2IOIA

Crystal structure of the mouse p53 core domain at 1.55 a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
QKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cellular tumor antigen p53
publication title High-resolution structure of the p53 core domain: implications for binding small-molecule stabilizing compounds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, antitumor protein
total genus 40
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ioiA00
3Q05A 1CO1A 4G83A 4MZRA 2IOMA 2BINA 3EXJA 2MEJB 3EXLA 4L18A 1HU8A 1EAQA 5LGYA 3VD2A 1EANA 3D06A 4QO1B 2BIMA 2ADYA 4IBWA 4IBTA 4L0YA 2H1LM 4AGLA 4IBQA 2BIPA 5AOLA 5G4OA 5LAPA 1TSRA 3D05A 2X0WA 4KVPA 2XWRA 4GUQA 1IO4C 3IGKA 2IOIA 5A7BA 4IJTA 2VUKA 2X0VA 4AGMA 2J6WA 2BIOA 4LOFA 4AGOA 3US1A 1UOLA 3WTXA 1H9DA 5ECGA 5AOJA 2X0UA 1YCSA 2FEJA 3Q01A 5AOKA 4XR8C 3WTYA 3WU1A 2J1XA 3VD0A 3QYNA 1EAOA 2YBGA 3D0AA 3VD1A 1T4WA 5BUAA 4AGQA 1HJCA 3WTSA 1GZHA 2OCJA 1E50A 2GEQA 3Q06A 3TS8A 3WTUA 4LO9A 2BIQA 3D08A 2J21A 4AGPA 4LOEA 3WTVA 4GUOA 5AOIA 1LJMA 3KMDA 5AB9A 2RMNA 4A63A 2J1YA 3D07A 3WTWA 3KZ8A 3D09A 3US0A 2J1ZA 4HJEA 2IOOA 4AGNA 2J1WA 2J20A 4IBVA 1KZYA 3ZMEA 3IGLA 3WTTA 1GZHC 2ATAA 1HJBC 2WGXA 2XWCA 2P52A 5AOMA 1TUPA 5G4MA 5G4NA 4IBSA 4L0ZA 2AHIA 4IBZA 5KBDA 4IBUA 2PCXA 1CMOA 4MZIA 2AC0A 5ABAA 3QYMA 4IBYA 4G82A
chains in the Genus database with same CATH superfamily
1NBVH 5G5DB 4Q9QH 1GKEA 4LU5L 5JA8B 3G9AB 3E9UA 4YDZA 1CK0L 3HMXH 1IAIL 2QBWA 5BPPA 1E4HA 3EOBA 3MA9L 5H2BA 3TLRA 4XAKE 5JNYA 4OLVH 4WUKH 4ODWB 5DZNA 1JG9A 2O6CA 4FMKA 3PXJA 2RD0A 4YDJB 3HE6B 4QHLB 2BVQA 3WNKA 4BIKA 3KPQB 1P7HL 3EGSB 3DURB 5ESAA 2NTSP 5I82A 1UZ6E 1WAAF 3H9SE 3MUGB 1CU4H 1BFOA 1CTOA 3D85B 5AW5B 5IBLD 4H25A 4XMPH 1F4YL 2EDXA 2J6WA 4E68A 3EOAB 3FJTA 3COOA 1JHLL 5JZ7C 3K4AA 1W8OA 2X0UA 3LDBB 1G7PA 1A9BA 2FX9L 3X1NA 5EBGA 5KSBE 2VW4A 4OZFG 4PBVC 4OJYA 5D7IB 3MRCB 1J9SA 3U0TA 4JHWH 3H2PA 1PZDA 5LN8A 2AEOA 1FO0H 4PJIE 1DVUA 2WP3O 5LUMA 4AGQA 3ULSB 4WHTB 5I8KH 5JHAA 1YEDB 4KKLC 1KULA 3LKSA 3FCBA 5T5NG 3CZKA 1DVYA 1FFOA 4JFED 2XQBH 5FKAB 4J8QA 3HG2A 1A5FL 4A2HA 1EIBA 2D4DA 1YUHA 4ZQKA 3OAWA 3F7LA 2AKRA 1JFQL 3F3HA 4PJGE 1JZ6A 3MYJA 4UQ9A 2W92A 1D2PA 1KV7A 2VXQH 4HUXB 5F1IB 1GH7A 4R7NA 3EJZD 3PWVB 3WDJA 4F27A 1UZ6F 1BM7A 5F3HB 2X1PA 1Q0YL 2UZIL 4AK2A 3F6IA 2EACA 3GI9L 2F5BH 5FK9A 1XF4B 4QOKE 1HINH 5AD0A 2BNQE 3IAPA 5TF0A 1RMFH 1YY9C 3AUVA 1X5FA 3MRQA 4NRXB 3DX9A 3A4EA 4AL8C 1T03H 5KSBF 1TZHA 4JM4L 4KPHH 3QS3A 4P23B 5DK2A 4GUPA 2KMWA 1BQHA 1F2XK 1ZPUA 3PDDA 5FWRA 4DQOL 4XMXA 2EVFA 2EDWA 3MRIB 4ZS6D 1UM4H 2CDGB 3KVQA 4LP8A 3H9SB 3MV7D 4PJIF 1ANUA 5IJDC 3ISWA 3JSSA 2IPKB 4ZS7L 1CDCA 5HYIA 4G82A 2CA3A 1GC1H 3DETC 5BS0E 1MFCL 1OTSD 1AQHA 5DUPH 1VADA 4U0RB 1AZVA 4KNTA 5LGYA 4XGZB 1XF3B 4ODBD 5KSBB 1EJFA 3VFMA 2X6MA 1QSEA 1RZKH 2IAND 4RA3A 1U8PA 4ZPVA 4PJGF 4BXVA 2O5YL 3ZYJA 3L3IB 2AV1A 5FR3A 1QFWL 4PJIB 5TDNB 1MCCA 3QQDA 4N5ED 3K2UH 1F00I 4GUQA 1BZOA 2P49B 4OLUL 3SKMA 3MROB 1L9MA 2F1BA 4MAUH 4H1LA 4YWGL 1BJ1J 3NQKA 2E59A 5EWIL 2X70B 2E9GA 3K7UA 4P06A 3O3AB 3T3PE 4Y0GA 2XI9A 4Q0XH 1PSKL 4PWEA 5DVLA 4OZGF 1ZV5A 4PJGB 2ZCHH 1GW6A 3WMSA 3NJNA 3MBED 4KJYB 4OCYL 1CLYH 3L4YA 3UGEA 3NOIA 5GIRB 3RL1B 2YN5A 4AQAA 3KYMA 2R4RL 1P84K 2CJUL 2KQMA 4GIAA 5DJZA 1SFHA 4QOKB 4BDVB 4DGUA 1JZ7A 1JF1A 1LO0H 4EVNB 4GW5A 2YK1L 3LSOB 3BVUA 4D8PB 2B3RA 3V52H 1HL8A 5E2WL 3GBML 3QUGA 3QPQC 2AI0H 1RUAL 4RZKA 1JWSA 4FQQB 1E9PB 1IT9L 5E8DL 2EEDA 3POHA 3KLQA 3QJOA 2LGNA 3CMOH 4OJFL 3F64A 4HFWA 1OW0C 1KCWA 3PGFL 4KVNL 5IFAH 1V8HA 3GIZL 1EVUA 5IB2A 1ZHNB 1BM3H 5CS7A 5DEGA 2YHGA 5I1GH 5E95B 3VRIB 3L5WB 5MI0C 4JKLA 1FVCA 1SM3H 3FRUB 3UAEA 5JYLA 3AQZA 3TBCA 4HOMA 4DPCX 5BS0B 1TZ8A 1VFBB 4C4KT 1M6OA 5E1GA 3T3PF 4E5XA 4S2SB 3CVDA 2P48B 5FYJU 4ELKB 2HG5B 2F53A 4LLVB 2DTMH 1FL5A 2Z8VC 4QXVA 3CDZA 2HTKC 3BO8B 4TVSa 4EN3B 4Z5RB 3TURA 2KZKA 1RK1A 3QUMB 2OXHB 1MCDA 3DUUA 3WKQA 3W9DB 2EDYA 1M7IA 3WS6A 5FM8A 1J1OL 3DIDA 3FH5A 2GFBB 2FLRT 4M48L 4PJ5D 3SE8H 3VACA 2CPUA 4XMLH 5BUGA 2CK0L 3QJFB 5D7LD 1JD7A 4RBPH 3H9ZA 5IF0B 3T3PB 5IHHA 5CZVH 4GLRH 5EPMB 1IZKA 1HI6B 2AQRA 4LEEA 2E6QA 2ZXAA 3RWFA 5JW4N 2NY5H 1JTOA 5EU5A 3AM8C 2XN9D 2HSIA 3AM8A 2WOBA 4Y4HD 4JG0H 2NX5E 4Q9RH 4AYFA 1EFQA 2MPAH 4FYQA 4EPSA 5LBSH 1U95B 3HNVH 4P57B 2GEEA 4MSWA 4RRPM 4AGLA 3VUAA 5MEPB 1X5XA 1I9JH 4LSVL 4PJFE 4PGCB 2N4IA 3CIQA 4U1IA 3QG6A 3GWJA 4P49A 1MJ7H 2AJVH 2WV3A 2SODB 4TULH 3DHMA 2H41A 1SBBA 1K3ZA 2X38A 4WHDA 1Z0MA 5GS2H 1ACXA 3B2UD 2GI7A 5I6LA 1ZTXH 5HYFA 4UM9A 2B08A 5E6YA 3LTVA 1K6QL 3PWJA 1KPRA 3BHBA 5C1MB 5FECB 2ITCB 5D2NE 4M7JH 3KGSA 5ID0A 4X99B 5BO1H 3X11B 1PKQA 1LYQA 3RNQB 5IW6B 3D0VB 4HDIB 3FRPG 4U3XA 4DEPB 2WVUA 1JE6A 4KHTH 5FYLH 3BH9A 2G75B 5EEYA 5CIPB 5DQ9B 2A6DA 5LCVH 5K93A 4Z77A 5C8JA 3TEZA 2AZUA 1IAIM 3QXAB 3UBXB 4APQB 2FHCA 1K8DB 2VB5A 3EAKA 3GMOB 3LNDA 3PHSA 4OQTH 3QO1B 5E5MB 2IPTL 4XCNA 2Y07L 4JFEA 5LAXB 4DESA 4XODA 2BHZA 5I6XB 2W07A 5K9OB 4XWGL 4TUUA 1LK3L 5CZXC 4DN3H 2DLHA 1NAMA 1NEZA 1FH5H 5JHLA 4XX5A 5KVFH 1RZ7H 4PJAE 4PJFF 4YHKL 3AY4C 4JAMB 4LCCC 3KDPB 2QPDB 4P0DA 