2IOIA

Crystal structure of the mouse p53 core domain at 1.55 a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
QKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structure of the p53 core domain: implications for binding small-molecule stabilizing compounds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, antitumor protein
molecule keywords Cellular tumor antigen p53
total genus 40
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ioiA00
4IBYA 5AOIA 3KZ8A 4LO9A 4G83A 4LOFA 4L18A 4IBZA 4AGPA 3D05A 5G4MA 5LAPA 4MZIA 3VD2A 1CMOA 2ATAA 1GZHC 2FEJA 5AB9A 4KVPA 2BINA 4AGLA 3Q06A 3Q01A 1IO4C 2RMNA 4A63A 3D06A 3US1A 5KBDA 3WTTA 5ABAA 2J6WA 3D09A 4AGNA 1HJBC 3ZMEA 1EAQA 1E50A 1EANA 1TUPA 2J1XA 2VUKA 2IOIA 2J1YA 5A7BA 4IBQA 2XWCA 1KZYA 1TSRA 5G4OA 2X0UA 3TS8A 2J1WA 3D08A 3WU1A 5AOJA 1H9DA 2BIQA 3WTXA 3QYNA 4IBTA 4HJEA 4XR8C 4LOEA 4IBSA 2MEJB 2IOOA 3WTUA 4QO1B 3KMDA 5ECGA 4G82A 4IJTA 3WTVA 4L0ZA 2BIOA 3D0AA 3EXLA 4GUOA 2OCJA 2IOMA 1EAOA 2X0VA 4IBVA 4IBWA 4IBUA 1HJCA 4GUQA 1LJMA 3QYMA 2WGXA 2BIPA 1CO1A 2PCXA 2X0WA 2P52A 5AOKA 2AC0A 1YCSA 2GEQA 3IGLA 5AOLA 2J20A 2YBGA 1HU8A 3VD0A 1UOLA 3IGKA 2ADYA 1GZHA 3VD1A 4L0YA 5LGYA 3EXJA 5AOMA 2BIMA 4AGMA 4MZRA 2J21A 2XWRA 2J1ZA 5G4NA 3Q05A 2H1LM 2AHIA 4AGOA 3WTSA 3D07A 5BUAA 3WTWA 3US0A 3WTYA 4AGQA 1T4WA
chains in the Genus database with same CATH superfamily
2ROYA 4NAMA 5EUOF 4X7DC 3I3BA 4LXFA 5AVZB 2ZOOA 4QEGA 2HJLA 5ACZA 1E4HA 1MVYA 3ZHKA 2WTPA 4PVMA 3EO1B 5H35B 3IXTA 4XC3L 4HUVB 5EH1A 3K1KC 4ZMZA 3H9ZA 3V52H 3BFQG 3AQYA 3HS0C 3BN9D 4OBSA 4Y16B 4XZUB 3VGHA 2EACA 3S3SA 3QHZL 4LLMA 3HG5A 4NP4L 2APFA 4HLZG 5EMYA 3KPSE 4PRID 3WBDA 1OAKL 3QDMB 3AGWA 1U0QA 3EYSL 2QV4A 4QXGH 3HNVH 5JOFA 2C34A 2Y25A 4CL7A 5EN2A 3MLZH 1JXKA 2ZCKL 2ZTBA 4XXDA 2YHGA 5T3ZH 2BERA 5D71H 3BPLB 1DHKA 4LF3A 1V7NL 2WLLA 1UXSA 5EFIB 2OXGB 3BP5B 3C60D 2HX9A 5TDNA 3RLSA 4I18B 1MJUL 1KJMA 4FXGA 1INEH 4KROB 4LSRH 1ZHNA 4R8WL 3TBVA 5HVHB 1I1YA 4YDIH 5EC2B 2GY5A 2PPCA 2HB0A 3BVWA 35C8L 4OAWA 4OQTH 1XIWC 5DJZB 3LKOA 3RVVC 1H3VA 3T3ME 1CF8H 4JY6B 3E9TA 4NYLA 4PJFE 2VQUA 3VFWB 3FHAA 3EH4B 1A6TB 1P4IL 3GRBA 3DBXA 4WJKB 3MJGX 3DX4A 4XBGA 1RHHA 3FTGA 1T7ZA 4HMEA 4M56A 2IFFL 2H2PC 4OJEH 3RDTB 4D9RD 3ATBA 3TBYB 1DE4A 4UU9B 2CHNA 2DQGH 5E2JA 4DVBB 4OZIF 1ZA6A 1T5XB 4BSJA 5DMGD 4DN4L 3MRCB 2ZOKB 3TH3T 1Z9NA 3VFGL 3C6SB 5LQBL 5K33A 4MKTA 1WA1X 3KGUA 2EVFA 4RESB 3MGOA 5IBUG 2VDRH 2V2XA 1B4RA 1X5MA 4HIIB 2QMJA 4TNGA 4JHVA 4O2CB 2WMPA 1CFNA 2YPVL 2Q9OA 4UUJA 5CP3H 2FR4A 1S7UA 4F7CB 2VB5A 2UWEE 2R2EA 3ARGB 4IOSA 4RRPG 5E9NA 1OAUH 1BVNP 2X38A 3DX6A 2V7HA 1T20B 2W0PA 1KB5L 2CO6A 3REWA 5T5FA 1MCSA 3T65B 5IEKB 2XQ0A 3ZE1F 4EI6B 1XR9B 4PHZA 2L7QA 3AU1B 1WBYB 2HLEB 2M26A 1JHTA 5IQ7L 2QPUA 4U1GC 3UAFA 3D07A 2P46B 2Q3AA 1KYUA 1CBVL 4FI8A 3GHEH 2FO4A 3QG7H 3O8XA 1I1AB 1S7TA 3KWWB 4L37B 4AKOA 4U1LA 4M8VA 1ADWA 4HUUB 4UILL 2J55A 4QJ4B 4GP5B 4WUUB 3MRPB 3BKCL 5DHVH 1J1OH 2E76C 2NR6A 5E94B 3EGSB 4YSDA 5F3HB 5J11B 1T4KB 4OT1H 1EX0A 3FB7A 3G6AA 4RX4D 4WEMB 5EO9B 4OCMC 1Q9OA 2BIIA 1E5BA 4M6NH 3BUPA 1JF1A 1N2RB 4XCCH 2VUOA 3K6NA 3F04A 4AW7A 4G6FD 1M05B 2J2ZA 4PI0A 4X4ME 1XAKA 3LSOA 4HPOL 4KTYA 2CKBH 1JWUA 3ISRA 4LLWA 1WIPA 2RTTA 5LXGH 3P77A 2HTLD 2WZ6A 3UACA 3KW7A 1TU2A 4C59B 43C9B 4L1DA 4RFEA 4MYPA 3FQ2A 4XNYL 3PGCB 4EUPA 1MELA 4B0MB 4PWKA 1UXWA 4PJ9A 2VXUL 3MLYH 1P1ZB 3GBML 4RQQB 3AS0A 9CGTA 1XGYH 4PP2B 2BMKA 4QHNB 4Y1TA 1U92B 4BJLA 2PYEB 4WNQB 1RSFA 3WTXA 1T5WB 1O9ZA 4H20H 4LU5L 1KEGL 3COOA 4M61A 3CX5J 1D6EA 1BOGB 4HEPG 3EOAB 3N41F 3QIBD 1I7TA 3HJ0A 2F1BA 3ZDXB 1M2VB 1U8QA 3W0WD 2I60L 1IGYB 4LOUC 1Q72H 3BUBA 5EPMB 3SDYL 2AJXL 3H42L 4AMWA 4FQQB 2BWDA 2J5LC 4L3ED 5ITBL 1KLGA 2DN7A 2ESVE 4L4VD 3RKDC 1LYQA 1LE5B 1NGZA 1PQZA 1S9YB 1OARH 3ABKB 3G5WA 4OLXH 3GSNH 4F57L 3G5VB 3G7TA 1U2CA 4NSKA 3NESA 1T1XB 1JBJA 4U6HB 2YBGA 4TQPA 4N8VB 1CI3M 3EYFA 2EDKA 5D2LF 2YSSB 1U95B 1OTTC 1NM9A 5FYKE 3GSNB 3TNNB 3PRZA 4M4PA 3RUGA 2CQVA 1OP3K 4OZIB 1EAJA 4ZRGA 3MV9E 4MS8C 2H6UA 3PL6C 3T0VA 1W2KT 2XTJE 3RFZB 5FPIA 1L9NA 4QD2E 4R7NB 4KK9C 4Z1PA 4KMLB 4DGIH 3D6GA 4JW3A 4HU2A 2ZPKL 4YHNA 3TPUB 3EJPA 1PTZA 2DIAA 1KCLA 1KB3A 3F7YB 4KDTC 1ZXKA 5E7BA 1ETZA 4JFFB 4LCWA 3MRHB 5ILTH 2X89A 2Z3FA 4XWGH 5HHNA 2DLFL 1BD2D 4Y5VC 3E7JA 4GLRH 5FV1L 2HVJA 1KCKA 1TPXB 4G8IA 5CLYA 4WU7A 4R6UA 2WZ0A 1H15B 3KVQA 4HEPA 3FSOA 3STLA 1GJWA 1W0VB 1JGLL 2YQBA 3V52L 2MNWA 32C2A 4TL5A 5EBLA 4CBPA 4XC3H 3GWJA 1LO0H 3F7PC 4G8EA 4NBXB 4WY7H 1KEGH 3CU1A 2IDTA 4HCIA 3VFMA 2A9NL 1F5WA 2ITCB 5DHMC 3QRFM 3BAKA 2AK4B 4HDIB 4HJUA 2WLIB 4ACPA 3MRNB 3EO9L 1GY2A 5J7CC 3ETSA 1KN2L 3QZWA 3WSQH 2BCMA 1C12B 4NHUA 1H3WM 2H3NA 3I3EA 3PAUA 5DUPL 4ANWA 5GGVL 4N8PA 5E2VL 4FXKB 4JFDD 1PJ9A 5MHSD 3Q2NA 1EERB 1H8NA 4PJ8A 2EXYD 1KGIA 2V9RA 1T89C 1SHXA 3CDZA 2O5ZL 5B1JA 4XTRC 3ESMA 1AGCA 3UZVB 2CRYA 4FF9A 1AYRA 1DANT 2NNXA 2R2CA 3M17B 4QOKB 5DJ0A 2LABA 3DX0A 2FH8A 3GXNA 4LHUB 1MLCA 4NNXB 3ZZSA 4B3EA 5T3ZD 4HS3B 4DCQB 1ML0A 2D4DA 2X4QA 4Z7UB 1WWCA 2YQ3A 1QVOB 1CF1A 4MQSB 1MY5A 4I1RA 3U46A 1DJXA 1IEBA 1OAXL 2C1OA 3F5WA 3HVNA 3GS4A 