCWA 4PRBB 3FPXA 2Z6FA 3MUJA 3OKNA 3ZE0E 5KSAB 3DMMC 5KYUB 1KPVB 2PW1B 1A5FH 4IRJB 4YFLF 4U3CA 5AL8A 1A7QL 3HI1B 4R4NC 5ANME 4YC2B 2IBZY 1YY8B 2EXYD 4WNJA 4C56B 4OCXL 4NDMB 5AW9B 1BBDL 5GGTH 5L2KE 1TO5A 2X6AA 1PFOA 4P5TA 3D5OF 2VL5B 3HE6D 1GTNA 4OCMC 3MRRB 3IAPA 2EDLA 3ME0A 5I1JL 1KFAL 3MRLA 1ETB1 4LPCA 3W0WE 3QZWG 3ABLB 1PGRB 4X6BB 1KB5A 2CJSA 2WP3O 3SEPA 1K8DB 3TNNA 4HCRL 2XG5A 2E8ZA 1RH8A 3IXTA 4JMXA 4GUOA 3D39D 3PP3H 4XVSL 1EDHA 3P54A 5EU6B 4JCLA 4FP8H 4J3OC 4ZSOB 5IMMB 1FSKB 2PW2A 4FZ8H 1NLDL 5EF0A 3Q8EA 3EFOA 1GXEA 1F11A 1MCWM 4ODVH 2X2YA 5D1XC 2XRAL 1WF5A 2AQRA 4WFEE 2XXMB 3P40A 5AW6B 5LGJA 1IQWH 1JPSH 3HKFA 4LLQA 1OP3K 3S2AA 1ZGLP 4LHUA 1UG9A 5ITBH 2APFA 4HX1B 3C60B 1EFQA 1OCWL 3BPCB 3CHPA 2FBJH 3D0LA 2JWYA 3DJRA 3P02A 4LCUA 4KK6C 4PYHA 5E9AA 4TSCH 1HKLL 3TBTA 4AZUA 1KDIA 2FQEA 4QJ3B 3SOBH 5BUGA 5C0JB 1AG6A 1SDDB 1NAMH 1ZSDB 4XN4A 4OUUB 4D9QD 2WHVA 4ETQB 1IM9A 4K3DL 4BHUA 1IGYA 4PS4H 4D0BB 4CRPA 1FO0H 1OK8A 1OLLA 2FJFB 3TEZA 2CXGA 2EZ0D 4QCIA 5IEKB 2BNQA 5KS9A 4QXUL 4J3SA 2OYPA 3APMA 4NOBA 4L1TA 1RJYB 3LNHA 4V33A 3WLWD 5JHLL 4NQDA 2AXHA 1T89A 2VC2L 1QTPA 3QJQB 5B3JE 3B56A 2CBOA 2CXKA 3PWPB 2FX7H 2D7TH 3OQ3B 4MFHA 2NYKA 3P9LB 3KPOA 5C6PB 1FLTX 4OTXL 3GBLA 1PQZA 2OX5A 1FNAA 4QRPD 3PP3K 2NYYC 4PGJA 3VXUD 4LT7A 1NL0H 4ZPVA 1OPGL 3VRIB 1CVSC 2YMXL 2HUHA 1FQ9C 3ULVH 4X6DA 2DKMA 2Q10A 2HX9A 1VFUA 3Q1EA 5D96C 2Y9RT 5C0GA 3UJJL 5CMAB 3QK0A 5BXFA 1TIUA 3LS4L 1HKFA 2CALA 1U2YA 3IGKA 3WN6A 3QB7C 1OM9A 5E8EB 5F72S 3CG8A 1DQDL 3EYFA 4B9JA 5EEVA 3L6FA 1NFKA 1ACCA 1T1ZB 3AADB 3IMUA 4M7ZB 3RTQB 4YHLL 2NNCA 2DQTL 1ZJBA 2YA2A 4P8QA 1PX3A 1BIHA 2ZUSA 4P9MH 3MUUA 4JFTA 3T2OA 2ESVB 