2Q86B 4JJHA 4KK9D 1EEUA 2P8MB 32C2B 1X7QA 1T7WA 3VFGH 1FFNA 3I3EA 3VXOA 4D9RE 5I0WA 5H37A 1RP8A 3K0WA 2EUWA 1Z3RA 3CN2A 1NDGB 1JZIA 3U1SH 5T3ZL 1WD8A 5CLYA 4GAYA 6TAAA 1RURL 1MLCB 3N42B 4HIHA 4PJFB 1GZQB 4QHUB 3CH1B 4QYOA 3TNMA 4YR6B 5DLLA 1YEHL 1KJ2L 5DT1H 3P4MA 1GIGL 1HOCA 3MV7A 3CJJA 5J6HB 2PXYD 2GY5A 3OLGA 3VWJD 3ZSTA 3FT4B 2ARJA 1A2YA 2ISDA 3IEAA 1EZLA 4LVOC 4DP5X 2YGNA 4C4BA 2AEQH 2IDUA 1I3VA 1I8MB 4ZXBB 3L3DB 5I1AB 4FZ8L 4MD0A 4OSUH 5KVEH 1RKRA 4N0FA 3QQNA 3OPZL 4GQZA 5D2NB 1F4WH 4EI5C 3K6FA 1AQ8A 4KJWC 5IGXL 2H1XA 5I76A 5CINH 2YR3A 3DOSA 4BA8A 2AANA 2BZDA 3LKOA 5D7JC 4PJAF 4P59H 1J0IA 1U93B 1BYPA 35C8H 3CHPA 4G6FD 1DN0B 1IL1B 4B96A 3DIVA 8FABA 5I5JA 1QASA 3CSBA 3SQRA 5L88L 4PPTA 4WTZG 1DP0A 4AJ0A 2NR6C 4XOEA 2X7LA 4A6YB 4FKEA 4HCRL 4ZTOH 2ZXGA 3VVWA 1QTSA 3MLSL 4YDIH 5GGSY 5ALBL 3KJ4B 3TNNB 2NCMA 5E8NB 4I13B 5AAMC 5DGQA 4HF5H 4A55A 4H40A 4PJAB 1EZUA 1OSEA 5KVGH 4XMKL 4ZMZA 2P8LB 2YAQA 4P4RB 4Y4FD 5FYKL 2X9ZA 3BIAX 4LBEB 1YAIA 3EO9L 4M3KB 1UGNA 2RBLA 4NQDD 5J13B 1I9IL 4IRJC 5GGVY 3GD1C 4IRJA 2O30A 3IFLH 3ZIMA 3ILPA 1FAIH 3HUJA 1HJCA 4M03A 5FFLA 4AZ8A 4GAAA 5JLZB 1CGWA 1NANH 2DMKA 4YXKH 4I85A 5EU7E 4AENB 2AS5M 1QFWM 2I9LB 5CCJA 4G1EB 1F58L 3KBHE 4QXTA 3MLTA 1Z3GH 3EYUH 1EUUA 4L8BB 5C09E 4FJ6A 4U6XB 1W8EA 4H4NA 1RJCA 4XE5B 4JMXA 3H0TA 3MR9A 2YGVA 1QPKA 3EZJB 1MCSA 1A0QH 3L08A 5IVNA 1NKRA 4HPOH 4LPCA 5KSAD 4ODTL 4BK8A 3FQXB 1NLBL 2G4EA 2YAMA 4FG2A 3OB8A 3VXTB 1IKNC 3KLHC 3F05A 4R96B 4YHIA 3UG4A 1IAMA 1NCUA 3SN6N 1E5ZA 1AYOA 2Y06H 2I85A 1MUJB 1ZJBA 2CNZA 5A3ID 1FSKC 5JXED 3ZHLA 1QSZA 5EOTA 2FO8A 5TPWH 1MHCA 3LH2H 1I1YB 2A77L 2DKMA 5KN5A 2WO3B 1C1EL 4XAWH 1E8YA 2NY3D 2ARWA 5C86A 3HE6D 1JYXA 4B9FA 1KN2L 2H32H 3CNKA 3MV9A 2NY2D 1OL0A 4NIKB 3S36L 3WKNA 4PLNC 1CN4A 3ZQWA 1CE1H 3N6YA 5I2IA 2YMXH 3BUIA 3UAJC 1DVFA 1AO7E 2ADGB 2GITA 43CAA 1IGJA 2EINB 4PSPA 2XN9A 1BG1A 2ZYRA 1NUFA 4CC4C 2UXTA 5GGVH 1PAZA 2CRYA 4CC4A 1U4FA 1D9KC 4NQEE 3ZK0A 2OTUA 4LE8A 4QO1B 3ZTNH 2G3ZA 3MHZA 4KKCC 4YXLL 4LSTH 3H8NA 1AZUA 1FFPA 1U3HC 1XF5B 4QRSA 5ENWA 1T0NB 3RG1C 1EGJH 1O7DE 1XCXA 1IAOA 2G2PA 2B5IC 1JOIA 4YQXH 2F19L 2VDNL 2E47A 1WWCA 1MHPL 5CZKA 4N2IA 3N0AA 4IHOB 3T0DA 1FRGL 2P9RA 1M9WA 2EDMA 2EH8H 2H6OA 3T65B 5IFHH 5GRVL 1ED3A 5C09B 1CL7H 2GT9B 1J8HD 2BP0A 1Q8MA 1F0LA 3ARQA 3PWPD 4GRLC 5CJOL 4GRLA 3HKZA 1DBKH 3BPOC 2D0GA 4YMPA 5H94B 4M7LL 4P04A 3QNXB 2QGCA 4H5SA 3CU1A 4ZO6A 3MBWA 1RUPH 2Q2EB 2BERA 3RNKA 2LE9A 1E4JA 2Q8BL 1ZOXA 3REVB 4LK4A 3WNLA 2XWBB 5EN3A 3F7PC 4DAGL 4BHUA 4R4FL 5B3SB 2WAHA 2DWEB 2HKHL 1YYCA 2APWA 4YSTA 2WP3T 5IQMA 1QEWB 4R2GB 2YGOA 4GP8B 4I77L 4M62L 5DURB 4B9YA 4Y5XB 2Q8AH 3RHWF 4XAKD 5DVPA 4Y4KB 3MCG1 3WIHL 3QZBA 4HW6A 3SGDH 1J1PL 2EECA 4KQ3L 1UXMA 1X5JA 1ZS8A 3W37A 1RHHA 3MRRA 4HUNB 1T7XA 4A7QA 1AO7B 3G6AA 3P77A 3QJSB 1F45A 2IWGA 2BY1A 1F4HA 1WLHA 1LO4H 2GB2A 3ZHFA 2CLZB 3NZSA 2OI9B 2XTSA 1FL6A 4NSKA 1N67A 1FPTL 1WT5C 4NQEB 3CZFA 1EFXB 4PJBF 1WT5A 2ZUUA 1CTNA 2EDHA 4P5KB 3WMQA 2AK1L 3WUZA 3V4UH 1YN6A 4TNWK 3LKQB 1B2WH 3A23A 2HFEB 4F5CE 4PGZA 1E4KC 3UPRA 5E1QA 4ZFZA 2B2XH 3C08H 2O6PA 2PXYA 4K3JH 5AVUB 1Z5LA 2C1OB 2IADA 2AXJA 3VWJA 5HVHC 4QXUH 3LKRA 3C87A 4ATTA 1P4IH 3GXNA 3Q8BA 4PJHE 3DX3A 1JPSL 1XGPA 4MAZA 2FX7H 3HNTL 2N7AA 4H8QA 4HEME 1S7QB 3NACH 1P5UA 4K8RH 4KH9A 3S4SA 2W0FB 2D7NA 4XP9H 5EEVA 1BFVH 1XFPA 2PKDA 2BP3A 2VLMD 3IDXL 3LZFL 4Z9KB 5FDWB 1R5VA 3ARDA 3ARVA 2ZUWA 1UHVA 1OAYL 2XG4B 1ZDSA 3RU8L 4P2QD 2BXYA 4R83A 5T3ZE 2EO1A 3NJFA 5E0FA 3JT0A 4FFYH 1RFDL 2A6KB 2K4AA 4XH2A 5GS1B 2R2HA 4FI7A 4Q9BA 2LAAA 2EIZA 4KFZC 2GSIB 5KOVC 1GOFA 3FTWA 5DVKA 2BNQD 2Z6FA 3RVVD 1JHTA 1A4BA 3CZGA 4GKNA 4K5PA 1GGIH 1XMWA 2CWRA 2WN3A 1INEL 3BIBX 5D71L 3DBSA 4I1PA 3J27A 4NXSA 3DUSA 4UDUA 3D4CA 4K3GA 4LAJH 3BWAB 1FCCA 2KPWA 2R15A 5AKTA 1YNTA 2VLRE 1ZHLA 2JCCF 4NQDA 3BW9B 2YD0A 5JMOC 2YRLA 2YD7A 1LNUB 4E9RA 4HK3N 3NSCA 4PJHF 1OP5H 5BS0D 3OXRA 4EDXA 5CJ5A 4KUZL 3VYNA 5ICXA 3QHTC 1RULL 1BQ5A 4IGBC 4XCCL 5DI8B 1GKOA 1BVKA 4K94C 4U1HB 1AHWC 3MODH 3OQ3B 2AEWA 4GXFA 4XN4A 3S8FB 1ZEAH 1H19A 3WNIA 5LNGA 1B9ZA 4EN3D 4UT9A 3BAIA 1C5DA 3VSTA 3WN5B 3NZHH 4EXPX 1EJ6A 4AT6A 1D6EB 1P6WA 3W3BA 2EC9T 3AG4B 4PJHB 4FYRA 3TA3B 15C8H 1B4JH 1MSPA 4NO3A 3FUMA 3P3TA 3O2DA 4I2XE 5D72H 4C4UA 3EFDH 2CXGA 5FYKE 4DGYH 1TO4A 4V11A 4HHAB 3M17A 4FDWA 4QRRD 4XPFL 2PYEE 1BF5A 5G5DA 1J9CT 1KIUB 1HJBC 1RXLA 1SFDA 2BSSB 4FNLL 2Z4QB 1VZIA 3ZGHA 5JXEA 3MV8E 1UCBL 3ZTDC 2H2SC 1NCGA 2CG9X 4OJEH 3GQFA 5TFSL 1FJ1A 3N2JA 4PJCE 2QMKA 5LBVA 4ODWA 3AXLB 4ZMVA 3BPNB 1UH3A 2XJKA 3SPVB 4YDJA 3HE6A 4QHLA 5CP7B 3KPQA 1KJ2B 4FTDA 5IM7B 2XETA 3DURA 1F6FB 2OZ4H 3MUGA 2IAMB 2AERT 3EADA 1CO1A 3D85A 3NT0A 2NZIA 3HG5A 3X14B 4DP8X 4FQ1L 4N6RB 4S1SH 2NUTB 4LEBA 3U7WH 1KXVA 2GJ6E 3EOAA 1NL0L 5EC1B 1GXEA 4UU9A 5LXGH 1PEWA 2PO6B 1AKJD 1RY7B 1G7MB 3MOAL 4PGDA 4HS6B 4FFZL 5TQ0L 4RLDA 2FATH 3R7QA 3VX1A 2VLRB 4OTXL 4XP6L 2X4RB 4LCWE 1ICTA 4JDTH 3KCWA 4NC1C 3MKGA 3X1GA 3H4FA 4NO0B 2X53A 2DRUA 3HTLX 3MRCA 2A6JB 4P9HH 2E7LA 1BBDH 4IRZA 1WSST 3T4YB 2OSLA 5IB4B 1WAAA 3RVTD 1NICA 1VACB 4KZDH 2VC2L 2YLKA 4FE9A 5LGHL 4NWTL 3D9AL 