2DWXA 5J5EA 2VLME 4BXSV 1CPUA 1WLHA 2W0FB 2IOMA 4QTHB 2L7UA 3QO1B 2IADB 1KT2B 1ZGLA 5PAZA 4LKXA 1HJCA 4JMNA 1OB1A 4U4BA 1QSED 5EORH 2A9ML 4NNPH 4O2FA 3PABB 4NS0A 4O51B 3Q2VA 4ADJA 3CMOL 1BBJA 3QQ3B 4UINH 2E9JA 3D3VB 4U3HA 3F58H 3H4HA 4JO5A 5A6LA 2KLSA 5MERA 1GMIA 1X5KA 3BCDA 5F1NA 4LKCA 1MFCL 3A3YB 1HXYA 4JN2B 3L3GB 5E03A 2YUWA 2YFOA 1I1RA 2XI9A 4NQTA 2IAMB 4GMTH 3UAJD 1NGYA 1OAQH 4HW6A 1JGVL 2BDNH 3GO1H 3RIAK 4TYUA 1A7OH 1QFWM 4ZOCA 1GZQA 1MWAA 1EUTA 3QAZB 2EIDA 2GKIA 4J2XA 4Z3EA 3GK8H 1HXKA 4P23A 3FT1A 4AIOA 3ZSSA 3TBTA 3FQNB 4OI9A 3V5KA 5GRUL 4KJYA 3SJVD 3US0A 3MRKB 1MCWM 4M7LH 2H3XC 4PJFA 4KKRA 4QRPE 1IKNA 3DGGA 5C07E 4G6ML 5F7BA 2X05A 4EEEA 1GOHA 2NY3D 4YDJA 4WGVB 1FFNB 4JO2L 5T5FH 1DEDA 3VXME 3DARA 4KNSA 5FUZH 1DSFL 3QZBA 4J6RL 3H2PA 5ISZD 1EUUA 4I4WA 4CC4C 5SX5H 1TXKA 2WXIA 4I1NB 3ARWA 5L6YH 3WFBH 4KXCA 2P24B 4WUUD 1OCZB 2R29L 1F00I 1J8RA 3HC0B 1R4XA 3NZUA 4FFYH 5D4IA 1XIWA 1SJHA 2DTSA 2P7TA 3AVEA 4TNVF 4ONGL 3FMGH 4YDVB 1BM3L 3QUZC 5C0ND 1OM3H 1DQQA 5D1XA 3W1ZA 3MUGA 1IVLA 4M62H 3EBGA 3V9EA 2WC7A 4G8GD 1IC1A 3P0YL 1JD9A 1OSZA 4GNKB 5I0YA 3U0WH 1XGQA 3L5XH 4Y88A 2WXMA 4NGHL 1K5WA 1NLDL 3ARGC 3HI6H 5A1AA 4NERA 5E95B 1KCWA 5IKCA 1UWFA 2QQLL 2G0LA 5DJAA 1YDPA 3IU4L 5CCHE 1MHHA 3L5WB 1NCUA 3OKLA 1J05B 3IWUA 2JI3A 3T4YA 1X5LA 5FO9B 3OC8A 3SN6N 1WYJA 1U6AL 3GGWA 5FIEA 5DRWA 3K71A 4H40A 1TEYA 2WQ8A 4P2AA 1ORSA 4GKNA 4U49A 1AR2A 4DIXA 4MDIB 3KVPA 5IBLC 2ZUVA 4WO4B 1O6SA 3SQOL 4KXDA 5AFAA 2ZXWB 3M1BB 4PB0H 3UTZA 1TJMA 3W57A 4L8DB 4LMQE 3II2A 1TCRA 1V54B 3L8QA 3M1CA 2F8IA 4PJ5D 5IB3B 4P3WA 4HF5H 3V7AG 5F1IA 1YUHA 3FFCA 2YGNA 4NKDA 2VZTA 4LLVA 2XACC 5DLML 1RQ5A 3CSPA 2FJFA 1JVKA 4UM9A 5CJ8A 4MA7L 3UTTE 4XMUA 4RGNC 2W8CA 3NFNA 2OMWB 1UURA 2HJFA 5D93C 3QUXA 3FK3A 4KWUA 1PNCA 3L4TA 2ZONA 1MCCA 3RWFA 3V6OA 3OBAA 1AC6A 3O6LH 2L0DA 1GTNA 5F89A 3O2WL 1LO4L 3RE0A 1I3RB 3MRJB 3RHWF 1HEZB 5GJTL 4P5MA 2NT1A 1S7RB 4PJDB 3S36H 3FDWA 3FT3B 3WIHH 5BS0E 1ZDQA 2FT7A 5I1AB 1AH1A 2J88H 4JKKA 1LNUB 4JKPH 3NSDA 3IDNB 2AAVA 2X6BA 3H9YA 3MJWA 3N9GH 5DJ2A 3KDPB 5IQ9A 2R0ZH 6FABL 1S7VB 1IB5A 2Y36L 3Q5YA 4JKLA 1W0WA 1NCDL 4UQ3A 4PJXA 3W5NA 3DHMA 3PAYA 4XE5B 3SPVB 2AGJL 3TIDA 1PX4A 2EDTA 4N0FA 3WHXA 3RDJA 1DBJH 1ZHLA 3CBJB 3GSXA 4M29A 1XF2A 1DQIA 3LIZA 1ZT1B 4OSUH 5GGTA 1DJIA 1ZA3B 4PW3A 3V6OC 1RUPH 2OMZA 4FKKA 4BSWB 2ARJA 4BK5C 3AY4C 2WVVB 2IWKA 2J88L 2BNQE 3B8YA 3ZE1E 1I7UB 3VXQA 3VXMA 2CBMA 5L2JB 1KIUA 4XMZA 5C07A 4KI5E 1SY6L 1QR1A 4FQ1H 2OYKA 3FQ4A 5F7LB 1FNGB 3O6ML 4MJIB 3LN4B 4MD5A 4GI8A 3V6OE 3VGFA 5JA8B 1N3NA 3PDOA 1ZT4A 1M56B 1UA7A 4MAYD 5G5DA 1ZTMA 5LG1A 4MYWB 3UPAA 5T1DL 7FABH 5C9JB 3U9WA 4ZDHB 3IJ8A 1G9NH 4HCFA 4APXA 4PG9B 3LZLA 3QNZB 3UL4A 3LB6D 3VJ6B 1SHSA 3BO8A 5FYJH 5TDOA 3KPRA 3L1OH 5IW1B 5JPMC 4JUTA 1R3LB 3K91A 1DJYA 1I82A 3VU2A 2VLJD 2CBTA 1CFTA 3B5GA 2IANB 2UY6B 5FO7A 1RURL 3HG1D 1BCIA 1O7DE 2ATPB 4NQED 2E7LC 4ELMB 5H37G 2Y1AA 1UCTA 4YQXL 1O6VA 3IJHB 1B0RB 5F7WC 3T2NL 2N1KA 4WTZG 5LBVA 2ZXCA 1HL9A 2KMWA 3SO3C 2IEPA 3EYQD 2CO4A 2BP3A 1IJ9A 2WCSA 4JQIL 5FM4A 3S5ZA 2EEFA 1VEOA 4NN5B 3L7EB 3L1EA 1RFDH 2CLVB 2J8UB 2CHXA 1ZLSH 4ORGA 3LZRA 1X9QA 3PNWA 3X1NA 2DQIL 5JDSB 4D3CL 1JXGA 1NEZA 4WDIA 5MI0C 3VGAC 7PAZA 2PYFB 1YMHB 3MQIA 4Y1SA 4XTRD 1IBZA 1XGRA 2W65B 2A6IA 1SN5A 2QKSA 4KNQA 1INQB 2AJUL 5AKRA 4DKAA 3I9IA 1BPLB 1FAIH 1EO8H 4KPHH 4RMQA 5GGRB 3MREA 1FVEA 3SDCA 1T1WA 2ZUQC 5FYJL 4OF6A 5HYEA 1BZ9B 4C56D 2G3XA 1O7DC 1SEBB 1DJGA 4FQLL 2UX6A 4U05A 5FDYA 4CDHA 2Q86A 1QWNA 3B34A 4N2MA 4AT6B 5IUCA 4OUUB 1T21B 4EN2A 1KTJA 2XZQH 3I2CH 1NWPA 3KPLB 4WWNA 4DZBA 4MLIA 4QXTB 4H0LC 3MCKB 5IJBC 3KM2A 4DKDC 1V55B 3OPZL 3THML 4AK2A 2QQNL 2C3XA 4O9HH 4PY7A 4ODVH 4XNXH 1KXTA 4X6EB 3N0AA 3IDXH 3NIFB 3TN0D 4FZEH 5JNYB 1KSRA 1YECL 2D9QB 1DZBA 3BPOC 4L3EA 3CN4A 4NNYA 2R51A 1RU9L 3D69B 3QIWB 1A9EB 1QPKA 2AK1H 3SDAA 1LEKB 3DPBB 25C8L 4BZ1H 3FFCE 3PWPD 4JPKL 5EBGA 1OHQA 1R24B 3S5LB 1R1CA 1I8KB 5IR1B 1F0LA 1HL5A 2H6PB 3IJSA 4Y2OA 4Y5YC 1FL5B 5E8OA 4JFDE 3U36B 4C4KO 4TSCH 4N2EA 2R56H 5LBGA 1GAFL 2VLRA 3ARUA 1KB9J 5E8PA 3SQBB 4AG4L 3MRQA 1OLLA 1ORQA 2NY5L 3CHQA 3LTVA 1Z7JA 3R06A 2ZSWA 4PRHB 4TNWK 3QZMA 3CMOH 5BUGA 5FO8A 4HHAB 4PJ9D 2BIOA 3TJEL 4H25B 7CGTA 4LZKA 3NZHL 5E8EA 4P4KC 4JO4L 2CHZA 4OQTA 4NKMB 4CN4A 1HVXA 3R1GH 1D9KA 5ECJE 3SE9H 4K71C 3VI3F 3S88H 1BYPA 1UWGL 3TO2A 3ATFA 3QJUB 3S37H 4DPAX 2QFRA 2AC0A 2XX1A 1LO4H 4PJ8C 3VWKA 1DJSA 4M4RB 1BD2E 3CVHH 4PQXA 2W0KA 3TFKC 4ZJ9A 2PO6A 3D0VB 4FXGC 3SGJA 3W0WB 1H3PH 4X6DF 2FT8A 1XF4A 2CMRH 1F8TL 1XGUB 2BCKB 3PXHA 5E23A 4IS6B 2LV4A 3UPCA 1YYCA 1AP2A 3FRPA 2NCMA 4BSVB 2XHNA 1DFBH 2DH2A 3QEQB 3HMWH 4WZ9A 4XNQB 2IPTH 1C9SA 3VFUB 3SPJA 2W88A 3DROB 3U6XA 3WJJA 2N4IA 3F8UB 4RZCA 1VZHA 4HZLB 1WZLA 4N5ED 4DQOH 3F6IA 2OL3H 1JPFA 1OT2A 1U3NA 4MRBA 1KC5L 5C0CD 1NGXB 4YC2C 3FB5A 2YZ8A 3VVVA 3VQ1C 2OMYA 2BWQA 1OK0A 4QHUA 5GS1A 1F1AA 4GBXC 4LOFA 2YA2A 4NN6C 3VFTA 3DOSA 1E9PA 1MJ8L 1NIFA 3E6HA 1WRFA 2GIYA 5E1QA 1S7QB 3Q9QA 4QTIH 1U8KB 3STBA 3MRBA 1TQCB 4P2YA 2CUAA 4GP8B 4K71B 1WCBB 5LGKA 2K3TA 2GJ6A 5I1JL 4X83A 2NY3B 2KPNA 1WGVA 3A47A 2IBZX 3IMTA 