5A7BA

Structure of the p53 cancer y220c bound to the stabilizing small molecule phikan5211
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Experimental and Theoretical Evaluation of the Ethynyl Moiety as a Halogen Bioisostere.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5a7bA00
2RMNA 2YBGA 5LGYA 2J6WA 5KBDA 4KVPA 1HJCA 3TS8A 3Q01A 4HJEA 4LOFA 5G4OA 1CMOA 4IJTA 5AOKA 3D05A 1EAOA 4MZRA 4L0ZA 3D0AA 2GEQA 3D06A 3WTVA 2BIPA 2BIOA 4IBYA 5AOIA 1HU8A 2VUKA 2X0UA 1KZYA 1UOLA 2WGXA 4IBSA 1EANA 1GZHA 4XR8C 4L0YA 2PCXA 2P52A 4AGMA 1IO4C 2BIQA 3D08A 4IBQA 3WTTA 1EAQA 2XWCA 4AGLA 5AOJA 5G4NA 2BINA 1H9DA 5AB9A 4IBWA 2XWRA 2J21A 3Q05A 4GUQA 4GUOA 4AGNA 1T4WA 2IOOA 4AGQA 4IBZA 3D09A 3VD2A 1YCSA 1E50A 4LO9A 3WTSA 5LAPA 3WTUA 5G4MA 2BIMA 4L18A 2ADYA 4AGOA 2IOMA 1GZHC 4G82A 2AHIA 1CO1A 3US0A 1TSRA 3EXLA 1LJMA 3WTYA 3IGLA 4AGPA 1TUPA 4IBUA 4QO1B 2J1YA 4A63A 3Q06A 3VD1A 3IGKA 2X0WA 3VD0A 5A7BA 3EXJA 2J1ZA 3WU1A 2FEJA 3D07A 5BUAA 2OCJA 4G83A 2MEJB 3QYMA 4IBTA 3WTWA 2IOIA 3ZMEA 5ECGA 4IBVA 2H1LM 4LOEA 2AC0A 2X0VA 4MZIA 3KMDA 3KZ8A 5ABAA 5AOLA 2ATAA 2J1XA 2J20A 1HJBC 5AOMA 3QYNA 3WTXA 3US1A 2J1WA
chains in the Genus database with same CATH superfamily
4YXKL 3NIFF 4LFHD 3LJ3A 5F9JA 1MY7A 5TDNA 3TYGH 2E6PA 3ARFB 2WHVA 3CHSA 3DBXB 2V9UA 1S9WA 1CDIA 3G5XA 1ID2A 3I9IA 4E9RA 1P7KB 1ETJA 2OLDA 4MHHG 1CICD 3DURB 4PCYA 3DIDA 3DTXB 4MHHI 2EIMB 1UWFA 4R7DA 4KJPC 2AV1A 2VZ1A 4Y5VC 2EDXA 4OW6A 3I6GA 4QHUB 1N5YH 2CKNA 3AFLA 5EU6A 4XH2A 3BVNA 5DJDB 4H0GA 3UYRH 3EBHA 1R5WB 1Z5LA 2UVEA 2X5PA 3CPUA 5IFAL 2GAZA 1KTLB 2ZOKA 2P28B 2ZXBA 2A4EA 3V55A 4A2GA 4DK3A 3O6KL 3HR5B 2CCWA 3PLYA 2G5UA 1U8QB 2XBTA 1FGNH 3IPEA 4UTAL 2IQ9H 1WZ1L 4HKZA 1JGUH 3FQXA 4HS6A 4OTXH 4X42A 3U1SH 5BOJA 3PWLB 3K6NA 4CKQA 4JN1L 4TRPH 3SDDD 3WIHA 4OJAA 5KYUA 1FZOA 3EAKA 4L37A 1NMCC 3BN9D 3FO0H 3V6OC 5BS0B 2VQ1A 1G1YA 5BZWB 5SWSB 3DO7B 3F64A 5HHPA 5D2NA 4CBZA 1UJ3B 3WXWH 2O5XH 5DD5H 1F18A 3PAVA 4R7NB 3BAXA 2WUBL 2VL5B 2EXWD 1T03L 5FCUH 3AS2A 3EFDH 4YSPA 4MMXC 1GC1L 1YNTF 5E2VH 4CSZA 1TU2A 2YXFA 3CLEL 5K9JL 3FSZA 4OQTH 1H8NA 2WK2A 1TYEB 4YLCA 4BHUI 1OCRB 4Y19E 4XWOD 2B4CL 1T2QH 4PRIA 4CDGC 3TZVB 1HQ4B 1RUQH 2O5NA 4V1DB 4YHZH 2ENQA 1E9QB 2DTML 5B1JA 5I8OH 2XN9E 43C9B 4LBAA 4BFJA 2W91A 2KERA 1GW0A 1KJ2B 1U8KA 1H3PH 5KVDH 4KXBA 1JI2A 4GI8A 4JUTA 4X7EC 4C57C 3F58H 3PCYA 4IK6A 3SKNA 3LQAH 3VD4A 1KBGL 4XAKE 1E9PB 2XBZA 1LO4L 4H8QA 3BFOA 2AEOA 2FWOB 5IW3A 4JFXB 4WJG3 3UG4A 2HRPH 1PU0A 3N1QC 4P2QE 5I0ZA 5DZPA 4GG8A 1FFQA 2XZQL 4APQA 2D7QA 4B5EA 3T0XA 2LFEA 3NSXA 3L45A 3R4RA 4BZYA 2XWTA 3ASNB 2HTKC 5FB8B 2FJHA 2A6JA 4IGBB 1X5AA 5C09E 3FN9A 4KUCD 1IFHH 3RLSA 4RX4A 3NFPB 3FF7A 4YR6B 3WTXA 3AU1B 3SGJC 4WEUD 2QGCA 4M48H 3QWQB 2E6JA 4QRUB 4ELDA 2TRHA 3BMWA 5ALBH 1A4BA 1I8LC 4MXQC 4UTBH 3B43A 3WDHA 2EE2A 3GLAA 4P0DA 1MCHA 1UXLA 3L4CA 3CXFA 2QADD 2PO6A 5F9WC 1YC7A 4AV4A 4QRRE 1HU8A 4Q9CA 5CNHA 5E00B 1DO6A 4ZOCA 4X4YA 4A7UA 4KZCA 1S9KC 3QZWA 3LXAA 4K7PL 3T2OA 2XFXA 2P5ED 4UV4H 1XCTA 3WAJA 4L0YA 5D1QA 5DA4A 3EH3B 3T2QA 4PJIF 4FXGA 3LRSA 2NZ1A 1TR7A 2DQIH 1WVZA 3WJMB 1OAZH 2QV2A 2E8YA 3JV4B 3KR3L 1S9XB 4L8SB 2P47B 4JBSA 3VFUB 1J8HD 2J55A 1XL4A 4P2RB 1WAAE 1Y0LA 4L8BB 1NKRA 2GBAA 4GAJH 1JIBA 3SD2A 2HYMA 4ZPVA 1NGZA 5T5NG 2L04A 3AUVA 4YHIA 