3ULSA 4MNHB 4A67A 1YEDA 2RQEA 2HT4C 3BE1H 2OL3H 1EXUB 3FT0A 2C9RA 3FW6A 4PI2A 3N1GC 4L0PB 4LSQH 3RL2B 1LEKA 5FKAA 4F8OA 5BVJA 2V5YA 2VKWA 2CUAA 3G5XB 4BCZA 4F57H 2EZ0D 5AYUH 1G9NL 4S1DC 1QUPA 4NQUA 1CC3A 4L1BA 4PJCF 1UTDA 1F6AB 4I2XB 4X7SH 5AKVA 1QVOB 4G6JL 1NIEA 3KPPB 1MPAH 4HUXA 2MOQA 1YRKA 3PAVA 2ZX5A 1NCDH 4K5NA 4N9OB 4R5TA 5F1IA 2A5UA 3PWVA 3CFDA 2PYEB 5D7SL 2YMTA 4MB1A 1R46A 5F3HA 4R4BB 4ODXB 1A1OB 7TAAA 3DV6B 4JY6B 2E7CA 3BX7C 4UT7H 1A7OH 4JG1L 1XF4A 1HWWA 1QFPA 3G5WA 2NX5D 5KG9B 4QHMB 4OFYD 1TO5A 1PZBA 4JL2A 4PJCB 3WLWC 2ID5A 1GZPB 1BREA 4P23A 5B7EA 2E3VA 1FLRL 1WRFA 3G5ZB 5L7XH 4RMRA 3FQUA 2H4EA 3BEWA 2XWXA 4FFVD 2CDGA 3BJLA 3IMVA 4Q2ZB 3H9SA 3QRGH 3GRGA 2BP5M 4MDRA 1YC8A 3DK0A 3RILA 2IPKA 2DQEL 2EEAA 2GJ6B 4OD3L 2VR7A 1U3ZA 3TEXA 4AI7A 3GI8L 4M8UA 3N44F 3UC2A 2WTOA 4OCWL 1MIEL 4WSJA 1RJZB 4PP1D 1E65A 4LCWB 4XGZA 1XBRA 1XF3A 4OF0A 4EIUA 1XIWD 5KSBA 5LXVA 3JYBA 4LSSH 4PB9H 2XV3A 3REWB 1L7IH 4LVHB 2ZXBA 2VT0A 1P1VA 4PJEE 1IC7H 2V17L 4PJIA 2WBJB 5TDNA 4P3DB 5TE6H 3ARBD 5I75B 1V55B 2BWIA 1TU2B 1ZTMA 4Y5YB 1EEYB 3LAFA 3MROA 3O6FC 2FJHA 4GBXC 3N44B 2JCWA 3S7GA 1TITA 4L4TD 3V7MA 2X70A 5CGYD 4HJIA 5HHNB 1WFMA 1ZVYA 3O3AA 4WHYH 2V9RA 1W0YT 2VQ1B 3V0EA 4NXKA 1FZOA 3VMPA 2DD8L 2XKNB 4ABWA 4PJGA 3HLAB 9CGTA 3M45A 4KJYA 4ZG1A 3GJFB 1MELA 3RL1A 5GIRA 3ATDA 4PGBA 2EYRB 4D9RD 2NSXA 3KPMB 2IH8A 1BAGA 1BVLB 2ZXEB 3CVBA 3CSGA 4HFUH 3VFNB 1KDIA 4QOKA 4N0CC 4XX1G 1TTGA 3V7AG 4BDVA 5BV7C 2BNQA 1QTPA 4OT1L 4EVNA 5GZOA 3LSOA 3FUJA 4D8PA 3C60D 1RHFA 5HYQB 2H3KA 4XCYB 4KO7A 2WKLA 3HJEA 5SX5K 4FQQA 1E9PA 1HQ4B 3KLLA 1N4XH 1DYZA 3QDAA 4PJEF 3QXDA 3QWOB 2Z31B 4FHKA 1ZHNA 1UQSB 1EAJA 2BY0A 5HGHB 3ZUNC 4UV4L 3OPUA 3L5WA 2EXTA 3VRIA 2YBGA 5MERB 5E2JA 3FB8B 1A4KA 3DHJA 4PJ8D 5BS0A 1VFBA 2NY6C 4FAAB 4ZUUB 2XA8H 5T1JA 2LVEA 5I24A 1A9EB 2G5RA 5TDPB 4EQ2A 1UKTA 4S2SA 1Q9OA 1B0RB 3LVEA 3I50H 4LLVA 3DOIA 1PD0A 4LARL 4I1NB 1S9VB 3V4PL 4N1HB 1Q4NX 4YFDB 5L2KE 3IKCB 4NQCE 1WTGT 3BO8A 3MBXL 4PJEB 1EO8H 5AYTA 4Z5RA 4EN3A 5HI4D 4U33A 3DVNB 3QUMA 2OXHA 3DO3A 3IMUA 3L4TA 3W9DA 4DIXA 7FABH 2BS71 1N70A 5J12B 2DF3A 2F58H 3QNZA 4JN1L 4F2EA 5J89A 2MCAA 1DLFL 2OYPA 2J1WA 3GSNL 3QJFA 2C9VA 1AC6A 2QQLL 5IF0A 4FN0A 4XNXL 5EPMA 1HI6A 1UYWL 2HLAB 4L05A 4YLQT 5F3FA 1AD9B 5B1JA 3QQ3B 1YO4A 3L8QA 1PW3A 3OAYK 4N9GB 3D25B 3ETSA 4APXB 3MRDB 2AJ3B 1MWAH 3FS9A 1U95A 4P57A 5GJSL 1M7DA 4LHQB 4OJCA 3HZYB 3RWCB 5MEPA 4CSSA 3NIGE 4JO1L 5JIKA 5E94B 1WFUA 1F56A 3BYTA 3CX2A 3QE5A 5FCUH 5IJCC 5HHOD 2WUCL 2CO2A 1OSYA 3QC6X 4LOVA 3UTTE 4JO5A 1IIIA 5C0AB 4R5XA 2ICWA 1UOVA 1QA9B 4M61B 1NH6A 4RMWA 4IDJL 4NHCH 1AKJA 2ILLA 3RIAK 1B6DA 4JFXB 3I9AA 5FECA 2ITCA 2HRPH 3JVFC 4ZBJA 2QQNH 3C5ZB 4HG4K 4X99A 1YJDL 3X11A 3RNQA 1XZ0B 2X10A 3D0VA 4HDIA 2JQZA 4OLYL 4YBQD 5IW6A 3MA7B 1GW0A 2G75A 5F1NB 5CIPA 5DQ9A 5IEHB 1NFIB 2VWEE 5E6IB 4BQBA 4WNQB 4AG4L 2HVJB 4KITB 3QXAA 5IOPB 1F42A 5E7BA 2R59A 4U05A 4APQC 3MRFB 4KKQA 3UBXA 5GS0H 2JKIS 4N5UA 2X0VA 4APQA 1XGYH 2VJXA 3GMOA 4NP9A 4NQCB 1ODUA 2DMBA 3QO1A 5E5MA 1BZ9B 5LAXA 3ZMRA 4U6YB 5DD1H 5DJ2A 5KTEL 5K9OA 1CDBA 4S11A 5T33H 4S1QL 2FVNA 3LQAH 5DURD 5FA4B 3PAUA 3UADA 4P9ML 3RGBA 4TTGA 1YEEH 2WWMC 2QDWA 3U2SB 1RD6A 2ZKYA 3P73B 4PRBB 3QNYB 1SF5A 3NIGF 4JAMA 5DFVC 4FQJL 1QATA 2Q86A 3BAEL 3PWLB 2Y25A 4TNFA 1U2YA 2P8MA 32C2A 4MASA 3CTTA 1UA6H 5BUAA 1R4XA 3CSPA 4OM1L 3OLDA 3FAXA 3IXTB 5F72S 4QRBA 3L3HB 4S1RH 1UWEL 1OD9A 2NY1D 4OF6A 5DC2A 5TE4H 4D8OA 2AEIT 5FB8A 5K59E 1QPXA 3I2CL 4M1DL 1NDGA 2NX5A 3DECA 1UWXK 4PWIA 4RRPA 5E08L 2X44D 3MJ9L 2B1HH 4PRHE 1FGNL 1P84J 2NQ3A 4AMWA 3LS5L 1B3JA 3JV0A 1G7HB 2HLEB 3AXHA 4F33B 2Y6SD 2VDRH 3ESMA 1MLCA 1FVDB 4PJFA 1GZQA 3G3LA 3NIGB 3CH1A 3FCTB 4N8CL 4QHUA 4YR6A 1LWJA 1TETH 3QQXA 3GSWB 2ZOKB 4G8AC 4KC3B 3DYPA 1ZHKB 2WNWA 3UTTB 3V6ZB 3ZL2A 5IP4A 1Y6MR 4BKTC 3RX9A 5EA0L 1NCWL 3IGLA 4ZXBC 4DKDC 1IFHH 1I8MA 3L3DA 5I1AA 4NKDB 5D2NC 1FG9C 2C3HA 3INUL 1M6UA 1WH0A 4LPXA 4JO4H 5D2NA 3WFEL 4QRPD 4FABL 1I8IB 3HPLB 1ERNA 4NJ9L 4OU3A 1TJGH 4MWFB 3MNZB 4MYWB 4FI8A 3E1ZA 4E9YA 4G9FD 4PBWD 5FX3A 3SBRA 4KKAD 3T1FA 1U93A 4FD0A 1P5VB 4JFDE 3WOVA 1CB4A 5CU5A 1U4EA 4ZDHB 2TSBA 1DN0A 1R3KB 1IL1A 4YPGB 3FPYA 3LEXA 3A6OA 5I1IH 3L4VA 1RIHL 3D51A 5K59F 2D2OA 2EABA 4BZ1H 5F88B 2KH2B 4QI3A 2ZOOA 1X9QA 3LIUA 3S6CA 1VPOH 3TNNA 5E8NA 4WUUB 3L2MA 1WS7A 3TYFB 2JKRM 3S2CA 4A7UA 4ZAKD 4J2QA 1BXUA 4OUOA 2CGZA 5ADPL 4PJAA 2LABA 3UIYA 5A40E 1TNNA 4IBTA 4QLWA 4P4RA 4G7YH 4GRWH 1A3ZA 3MRBB 5LLIC 1JHKL 4HISA 5IQ9B 2VXTH 2HT3C 2FT7A 3MRGB 1UADC 4KK5D 3WE1A 5F7LB 4AY0A 3ULUL 3ERXA 2WZAA 4RQQB 2X3CA 4OD1L 2UZXB 4PRHB 5JLZA 1OAQL 1FNGB 1UXLA 2VC2B 3KEHA 2NT0A 5A2LH 4AENA 3S88H 4JQXA 3I6SA 2I9LA 3STBA 4G1EA 5E99H 5JUEH 1EDQA 5HGBB 1UASA 4L8BA 1YEJL 4OFVA 1G4RA 2B14A 4U2YA 2YXFA 4U6XA 3QYNA 1RV6X 4PCKA 4PHZA 3KW7A 2DMGA 3S5LG 3EH3B 2IBZY 3QWRD 3F8UB 4ECNA 1V10A 4L29B 3TA3D 3U7AA 1P7KB 4TVPH 5GQBA 3FQXA 3VXTA 3RIFK 3VGDA 1JPFB 1MNUH 4R96A 5EOQL 3CZSA 3TN0D 3C8DA 1EAPB 3I75B 4OLXH 4ANUA 3LYRA 3BVDB 3ARUA 1MUJA 5D2LB 2JKNA 1D5XB 5ITFB 4B60A 5HHME 3L4CA 1AJ7H 3ARGB 1JYNA 4JFDB 1HSAB 1ID2A 