4POZC 3DHUA 5D93B 3LDBB 5EMYA 5E8DH 2C4XA 2GJ6E 1L0QA 2CJTA 1AZRA 2JI3A 3AU1B 3GPEA 2YEZA 4ZX5A 1JXJA 5SWQA 5ERWA 4AVIA 5F9WB 3WFZA 3I9PA 1N64H 3MV7A 5ADOL 2A0LD 1KG0A 1N7MH 3RVTD 4PJ9C 2A5UA 4JFYA 2BY3A 2G5BA 3MODL 3VW3L 3Q9QA 3EGSA 2E9GA 3T3MB 1KLFB 4YK4C 3BWZA 4WJ5A 3E3QC 3OKMB 2OV0A 3HR5A 4RFEA 1W8EA 1BCIA 1S7VA 5GISL 3VRLF 3H3KA 4XPHL 2LW3A 1CS6A 2NXYD 3KL5A 2P7TA 4JZJB 5FYKH 5E1AA 2ZP8A 2VRAA 4R96A 2GTZA 3VFPA 1EHAA 3IWUA 2JK5B 1PZCA 3UIZA 5JXEC 1CURA 4GS7B 3V0AC 2XWCA 3II3A 1JFQL 2F19H 2PYEA 3CFEB 3HBPA 3K2UL 1JIBA 1HHGA 2HRPH 3CX5K 1N4XL 3ZZSA 1YEHH 2AF2A 3GMPB 1TF4A 3I75B 1EA9C 5IB1B 4P4KD 1A6WH 4PJ7E 1PSKH 1G87A 2XXCB 3UTQB 4WSGA 1ZT1B 4LVOC 3UJTL 3ZTDC 3B1TA 4W68A 5KW9L 3AT9A 2OJ1A 3QJHA 1BF5A 2EKSA 4HOXA 1S3RA 4NKOB 4XNQA 3EGXB 1OCRB 3C6LA 3Q1SH 5CUSL 2AVGA 2DI9A 4XP5L 5AG8A 1D6VL 5DRNB 1JGIA 5FCSH 2VDKH 3QARA 1FZMB 1R34A 4NRZA 3KPTA 3QRGL 4NUJB 3QW9A 4QJ4B 1KYOJ 2WXOA 4LNRA 3RVVD 4S1RH 3EKCA 1J5CA 1JRHL 1RZJC 3DVNB 4XMLL 4OCYL 1S7RB 4R97C 5HD8C 5EEXA 4NOFA 3LKSB 1T2QL 2K9UA 5C09A 5TDOB 4OLZL 5IB3B 3V7AE 3ULVD 1JPST 5JR1L 3MRFB 3LKQA 4Q6KA 1CICC 4JFUA 4N24A 4WU7B 1IC4H 2X2UA 1N59A 2FR4A 3V5HA 1UM5L 3BUDA 3OKDA 2C1PA 3JT2A 1VGKA 3LQMA 5EBMA 1AKJB 5DZNA 3U7WH 4KXCA 4YN3A 2QQLL 2NR6C 3NSCA 3BP4A 1X4ZA 1O6SA 2JH2A 1JZ2A 3EYSL 1JF5A 3FB8A 4AYGA 1U92A 4XI5C 4ENEC 4GXVL 4X80L 4F9PC 3IEAA 4YHOH 3KNBB 2H6UA 3C12A 1NCAL 4JW3A 3TZVA 4J5VA 4DKAA 1GY2A 1EQWA 4DGVL 5FGCE 3H1ZA 1RZKL 1UZ8A 3E80A 4XCYA 3BT2H 1UCTA 4J3XA 5FFGA 4WHYH 5F8RC 5I8OH 1H8NA 3VXMB 2XYBA 3TO4D 1MQ8A 1QABA 1T5WA 5JIIA 2FSDA 4R84A 1PDKB 4WUUD 4WUKH 2VOTA 1SGKA 3WXVH 3DHJA 3ES6A 4NUPA 2OTUA 3HHMA 