1YMMB 3EYUH 2E27H 1WUNT 5GGSB 4BZ2A 4CL7A 2C34A 3C6SB 3GJEA 4I8DA 4B9KC 5FHBH 1FV1A 1CD9B 4PJHB 2FWUA 2J4WH 5GRXG 1IBZA 3F04A 1JNLH 1RIUL 3KEHA 3UADA 1HCZA 3KGTA 3VVVA 4UM9B 4HKXB 5DF0A 2ADYA 4KKCC 3IMTA 1P7QA 1LDPH 2WTRB 2A5UA 3VXME 3VGGA 4URTB 3VWKA 4UOW0 4PY8J 1BMZA 3NRFA 4M7ZC 2HVJB 3WTYA 5TQ0L 2W9LA 4LCYB 5FYLL 5HJGA 5E4IA 4PP1D 4DFHA 4QO1B 3BZDA 4KXDA 3L3KA 1KGUA 1YN7B 4R26H 5DHYB 3V5DA 1T1ZA 4PW9A 5IB1A 1WO2A 3C8DA 1UUNA 4KBPA 1QSZA 3W9EB 5FECB 4N8CH 3KYKH 4Z95L 4JRXA 1NCJA 1VFMA 4XHQA 2CHXA 4MD5A 1U8IA 2XKSA 4Z0BL 1ZLWH 1UGNA 3OX8B 5I1GH 3FCTA 3OKDA 2A4CA 4EUPA 3T08A 2H2PC 3MX0A 4JCMA 1CK0L 4HBCH 1PX8A 4H44C 4I5BB 2CK0H 2X7LB 5HSFA 3MXWH 1GJWA 3I6SA 4BK5C 2WKOA 4LARL 1HE8A 4MZIA 3SPVA 2QT6A 4KKLC 8FABB 32C2A 3TN0A 3NABL 3O6LH 3K6FA 2EVJA 4PS7A 3OAYH 4E5XA 1UENA 4OCWH 3CSPA 1UWXK 4EI5C 3RGVA 4JFOB 5ITFB 2JIXB 3KG5A 4DPRA 1CGTA 2EP6A 1GHFH 3D25B 3NZHL 4BE6A 4L8CA 1TLKA 4F1ZA 3NIDB 3OJVC 4P3WA 3OXRA 1IIIA 2RH0A 3PHAA 4N0YL 3OD3A 1ZTXH 3BWUC 4MNGB 3FQUA 4XP1L 1CICB 2YHGA 3L5WB 3IDUA 4OR1A 1OP9A 3ZZSA 1XAUA 3QWNA 5KVDE 1KWGA 3VFMA 3VM5A 1RUAH 3R1GL 2JH2A 2P5PA 3GGWB 4NQDA 3NZSA 4KRLB 1RL1A 2R7EA 5EO1B 2P8PB 3OB0H 4G8AC 3LDBB 2NY7L 3IDGA 5MEQA 3QUYD 4UAHA 2FGWH 1XGUB 1ZPUA 2Q6WA 4PV8A 4Z76A 3ZSTA 5KEZA 4GQPH 4ZD3L 3ZDZB 1Q9WB 3SDDB 3ZDYB 3SEPA 4XP9H 5IB4B 3K7UA 1F56A 1MVUA 5E8EB 1A9BB 5I1IH 2GHZA 2GJPA 4N0CD 1ZE3H 3GRWH 4Q7DA 3FB8B 1Z7JA 5HY9A 4MJIE 4JFHE 4PREB 2QVFB 1I9JL 4KKZA 4LMQI 4UOJA 5F88A 1DJZA 5C08E 5JDSA 3EGDB 5DI8A 4ORZC 4RZCB 1F42A 2UY7B 4WTQA 4LSUL 3BWSA 4NHCH 4F2FA 2WKLA 3EGXA 3OZKA 3AVEA 3WEXA 5CU5A 1OCZB 1Z9PA 3GM0A 4Z18A 2XN1A 4O2CA 4X4ME 4YZFE 4GRWH 4N9GB 1K2DA 2DI7A 3WU1A 4X5LA 2RCSH 5DVMA 2XKNB 5M7QA 1KCRH 4OCXL 5KVEE 3WFBL 4G2AA 4JPKH 3GMLB 4YDJA 2Z8WC 5ESVA 5IVXB 3M88A 3LEXB 3O4LA 4TLUA 5T33H 3MO1A 3EYOB 3LNFA 1UCBL 5DVNA 1NAML 5B3JE 5J12B 4YC2C 4Z5RB 3NCBB 1U2CA 4RIRB 2XZCH 3UEZA 4MFHA 4JFYA 4U0RB 3RDTC 1LE5B 3ZR5A 1GAFL 1CYGA 1KBKA 1NMAH 3U4EB 4B9CA 4KX9A 5I15L 4P59H 4RGNC 4XTRC 5F7LB 4BXVA 3PWUB 1CD1A 4X4KA 2HT4C 4G9FB 1A3RH 3DV4A 2VMDA 3HG2A 1AR1B 2W0FB 4F8LA 1MG2C 2CLVB 2WWNA 2F68X 2P7TA 4K7FA 1LEGA 5DRZB 4KOBA 3X13A 3S35H 5D96B 3CZNA 4UQCA 4HLZG 3V4PH 3GSRA 3TBBA 2AZUA 3W81A 5GS0H 2QADB 4AYDC 1BDYA 3J2PA 3GMNA 2DQFB 5E2TL 4KXCA 3WFHB 2FT6A 2XIIA 4M7LH 1GZHA 4YQXL 4R90L 2FD6L 1P7BA 2O1AA 2OW6A 2JQZA 2B20A 3WKML 2OI9C 4FGMA 4NJ9L 1FORH 1GW6A 4KI5D 1A3LH 4UQ3A 4W9IC 3DMMB 5ALCH 1GY2A 4I1RA 3TIEA 5IJKC 4EKJA 3C60B 4ZFZA 1A7RL 3BEWB 4PP2B 5LBGA 3RVXD 1MWAB 2EDYA 2JTYA 4XBGB 2ZXGA 4H13C 3SE6A 3V9FA 1SXCA 3WY4A 3MRGB 4WV1A 3ABKB 1U3NA 1DVFA 3FFDB 3KVDD 3D2UA 3MDJA 4UT9H 3DIFA 1IB5A 3MCKA 3QORD 4ZTOL 4YOKA 4Q6IA 5JZ7D 4L18A 4WU7A 5F3HB 4AK2A 4XNBA 1JE6A 5KSAA 2HPOA 1RH8A 2C3HA 2R29H 1XGTB 2WWKO 2CKBH 3GF8A 3IVKB 5HYQB 3BPOB 5J1SC 1T0NA 1DLHB 4BUQA 4P57A 3U4BH 1XB6A 1E8ZA 4TTDD 2YEZA 3ZKMC 1WFTA 3GSQB 3ULUF 3KYOA 2X4TA 3LIZA 1FHNA 5FV2A 5HYIA 2AXGB 3IJEA 4X4ZA 5LBVA 3WELA 1HI6B 5IMOA 2BVOA 2Z64C 5D7JC 1MH5B 3T1FA 4WKXA 5I17A 1LO3L 1UH3A 3IETA 2AQ2A 3B8SA 4PJBF 4UQ9A 5GZOA 2WO2B 1KLGA 3H6JA 1SJVA 3RQ3A 1FL5A 1M7IB 1X9RA 2ZX9A 3DDFA 3GJFH 3UYRL 4AKOA 5T3ZD 5ADOH 2JKIS 2WM0A 4CGUB 2HFGL 5HYSB 3K6SB 2D3JA 2G30A 4AE1A 5FV1L 4WFHE 1IC7L 