5ADPH 4E9XA 1KB5B 5DJDB 1OTUC 1JK8B 5IM7A 3NIGB 1NICA 1XO8A 3CDYA 1AKJD 1UH3A 5T1MB 1AGEB 2XV6B 2IGTA 2NNRA 1EEYB 1NLDH 4PJIF 3S6CA 2ICWB 4HAFA 2ZPKH 3NPSC 1WK0A 3DLQR 2A99A 4PGEA 2F15A 1JGUH 4KRNA 2XWCA 5J06A 5KYNA 2EC9T 4ILDA 4OCYL 2Y6SC 4BUHA 3PWPB 5T3XE 4J39A 1RVFH 1QD0A 2I32A 3RZCD 2NR6D 4KQ3L 3RWHB 5CEZH 5AOJA 4CVZB 2IWGA 3FTWA 3JXAA 5KBLA 4N2KA 3O6FB 3Q8BA 4FFWD 4GS7B 3QIBC 2A5UA 1BQLH 5DVOA 3N2JA 2DWYA 1X9LA 4RFOH 1NGPH 2AQRA 3DOHA 4L8BA 4NZUL 1HIMH 3TZVD 4BGLA 1LL1A 5L6YL 1J5OL 2VZ1A 1AZUA 3PU7A 4IK7A 4M3JA 3WTVA 3SJVE 2Z35A 3ROOB 4MX7A 2DQJH 2DLEA 4GG8B 4N90D 3OR6A 4NI3A 2Z31B 2BW4A 3KAAA 4R26L 5AW5B 1QFWI 4RSYA 1TO5A 1WCBA 3M45A 2BIPA 3T0EB 1E65A 2PTTA 1MZYA 4PD4K 3X1FA 2I60H 3MRBB 4ZX6A 4XMVA 2LFEA 1U8KA 2HH0L 3HZVB 5AW6B 1NUDA 2YKLH 1GTFA 4F37K 3DOSB 2P5WA 4PWHA 4V1DB 2RA1A 5IVXA 1GH7A 2XN9D 4FXKC 4JHWH 2IH3B 5KSUA 4N2FA 1H0DB 5E1GA 1HL8A 5I15L 3DPDA 3MA7B 1QA9B 2PWEA 2AEWA 4HLZH 5K1NA 1JZ5A 3BUYA 1KG0A 4JFOB 1B2YA 2GHZA 4RIRA 4RZCB 3F58L 3VFVA 2HKFH 4W9ZA 2YAOA 4XNQA 5D55A 3MSPA 1ZOXA 4HAGA 3KYKL 1KWGA 4PJIA 4M9OA 2D0GA 4ODUA 4BSVA 1JPGA 2O4EA 3FU0A 1NC4D 4X7FC 5J9PA 5EZJA 3POHA 1XGUA 1XF4B 3U2JA 3OQRA 2NY7H 4FYRA 4DO6A 1MF2L 1T22B 2JQMA 2Q5BA 2PO6B 3D0VA 4HQQH 2F53B 4YDZA 3RGVC 3D05A 2DYPD 3QA3B 1HINH 2XA8H 3GXUB 4Y19D 1KLFA 1M71A 2HCZX 1UFGA 4AIXA 4RISH 4EF3A 4X6CE 1JOIA 1XGTB 4FOMA 1CU4L 4K9JA 3TO2B 5I6LA 5KTEL 1TZHB 1UC6A 3OXSB 1ED3B 3NN8A 1D9KB 2CH8A 3MZGB 1PX8A 4KY1H 4NKMA 1A7OL 5A40E 1MFEL 1JGDB 4B9PA 3GO1L 4ESKA 3PUUA 3UZQA 1FNHA 3UJJL 5E2UH 5E00A 3GSQA 4HOMA 2AXJA 2ZSWB 4L48A 4YLBA 3ZE1B 1ORQB 1KCUL 3C6LA 5CZKA 2VLRB 2DM2A 4JJ5A 4MDRA 1Q8MA 3U4AA 3HC3L 3WXWL 4E5XG 2QSCL 1JPST 3DUHA 3UO8B 4A7QA 1RZPA 2H2PD 3BZ5A 5ICUA 1RIUH 1YNTB 3MBWA 2XNAA 1I8KA 4B9KC 3MOAH 3P9MA 4NC1E 1YN6B 4JFPB 2W9EH 3CG8A 2I07A 3QDGA 1AKJA 3AB0B 3UJJH 4G1MB 5E6YA 1AQMA 1TR7A 4DWHA 2RD0A 3LMJH 5J3HD 4Z7WE 1Y6KR 4Z7VA 1XIWD 3HB3D 3MOQA 3NDYE 3OPUA 5JNYA 4PV8B 4WHCA 3U7AA 1CR9H 2VXSL 4Z0XB 4IQHA 1J5CA 4ZPTB 2KZWA 3LEVL 5ABZA 2VL4A 3QG6B 5DTFA 1CTOA 2NY0C 1L6ZA 4Q56A 2XKUA 4QXTA 2YC1B 3JWDC 3O8XC 1I7ZB 2V8LA 4GUQA 4APQD 4IRSD 4F3FA 2B5IC 1QNIA 1T0OA 3FBKA 3GXIA 3INUL 4K9EH 4PJFF 2QHRH 4YDLC 2ZYHA 1AO7D 3L9YA 1D9KC 1RUMH 1SEBA 2NNAA 3TA3D 1N5YL 4YEFA 1AHWB 3O3DB 1T1WB 3FB6A 1ILSA 2CK0L 1KEMH 3MREB 4UOJA 4WI7A 1H5BA 1LK3L 4X6BA 4Y19A 1OCCB 1RCYA 4XAWL 4PIRF 2Z93B 3FXIC 3Q48A 1S7XA 4L4TE 1ZRUA 4FJ6A 3M88A 5INDB 1MZZA 1NEZB 4XNUH 2KZBA 4QRUA 3DX7A 4DKFL 3PNWB 2CLVA 4ZUWB 2G60L 1MREH 3D30A 1Q0YH 4KHTL 3Q9PA 5D93B 2HH0H 2BOLA 5C08E 3ZN6A 5AYTA 3RVXD 3HE7D 2BH0A 3JTSB 1HL4A 1X5IA 2BVPA 1NOLA 2WLZA 1J7VR 4MQXD 4ZO7A 2P8LA 1MH5A 4AEEA 3DX3A 5F0LB 4GPVA 3BYYA 5T3ZE 3CGTA 4NKOB 3RTQA 4W9GC 1B0RA 4KZCA 1E6OH 1P7BA 5AUMA 2FEJA 4NZRL 1JRHL 5DZ9A 1BQHB 3ECWA 1N9PA 4KUZL 3UIZA 5FO7B 2HFFA 1EFQA 2IANA 2W07A 3VI4B 4WV1C 4JFFE 5AW8B 3WTTA 2EIEA 1XCQB 4M1CC 1JIBA 2CJUL 1R3LA 3SY0A 1JF6A 1I8AA 5AAMA 1NWOA 1A21A 1KYFA 4K73A 4MD4A 2YMTA 3J7HA 5TDOB 1KV7A 4R9HA 4Y4KD 1Q1PA 3OMNB 1BOYA 1KN4H 4KK6D 2H26A 3EDFA 3B37A 4M7JL 3QNZA 4OV6F 3LKNA 4APXB 1RZGA 1CYGA 4BFFA 1WSST 2CDEB 4ZDHA 4JFHE 2AXWA 2OMTB 3GPSA 2B4CL 4JZJC 4P4KD 4XN4A 4G6FB 4LL4A 1LMKA 3RZCB 4P2OB 1SLXA 1R0AH 4AX3A 2X40A 1MIEH 4XN2A 4AL8C 3GSNL 1ZT4B 4AM0B 3GMPB 3IVKA 3BDBA 1XH2A 2CR0A 2YGQA 1UJ3A 4ZFQA 2A6DB 3KLHD 4ONOA 2FHCA 2F1EA 4LARH 1JPSL 3VXMB 4PYHA 2H3KA 3I75A 4LPCA 1NCAH 1HWGB 1BLNA 3EXLA 5HI5D 2OAAA 4ZOEA 2A1WH 3L4YA 4JRFA 5T1KA 1TVBA 2OMZB 4BSWA 3UGEA 3D0LB 4G6KL 2O5XL 4AI7A 2WLNA 3CH8A 4MAYB 1UUSA 4L29A 3GSXB 4AENA 4QOKE 3NAAH 3X1EA 4K94C 3NK4A 4EOWH 3N50A 4JG0L 4WFHD 3RG1C 1YMMD 4NPKA 3K2IA 4YXLL 1W0WB 1O9VA 2IJ0C 2V5RA 4NQCE 5AVYB 4GEJA 2C9PA 3IDNA 4M7KL 4OJAA 1G7JA 4DERA 4GRLD 2NUTB 3I02B 1PFOA 4PJBE 4S1RL 2XLLA 1VAHA 2YMXH 1YYML 1HEZA 2IAND 4YHKL 4ZUUA 5JYMA 3T3MF 5FUCE 4GI6A 2BSBA 1AGFA 3WFDL 3ZDYE 3VNYA 3UMTA 4ECNA 1CU4H 3K2UH 1NCWL 2G5UA 3RWFB 4IRJB 3DTUB 4Y4KA 3BQUB 2VMCA 4JY5L 4B97A 5I76A 3KJ4C 3C8HA 3GIZH 2XRAL 3TASA 3WUZA 3IFOA 5GS0H 4NFDA 1ACXA 2HJFB 2BZDA 5H4ZA 5ANHA 1XWVA 2A6JB 4F8QA 3IK2A 1JZ3A 5B1JC 2VLKD 4XOEA 4FDWA 5HGHA 2OFQA 3C2SA 2EIJB 1E43A 2FQDA 3V6FB 1P4IH 3JWOC 1G7HB 2OZ4A 4U1KA 3DTXB 3KPOB 4GW4A 2WUBH 3IPBA 5F1IB 2ZOUA 1J0HA 4G5ZH 4A6YH 1U8MB 2ZCHL 3HE7C 4PWFA 1TJXA 4LOVA 2QDWA 2ZWYA 2F19H 3BGFB 2EDHA 3RFRA 5BVPH 3CC1A 4LSVL 5EO0B 3B3BA 1XTMA 1S2EA 5I1HH 2K1MA 4PCTA 3SDCD 3SO3B 2OSLB 1Z3GH 1O6SB 4XO4A 3R0NA 2I9TA 3MV9B 4MDIA 2YQGA 5PCYA 2X4RB 3NZ8B 4N0CD 1A0QH 1J87A 4GYBA 2GC4C 5FGBA 5TFSH 3H3PH 1A7PH 4M6ML 2DYRB 3A23A 2AJYL 4LIQH 1MHHB 3L5WA 1QLEB 1GGUA 1YDPB 2Y5QA 3TH4T 2UV3A 4LLAA 4Y4HC 4HT1L 1UXMA 5JHAA 2B8OT 5CU9A 2DY2A 5DYOA 3MRMB 3QXAA 1HAUA 1SOKA 2IDUA 4X7TB 3TIEA 2WIMA 4JFDB 2PXYA 3SBQA 3UBXI 2WXJA 4UQDA 1FVCA 3LH8A 3UBXA 4X5RA 4NIKB 3GNMH 3NP3A 4KNUA 2XZQL 5E4IA 1ODUA 3SZ6A 1CXLA 4XOCA 4Y2LA 2D2CC 4JRXB 1HHGB 1JZJA 1KIPB 3SJVB 4OIBA 4DN3H 2E9WA 3KH3A 1SJHB 3U9UA 5KWYC 5CUSH 2E9GA 3JSSA 3N91A 4XB7A 3VXSB 4OCLC 1XTLA 4CGTA 3WN5C 2R69H 2X0WA 3KLDA 1MJUH 4MQ7A 