2IOIA

Crystal structure of the mouse p53 core domain at 1.55 a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
187
structure length
187
Chain Sequence
QKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cellular tumor antigen p53
publication title High-resolution structure of the p53 core domain: implications for binding small-molecule stabilizing compounds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, antitumor protein
total genus 40
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ioiA00
2BIOA 3Q05A 1KZYA 1TUPA 4G82A 5A7BA 2GEQA 3IGLA 2FEJA 3VD1A 4AGMA 5AOJA 4MZRA 3WTSA 2X0WA 3WTTA 2ATAA 3IGKA 5LGYA 2IOMA 4IBUA 3D06A 2J6WA 1GZHC 1EANA 2VUKA 5AOIA 3QYMA 4IBTA 2P52A 3D0AA 5ECGA 4A63A 5AOKA 3D08A 1CO1A 2WGXA 3WTVA 4AGNA 2BIPA 3WTUA 4GUOA 3WTYA 3D09A 3WTXA 4KVPA 1E50A 4AGQA 3Q06A 3Q01A 3D07A 2XWCA 1HU8A 5ABAA 2YBGA 3QYNA 1EAOA 3ZMEA 2MEJB 4L18A 4L0YA 1YCSA 4AGPA 2AHIA 4IJTA 4G83A 2X0UA 3KMDA 1HJCA 2J1XA 3EXJA 4HJEA 2H1LM 2J20A 2PCXA 4IBYA 5G4NA 1UOLA 5AOLA 4IBVA 2AC0A 4AGLA 5AB9A 2BIQA 2X0VA 4IBWA 1CMOA 3EXLA 1H9DA 5LAPA 3TS8A 2BINA 2RMNA 3D05A 4MZIA 1T4WA 4GUQA 1GZHA 3US0A 4LO9A 1EAQA 2XWRA 3VD0A 2J1ZA 2J21A 4L0ZA 5AOMA 2IOIA 5KBDA 5BUAA 3VD2A 1TSRA 1LJMA 2IOOA 2J1WA 2OCJA 3WU1A 4IBSA 3US1A 2ADYA 4XR8C 4AGOA 2J1YA 5G4MA 4LOEA 1IO4C 2BIMA 4IBQA 3WTWA 5G4OA 1HJBC 4QO1B 3KZ8A 4IBZA 4LOFA
chains in the Genus database with same CATH superfamily
5T1LA 1SJVA 4UTAH 4X98A 2A9DA 5FGBC 5CWSA 4QXTA 5HHPA 1E6JL 4P2OC 1MWAL 3RU8H 3THML 2BRRL 4F1SA 1IB5A 3UTTE 5E4IA 1CI5A 1I7ZB 5ACZB 1AR2A 4J39A 3QWRA 3DJZA 4NS0A 5IUSA 1SHXA 4QF1B 3AM8C 3IVKB 3NEOA 4LZKA 4AZ8B 1XB6A 1XR8A 5DQDL 5EIIA 2B9AA 3L4UA 4NT6A 3VCLB 5GZOC 1HSAA 2EO9A 5I0XA 1CL7H 4XP9L 2ZOLB 3FT2B 4AGNA 4FP8L 5KSAB 3AG3B 3D0LA 3O4OB 1W8EA 4N25A 1Z9SA 3FSWA 2Y06L 4OF6A 3HLAB 2VQTA 3DROA 1W72L 4HYTB 5I1JH 5DJ8A 1IC5L 5I0DA 4QRRD 3ZRFC 1TSHA 3T4AC 3UZQB 3OG6B 5E51A 4J6RL 1I7UB 4KTEL 5ISZD 5D7IA 1B6UA 4W9FC 1EBAA 1O9WA 1XF3B 2H1PL 1JGVH 3HZMA 4JY5H 2WXNA 4KKAC 2JV6A 1TZIB 3RFZC 1A5FL 5B3JE 1IGFL 2JMRA 3WFEL 2W65B 2JB6A 5E9DD 5KAQF 2J20A 4LCIH 2NNCA 1LO3L 3V6FB 4GI6A 3UMNA 4MYPA 2EIZB 1JNLL 3QJRB 1ZHLA 4NAQA 4JFQB 2OSWA 3SDAC 4A7UA 4C83B 5BRZE 3SDCD 1XCXA 4KKPA 3MBEA 4G6FB 4APXA 2XT1B 1INQA 1ETZA 5FX3A 3A6BH 4OT1H 4XP5L 1F90L 4KUZL 1QSEA 4G70B 2HJFA 4F7MB 4PG9A 1CN4A 1YECH 1CXFA 2VKWA 5IEHA 2FR4B 4HV8B 3BMWA 1TJHH 3BQUB 3IU4H 2X3BA 4AE0A 2ODHA 2VDKL 3PV6A 4UNUA 4F7EA 4JEGB 3FU7B 4GKZA 5DF0A 3WKQA 2CO7A 5LCVH 3OMNB 2WWOA 1R47A 1IRAY 1OAXH 3GMMB 5GGSA 1C08A 4IMLB 1S7UB 1Q0YL 4Y4FD 3ZR6A 3NRQA 3QUHA 5J6HB 4G9FD 4OM0H 3KDMB 4OFPA 1XIWB 4YHIA 4BQ6A 4MQ7B 8CGTA 2PW1B 2J8HA 1NFKA 2N1TE 3U2SA 5JPMC 4F15B 3W81A 4JFYA 3ARFA 3TTSA 3EJUA 1JGIA 2HKHH 2XIDA 3CIAA 4QLRA 4QRTB 3VXPA 1IC4H 1GIGH 4DO6A 1R3LA 4NNYB 1IM9A 4H1LH 4LAQL 5IVZB 4GAGL 5CNHA 4LRIA 2BZ7A 1KCRL 1R5WB 1B88A 3DVGB 3HTLX 4PJDF 2Z91A 2BY1A 2HVJB 2NXZC 4JDEA 3GMOB 3IU3B 3OF6D 3IDIB 5K9OA 2VRAA 4JHVA 2VDRL 1HI6B 3UCRA 3VXUE 4MMZA 2F19L 1XB8A 2XZQL 1G9NH 4HJUA 2W0FB 3WTVA 4Z7VF 4BKSC 4UV4H 2K3HA 2CAKA 3CN1A 2FWUA 4QNPF 1X7QA 1XT5A 2G5RA 5D55A 4ZFGH 4MXWH 4J8QA 1RL1A 4ELDA 5IBLD 1BYOA 3V4PA 3AXLA 4LDCA 4WKXA 2DJMA 3ZKMD 1DVSA 1B0GB 1BJ8A 1EAOA 1XH1A 3V6ZA 3VM7A 2ZOOA 1G7QB 1F97A 2O6EA 5C9JB 5E6IB 3UEQA 4NNXB 1MLCA 1SVBA 4QEGA 4G6JH 1IL1B 5GRVK 2G9KA 4D0CB 3MRNA 3QXDA 4G83A 1KIQB 1QPPA 3WOVA 1I31A 3D2UA 3BVUA 1PIFA 3QDAA 5TE4H 3VGFA 3WGUB 5F9OH 4F7PA 4YZFF 3SKMB 3TH2T 2PWFA 3ZTJG 1KYOJ 3VWKD 4GXUM 5F0PB 3U4AA 2WKOA 4QRUB 3W56A 1VSCA 4HS3B 2RJMA 2EIBA 3U7WH 2ZXGA 4YXKH 5FLVA 5TH2B 1MH5B 4OGXH 4H13C 1D5XB 3VXSE 3IE9A 1N0LA 1SDAB 2EDRA 3KS0H 1WFOA 1UA6H 2VLME 1HCYA 1DLHB 1UYWL 2IAND 1P7KA 3PWPE 4G42A 4LPTA 4NO3A 4TUOB 4L29B 1R0AH 4NENB 1KWGA 5A2JH 9CGTA 5DD0H 5DHYB 3T2NH 4F2MB 4X4XB 1HHJA 1WP6A 2PCPA 2Z4QB 3Q9PA 3EDDA 3VXME 3ZKND 2DTMH 1U3HA 2ZUSA 5KVGL 5CGTA 4DN3L 1I1FA 1TSRA 3WL9A 3P2TA 2ICWB 1O6TA 1L6PA 1SBBA 2N1KA 4BSJA 2R8SH 4YPGA 1A7PL 1Q94B 5D5MA 5F9WB 3BDXA 3RGVD 4MB3A 3BAYA 4P04A 4EZJA 2FJFA 3AW5A 1TJXA 4U7MA 1SEBB 3UZVA 3NTCL 4I5BB 4IBQA 3RTQA 4PS7A 2HXAA 2QSVA 5I71C 5LUMA 2YJQA 1BEYL 1W0YT 4JM2A 4Y4HC 3FB7A 2V2WA 2HWZL 4KJPD 3UP1A 1MCKA 2MPVA 2B20A 3IKCB 3LKOA 2DEWX 3LCYA 4R5TA 4N0YL 1NM9A 2E3VA 1AKPA 2XTJE 1BECA 5KZCD 4TNGA 2JCWA 4XB8A 3FZUD 4B7IA 1SDYA 3UJTL 4U1KA 2BVYA 2ILLA 3ISRA 1ZSDA 3WS6A 2ENSA 4G1MA 1GHFL 3FH5A 1YC8A 1VFOA 2X4PA 1WHPA 5J6GA 4GEIA 5FB8B 2YMXH 5C07A 4R97B 1SEQH 4JREC 4XNXH 5EEXA 1WFIA 2J56A 5I1CL 2WXMA 3CQFA 3REWB 4FA7B 3HR6A 3QG6B 3RTLA 5BUGA 3FQTB 5D4JA 1D6EB 3EJYD 2HA1A 4Z5RB 3DVNB 1G87A 4FZEL 1NKOA 4K3JH 1I8MB 3CCHB 3QORB 5CP3A 4DP8X 1EAJA 3BESR 3IK2A 5EUOF 4DKFH 2O30A 3WKMH 3MNZB 3LSOA 5C0AE 1NCAL 1A3LL 4KMQA 2QGDA 1GL4B 4YDVB 2FX8L 4ODSL 1EQWA 3VRJA 4IRSA 1NCIA 1S9WB 5L4JA 2LFGA 1YYMH 3T1FA 2WKGA 3V7AG 4LLYB 1KBWA 4AC2A 1IAKA 5CLTA 2KL6A 4UQEA 1CR9L 2P44B 5CD3A 5T5FH 4U1MB 4XNZB 2WBKA 3CFCH 4JRXE 3F6LA 4GAAA 4MAYC 1R33A 5FGCE 3DUUA 4U05A 3BZ4B 1PLBA 5SWZD 4LSPH 3I2CL 3S36X 3IRZA 3B2XA 2YAEA 2DJUA 