3G6JA 1RIHH 3BAIA 1SJEA 1V3JA 3O41A 4FG6D 4RMRA 2BCKB 1R5WA 2NX5E 4RMTA 5FYKD 5GJTH 3ZL1A 2X3AA 1ZGLA 2HFGH 2XWJA 4HUKB 5D6DA 5JHMA 4NO3A 3WTXA 1KXTA 6TAAA 1F58H 2YAPA 3QRBA 3BVTA 4J6IA 2X9YA 4NKQB 1H9VA 1TITA 3QJVB 5LNEA 1HH6B 3G04A 4JFPA 2EDBA 2JIXD 2WGXA 4LEEA 5CJXC 1K4DA 1X4YA 3R7RA 4OQTA 4V1DD 2WJ7A 3FT0A 4BJLA 3DVFA 1U8OB 2FGZA 4RGOL 3F7VA 3GIZL 1AI1L 2IANB 3LNEA 3B9KC 4OBSA 1OY3B 5DRZA 4POUB 2CDFA 4PRPB 3NCJL 1KULA 3WJLC 2ADFH 3QUYC 4YZFE 4N2EA 1CGSL 3L1FA 1PY9A 2BVUA 5D96B 1A7RH 3WTTA 1OOAA 3TJHD 4Z3EA 4G6ML 1SZNA 1YQVH 4QKXB 2F08A 4NM4L 2VMEA 3AS2A 4RFNC 4UU9A 1FDLH 3VMNA 4JPIB 4KKLC 3MJ8B 3LZFH 4GRLD 1H19A 4P3CH 2YMOA 2H8PA 3O45A 1WUNT 2Y7OA 3BAEH 1AD0A 1ACXA 4JREC 4AEHH 2GEQA 2APBA 5D6CB 2UV3A 4BK5C 4ZMTA 3K5RA 1HHHB 2EO7A 4ZZFA 4YGVB 2D9CA 4AM0A 4LSTL 4KJYA 2CK0H 3RX8A 2NZ1A 1VGEL 5CHNB 4NZJA 3WIHH 2VLKE 1KTRL 3MZTA 4MYPA 3RWGA 3UP1A 4HIXH 2H6OA 3HZMA 2J57A 3LQAL 3HUJA 4FQHB 3O6FC 4RWYL 5IJCC 1GZHA 3TA3D 3GDBA 1MFBL 2JKIS 3P77B 4JGNA 3ABKB 1G9NC 5I71C 2YQGA 2ORBH 3RHWK 1E5YA 1RUPH 3EDEA 1XB6A 3L5XL 3GGWA 3LV3A 1H15B 4KTEL 1MY5A 3O4LE 4YK4B 3VWJA 2C1OB 2DWDA 3EUDA 4K7PL 4WK0B 1ZMYA 5AB0A 2EKJA 4JFEE 4HWBA 5I1DA 4PJBB 3MLYL 3GSNA 4PBXA 1JOIA 1N8OE 5BQ7A 3M7FB 2V5RA 2QKIB 1EXUA 3BGMA 4GXUN 5EZLB 5D9SA 5CEYB 1GKOA 4ZAKA 3LQZA 2V2XA 5DJ2A 2BIIA 1U93A 1KJMB 1RZ8A 2N3JA 3ZTCC 4BEIA 2VXVL 3TVMA 2CPUA 2JB5H 2QGCA 3GT6A 5BZDA 2JJWA 3CFNA 5IUCA 1BA9A 1IAKA 1XH1A 3CFCH 1LE5A 2XWXA 2YRZA 3EOBB 4WY7H 2I85A 2NLJA 1S7QB 3JTTA 3SKNA 1F5WA 2FH6A 4XO8A 3B7UX 3D2TA 3PPSA 2ED7A 3SDXF 3SYOA 2EDFA 3X1BA 4PIBA 4XE0A 2D3VA 1A14H 3DTXA 4LVOB 1CL7H 1KV3A 1RZFH 3IM1A 2XZAL 1WAEA 4X6EA 