1CC3A 3WL9B 1QFHA 1BFVL 1P7KB 5AB1A 1QYGL 3CTTA 5KVFE 4DNLA 2XICA 1IGJA 5IGXL 1FLRH 1MCWW 4N26A 4D0DB 4P59L 2WD0A 4DAGL 3VXPA 2R2BB 4OCSH 4E0RB 3V5KB 2DBLL 4JRYA 1L3NA 1NFIA 3TBTB 4OI7A 2N0KA 1FPTH 5D7IF 3O0LA 1MWAB 1P69B 5JW4N 3G9VA 3OLGA 3N85H 1MW3A 1CFVH 1TJIL 4PJGF 5FKAA 3ECBB 1TKWA 1I31A 2ENJA 3D9AL 3O6KL 4BZ2A 1GCFA 2GW5A 1HXYB 3Q44A 3A4EA 3O0RL 2JCWA 5D6CA 4LKCB 4Q4IA 1J86A 5F1NB 4HKXB 5MERB 4FQCH 3B9DA 3NSXA 2WWOA 2F0CA 2FX8L 2JKLA 4K23H 4OD3H 5D2LA 4DP1X 1WISA 3QQ3A 4Y2DD 4PJ5E 1RJZB 4EIGB 2CO2A 5C0NC 3FUFA 4O2FB 4YK4B 2VRAA 2NY0B 4DZ8B 5I17B 2DLGA 1KT2A 1ZGLB 2IADA 4ZUTA 5H94B 3QXUA 2FL5B 2TSAA 5DFVD 1SEQH 2W0FA 4NQDA 3V7MA 4UOQA 3VDCA 3MRIB 1KTLB 5E99L 3W3BA 3C75A 3QIUC 4Z7UA 4HGWA 4IRSB 1XH3A 1JNHA 4W4OC 1CD0A 4XN8A 3ZR5A 2YEZA 4DCQA 2NY3C 1MLCB 1IEAA 2IMNA 4NNXA 1T66C 1PVHA 2B59B 4Q4EA 3KH4A 1X5HA 4RGMC 3CFCL 2HFGL 2JJSA 3L4CA 4UT7H 4FP8L 4P2OD 1GGCL 3SEPA 4L23A 4ODSH 4YSCA 1QPPA 1VSCA 2DLHA 2VDLH 1KCRL 3RRQA 4KI5D 5ESAA 3C8DA 3CN3A 2P5WD 2P80A 5F9JA 1S8DB 1BMWA 4Y5VB 2Y2WA 3T1WA 3SZKC 1C12A 4GG6F 2X1OA 3PP3H 2CR6A 3UAJC 3V8CA 3QZWB 5F71A 4CC0A 3F85A 3ABZA 4K23L 2DWSA 2IGLA 3EDJA 4HDIA 4ZD3H 1U8NB 2ZSVB 5KSAB 3QZNA 3S35X 5FCSH 4PLKD 2MIZA 3LY6A 2ZJSL 3QIUA 5TQ2H 3VFMB 2KUTA 2XKNA 2AJVH 4ZUVA 4FG6D 1W0VA 5GISH 4WVRA 3STLB 2FO8A 5K93A 4F9PA 4M3HA 1SLWA 3GZPA 5HHNB 4HIJA 1FH5H 2R1YA 3OB8A 3WGUB 2NYZA 4XVJH 4UQ2B 2VISA 4PJ5B 1BG1A 1BZ8A 2QQNH 5SV3A 5IZ7A 3T4AC 4YHNB 3NCXA 5C6TH 2FZ3A 5T1KD 2WN2A 3MJ8B 3B9KD 3BIBX 1EQWA 2JTYA 3S34L 3VB8A 5I1CH 5JHLH 5IT2H 1BXXA 3ZMRA 2FH6A 4DP4X 4U31A 1KGYE 1UACL 2PTUA 3NSJA 5DHXB 3WIIL 3WIFB 3CX2A 3ZHFA 3ARQA 4P2CG 4ONGH 3GSNA 3MV7D 4Q6YA 4XMPL 5K9OA 2YSSA 2QPEB 3EYFB 3MJ9L 4UT9H 3GIVB 3JYBA 3TVMA 4DN3L 4U6HA 4J5VA 3V6ZA 4JREC 3VI4F 1T1XA 4WTQA 4XP1L 2FZ3B 1PKQB 5DZLA 1S9YA 4JANB 2P80D 5AD0B 1LE5A 2H4EA 1CE6B 1BJ1J 2W80C 1LWHA 3GRGA 3LD8C 3TCXA 1QRNB 2FWOB 2B16A 3CV5A 3VXRE 3LXUX 4PJXF 4UQ2A 1CDCA 4HIJB 5EPMA 4AMKH 4HLJA 1IGYA 4G7SB 2NRDA 2WLJA 1VGKA 3L3DA 2BRQA 1U8QB 3R8QA 1IX2A 1NAKH 3NIGF 3NGBB 5C0AB 4MA3A 4P06A 3BSZL 2DTMH 1CD1B 2VW7A 3LZQA 5C08A 5CNHA 5IMMB 2R4SL 4WNQA 4KRLB 2VZOA 3QCTH 4QHNA 2BMKB 1KV3A 1NCHA 2OTWA 4PP2A 5D70L 5KSAA 1QLEH 2KLRA 4MD0B 4A2GA 5FAAA 1OM3L 4G5ZL 3LEXB 5HHXL 3EH3B 3L1OL 4G7VH 4MGXA 2B7DT 5EEWA 3CXFA 4BD4A 4UQBA 2M2DA 1S8DA 5GGQH 3VYPA 1WV7T 4N28A 4ONFH 4OJDH 1OTTD 3ABLB 1YEEH 4ZW5A 3P2DA 4JB9H 5CMAB 5F0JB 3BXNA 4K9EC 4LT7A 1Q9OB 2IAMD 2WJ7A 3EAKA 3G6AB 4PRPD 3WDHA 1H5BC 2G2RB 5DHDA 3TLRA 2HPTA 1RPKA 3LZOA 3WXVH 2EDBA 1A25A 3EGSA 5B21A 4B9GA 4FHKA 1XH3B 4HGWB 3IAPA 3AY4A 1A1NA 6TAAA 1XF5A 4U1LB 5C2UB 4P99A 1CZ8L 4OGXH 5FA4A 5B8CC 4NDMB 4NQDB 2DQHL 4L37A 1I1AA 1S7TB 4AQ1B 4AMXA 4OFQA 1H9VA 3AXHA 4Q89A 2PWHA 4WW1B 1JHTB 4UTAH 1RJZA 4FI6A 1WBYA 5IVOA 3BVVA 1Y6MR 2IPUK 4ZXBC 2VNCA 3QWRA 4L5FE 3C8KA 4EI6A 2WYTA 3REWB 4HKXA 3T65A 2BNUB 2ENSA 3DWTA 2JCCE 4V33A 5CJQH 4DF9A 1X5AA 1DLHB 2RB8A 3MODH 4PI2A 4K3GA 5B1CA 4XVSH 4HA1A 1GS8A 2I7SA 4G6KH 4UUJB 5FKAB 5HDBF 2A9CA 4M3KB 4IOIB 1UZ6E 2HTLC 3QEQE 1PPIA 3SO5A 4JPWH 1EJ8A 1GGIH 1GZHC 2V2XB 3HG2A 4FQIH 2Z8SA 2QKIA 3ZL2A 2E6QA 5LGJA 3U82B 5B7FA 4PRHD 3VXPB 2ZOKA 3AC0A 3MRCA 1X9UA 2F54E 3GSUB 4PRAB 3P3TA 4D0DA 4DAGH 1N4XH 3ELAT 4UU9A 4DVBA 3O2DH 4CILA 4EKXA 5I0ZA 3RDTA 1BD2A 4WO0A 5DA4A 1RHHB 2OJEA 3FTGB 4HIPA 4EN3A 1A6TA 1JHKH 3CSTA 3QUYC 4DGIL 1GA2A 1Z66A 1SDYA 2IOIA 4WNSA 2VRQA 5A7BA 5IWLA 2JK5B 4I0PA 5JIHA 5C0IA 3WL9A 2YRBA 1QBMH 2Z4QA 3BDYH 5DJZA 1FYHB 3AMKA 3F6LA 3SKOB 4X9GA 2HG0A 4F8PA 1HE7A 3RGVA 2NY1B 1TETH 3AXLB 4Z7UE 1SHMA 1KIPA 4ZMTA 1IV8A 4I18A 4DP8X 2PR4H 3LRKA 4LSTH 4BFBD 2WLLB 1B0GB 1BDYA 1BREA 5EFIA 2A73A 1J9SA 3VH8B 1E6OL 1Z0MA 3GHBL 4N0YL 3UBXB 4KJWD 1LO0L 4WY7L 4X5LA 5DYFA 4JFDA 3DX9B 5BZZA 3JWNC 2VM9A 5I75B 5C71A 3RTQC 2AQ3A 5JOFB 3QXAB 4WWPA 4FXTA 5E9AA 5KOMC 1BQHG 5KAQF 4PWGA 3LB6C 4XODA 4LIQL 3SDYH 1MI5D 3FO0L 2N7SA 5AVXB 5CLWA 3OWRA 2MOQA 3ELQA 1SQMA 4HZAA 4N0YH 2Y2TA 5I66B 1BSIA 4HUVA 2EC8A 4YHPB 5H35A 1I9IH 3CSYB 5FA3A 1UYWH 4QRPB 3WJLC 4L0YA 1EVUA 1UKQA 3P0YH 4LU5H 5ACZB 4M6OL 4P5RA 4WHTB 5EO0A 3FCUB 3CE1A 1NINA 3CX5K 3LN5B 5F97E 4KZ0A 3S3BB 3K2KA 5I1HL 2J73A 5GZOC 2F19L 1U8MA 4S1SH 4D0CA 2C9AA 5JYLA 2IIJA 4FXLA 4XNYH 4D8PB 3O3AB 1AS8A 3OG6B 5AAWC 5JHBA 5EWIL 3S7GA 3AG1B 1XD0A 3D5OF 2X6VA 1V7ML 4IOSD 3OKEB 5IHUL 3ULAB 4OGZA 1USQA 2CBOA 2VN5A 3RJDA 2ICEC 2C9QA 4DGYH 4DTGL 4P5SA 2X12A 4WKXA 2B2XH 2QHLA 4LL1A 3DXAE 4G6MH 3BQUA 5EU6B 1MCRA 4R96B 3EJCA 5HYFA 4NIYE 5L9DH 1B3JA 2MFNA 3EDKA 3NVQA 3IKCA 3AZUA 3QWRD 3LMJL 1J88A 1QG3A 4ZUUB 5K39B 5CEYA 3TYFA 1M3IA 1JMXA 2O6PA 2GY7B 3HIZA 4MXWL 1MLBB 1SBBA 2NUTA 2BS71 3WUWA 3ZQ9A 2VITB 4LHUD 3QK0A 4JM0A 3D2UA 5FKPB 3GDCA 5AW7B 3S2CA 3IFNH 4S11A 3DI2B 4FG4A 1MCPH 2M1KA 4G8FB 5BJTA 1PEZA 3M8OH 5D8JL 4EI5C 3WE1A 1JN6B 4AENB 4OZHF 5HJ3B 4IK6A 2WNWA 4X8GA 3UOAB 3S9DB 1CQKA 1M53A 4RGND 4WFFD 3RAJH 2ENYA 4KY1L 2VRKA 1QSFD 1AZCA 1VFMA 2AJZA 2FEDD 4X9HA 3D39A 1DR9A 3D85D 4NHCL 5LXGL 3IDGA 2VLJB 4XPBL 3OMZA 2D3JA 4BCZA 2RGSA 1K2DB 3EH5B 1GGBH 3EJYD 3ZDXF 4M6NL 