1P6FA 2BNQD 3QGVA 1GZPA 2WQXA 3CHQA 5ABAA 5J7CC 3TESA 2K9FB 2HFEB 2HLAA 4XWGL 4Y89A 4NO2B 4YSUA 4ZUWA 3WNJA 4OTXL 3RZWA 3U1SL 3N1MC 5IUSA 3VGBA 1BVKB 3NPSB 1ILSA 1BEXA 1JWMA 2I07A 3L3IB 1VB9A 1ZHKA 1JZ8A 4YBQD 3CCHB 2BSSB 4KRPB 2FJSA 1ETB1 3BDXA 1JNJA 1C16B 2VDMH 3IGUA 2GBTA 2O5XL 4UT6A 4M1GH 5I1EH 4CU8A 1BQRA 5FCUL 1EJ8A 1T20A 1INEL 1RJYB 1AHMA 4WFGD 3RHWK 3P4MA 1S9YA 5KVFH 4F3FA 1A4JB 4FDWA 5F7NC 3KBHE 5H2BB 1MRCH 3K6OA 3OG6B 4QGYA 2XWDA 2YWYA 4BH8B 1AQDA 2DQGH 4KMTH 4GRWE 3W0WD 3ZGIA 3SE3A 3WD5L 3GD1C 3RWHB 1FNFA 4HLEA 4YHZL 1OO2A 3N85L 2YUXA 4RGMC 5EBMA 1MHEA 1H3VA 4QT5B 1ITCA 4YIQB 5DMYA 3HRZB 2I5YL 3HZMB 1H3PL 5KVDL 3LRLA 4DTGL 4PJCE 4E9XA 3LEVH 4CILA 1XGQA 3FYEB 1E7VA 2OQJB 2R2EA 3AREA 4AQ1B 1B0IA 1R3KB 5B8CC 1T3FA 1QQDA 2QZQA 5EIVA 4BUHA 5EUOF 4BFBD 1JWUB 1Q9OA 3P9WB 4ONHB 4D9QD 4JZJB 1Q0YL 1V7NL 4HOXA 1N6QL 1XTMA 5IMKA 2XJKA 3FOLA 4PVNA 1OAUH 3JV6B 1AGFA 1Y7VA 4GIOA 1XXDC 4UIMB 2EEXA 1XV8A 3BVVA 4BFOA 4ELMB 2DQTL 3KPMB 4F8QA 4H25B 1OB1A 1QLFA 4ABVA 3OTTA 2FT8A 2WB7A 3QDMA 4TVUA 1UATA 3CVCA 1OAYH 4HMDA 4DUVA 5JHMA 2VXTH 4OF3A 4ZOBA 2ZPKH 4KGLA 4MXVE 3GTNA 5E6ZA 4Y5XB 1HH9B 1HXYB 1QFWH 2Y5EA 3ZTNL 5TFSH 3C8KA 5E23A 2DLFH 1RZPA 3O3AB 1K4DB 4LLQA 3F5WB 3GI9L 5J8OA 3MREA 2KPNA 3QZWG 4GT0A 4OFPA 5IEHB 4AJWA 5HGDB 3DI3B 2MOVA 2EACA 4G43B 3QC6X 4HLJA 5D1ZI 2JLPA 1LO0H 1OW0C 4OD1H 4YGVB 1BBJB 3TBSA 1E4KA 4G1MA 2E4TA 2L8AA 4XAWH 3W11C 3VXUE 1JERA 5KVEL 4KTDH 2ZT9C 2J5LB 3ARRA 2DQIL 4MAYC 2DQJH 3BWZA 4J4PA 1XIWC 2EUVA 3ZE2F 4YVUA 4EZMA 2XWZA 4HS3B 4GG6A 3KXFD 2FYYA 3L1OH 5I6KA 1QFHA 3MOAL 4GAJL 4HK3N 4NOFA 1T83A 5I8EB 1JF5A 3JV5A 1JZ2A 1BZ9A 4JJ5A 3GSVA 4HXBL 1S5HA 4EF3A 5JPNA 2CUAA 2AJ3B 5F71A 3FH5A 3LXUX 1GS6X 1T2JA 1FAIH 3NVQA 2BOBB 5I1JH 2GI0A 1ZMYA 4Y4FC 4OZIE 1VEPA 2GBUA 1I7TB 2VO5A 3QJTB 3NZ8B 2WQAA 4PU2A 4APXA 1M7DA 2OMNA 4ODXB 1P2CA 3KPSD 1CXIA 2CWRA 2X9YA 2OX5B 5ANMB 1N8ZB 3FHAA 1ET5A 3E7JA 1NJ9A 2ADIA 2IALA 1DZ0A 4TXVB 5IVXA 5F72S 1YYML 2IAND 3CPLA 2NY1D 2V8MA 4AMWA 5CCKH 2ZCLL 2D3LA 1QR1B 2FVNA 2C1PA 2Y36H 3F6LA 5T1DL 1T6VN 4TQIA 2WO3B 1JD9A 4QXGH 3SO3C 2DJ4A 5F6IB 3K71B 5BZDA 3BLKA 4LPUA 1BM7A 2J57A 2H9GB 2AEPH 4XXCC 3WHXA 4TPRH 1O9WA 4NNPH 3HAEH 3OF6D 1HH6B 4L3ED 1LYQA 4HBCL 4FJ6A 5JLZA 1TKWA 5CBEA 4WGKA 4GJTB 4M3HA 1AG0A 4AYFA 3EFFA 4E5XG 2UY6B 4GO8A 1UHVA 4JFFE 1U6AL 4JQVC 4CC4C 1M53A 4ICWA 4IMKC 3QORB 2VM9A 4JPSA 1RZ7H 3MJWA 3FZUC 4KX8A 5D6CB 4W81A 3WIIH 4N0RA 3O6LL 2R8SL 2AXWA 3H2PA 2L7EA 4D94A 4WUUA 3QQ4A 3IGLA 1JPFA 2VXQL 4CMHB 3N3EA 4OFYD 3TURA 3RTLA 2YR3A 3G6JF 4QF1B 4QWWD 3V0AC 3IGKA 5E6IA 1SXNA 2HVKB 1T04A 3RY4A 1DP0A 5KVFE 1GHFL 1QFOA 3IPFA 3I50L 4BKLB 3RL1A 5C0FB 2WCGA 4KDTC 1NBZA 1KB5A 1QLEH 1UWYA 3GBEA 2QPUA 3S48A 1N3NA 4MQSB 5FO8B 4FERA 3VFNB 1NEUA 1NAKH 4JG1L 2CE6A 1AGEB 2GSIA 1J5CA 1RUAL 2Z34A 1XSKA 2PW2B 4RSYA 5DURB 3BHBA 4YHNA 3W39A 3P77A 4EO5A 5MEPA 1XBDA 4K9EH 5EF0A 3MJGX 4Z78A 2BNQB 1U8MA 3B4NA 3LN5B 4QYOA 3VFSA 2IGLA 4CU6A 3FQRA 3E8VA 1A0QL 1EX0A 3O6ML 4K8RC 5L0QC 2EIZA 4RBPK 5FYLD 3GBDA 2SEBB 2W9DH 3G6AA 1OSZB 1NCAL 3BUTA 5DMGC 5EO9A 1KFAH 3W57A 3R06B 1HJCA 1CXKA 4XP9L 2G4EA 3TYFA 5G4OA 3QIWC 5HI5C 4JRYE 1J1OH 3S34H 1LP9A 3UX9B 3U82B 3CSBA 3TCLB 2BP3A 4DFIA 2R2HA 3D39A 4LEOA 4PGDA 3BQUC 3TT1H 3ZYJA 2BRRH 3M1OA 2N56A 4Z7WA 