3FSVA 3UBHA 2N59A 4KV5E 4QCIA 3MZGB 2WZ6A 1I1YA 3S97C 1N10A 2QQKL 2OTPA 4FMVA 5CJQH 1HKLH 2G4GA 4JKPH 4WGKA 3KH4A 2J1ZA 4D9QD 3U46B 2QV2A 3DK2A 4G6MH 2XVKA 4KMLB 2Y3NA 1KF9B 5IB3B 1B9KA 4ZO8A 1QO3B 3WXWL 4KU1A 2NY7H 3ROLA 3MUY1 1OARL 2FHBA 3P3YA 2ADGA 4YZFE 2YUXA 3HI5L 5I8OL 5IV2A 3O9WD 1GSMA 1PZ3A 4YSSA 2XC8A 4EE2A 3KYNB 4QO1A 1L5GB 1U30A 3G9VA 4N2HA 3W0WE 2OR7A 1JZ5A 5J1AA 1KTLB 1XF5A 1T0NA 2JIXB 3FQRB 3VSUA 2CKNA 2G5UA 1KFGA 1ND0B 1JGEB 3KPOB 4R5VA 1IMHC 3BCFA 3Q8AA 2YAPA 4Y2DD 2V7NB 3U7YH 4LSPH 3VXRE 1ZLUK 1DJWA 2OJEB 1IKOP 4AJYV 4IHOA 2WCGA 5EZOL 3T65A 3AQYA 4LGPB 3AREC 1M7XA 1RI8A 5C09A 1EBAA 2GT9A 4KV5F 3APCA 4P2OB 4RNRB 2R4SL 5DWUH 2ZF8A 5FF6B 1JPTH 3EJRA 1XD1A 2D73A 5H94A 3QNXA 5G4OA 2D0FA 1CCZA 4HIQA 1GS8A 5FYKD 3REVA 2CKBH 2WWKO 2XWBA 4X6FB 4ZO7A 1H5BB 6PCYA 5F96H 3SODB 1DJHA 5IBUG 1SXAA 2DWEA 5HHMB 4LT7A 3VMNA 4CILA 4R0LB 4ZMTA 3ML9A 4N2NA 3MV8D 5CLTA 4R2GC 4IK6A 4JRXD 1QEWA 4UAOB 4TLKA 3QA3A 2F08A 5ELIA 4Y5XA 5CWSA 4Y4KC 1S7RB 3BN3B 4Y4KA 3EJPA 5ADOL 2M83A 4O58H 2FEDC 5DHYB 1JN6B 4K7PL 5IQ7L 1WEJL 2LV4A 2DJMA 3UIZA 1R75A 3MUZ1 4NI6A 2XX0A 2MSPA 3FBKA 1AO7A 3AT0A 2MMXA 4FG4A 4FXGC 4M43L 5CN1A 2LVCA 1OQOA 4YDLB 2CLZA 2GJ6D 1EV2E 3L1GA 4GINA 3MXVL 3WN6A 4AQEA 4NQEA 1ZT1B 3UTZB 3W0WB 5C0FB 4ZX5A 1BZ8A 1QLFB 4P5KA 4W9LC 3RRQA 1O7DC 4PRIE 1Z2KA 2CALA 4EZKA 3LKQA 1QYGH 1UB6B 1NPNA 1SF3A 2HFEA 5KW9H 1T0MA 4P5TB 1F1AA 1YNKH 1X5AA 4UTBL 3TO4D 1F6LL 2C1OA 2WNGA 1BLNB 1CLOH 3VXRB 2FGZA 3WFHB 1G9HA 4AGNA 1SXCA 4O51B 1PG7W 3UTSE 1CGSL 1D7DA 2I32A 5HDBE 1QFUH 4L5FL 1V3JA 4JZOB 3GSNB 3GK8L 4OCSL 4PJBA 4L3CB 5DMIL 5EU6E 1S7QA 1F4XL 3LRKA 4XMZA 4EI6B 2W0FA 4IBSA 3Q5YA 3QEQD 4JPQA 1OKEA 4R4NC 4AJVA 1QNZH 2WSPA 4IBZA 1D6VH 1FLTX 1JPEA 4FCAA 1HVXA 4M1CD 4XNQB 5FDWA 1I4FB 5I73B 4NM4H 1SY6H 2H6PB 5GGQL 3DBXB 4HBQA 2XG4A 2WWNA 5C07E 1RVFL 1BHGA 3T71A 3TBBA 3IMRA 3CSFA 5GRZA 1NOFA 5GS1C 2A6KA 5GS1A 5C0GB 1SJVA 3RY5A 1AIZA 1MJJB 1KV3A 4M8QB 3VNZA 3NTCH 2WXNA 1D5IL 4EMZA 1WTLA 2Y2YA 3OLIA 4A2FA 4KROB 1OF2B 3BDYH 4HQQH 3NRQA 4NDMB 3H56A 4U1SB 5AKRA 4J3BA 2OMYB 3Q2NA 1MCWW 3T0ED 4U31A 4XPAL 4ZAKA 4JR9L 2D31B 3KR3L 2X4PB 3L1EA 4Y19D 3GSUB 1KIRA 3BWAA 4L3EE 4H2CA 3HC4H 4OM0H 1T83C 3K2MC 3BW9A 2BK8A 3LIZL 4Y1AE 4LHUD 2VUOA 4MB4A 1LNUA 4E9TA 5C0DB 4WI3A 2IC2A 2B1OA 5HDBF 4H1LG 3VU2A 4CKQA 2BVTA 3LXCA 4NERA 3WE6B 1MRCL 4M5ZL 4CUCA 1K2DB 5T5NF 4GS7C 5DI8A 3CFJB 1X9UA 4PRIB 4IJ3B 3TFBA 3NA9L 5L9DH 2XNAB 2WXMA 3W5MA 1YCSA 25C8L 3GJEB 4F5CA 3WN5C 3DO7B 4OZFB 3WN5A 1OCRB 4FFWD 1D6EA 4OIIL 2YSSB 5E0QA 5F7FA 1AZRA 3UTSB 4YO0B 2F8VA 3IETB 4PJHA 2ZUTA 3TA3A 3ESUF 1BEYL 4GXUM 5HDBB 1JWMA 1T4WA 3S3BB 4AL8H 4BGLA 3QG7H 2CO7A 1ACZA 4HEMA 2WNKA 3CFNA 3Q1SH 4HHAA 1JZEA 4KMTH 1RSYA 3JTTB 3TN0A 3ETBJ 1A9VA 4NJAH 3UYOD 5DJXB 1KIUA 2GUYA 2YA1A 2BSSA 5HYSG 2Z4QA 4IQHA 3WNJA 2EICA 3BGFB 4KK6C 5E4OA 4BEIA 4QNPE 5BQDA 2RFXB 2CJSA 5C07B 3MZTA 4ZTPL 1D3CA 2MQGA 3AU1B 2UX6A 1SN5A 1X6NA 4F7PB 1GCYA 4XO3A 3L13A 3BPNC 3CVIH 3AXLA 3JV4A 4PRDB 4AVHA 2GY7B 3SPVA 4G3YL 4FQCL 5CP7A 4M6OH 1KJ2A 3ZL1A 5CO1A 3BPLB 5I1KH 4Z7VE 1PLCA 1T6BX 3SPHA 5IM7A 1X5YA 1WHPA 2X9YA 1LMKA 3UYRH 2EEBA 2IAMA 3QXTA 4E5XG 4LSRL 4AE0A 5C9JB 4N6RA 2NUTA 2PO6C 3IPFA 3RI5F 4HLZG 3WFBL 2IDCA 1G7MA 1QFOA 4H1LH 4L3EB 2VLRA 2VDMH 2X4RA 3VD3A 1KELH 2FEEI 3C5ZD 4H8UA 1DUYB 4U1NB 4Y1AB 4J5VA 3N85H 4KQ4L 4NO0A 5H8DA 4AM0Q 4LDCA 3LRGA 2IGLA 4ZFGL 5KAQG 1ZT4B 2N1TE 2FECI 2Y2TA 4OLZL 5F9DC 1WWWX 3BN9C 3T4YA 1IGTB 3FHQA 4X8GA 1RUML 3IMBA 1VACA 2HFGL 3ZQXA 3SDDB 5HHXH 5KSUB 4MNHA 4A7VA 5J6GB 1JVLA 4MLIA 3FTZA 2ZONA 3K6NA 1EXUA 3K72B 4HCRA 4Z7QE 3RL2A 1I1CA 3LPOA 2N01B 3G5XA 3PJSB 5DS1A 1Y0LB 3BYYA 1ZE3H 1F6AA 1U91B 4I2XA 2D4FA 2EDRA 1OIOA 4G6KL 5I0ZA 1KEMH 3IJ9A 3KPPA 5SX4H 2XWRA 3VFVA 3WYRA 4Z7VF 2PYEA 5TK4A 5DEJA 3TYGL 4YSEA 2GABA 1XQ4A 4R4BA 3BP5B 3DO4A 4E0RB 1OOAA 2VUKA 4ODXA 1A1OA 4WO4B 2HKFL 2WQRA 3DV6A 3HZ3A 4JY6A 5I1DB 3MV8A 3C2SA 1BZQK 3MLVL 3R1GH 1TYEB 2DYPB 2GIYA 2WAQA 4JRXA 5KG9A 1UENA 1SEBB 1SVZA 1KCSH 1S8DB 1YN7B 2NY4B 3K5SA 4PJCA 1I1RA 1FWXA 3OHXB 3R0MA 3LZNA 4I3SL 1IBGL 2K6WA 4HOZA 1NLDL 3BOVA 3W5NA 2XQ0A 2YEZB 1I9RL 3E38A 4G9DA 4Z7VB 5ES4B 4Q2ZA 3PXLA 1A6TB 1VZHA 3QFDB 1OAUL 4XOAA 5DQJB 3W9EA 2EDBA 5DZJA 3VA2C 2GJ6A 4OW6A 5FGRA 1E50A 2YFOA 3B3BA 1LO3L 2X9WA 4Z7QF 4DZ8B 3FOMB 1AXIB 1RJZA 4ZFFB 4LCWA 2XKUA 1P4BL 3LMJH 3K4DA 4QDGA 4GSQA 2BJMH 3OG4B 3QBTB 4KXBA 5IZ7A 3FKUS 2FDBP 4LVHC 3ZYOA 3REWA 1KCLA 4HUCA 2WBJC 1UXSB 4MQ7B 2WBJA 3ALXA 4P3DA 5D1QD 1KBBA 2O61B 2NOYA 2OPCA 5KWYC 1PCXA 1E3FA 1TU2A 3ZDYE 1A6VH 4Y5YC 1XSJA 4H20H 3GXMA 4Y5YA 4FQ2H 1EEYA 2IPUG 4XNAA 4Z7QB 4ONHB 3KBEA 2YPVL 2VTFA 3IDGB 2P52A 2ZYHA 5IB5B 5HHNA 3AGWA 1KOAA 2VQ1A 4DO4A 2HVKB 2XKNA 3AQDA 2Z7WA 3KL0A 1NGPH 3ECBB 3HLAA 5PCYA 1UH4A 3DMMB 3GJFA 4LNRB 2HJKA 1HE7A 2EYRA 4K5MA 3KPMA 1YEFH 3MRMB 4HT1H 2R8SH 1X5HA 5D1XC 4DJMA 1BVLA 1WUZA 3MLRL 2VITA 3VFNA 4YGVB 4GKZB 3AWGA 3VO0A 4F91B 5CP3A 2JKWA 3PY9A 5ID1B 2Q3ZA 4PRHD 4CU6A 3RPBA 3MOBH 1F8TL 3OZ9L 5HYQA 3QR1A 2WLKA 4QAMB 1N7ML 4TTDD 1HQ4A 1HYSD 5JXAL 4NNXB 4L5FE 5GSRB 3RDTB 5FKPB 3ZT5A 4UOW1 5ECJE 