1N0XL 4YXKL 3DX1A 4RMTA 3UJIL 3A6BL 3R18A 4P07A 4LLDB 2A6DA 2VABA 3BJ91 3C87A 2EE6A 5LQBH 2QSVA 3CVDA 1TQBB 4PN6A 1E27A 1HINL 1I1CA 3GMPA 5F3BA 1DQDL 4AM0A 1MJJA 3PWUB 1FIEA 4M5YH 4ONFL 1GYCA 1KFAH 1RLBA 3HUJE 4M93B 3STZA 3UDWC 3ZT5A 2O5ZH 4UNUA 3RZCA 3T9WA 3WS3B 4B0MM 4H1LH 5DEGB 4LPVA 2GEQA 2HX7A 3KYKH 2HKAA 3LKNB 2FJHB 1CK0L 1J9RA 4OFPA 3EF7A 3PUCA 5I15H 1JERA 2CJSA 4CMHC 1R46A 2J1KA 1EIBA 3N1FC 4MD4B 3ZT6A 4PJGB 3ECUA 2QTEA 3A6CL 1KJ2A 4M6OH 4KKNA 4N22A 4P9HL 2EABA 3MCYA 5F7YC 4ZFZA 3L3OB 4YSOA 5M95B 1QI4A 2W07B 1EZUA 2B0SH 4TVUA 1KIRB 4PJEE 4HGMA 4OZIE 1PZBA 1FO0A 2VKWA 3P9WB 3MGTB 4LAJH 3X1GA 3FO0H 2MPAH 2WBJA 4K3DL 3QUZD 3RTQB 2ZCKH 5DFAA 3P0VL 1DVTA 4BH8B 3GLAA 4Z3HA 1CDIA 3FO9B 4BZ2L 3GMOB 2EE9A 4U3SA 2DI7A 3I9GH 4HUWB 5DRNA 5IB4A 4XT1C 2DQJL 4JO1H 1GOFA 3EJUA 1OY3B 4I85A 1J5DA 4KHTH 4RRPM 3HZYB 4U33A 4Y7MA 4LASH 5F7EH 4JKWA 2MPAL 4QRUB 2ADFL 1V10A 1YRKA 4QXVA 3GRWA 2F6AA 2VT0A 4TL4A 1R5VA 1H19A 1Z6JT 2Z93A 1CFBA 3ARDC 1ZLUH 3ZYZA 2VQ4A 4Y19B 1D7FA 3W9DB 3I84A 4G11A 5L8LB 3MUY1 5F6IC 3V0JA 1E3ZA 2NNAB 3D50A 3Q1EA 5D9SA 4Y1AB 1T04B 1FV1B 5MEOB 4NLAA 4LPYA 5KEZA 5F9OH 1CD9B 1MIMH 1I7ZA 5FYJU 3T8MA 4DUVA 4ZNEA 3OLIA 2JB5L 5IY5B 1MNUH 2Z31D 4QHKJ 1T7VA 4JZJB 5ADPL 3OJDA 4D94A 4NO0B 4NQDD 1XCTB 3HNVL 1F4XL 3ZKND 4WF7A 4PTUA 4ZPTA 2DMBA 2VDMB 1I8IA 2CNZA 4FQIL 3ARBD 4F27A 3GSVA 5KS9A 3EFDL 1FDLL 2F7OA 3H1ZA 1RUQL 1E5ZA 3MLWL 4AEFA 3MOBL 4L0PB 4Z7VB 5J6SA 3IJ7A 5A16A 4X6DE 1G0XA 4G1MA 4QTIL 2VH5L 1MHEB 2DIEA 2I07B 2B08A 1QBBA 3P9MB 5HPMA 3BH9B 3LRLA 2XNAB 1A9BB 1YNTA 4GQ9L 3DYMA 3MRDB 5KN5B 4MJJA 5F7AA 3WEMA 4RLDA 1BIIA 1HHHB 3L81A 1FNLA 2NPLX 4JJ5B 3QXDB 3C6LB 4U1MA 1KCSH 1Z3RA 1HSBA 3GSQB 1DN0A 3UZEA 1KCRH 1IFRA 1P5UB 3UZQB 4CVUA 5J13B 1GS6X 3OHXA 4N86A 4ADGA 3IJEB 3O4LE 1VCBC 1BZ7B 3WLWC 2K7PA 1ZS8A 4PJHE 3MROB 4W9LC 3IPFA 4A7GA 3FQYA 4MAZA 4ELME 1TZHA 2WQVA 2HVKB 4L1SA 4K3EH 1XGTA 2BVYA 3B5TA 3K1DA 5I2IA 5JPMB 5CBEB 3L17A 2R23A 1M71B 3P4MB 2WW8A 4DJMA 3MLRL 1AOHA 4DT2A 1NMCB 3MGAA 2OM5A 1MF2H 4HQQL 3QWQB 5EZJB 2VMFA 4JFZL 2BJML 3IWVA 1JPGB 1DEEA 5HVWA 4JB9L 1VGEH 2HMIC 4MXQD 2ZUQB 1I3VA 2JI2A 3T0EC 3BVDB 4HOXA 4Z3TA 2X3CA 5BXFB 4HUNB 4OF3A 4F7TA 3VFVB 3PQYD 3LRGA 1KG0B 1RP8A 4CMMB 3QHFH 2X28A 2A77L 4QIRA 3MA7A 5F6HJ 1BA9A 4QRRE 3ARBA 5HHOD 4PLNC 3GDBA 5CZVL 1QWHA 3T08A 1E0OB 4TF4A 4XRCA 1NCTA 2WWNA 2BHYA 2IAAC 1X4YA 3SDAC 5DVNA 3HZVA 4GW1A 4PJDF 5CGMA 1MI5B 2NSMA 5GZNA 3CFUA 3RNQB 1JF5A 5DD1H 4MNHB 3T0EA 3TVMD 3QCVL 2M83A 2VDRL 5CHNA 1KZQA 1U33A 5KYWA 1P7HL 4L4VA 4K8RD 5EIVA 1OGPA 1NJ9B 2JVUA 3FOLB 4MX7B 5D4QA 2Z35B 1V8HA 1FRGH 4OF8A 2GK0B 5DGRA 3ROOA 5CSGA 4Y4HB 2ZG3A 2D31B 3S96B 1G0DA 1MW2A 2BNRE 2HZHA 4LAQL 4E9WA 2AXFB 2WCPA 1IEHA 2J5LB 5TJWK 2YPLB 1FYTD 3ZYOA 4R0LA 1D7CA 5L2KB 3QZPA 3UTSD 3MJ9H 4K55A 2X1WL 4YDIL 1MPAL 2HTKD 4QWWD 3VD5A 2UX7A 2Q6WB 5E2TL 3PWPA 3PP3K 2HLAA 2IH1A 2YPLA 4NC2B 5KVGE 3VA2C 2KERA 5J3HC 2AXFA 3P3YA 3FUEA 3BUTA 3FUKA 2QR0A 1KJ3L 1QBAA 2RJMA 3AW5A 3HBGA 2VXTH 3MA9H 3UTTD 2YN5A 4P2RE 5AOMA 4HWBL 1EEYA 1WBZB 5FUOH 1NCCL 4KI1A 1E28B 3BKYL 1VESA 4Z7VF 5LNGA 4Z0BH 1KB5A 5DJDA 4ALAL 4BE5A 2NZIA 3SD5A 2YAHA 1M6UA 1PSKL 5DC0A 4RDBA 1P84J 1IZKA 1W15A 3UG4A 2GBUA 2JLPA 4HULB 3UO1H 5I0VA 5KVGH 3POCA 1A3LH 5BZDB 4B41A 2R2HB 3FQTA 5CSBA 4XRCB 4QHUB 3GD1C 4LO9A 3AXIA 2OMYB 3WE6B 1LO3L 2KL6A 1NGXA 1XB6A 3P40A 2JB6A 3UABA 2FUTA 3DGCR 4ZTPH 4Y5XA 1GYWA 4A6YL 4ZD3L 1EO5A 1M7IA 4HBCL 3MV01 3ARFA 3QDAA 2IH9A 3NFPA 5BXFA 3UIYA 4Z76B 3VFUA 2F74A 5BMFH 5C09E 4P9MH 4JQVC 2H1PL 1AP2B 4AJYV 5F7UA 4QUOA 4MMXA 3OKNA 1K3ZA 3FKUS 3BD3A 1H3PL 3VXSD 4M4RA 3P4MA 1HHJA 3TURA 3VWKB 2BVQA 5JPMA 1KZYA 2L4OA 4I7ZC 2ED7A 1PG7L 1YYMH 3WXVL 2CO7A 4GSXA 4J4PD 4OGYL 2GJ6E 5T5NF 1C16A 1E9OA 1YY9D 1BZ7A 3DDGA 1IGFL 5E8EB 5EHFA 3R1GL 4FEIA 4QHLA 3NZHH 5F2FA 3WTUA 3VQ2C 4LGPB 4HXAL 3ZE2F 4GBXA 4JCMA 3HE6A 5E8PB 4FLSA 3VXOA 3JVFC 3VRLF 5DMGC 1BIIB 1HHHA 2J72A 4FFZA 1HKFA 3E38A 4HBCH 2FQEA 5E8OB 3QARA 2C9XA 1FL5A 4DGVH 3FN3A 4D9LH 4WEEA 4ZTPL 1A14L 1NCDH 1R24A 3S5LA 1R34A 3QUHA 1ZE3H 1I7RA 4OBRA 1I8LA 3BW9B 3SE3A 4HG4J 1E9QA 3SDAB 1TJHL 3D69A 3QIWA 4LARL 1G9MC 2ED8A 4PW4A 4BIKA 3NCJL 3CZLA 4OH2A 4X7SL 3TH2T 5KS9B 4O2EB 1DTUA 4P2QD 1DQMH 4AVIA 3CQPA 5D5MB 1I8IB 2UZIL 4X6EA 3RZCC 3KWVA 5JQIB 4P59H 4A1RA 1XVSA 4PY7B 2BP8B 1FSKC 3FH7A 4NC1C 1FH2A 4GT0A 3L3KA 3QPQC 4I5BB 3M7FB 3MCKA 4ODVL 4ETYA 4BRJA 1F4HA 4B95C 2JKTM 5MEOA 3WAJA 1HQ4B 1FV1A 5E1HB 2E6JA 1T04A 5BO0D 1J0KA 1IGIH 1R33A 1SY6A 2CIIA 3QORB 3HI5H 4OZGE 2DQUL 1T0NB 3W9DA 5J11C 3TV3L 2L7EA 2ATKA 1INQA 4HUKB 2NYYC 4FAAB 2PPEA 1EV2E 1QX1A 4PCKA 3RB7A 1B4JL 1DQKA 1YMHA 2PYFA 2XT1B 3EZJB 4JKNA 5HGBB 3C2AH 4H8VA 2ATAA 4WDIB 4C4KT 4EIZC 3FH5A 1U6AH 4WK2B 3NACH 3U7YL 1VENA 3NQKA 3I9GL 3L7EA 1WFUA 3DA0A 4HT1H 1G43A 2XN1A 2HAZA 3RTLA 5TE4L 4U3SB 2XTJC 3B2PA 3GMOA 5B3JE 4N5EC 3WMPA 1RZIB 3WGVB 2QBWA 1GGTA 3P0VH 3SB3A 2LLGA 4BH8A 5F70A 2MRYA 5HDQL 1K85A 4M5TA 3ARFD 5DO2C 1JV5B 3MI6A 1FSKB 3MGTA 2GJPA 4ZW3A 1MCLA 4ODBD 4ELMA 1DVFC 5IBUB 4PU2A 3VSQA 1JGIA 1MAKA 1MCFA 3O2VL 3WU1A 2OSWA 3FTZA 2OP4L 4AXWB 3PREA 