1LVEA 1D5ZB 2E8ZA 2ESVD 3FT2A 4HDIB 4JLRA 2WLJA 4RMRA 1KGXA 3UMTA 5GGUB 3RILA 1P84K 5GS1A 4ZFOB 4PJEB 4A7SA 4XNYH 1P4IL 4WI7A 5IB2B 4G1EA 5KSVB 3L5XL 1RZFL 5DT1H 1VESA 2F61A 2RCSL 3CZEA 3AXLA 2QKIA 3F7PC 4YGAB 3KLSA 4PBWD 1QHPA 3APCA 3M7FB 1QRKA 5SX4I 2ETWA 1XF5A 2TSAA 3ZYIA 1GRWA 1K8DB 2VSKB 5GGVH 1MLBA 4N26A 2ZX7A 5JOPD 5E9NA 3QUXB 1JPTL 4MVBD 2OXGA 1PNCA 1XT5A 4M7LT 1PLAA 4WKZA 1P84J 2FBOJ 3AW5A 4KJYB 2V5TA 4J27A 3RZCB 2P8MA 3M46A 1R5VB 5AUMA 3HNSH 3KPOA 3VH8G 1TETL 4N2LA 4PHXA 3HMXA 5CEYA 2J1YA 2UWEF 3BAEL 1OGAA 4S2SB 3UAFA 4S1SL 1RXLA 1URZA 3I3BA 3LKQB 3S35L 4OLZH 3NJVA 4FJZA 1BW8A 1C9SA 1AIZA 3PWPD 4O5LH 2EDWA 4DP2X 2WBJB 4EBQH 2X2YA 3DPBB 2XQBL 4POZD 3RTQA 3PL6A 4AQ8C 1W0YT 4RQQA 1FFNA 3IMUA 1NA8A 1ZK5A 3FUHA 5HVWA 3IJHB 3RIAK 3V4VL 3EYQD 1OWRM 4X5PA 3RWFA 1TZHA 2MTAA 4U1IA 3IU3A 2A74C 2Y3AA 4G7SB 3FTYA 3MV7E 4HKJA 3W9DB 3KH3A 2Z31D 3DOHA 4Q9RH 4I18B 2PR4L 3PFUA 1TZGH 3U2SB 2ICEC 3T3MB 5TTRA 4M9OA 3GMMA 3ARZA 5AAWC 1R3JB 4C83B 3GHBH 1GY1A 2RMNA 4HUKB 3CVHH 4M3KB 2FAUA 4BSJA 3ILPA 1NGWA 1MIEL 4HBQA 4L4VA 5C07B 4OZ4A 3AGWA 4OJCA 2X4QB 5JQ6H 3SYPA 3QR1A 3VSUA 4HJEA 3QNXB 4P4RB 3BD3A 4UT9L 4OY9A 1HWWA 2AEIT 3LEYH 1BOGB 1ZLDA 2X89A 1EEYA 5D70H 1KV3A 1T7WA 2PF6A 3CFCH 4HUXA 4LRIA 2XN9D 2JWYA 4MWFB 5DMJB 5DS8A 4XCFL 3UZQB 3HFMH 3FCSA 5G2NA 2CKBL 2AV7B 1PL3A 3DBSA 4WW2C 1K3IA 3DARA 3A67L 3D0VB 2RFXB 3T5WA 3K72B 3HS8A 4B0MB 1B4RA 2ERJC 3V95A 2Z91A 2R1WA 3RJDA 2NY1B 4KK6D 4X6FA 2NY3C 4WI9A 3LV3A 4HD9A 5AOJA 2VDOL 1JGLH 2VUOA 3D34A 3FSOA 4LEBA 2A6KB 2ITEA 3HNVH 4JDVB 2YAEA 3FAXA 4AXWB 4EXPX 4F37K 5CD5D 3IRCA 4ZS7H 4PGBB 2ENJA 3N1FC 1MNNA 2FB4H 4HWUA 1WFOA 1N0XH 5EZJA 2VQUA 5C09D 4P9HC 4PS3A 3HPJB 4W6YB 2B2XH 1UKQA 1JZGA 4LCCC 1S9VA 3NSYA 1C1EH 3QXUA 1E4XL 4W9CC 3SKMA 4CADA 3B2UC 3S88H 3E1ZA 4MYPA 4W9LC 4OJEH 5HHVH 5BJTB 4MMYA 4P07A 3VE0A 5T1LB 3CVDA 4HIXH 1ET8A 1KTKE 3NQKA 5JORA 2FSDA 5ENWB 5EUKB 4ZX5A 1M05B 1VGKB 1XHHA 4X6CE 4EN3D 1PG7L 1NANH 3QQ3B 5DUBB 5CJOH 4HOMA 2NXZD 4MA3B 2VDKL 4D0CA 1S7VA 3CH1A 2P4AB 4LAJH 1QWNA 4L3CB 5DWUH 5I73C 4A7VA 1UWGH 2VDML 2YD6A 1SDYA 2WXIA 3T0WA 1U8HA 1J0IA 1IMHC 3MNZA 4IU3B 1U92B 1ZVYA 4LKXB 5JQHC 4L4TE 1MFDL 2A9NL 4GKZB 5DJ6B 2WCPA 4JFTA 5AG8A 4CJ0A 4YEEA 3KL5A 5AYQA 5B4MC 4X80L 5MI0B 2AJXH 1CN4A 4LQFL 3GI8H 1U42A 4A2FA 3K2UH 3MGAA 2WP3O 2GTQA 5GSVA 1TVBA 4XCEB 5FFLA 3C09C 4X7FC 3F7YB 2Q3AA 2EO9A 1CFQA 1PD1A 1KWKA 1E9OB 1V3LA 5I18H 1LEKA 1EERB 3LSOB 3IJSA 3V7MA 1DE4B 1INQA 5F0JB 4QJ3B 4NN7B 5B39A 5IROD 5F1NA 1K5NA 5EBWB 4FNSA 5IEKB 4HU2A 5ELIA 2ZSWA 1NH6A 4CVXA 1MIMH 4D8OA 3ULVC 4K5LA 5AYUH 4N6RB 4OZGA 3VVWA 1H15A 4XNMB 3H53A 2QKSA 4GRLC 4Y9GA 1OAYL 5JDJA 1X5XA 5I76B 4QRTA 1AGDA 1MJJA 2H7WA 2VXTL 4ODUA 4P3DA 3LQMA 1IQWH 2ESVB 3SGEH 4XPFH 4WEBH 1QFWL 5EZPA 4Y16B 4IRSB 2DLFL 4F15C 4Z3EA 3D87B 4P2YA 2R69A 4Z3GA 1LGVA 3T8XB 1K85A 1TFHA 2I7OA 1OTTC 3CDZA 4L3AA 3MGOB 1MCBA 3IDIA 4ODBD 2VSCA 2J6EH 1AP2A 3GK8L 2EEFA 4RMVA 4OKVB 2IVFC 3ILQD 1E28A 3KPRA 4JRWA 4D9LL 4DN4H 3ESUF 5EU5B 1JWSB 2CM5A 4FG2A 1BQ5A 1V3KA 4XAWL 1A6PA 4ZSOE 3WENA 1O7DC 4PYGA 2FJUB 4LLWA 4IJ3C 4UI2A 15C8H 4EJ1C 4JHVA 4F24A 3NEOA 1SBSH 3I2CL 3LYRA 4ZUVA 1DUYB 1WEJL 5FUZL 4D3CL 4NWUL 4FXKB 5EMYA 1MI5A 1VPOL 5JIKA 3SDCA 4O4YL 5E8DH 3FTGB 3ZT6A 2ZWYA 3B5HA 1NMBH 5F6HJ 