2JQZA 3KBPA 4BWTA 5BO1H 2XWBB 2NSMA 3OLGA 1JZ2A 5EF1A 3BFWA 3ILQC 5E0FA 4ABQA 2VXVL 3QRGH 2MHAA 1WFMA 2AERT 3MPCA 3DLQR 4N5EC 4EPSA 4N8VA 1QRNB 2C1OB 2VDLH 5C0BB 1CDJA 3QEQA 2VISA 5ANHA 3O0LA 5ICZB 3MLTA 2XTJC 3L6FB 3UMTA 4LASL 1IGCL 2V8MA 1TJIL 3VA6A 4NO2A 2I9TB 2EDLA 2FECL 5HHQB 3O41B 4M8RA 1WHOA 3DIFA 3QQ3A 1F02I 3C8KB 3Q1SH 1XGUB 1MWAB 3BEVB 3DTXB 2B59A 5K1VA 2E9BA 1PY0A 3KH4A 3C6SB 5C2UB 1D9KD 1JFQH 3OLIA 1T1WA 5E8OB 1UKTA 2BVUA 4UQDA 2BY2A 4LCCA 2WSDA 3BAJA 3NRFA 4YHML 2XN9D 5FA3A 3BH4A 3KVPA 1BVNP 1ET5A 4BXSV 3M1OA 1I9RL 1NPJA 3W9DB 3FQYA 5I66B 1M7IB 2LHAA 3N04A 4FXGA 4KKBC 3ARWA 3HZKA 1W72B 2RACA 4JHUA 4QHNB 1UKQA 3G6DH 3SDYH 3T0EE 3TBYA 4Y2LA 5E94A 1GSMA 2PXYB 5F3BA 3NZ8A 4WUUA 1CGYA 1GGBL 7FABL 5HGGS 1ZLWH 4E5XB 1YYLH 5I0WA 4NNPH 3MNMA 1T1YA 4UU9A 4ATWA 4LDEB 4XI5C 5ID0B 4IBLT 4MNQA 3ABZA 3RX9A 4D9RE 4FQXD 1GYWA 1CDHA 4X7TB 5DD5H 4M9OA 1QKZH 3WIHH 3KPPB 1BVKA 4J6IA 3QWQB 1U92A 4Z0BL 1FO0A 4HH9A 5MP6L 1JCVA 2R2BA 3FQRA 4UBDD 4ACTA 1NANH 4G7VL 1J7VR 1FV1A 4V2BA 4N4YB 3SPGA 1AXIB 2Q20A 3QQDA 5CCKL 1LTXA 5LVEA 5C09D 3G6JA 1MLBB 2FZ3B 3B9VA 3PXLA 5EOQH 3VTTA 3AB0C 4NHCL 5KSBF 2FGWH 3PDOB 2ZPKH 1E4WL 2EJ1A 3HS9A 4YDMA 4O51A 1T4KA 2VDKB 4YSAA 2V3FA 4K5LA 1GJIA 1NLDL 2NTFA 1ZHBB 1AQ8A 4ZK8A 5CR1A 2GBVA 3L54A 3I6GA 4HC1A 4DFHA 4RISL 3QUYA 4FMFA 2B3RA 4PS3A 4EN3C 5HYJE 2D4DA 4Y5XA 4R4BA 1X7TA 3DBXB 3ZUCA 2VLLA 2E0PA 3BAEH 1JG9A 3EYQD 5E8DL 1NKGA 1S3KH 4Y19D 5CEZD 4PIRF 5K9JH 1HXYA 4NPKA 1CLOL 5MENE 1KFAL 2ZG2A 2EECA 2OJEB 3W11C 2HLFC 2LT9A 2VLJB 4HHWA 5K1NA 1QBBA 4IK6A 3H4FA 2BNRE 3L95A 3IDGA 3T0EC 2G5BB 1QYGL 5SV3A 1GGIH 2NYYC 1CBVL 1HILB 1KB9J 3TO2B 3PWNB 3NJLA 3L5XH 4XB3A 5JPNC 1KXVC 2W0PA 1IAOA 3K2UL 2VDRB 2H2SC 4I0PA 4PREA 5AAWC 4K9EH 1NJ9B 1TQCC 4XVTH 4YQXL 5E5MB 1ZS8A 4W68A 1LE5B 1BSIA 4ZQKB 2N4IA 1L6XA 2F8VA 3ROOB 1BP3B 5F6IB 1PYWA 1ES0A 4KKLD 3BVWA 4KBPA 4P2QA 4B97A 5JW5A 3C6LC 2R2EB 2BMKA 2OBGA 3TNNB 3ARSA 3RDTC 5DJ2A 5HGDB 4XO4A 4HK0A 4W4OC 1EEYA 1L7TH 3JWOC 3GSQB 3M7FB 2WXIA 4TTDD 5F7LB 4S0SD 4BK8A 4WTWA 4Z7VE 1CYXA 2DQTL 5GS1C 4QNPE 4FX5A 5AQ0A 3TBSB 2ODIA 1YMHB 2Q9OA 3FO0L 4BGLA 2AXGA 4IU3A 3E6HA 4XXDB 1KIPA 2OMUB 4XNYH 3ETBJ 1DL7H 2HT2C 3HPJA 3KM1A 2CIKB 3MJ8B 3WD5H 2BIHA 4YHOH 3H85A 3CU7A 4RGOL 5DRZA 1NMCC 1DDTA 3ZE0B 1CK0H 2F8OA 1UHVA 1XCQB 4OD2A 1MY5A 1FNEA 4DZ8B 3BZDA 2M83A 2R0KL 4FG6D 4QHLA 2AQQA 3Q48A 4CMHC 4YDLC 1M56B 4YZFE 2H26B 4R90H 5L8KB 2FSDA 3RZCC 4RNRA 3IDMB 4P5KB 3INUL 1IEBB 1V7MH 3SIKA 3ESNA 2A6KB 3V9EA 4P2RE 2OMTA 4PBWD 4YLBA 3EOBA 3NJGA 1AZZC 2O5YH 4FZ8H 3WKNA 1S7XB 1HE7A 2GJ6E 1TLMA 2WNXA 3ZZSA 4NQED 5H35A 3AGVA 3O4LB 2XWJA 1OM9A 5CJ8A 1FH2A 5AAMA 4L3AA 4P5MB 3MRRA 1H8OA 3DA0A 4PGCB 2G3ZA 3CZGA 3QUXA 2NSQA 3D9AL 2X6MA 3HMWH 4X6FB 3HE6D 1FFPB 3T0BA 4DFIA 4KX8A 1FH5H 4N2AA 4QOKA 3US0A 1H9VA 2CZNA 5KAQG 4V1DB 3DBSA 4YUEH 1AKJD 1WSST 2DLTA 3EJQA 1J1OL 3DSFH 3N42B 3LNEA 3P0YL 1NEPA 5DYOA 4W9HC 2NW3A 4DTGL 2JKNA 2ZF9A 3MUY1 3VD2A 3SQOL 3KXFD 5B3NA 2VDQL 5IMKB 4UTAL 3H1ZA 5F9JA 5F1IB 3CXDH 3ZHDA 4HDIB 3EIFA 4QT5B 1SN0A 4OVVA 4BUGA 4YNYA 1KJ2H 1EK3A 1WS8A 3K80A 4ODTL 1L9MA 1TJGL 3C60C 3SE4A 2H6PA 4HJIA 3VXRA 4FFYA 5HJGA 1PZDA 2MTPA 4B3EA 1Z9PA 2DLFL 2GSIA 2YGOA 4MJJA 4XHQA 3RRQA 5J1SC 5B38B 3D39B 1CL7L 3FJTA 5KWYC 4PLOB 4DETA 2IQ9L 3MBWB 4MJ2A 2G2PA 3A3YB 3FB5B 4HUWB 2CLVB 5I1JL 3O2DA 1OEZW 4N2KA 4Z3GA 3WIFA 5F7NC 3S3DB 1DVFB 4XMWA 1GOGA 1GZHC 1I75A 3QEHA 4XP1H 3F7RA 3GBDA 1YJDH 2NXYC 4BSVB 4UDTB 1J0ZA 2BVQA 3UPRB 3EOAA 1JGVL 1NH6A 2HLAA 1TXKA 2QVTA 3TA3B 2KDYA 2QHRH 3NYKA 2EEDA 3F04A 3MUHL 3QUZB 4PB0L 3CDZB 1YAZA 1I1AC 4LGRB 4CN4A 2VDML 5EUOE 5CFAA 3PIQA 3A6BL 4MBOA 3RY6C 4IKIA 1UWXH 5E08L 2O6CA 1LO0L 1TFHA 3CVBA 2Q87A 2ENYA 3VD4A 2DS4A 3NBNA 1ESOA 3VDCA 1DEEA 2ZOKA 4PWEA 3G6AB 3IU4L 4C8XA 3L7EA 3ME0B 1PFOA 4Q2ZB 2TAAA 5J9PA 2RBLA 2Y23A 1C5DA 2WY3B 4PW9A 4MD5B 3HHRB 2FYVA 3QULB 2FSEA 2W59A 2APFA 3VMOA 2ICWI 5C0CD 1JHTB 4PCKA 3KYNA 4ALAC 2I07A 1Z1WA 1JD9A 1V3MA 4P46B 3ATBA 1A8JH 2MJWA 4K8RC 4EE2A 3TFKD 3BEWA 4HT1L 1X5XA 3DJ9A 1J9QA 1KN4L 3EHBD 2JI1A 4M48H 4OM0L 5FO9A 1YY8B 3NJJA 5GRXG 3VB9A 2X9YA 5DMKA 1NFDF 2EC9U 5F3HA 5TF0A 2XV0A 5EO9B 1QWHA 4LSUH 3Q6FB 1NGXA 5BUAA 2CM6A 4OZGA 4Q4IA 1E5UI 4NZUH 4XBGA 4M8QB 1YNKL 4YBLC 5DZ9A 3A6CH 1IC4L 1GIGL 4PGBA 1MVUA 4NYLB 3OQRA 1OP5H 3MBXH 3L3KB 5L2JA 4L8SC 3QCVL 4WFGE 2OMXA 5CGMA 1H8LA 5IVXB 3D85A 3KJ6L 5BZDB 2CBPA 4QGTA 3FH8A 1S5IH 1SUHA 4LSRH 2HJKB 1G9NL 4FCAA 2LLLA 3GSUB 1R1CA 2ED7A 1N19A 3VB8A 4U2ZA 2Q5BA 4Z95L 1SF5A 1TUPA 2ESVD 3DXAA 4GEJA 4PRIE 4AQZA 1KGIA 2DD8L 4Y1TA 3V0VA 2A6IA 4AGMA 3BUPA 2AVGA 4W9IC 3ALXA 1RULH 4OAWA 1USQA 4OF3A 5E2TL 1KSRA 5TF1H 1U8NB 3GO1L 4AMKL 3GSNA 4X6DB 5T1DH 4GO9A 4GMSH 2ZWNA 3VI4F 4PY7B 5EFIB 3TEZA 3GK8H 4PJBB 2Z0BA 3D08A 3ZIMA 1GAFL 4PJ8B 4WU5A 3VU1A 2VL5A 3MSPA 4KJWD 4WV1A 2AEPH 3MV9D 4Y7OC 5F9OL 1IILE 2DM2A 2VR3A 1BJMA 3HI5L 2A9BA 1FL3A 2YQBA 3HB3D 3WEAA 4HOMA 3ELQA 3U7WL 1FFOB 1HL4A 3ZMEA 3ZGIA 3EO0A 2MEJB 1BREA 2FJGA 1LDSA 1M9SA 5DK2A 1QX1A 3T4AB 3S4SA 1JDDA 3BPLB 4QRRE 5IK3B 5HJ3B 4M5YH 5FF6B 2RA1A 3IRCA 2CSPA 2X0UA 5ISZE 2CA3A 3FO1A 