1GJUA 3ARZA 5A43C 2DQCH 3II3A 5BVPL 5TE7L 1U91A 3BT2L 1A7NH 4HPYL 1SUJA 3BO8B 3LZFL 4PBDA 1RUML 2FJHA 4PYGA 4U1NB 1EHXA 4X4MA 2QHRL 3RDTD 5LNDA 4RCAA 1DJWA 2BP5M 2MTPA 3KGRA 3KPMB 4UM9D 4PJAE 3VRLE 2BJMH 3WS3A 2XXCB 3N0PB 4A39A 1QFPA 1U8HB 1VGEL 2WSDA 4G72B 3CLFL 1MJJB 1VA9A 3EJQA 1IAOB 5K5YA 1IBFA 2VM4A 4U7SA 2Z1PA 1DBAH 4QNPF 4MD5B 4KTGA 4AIEA 4MJIA 3K8LA 1N0XH 1SF3A 2AQNA 3IJ9A 1QR1B 1QSFA 1KIUB 3P30L 1UOLA 5L2JA 5H2BB 1R3HB 1K2DA 3WHE0 1IQDA 3UP6A 4F92B 5AZUA 3T09A 3AWEA 4S1RH 4EDWL 4JG1H 1BAWA 1QFOA 3TN0C 2HFEB 4Y2DB 2QGCA 5HJ3A 4XMKH 2W94A 3WHXB 5JOPE 4UINL 3LS4H 2YARA 4BHUA 4C8XA 5BJTB 1O5PA 4J3OF 3SPVA 1OCOB 4Q74A 3TWCL 1QI5A 1HDMB 2DWTA 3QPKA 4WFEE 1ZLUK 4Z95L 4JVWA 4AZ8B 3KWUA 2X7LA 3C5JA 4GLRI 2VITA 1HX0A 2R0ZL 4KRPD 5J12B 1LNUA 4NUGH 1MCBA 2OMUA 1MLBA 2J6EL 1THAA 3QFDB 4UDTB 4ELMF 1S7RA 5GRYA 3NJXA 4KRPC 4CVXA 3VDBA 3BYTA 3MRJA 4GO8A 4IKKA 3SSGA 4X8XA 5I30H 5EV7A 2ZOWA 1CXHA 4MASA 5A2FA 4JM4H 2XA8L 5F89B 4NQSA 5E2WL 3HNSH 3EFDH 4R96A 3V9FA 3CDGB 5EU6A 3CFIC 1ZJAA 3ULVF 2CM5A 3K4AA 4MMZA 3SKMA 3NFNB 3U79A 4DEPC 1BHGA 4I2XE 2EAEA 4DK3A 3I50L 3OKEA 4TRPH 4ZG1A 2JB5H 2NXZB 4KGJA 4Y8DC 5GGVH 4Z7NB 4MA7H 4RWYL 1ECYA 2C26A 3O3AA 4JR9L 3ZL4L 1YUHB 1JXDA 4KXZI 4D0CB 4XVTH 3V0WL 4JHWL 2ZX5A 2JMRA 2QTVA 3OV6A 3O3BA 3QIWC 3TO4D 4KITB 3LN5A 4WHTA 1CG9B 4KUZH 2C4FT 2E8ZA 4PG2A 4RAUB 1NFAA 1N10A 5K1VA 4NZRH 2DLIA 2WB1A 4M1DL 1M2OA 3VRJA 4YBLB 3CSYA 4FNLH 5FA3B 3SY6A 4AE0A 1HC1A 5I66A 3C60A 5JMRA 3GGWB 1JTPA 2YRPA 1IC5H 5FHBL 5KVMC 1IC5L 3L9RB 2TRHA 3VFOB 5DJAB 5IFHH 1CURA 2YAFA 1J48A 4KMTL 1C8QA 4M6MH 3BIKB 1XGQB 1J5OH 4RMRA 3DX9A 4GI9A 2Q2EB 2FB4H 5D1XE 1UWXK 1ITBB 5FV2A 4A2FA 2EDLA 4O02A 4BUQA 2EVJA 1B0GA 5C0BD 4OCRH 1MQKH 4WK0B 1TETL 4I13B 4PV9A 5D1XB 4ETQA 5JDJA 3IDIA 2LQRA 3FZUD 4Z7NE 1IJNA 1KEML 2XKSA 2GBTA 2OMNA 2KKQA 3QDMD 1W8EA 3JWOH 4N90E 2AHIA 4JR9H 3HC0A 4IU2A 1F56A 5C0EB 2Z4QB 2P24A 2D03H 5C0IB 2R29H 2XTSA 3RIAF 1ZIBA 3VXUB 4HUMB 4A2LA 2YN3A 3RURA 1Q0XL 2I27N 5E70A 1IMHC 3U2SB 2OJEB 1Q9KA 1HWWA 2F5BL 1FFNA 1BD2B 4H5SA 5FUZL 4WI2A 4YSPA 5TF1H 3MLVL 4PJFB 5ITBH 3OKDA 5G4MA 2ROXA 3FO2A 1E4WL 4NQUA 2EP6A 4F8OA 3CCHA 5JIIA 5A6IA 4FNPA 1Y6NR 4A63A 2YD3A 1CGVA 1GZQB 3LCYA 4XCNA 3OMIB 4IOIA 3RY4A 1I3GL 5EO1A 1NGYB 2WO4A 3ASOB 3RILA 3ORJA 4G8GE 5DK2B 5JQHC 4XBPB 3QS2A 1HYRC 3L3GA 4QGTA 4JN2A 2BNUA 3TWCH 5KVDH 3MOAL 5D8JH 4XPAL 1IT9L 1YC8A 1UASA 4W9EC 3WS6A 3C8KB 1NPNA 1IGCL 2XQYK 3D3VA 3EUDA 3QI9A 1Z32X 4OCWH 3VXRA 1IAII 1S3KL 3PQYB 3DYPA 4DGWC 1UHVA 1OSYA 4X0KB 4XN7A 1XXDC 2IF7A 3D08A 2GTWA 2YD5A 3DV4A 3LXAA 4PJ7A 4WW1A 2NSXA 4LKXB 3ZTJH 5EORL 3ZDXE 4JFHD 1HCZA 3HHSA 2OYMA 3QO1A 1L0YA 1P5VB 4AQ1A 4U1SB 4NDMA 2Y5EA 4W9DC 1XEUA 2A1WL 4ZO9A 5D7EA 1XF5B 4AJ0A 4XCCL 4ZT1A 1FHGA 2PYEE 1A1NB 2DZEA 2OZ4H 3H2WA 3U46B 4BK4A 3WKML 1XBDA 3APFA 4FCHA 3N55A 3VWJA 3H3KA 5BOPA 4AYMC 1AE6L 3BXNB 3UZVA 1X5YA 5D7KE 1YEEL 3K74B 4OB5L 2P26A 2A83B 2ZNWA 2E5EA 3CDZB 1C08A 3S98A 1CE1H 3ML9A 1SZNA 4KI5C 4PJ8B 5AW2B 4OGAC 3X3GH 1TNNA 2H3NB 5AVWB 1IZJA 5D2NE 5IQ7H 1T66D 1T5KA 4FNRA 2DQCL 2PXYD 1EZVX 5DC2A 4MD0A 1F1GA 5GZNC 2AQTA 2ENQA 2AK4A 4Z7QB 1S9KC 2X4PB 3MBED 4FMVA 4MRCA 1EAPA 4APQA 4JG5A 3CZFA 1MQ8A 3VFPB 1KYOJ 3ARYA 2YKLL 2RQEA 3JV0A 1WTGT 4H2CA 4I9WD 3IT8D 4MTMA 4PGZA 1JRHH 4MA3B 1MVFA 1JGLH 2DMKA 4KJQC 5BZXA 1VGKB 3L3DB 1M1SA 2YJQA 3PIQB 4QLWA 2EDXA 2XY2A 3MACL 5EN3A 5BRZD 1ETZB 4JFFA 1QRNA 2FWOA 4LCWB 1BBDL 4ODXB 3F7YA 1CE6A 2LR4A 1Q0XH 4JANA 5DJ6B 4HIEB 1PKQA 4ODTH 1TSHA 5KSBA 1BQLL 2XCMC 2C3VA 4G6JL 4PRDB 4RFOL 3JWOL 3D09A 3RUGB 1INEL 4G7RB 5HDRA 5K9OB 3ULVL 3RQ3A 3WG7B 3ESUF 4TNWF 1T0PB 4OCRL 1U95A 5AG9A 1X5ZA 4XVUC 2J3SA 4N8VA 1YEDB 3QEHB 1R17A 2MCPH 2C3VB 2J1YA 4PRDA 4NJAH 1JYWA 5DLLA 1U8PA 3PCYA 4V2BA 5KBNC 1UKSA 2XN0A 2ZXBA 1Z9MA 3CZSA 2VDQB 3HKFA 5KSBB 2VC2H 4HJJH 1TQUA 3FHQA 5GS0D 4ZW6A 5DJ6A 1NGZB 1PQZB 4J28A 4KI5F 2WWMC 4A7SA 4PS3A 5KUKA 4ODXA 1KLGB 3ML8A 5EZIH 5SWZD 3SPCA 2VISB 4PJ5A 4LCCC 4W6XB 3RB5A 2R1YB 1JMZA 2ZAGA 4HJTA 3BT0A 4PM1A 5F93C 4J3WA 5CCKL 4TQEH 3QHZH 1GVIA 5BV7B 4KQ4L 1EHKB 3ZW3A 4H26B 2HT4D 2V3DA 1SXBA 3EJJX 1DBKL 2DH3A 1D6EB 4NUGL 4ZUVB 3MODL 3FN0H 3TEWA 4S0SD 3QIUB 1EAPB 4APQB 5FC9A 2K0RA 1U8NA 2ZSVA 3UTOA 4IYKA 4RQQA 3B1TA 4IOFC 4KZDL 2OYPA 3ZQXA 2K7QA 3V95A 3GBMH 5B38G 1DVYA 4EUPB 1JVOA 1NL0H 2OL3L 3FUDA 5I9QB 1G7MA 3ZL4H 4AVJA 1C5BL 4WAFA 3LRSA 2KQMA 1KCUH 2WP3O 4Y5VA 1TG8A 4JQXA 3I50H 4TRPL 4V1DD 2A9AA 5KS9E 5ESAB 1RP9A 3LSOB 1C08B 1OK8A 1M05A 2J2ZB 5AKSA 2A83A 1N2RA 3LOWA 4UANA 3PDDA 3OAYK 1T4KA 3FC8A 1IEAB 3HUJA 4J2QA 5F8RC 2WZPA 1JZFA 4PUBL 1WTLA 5CGBA 2OCFD 3S37L 1JNHB 1DBAL 5JPNC 4GXVH 4IRSA 1G84A 4QTFA 2B9AA 4AQ1C 5AOIA 2IWEA 5LUMA 1TITA 1G7IB 3GUFA 4KU1A 3KWWA 4U1SA 1P5VA 1IC4H 2FL5A 4WFHE 2CJTA 3SE9L 3SBWC 2CA4A 4PJ7B 4JDTH 4JO4H 4DZ8A 4X0KA 5AVRB 1WAAF 5I0WA 3ULUD 2Y7NA 1L7TL 3AU1A 2VDOH 2BINA 1HKLH 3IN0A 2FX8H 3APMA 3GKWL 4WWOA 3QI9B 3VXRB 4NWTH 1BZQK 4XMWA 3OZKA 4E36A 4WCYH 4XXWC 2OR7A 2CO6B 4EDWH 1OPGH 3DX6B 4ZMPA 4QHKI 1KB5H 3QJSB 5DK2A 3KYOB 1NBQA 4HFWB 5EUKB 2C3WA 1TKWB 3MJ6A 3ECBA 1PLGH 5EO1B 