2B1HL 1P5UB 3D7PA 2ARJA 3MRDA 2NLJA 5L9DH 1UFGA 2ZX5A 4PTTB 2WN2A 1QFUL 3O9WA 5PCYA 4LLVB 3MXVH 1U8LB 3CXDL 3KGSA 1VIWA 5D7HA 2WUCH 5DSCB 3BE1H 1OT4A 5D7LE 4U4IA 2CA4A 3VXNA 4NUGH 1UB5A 2F5BL 5GRVK 2JF1A 4M3JA 4B95C 1PF3A 5HDWA 4Z3FA 3S3SA 1QATA 4AYMC 3V0JA 3G5VB 2JTDA 2YMOA 5E6UB 5DVOA 3BUIA 2BNUA 4WHYH 4HUWA 2VLKE 1XH3A 2VLJE 5FM4A 1FL6A 1SDDB 4IBVA 4HGKC 2XXGA 4YUEL 2H2SC 1A6UL 2J8UA 4XCNA 3GMOA 4K2UL 2DAVA 4NENB 5ILTH 2CHZA 1T5KA 4OB5L 2Z31B 3BCFA 4XNZC 1MF2L 4FLQA 1U95B 2A6DB 2FWSA 4F7EB 3QK0A 3GQFA 4LSDA 1THAA 4I9XA 4DP8X 3DBXA 4MJID 2YBGA 4JFHD 2DYPD 1N59B 1FH2A 3N1GC 5LCVL 4NRYB 1P7KA 1RK0B 2XPZA 3HI6L 3ZE1E 2OZ4A 4IMLB 1E4JA 3DURA 2TAAA 3DTXA 3LZPA 3BOVA 5I82A 5J0BA 2HA1A 4Y19B 4QHUA 4KJPD 5CSZB 1B9ZA 5CR8A 2XN9B 1R5WA 4QLWA 2XQYK 4ZXBC 5K1JA 5BRZD 1KTLA 2XYCA 3CSFA 2QVTA 3GPSA 5E6YA 4FFZA 1JBJA 4KKAC 3VA6A 4MB3A 2WQVA 2AS5M 3O2VH 5GGVY 1U8QA 3KHQA 5D55A 5JPMC 3L2MA 5GRWA 2E56A 3WNKA 4P5TC 2XACC 4Z8FH 4P2QB 4GS7C 4XP6H 5GPRA 3PWLA 4GUCA 3C8HA 1S46A 5AKRA 5BS0A 5BZWA 3UTZB 5SWSA 3DO7A 1EGJH 4N2HA 1UJ3A 3BI9X 5IKCB 1E50A 1T22B 3FUEA 5C09B 2OYLA 2VL5A 3GO1H 3OG4B 4W4OA 4XMVA 3HS0B 4J3OF 1F6LL 3QB7C 2BP8B 3MLXH 4TNVF 2WKOF 1BPLB 2GK2A 4W9ZA 5E0FA 4K94H 4AI7A 3IDMB 4X5WB 4Q0XL 2OXHB 4NQTA 2IBGA 3HN3A 1X5LA 1ACYH 4NC0B 1I3UA 3TZVA 1HQ4A 2XV3A 4XPTH 5E9DE 4DNLA 4EN3B 3FB6B 3WLBB 1MVFA 43C9A 4EIGB 1SVCP 4DERA 1KJ2A 4A63A 4J6IA 1QACA 4QRRB 1HS6A 3UZEC 3S34L 1E8WA 3B9KB 2FWOA 4JFXA 1PLCA 5D2LE 4RISH 3C5SB 5DDHB 3TT1L 2XIBA 3B1UA 3F12B 4XNDA 5F7EH 1AQKL 4MD4B 3WTWA 3QARA 1X5FA 5LBSL 1YPZE 4PJFF 2I26N 1OCWH 4JM2B 5F8RC 2EKSB 3BH8B 4G8IA 4YHLH 3SQOL 4R8WH 5F3BB 3QRGH 5FB8A 2OMVB 5AKSA 3KYNA 5E7FA 4XNYL 4IGBA 2P26A 3TLRA 2HTKD 1AXSB 2YXWA 3NFPA 4FQQB 4K73A 3UP1A 4Y0GA 2YD5A 1U2YA 4YR6A 1QG3A 2MMXA 4XP4L 3AU1A 2YK1H 5CP3A 1PEWA 3GMRA 4WTWA 4YXHH 5DZLA 2WCSA 4NM4H 4EZJA 4QRUA 4NGHL 3MCLH 2Q1EA 1XZWA 1TSHA 1UC6A 4PYHA 2CK2A 2PNDA 4MXQD 4U1JA 4C47A 5BCAA 1FDLL 4YSRA 2Q86B 4WDIB 4OI8A 3ZIMA 1FIGH 2E7BA 3T77B 5E1IA 5E00A 4JMNA 3LZFL 3IS0X 4KKPA 4M6NL 5BUGA 5I30L 3L9BA 1CLCA 4G9DB 2LFGA 2FHFA 4PJXE 3VJ6B 3BD4A 3CSYA 3WJMA 3JV4A 4LU5H 3VGAB 3VCLB 1CFNB 3VQLA 1S9XA 3GLDA 4L8SA 3VFUA 4P2RA 3TPKA 4L8BA 2HSIA 4U1MB 4GSXA 1V3MA 4WFED 1U2HA 2ZXEB 4IBWA 2YMTA 1M4KA 3EOYG 4O5LL 5I71C 2HJLB 4JR9H 2NT0A 5GGSA 1UM6H 4WFHD 3C08L 4BINA 2RTTA 2ZUUA 2OYMA 3FUNA 1T4WA 4XGZB 4PJHA 2X2HA 1GA2A 2XTSA 1NBVH 2X70B 3A5VA 3I6KB 4HXAL 4G6JL 3NCMA 5AYTA 1JPSH 2WXFA 4UM9A 1DBKL 1C8QA 4HKXA 2VC2H 2BVPB 3OKLB 3E2HC 2H8PB 2WTRA 4KKCD 3AUWB 3P73B 4JANB 1DBMH 4Q9RL 4FA6A 3HI1B 4LCYA 4M7KH 3H1ZA 4ZFQA 1QRND 4M8QB 4K8RL 4QO1A 4GKNA 5D72L 4IRZA 3W9EA 5FECA 1NUFA 3DSFL 1EVTC 4NKQB 4E2OA 2UX6A 3LQZB 1H6UA 3DVGB 5CGYC 2UXVA 3WOVA 5JQ6L 3L95B 4GEJA 3ZHLA 1UA6H 5H8DA 4RA0C 2F8XC 1SMAA 1ODAA 3QDHA 3L3HB 2J1KA 3DX4A 3HG3A 1NPUA 5D70L 3CFCL 4DEPB 1SLVA 2EJ1A 3VI4E 3H42H 3GSUB 4I5BA 2BHUA 2H2PD 4RAHA 2FZ3A 3QCTH 1T7YA 4M7JH 3POCA 3JUYA 5ETUB 1N7ML 2YZ1A 3L2NA 4YSCA 1UM4L 1AS7A 3ZDXF 4P05A 8FABA 2CMRH 2ID5A 3GSNH 4KKLD 1E7UA 2DIEA 3GHPA 3MRIB 1BZ8A 2IBZX 3KDPB 4PV9B 2PMZA 4QAMB 1S7SB 1X5KA 2WLHA 4JFOA 3VXRE 5ITFA 1XXFC 1O7DE 2ZQKA 3NA4A 3QQDB 5EWIL 4EI5D 3NRPA 2JIXA 3D25A 1ZA3B 4MJIB 1K72A 2BFVL 2WBWB 2DYPB 4JREB 