3RGBA 3RFZB 4WFED 3MLSL 3MRIA 4YDJA 3G5VB 3IBOA 3C12A 3SOBH 1GH7A 1CE6B 4P5RA 3U4EA 2K0RA 2BERA 5ESAB 1PY9A 1ACCA 2R1YB 3DX1A 2I60H 3QIWB 3RVXC 1OARH 3EUDA 1T1ZB 2AV1B 3HNSH 2DTML 2B5IB 4MNGB 3TZVA 1SM3L 3LPOA 2YK1H 1A6VL 3PAUA 3EJJX 3GMQB 2CRYA 3L7FA 5DT1L 4RFEA 4F5CE 5GQBA 2RCSL 3X14A 1D2OA 1OXYA 4L4TB 4C59B 2AKRA 3SD5A 4UM8B 4JKPH 1RCYA 4NGHH 3NCEB 3PHOA 4H8HA 4HEPA 5D4QA 2VXQH 2H0EA 5ITFB 2YXFA 3NK4A 3DARA 4OVUA 3TBCA 2XDHA 1QLRB 4M9PA 4CU6A 3I3BA 2JKRM 2YS4A 3GI9L 5H37A 3DSNB 4OSUH 4HJGB 3TN0C 3SO3B 1SFHA 1M6UA 4ONOA 4BDVB 4CVWA 3ZUNC 4R8WL 3MLRH 3UTTB 4HUMB 3P73B 4N0UE 3N3EA 3CDGB 3QQXA 5DJDB 3IGAA 1HEZB 1LD9A 5JIHA 2EE3A 5I30L 3AU0A 2DMHA 4UZUA 3V4VH 2BSDA 5HHOD 12E8H 1T20B 4YO0B 5DGQA 5B4MD 1VDGA 4G9FE 1JERA 3TTYA 4PW3A 5I5IA 2R1WA 3CH8A 1UKSA 1V10A 1HWGB 5DJ6B 5JPMB 3HNTH 4TLTA 3OSVA 4RAUA 3OKOA 2DWXA 2W0LA 1Z3GL 3MUGA 4HIJA 3SKNA 2D7NA 3JWNE 4WTZG 4XCNB 3KEHA 2BO0A 5C6WH 1RZKH 2AMUA 3R0MA 3U1SH 5AOJA 2BVPB 2V9TA 4JL2A 5LBSA 5JR1H 3ZE1F 3Q44A 2BK8A 2OX5B 2OMWA 1OCWH 3LS5H 2IPUK 2DICA 3WKML 4RFNC 4B53A 1UWEL 2OP4H 3SE8H 3FYEB 1PG7L 1A4CA 1HKFA 4LKXA 5LNEA 4MB4A 3OZLA 1U8LB 4M61A 1KCUH 1AFVH 1CGUA 3IJYA 1MVYA 2PCFA 1KIUA 2QVKA 4MS8C 5FFOA 3SDCC 1NPNA 3DKHA 3CFCL 3MOAH 2Q76A 4RBPK 5IMLA 1A7QH 5BRQA 2J44A 4JFOB 1ODAA 3F6IA 4LSPL 2WINA 2JB5H 4KV5F 1HXMA 1KJ3H 1MFUA 2J55A 5IQ9A 2Z93A 5EEYA 3ZVVA 2X4OB 2AAAA 3GGWA 3RY4A 2VMEA 3HG5A 3QRGL 2OMZA 3NZHH 1O75A 3FAWA 5HPMA 2CBTA 2YZ8A 5C6PB 1YVLA 1CE1H 5E2VL 2AQTA 4FYQA 4GS7C 2W9DL 3FQNA 3KPLB 1E30A 3BFOA 3IJHA 3WYRA 4BH8A 4JY6A 4A68A 1MKFA 3GSRA 3WE1A 2P8PA 1MI5D 2VDQB 1AYRA 3ZSTA 5KBNC 1X5YA 4H0IA 1RZIA 4IOIA 3UG4A 3WNKA 2GUOA 4U3XA 3N0AA 1JE6A 4GXVL 4RCAA 2FUTA 3B56A 3NCYP 5DEJA 4XCEA 4KJYB 1JFQL 2XZAH 4PCSA 4Y16C 5DD3L 3DO4A 4DGVL 1F3DJ 2ZTBA 2IANE 5IJVA 4UYQA 2JTYA 4X7SH 4YWGH 5HVGB 1ZV9A 2Y36H 3JWNC 1S2EA 5IQ7H 3DGGB 2B1AH 2APSA 3U6XA 1Z5LB 4CNIB 3GSVB 5F7AA 4M7LT 5FCUH 2I27N 4IRJB 1CGVA 5JZ7D 2ZP0T 2MTAA 5TQ2L 5CEXB 4EI5B 4RMQA 5D93B 3BVDB 5HY9A 1SBSL 3GXPA 4NHUA 4DO4A 4Y1AD 4RH4A 2NOYA 3CX5K 1AS8A 4H20H 1MEXH 3BISA 3BN9D 4JBSA 5KVMC 3TESA 3TBBA 3JUZA 5JOPD 2QQNL 1A6AA 4I18A 3N44B 4X6EB 4RLDA 2IADA 4WNQA 2J1KA 4Y4HB 1JS4A 4NNPL 4P23D 1XF4A 2I69A 2FHBA 4HZAA 1KT2B 5IBLC 3LTVA 5BV7H 4I3SL 1JNNH 5T33H 4HKXB 3K5SA 2BY3A 1N6UA 3OKDA 3P3TA 2Q10A 3ZKMC 2K70A 2NTSP 4WRLA 3PHQA 2VDOH 3HG4A 2VLKA 1BX2B 2ATAA 2DIJA 2L8AA 1PG7W 2VDMB 1LWJA 1O6VA 3IDXH 4HKZB 1RLWA 2AI0H 1NDGB 5KTEH 3NPSC 1BVNT 1GGYA 4BKLA 1XL6A 3X13B 4PJXF 4GPVA 4TLSA 3IS0X 3D52A 2C9QA 4ODHH 1IQDA 1HN1A 2HUEA 3VWKC 2CO6A 3DYMA 1ID2A 2C9VA 3EFDH 2EYRA 3BWZA 1VACA 3VDAA 1EMTH 1U8OB 3U0WL 4AENA 1A7NL 4TNWK 3E3QE 3UAJD 1PD1A 3WUWG 2VZSA 3VXSB 3JWNG 2F53A 3KG5A 3AQXA 4XPAH 2UZXB 3RUGE 3IB4A 1J8HA 5T3ZH 4DVRH 2MH4A 3WJLA 2IQAB 4AVKA 4N1CA 4ZNCD 3II3A 5A40E 4QDGA 2BVOA 3VVWA 3MRKA 1BQLL 1SYSB 4F8PA 4CADB 1G0XA 1V55B 3O2DH 4R7NA 5FYKD 2ICES 1LNUA 5C3LD 4HSAC 1L0XA 1A6UL 3H3PH 3VXMB 3RHWK 5B8CB 1OQXA 2BX5A 2A6DA 3CG8A 4LB8A 3ZKNC 4URTB 2W1NA 4H40A 2CHXA 1IKFH 2E7DA 3T8XA 2OYLA 4NQVB 4HIXH 3O3AB 4MAYB 4AL8C 5A6IA 3CU1A 4RFOH 5JDJA 4Y4KD 4WFHD 2NY0C 1NAMH 3NVQA 1LO5A 4A2HA 4PV9B 5I2IB 3RGVC 4JX0A 4KRPB 4F57L 4PTUB 1A4KA 1VGKB 5SWZE 4YHYC 1VA9A 1NFDE 1QUPA 5D1XD 5LNGA 5T1LD 4N6RB 4CW1A 1QFUH 3EGDA 2AEQH 4TVPD 1BIIA 4QHUA 3RA7L 1LO2H 1K85A 3RNQB 5AOMA 4KJPC 1FZMA 4U6XB 4ZX5A 3NH7L 3BKMH 3QWRD 5DZJA 4NC1E 4P3DA 4HHAB 4WTQA 5C0EA 4K2UH 3GJEA 1CG9B 3KPSB 4HIPA 4XWGH 4M6MH 3UERA 3FZUC 2J6EL 3S37X 1XCTB 1OAUL 5C0GB 1AIZA 3V6OA 1S7WB 3KVDD 2XX1A 4OM1L 1K2DA 4PFEA 1YEDB 3ILPA 1WAPA 5HHNB 4EZMA 1TCRB 3OM3B 2YUXA 4NCDA 4L1HA 4WHYH 1EDYA 2AJUL 3LRSB 2YQ3A 2ORBH 1M6OA 2WJ7A 2XN9E 3W3BA 1HHGA 2QPDB 3EJYC 3HG3A 1DL7L 3O3BA 1YEHH 1UH3A 1QPXA 3WD5L 3UBHA 2J43A 3CFDA 1IC7H 4BWWA 3SKOA 3VI4E 1Y6NR 3KYKH 3NCXA 43CAB 4LP5A 5TDPB 1JK9B 4KVNL 4UUJA 1F6AB 4GSQA 3MBED 3KR3L 4PTTB 4Z7WA 3SQBB 3SE9L 1QSFA 3VFMB 1T6BX 4D3CL 2C3VA 1WISA 3BSZA 2NY1B 2EE9A 2YKKA 4F9LC 4L37A 3BUBA 1QSED 1VADA 5IB1A 3NAAL 4KAQH 4WI0B 1V7ML 1QFHA 2XYCA 3FO9B 3N55A 3AS3A 3OMZA 4Y9BA 4O58L 2EDDA 3OHXB 3KW8A 4HP5A 1CQKA 2WSKA 2I5YL 5C8JB 3LPPA 1A7BA 3CD4A 3RVTD 5KBKA 1DUYA 2O6DA 3WENA 4JZJC 1GS6X 1MPAH 3D4GA 4H8WC 2X2UA 1K9TA 4K73A 4WI4A 3UDWC 2H2PC 1SDDA 1TDQA 3AREA 3GC3A 2OZ4H 5J12C 3SCMB 2EDNA 1QO3B 5JA8B 4P59L 4IIQC 2NR6A 3LN9A 4R96A 4AV0A 3QIUC 3WEOA 1W8OA 1WZLA 2VDNL 3H55A 4NC1C 3RVUD 4WO4B 2J8UE 3IFOB 5HD8D 1I8KA 3DSFL 2FNWA 1S7TB 1SOXA 2LTQB 4MXVF 3ZK0A 4YLCA 1HXKA 2IPKA 3S98A 5AOZA 5T1MA 1F8TH 2P5EB 2QPSA 3CXDL 2WZ5A 4M8UA 5CILL 1JFHA 4M3HA 1P9MA 4P4KB 4UB0H 2ZUQC 2Y2WA 3ARFD 2WBJC 4YX2H 2DWEA 3CXHJ 4F7CB 3C5ZB 1D9KC 2NY5C 3D4CA 3I50H 5B39B 4K3DH 3OKYA 1PSKL 4WO0A 3FN3A 4URKA 1KJVA 2QVMA 3O6LH 4Y19E 4DUVA 5GJTH 3VA2C 1YPZE 1ZHNA 2H45A 1ZOXA 2EC8A 2ALWA 2BWQA 2CLZB 3LKRB 4GNKB 4JVWA 4N85A 3S35H 3ZKQD 1JZ8A 3TIDB 5F71A 1GRWA 4IEFB 2BSBA 4PLKD 3HMXA 2EDHA 4NQCA 4DQOH 2APWA 2FIRT 4N8PA 3VFVA 1ED3B 2OTPA 3I6KA 3DYOA 2C3GA 2P8MB 4GG8B 3BPOC 1ZWIA 4F8LA 5JPNB 3BGMA 3CH1B 4U6YA 2IBBA 1M53A 