4HUCA 1RU9H 3I85A 3N43B 4KDWA 1W72H 4GRLC 4XCNB 4WWKD 4YSQA 3H6JA 5GXBB 4QRRD 4HIIA 3P30H 4TULL 5I8OH 2DTML 5A2LH 3AWGA 1KXQE 4XXCA 1NFIB 2IDSA 3ZDZE 3PWPE 1T0MB 1L4IA 2O6CA 2R2BA 5TE4H 2ZT9C 3H9SB 1T5XA 3QORC 5IGXH 1G6RH 4P48A 1Z0NA 3A21A 4H5SB 5AVQB 3BZEB 1ZGLP 2OL3B 1IGJB 4DP7X 1Q9KB 2FCBA 3U2SA 4XBGB 2XVBA 3ZKXB 5B4MC 4ZOAA 3C2AL 1P7KA 4JPSA 2CUMA 5AW0B 5AWNH 3VXUA 3PPEA 3JUYA 3VFWA 4JY6A 5F0PB 5KBKA 4MAUH 4BKLB 3LKOB 2LE9A 4XMPH 1CF8L 4IGBC 1CGWA 4IU2B 4KPHL 4FQLH 5HHMB 2RHEA 5C0EA 5E5LA 5EC2A 3VXSA 5JOPD 4FXGB 4ZOBA 4HKBA 1KJMB 4JX0A 4K3JH 3SJVA 2VMJA 4FKEA 2DQ6A 4CN1A 3IDIB 1HHGA 3BOVA 3MU3A 2F61A 4ETQB 4JRXA 5TDNB 4F91B 2MCMA 5HY9B 3IAGC 1UXSB 3W56A 2BZCA 5CEXA 4J1UB 1TTFA 5JXEC 1BAFH 2PXYB 5ELIA 3S34H 3L4ZA 1R75A 5EN2B 5CR8A 3KBFA 4X7TA 4XPHL 4PRBA 3BFWA 4CJ0A 3MRMA 2ZX9A 5I8EB 3RGBA 3AU0A 4OY9A 4R4BB 3EYSH 3T04D 3L9RA 4LLMB 4XZUA 4Y16A 5I23A 2CKNA 4TULH 2MCG1 5I8OL 4FNQA 1NAMA 3QR0A 1NKRA 3WHE1 3C60B 1L5GB 2YFNA 3IXTB 1A6UH 1PMYA 1RURH 1LDPL 3EO1A 3GXPA 5TQ2L 3EYUL 5CZVH 5H37H 2FVNA 5B38A 2I9TB 2WTOA 2NYKA 3MRGA 5JW3H 4DGVL 1WFJA 3TJPA 1CG9A 1SOQA 4FC3E 4ZS6D 1F4WH 2ZCHH 4UAHA 1KBWA 3N5AA 1UTDA 4YHYB 3WNIA 3IS0X 1NGQH 1E40A 1MFMA 1DN2A 4BKTC 3S3PA 3DTXA 1MFNA 1FE8H 2DAVA 3KPOA 4GW4B 2QEJA 4OIIH 5C7ZA 4J6RH 4TNEA 3AITA 3GBEA 4Y9CA 1OP5H 5GGSY 2D3VA 2N59A 1E2ZA 5HGHB 2GQHA 1L9RA 3A67L 2D8KA 2PTVA 2A6JA 5T1DH 3TTYA 2BX5A 3UJTH 4ZMAT 1AQKH 4IKNA 1W6LA 4XAKD 3SKMB 2GIMA 3IFOB 4MMZB 5E5MA 3KM1A 1ID2A 4GB9A 5I76B 5GRUH 4Y4KB 4FQXC 3RP1A 4NT6A 4NQSB 1CD8A 3ZR6A 2VDKH 4CN6A 2GK2A 4N6RB 3AT8A 4U1JA 5FYKU 4FFVC 3SGDI 3TA3C 3DIFB 4GMTL 5IF0B 3QFDA 4UDTA 2OMUB 3CFMA 1G7JB 4BQ9A 1Y7VA 2V9TA 4KHXH 1OPGL 2X7LB 3C5JB 4FYSA 3SDDB 4X98B 1P4LA 3VXMD 5I24A 2EQDA 5AAMC 5J12C 1UWEL 1HDMA 4RDQF 2X6CA 4HCRA 3N42B 1NANH 4XP5H 4HC1L 3LPPA 1NMBL 1VF5C 2XIBA 1NBVH 4WU5B 2BZ7A 2HFEA 4ICXA 4L29B 5IMKA 4MAYA 4XX1G 2Y36H 1CFVL 1TJIH 3O2DA 1EGJA 4MS6A 4YHYC 1A3LL 5T1KB 3GM0A 3UYRH 3K6FA 5AOKA 3FB8A 3PFQA 4Z9KB 5I19L 4X4ZA 1IQDB 3I75B 5AKVA 1R3HA 2VR9A 3C09C 5H2BA 3A5VA 1LXMA 5D72H 4M5ZH 3PV6A 5KANG 3K6OA 1QSFB 1YMMB 2K45A 4EPSA 2GSIA 3O2WH 1QW8A 3HN5A 4WENB 2QSQA 2EDMA 2VXQL 4WUKH 4Y9GA 4TNFA 2JKRM 3ZOAA 4O9HL 2AP2A 4R7XA 5DZAA 3EG9A 3H56A 3INOA 4BWWA 1ZIAA 2H1LM 1OL0A 2X9WA 3KPMA 2HSIA 2CDEA 3BESR 1P4UA 1LHZA 4NCC2 5E2TH 1RZGB 4FLRA 4G6AC 2H26B 2CRIA 2FGWL 2Z7UA 3NMEA 4U1NA 1A64A 5C0BA 4KZDH 1TO4A 5IMOA 2CRMA 1U91B 3ZU8A 1XZ0B 2K6ZA 1NPUA 3HS0A 4PB0L 3T1FA 3V0DA 2D3LA 1XV8A 3GMNA 3I3DA 3P02A 3CD4A 4UBDC 3T0WA 4IM8A 4AXWA 4LCWE 1A5FH 2CZNA 3RPIB 4DGUA 5CZRA 4XPGH 4K5OA 2G30A 3TC9A 3HN3A 4JO1L 2FD6H 2I5YL 5I28A 2BO0A 5AUMB 1QP1A 4TLTA 1JV5A 5LXVA 3QUMB 1BYOA 4NKOA 1PAMA 1QPXA 2WUCL 3IU4H 2P8LB 3NIDF 4PJEB 5KVFL 2M8XA 4Y7OC 1RZIA 3CHPA 4L05A 1ZDSA 4L8SB 3JTSA 3U4BL 3M07A 1A0QL 1S4IA 1YC7A 4TUKL 3ULUH 4Z7QE 3U2IA 5EEZA 4KUCF 4LLQA 3ZMNA 3RX8A 4LESA 2AERT 4HCRL 2VLLB 3EKCA 4F58L 4FABL 3ATDA 2JNZA 2V6HA 5C0RH 1PD1A 1BM3H 4ZW8A 4PS4H 3ALXA 1S7XB 5DZJA 2FK9A 3DJZA 4PBVC 2GBAA 4UYPA 2ZAIA 4F33A 2ATKB 2OJZH 2ZWKA 4U6VH 4WEUD 3ZDYB 1RPUA 3GLEA 5E8DH 3BSHA 4M7ZC 4HJGB 1FBIH 1PIGA 2E4FA 3CBKB 3FB6B 2FNBA 5IREA 4LAQH 4XAKE 1AHWA 3QUKB 3BX7C 3S97C 3QORA 4QRPD 4W9FC 2CJ3A 2OSXA 5AWNL 4DKEL 1CE1L 5SX4I 1OKEA 1CVSC 3GF8A 1PX3A 3C5SA 3BJLA 4PRIE 4JO2H 1HQ4A 2NZ9C 2XN9A 1HFUA 2ZWLT 5JXED 1TT6A 3TZVC 2PR9A 1TZ8A 5E9DE 2YC1A 2Y1YA 2E75C 3L3KB 1UB6A 3MACH 1JWSB 4FFWC 2ZKXA 3FQXB 5GS0L 3IDUA 4QWWC 4Z0XA 2HTKC 3BUQA 3HLAA 5HYJB 1UD5A 4LLUB 2Y6SD 3GK8L 2A7BA 2B3IA 2NW3A 1E9QB 3VQMA 5DZOA 3RU8L 2NXYC 3BW9A 4R2GB 1AKJB 2NCEA 2X2IA 5IOPB 1GYUA 1YN6A 2OCCB 4JFPA 4W9JC 4K5NA 4MJ4A 4XMLH 1CTNA 3BZ4B 3QAZC 3M1OA 1FFOA 2YS4A 4I3RL 4XHQA 5A2KH 4G80A 4MA1C 3VXOB 1J11A 4KKCC 2XFXB 4GBXB 3ESVF 3IRPX 3WIAA 2NY2C 1CDYA 2O93L 2XG4B 4QHLB 5HD8D 2FQFA 3ZXAC 1JGDA 1E9OB 1WWWX 4LEBA 3FQRA 4UYQA 3OXSA 4OT1L 1PNDA 1CMOA 4FZ8L 4O00A 2CO7B 3BAEL 3FU8A 5EU4A 1F1DA 3S4SA 5BCAA 2G3MA 3P11H 4ZBJA 5AB9A 4KVPA 4IRZL 1OAXH 2BVQB 1EHAA 2OZ4L 1KLFB 5G2NA 5I1IH 1XCXA 3QA3A 3QRBA 2BSCA 1LQBC 4X5WB 5DQ9A 4S1DD 1T22A 4OJFH 3GHEL 1R19A 3MLTB 2YXMA 3T3MB 4MBOA 4ODUB 4MVBC 2VUKA 5KS9F 4R97B 1CJYA 2F8XC 4Z76A 2MKLC 4R2GC 1SFHA 3MBXH 3F84A 3PHSA 3EBAA 1SMAA 1CLYH 3BUYB 4JFOA 1D2PA 4RIRB 3VI3A 1QA9A 1QABA 2R7EB 2C1PA 3CFTA 4PIBA 5F72S 1M7IB 2F5AL 1DL7H 4HAKA 5HHOA 3UMNA 1H0DA 1IAIM 1MQKL 1OTSC 2XZAH 4OF5A 4TQ8A 2ZUUA 1KXQA 1JZIA 5BNXD 1SDAB 5HYQA 3HB3B 3X11B 5IVXB 5DZVA 3CXHJ 4TVPD 2BFVL 5B3NA 3WEOA 5F7EL 1CN4A 3DV6B 2P5WB 4V1DA 2WXGA 7PCYA 2OTUA 2I25N 5BZDA 1S5HB 2EXTA 1YEJH 4JZOA 3DK0A 5I6OA 1YEKH 2XIIA 1V05A 2YQ2A 2PTTB 3H9SD 3KJ6L 1AXIB 1BVLB 4P23D 1PW3A 2Z31A 4AUYA 3OR6B 5HYIA 1JFHA 3ZTCC 5D7SL 1NEZG 4PHXA 1MVUB 1JNLL 1MREL 1XZWA 1E28A 4ICWA 1N59A 4TKWA 2GSMB 3BSGA 3VFNA 4NZTH 3BSZA 4FA8A 1Q0YL 2VLKE 4AJWA 2LU5A 4EXPX 1OAJA 3SE6A 1CLOL 1J0ZA 3SPIA 4XOBA 3OZLA 1IGMH 4R7LA 2HLAB 2IH1B 3B8SA 3O6FA 4W93A 2HT4C 4J3OC 1OSPH 1SNRA 4WFGD 3QFJE 1OSPL 5CD3A 3F83A 2P3YA 4PJCE 5L2KA 2D7QA 1ZXQA 4N2BA 3BWUC 5AKTA 4ABUA 1ASPA 