4J3UA 4F9LC 2O6CA 3MOBL 5C08B 4QLRA 2X4OB 4MNGA 5T3XH 2EICA 1CICA 2K1MA 2WLLB 3HI5L 3L5WA 1AYRA 1Z5YD 2VUYA 2GFBB 5BO1L 5JO5B 4QOKE 4X8GA 3KCPB 2Q0ZX 1HCVA 1GVIA 1FFOB 1A8JH 1MCLA 4H20H 5HYJE 4Y5VB 1KSRA 3UBXG 3DV6B 2Y07H 3QI9C 1MSPA 1OLLA 1A1OA 3GGWA 3LTVA 3T0EC 5DK3A 5IWLA 5DJ8A 3OLDA 1XWVA 1HESA 3N44B 5CN3A 4NN6B 1CE6B 5EO1A 2P8PA 1YNLH 2A77L 3QS2A 1AZVA 1A1MA 1UWGL 3BIAX 3BP5A 5EEUA 1K8IB 2SODB 1Q8MA 3VG9C 4ZODA 1Q9WA 5EZOL 2PYFB 4HWBL 5FIEA 4ATTA 5E8EA 1A9BA 4LCUB 2V37A 4DPBX 4PJFE 1PBYA 3FB8A 3N91A 2E7LA 4PREA 1BQKA 1Z9NA 3K2UL 1VADB 1ZS8B 1YN6B 3EGDA 4C56D 5CN1A 4RZCA 3RFZA 1DYZA 2E7HA 4MMXB 2UY7A 3ZXAC 3LPPA 1SYVB 3FH7A 4F9PA 3FCUB 5I18L 4YE4H 3FQYA 1HL9A 3ZJAA 1WIPA 2IWGA 3THML 1L5GB 4M5YH 4GBXB 2XKNA 1KB3A 4TUOB 1QD0A 4LESA 5G5DB 4F8PA 3CAFA 5AYUL 5FO9B 2YGNA 1C5CH 3GMLA 3GIZH 3LNGA 2IFFL 2Z1PA 2YWZA 3EYOA 3DGGB 4Z7VB 4RIRA 4ANXA 2E5EA 4XPBH 3RDTD 3U4EA 3SHSA 1ZSHA 1E6JH 3DVNB 1G5GA 4OZFH 4PS4L 3PWUA 4WHCA 2QVMA 4JPVL 4P5MB 4I88A 1MUJB 4RGND 4G9FA 4XTRD 1IGCH 1TTGA 5CR1A 5L2JB 2HT4D 2W0FA 1IGIH 3CLFH 1QUNB 3QJFB 4WI0B 4GQQA 2CLVA 4JM4H 4NEHB 4PJ7E 4P9HL 3BKMH 3L2LA 3DPDA 2FATH 4URKA 3RAJH 4FQIH 2HFFB 4M4RB 4CRPA 3LD8B 1F97A 4O2EB 1NC4D 4WGVB 5F0PB 3O8XC 2H0FA 2DQFA 2FX9H 1NGQL 2YD4A 1M2OA 4OU3A 2ZXAA 5F9WB 2WXKA 1CFVL 3P3YA 4TOYL 5AAMC 3WFHA 4AENB 2YQ2A 1AMXA 1J1XL 4NQCE 1NMBL 4IOSD 3P1VA 3VDAA 3QULB 1D5MA 3H3KA 5CLZA 5DTFB 1PCXA 4UM8B 2PW1B 1KTRL 4BYHA 3DMMA 2FLRT 1JHLL 2XETA 2YJQA 3C60A 4GFXA 3LHPH 3BEWA 4PP2A 3FO9B 2Q76B 3ASOB 3REVB 2EDEA 1DL7H 1MEXH 4RGOH 1MWAA 1M57B 2W9EL 4XBGA 2JKTM 2YN5A 3BLBA 3SDAA 4OD3H 4D7PA 1ILUA 1TJXA 4KVNH 3MRGA 5ICYB 2CPCA 1DFXA 3FFDA 1FNSH 4DVBA 2IOOA 3TVMA 5EC1B 2HKFH 3CN1A 4QHPA 1BREA 2O61B 2D31B 4WZ9A 3OAWA 4FTVD 4JN2B 1WBXB 1NLBL 5F3HA 1UA7A 5GS3A 3ZK0A 1GGTA 2CJTA 3C9NB 3S36L 1U3HB 1EEZB 4AKPA 4ZMLA 1VERA 1XGTA 3IVKA 5HYQA 2XV2A 5CBAA 5ESQB 5AOZA 1TZ8A 5KW9H 4TSAH 4JRYD 5IB5A 3D9AH 4YHOH 4EI0A 4M7ZB 2UZYA 4PRNB 4RMBA 4GG6F 2X9XA 5T3XE 2H3KA 5DWPA 4HOWA 4JPIB 2ZWSA 3EO1B 3JTSB 3ZKMD 4BQ6A 5AW7B 1AZRA 3B6SB 4PS8A 2KBGA 2K8MA 1B88A 4OCRL 2ODHA 5CMAB 3ZTJH 3ULVL 3UP6A 4LE8A 4ES9A 1HI6A 4ODVH 4PMFA 1MH5A 2DIBA 4HQQH 5D7JD 1M7IA 3MJ9A 4MNQE 3BW9B 4KU1A 5HYSA 1HDMB 4PJCB 4MBRA 4EE2A 4G8FB 1DN2A 4WNSA 3I9GL 1S8DB 2VXUL 3CSGA 4JX0A 3FFOA 4P4KC 2CO2A 3IK2A 4XP6L 5FDWB 4H0LC 1BVKA 5CJQH 5HDRA 5C70A 5I2IB 3L3IA 5T5FL 1R6VA 4WUKH 4KK8C 4DIXA 3CCHA 2BSSA 2VQ4A 1C16A 3BUQA 2WLKA 5MEND 3MLVL 5GHWH 5IIEB 3TS8A 4GI9A 3GO1L 3OKEB 4QTFA 1CD0A 1RJYA 2AP2A 3H0TB 4KV5F 4Z3IA 3MLXL 5IGXL 1A4JA 5H2BA 4NO0D 3V4PB 1HKLH 1PAZA 2FQDA 4N8VG 1AOHA 2DTSA 4NZUL 5JUEL 5IP4A 2ZKXA 4HF5L 5CZXC 1ACYL 2F8OA 4N1HB 4WCYH 1LILA 3RWHA 3RVWC 3C2SA 2VXSH 1BVNT 1A7QL 4Z7NE 4PJGF 2CRYA 4YIQA 4AQAB 3HRZA 2HKAA 3NTCL 5CWSB 2OQJA 1R47A 3QE5A 4AQ1A 3JTTB 1R3KA 4PJ8C 4FI7A 3ULUC 2YAMA 3HC4L 4B41A 4ONHA 4JZJA 3UJJH 2CNZA 2WXPA 3JVGC 5F7EL 3HZYB 1L7IH 1MCJA 2GCYB 3HC3H 3H7LA 4NQVB 3JV6A 1H5BC 4X0KB 2DQEL 4F5CE 4UIMA 3L13A 3QRGL 4M93C 1TZIB 4ODHL 1F4XH 3KPMA 4H25A 2FGZA 2WAQA 3JWNG 2XXCB 1MCWW 1TJIL 1U21A 5BW7A 1V7ML 3OJ2C 2VDNL 3P0VL 1NCOA 1E67A 1N26A 1M7UA 1I1AC 4YDZA 2GJ6E 1HH9A 1HXYA 5FA3B 4YXHL 2E6QA 3KAAA 3P0YH 4NM4L 3O3AA 1K4DA 2CKBB 3F5WA 4KC3B 1R0AL 4OZIB 