2WXKA 5GRXG 4PJIE 1L6ZA 3KPNA 3LZLA 4L1LA 5ANMA 4PHZA 5BS0E 2W0PA 1OLZA 4EQ2A 1EGJA 2Y22A 2I7OA 2HLEB 1ETA1 1C7TA 5T33L 4AL8C 5L2KA 1ZA6B 5D1ZI 5SWSD 2FX8L 2YAQA 3LEXA 4FQXC 2WO4A 5FA3A 1KWGA 1SQ2N 1JCVA 4CADA 3BSZL 1TMQA 3V0EA 1K85A 3P30L 1NLBL 4HIIA 1QSEB 3W0WA 2HN7A 2PXYD 3PWUB 4OGXL 4U6TA 5D1XE 1XF1A 2ENSA 3NABH 4TNVK 1OTSD 3VH8A 3GLDA 4IRSC 1WFUA 4UT6H 1OT1A 1IB5A 2HT2C 1CC3A 2YO3A 4ANKA 1MFVA 4PJ5D 1G6RA 5B38A 1UWEL 2E4FA 1FNEB 4LL9A 1QUNB 1DVQA 4WO4C 1MCLA 1SOXA 2R0KH 1AZUA 1J1OH 2BVEA 4X83A 3INUH 4HS6B 3CFDA 1A02N 2R0WH 2J88H 5I76A 3WO4B 3N9GL 4HKBA 1ECYA 2ZG1A 3QDJB 3NJVA 1XT5A 4G8IA 4F3FA 5IR1A 3NCFB 3F12A 4NO5A 3CZUB 3WENA 3KCWA 4LRNL 3LH9A 1JZDC 1ZHNB 3GMLB 3RHWF 3WL9A 1KBWA 3HPJA 3WUWA 3ZTJG 2F74A 8FABB 3L54A 3FQ2A 3P4OB 3OHXA 4UDTB 4NWTL 4S1QL 4YHZL 4L3ED 5LNGA 2P45B 3EF7A 1HK6A 1JI1A 3KPSB 3UPRA 2WXRA 5CEZL 1R3IL 3SKOB 1PZ2A 2PWGA 2X4OA 5K9KA 3A21A 4MA1C 2JELH 4HSQA 5FO8B 2DW5A 2QVIA 2PYFA 3E6HA 4UYPA 1RJLB 4PTUA 1QBLH 1CYWA 1MCOH 1XBDA 4Z6AT 4JPWL 5DWUL 4FNUA 4JCMA 1S7WA 1B0RB 2FX9H 3QEUB 3VXOA 2ZOKB 3IKCB 5T5FA 4BWWA 1F4XH 5HI4C 3D4ZA 5I1AB 5EEWA 1J5IA 5ES4B 2F0CA 4G5AA 3WKML 1OAUH 1OL0A 3V6FA 3DETD 4Y16B 4KOBA 2JKWA 2PWHA 5ALCL 4N90E 4JLRB 5BW7C 3EFDH 3V4PB 5DJYA 5J6GB 4XP6H 3GS7A 4F5CE 4X4YA 4LDEB 3VFVA 3G5WA 5GZND 3FQXA 4OCRH 3D69A 1VFOA 4PJXA 5DMGD 2B4CL 2ZIDA 5E0QA 2GPZA 3F7LA 4G1EB 4YFLI 1HN1A 5GS0C 1S6NA 2C9QA 4X6FB 5BVJA 1J5HA 3T8XA 2H0JA 5EO0A 2GJPA 3B9KB 4U1IB 4AZ8A 2YS4A 1IKFH 2GSIB 2VW4A 4NRYA 3WLBB 1YNTA 5F0JB 1E9OA 5E1IA 3IJ8A 5FFOA 3OD3A 5A2IH 1BPVA 1KXQA 3WIFA 1ID2A 3BWAB 1FE8L 2DQIL 3EYQD 4TNVF 5CP3A 2GJ6A 2OLDA 3HZKB 2AC0A 4KRNA 4R4BA 