5AW0B 3QWOA 1MCPL 2Z31A 1UQSA 3LZOA 5HGHA 4L1TA 3KM2A 1RP9A 4L3FA 3ZDYF 1NAMH 4E41D 1KGYE 4DW2H 1UUSA 5MERA 2APFA 3UACA 3FB5B 2NYYC 3SE3A 3T6ZA 5DMGC 1QFHA 1RCYA 3L4ZA 5I1HL 4KY1L 3BIKB 2F7IA 4H88H 1E42A 4ZUUA 5CEZL 1A9EA 2BH0A 5TDPA 4O9HL 4OLWH 1B0RA 1AY1H 2DQHH 2YJLA 5H37H 3LNHA 3IKCA 4PLKD 4PJEA 4GKLA 1E90A 1FL3B 4JFDD 4KTEL 3DVNA 3NSDA 4HS8L 2J1XA 4WKXA 3V0DA 1CZ8H 3EH5B 5FM5O 3ZDYB 5J12C 4NPKA 3WIHA 1K4CB 4U0QB 1A6UH 3BPCB 2H2PD 2HAZA 1H3PH 2CA4A 2F54D 1BJMA 4LHJB 1DJGA 2DQDH 1YDPB 1KLFB 1GYUA 2ZWLT 1AD9A 3QQ3A 4Q52A 4XVSH 1TFPA 4ANVA 4AEIH 4GUOA 2P5WD 4N9GA 3D25A 4QTIL 5B7MA 4APXA 3MRDA 2CXKA 3G6JB 3SKNB 2MCMA 4YE4L 4LPTA 1LP9E 1QRNE 3GINA 2DLFL 2XTJE 5FW6A 1A7BA 2JIXD 3I3DA 3AGVA 1NKGA 4P2RD 3PU7A 1L7TH 2IOOA 4N5EC 3RWCA 5BOJA 1JZJA 3T5WA 5E00B 5E94A 2VDQL 5K1JA 3BQUB 1EJOH 5DD0L 3SQOL 5IBTH 2VXUH 4FYSA 3L1OL 1ZA6B 4PD4K 4ACTA 1QA9A 4M61A 4ORGB 1E4XH 1DQKA 4UCFA 5IVZB 5T3XD 4YHZL 4JFXA 2LTQB 4Z8FH 4Y5VB 2NCEA 5AYQA 1S9XB 3C5ZA 3QORB 1XZ0A 4ZO9A 1OGAB 4PJ9B 4LP4A 4BWTA 1KXTA 5E6IC 5F1NA 4W9ZA 1NFIA 4GMTL 4WNQA 2HVJA 2MNJB 1AI1H 1JMXA 2XZAH 1WE5A 5JW4Q 5IOPA 1F18A 3MRFA 5K9KB 5L2KA 4NQCA 4QXWA 3MPCA 1BZEA 1BZ9A 2APBA 3D2UB 2Q87A 4U6YA 3M86A 3TOPA 5KYYB 2EAEA 2X12A 3SDAC 4HU2A 3LN5B 3P0VH 3AW5A 5FA4A 1N26A 3MLXH 2EDLA 4GSDH 1LP9F 5BMFL 2QMJA 3U2SA 3GDCA 4G5ZH 5AVVB 2KLSA 3P73A 3B2PA 4PRBA 3QNYA 2WINA 4TVUA 1JNLH 5DTFB 3RKDD 3F2LA 3UO1H 3PWLA 4W9JC 3IGKA 4WFGD 1WJ3A 1IGFL 1X7TA 1E5CA 1JK9B 3IXTA 3L3HA 4YL4A 3TCLA 3O3DB 4KNUA 2WWKT 4HD9A 5BZWB 1C12B 1UJ3B 1UWGL 4IOFD 1LP9B 2XTJB 1G7HA 2VE6B 4WW1A 3L3JA 1FVDA 3FCTA 5DUJA 4N1CA 4R3SB 3ZT6A 3GSWA 2ZOKA 3S34H 1NCCH 1ZHKA 1MNNA 1BOGA 3UTTA 4ICWA 3V6ZA 3OAUH 2DI7A 2WXPA 3FL7A 3QEGH 4XP5L 1BVOA 3DRTB 4NKDA 4HXAH 3ZE1E 1MFAL 2D3NA 1DJZA 1PBYA 4PS3A 3T2NL 1T21B 1I8IA 3HPLA 1NCBH 4EJ1C 3A6CH 4F7EB 2VRKA 4MWFA 4YZWA 3MNZA 5EF2A 2XA3A 1DJYA 2J1YA 2IALB 5IREA 1CBJA 3HN8A 1P5VA 1XX9C 3GBLA 4XB8A 5ISZE 1U8HB 4ZDHA 1T0PB 1QTYT 3N06B 1XL4A 3VFWB 3VFRB 3GBDA 4WDIB 5MENE 3ARFB 2CBMA 2DQ6A 1DBML 1RUQH 2ZCLH 3CAFA 2F74A 5DDHB 4ODSH 5DZAA 5F88A 2MRYA 5D70H 1EQWA 2ZP8A 3TYFA 2BS9A 1MFNA 1N3NA 3QUKB 2DDQH 3HB3D 4W68A 2AABL 2QHRH 2LW3A 3V79C 5C0RH 3ZKMD 2OP4L 2VDPH 3MRBA 1QRKA 5JORB 3K3QA 4QAWA 4F37K 5I6PA 2YMOA 5IQ9A 3FNKA 3MRGA 2GBTA 1I7UB 1FIEA 4B3EA 1A7NL 2WUBH 4QMEA 3GBNL 2R1YB 4RQQA 5D7HA 2IOMA 3T6WA 3ZE1F 3NCEB 2P80D 2UZXA 4HZLB 4PRHA 3S4SG 1NM9A 1FNGA 4NNYB 2ZD0A 4PRID 3P2TA 1AQKH 5PAZA 2WANA 1MHHB 2HWZL 3LS4L 5HGBA 4ISVB 4KNQA 2FYVA 2C3XA 4XPGL 2OMTB 2JV6A 3PP3K 4LSUL 4IRSD 4C56E 1G9NC 3SKUD 2XPZA 2KS0A 3H3KA 4YAQB 1Q94B 3UTSD 4L29A 2MPVA 2XZQL 5LNEA 2Q6WB 1P7KA 2DMCA 3QHZH 4DKEH 1S9YB 4HK0B 5DR5L 4U49A 1L9PA 4TMPA 3ZE1B 2V8LA 2OULB 4NQVB 5EU6D 3ZE0E 3U9PL 1NCAL 2XRAH 3UZQB 4CVXA 2I69A 4K9EL 4HG4J 1EAPA 3I75A 4J6RH 4TL5A 3FTVA 4HV8B 1PX8A 3N04A 5IHZB 1A4JA 3VI4E 3FUIA 5ITFA 4UOZA 3HJ0A 3ARGA 3B5HA 3UZEC 4JFDA 5ISZB 2ZX8A 1HSAA 1DANT 3PWUB 5EF1A 2DL2A 4LOUC 2BWDA 1DFBL 3Q13A 3VD0A 2CUMA 4FL4B 5MENB 1COBA 1NA8A 3OF6D 3T2QA 2QSTA 1DN2A 2H8PB 4F7TB 3LN9A 3U46A 4UTAL 2P24B 1ASOA 4W6WB 5IHWA 3LHPH 5CBAB 5IB3A 2ZPKL 4JPKL 3L7EB 5HHVH 1OHZA 4FRWA 1G84A 1MJUH 1IVTA 2FNWA 2HFTA 1RZJC 1IEBB 1WFIA 1C7SA 1EHNA 3BC9A 4RETB 2WXGA 1L5GA 3KYNA 2R0KL 3F84A 5CEZE 4KMQA 5C08D 3A0OA 1KCVL 4M9PA 1KTLA 5ALCL 2JIXA 3B2VL 2FBRA 1OHQA 3FQRA 4L1LA 5ESQB 5CGBA 4A1RA 1PZ5B 4B5EA 4YSDA 1ND0A 1JGEA 2PNDA 1A6WL 3KPOA 3MRKB 3O8XC 5EIQA 3ZE0F 4TUOB 2V7NA 3KWWB 5DJDA 1R3IL 1ZVNA 2OJEA 3P3RA 2RALA 3RZCC 5DJAB 4QRFA 1N6QL 4GQ9H 1A47A 2A9MH 1BVNT 5E6UB 3HG1E 4BUHA 4C56B 3MGTB 1XH1A 4P2OA 4RNRA 4G7RB 1F3DH 4ONOA 2KERA 5FF6A 1WZ1L 4BK5C 4OB5H 3NJJA 2CRIA 1KJVA 4BK5A 1DHKA 1FNAA 1LQSR 3INOA 2YEQA 1M2OA 2IFFL 2BLFA 4JFQB 4O2CB 2VLLB 5EFIA 3ZE0B 3QJQB 1HCVA 4AX3A 4X7DC 3BKYL 3FFCE 5C6TH 1H5BC 5MEOB 2VLKE 4V1DD 4X6FA 1H5BA 1CXIA 1HZHL 4DP9X 4HKJB 1M42A 5A2AA 4O2EB 4QTHB 3VI4B 3CHRA 4R0LC 3EXLA 2WIMA 3K2IA 1JGIA 1K8IB 1YECH 4R0LA 4YHOH 3ULUD 3VGHA 4PS4H 1YY8A 2DYPD 1AFVL 4X5QA 5CSZB 4MFHA 1CJYA 1S7RA 4HOWA 4I18B 5DHYA 1I3RB 2VLJE 3RWEB 2YD5A 4TPRL 2L7EA 2I60L 4UIKL 1MHEB 4UT9H 2NUPA 3B2DC 5KSAC 3RGVB 4K3DH 2VDLL 3R7RA 2WZ0A 3B7TA 3EOTL 4PTTB 2V5MA 2UZYB 3O2DH 1CGYA 4GG8B 3HE7B 4DETA 1ZT1A 3CSTA 5A3IC 2Y36H 3BLBA 1IKFH 4XC3H 5AOJA 3UTZA 1QLFA 3W0WA 1A14L 3WDHA 5C0FA 1JS4A 3V4PA 1JFHA 3D3VD 4L37B 3SYAA 3VFVB 1UB6A 4NAJA 1PD1A 3IU4L 4C55A 4P5TA 1I1AB 5GJTH 1C8QA 2CRZA 4DEWA 3GXUB 4MBOA 1T1WA 1Y18B 3L4XA 5B7FA 1BLNA 1KGCE 1Z9PA 3VXRA 3WFHA 3Q8CA 1GYWA 4JZNB 1IQWL 1VSCA 3QVAA 2C7FA 4O51A 3P30L 2B4CC 1BWWA 4ZYKB 4NKOB 1XGUA 1EHKB 3D7PA 5I26A 1TJHH 3Q43A 3VD4A 3GSNA 3K46A 2CIKB 3IWVA 3HG1B 4EI6A 1D5ZB 1HHKB 4MJ6B 4FA7B 2Z65C 2ESVE 2B9BA 5I73C 5BCAA 3ZO9A 3GUFA 4XNQA 4ALAL 1I4FA 4XPTL 3DBXA 3VSQA 4OCXL 5I1CH 2CH8A 4YSOA 2X05A 2J88L 3EFFA 1CD9B 3BKCH 1NCTA 5D55A 3KBPA 1MJJA 4M8QA 1BFSA 2VZUA 1GCFA 1CURA 3DX1A 3ZJAA 2L7JA 4KROC 5CFHA 4H8HA 2DQTL 4M7KL 2VDQB 4IRZH 3OX8B 1F90L 1OF2A 2YRPA 4R90H 3ZGIA 2V5SA 4NDMA 3MJ6A 1OB0A 3ASNB 3ZY7A 2OMYA 1ZA3A 3WY1A 