4ZQTA 1DFBH 3QUML 4X0NA 4B9IA 2FT7A 1BJ1H 1D6EB 1BFVL 2X4NB 5IEHA 5HGDA 4XC3L 1R9FA 1P9MA 1HYRC 1MFAL 2K6ZA 4G43A 5INDB 4OLYH 4QHMA 1FIGL 3HR6A 3TA3B 1ND0B 4JO8A 4FQXC 1LP9F 1WZAA 1KY7A 1BBJA 3MFFB 5CKAA 3W11D 4Z7WF 5C0RH 5IREA 3GJFB 1YEEH 1E8YA 3SYOA 3MLZL 3HG5A 4W9HC 4MAYD 4A1RA 3RDTB 1XIWD 1B6UA 4XMPH 2J1XA 5DZNA 4U33A 4XZ4A 3ZKQD 5I8EA 3WY1A 3OR7B 1UM6L 1R34A 2FIKA 3EH5B 3HOGA 3T65B 3WFEL 1KLFB 2WMPB 3US1A 4TKWA 2AQSA 2BP0B 3NFSH 4ONFH 2AJ3A 2JNZA 3S5LB 4KVPA 3K46A 1NBYA 4M1CC 5FYKE 4ES8A 1SXAA 2BOBA 1T1YB 1NBVL 4N85A 1KPVB 4OH2A 4AVKA 5DJ2A 4IIQC 2O93L 4BRJA 1I7TA 1IL1B 1KFGA 1ASQA 2A99A 3FQNB 4KJWC 4Y4FD 2VC2L 3NZ8A 2WOYA 3QNZB 5IJDC 4W6XB 4AYGA 2VDMB 1MCWM 2ZCKL 4ODXA 2NCMA 5ANMA 5FHAH 4LPTA 5BO0D 2OX5A 2IJ0C 3BSHA 3FN3A 4NUPA 2PCFB 1N8ZA 4XVTL 2BCMA 1RMFH 2H0JA 4CSTA 4GW5B 4DUWA 3WGUB 1ZLSL 3HHSA 4UQAA 1LWRA 1N5AB 4KY2A 3TFKD 1OSPH 1Z6JT 1QR1A 4XR8C 1HZKA 1OE1A 2IPTL 4E9VA 4JL2A 5I1CH 3WTTA 4ZK8A 4NDMB 3NQIA 3FUFA 3ZTCC 2OI9B 3K71A 4OFDA 1OAKH 1YY9C 3BRDA 1Z0NA 2H9GA 4XVJL 4MDJB 1DBAL 4OGAC 3V0VB 5I5JA 1U36A 2QSVA 3D4CA 1ULVA 1HH6A 2IG2H 1I7ZA 4KX7A 2YD9A 1G0YR 5KSBA 3OWRA 4Y8AA 2UY6A 3EKCA 1AJ7H 2BHZA 1VZIA 2CMRL 2ZKHH 2UZXA 2ZUTA 1OOAA 5D6CA 1T0PB 4FTVB 2DYRB 1WIOA 4WHTB 2XA8H 3BEVB 3BYYA 3QJQB 3FZUD 4LIQH 3I75B 2WBXA 3TGXA 5I16B 2VR3A 1PY9A 4LGRB 5A43C 4GAYB 4WO4C 3MBEB 1I31A 2IDFA 3GZPA 1RK1B 4TNVK 5DC0A 1SN0A 2D0FA 3D85D 3TU6A 4JRYB 4PIRF 4QF1A 1E3FA 2HVKA 2VDRL 3QNYA 3DO4A 1N68A 4KMLB 3X1EA 3QJRB 1NUDA 4BKLA 5C0FA 1AGBB 5GGTA 1BLNB 2BDNH 5K9QG 1ZANH 5EU3B 4M02A 1J1PL 4UDTB 5FO8A 4H7VA 3VFNA 5K9QI 1Z9LA 3QIUC 5SWZE 5KSUB 2R0KH 5H37A 1AGEA 2ARJQ 2FYVA 5DHXB 4E42B 3EJQA 5KG9B 1CI5A 4ZTEA 2MQGA 1DQQB 3O45A 4E41E 2ZX8A 1BD2E 1EBAA 43CAB 3LH2L 2BNQA 3LN5A 4RWHA 3UIZA 1XSJA 1BQLH 4IKKA 3EGSB 1DJHA 1DUZB 3OAUL 2MCAA 4FQ1H 4HGMA 3WV0A 2SEBA 4K8RD 1OSZA 2X42A 1SY6H 1OCCB 4D0DB 1DANU 1KOAA 4BFGA 3R06A 3WEAA 5DMGD 5DA0B 4YL4A 4ZX4A 1MAKA 2IAMC 1WH0A 4DEUA 5DMKB 1RPQA 1XZ0B 2DQDH 3QIWD 5HI5D 4YX2H 1PJ9A 2V5SA 1G7MB 1UYWH 3DTUB 3TCLA 4DQOL 4MS8C 2JKRM 1KCSL 4YXLH 2E9IA 2J73A 1QBLH 1D5IL 4FXTA 2OCCB 2AJUL 1LK3H 2G9HB 3BQUD 2YUZA 2J71A 1D5ZA 4NWTH 4NO0B 3T8VA 3L4VA 3WEOA 3X3FH 3QEGH 5GGUA 3LZNA 2A1WH 3SY0A 4ZFOA 5L2KD 3WAKA 2EKJA 4WWKB 3GLZA 3PP4L 5IB3B 1QI3A 2H6PB 3HTLX 5KSVA 3CQQA 4OCYL 1HHHB 4NBYB 5DFWH 4JNXA 4HCGA 3WFCL 5TDOB 3WFZA 1WWWX 2CGYA 1M9WA 2DWYA 4ZFGL 3PFQA 3IN0A 3U7WH 3MRPB 4K7PX 1R3IH 2H41A 1SVZA 3EH2A 1K8DA 1IV8A 3QUXA 4RVBA 3B9AA 2XX1A 3DRQB 3HAEB 1CLOH 3UJIL 5JNYB 3PS6A 5LGHL 4KJYA 4DP9X 3OWEA 1TDQA 1BQHG 4U1NA 3MSPA 1R75A 3RZCA 4XPHH 2WWOA 1U8JA 2EYRB 3CH8A 3ARBC 3MLWH 5I1HH 4G82A 2ZNWA 5I0XA 1DVUA 3WNLA 3EXLA 1PTZA 1AKJB 5KOMC 1DBJH 2YS4A 1FO0H 4S2SA 4PWFA 3FCGA 1F3DJ 4L2YA 4CNIB 3HB3C 4TNEA 5ISZD 4HIEB 3QQNA 2FATL 2FL5B 3ULSB 1A4KB 2WBJA 3U0WH 3DPBA 4W70A 1QTPA 1I7RB 3GZKA 3N9GL 4UTAA 1CC3A 4EIUA 4KZDH 3IMWA 4PGCB 3LMJL 2PCPB 2VLME 1YQ2A 1DVTA 2WJ5A 1DVQA 1MCOL 2XSKA 3SGKA 4OZGF 3IJHA 4UQDA 5IVZB 2FR4A 1VFBB 3FU7A 2BMKB 3L3JB 4ERSL 4R83A 3GKZA 4ZYKB 1VFOA 3W9DA 2JELL 1EJFA 1ORQB 2UUDK 4N22A 2C9XA 4I18A 4Z7OF 1JMXA 1ROCA 5DR5H 3U2SA 1I53A 1KG0A 4GMSH 1AYOA 2XDHA 4MAYB 5DS1A 3QA3B 1R3JA 4C83A 4RGOL 4YNYB 1XIWB 1UCTA 4L4JA 1S5IL 1OL0A 