3OZ9H 4S1QH 4MCYB 1KY7A 2X3AA 4Q0XH 3SYOA 4ELKB 3NSCA 1TDQA 5DHVA 3O4LD 2D31A 2ICWA 1V27A 3MJ9A 5DD6B 2GJRA 3KLSA 4JFWA 3HNTH 1GJIA 1TYEB 2GK0A 3IDMA 5IHZA 3EHBB 4GQZA 1JK8A 3LEVH 2HRHA 1JVLA 1NJ9A 5FDWB 3H42H 4KX9A 3HAEA 5I1JH 5E2WH 4FQ2L 4XVUD 1IFGA 4MHHI 3KJ6H 3X13B 4MZIA 5CHNB 4FRWA 3NCCB 1E8XA 5JOEA 3MLSL 3RNQA 4JFEA 2YD8A 3HFFA 1UM4H 4LCUB 5I1KL 2QVTA 3A24A 5D1QB 3RA7L 4M1DH 1E9PB 3E6HB 4OV5B 4XX1E 3JWNH 5I6XC 5DURD 1WBXB 3FB5B 1ONQA 1CI5A 4K94H 3ZO9A 3PHQB 3BLKA 1DQLL 1YNKL 3ARBB 3OSKA 2F53E 4U0RC 1XMWA 5BV7L 1KTDB 1F58H 1P7QD 3KHQA 4CMMA 2R4RH 5A3IC 4LPWA 4LP4A 2JELL 3GJFH 1RUAH 1CQYA 3GXMA 3J2PA 3Q6GH 2BOCB 4JM2F 1F8TH 1DEEB 4OZ4A 2EDFA 3RWIB 4U1GB 3OVUB 3I6KA 1KTBA 2X1XR 4HPOH 2BCKA 2CR3A 2Y06L 4LDCA 4NI6A 4UTBH 3GINA 5I1IL 4NXSA 3WY1A 5IHHA 3LS5L 3C6LD 4D0BA 3F7KA 2X09A 5CEZE 2IFGA 2WQRA 2ETWA 3PJLA 3EH1A 5SV4A 2R23B 3GTTA 5CBEA 3T6WA 4UILH 5E6IB 4AL8H 2XV3A 5L0QC 2QLYA 2ZYSA 2HVKA 3CLFH 3MYJB 5HI4C 4YDLB 4HIHB 4NHCH 3TV8A 4QKTA 4JBSA 3Q6GL 2GUOB 5B1KA 4OGAD 5IG7A 1ZTXL 3IJEA 4ZMLA 1G0YR 2J6EA 4H25A 4AVKA 4C56E 4CDGC 1DN0B 1Z5YD 3EFFB 4OCWL 1HSBB 4PJBA 4S1SL 4QAMB 1LVEA 1DQLH 1YNKH 2EJ1A 3PWVB 4PY8J 2XPZA 4PFEA 4X6CF 1ICTA 3U36A 3LX9A 1X44A 2YEVB 3MRDA 5KN5A 4RSVA 3IMVA 2H6PA 1SRDA 3IJSB 4LEEA 4Y2OB 1PLAA 5HPMB 3G6JE 3ZPDA 1SGKA 3RU8H 2VDMH 4QCIA 1I9IL 1OAUL 3QC6X 3WLBB 2AK1L 3WNNA 5A16B 1LEKA 2UYLA 1ES0B 1A9EA 2AV7A 4FZEL 2ERJC 4EIUA 2WQUA 3MJ7B 3ZHLA 2EECA 4OF7A 3QEGL 5DMIL 5TK2A 4K2UL 3U4EB 1KXTB 2RACA 4Y2DC 3MLVH 5KYXA 4EI5D 2DF3A 1XX9C 3FT4A 4LCYA 4PTUB 4XNBA 3UPRA 4YGAB 4NO0A 4XWGL 1JFQL 2IALA 3OJDB 4FKHA 2V5SA 4TSBH 4QHPA 2GEEA 3I2CL 4F8NA 3ET9F 5CJXA 3KPLA 3MBEC 4LCCA 4NZUH 4WI3A 2R0KH 2MQGA 2ZYIA 4I0PD 4LEOB 1WH0A 1IM3A 4Y1AA 3Q06A 5D9SB 3B7RL 2Q86B 4AT6A 2HG5A 1IO4C 3QB7C 4L3EE 4K7PX 3ZZQA 2GBVA 1NFKA 1AI1H 1BZ9A 2HXAA 2ICES 4MJ2A 2J6WA 4WTWA 1A7NL 4EIBA 3FUJA 1EZSA 1FVEB 2F53D 3SDCB 4UIKH 3FONA 3R4RA 4EKJA 2JE8A 1SM3H 3ARSA 1EXUB 2A6IB 2UZXA 2W65A 4H1LA 2D7TL 4F15B 1EDYA 1XR8A 3VE0A 1XGZA 3JWDH 1NEPA 3LV3B 3LNIA 1NUNB 3LN9A 5D2NC 4BYHA 1FN4B 5D71L 4KXBA 2WO2B 2J8UA 4BM7A 2FIRT 1OARL 4JFTA 5DRNB 3MXVH 1CVRA 1A8ZA 1H6EA 3BP7B 5ISZE 1Q9WA 2TAAA 5DSCB 2NW2B 4ZX3A 4HK3J 1XGPB 1K5NA 4UT6H 3CVBA 3RVUC 3TT1L 4M1GH 2WBJB 5JQ6H 4FD0A 3VU1A 4ZQKB 4XVSL 2LAGB 1FG2B 3KW8A 1FO0B 2OMXB 4NQCB 2ATPA 5IBLD 3O45B 3L4XA 1ANUA 5BQDA 1MJ8H 1T03H 4PLOB 1I9EA 4ZFZB 2EE2A 3U1PA 3D3VE 5ETUB 1PZ3A 3LVTA 4PJCB 4MJ6A 3KPRB 5IW1A 3P54A 2VJ0A 4PJGA 4LCWD 5HDBB 5IJKA 4S0HA 1QBML 1N8ZA 2FATH 1HU8A 1UD6A 4YXHL 4CA4A 3VD0A 4K7FB 3ECVA 2BHFA 5DQDH 1IGIL 1LEIA 4JE0A 1NM4A 4B7LA 3UCQA 5C9JA 4Y89A 3STZB 2DYSB 5G5DB 2CKBL 1E6JH 4JQVA 1KJ2H 1N3NB 1FGVL 1SVZA 3O6MH 3TA3B 2BP0B 4JG9A 2WLHA 2EH8H 4WHDA 2JQZA 3ULVE 5JIDA 3QIWD 3GM8A 3TO4C 6PCYA 4JM4L 4N9GB 2UUDK 2G0KA 4NO3A 3QXTA 5IFAH 4FZ8H 4BGDA 4JHAH 3V4PL 1YUKB 5AL8A 2OJ1A 2KI6A 4P9ML 5HYSG 1OHZA 2ARJB 2DKMA 3D39B 1ZA3A 1U3HB 2P42B 3EHBD 4WI6A 2XQBH 2F58L 1OAYH 4ACTA 5I1GH 4M43H 3G5ZA 4ZS6C 4N0FB 2VJ8A 2VN3A 4GMSH 1JN6A 3N6YA 2H0EA 4NO5A 4AYFA 2V37A 3D06A 1UWEH 5GRWA 3FFDA 1GIGH 4BZYA 1BFOB 2TRYA 4UQ3B 2JJWA 3VFRA 1S7VA 3Q1SH 3QI9C 4JKPL 1LE9A 4YK4C 3D2UB 5FKPA 5C3TA 5IQ9B 1ZK5A 3QUZA 5FFGA 1YLBB 5J4MA 3WUWB 2X9ZA 4OGXL 5JORA 2BSED 3VMPA 3WNMA 1C1EL 4XE0A 1YN7A 3CIQA 3WFCL 2Q2LA 4KGLA 4PP1D 3R8BB 3GS0A 1H8SA 3O6LL 3VH8G 2JXMA 2BVOB 4N2IA 2BPBA 3NCMA 2QJDA 3QEQD 1JDCA 3S4SG 2IG2L 3NABL 3QUXB 4HJEA 2OMWA 4XBMA 3VXSE 2XJKA 2DQGL 4N0UB 3LH2L 2APBA 4DVRL 4KKQA 1XL4A 3D1MC 3FSZA 4EDXB 1E2VA 3KDMA 1T6VN 2E86A 3UERA 1CDJA 1OT4A 2CXKA 3EO0B 5LG6A 5IW3A 3D0AA 1QTPA 2PP7A 4X0NA 5IB3A 2I9LB 2LLLA 4OCXL 2EIMB 3ILQD 2WKOF 5F7NC 4PS7A 4L8DA 3APCA 3UTZB 2IBGA 1RK7A 3M1BA 1B2WH 1PYWB 1T7YA 3QQ4A 4UNIA 5IT2L 1U8CB 1NCBL 1KXVC 3V55A 3RI5K 1UD2A 3QORD 4QRPA 5CILL 1AHKA 4DUWA 2IDCA 5D7LD 4YHPA 5LGYA 1EGJH 4FJZA 2NNCA 3IBOA 5AYUH 3D4YA 3NJVA 4KH9A 1L3WA 3V6BR 3EYOB 4MFHA 2NY1D 4L2LA 5AYUL 1TIUA 3T4YB 2EKSA 5MEND 4BEIA 3OKLB 2FTAA 4KK6C 4R5XA 1PG7X 4WWKC 3QNYA 3UC2A 5G4NA 5IKCB 3L5XL 2HUEA 3LH9A 1NCBH 4HWBH 3SKUD 4GXUM 3RX7A 1OSZB 1ETA1 1QOKA 1NANI 4RMUA 5FXCH 4HS6B 4HV8A 3WTWA 3QZLA 1BWMA 4M62L 1E4XL 2ITEA 1UCBL 2K8MA 3VH8A 2A73B 4H88H 3L5IA 1GSKA 3WY3A 3U0PA 5IP4A 1GPOH 3ATAA 5FR3A 4YDVA 2A77H 5CFAA 3AXLA 2P7TB 3FPXA 3RGVB 1XIWB 4E41D 4G8GA 1N6QL 3HI5L 1J0IA 1RL1A 2G9HA 1L0QA 4WW2F 1HQRB 1F2XK 3DSFL 3SKOA 1DUYA 1THCA 2XDHA 5C1MB 1HCYA 4OLZL 2JK5A 4I0PB 3SQRA 5LDSA 3MZTA 1NDTA 3V7AE 2YOCA 4CKVX 3BGFC 2XETA 5C6TL 1TJGL 4RBPK 4MNGA 5ITFB 1GGCH 2VLKB 5T8IA 4EN3B 4H44C 3HMXL 1EAQA 3BI9X 2IG2H 3MCLH 3NABH 4QRQA 1UWYA 1WAAE 4YDJB 2PCFA 5DQJB 3WYRA 3DGGB 3PL6D 3P4NB 3KE0A 3GSUA 4PRAA 3QXVA 1NLBL 3E3QE 4Y4FA 3MRKA 5F96L 3SPHA 4OI8A 1XL6A 4KJYB 3FQNA 1WZAA 3NCJH 4N4YB 5F44A 1BEYH 1JNNH 1MEXL 1OANA 5LGJB 1SY6H 1TJHH 4LB8A 2QKIB 3Q6FB 3B6SB 1NBZA 3Q43A 5FECB 5EOCJ 2APVA 1PEWA 1ZMYA 3ALWA 1BP3B 1D3CA 1D5MA 3B7UX 1GIGL 1Z2KA 3L6FB 3L7FA 1VHPA 2IAMA 4JQIA 1NGWB 5D7LA 2H0PA 1DLHA 4U3CA 5EU6D 4N3TA 3GTVA 4ZMXA 3AQZA 4PTTA 2G2PA 3QO0B 4HC1H