5J1AB 3ARPA 2P28B 2VLJB 3ARRA 1IEHA 2D31A 4PUBH 1HCZA 1A6ZB 1KENH 2X4PA 5T1LB 2L4OA 4M7LT 1ZLSL 1CYWA 1DR9A 4Q8BA 1P7BA 1FNFA 4NNPL 3D39E 12E8L 1YJDC 4HJ1A 1JRHL 1AS8A 2ZX7A 1RAMA 2CJ3A 4JREB 5C0DA 3KLSA 1OP9A 2C3GA 3WE6A 1IGIH 3CFTA 5DFWH 3WHXB 1IC5H 1KN4H 4FGMA 4ESKA 4LL1A 4CGUB 3CFJA 4PRIA 2JF1A 5JPNA 1CFQB 3OAZH 4FA6A 4BFKA 2XNAA 1YMMD 4GY4A 1C7TA 5FUOL 3GJEA 3RFZB 3SKOA 2D2CC 1U92A 3DV4B 2YBRB 4OZFA 4IRSA 1EERB 2YSSA 3QDME 3NFPB 1FHNA 4NB7A 3UTSA 4YO0A 3T4AA 3WXVH 4QJ4B 2PWHA 3IETA 4XNZB 4B7IA 5HPMB 1Q9KA 3FONB 4P46D 1T5WB 5D5ME 2FBJL 5EU6A 3WKML 1CFVL 1HOEA 2R69L 2HJLB 2X42A 2D0HA 3JTTA 3VXNB 4ZZKA 2E4FA 4XB3A 5DJXA 3SCMD 3SO5A 1U6AH 5DZLA 2ESVB 4FQXD 3BGFC 4CNIB 2J6EL 3RJQB 5L6YL 2I27N 2UV3A 5IEKB 4N2LA 2RFXA 5E03A 5GS3A 5C07A 3ISYA 3U1PA 3MJ9A 5C0CD 3RY6C 3SDYL 4F7PA 2D7TH 3OF6A 4N24A 2QADB 4PRDA 4RBPK 2NY0B 4Z6AT 1BQKA 3BPLC 4O5LH 3IM1A 5TD4A 4NBXB 1EH9A 3OKMA 5A6LA 5D1ZB 1YEKH 1EHXA 4XX1E 1AXTH 1KPVB 3UROR 4BQCA 4WI9A 3VVVA 4B41A 3H6JA 3DVIA 3V9FA 4L3EA 4JDVA 4JGJA 4KOCA 3D39B 2VN4A 1GGTA 2BOCB 4CVUA 4Z3IA 5CFAA 1MEXL 1NMAL 1JGDB 1W15A 4Y1AA 4U1NA 1DUYA 4W70A 2ZNXA 5HYJE 1A1MA 4ZUWB 4UQBA 4P4KB 4PS8A 1ZT4A 5D5MF 2MQ3A 1TTCA 1ORSB 5FIEA 4DSYA 3SDDA 5KSUA 3RTLA 1XL6A 3QCUH 4QWWD 5J6GA 1T0OA 3DARA 1RU9H 1B0IA 3TPUB 2NSQA 2D7OA 2ROYA 2XUWA 3TWCH 3K72A 2ZUVA 3W81A 4JRLA 1OWRM 4HS3B 3X3GL 1L9QA 1OSZB 3LRMA 2XWZA 3PJSA 1QLEL 2ALWA 4ENED 3I9GH 1Y0LA 1EXHA 3OMZA 4HPYL 4M6NL 1B6UA 3ELQA 5CEYB 1E6OH 1GA2A 1U91A 2V3FA 2FTAA 3BLPX 5D5MB 3STLB 3HMWL 2C1PB 4NZTL 3B2MA 2D03L 3MNVB 2QLYA 4WO4C 1F3RB 4E0RA 3RP1A 2CO3A 4WO4A 5F7EL 4AOFA 4W9DC 3LH8A 2DQFB 5I1DA 5D4QA 4BELD 5GXBB 2DYPA 2CR0A 1MCHA 3TT1L 5F21B 1WUNT 4Z3EA 1UM6L 4EOWH 1S8DA 1YN7A 1N0LB 1QRND 1U8KB 5B22A 1Z9SB 1NQBA 4PWKA 3OHXA 3QDGE 3FT2B 5L0QC 4WEBH 4UZGA 1OSPH 2YEZA 4Z7VA 5H4ZA 4TOYH 1K4DB 5TQ2H 1A6TA 3JBG7 3QUMH 2BMKB 2HH0H 4IU3B 4YFLI 1IGCL 1USZA 5E8EB 3CQPA 4TF4A 4OVUA 3QR0A 3U4KA 2Z4TA 3DJ9A 1OAKL 2JKJA 5IMLA 1CICD 3JWOC 5IMKB 1OK0A 5FGBA 4D9LL 3IDYB 4ZFFA 1KGJA 1YEWA 5HYJB 2KKQA 1BV8A 1MFEH 4DWHA 4PRNB 4L1DA 1H3VA 4YHNB 4JPVL 4MJIE 1FIGL 3FT3B 4N0UE 5SWZE 1UXSA 4MQ7A 2W9LA 4GKOA 2BZCA 1UA7A 3N41F 4TS6A 1MRFH 4GO6B 5DD5H 3FQTB 3G6DL 4JZJB 1FDLH 3C2AH 2XYBA 3K74B 3FOLB 1CR9L 1PJ9A 5J6SA 4LLMB 3N43F 3NA4A 4ONHA 1BW8A 3PRZA 4RRPG 3IDGA 5L4IA 4Q74A 3UJIL 3IDNA 4L2LA 2XQYG 3L17A 4B6ZA 4BCYA 4ICXA 5FC9A 2ZUQB 3BUPA 4XC1H 2HVKA 5JOEA 1CGTA 1WD9A 4Y9GA 1G7IB 1SQMA 1LJMA 4J3XA 5EZPA 4OBRA 3ECBA 1E6JH 4B3VA 4IK7A 4G43B 3VQ2C 3CDFA 1ZSHA 3D07A 3DMMA 4AUJA 4UBDD 4LNRA 3N41B 4Z3TA 5E7FA 4MXQD 1ZIBA 1KTBA 3MRMA 2RHEA 1TZAA 2VQ4A 3GHBL 3OMAB 4X5XB 5IJVB 1MI5E 3W38A 2AXGB 4YGVA 4GKZA 3N43B 1BZ7B 1KTDA 3KPSD 2E4TA 3CBRA 5K9QG 2YWZA 3NSFA 3DSFH 1X5LA 4M7ZB 4G72B 3QDGB 3VFSB 4OGAC 4OGQC 3RDTC 4NNXA 4OY9A 4OGXH 1UD6A 5GSRA 3RDTA 3S48A 1CT8B 3B8YA 5IHLB 1M71B 5FM4A 5D93B 5ABAA 3DJSA 3L9RA 4PCTA 4WCYL 3V0WL 1DFXA 1YLBB 3GO1L 3QYMA 4BYHA 1PQZB 3V6OE 3VG0H 1HH6B 1HNFA 4LZKA 3GS7A 3BIKA 3GT6A 3K8KA 4FQIH 3ECUA 2WB7A 2X4QB 1E27B 3WIAA 4RDQG 3QCTL 4B9PA 4LKCB 3CFMA 4BK4A 3JT2A 2MNWA 1VJSA 1UURA 5DHVB 4ODHL 5IJBC 4LCUB 4N0UB 1HL4A 5SWZB 1FL3A 3T8MA 1CFNB 1GHFH 1H6TA 5IW3A 2A0LC 3KPRD 3HR6A 4LVEA 4FFVC 3MRPB 5FV2A 4M56A 4YPJA 1YHPA 4X7EC 5I0XA 2GSGB 3PNRB 1K4CA 2DQMA 2J8HA 3BPCA 4BKLB 2OMUA 2DQGH 5C3LD 3FMGL 4FXKB 5GRYA 3ABGA 5GHWL 1YDPA 2AK4D 3N50A 1H9VA 2VDLB 1KLFA 4LESA 1U58B 4JN2B 1USQA 3KVDD 3S0PA 4PEEA 4WI7A 5FO9B 4B27A 4P3CH 4EDWH 1S3KL 3ZDZE 3SKNA 3CLFL 4U6HA 5M7QA 1DQLL 3B34A 1MI5B 4YL9A 4GFTB 2CO4A 5AAWC 1KXHA 3ARBC 4JFPB 1DQIA 4Q6IB 4LU5H 3WNPA 4C83A 3ULVL 1CK0H 1BM3L 1IAIH 3BQUC 4H44C 5E00A 2PUQT 4UTBA 2RB8A 3T6QC 3UAAA 2XBTA 5FO7B 3MA9H 1XH2A 4IS6B 1MJ8L 4AXWB 4MHHI 2R56L 2XWJB 3QI9D 4LLQB 1G0DA 2EIKB 4HSCX 5DEZA 4ORGA 2H1PL 2DEWX 2A73B 4Y5VC 1OLZA 5AOIA 4PFEA 4Y5VA 4WY7L 1S9XA 3QORA 5AB9A 3QPXL 1B0WA 2E27L 4PJ9C 2AJZB 5EOCL 1IM3B 1J12A 2XWEA 3C5JB 3O3UN 3IGAB 4MB3A 1F4YH 4NN5C 3SGJC 5DEFB 4LIQE 3DIFB 1A8JH 2GK0B 1ID5I 1JHLH 1IM9B 3C9NB 3K4ZA 2W1NA 5BZXA 4AYDC 5HPOA 1KJMB 4RX4D 1H6EA 1XT5A 2FX9H 5K9KA 4TQPA 1J0ZA 4JCWA 4TSAL 3X17A 4JFOB 4A68A 5C0ND 1P9MA 1RSFA 5KYYA 3APNA 3KG5A 3B9KD 3LN5A 3ZDZF 2IEPA 3R19A 2B16A 1JV5B 4KDTC 1LE9B 4HWBL 2NXZB 2GTQA 2X6VA 1UT2A 5DTFA 4A04A 2YAEA 1A5FH 2QPSA 2XIBA 4KKBC 4NOBA 4UIMB 2H3NB 3O3DA 4GG6E 1JFQH 3EYSL 2CCVA 1BF2A 3H4HA 2OMXB 1UJ3C 2FNBA 3ZDZB 5BZWA 1GAFL 1LP9A 1QRNA 3D34A 3ENEA 4GAJL 3NH7H 2V2WB 4L0YA 3L95B 4BINA 2VE6A 1Q0YH 3WJLC 2UZIH 1J5HA 3ME0B 4WI2A 4PJXE 1X5ZA 3GI9H 3NCYS 1I1AD 4R3SA 3WUWG 4NBYB 4W9FC 1CFSB 3D69B 3PUUA 2LFEA 2YGPA 4DP7X 2GKIA 1VCAA 2FGWL 3D1MC 1FA4A 3BWUC 2QKIC 4JM4H 4P2CG 4J6IA 1CICA 4X9YA 1ET8A 3HG1D 4MTMA 1T21A 4XNDA 4F7EA 1E4WL 5IWLC 4WW2F 1P4LA 4K15A 5IWLA 3WU1A 4ZS7H 3S5LB 1W91A 4HKXB 4ZRGA 2BOBB 4DN3L 2IALA 3C09B 4TQEL 1MFCH 4CADB 3FFCD 3B7SA 1U8HA 1J9RA 2VLKD 1T66C 3OKDB 5AENA 3VFWA 3O11B 3VFRA 3BQVA 3K2KA 4AQ8A 4WDIA 4J2XA 2R0ZL 3ARFA 1DQDL 2HMIC 1NMBL 5AVRB 4D7PA 4GG6F 4IMLB 2V6HA 2GEQA 5JHLL 2CDFB 4OI7A 2O5YH 