3OJDB 1XFPA 3EF4A 3FTGB 4JJ5B 2QHRL 2X4QA 1BVLB 4QAWA 5I1HH 4ADGA 1Z2KA 4BFNA 4FNQA 4F27A 1BAGA 3L5WA 2VWEE 5C0FA 4MCZB 1GMEA 5T3XH 2IG2L 3ZE1E 3RURA 1LDPH 3H2QA 3D2UD 2B9BA 3RDTB 4UBDC 4KH9A 4JPWH 5KYWB 1ZPLA 4E9LA 4LNRB 5IHZB 1VFBA 3QZMA 1SMAA 1ACZA 4BFGA 4KXZH 2LV4A 2Y7MA 4MNHB 1MREH 2FWOB 2XV6B 4ZSOA 5KG9A 1M42A 1ZLSH 2DQIH 4OFQA 1I8LA 1KBVA 5TDNA 4DIXA 3WI9A 5LG6A 2CLRB 5HYSB 5IW3A 1FNAA 3NMEA 1JP5A 2Y69B 4KPHH 3ROLA 2WNGA 1H8NA 3QZWA 3SBWC 5HYJB 3LX9A 1NMCB 1FDLL 5EZOH 3QJXA 5FW6A 3OMIB 4KV5E 4HH8A 5D1ZB 4HIQA 2FJHA 5E4EB 1HJCA 3GEFA 5EBLB 2WTRB 3U7AA 1U3HD 3VFOB 3D4ZA 1FAIL 3EYQC 3T2QA 3S96A 2Z7ZA 4CMHB 5I75C 2FH8A 4AM0A 1R5VA 4F58L 1FI8C 5MENB 4WWPA 2XN1A 3RZCB 4KY1H 1BM3L 5DRWA 1AZCA 2LLNA 1KXTB 1SJEB 1DQQB 3S34H 5I1LA 4J12A 4MAUL 5JXEA 2BNRB 4O02H 5GSRA 2WMPA 4RZCA 2C5DC 4HWZA 4YHPA 3K6SA 3D50A 4JM2D 43C9B 1VKXB 4JDVB 4NM4H 4NQEE 1XWVA 5KVFH 1XZ0B 2X9WA 2VR7A 4UNIA 1O0VA 5I1IH 3MLUH 2AEWA 1U91B 1V7NL 4LSRL 4ZS6D 4F7TB 2ZX5A 3FU6A 2YUZA 1U33A 2PMZA 2VWEC 2HFEB 1AAJA 1MDTA 4KKLC 2JWYA 5I15H 2Q2EB 3KXFE 3MOQA 3ZDXF 1R75A 4WTXA 5C07D 2AJVH 4WENB 2XV3A 1EV2E 3IXAB 4ZO8A 3PP4L 1HTYA 4P57B 3VI3B 1RFDH 1HL5A 2EYTA 4ZMNA 1F3JA 2JELL 2DM7A 1TQUA 3D2TA 2IPTH 2DF3A 1KYFA 2EXWD 4GMSL 4L3CB 1HINL 4R83A 4TTDC 4Z7VB 5F7UA 5D1QA 5DU7A 4KK5D 2WXKA 4U7KA 1ND0A 3P0VH 3VD5A 4FQHB 3NPZB 3VSQA 4RIRB 1E5AA 2AJ3B 5DRNA 4IRSD 1QWNA 2CHZA 3BUQA 4NQTA 5I8OH 4EDWH 3FUNA 5BCAA 3ARPA 1OSYA 3F6JA 4UANA 3TNMA 4FG6C 2UY7B 4M5YL 4QRFA 5SV4A 5I17A 4PJXE 2YIHA 2F5AH 2WLJA 4LBEB 1T7XA 3S3SA 3RIFF 5CLWA 2KKQA 4K15A 3OKMB 4AZUA 3ZE2F 4WW2F 3LKPA 5L0QC 2XPGB 2P8LB 4WHTA 2P5WA 1U8CB 3HC2A 5SWSA 2CM5A 1BGXH 3UJIH 1TTGA 3KLAA 4PRAA 4AIOA 1CDUA 1AZNA 3V4UL 4H25B 2I85A 4HBCH 4AQ1A 2KZ1B 4U1JA 1K8IB 1MZYA 2DWDA 3MGAA 1PZ3A 1I1AB 2GIXA 1P53A 1G0YR 3VYPA 4BINA 5C2BH 4HBQA 3QEQD 4RMSA 4NGHL 3HE6C 4JAMA 3L9EA 3EBAA 4JUSA 5DVNA 3FCSB 1UVQB 3VFWB 1C5CL 1A0QL 4HZLB 2XG5B 2V7NB 1NTDA 4ZOBA 1OWRM 4N0CC 2CA4A 4QRQB 4K5OA 2XUWA 1JGDA 1UACH 4ANWA 2OYPA 1FYTB 1LL1A 4C58B 4XPTH 1TZHB 4ZUVA 4Y5VA 2D0FA 4PJHA 4GUPA 1FHNA 5C0CE 5MERB 2HFFB 3L5IA 1UJTA 1LGVA 1G5AA 4DPRA 1WPCA 4OLWL 3T09A 3D51A 1ZLDA 3V4VL 1TCMA 3VWJC 1LP9A 4K94C 5IIEA 1HESA 2WXRA 5DMJB 1SZNA 3GBNL 4HIIA 1AQKH 4MX7A 1GYVA 2QGBA 1YNTF 3CSFA 3BXNA 5CBEB 4OUUA 1BFVH 3RL1A 1FL6A 3SDAA 2DJSA 5JW4Q 3NZSA 4XCCH 4AL8L 3LV3A 1BQKA 3IAGC 4WUUD 1JPGA 2X2HA 4G11A 4J27A 3U1SL 2AXWA 1C12B 1AXSB 2AJSL 4MZ2A 5JR1L 2HRPL 2V2XA 3GSWB 4AQAA 4MNQD 1F13A 1OCWL 2JF1A 5ID1B 2JH2A 2YD6A 3TBTB 1HFUA 3B9KB 4G43B 3DX9B 3K74B 4OZHA 4JW3A 4QXVA 3B3BA 1UXWA 1QA9B 1QNIA 3LZFH 4I9XA 4RRPM 5F7WC 4NRXA 1KTJA 5CJOL 1MCWW 4XC1H 1IQWH 1KCUL 5EORL 4F2EA 5AVSB 4HJTA 1K3ZA 3ALPA 5E4OA 5KBMA 1HHKB 1S7VA 1XGQB 2CH8A 4KKRA 2BLFA 5EUOB 2ESVE 3US9A 3LXUX 1KCSH 4ZFOL 1RK0A 5D7IF 2JCCB 3SE3C 3MUZ1 1AQMA 2RD0A 4BBWA 1MDAA 1NGWA 5K93A 1KBPA 2BP0A 1CICA 1XGPB 1NBYA 2CE6A 4K7FA 1D7BA 1I1YA 5DJ0B 1INEH 1XMEB 2FX9L 4QRPA 1C7SA 3E6FB 4PB9L 1IKNC 5BMFH 2EH7H 3FQXB 4CILA 3D4YA 4HMEA 1FP5A 4IKJA 4YSSA 3NZHL 2FWLB 2HJLB 1U95B 1YY9D 3QUYD 3DJSA 1MRDH 3RWEA 1ZAGA 3MRLA 2VDNB 1P1ZA 3MV9E 4MS6A 4K07A 5CLZA 1IC1A 1RJZA 2CCLA 4GQRA 1IIIA 1KIRA 2RIKA 3TFKC 2Q2LA 4JO3H 4AGPA 1BBDH 4JHBA 1F3DH 1RVFH 2J12B 1E4KC 3TYFB 5AUMA 4E2OA 3EHBC 1MY7A 1EIBA 2QADB 1T21A 1MFAH 1SXNA 1O6SB 1YMMA 1A1MB 3LRKA 4LOUD 3HR5A 4QHPA 1CT8B 3N43B 4WFEE 3R4DA 3APDA 3LQAH 1XF2B 1ZT4A 4YWGL 2Y36L 5IQ7L 6FABH 4MXVE 4TXVB 3UIZA 1FGVH 1DBBH 1NMAH 2EDYA 2WNKA 1FZOB 3GXFA 5FCUL 4Z18A 1AANA 1T5WA 4KHTH 4Q9CA 3IJ9A 3P4NB 4LVHB 5F44A 4KRLB 4JHAL 5D7KD 3T8VA 1O7SA 4KVCH 4O2EB 4I0PD 3R0NA 3V7MA 4XNQA 4FMKA 3DVFA 3ARRA 2QDVA 3X11B 4Z0XA 3S5LG 1MEXL 4XVUD 2BSEA 3APFA 4LVOC 4NSKA 4P2QD 2YSTA 1NCDL 4FYSA 1GYCA 3VJ6B 5EDSA 3CFEB 2MIZA 3UG5A 3GB7B 1BAFL 4WHDA 1S7SB 4PRIB 1S8DB 4HLJA 4YBHA 5D6CB 4TUKL 1VRSA 1JNNL 4GI8A 4RX4D 4TLUA 3R7QA 5T33L 2RHEA 3W38A 2R4SH 2WXHA 1RAMA 3SY0B 2QEJA 1NC4B 4UQCA 2WO3B 2DAVA 4X6BA 1WJ3A 1DHKA 1MNNA 1AD9B 4NUJA 3E2HB 1YN6B 2A3TA 2AQRA 1XF5B 5ICUA 3IJSB 1L7IL 5HHOE 3EYOA 3GJFH 1KG0A 2ATKB 4D8PB 2OS7A 4JPIA 2AEOA 1AY1H 3S97C 2XSKA 3GLAA 4QJ5B 5I8KH 2R56L 3B8SA 2AGJH 4ODHL 4KJWC 1E28A 2FLBT 2FEJA 3V9CA 4NQXB 1NCJA 5DEFA 3MLYH 1EMTL 5DI8B 1QR4A 3DPBA 4J4PC 5AVQB 1LEGA 4NERA 3WJMA 2MPAL 2OMVA 2FO4A 4XPAL 4QRRB 3VVVA 3R06B 2G3MA 5ISZB 3H9SA 4L8CA 3ULUH 4OGYH 4U6HB 2P24B 1NCCH 4RFNB 3MLWH 4C56B 3JTBA 1NDMB 2JK5B 4PRDB 1E8ZA 4AM0Q 1KPUA 4XN2A 2UYLB 3UOAB 1SXZA 1EEUA 4HWBA 3CIQA 2V5MA 1MCWM 5E9DB 4V11A 5HDBB 4P9HH 4ONFH 3V5KB 4AGQA 4M5SA 1UM5H 1S46A 4JO1H 4AE1A 3PAZA 3SDCB 4JB9L 3QUXD 2CHWA 4ODWA 3CQQA 3WLWC 1JHKH 1IGML 3QDGA 1PQZA 4QOKD 4HIXL 3V5HA 3T08A 1ZT1A 4X6CB 3QEUB 1TR7A 4R9HA 4MWFA 3CPLA 5B7FA 4F20A 4RZKA 1R24A 2YEZA 2WB1A 4P07A 4UT6H 5DD6B 1PDKA 2Q86A 2AEQL 3EYVA 4YHZH 3WKYA 1M1XA 1CXHA 1LO2L 2IH3B 5BQ7A 4AEHH 1BZQK 1X5HA 1WDAA 1A65A 2EINB 5DRXB 5GGRA 3VXRD 4P4RB 3HAEH 3N85H 1ZLEA 3WSQH 1J5OH 3UTSB 3VMPA 3MFFA 1H5BA 4XWGL 1E7VA 4HJJL 5FUOH 1MI5E 4Y4FB 5TDOA 5ILTL 1FBIH 4H1LG 1RPKA 5CEZL 4MJ6A 3MRFA 4NFBA 