4O9HH 4RFNB 5DFTA 4LEBA 5DQJB 3FT9A 1MCIA 5DEGA 4F91B 5ID0A 2X1QA 2F15A 5EBWA 1ODUA 1X5AA 4G6JL 1MFCL 2X09A 3MUZ1 3U2JA 1DEEB 2WIIA 3GIVA 4MB5A 3TYFA 3ZDYF 3IU3B 3CLFH 1FZOB 3K72B 3QWRA 2VIRA 3RI5F 2CA4A 5C8JB 4GG6F 3JTSA 4G71B 1H3PL 3IDNB 1DJGA 4JFQA 5HGBA 3CDZA 3N0AA 5HHOB 3D4GA 5GSRA 4M5ZH 2G4EA 1WBYB 2CJUH 3DUSA 1P7KA 4NLHA 5AW3B 4NZRH 2LFGA 1WP6A 4GIPD 2Q86A 4JM2B 4QT5B 1YDPB 2MQ3A 3WIIL 4S0HA 1X5FA 4W9GC 5F1NA 4ZX4A 4E9RA 4GRWH 3PWLA 3MRQA 4U1LA 4JVUA 3DX7A 3MTRA 1CMOA 4M3JA 5E1QA 1G9MH 1AANA 5JNYA 4JFHE 1VPOH 1OALA 2IGFL 1E9PB 3HNTL 1YUKB 1MWAB 3QI9D 4PI0A 1PKQB 2X0VA 2WSKA 4MD4A 4F15C 5A2KH 4ZO6A 3L3GB 3CZSA 1LDPL 4GB9A 4JRXE 5GHWL 4OFYD 1Q8MA 3PY9A 5FGRA 4NT6B 4JHZA 2GK2A 1X7QA 3KEHA 4S10A 3QVAA 2VLJD 5B3NA 2WXJA 2EYSA 4OF3A 2Z8VC 2ZCHL 4HKZA 2WBJB 3VXRB 2ZF9A 2LVCA 3OSKA 2IH3B 1CT8B 2W81C 3SCMA 4XBPB 2JCWA 3JWNH 3PDOB 3AB0B 4W9IC 4PD4J 1T2XA 3O6KL 5DEFB 5HJGA 3NZHL 3V52H 4X99B 1B2WH 1YJDC 2CQVA 4A55A 4KO9A 3VAEA 3VCLA 3ULUE 1QA9A 4JDVB 5AWNH 2HAZA 1T4WA 1KCRH 1F4AA 3VI3B 1MVUB 2BSEA 3H54A 4K94C 4LSRL 4BZ2A 5KSBF 3NQKA 2YC1A 3K4ZA 1AO7D 4XXCA 4EUPG 4KJPC 5FYJE 4DP5X 3UERA 1SVCP 3VJ6B 4FXTA 1SMAA 4RAUB 3B83A 4FQXB 4MAUH 2RH0A 1U3HC 5I1KH 1PZSA 3RUGF 3BFQG 3RY5A 1FG2A 4I0KA 4ONGH 4YLBA 2NW3A 3QNXA 4E0RA 1F4WL 2PP7A 1TEGA 1MI5B 4MDRA 5IHUH 2CA3A 2O6CA 1NFIA 2X1XR 1TZ8A 4JQIA 2VDRL 1D5RA 1IEAB 2NNRA 1OCZB 1HE8A 1OXYA 4JJHA 5C6TH 2B08A 1PBYA 3S35X 4NUGL 4ODUB 1JK8A 1S2EA 2FD6H 5GSVA 5MEOB 5I19H 1WICA 4QRRD 5F71A 4YMPA 4MSWB 2H45A 1VSCA 2HT4D 3GSXB 3R06B 1J9RA 5D1QD 4WO4B 5C6WH 3U83A 1U8HA 4JO2L 2Z8RA 1FRGH 1Q0XH 2H2PD 3BE1H 2C7UB 3UAJA 4DHLA 3O6LH 5KTEH 1BVKB 