3BP4B 5DDHA 2OMBA 3R06B 5DMKB 2KZBA 3PHQB 3TZVD 5AW2B 1DDHB 1QFWH 2YD2A 3VJ6B 7PCYA 1X9LA 1AXSB 3CPLA 3QUKA 2C5DC 1BLIA 1ZT7B 3CFCL 2VLJD 5HY9B 4G8EB 1CE6A 3GMLB 4PJXF 3ESNA 4YBQC 4AJWA 4YWGH 5JORA 3US0A 5EWIH 2N3JA 2FX8L 3GNML 1J88A 3O4OC 3DOHA 3SY0A 4MQXC 1N0XL 3KYKL 3BAKA 1PSKH 1MFBL 4I8DA 5GZNC 1I7UA 4WSKA 4GG6B 3UO8B 5GZNA 3KPSA 2J3SA 2R1YA 2CHXA 2EC8A 5KANI 4HZLA 4X5WB 1PLGL 4I7ZC 4OCYH 2HP4A 3S3SA 1IBHA 1ETA1 2VIRB 1HQRB 4NNYA 5G4NA 5I30L 2XG5B 3PL6C 5JYMA 2R4RH 4HIXL 2CJUH 5D7EA 3WIIL 1MHHA 1KC5L 5EEXA 4DP0X 5CN3A 3IB4A 4MJ4A 4PJXB 2FJGB 4ISVA 4M4PA 5FOBB 4A39A 4QGYA 2OMTA 2PCXA 4HJSA 1QLEB 1J11A 1UFGA 2YK1H 3W1ZA 1OP5K 3GIVB 2BVEA 2D9CA 1L4IA 5E2WH 3W11D 3GBMH 1Q94A 5HDLA 4CDGC 2I7SA 1RUAH 2W9DL 3JUYA 2YPKB 1MY5A 4LMQI 4PD4J 2XHNA 4BJLA 1IT9H 5E8DH 1OB1A 1S9YA 4HK0A 4OJFH 2F68X 4NQVA 4XWOD 3PGFH 4KVNH 3D4ZA 3UZQA 3GIZH 2VAAB 1UZ8B 1HH9B 4J23A 1ZLWH 3D8MA 4HV8A 5K1VA 5DA4A 5IHZA 5FW7A 3I3BA 4F8LA 2ESVD 1AR1C 4HMDA 1HC1A 4LRIC 3GMRB 5JOPE 5ISZA 4LRIA 3PWUA 3WFCL 3POCA 4KXZI 4AUUA 4LPYA 1HL5A 1BMGA 2DMHA 5MENA 3NUKA 4KVPA 2D3LA 2F61A 3KWXA 1E40A 2H8PA 4G7VH 4S10A 4F7TA 4PN6A 2HPOA 4XXWC 2P24A 4KQ0A 5IBUB 4IMKA 4XVTL 1MRDL 5CBAA 2X89A 1ZLUH 2Y5EA 4BRVA 3L7EA 3S8WA 2X2IA 1J1OH 1F1DA 1MCOL 2E7MA 1TJMA 1JI1A 4Y16B 1CYGA 2JQMA 2QSCL 4N2BA 2XOTA 3K6DA 4ZTEA 2CK0H 3QEUB 4FG6D 4TUKL 1XCQB 3L9YA 4ZT1A 1AKPA 1BECA 3I02A 5ESQA 3VAEA 1PZ5A 1XR9B 5D6CB 3MRKA 1KYAA 4MAYC 3BRGC 3WTSA 4TUOA 4NHUB 2WZ5A 3KWWA 2X3AA 1A7RL 4HPOL 5DJAA 3QI9A 3ZKND 1WG3A 4LSVH 3KDMB 2HRHA 2YPVA 3NESA 4JS7A 2VR3A 1S5IL 4C56A 4GKSB 1MCIA 2BSDA 3ABZA 3VU1A 3KMDA 3QDMD 1H6FA 2IDQA 3MLWL 2XACC 4PYHA 4OLEA 4PI0A 2X4OB 1VGEL 4KI5D 1GY2A 3FTSA 3KXFE 4JFQA 4O2CA 2XBZA 1K6QH 3BSZH 2Z93B 3LD8C 2AQPA 5MEOA 2CBQA 5F1OB 2NZ9D 4HUWB 4HKJA 4O2EA 4QTHA 3VI4A 4P3WA 4N68A 5F1KC 3SJVE 1K8IA 3VXPB 4MS6A 4CVZB 3ULVE 1WICA 2FYYB 2G2RB 3QCVL 2E56A 1V7NL 1KDJA 1I31A 1VLXA 3APDA 4KKRA 2H7WA 4I18A 4JRYE 2BNRE 5J0BA 4XO5A 4Z0XB 3RWEA 2IPTH 2Y07H 2YAFA 3LPPA 3ZTNL 3M7OA 1NGZB 1MHEA 5DYOB 4Z18A 3RGVC 3ZKXC 3RGVA 4LNVA 4XWGH 1LK3H 3CSYB 2K4WA 3QIWD 4QHKI 4JJOA 3S35L 4MJJA 4RAUB 1WAPA 1ZSDB 4W9KC 1SDDB 3JYCA 2UZYA 5EO9B 3HE7C 2ZOWA 3O3EA 4PG2C 4N1EA 4GG8A 3HE7A 4YHKH 4PG2A 2JI2A 1NFKA 4K5OA 2R51A 4XZUB 4KJPC 3H85A 4L37A 3ZMNA 4K55A 5I5MA 1CL7L 4X83A 1I1AA 1LVEA 3VWKD 3JWNC 4CSPA 2YA2A 1MVYA 4HJJL 1I3UA 3IN2A 4Q56A 5AZEL 5T3ZH 5DUBB 2JB5L 4CKVX 1T5KA 1OALA 2ENQA 1U9KA 1RURH 4NKOA 4WFFD 3NCJL 1FFRA 3ULVF 2CIKA 2ED9A 1YNLL 3HG1A 3T8VA 1YEHH 1KJ2H 2QGDA 3S3PA 4D0DB 8CGTA 3S8GB 1D5ZA 1AMXA 1GIGH 1HHKA 4XBGA 5SWSD 4MJ6A 4CBZA 5IHBA 4UAHA 3UC0L 1RJLB 3MUUA 4QHKJ 3KXFB 4XXCC 3BMWA 1JERA 2WOYA 4XXCA 4FZ8H 3FFCA 1YPZE 1E5AA 3OPZH 2ICES 2VLKA 3BEVB 3J07A 3QS2A 5FAAA 3VD1A 1PX4A 3PWNB 1ZTXE 5IGXH 4Y2DC 3GHPA 4HKZA 1DE4B 1S78D 5JQ6L 3K6OA 4AIZB 3OL2A 5HYSB 5HI5C 1Q38A 3OX8A 5INCB 4E36A 4UOQA 2C4XA 1PJWA 1SDYA 2UY7B 3QDGD 2VLJA 2BNRB 5L88H 5T1LA 1A6ZA 3K1KC 2JKSA 2RH0A 2J4WL 4HCRH 2WTRB 3LXBA 2WVVB 3BESR 5J06A 5KAQF 2WXHA 3MLSH 2J20A 4JREC 1Q72L 1JMZA 3NBNA 4YJZL 3HRZB 5KYUB 1IQDB 2B8OT 2VRAA 1D5BB 1U2HA 1GZHC 1OTTD 2QQQA 3WHXA 3HZVB 3WCYA 4XMKH 1GMIA 5FYKH 4K7FB 1XD0A 4W9HC 3EO9H 3M88A 4FZEL 4KAQH 5F7KC 5KVFE 1I9IH 3ABLB 4I0PD 5FA3A 4MJID 2YQBA 5HDRA 3RFZA 4I3RL 3DV4A 3QFJE 1YPZF 2BVUA 4RAHA 5F89A 2E9BA 2WO4A 1NBYA 2ADJB 4HA1A 3NFPA 4XNZC 2VM3A 4WLCA 3CZJA 3OM3B 1F58H 1T5WA 1BMWA 1JPGB 1MW1A 4H8PA 2HJLA 5J3HC 3VXNA 2OZNA 2EE3A 4ZFOL 3BAYA 2AQ1A 2ESVA 4CNIA 5I5IA 2NXYD 3QDHA 3CC1A 5IEKA 1QWNA 2VXVL 4ODTH 1NFAA 1NLBH 1YPZB 2XLLA 4MD4B 3WLBB 1FGVL 5JO5B 3F7QA 2ED6A 1G4MA 3L4UA 3ZE2E 4CA4A 4H8WH 5AB0A 2QADC 1QNIA 3CDGB 5CLZA 3G5YA 4AV4A 4QRUA 3SGEH 4NN6B 4OI8A 5BJTB 3KPNB 2Q7YB 4ZD3L 2O26U 2A74C 1UVQB 1NIDA 5D1ZA 4HIJB 4DVBB 5C97A 1KPVA 2DQJL 3HC3L 5LG6A 1JIBA 2A77H 3KGUA 4GNKB 5I0VA 3D5OF 1DQQB 1C1EH 2WXJA 3EDDA 4HU8A 3NCWA 1VEMA 2ZG2A 4FTVE 3UEQA 3D39A 1KN2H 2BOCA 2WLLB 3PDOB 3S36H 1JGDA 4WI8A 1O7SA 3L4WA 4G1MB 4P4KC 4KHXL 2XFGB 3MSPA 4P4KA 2YN3A 2B77A 4K94L 3FU3A 3IRPX 1H8NA 2X2HA 1L3WA 1BXAA 3QDJE 2GC4C 4HH9A 3FCSB 1ORSA 3GJFH 1KIPB 2WSKA 4XNYL 3IAGC 4YXLH 4Q9CA 4AMKL 3JTSB 3MYZA 1GTNA 3EH2A 3ATAA 3MTXA 1BAFL 3T0EC 3A47A 3QFJB 4HS3A 1OSZA 1U2CA 2PWFA 3RUGE 2VDNH 2XVLA 3O2WL 3FUNA 1HCFX 3QDMA 4WNJA 1KBVA 43C9B 3OMIB 5KBLA 4PVMA 3SE6A 3ZE2F 3QUHA 5CEYA 2WLZA 1SBSL 3TIDB 5D5MA 4HIPA 2X2JA 1FRGH 1XR8B 3CFKB 1LDSA 3H2QA 3W82A 4ANXA 4WK4B 4EZLA 1I8LA 5CJOH 2DWSA 3IS1X 5EHFA 5GRUL 3THML 1FYHB 5CN2A 4POYA 4M7LH 2DQFA 3UJTL 3NEOA 1OGSA 2PWEA 3MCYA 1BYOA 1MZYA 1N64H 1TIUA 2VO5A 5DHDA 3DXAE 1NBCA 4PREB 5FUCE 3CLEL 4L0ZA 1S9WB 2Q8BH 4ATWA 1N0LA 3ZE2B 1U8KA 4BD4A 1OANA 1Z9SA 2BY3A 2XN2A 4B53A 4DAGH 1U8JB 3FT2A 4R4FH 1XGTB 4RESB 2HKHH 2Y6TE 3OSKA 1UB5B 2C7UA 4PR5A 4Y2OB 2DQUL 3ARZA 3QSKB 4UF7C 3WFDL 3EH4B 1OF0A 1TMCB 4I77H 2IG2L 4IU3A 4M62H 3NSYA 5E8EA 1LO5B 1MKFA 2CCWA 2EC9U 1KB5H 3FN3A 3WIHH 4EI5B 2X4UB 3LRLA 3F12B 3RVUC 2B7DT 1AD0A 2UXGA 4FTVB 3RUGF 1J1PH 3WY4A 3IDYC 4NRYB 4KQ3H 5DVOA 5T5FH 1CD1B 1MVFA 2AF2A 1RPUA 4DO5A 