4OV5B 3CFJA 4KGLA 4ENZA 2NYZA 2GK0B 4KZEH 5B7MA 1OSPH 3QDMA 1URZA 2VM4A 4JLRB 3MV11 3ATDA 4IJ3B 5EB9A 5EBMA 5AW7B 5D7JB 5BOPA 3S8FB 5G5DB 4M1DH 1BFOA 2ORBL 4AIZA 5KYXA 3O45A 4WEMB 3EH3B 2QDWA 2BZCA 1KBKA 4MSWA 4MJ5B 1HZKA 4OLEA 1YEHL 5JOFA 2XPZA 4ISVA 3STLB 3L3OC 4LVNC 3HC0B 4FQQB 1IC7L 4Y1AE 5BZXA 3X1FA 4HAGA 3BP6B 4AIXA 1DCLA 3V0HA 4NBYB 1ZLWK 3A4EA 5JOPE 1XGRA 4PP2B 5IBUB 1BVOA 2BIOA 4RMRA 1L9NA 3MJWA 2ARJB 2GC7C 3D3VA 1UM6H 1CGXA 2E7LC 1WAAA 3VFNA 4KAQL 1IVLA 2HCZX 5A1AA 1CPUA 2Y5QA 2HFGL 3M45A 2IH9A 3CHQA 1NKRA 2X6AA 4DP4X 2EDJA 5A2IH 2Y1YA 5LQBL 1NEZG 1TPXC 2EDMA 3Q5YA 4NRZA 1MPAL 5HVHB 5EU7E 2K6YA 5D2LA 1ACYL 1AI1H 2KDGA 3IDJB 3UBXB 5HDQH 3MGTA 3RP1A 1CD8A 3ZE2E 5IW1A 5FGRA 1QHOA 3NJXA 3P9WB 4ZMOA 2CRMA 3BKJH 3CFKA 2D7MA 4JFDB 2CXKA 1KV7A 3Q01A 4X8CA 5JIDA 4R2GB 2OR9H 3RNKA 3ARBA 3ILDA 1GOFA 4UILL 2KS0A 1BIHA 2R4RH 3VD9A 2WWKO 4A7VA 2CDGB 3QUML 1U8IA 3WY3A 1TKWA 4I85A 5A3ID 6TAAA 4G8GA 3BVNA 4ZPVA 3U0PA 1KZQA 1XGYL 3MUUA 9PCYA 1BXUA 1X9QA 3B7RL 3V4VB 4HQQH 1DO5A 1SXSA 1UQSA 3L3GA 3CZSA 2OQJA 1D5IH 3FQWA 4XO3A 5FYKE 1EXGA 4X9GA 3QFJA 1M1SA 3F7VA 4TL5A 3FRPB 3O6LL 4OD3H 1IAIL 1QR1A 2A38A 1HOCA 2Z8WC 5GJTL 2GCYA 4HA1A 1C7TA 3D85D 4U6VH 5ICYA 1V3LA 5GRZA 3NA4A 1A47A 2AV7A 3EYSL 4PG2A 1N59B 3KGUA 3FHEA 5I8EA 3TIEA 2KH2B 1CQYA 4ZPTB 4N8CL 2G2RB 4QPEA 4AEIL 4YDIL 4LCYA 2FQDA 3AWEA 5CMAA 4WFHE 3BN9C 1OAQH 3HNVH 3DXAD 3L3HB 5E8EA 5KSUA 1Y1DA 5D1XE 3EUUA 4I9WD 4JFVA 2J21A 3ZIYA 3O3EA 4P23C 4J3WA 3IPEA 4TVPE 5D71L 4UQ9A 4GAYB 5FOBA 1G7HA 2L7EA 1LXMA 4O9HL 2DQUH 3GZQA 4FNTA 4KDWA 5FUCE 4JN2A 3GXNA 3OGCA 3ZT5A 5KZCB 3BPNC 1JF6A 4LEXH 5EU7C 4NUPA 3DHMA 1CWVA 4LOEA 4ZFOB 3STBA 32C2A 4Q74A 3NACH 4K94L 1AGBA 1MXGA 2GSGA 4P2YA 2DBLL 3WTWA 3GSOB 3SJVA 4WW2C 3B5HA 2BS8A 2CIIB 3UZEA 2CNYA 3MRDA 1TTBA 4OCYL 3NQIA 4ESKA 2A9MH 2AK1L 5HYQB 1Q9OB 1ZVSA 1CC3A 5IJKC 4ABWA 2H4EA 3UAJC 1G4MA 1N3NB 5D7IE 5HHMD 2AXFA 3RUGB 1IAMA 4DW2L 3MRQA 3LVTA 3L8QA 2CHNA 3P4MA 5EZJB 2NY7H 3HPLA 2R69H 5CHNB 3OAYH 2CK0H 2ZT9C 3WLBB 2BRQA 2EVGA 5FM5O 4ERSH 1E9QA 2H9GA 2QLVB 1TZGH 1CTOA 1VFAB 3QAZC 3G6JF 1D5RA 1VLXA 4I48A 3TZVD 4OFVA 4P9ML 5J1AB 3JZYA 1OGAA 1Q72H 2XJKA 3SKJH 5EZLB 1HDMA 1QP1A 2P47B 2H32H 1P7BA 3MGOA 4MMXB 5GGTL 1A66A 2BP5M 2WLNA 3F7KA 3VRIB 5BPPA 3GUFA 5I8CB 1A7OL 2YRBA 5LAXB 1QSEE 5C70A 3FW6A 3OKLA 4X4MA 1SN5A 4CMMB 4O02L 4W81A 4TNVK 4Y4KC 4U1SA 4QCIA 5SWZB 4HIEB 4PWFA 1NFDB 2XWTA 3RWFA 1KLUB 3SPIA 1JGUH 4JQXA 3OR6A 1JWSB 5D1XC 1WIPA 2ENQA 4PJFF 2VERA 4MDIB 2B7DT 4LLAA 2DV6A 4YHNB 3VFPA 2GK2A 3FCTA 4EN2A 1JYWA 4X0KA 3MLUL 3EKCA 3WMPA 5GS1A 3MCG1 1KGYE 3W39A 1CLZL 3FFDA 2X1OA 5FUCC 4XPGH 3RWGB 1QLFA 4PW4A 1XSOA 5BZWA 3P11H 3NSDA 3ZO0A 1UZ8A 2DOCA 5D8JL 3BZFB 5FUZH 1CGSL 3VG0H 2BINA 5CKAA 5IM7A 2AJVL 3FOMA 2ZUXA 1MJUH 2ZUQB 3UABA 3FF7A 1A6TA 3AT9A 3HI1B 4M1GH 3AY2A 4O5LL 3VNZA 1RHHA 4AXWB 1D9KB 2NLJB 3F65A 3NA9L 2Q7YB 5KBDA 1KB5H 1F41A 3T9WA 5MEQA 4M4RA 2XN9B 5IUCA 1WV7T 2HT4D 2YXWA 5GGQH 4YSTA 4YGVB 3P77A 3NFNB 3FC8A 4XMPH 5ACZA 4AKPA 1IGJA 4BH7A 2AK4B 1ZVHA 1TO4A 4QF1A 3IVKA 4I3GA 4ZXBC 1KGWA 4AZ8A 5B7EA 4KDVA 3LN4B 2V33A 4YC2C 5DUMH 3IGFA 3BPOB 3OAUL 3MBEC 4PCYA 5ELIA 3RVVD 2ZOLA 5L7XH 4NKDB 4RWYH 5E1GA 3RBSA 3QO1B 5KSAA 4DOHB 3L4YA 4X8GA 1L9QA 3HLAA 1RIVH 3HCVB 4FQXB 4WWKB 1EHXA 4PJDA 4JCWA 5A2AA 3QXTA 4R4FH 3N41B 3RVTC 4HSQA 1I7UA 2AS5M 3ZO9A 5C2BL 4JG5A 1M2OA 3APCA 5EIIG 3ORJA 3C60A 1XF3A 2D7TH 1EERB 2ZCZA 1TZIA 1N18A 5EU4A 2X1QA 5E8PB 1XH3B 2W65A 1RI8A 4Z78B 3HFFA 3WTYA 1AE6L 2J8UB 5C09B 1KJMA 3RVUC 4C83A 4JFQA 4X5PA 2ICWJ 1MAKA 3LHAA 4MA3A 3HS0C 1JPFB 2BNQA 4ODVH 3FXIC 3O8XB 3F58H 1ZLUK 4L18A 2MQCA 3Q3GA 1OZUA 3ARXA 4X42A 5GGVH 2O61B 1GPOL 2XCMC 4JJOA 2F54D 3C9NA 4PPTA 5CLYA 4PVMA 3ARFC 3FUIA 3S8GB 4HV8A 2ZWKA 2FR4A 2WC7A 3BQUA 2Q8AL 3ZT7A 3SKUD 2Z92A 3EADA 4Y19B 1TQWA 3WELA 5I75B 1U4EA 2FQGA 1YPZB 1ROWA 2A1WL 4LRIC 4NWTH 4X5RA 1KNOB 3FU7A 2X0VA 2YRLA 1WFTA 1BFVL 1GZQA 4AQOA 4B6ZA 2VN4A 5CGBA 3GMMA 5D5ME 3UPAA 1DJYA 4MMZC 1KTRL 1OP5K 3VFRA 4BFRA 1M05B 2WNWA 4JRWA 5JHLA 4PLKC 4G6MH 5ETUB 3T6XA 1XIWA 2YQ2A 4KXBA 2PW1A 3II1A 4GUQA 4U7SA 2GPZA 2XQYK 1OTSD 1KEML 3V0DA 4Z8FL 5F7DB 2Y22A 4HUCA 1IAIM 4XX5A 4OZ4A 1NIAA 3FRUB 1EDHA 1ZMYA 2ZX6A 2CG9X 4FFZH 4WJG3 5C6TL 1DDHB 1FNSL 2VLKD 3H8NA 2E5EA 1IQWL 1DVYA 5PAZA 2X9ZA 3TCXA 2RR3A 4X4YB 2QVFB 4QTIL 3ZL4H 2BJMH 3P3SA 7CGTA 3QUKB 4AX3A 1R6VA 4MD0B 4EOWH 3H6AA 1IM3B 5GS0D 3EJRA 1RXLA 3QQ4B 5C07E 5B1KA 3HG2A 1KYOK 2X44D 1HI6A 4JZOB 4OJCA 3JWDC 5JNYA 3VH8B 1YEEL 5DZAA 2F53D 4L4JA 1UENA 1J8HD 1N8ZA 1ZJAA 2NY3C 4JFZH 1TTRA 3S35X 2D03H 3WY4A 4MGXA 1CGTA 5IFHH 3BW9B 3KYMA 4XPFL 2X6VA 2EUZA 3NCJH 2E4FA 3OPUA 1G7QA 5HPOA 2VE6B 3BKYH 1OF0A 4FLRA 5E6IA 4BZ2A 1ICTA 5F93C 1D5MB 2HG5B 2IWFA 4D0CA 4ZQTA 5BVPH 5I1GH 3QHZH 1QZNA 3PL6A 3VFSA 3QUMB 4KHXH 1J05A 3SO5A 2R0WL 1AMXA 2BOBA 2RALA 4F37F 4PJIB 2APVA 3ZQXA 3FQ2A 5L0QB 2WVVA 4LLQB 5C92A 4FQCH 4PJ7A 1SY6L 1FPTH 1HIMH 2B77A 2F7RA 3CTTA 3TT1H 4HD5A 3KBEA 2X6BA 1D5XA 4TSBH 5E00A 4LFHD 1DBBL 1H3GA 2APBA 4HUUB 2Z9TA 3RTQC 1ODUA 4KHTL 4ODXB 2A9AA 2Y6TE 3BOVA 4L9LC 2EP6A 2IVFC 3QJUB 