3HE7A 4HGWB 4E9SA 5JOEA 2YXMA 4RNRA 3VYPA 4Y1SA 3ZKXC 1HL5A 4YBHA 5FA4B 2V2TA 3MLRH 3IN2A 3EBHA 4KZDL 1I1AC 4WENB 5I23A 4MX7A 4N8VG 4LSSL 4DQOL 3FH5A 1S78D 4L37B 5ISZE 3O3DA 1I9JL 4LSQL 4ABVA 4PV1C 2YN5A 3RFRA 2I24N 2D0HA 5TF0A 1AIFB 3GSRA 4PJFB 4KQ4H 5FDWB 4URKA 3L4WA 3CN4A 3HNVL 1R75A 4AT6A 4MA1B 4ELMA 4G8FB 2J1ZA 4PBVC 4RAVA 5E94A 2BOCA 3X13A 3ZOAA 4HUWA 4AQEB 5GRUH 1PCSA 2YUVA 4LSUL 5ESVA 3OLDA 3B8SA 1ZPLA 4IRZH 3EYVB 3QPQC 4Z7IA 4OZHF 2K70A 1GIGH 1AZCA 1F3JB 1NCGA 2GC4C 3BD3A 5H37A 1J9CT 2XQYA 5C08E 4UOW1 1QRNE 4LHQB 2HWZH 1SEQL 4XPAH 1Y0LB 1NWOA 2CHZA 1MRDL 1XZ0A 4U6HA 5F6HI 5KYXA 1NEUA 3V55A 3VD3A 5T1KD 4OBRA 2DJUA 4PJHF 5K1NA 4G70B 5IESL 1BQLH 2IV9A 1AVAA 3KPMA 2VXSH 5KJ4A 3IDXL 1CBVL 2JQAA 1PG7H 3MRDA 4JZNA 3RL2B 5I16A 3GSUB 1BOYA 2JKTM 2GI0A 1KBPA 1G1OA 2AK4B 4NHCH 5DS8A 4A7VA 4X5WB 1DVTA 5DLLA 4JN2B 2AITA 2WAHA 3AS0A 5HGDB 4ZX6A 4JL1A 3MA9L 2R1YB 1S7XB 4JKNA 4RZKA 3FBQA 4RRPM 2DQFB 1CXIA 2C9UA 4U0QB 1XAUA 5HDBB 3VXSB 5EOTA 2UY6B 4JDZB 3ETBF 3LD8C 3ZHKA 4GLRI 4O2FA 5BRZB 2AXFA 2P24B 4FXKA 4Z95H 3UG3A 2NXZD 4U1MA 5C0CE 4KK5C 5EUOF 2H7WA 1RMFH 2VLKA 5K1JA 3M17A 5J1TC 4CC0A 1WISA 2MPAH 3H3PL 3KW7A 2E7CA 2NY6D 3FRPB 5F21B 2ZNWA 3N06B 4RMWA 2D7QA 4N0FB 1SY6H 1P5UB 2A6KB 2ZXEB 3UTSD 2BZDA 3KLQA 4XAKE 4PIRF 4JG0L 4JFEA 5IB2A 5ABZA 3I6LD 4H0GA 1I7ZA 1NFAA 1JVOA 2OW6A 3CH8A 3HFFA 4IOSD 4KMTL 4P57A 3VE0A 1SJVA 1JPGA 4A2LA 4LPYA 4I4WA 3CIAA 1E8WA 1G7IB 2VZTA 4HH9A 4GRMA 1S7UB 4IOFD 3DV4A 5IMLB 3MNMA 2VXQL 3W9DA 5MHSD 4XAWL 5GGQH 3VD9A 4GBXC 2A3TA 3GBNH 3FYEB 1RSYA 1WZ1H 5D2NA 4NZTH 3RWEA 3QDGB 1EK3A 4QY8B 3RDTC 3FT2B 4ICWA 4QXGH 5G4MA 1QLEL 2R4RH 3QP3A 4RGMC 2WWMD 3RVTC 