5HYJA 2OL3L 3QPKA 5T1MB 2PWGA 1GGCL 4YHNA 2NW3B 3D05A 3FT3A 3QDJB 1U8MB 1NGQL 1C5BL 1FPTH 1KNOB 2X88A 3IMSA 4U1KB 1ET7A 3FQTA 1O5PA 4JZJA 2AK1H 3BZ5A 3FOLA 5IT2L 4TXVB 4GLRI 4UTAA 1AQDA 1G1YA 3CPUA 3FB6B 4LLMA 3RUGB 1REIA 1EZSA 4PV8B 3BFWA 4MLSA 4MJ2A 4PIRF 1W6LA 1FNSL 1TCRB 4OI9A 1INQB 3JWDC 4UT7L 1A7OL 1G7IA 1D7CA 3QUYB 4KY2A 3FN9A 3Q2WA 1L6XA 3LKPB 4G43A 1JPSH 3HNTH 3E1F1 3GXFA 4N8VG 4CL7A 1OGTB 3TV3H 3P0YL 4X5XA 5IJVA 3LZFH 3SBPA 2AXGA 4HGMA 5CUSL 2OQJB 4ABVA 1BZ7A 1OD7A 3DXAB 1J8SA 1OAYH 3RU8H 4M7ZC 1UGKA 4WI0B 4LL4A 2MKLC 1RFDH 4JPWL 3QDGA 3VFSA 2RGSA 3KLKA 1NUGA 2PP8A 3FUHA 4FEMA 3U2JA 1L3NA 5CD5C 4LSDA 4P07A 4NZUH 5BRQA 2W80C 4CW1B 1JYVA 3TEYA 1WS8A 3FU8A 3IDIB 3N9GL 1I9EA 2X4SB 1PQZA 5D71H 2DZEA 2YD4A 4IKIA 1HH6A 3QJTB 2K3HA 1I3GL 2AJYL 1QABA 3VSVA 1M7UA 3CHOA 3GUTB 3GBEA 5AOMA 1S7TB 5GGSB 3IKKA 1E27A 4S0TD 4JRWA 1SJEB 2RCSL 3ARYA 2LOEA 1ADQL 1KGUA 3MRNB 4I0PA 5DHVA 4MJIA 4LCUA 4N0UA 5SWZA 3S9DB 3TBSB 1XXFC 1MF2H 4KUZH 3X1EA 4R7DA 3GTNA 3AXIA 4B9GA 1RULH 4OCLC 1URIA 4XCCH 1L9RA 3MRPA 4AMXA 2W0LA 2GSGA 2OS7A 5JPMB 1H0DB 5LWYL 3HW7A 4BKLA 3Q6FA 4TLTA 4FXKC 5ACLA 1AAJA 1DJIA 4RFOL 4FXKA 3GZOA 1BVZA 1U58A 4JN2A 3IJ7A 4UINL 1R6VA 1D9KB 3CX5K 1SHMA 3TU6A 2BPBA 1RERA 1H3XA 5FO9A 3B4NA 5EN2B 1ZLVH 2P44B 1R0AL 3UPCA 4XBEH 3UEZA 5BV7L 1MI5A 4XPFH 1KIQB 3O0RL 3WDIA 1N6UA 4Q6IC 4CGTA 4JM0A 4JFPA 4OFDA 3P69A 4Q6IA 4FNLH 1ROCA 2DBJA 1Z9OA 4PH8A 3U36B 4TRPH 2OX5B 4KKLD 4LPUA 3WY2A 1G1CA 4IS6A 4Q58C 2YRZA 4WWKC 2XWJA 5TFSH 4LLQA 3DKHA 5IROC 1QG3A 4JY4A 4RGNE 4YHPB 5IROA 5EBLB 5I1JL 3LNIA 2YFNA 2Q3AA 2A73A 3DGGB 4YDVB 3LZPA 4MMYB 2XDHA 2OKMA 3BFQG 4RISL 2AJZA 1IM3A 3OR6B 5B1KA 3V6OA 3BZDA 5B38B 3C5JA 5TH2B 4FQ1H 1ONQB 2MQ0A 3IGAA 4PRPE 1NL0H 1Q90A 5DEFA 3MOAH 1R5IB 7FABL 1V05A 1OV8A 1ZGLB 4FFZH 2GK0A 3H42L 1IM9A 3C9NA 4OTXH 4XP6H 1FUNA 1KJMA 2WHVA 3HAEG 1WBZB 4X5RA 2EEXA 1U3JA 3AB0B 4JFOA 3US9A 1R24B 3W39B 1SHWA 4TNEA 3IBEA 3IVKA 4IIQB 4RMSA 3QUZB 4NP4L 3HN3A 2VC2H 1LE9A 2NXZC 1N18A 2AMUA 4NWTH 4RFNC 1SJXA 3D9AH 5LGHH 1QP1A 4C57C 3C6LB 4HIIB 3LB6D 4GT0A 4E9QA 1DCLA 2AEPL 1IGYB 2WLIB 4WV1A 3TEWA 3DETD 3EBIA 1G9NH 3BZEB 2H3NA 1QR4A 3FT9A 3NK3A 4J3OF 2XN1A 3NJLA 4EUPG 2N7SA 3B2XA 4R26L 1QSED 3FO2B 2OMXA 3OKLB 2BZ7A 4G6JH 4H0IA 2I5YL 1OTUC 3NAAL 3PLYA 4DH2A 5D7SH 1EA9C 3QNFA 4WWOA 4NHCL 3QZWB 2W9EL 1JTPA 3VYOA 4N22A 3TC9A 3ME0A 5HVHB 4JG1H 3QQ4B 5FEBA 2PWDA 4GSUA 3U48A 2IXQB 1TNMA 5DA0B 5CBEB 3AS1A 3D69A 3EO0B 3IF1B 4KTDL 3TF4A 4BUQA 4GPVA 3DX6B 3P4OB 3FF7A 4RGNB 2YQGA 1HU8A 3ET9F 1FLRH 2R69A 3IJEB 4EQ3A 4ZFOB 1BXVA 1XZWA 3NJKA 4N2GA 4NZRL 4YNYB 2WIIA 2XPGB 1UM5L 4G8IA 2J6EA 4XVUC 2DQEH 4PRPB 4WTQA 3C09C 3S5LA 2BOBA 4OD3H 4CADA 3GI8H 1J05B 2K1MA 1QHPA 3M1CA 5AW8B 2EVGA 4OCWH 1KY7A 1MIEH 3OKDA 2LU5A 4LEXL 4I48A 3FQ2A 4NKIL 3SJVD 5CKAA 1IC4L 3QPQD 2CDFA 5DMKA 2V17H 4WFHE 3PHQA 4X9HA 3SPCA 3VJ6A 4BZ2A 1CWVA 2RR3A 3PYCA 3SDXE 2HG0A 4I89A 4OD2B 4L8SB 4JCLA 4WW2A 3P02A 4JRYD 1JXJA 4UOJA 1XAUA 3QFGA 1KYFA 2X41A 3AUWB 3GMLA 4CU8A 1YEIL 3BLKA 3D0AA 4DT2A 2R29L 2F0CA 3N1QC 1MAMH 3TJEL 1GR7A 2APSA 1NGYB 2DD8H 3FCGA 4IGBB 4X9BA 3MU3A 3ARXA 3SKJH 4GG6A 3SBWA 3QP3A 2F53D 1AHWB 1FVEB 3H3PH 1W9XA 3IFOB 4X5WA 2VIRA 4UV7L 1HQRA 5ILTL 3TEUA 1VA9A 3HS0B 2XG5A 4XO9A 1XBDA 1YQVL 3FF8A 2BVPB 4KRLB 4JO4L 4PJXA 4HWEH 3BSHA 5D7KD 2XXCB 4NUGL 4W9CC 1IGML 2DB8A 4OT1H 5CHNB 3GIVA 3GS0A 5GISL 2IH1B 3UOAB 1G94A 2ZAHA 1G0YR 3MUJA 1WZMA 2YD1A 5ACZB 2W0KA 3NFSL 4YLBA 5E9DE 1Q1JL 4OZIE 1IJ9A 2VAAA 1UZ8A 1NCJA 1HH9A 5FWQA 4HIEB 3SDXF 3T0XA 3ZKQD 3ABMB 5I9QC 4UV4H 1W72L 3ZKSD 1BP3B 3GMRA 5IJKC 5IJKA 1S7VB 3SGDI 5D7IF 4A6YL 2AQQA 1DLHB 2CLRB 3T04D 1FNEB 4LARH 3V4PH 2CHNA 3MBXH 3A4FA 4EZJA 2IBZX 2EQDA 4DTGL 4UM9D 3GKWL 4WZ9A 3SDXB 4ETQB 3DTXB 2CU9A 4KK8C 4JNXA 1YYLH 4X6EB 2DS4A 4G42A 4Y16C 3KL5A 4HVBA 2ZG3A 4OV5B 4JN1H 3ZTJG 5B8CC 1DLFH 4FEIA 1LLAA 4JVUA 4YHLL 3GSNH 3QEUA 1A25A 3S88L 1XCQA 2QQLH 1TSRA 4MXVE 3U30B 4XNXH 1UYWH 2OL3B 1G7QB 5F6IB 1JZDC 4MXWL 1IBDA 4HCGA 4OF7A 1E3XA 1XR9A 1MDTA 3II3A 4FX5A 4X4XB 3P11L 2JKTM 4OZIF 1HN1A 3OKYA 3AS2A 1A7PL 3RE0A 4Q14A 4LDLB 2HPTA 4UQAA 4F58H 4L2YA 3GMNA 1V54B 5GJSH 5ECGA 1BAWA 4X9FA 5CZXD 1NINA 3KDMA 1PGRB 2AJSL 1IAKB 3WI9A 4JO1H 1HAWA 4GKSA 5D8JL 5DS2A 2XCMC 2EDFA 2X4NB 4FNTA 2WUCH 2X4OA 2OMWB 4AKQA 5C71A 3JXAA 4IDJH 2GTWA 4OZIB 5E9DB 5TTRA 1GRWA 7CGTA 2Z93A 3TCXA 3B1UA 3VQMA 3HN5A 1E8ZA 4HUWA 1DVTA 2AXHA 1YJDH 1MIML 1QSFB 4LO9A 1F11A 2GPZA 4OLYH 3EBGA 3VXPA 5C7ZA 1QI3A 3AROA 3SE4C 3EJYC 3ZSSA 4CVZA 5IHUL 3VYPA 2FYYA 3NRFA 3UX9B 4DQAA 4AG4H 5F9OL 1GC1C 4MXVF 5J5EA 1O6VA 4A63A 1N8ZB 1MCQA 3QUXB 1NC4B 1EDHA 5DUML 1OM9A 4Z0XA 4DFIA 5E2VL 4DHLA 5I16A 4OZ4A 3PXHA 1HILB 4OCRL 5I6NA 1NGZA 5DYOA 5KTEH 2KLTA 4OZFH 3TP4A 4S1QH 4UB0L 1N68A 5C0JB 1ZGLP 3CSYA 2FJUB 4P9MH 4LASL 4RAUA 4EI5D 1ZSDA 3R4RA 1L0PA 5EO9A 3VM5A 4KJWD 4YN3A 1NJ9A 2AJUL 1EVTC 2KDYA 5D7JD 3BAEH 1AS6A 3WKPA 5IESL 1CTMA 5KBPA 1KSRA 1VZGA 3GMMB 1PCSA 4OM1H 1VCBC 4XZUA 4XNBA 5MHSD 5T1KB 1KWGA 1UWEH 4IDLA 3VFTB 2VL5B 3EYFB 3H9HB 1JL8A 3I2CH 4M1DH 1SRDA 4M93C 2ADIA 3O6FB 4M6ML 2NR6D 3SEP