4MA7H 4F24A 1BFTA 2XX0A 2B8OT 1DLHA 2FATH 3HE6B 2BSRB 5IF0A 3QEQE 3CK0H 5DFTA 1T7ZA 3IMTA 1GS7A 1MCQA 4F2MA 5IWLA 3F2LA 3BZEA 1FIEA 4OZGF 4ZBJA 1AKJB 2Z4TA 1BXAA 1CFSA 2Z4QA 3MAWA 3BKCL 4OF7A 4TKWA 3WS6C 3IETA 4LSQH 4Z7QB 2V5YA 3KXFB 2A9CA 3ZXAC 3W37A 8FABB 2PN5A 4Y2DD 2ZKXA 4WGKA 4F3FB 1Q94A 4XGZA 4FEMA 4I87A 4LK4A 3MDJA 4KU1A 2ZSWB 3VG9C 3ATEA 3EJZD 2ADJA 4XPHL 1EX0A 1SEBA 2EXWC 2NQCA 2WZPA 2BHFA 3TEXA 2J1ZA 5CIPA 1BG9A 4IHOA 2NX5B 2ICEB 4WTZA 3IKCA 3JV6A 1DQIA 5DZLA 4FQ1H 4KNUA 2AGJL 1KLFB 2WYIA 1RY7B 1WA2X 1G4RA 4G80A 4JFWA 4IRSC 3INOA 1QSFD 3GSXB 3VGAB 4WUUE 2D9CA 2QQQA 3TH4T 1IO4C 2OW6A 3UP6A 1EVTC 3ARUA 1XEUA 1YDPB 3L1FA 4MNQE 5E6UB 4EIBA 2UXVA 5FB8A 3PFQA 3B7YA 2CJUL 4A1RA 2OTUB 1KZYA 4TPRL 3REWA 2FT7A 2QELA 3PGFH 5A7BA 3FQTA 3OKEB 2WIIB 4FA6A 2R0LH 2XYBA 25C8H 4FTVA 3ARED 1JWMA 1JV5A 4KQ3H 1D6EA 4RGMB 1FJ1B 3GXIA 3S5ZA 4Z5RA 3DVNA 2R2HB 3TN0A 1I8MA 3CCHA 3QORA 1TJMA 4G3YL 5K5YA 5L88L 3OBAA 4R84A 2KHAA 4GQZA 4IU2A 4OR1A 3V5DB 3MNZA 1TMCB 2X9XA 4O02B 4LEBA 3G6JE 1XBRA 3DGDA 4YDVA 2H8PB 3TCTA 4QLWA 4UQBA 3H53A 2BH0A 2OJZH 1G1CA 3GQFA 5MI0C 5FGSA 4N0FB 2VXSH 1B4RA 2VDPL 3ZT6A 2AJZA 1ZHKA 3TP4A 3FOLA 2NY4C 1FVEB 1A02N 5C0CB 4WY7L 1KCWA 2M26A 1HQ4B 3N85L 4BFOA 5JO5B 4NRYB 4N26A 1E5ZA 4LCCC 3DV4B 4TUJB 4AIEA 1XZWA 3UYOD 2W5PA 4NWUL 3EHBB 4G6AD 4X7CC 5KSBA 2A6JA 5E5UB 4WK0B 4W6XB 2ITCB 2X4RB 4FXGC 4HIHB 3VQ2C 4QXWA 2AC0A 1AGFB 3PGCA 5E9AA 4IGBA 1M7DB 2JSFA 1CMOA 4NQCD 2YPVL 1JZ6A 1QOKA 2XQYG 4GO6B 1ZGLP 2I9TA 5HHQA 1H15A 2WTPA 4M6AA 3O41A 4MMYA 4U3HA 3VE0B 5JDSB 1YQVH 4YFLF 1F4WL 5F89B 3C8KA 1TYEB 2WGNB 3A6OA 3LZQA 4Z77A 4L1BA 3DUHA 3HN8A 1PKQA 2OAAA 5D7KE 2YQGA 3C6SA 2V6HA 4N1HB 4GP4B 5E8OA 5C08D 3V0FA 4YVNA 1A21A 4L8DB 4XVJH 4H0HB 4TQHA 4P2QE 4BYHA 4U49A 4ZD3H 3PFUA 5DS8B 3WN5B 2ESVB 1C5BH 2ADFH 4XNUH 5INDB 2VJ8A 4MLSA 2ADYA 2X4TB 4OF5A 1ZANH 1KBGH 2XFXB 1W72A 3MOBL 3PWVB 4QHNA 3PWUB 2GIYA 2WN3A 2XXCB 4LLMA 1IMHC 4O2FA 1VENA 1A1NA 1R3KB 3MCLH 4S1DD 3BRDA 3EOYG 3Q1EA 5HTSA 5HDQL 4EUPH 2W92A 4PN6A 3X3GL 3MV8A 2ATPB 1DN2A 1O5DT 2EQDA 3BPCB 3MRHB 4OCRL 3WDIA 1XGTA 5LGJB 1YY9C 1Q1PA 3MV9B 3QUYC 1BHGA 4X7TA 4FKKA 3H2WA 4Y5XC 5LGHH 3GXUB 3QCTH 1MCOL 2OR9L 3KPPA 3HB3B 4KROB 1XGZA 2X4SA 2OA9A 3MKKA 5I9QB 4GP5B 4YHLH 1RZKC 2VR4A 4JQVA 3U4BH 1ZIBA 3OWRA 2BCKB 2F8IA 3FKUS 4PUBH 2JE8A 1DQMH 2DQGL 1UCBH 1KN2L 1UUSA 4XMXA 3V0WH 4PI0A 5JXED 1FN4B 3UBXG 4LOUC 2FZ3A 4RAVB 1AD0A 1WFJA 3I3EA 3KPNB 4TM9A 1D5IL 1D2PA 4CC1A 4RDQF 1TYJA 5HP5A 1WEJL 4XCYB 5DUJA 2EKJA 1GA2A 4U6VL 1KB9K 3KBHE 1ZHBA 2N01B 1N26A 5DTFB 5DQJB 1NQBA 4TV3A 4ZMAT 2W80C 2QR0B 1VGEL 4I0PC 4QOKE 3DBXA 3WHE1 3M46A 2F8XC 5CF3A 4XVUC 1OAQL 4QXGL 4ZW8A 1AMYA 3LYRA 3T77B 3AY4A 5KW9L 4M6OH 4RSYA 3AVEA 4AVIA 2L04A 4B9YA 2FT6A 5AVUB 1WICA 3FT4B 1H9DA 1QFOA 2DQUL 3GUTB 2B2XH 3VXRE 4D0DB 2X38A 2AQPA 3EBGA 1I3GL 2G5BA 4ZW3A 3WKPA 1KTCA 3IDUA 1X5KA 3S0PA 4G8FB 3U79A 2KQNA 3TO2A 2FH6A 3PWNA 3FNKA 3NACL 1QI5A 2XY1A 3FULA 3MJ7B 5HHOB 4KQ0A 1A7RH 2XIBA 1NBZA 2VMDA 3TBVA 3RKDD 2IAMB 1NJ9A 2Y3NA 4G5ZH 7PCYA 5I6MA 3GHPA 4U1IB 5K69A 4ZQKA 5CXPA 4CUCA 3LZRA 4W9DC 1LE5A 2QTVA 1F1GA 5I74C 1B2WL 3BGFC 2IFFH 1EPFA 2IIJA 4I77L 3ROOA 3SY6A 4A7QA 3PQYA 1UXSB 2R2EA 3MR9B 4QWWD 3DETD 2JKXA 3L3OB 3V4PL 3U6XS 4LVNB 2P5WD 3OKNA 5CKGA 4AUYA 4EIGB 5SWSD 3TU6A 3CZNA 3TCLA 1OZTG 4Q9QH 1RLBA 2CBOA 2HLEB 2VTFA 4OQTH 2VIRB 2WLIB 2G60L 3ZL1A 4QD2E 1D6VH 1Q72L 1MIEH 4MCNA 2AW2A 2BSSA 1WGOA 5AW4B 5AAMC 4UAOC 1FL5B 4FKEA 2UV3A 3MJ8A 4JFXB 3P30L 3QUXC 5D6DA 1E4XL 5F2FA 3UEZA 5AAPA 4IBUA 3P69A 5AOIA 1YAIA 5IB5B 1DR9A 3NIFE 1XCQA 4XAWL 3K46A 1TPXB 1OY3B 4DZ8A 4LKCA 1AGCA 4DP2X 3TF4A 1KCVH 3CDFA 2BOCB 1O5PA 1F2XK 1U8QB 5JQ6H 1FRGH 2EH8L 5DQ9B 3MC0A 4ZMZA 3SDDC 1GOHA 3ARDB 3L48A 3MVSA 2A6KA 1FE8H 2O5ZL 3NEEA 2A4CA 3SE4C 4CN1A 1N4XH 1SF3A 4KKAD 5G2NA 4HISA 4RQQA 1BAWA 4H0GA 2IWKA 2NZ1A 1MNUL 3AS1A 1MHPL 3O4LA 1MI5B 4HK3J 3MTRA 3D33A 4P5MA 4FXLA 5IESL 5FYKU 4PGCA 3LDBC 1I3VA 4X6FA 3SDAD 5ANMA 1FFPA 3NSXA 3LRMA 4C47A 3KL3A 4LMQE 2B3IA 4OZGE 2Q8BH 3SDXF 3WY2A 5DVPA 3MODL 4LPUA 2FX7H 4WEEA 1KB5L 4O2CB 2W60B 3GRWA 4Z9KB 5LBVA 3W5MA 4FG0A 1JF1B 4PMEA 1TITA 5AZUA 2O1AA 5F1IA 4HDIA 4QT5A 1NGYA 2FRGP 4XMPL 3DVIA 3DK0A 1UEYA 3Q5OA 2L7QA 4XMLL 4G9DA 1HZHH 4Y1AB 5EC1B 4YXHH 4F93B 5GIRB 2GFBA 4MQSB 1T89A 3L17A 3VGBA 3MUJA 4I7ZC 4PGDB 5DUML 1LHZA 5CJQH 5EOTA 3DXAE 4MJ4A 4Y1SA 1GW0A 3ZL2A 1R17A 4ECNA 1T0MB 5B38A 1HHHB 3QIUA 1BZ9A 2RTTA 4XMKL 5HI4D 5IZ7A 4I9WE 3FU5A 4P23B 1BCIA 1ZEAH 5IGXL 1CICD 2C9XA 4N90D 1H3PH 4D0BB 3QQ9D 1OAYH 1RIVL 3L1GA 2AMGA 3FB5A 3D0VB 2JXMA 3L5JA 3Q8CA 4HUWA 4QRPD 4GW1B 1DBMH 5FO8B 4L5FE 1BPLB 2CLVA 3BPNB 4R4FL 4TSCH 3NIGF 4IRZH 1CFTA 3TOPA 1LYQA 4L3EA 5I28A 4XP4H 2YPKA 4BSVA 4UDTA 3ZE2B 1A4JB 5ESQB 4Z7WF 3UPRA 4WW2B 1HS6A 1I3UA 1X5IA 4LLVB 1MHEA 2WVUA 2YLKA 5MEPB 4PRBB 3V52L 4HKJB 5HGAA 4JY4B 5A43C 1EEZB 1NA8A 2L4OA 4FLSA 5E99H 1IAII 2NXZD 5JHBA 3FUKA 3OJVC 4ODVL 4XHJC 4PJ5B 1NMBH 1XQ4A 4G6KH 5DC2A 2VDPB 4HUXB 5E5RB 3FHQA 2Y4SA 4ZOCA 3VXQB 5HHME 3MNWB 5ITBH 1CFVH 1YMMD 2CUIA 3BIKB 4NDMB 4K7PX 2FO8A 3QXUA 1MRFL 4LCWB 3X17A 5A3IC 