1YECH 3QIUD 4O51A 4PJCF 3S3BB 3FB5A 4F15B 3S98A 1HFUA 4NQXB 2VLRD 2L8AA 1XCTB 5EZIL 1CTNA 1IO4C 4RESB 2O61B 4Z7WE 4Z7QF 3KL0A 1CGYA 4FTVD 1NZRA 32C2A 2F5BL 4PJIA 1J88A 5AW4B 4PR5B 2BIOA 3DGCR 4I8DA 4UUJB 1JHKL 1OSZA 2X4NA 3PP4H 2UZXA 3RIFF 4P5TB 4JGJA 4OLWL 2C34A 3WXWL 1A1OA 1PX8A 4FQCL 2BH0A 3H2PA 1VEPA 4B9PA 1VEMA 2HH0H 3MRLB 3P4NB 2ZSVB 3HAEG 1MRCL 5D1XA 4DUVA 5IHBA 1EXHA 3FB7B 2B0SH 3BIBX 2FDBP 4P4KC 1KB5B 3TNNB 2BLFA 5JLZA 1A4CA 4MXWH 2XG5B 4LOUC 1YEIH 4YIQA 3NJLA 3MBXL 3LKOB 1EAPA 1RV6X 1U3HB 4QHKI 3S8GB 5AYUH 5DT1H 2PW2B 5AVUB 4G3YH 1JDCA 1F11B 1SLUA 3QWNA 4XXWC 3QZLA 4PRID 4DEPC 5H4ZA 2VH5H 1TTRA 2CO4A 2IPKB 2LU4A 2OJEA 3X3GH 2V0AA 4ICXA 4Q74A 4RLDA 5LGJB 2QHLA 5K9JH 5F70A 1NANI 2AEQH 1T7ZA 1EBAA 4MCNA 5CD3B 5EN2A 4PCKA 3KLSA 1WAAA 2GITB 3UJIL 3TBTB 5GS1C 2X10A 4LCUB 3UL4A 3DK0A 4KXBA 2NY7H 3ULVC 1JMXA 4AG4H 3BLKA 5CLWA 4IDJH 1KMGA 4UT9L 1ETJA 2N01B 5DD3L 4M1GL 1IM9B 5KZCD 3CNKA 5H35B 1E5ZA 4LO9A 3RJQB 2AEWA 1EFXB 1I8LA 1IGCH 3CFMA 3ZKXB 4BCXA 4OV5B 3FQRB 5KS9B 4A7GA 4YLCA 4Q9RH 1EEYA 2VM9A 4Z3TA 2ZPKL 4HG4J 1UH3A 3FT4A 4M48L 2YAMA 4K7FB 3LKRB 4NP9A 3TC9A 4XN9A 4JHAH 3P0YH 3GMQA 1ORQA 1R3LA 5DMIL 2QV4A 3OKOA 4D9LH 3O3EA 2EE6A 2V37A 3RA7H 2GSMB 3MJ7A 2QQKL 2HJKA 5ESQA 4ETYA 1TTBA 4XMUA 4D3CL 2JFCA 1WFOA 4URTB 4JPVH 4PVNA 1G1KA 3EHBD 2GHZA 4PRHB 5ADPL 4LFHG 5B1KA 4U1HA 4WWPA 1KBKA 2FJSA 1A3RL 1I53A 4XMVA 1FZKA 5AW2B 4N87A 4X6DB 4WJKB 1MRFH 2ARJQ 3KAAA 5IKCB 3FO9B 5C0GB 4A6YH 5BZZA 4AWJC 1X5HA 1FLRL 3ZDZB 1KTDB 5E9DE 5KSUA 4LQFL 2Y5EA 1JRHI 1SHSA 4MQ7B 4ZOAA 2ATKA 4MXQC 2NY1D 4L4TB 1KBVA 4YBLC 1K3ZA 2WBXA 2GY5A 1EJ6A 4A67A 2VZUA 3K7UA 1EHLH 3PLYA 3NIGF 2ALWA 