1IBFA 3NSYA 3GTVA 1BZ7B 3WIAA 3VSTA 4K0OA 2VSKB 3G6AA 4KC3B 1N2RB 3ABGA 4NX0A 4X83A 3TJPA 3WIIH 5KYUB 3B5GA 3P9LB 4WCYL 5IKCA 1F6LL 1QUNB 3PJNA 4JDTL 5EA0L 3WS3B 3BP4A 2QVIA 3QULA 2LOEA 1JHTA 4AVHA 4I3RH 1G7PA 1DJIA 1YCSA 2BSED 4QTHA 5D2NB 5I6NA 1DYZA 4Y4KB 2PO6A 2CPCA 4GKNA 5AVYB 3RWHA 1SVZA 4HETA 3UTZA 3CN4A 1YY8A 1HAUA 3TEUA 5D1XB 3ML8A 5T1LB 2OL3A 5GISH 4Y8AA 1RZJH 4GJTB 3RX8A 5HHPB 1G5GA 4FFZL 4LSTL 4Q6YA 3RI5K 3TT3H 2PR9A 4X9IA 1VEOA 4ZDHA 4RSVA 4FNLH 4K9JA 1DVXA 1UEMA 1QHQA 3C09B 1AHWB 3ZL4L 1UT1A 4U1LA 4KY2A 3ZN6A 1WWBX 3L3KA 2IWGA 1JPSH 1LQBC 2RGSA 3BUIA 4K55A 5H4ZA 1F56A 1HSAB 3QJTB 4QAMB 2XBTA 1E5BA 1KCLA 5H2BA 5IBTL 4EOWL 5IVXA 2QJDA 1BEXA 5GRUL 3VX0A 3POCA 3OWEA 4P3CL 2F08A 3LZNA 3D0LB 4CKQA 4UMSA 4YLQT 2DQCH 5GRJH 2HUHA 5FV2A 1R3JA 3V8OA 2HJKA 5AYTA 3DROB 2ISDA 4ZMWA 2YC1A 3GSUA 3FB8B 1JYVA 4X50A 5DJ8B 5LHDA 2W8CA 4E36A 3ULVH 2P43B 4JFZL 4Q97A 2B1OA 3O2VL 5HDWA 3H9SD 1LEKA 5DHVH 3TGXA 4AJVA 4QMEA 5IFHL 2OLDA 3RAJH 1LK2B 3GIVA 5AWNL 3ERXA 3HZMB 3MRBA 4DEPB 4OJAA 1P6AB 5GGUA 1UZ6F 5FC9A 1U8NA 4M7LH 3RFRA 1OM3H 4X6DA 1OAZH 2GBUA 1JMZA 2Z6FA 5I1GL 5CCJA 3PAVA 1ZHLB 4PY7A 4FXKC 1E40A 2Z1KA 3LVEA 4LOFA 2HH0L 4KHXL 2CPUA 4PJ8A 5KBLA 1MWAH 3TZVC 3THMH 4F91B 4APXB 1FO0L 4XCFL 5KVFE 3QDGD 1INQB 4PSRA 3NQKA 4TMPA 5ADOL 3ARGB 3CUPA 1QSEB 4ZW5A 1NGZB 2PF6A 4UTCA 1RUAL 3HZVA 4PG9B 1FFOA 3TT1L 4AKOA 5F1OB 1P5UA 5IEHB 4TSBL 5KYNA 2Q7AA 1HNGA 4U3CA 4B7LA 2XA3A 4XP9H 5KVEE 4FP8H 2XI9A 3NK3A 3EH4B 2CQVA 2UZIL 2H3NA 4F7EB 4MA7L 1X5ZA 4GKZB 2CO7B 1I9IL 4A2FA 3EO1B 1E4HA 4QYOA 1IC5H 1YSOA 3G5VA 1CE6A 1H3UA 4WW1A 2DEXX 5ESAA 2OSXA 2R1YA 4KTEH 3QIWA 4Q0XL 1O7VA 3CV5A 1RSFA 2FB4L 4MNGA 4DUXA 1IU1A 5E2UH 4YHIB 5EZIL 3GMQA 4PVLA 4TOYH 3WFEH 2K9UA 4UM8A 1LO3H 3QDMD 4PRHA 2XWDA 3NIDF 3VTAA 1JNLH 3CJJA 2P48B 1UCTA 4QYAA 3M6DA 1Q1JL 2Y7SA 3VXPB 3FN0H 2E46A 2CBQA 1R3LB 4XP5H 3PHAA 1F90H 4KUZH 4ONGL 3AJ7A 3CVHA 4LL1A 5KVDE 2W38A 3A4AA 2V37A 3DSNA 2H41A 4HJGA 5AKSA 4BDVA 1I53A 3ZYZA 4JDEB 2HT4C 3KEDA 4XXWA 5K9OB 4KMTL 1EGJH 3DX4A 3ILQD 4MMZB 4F8QA 2LLGA 2QHLA 5F6HI 1HH6B 1EFXA 1OHZA 2K7QA 3GYRA 4GI9A 2VDKH 4N5ED 4YH6A 4XNBA 4ZTEA 1T20A 2OTWA 4YO0A 1FA4A 3J07A 35C8L 1NEUA 3D3VD 1KENL 2XTJD 4OU3A 3V4PB 3AXLB 4OZFH 1T6VN 3WFBL 2XWXA 5DJ6A 3P2DA 3RVVC 4ETYA 1Q0YH 3L2LA 4DT2A 1USZA 1YEGH 3PGFL 1BDYA 3GDBA 2VLKE 4XCNA 1M71B 4A7SA 4NUGH 4IBSA 3CSGA 2B0SH 4KQ3L 1MLCB 5C7XL 3TEYA 1AH1A 2H32B 3MRNB 3QXDB 4QJ3B 3ZKXB 4WNJA 2OX5A 3ZYIA 4PYHA 1XXDC 3D2UB 4P05A 3CDCA 2W07B 3HG1A 2Q7NA 1AG0A 2PETA 3G9AB 3LPGA 5CZXD 2PLTA 4LAQH 1U8LA 3ARBD 1OE3A 4JR9H 4FABL 3WDJA 4DCQB 4GAGH 1NCOA 2Y07H 5K9KA 1U41A 3UAEA 3C8DA 3NFPA 1UA7A 2F53E 2FQFA 5J4MA 1EAPB 4PEEA 1J8HE 4MZRA 4DEUA 2D3NA 2KPNA 4DK3A 2VDRH 1S5HB 2G75B 4G8GD 2IOMA 2F19H 2XOTA 2XZQH 1ROCA 1JMXA 1SXBA 5DZOA 4JFOA 5DURD 4G42B 4NO3B 4HJSA 4MKTA 1ZV2A 2EIJB 1GSKA 2WCGA 5KANG 1X4YA 1J9RA 3QFJD 1HHJB 2VZUA 1QACA 2WGXA 3BT2L 4N1EA 4EBQL 5JW4R 5SWQB 4PJGB 1FFRA 2PCPB 4ZO7A 2UX6A 1KFGA 1U3HB 3U1QA 5KYYB 1CZ8L 1MQ8A 1X9UA 5HI3C 5INCB 1I1FB 1S3RA 3WL9B 1L9OA 2AAVA 5D5MB 4WEUD 1I1CA 3KPLA 4PJHF 3X1BA 1KB5B 2EDBA 1CDYA 3TPUA 1A22B 1P4UA 2FJFB 3VFUB 3UZVB 4UTAA 4I18C 4QUOA 2UXTA 3A47A 1NL0L 4YSCA 2VN5A 5E8NA 1LP9F 2RQ8A 4JM2B 2E74C 3FB7B 4I2XA 3R19A 3GFUA 3H0TA 1OTSC 2AXJA 4ZW7A 3VFGL 4XVJL 2GI7A 2GAZA 3DGGA 2H6OA 4CNIA 1AQDA 1ZXKA 3GSVA 4BQ8A 4U1KB 4FFYL 4EN3D 1QHPA 2CHDA 4IRJA 3SJVD 1C5BL 2ADFL 4XNUL 3V6OE 4EI5A 3QR1A 1UYWH 5KS9B 1GW6A 2AABL 2X4NB 5J6GB 2GW5A 5L4IA 4M7KL 4S2SA 5GS0C 2QPUA 5H4YA 4OZHF 5ALBH 1H3XA 3MCLL 3H6JA 5KVGH 1T3FB 3GJFK 1GJUA 1RJCA 3TJEL 4DN3H 1TZAA 2VW7A 1HYSD 5DHMC 2YEVB 1ILSA 3WJLC 1KT2A 1WD8A 2VZVA 3LH9A 3NESA 4R0LA 2GTWA 5E03A 4YSOA 3WHXB 4N9GA 3L08A 4MHHG 4JG0L 1YLBB 1BEYH 3F12B 3NIGE 1IBYA 4IRSB 3VRJB 1V3JA 2HWZH 1OGAD 1H3TA 4Z7WE 1QSFE 6CGTA 1OPGL 3GZOA 4N0YH 1NDGA 1SOQA 5CD3B 3G5XA 3A67L 1AXTL 1ZGLA 3ISYA 3QNXB 1NCBL 3X1NA 3MRGB 4NM8L 4ZT1A 1UCBL 4C4BA 1MCRA 4ES9A 2YAOA 3CX2A 3MHZA 1JGEA 2YRZA 4DUWA 1UASA 2EE0A 3DUUB 3LNIA 2XTSA 1OB0A 1MCDA 3TVMB 1U8OA 1AC6A 2QQKH 4AITA 1AVAA 5AW0B 1XV8A 1MCNA 3TWCL 3B37A 4B95C 1ZTXL 1CFBA 3HZ3A 5D9SA 3SYPA 2UZXA 5DWPA 2JI2A 1JPEA 2IQAA 1YC7A 3ARQA 5LCVA 2QSCL 3D12B 2DIEA 2DLIA 3EO9L 2VCOA 4XBPA 5I1CH 2MHAB 4R7VA 3K71A 4N8VB 5FW7A 2N7AA 4MRBA 3FT3B 4FNSA 3DX8B 2FYYB 1W0VA 3WTUA 3P0GB 3EYFA 3LZLA 4H8UA 4NO2B 2C9UA 5B1JA 2JFCA 5EU6A 3JV4B 5B8CA 3DIFB 4GXFA 2EUVA 4M6OL 2VSCA 5KSVB 3VD3A 1NCAH 3HE7C 2K9FB 3V6OC 2IDQA 4Z23A 5IB3B 2B59B 3O9WA 4NQVA 4J4PA 3O3AA 1IIKA 2FX8H 4ODSH 4Z7NB 1EFQA 1RURL 2HSIA 3A0OA 2B2XL 3OAZH 3EDJA 3AC0A 1JRHL 4GQ9H 4M8VA 4PV9A 2OJ1A 4D7BA 7PAZA 4H1LA 4B9IA 2ZG3A 2DMBA 2EXTA 3EJZC 4X5WB 4FRWA 5FA3B 3OB0H 5HJBA 4DJMA 4OKDA 5IY5B 3CFQA 1PIGA 5M7QA 1KTDB 2ZCLH 1MSPA 4MD4A 4U6XA 1LE9A 3X3FH 4P5TA 3UYPA 3I2CH 3LMJL 4WEBH 5ACMA 1VJSA 3HZKB 1INDH 1J0YA 1CG9A 1JXDA 3KYAA 3KPSA 4NQCE 4XODA 1W16A 2IFFL 3WFDL 3NZ8B 1HX0A 3OJMB 4WUUB 1H0DB 1XCTA 2YD7A 3D6GA 3CHSA 4PWJA 5DFAA 5C0GA 3TFBA 3AAZA 3HG0A 1S7WA 2WOYA 3M8OH 5KSAD 1EVUA 5KOMC 5TE7L 4MNQB 4EI0A 4Q6KA 3RB5A 3QIBB 4LASH 1IGCH 1X4ZA 5HHNA 1TJIH 1TCRA 1J1PL 2QV4A 5DK0B 3LRGA 4U0RB 2CWRA 1BVKB 4J3OH 3WY1A 3GI8L 1U92B 3KPMA 3NZUA 3QXWA 1FO0B 1XXFC 1MRCH 2R2BB 2WBWB 3C60D 2B4CL 4UQAA 3CVCA 5CBAB 3RIAK 4AEEA 5GS2H 1UZ6E 2ERJB 3GT6A 5L8LB 2NR6C 3QQDB 5EF2A 4G1EA 1BMZA 3G6JB 4YHMH 5T1JA 3RLSA 2VC2H 5TDPA 1JK9A 1U8KA 2B08A 5L4MA 4DNLA 1CGWA 2WWNA 2BNQD 3OL2A 4ZSOE 5FA4A 2VXTH 5T1KB 3SQBA 2WLLB 3VFMA 1I9RH 2ZKHH 1T4KB 2WHVA 3WNMA 3E8VA 1EO8H 4G7RB 5I26A 2NTFB 1FRGL 2VR8A 2ROYA 4HLZG 4WI0A 3FUJA 4AKQA 4HOWA 1P4IL 5JYLA 3OHXA 3KGTA 3P02A 1A2YA 2N0KA 1GGBH 4WI5A 4LSSL 2GHWB 2UVFA 3BQUD 3EYUH 3IS1X 7FABH 2HT3D 1AZRA 3CFMA 3LKNA 3KWUA 4JQIL 2PPCA 3LIUA 1WYJA 1S4IA 2P28B 4G6AC 4AYGA 3PV7A 3UL4A 3NCYS 3VQLA 3ETTA 1KGUA 4KOBA 5CZRA 4ZMVA 4WO4A 1XHHA 4TUUA 1PNCA 4Z0BH 4LL9A 3IFOA 3L95B 5MP6H 2FX7L 1DO6A 1DQDH 2XLLA 2BDNL 3GMNA 3ZYJA 1UOKA 1R4XA 1XIWD 2NDFA 4OIFA 4FQJL 3I6LD 4APQB 2A83B 4N2NA 2P5EA 5B1BB 1X6NA 3FSOA 2WM0A 3NIDE 4P4KA 1JGLL 1IAOB 2HX7A 1PAMA 2QQLL 4I0PB 4NHCH 1T0OA 4Q6IA 1E4WH 1KXHA 2PW2B 4YXHL 1HZHL 2JJWA 4F7CA 5G4NA 3C5ZA 5ICXB 1SOSA 1ZS8B 5B39A 2E8ZA 1NLDH 1PYWB 1ES0B 3CXFA 4KGJA 4P2QB 5JW5B 4WLCA 2BMKB 3JTTA 4RISH 1I82A 2CLZA 4H88L 1URIA 1H3PL 1JVOA 4B96A 1P5VA 1JI1A 1WAEA 1L3WA 3LS4H 2UUDK 1MFEL 4I4WA 1CLOH 2D2CC 2DM3A 4IRZL 1KGXA 4IU3B 4PY8I 5D1QE 3E6HB 1KFAH 1KIPB 4L2YA 4S1DC 1PU0A 1KPVB 1YYCA 2F7IA 3FBKA 1NGQH 1I8LC 3OJDA 4R26H 2WYHA 3FTGA 4UQ3A 5LBSL 4YMPA 3NP3A 1OGTA 1WD9A 3DHJA 3PUCA 3NABL 5E6ID 5F7FA 1LJMA 1AIFB 3LEXA 1QYGH 2PP7A 1J1XL 3GEWB 2LVEA 4OD2B 5E99L 4PV8A 3PL6D 5T5FA 4NQDA 4DEWA 1WC7B 1NMBL 4G6KL 3KJ4B 4QHLB 3ZTNH 5D2LF 3C08H 2DRUA 5KYWA 3GMLA 1NWOA 5IHZA 4YQXH 2GKIA 4RNRB 4BSWB 2PYEB 5AD0B 1IGYA 1TU2B 2P5WE 4LHUG 5SWSE 4UIMA 1ZK5A 4AC4A 1RZ8B 2YUVA 5JXEC 1WWAX 4MNHA 5EULV 4A39A 4AW4A 4KQ4L 1DZ0A 4FNUA 3IJ7A 3R8QA 5HVFB 5H35B 1WA0X 3D87B 2ZYHA 2X7LB 4HUNB 4UAOB 3CBJB 2FK9A 3HC4L 3MRRB 5KVEL 1YNLH 3QUXB 3II2A 3I75B 3S3JA 1I8AA 3TONA 1BWMA 2DQTH 3DV6B 4QOKB 3ULSB 4E42A 5FO7A 3FO0H 4XP6H 1H6TA 2JKSA 5D1ZA 5KUKA 5FHBL 1OB1B 4B9PA 4K7PY 1E8XA 1LO4L 2NW3B 2NNAA 1TTCA 2J5LB 3FFCA 3HAEG 3UPCA 1QFWL 4ZUUA 2XN0A 1TQBC 1HKLL 1MCCA 2ZNWA 2MCPL 4AY0A 5D4IA 4ICXA 3KWWA 2E6PA 4PJHE 5EEZA 1KXTA 4TSAL 2EDWA 2E9IA 2R0KH 4H0LC 2XVBA 3FQUB 1EEQA 3HFML 1XH2A 2WZPD 3LEYL 5LNDA 1MAMH 5I76A 1LP9E 1XEDA 1QTYT 4OGQC 2GSIB 4JDVA 1J0IA 1S9VA 4FD0A 1UWGL 5D1QC 3NRPA 4YR6B 5DO8A 2AZAA 1XZ0A 2DKUA 3INUH 3QHFH 4WJKB 1TVDA 3LDBB 1MQKL 1E3XA 4ATTA 3PJSA 4LPCA 3GPEA 5GRJL 4Q9RL 1U91A 15C8H 3HN3A 1CLVA 3RKDC 3BJ91 2AQ2A 2KERA 4M62H 5DYFA 5F7BA 2EUWA 4BEIA 2Z31C 1I85A 3T1WA 4EUPB 3ULVL 3D9AH 4F33B 2ZONA 4QGYA 2EVFA 4JFSA 4B9GA 1E4XI 2H5UA 3PE9A 2BVQB 4LP4A 3UTQA 3VI3A 2HLAB 3S6CA 3MO1B 2AJYL 1N7ML 5E23A 4QWWC 3V10A 1J1OH 4OZHE 5DZPA 3P0YH 3WIHA 4DAGL 1L9SA 4OCWL 1WRFA 1LLAA 2DY2A 4ZO6A 1OM3L 2VRKA 1WBZB 3REVB 2DM4A 1OAZL 4FTVD 3SQOH 2O6FA 1YNTA 2VDQH 2NSXA 3TN0D 2ZOUA 4AQ1C 4EMZA 1A3ZA 3QORD 3MXWH 1T03L 1BJ1J 5C0JB 4ODTH 3ARVA 1TJGH 4FQHA 1UFGA 4B9JA 4HUKB 4BA0A 1AO7B 1WVZA 4N90E 2DLFH 4BHUA 3NIFB 5E6YA 1G7JB 2ZOKB 3LPWA 4QRPE 3IN2A 3OMAB 3LIZH 4HX1B 1DJHA 1A64A 4YL4A 2C1PB 5DXWA 4HCRL 1B0RB 3L7EB 5E70A 3QUGA 3RB7A 2IQ9H 2UY7A 4DP0X 5BJTA 2AXHA 4PWKA 5J9PB 5KJ7E 3EFOB 3QH3B 4LBEA 1MCEA 2ZSVA 4M29A 1JSYA 2FSEB 5IHBA 4GRMB 4Y5VC 3KYNB 4Y9EA 1FFTB 1PZSA 2I07B 4NKMB 1U8CA 4ZMYA 3WO3B 3QDJA 2EKSA 3BC9A 1RZGB 3APMA 3EG9A 4H25A 2FE0A 1RJLB 4U2YA 3BEWB 3TLRA 4M7ZC 5E2UL 1E0OB 4TOYL 4NCC1 5I6LA 5F3HB 1JCKA 4NZRL 2BSCA 1YMME 4IGBD 4PB0H 4ZXBA 3SB3A 3WFHA 3UBGA 3MREB 4MS8D 4PRNB 4KO9A 1FWXA 2VR5A 4LPVA 3FCSA 4RMUA 2VDMH 2E86A 3FN0L 5EF3A 3B3IA 4HZLA 2XG5A 4JRLA 4PGBB 4E41B 3HHSB 3RWJB 3PWLB 5F7YC 2W81C 3ETSA 4QRQA 5GJSL 2Z0UA 1KMGA 3GKWL 3APNA 2DMCA 3K3QA 5E08H 1LO0H 1FYTA 1AACA 3UGEA 1FAKT 1TZHA 1ANUA 4WSJA 5IB4A 2VITB 2DQMA 5MERA 2VQ1A 3JXAA 1EGJL 4FI8A 4DN4H 3C2SA 1KGCD 3LXBA 1WK0A 1XTMA 5CZVL 2PTUA 1XD0A 4JGNA 3IAPA 3DXAB 3VNYA 4EXPX 4OZIF 4HEMA 1FHGA 3V0VB 2A6IB 1BD2A 1FZKB 5CBEA 5HI4C 5L9DH 1Q0XL 3H7BA 3Q2NA 2XXFA 4GY4A 4OAWB 1CICC 1RZFL 4Y7MA 5ERWA 1YEGL 3HS0A 2IH1B 4HT1H 4JPVH 1KN4H 1TFPA 3QQ9C 3N9GH 4NUGL 3TS8A 2B0SL 4Z76A 1E2VA 1FGNL 1C12A 3L2MA 1G0DA 4Y16D 2E7MA 2P1YA 3MV8D 1J8KA 2ENJA 1SYVA 2Y5TA 1CXLA 5GHWL 4WV1B 1HAWA 5K59F 3DX9A 3O6ML 5J0BA 1YNKH 5CCGE 1W80A 4OGZA 2V5SA 3I74A 2EIDA 4JR9L 4NJ9L 3QCVH 2D3JA 2Y07L 3TV8A 4JN1H 1DJXA 5DK2B 3S4SB 4GKLA 4LARL 3VXNB 3RPIB 3KJ6H 2HMID 2JCCA 3H9SE 1D7FA 3BSZL 3FO1B 3MACL 1MXDA 1O9VA 2YARA 2YPLB 3V7AE 5DK3A 1E43A 1XGPA 2XXGA 1ZIAA 3PWJA 5K1JA 3M17B 1WZMA 2W88A 3MRIB 4BA8A 4OLXL 2BSTB 5DWUL 1LVEA 4Z95H 5F97E 3FTYA 3CSYB 3HVNA 3IJ8A 3F83A 3EH1A 3FQXA 2DD8H 4M1CD 4PU2A 1RKRA 1XSKA 1PPIA 3TZVB 1E5CA 2JKTM 2HJLA 5E2TH 3GO1H 1J8RA 3QDGE 3WTSA 4AMKH 2AKRB 3EJTA 4G71B 3C8HA 1D5ZA 1EANA 3PHOB 2WBXA 3QYMA 2WKLA 2C9PA 1GAFH 1A9EA 1UB5B 4K3EH 1OCOB 4N3TA 5LBGA 3H56A 3FUHA 2L7JA 1SJXA 1VPOL 3HI5H 1KJ2A 4OGAD 4ZUSA 4WF7A 1OANA 1A1MA 3ECQA 1CT8A 1KXQA 1RUKL 2BCMA 3D07A 5IQMA 1J8SA 1G6RH 2KI6A 1LD9B 2VB5A 4WK4B 1EZVX 3P4LA 1FG2