2VERN 1GW6A 1UT9A 3D85D 4EN3C 3B5GA 3L5WA 1RVFL 5JQ6L 3J8F7 4WEBL 5ERWB 2Y2TA 5SWQB 1PLBA 3OKKA 3MREB 3MV7B 1RK0A 3TT1H 1MHCA 1KG0B 5ID1B 1I9RL 4GQRA 4JFYB 2HKAA 2WAQA 4Y4HA 3TNMB 2FWOB 3RAJL 2DBLH 3LD8B 2EADA 4HJ1A 3RGVA 2JVUA 2BVQB 4WJ5B 5C9KA 2AEPL 1JWUB 5KYNA 3DOIA 3HR5B 1DN0B 1GC1L 4FQ1H 4RFEB 1H5BC 5FKAA 1NCWL 2BSDA 2P7TB 4I18C 4AI7A 5IIEA 5E1AB 3KZ8A 3V2AR 2GTZB 4O4YL 3VFPB 5F7UA 4KKZA 2ICEA 3ZSTA 3QORA 2KUTA 2PTVA 1IBZA 3OR7A 1DSYA 1GGTA 4ONOA 4OCWH 4ENZA 4I13B 3FZUD 2NUTA 2OULB 4B9YA 4XCEB 3UZEC 1NOLA 2MIZA 4AMKL 5BMFH 4MBRA 1QMUA 2DYRB 1ZV5A 4GMSH 3MLXL 4JRXA 3O81A 2P5WE 4BH7A 3THML 3IFPB 1CTOA 3IETA 4AIZA 2HTKC 2OM5A 4DVRH 3QJHB 4F2ME 4GFXA 3T0AA 3A47A 3BRDA 3C6LB 4LAQL 3RDTB 2KZBA 1BJ1J 1NGPH 4RGMB 4YHMH 3WTUA 2NDFA 1BM3H 3TA3C 3ZHDA 2GKIA 3Q2VA 1BZ9B 4UQ2B 4N6QA 2WN2A 4XOBA 1KJ2H 4G6KH 1ILUA 2BNRE 2ZUWA 1SQMA 3L9EA 2IG2L 3GSQB 4XVOA 2FO4A 3DX0A 4UNTA 4KFMA 2L7EA 3ZMEA 5LXGL 4PJDE 4WWNA 5FECA 1WTGT 2EEBA 2OMUA 4ATTA 3T4AA 2XXFA 2Z1PA 2R2BA 4W9CC 4JS7A 2AJVL 3FU0A 4KTYA 4YPJA 4ORZC 3OMIB 2F68X 4OLEA 3BKCH 1N59B 4FABL 3V5HB 2RQEA 1W91A 2K7PA 3IJ7A 2C1PB 5JQHC 1F02I 1VGKB 4ZUSB 4HS3A 5HGAB 5EBMB 2CBTA 3DO7B 3A6OA 5LBSH 4TRPL 4LMQI 1UFGA 2TSBA 3CK0L 1FIGH 1FL5B 3B1UA 4U6XA 4H1LG 4LKCB 2NY0D 2TRHA 3FTWA 3W3BA 4H8PA 2ODHA 1LK2B 4EZJA 3LPPA 4OLUH 3KLKA 2BOLA 4CSTA 2WQVA 4WTZA 1WFNA 1O6SB 2Q3AA 3NA9H 3FB8B 5D7SH 1ADWA 2OMZA 4X9YA 5FPIA 1KIQB 1U92B 3PHOB 1CU4H 1QPKA 5I5MA 5FO7B 3PF2A 4KNUA 4NM8H 3OAWA 1UD6A 5T3ZH 3JWDH 4ZD3L 3SO5A 3TZVB 5BV7H 1AGEA 3RPKA 2C4FT 4DEPB 3U46B 2CKBL 2VXUH 25C8H 1SOKA 3DSNB 3F7YA 1WPCA 1T5WB 1PZ5A 4U7KA 4EIUA 1IM3D 4N2NA 3IDUA 5F7DA 4NX0A