1WE5A 2KL6A 4H4NA 1EHNA 1RULH 4K0OA 2V2TB 3C6LB 5C07A 3JV0A 3P2TA 2X4QA 1S7QA 4I0PC 3ZOAA 1BM3L 1CU4H 3QNXA 1H3XA 4LIQE 4MDRA 1BOGA 3GXDA 4QHKI 3SOTA 4QRQA 4GW1B 5IQ7H 4X6CB 1RP9A 2F7OA 3MNVB 2HZHA 4IM8A 4KO7A 4FP8L 4X6DE 5D7IE 1L4IA 4Y4FB 3TM6A 1A14H 1MZZA 4IRJC 5FYKL 3GSOB 3UZQA 3WKPA 2J2ZB 4QY8B 2BVEA 2AV7A 5IT2L 3SE4A 2J88L 1JYNA 4B9PA 1M3JA 1ONQA 4KNSA 4TUJB 5DRXB 1Q94B 3ZUCA 2PP7A 3ABZA 2XI9A 4HVBA 4L4TB 2NY3D 4NM8H 3QQ9C 4JDVA 2O5YH 4AXWA 1D5XA 1W72L 5C0CE 5G4NA 4PR5B 3SO3B 4F2MA 4B7LA 3BIKB 4R4BA 4YLQT 3TBTB 1RCYA 2EUZA 1OF0A 3HPJA 3MQIA 2A9ML 3EBGA 2FEDC 3OF6A 3G04B 1OM3L 5C0BD 1N4XH 1OT2A 1ZV9A 4LO9A 2VLRE 4M1DH 1N19A 2ZOOA 3O2DL 4F92B 4JO3L 1SFHA 4MRCA 3FN0H 5BJTA 3X14B 3B2UD 1SNRA 5T1LA 1JTTA 3BSZL 5D5MB 3WN5C 5ENWA 2J8UF 5EUKA 1FPTH 1WWBX 4ZO8A 1M05A 1VGKA 3FSWA 5L4FA 3MV9E 4N2DA 3QXAA 1WCBB 3QQ3A 4U1SB 4NKMB 1I1YA 2YSSB 4ZOEA 4E68A 5DUBA 4U1GC 2NTFB 3VRLF 3EJYC 4MA3A 1MG3C 3ARDC 4OFYA 4Z0XB 2DMBA 2OSLB 3LS4H 2JB5H 2CIIA 2XRAH 4KH2A 2XPYA 3CVIL 2UYLB 3L6FB 5E24E 4ZMPA 25C8H 4LKXA 2ZF9A 3CQFA 4HFWB 3ZUNC 1UZ8B 5KZCD 5DJ6A 4AW7A 5J6GB 2NTSP 4KQ3H 2MNUA 3MNMA 4MAUH 4UYPA 1F13A 2IQAB 4FULA 2Q5BA 5B4MD 3ZLQC 1ORSB 1N10A 4XCEA 2Y6SC 4AL8H 2HAZA 3QRBA 5BZZA 2YBRB 4C54A 5CJ5A 4FQJL 4OAWB 1I8KB 3F7YA 3TBWB 2Y2TA 3MAWA 3T3PE 4TQHA 1E9OA 2E9GA 4LHJB 4ZOAA 2BHYA 5AVTB 3LSOA 4LPYA 3S4SB 5IEKA 5EBWA 1HAUA 1SHWA 1XR8B 1DVXA 3GT6A 3BN3B 3S7GA 3CVHB 3ME0B 2OP4H 3ULVD 1KULA 3QG7L 4N6RA 1AIFB 5E2UH 3SDYH 5DJAB 1EAPB 3QIWB 4FX5A 1MHPH 2K0RA 3F2LA 5EC2B 4J3XA 3RGHA 5JHAA 4M03A 4FL4C 1MPAH 4XNMA 3D0AA 3KPPB 2D8KA 4NUJB 1JRHI 3HA0A 5SV3A 5I76A 4GRLD 3BQUB 2I9TB 2MQCA 1RERA 4JMXA 2QDVA 3A22A 2YGPA 4KK5C 1RPKA 4TQPA 3QDGE 5D7LB 4Y16A 5IMMB 4IRSA 4N4YB 5F97E 3G3LA 5L2KB 1X7SA 1DFBL 2HN7B 4ZUUA 4G7YH 1BLIA 3T8XA 2WVUA 1CE1H 3KYAA 1VCAA 4G11A 1QSVA 4JL1A 4AZ8B 1REIA 4ZMZA 3A23A 2VLKB 1OTTD 1M2VB 2VLJB 3EDFA 3E6HB 1HL4A 1G4RA 4NP4H 2BNRD 5EU5A 4ODTL 2HJFB 1JWSA 1OD7A 2VJ8A 1GZQB 1JXGA 5DZAA 1KJ2H 4IBZA 4XX5A 2D4DA 2OZNA 1ZT1B 2L4OA 4P5RA 1GKEA 1JMZA 1BG1A 4ZO7A 1YEEL 2R56H 3VFOB 1DUYA 5CKGA 4RA3A 1JS4A 4PRPE 4UILL 3ARWA 3VGDA 3FTGA 3GTTA 4RMSA 3PPEA 4WTZG 1QSFE 1WA0X 4AYEC 7FABH 4HX1B 2F08A 1HHIA 4KROC 1M42A 3JWOC 2RD0A 4Y9FA 3ZE1B 4PTTA 5IW1B 1L3NA 4QTIH 4YFLI 3SKJH 1TXKA 4LLVA 3VRIB 5HD8C 1U8LA 4G5ZL 4DCQB 1GYCA 4J3SA 4QOKD 3ZIYA 1WFJA 5DSCA 5E4OA 1NGPH 2EIJB 4AVHA 2X6BA 4XNXH 5HYJD 3LOWA 4CVZA 5ISZB 1MCCA 4FS0A 1ACXA 5A7BA 3QEHB 1CL7I 5DS2A 4N5UA 1MQKL 2XTJC 3G5VA 5FHAL 2DDQL 2EDHA 3DDGA 2JK5A 4OBSA 1SRDA 1J9SA 1X5HA 4PLJC 5TJWK 2HH0H 5DVPA 5D2NC 2VW7A 1R3LA 2X10A 3HG1D 4NC1C 1AXIB 4NZRH 2X6VA 5INCB 1A22B 2WTOA 4XE0A 4JKPH 4XVSH 4CUCA 1WT5A 2H2SD 2OJ1A 4KAQL 3TNMB 1GPOL 1PSKH 4F7TB 1K6QL 2Z31A 1Y1UA 2A74B 5AL8A 3SDXE 1BVOA 4HLZH 5EORH 1U95A 1HKFA 5GRVL 3EHBC 1JNNH 5EG6C 1X5IA 4F7EA 3B9VA 4Z7QE 3ULUL 3Q6FB 1A47A 1IAII 1TCRB 3DETC 1JHKL 3OBAA 4JDEA 5B1JC 1N59A 4RRPA 1BV8A 4NRYA 1RK0A 2CUMA 5DJXB 3ZKXC 2H1PH 4OLVL 4IMLA 5I1AA 1ROWA 4PJHF 2ATKB 5JHDE 2XY2A 4S10A 1AJ7L 3WE1A 3LPGA 4Y19A 2APWA 2QGBA 3HRPA 5E9DB 4DKDC 2XN9A 3CBJB 3WTVA 3IKKA 4N90E 3DX0A 2KZ1B 4WIQA 1IC4H 3FRPG 4ZXBD 4APQC 4Q9QH 3MRRB 2E47A 1NCDL 2EYSB 3BC9A 4S0TD 1G7JB 3OKMB 4WW2B 4Y1SA 1M6UA 2MNJB 4QRPD 2DI9A 4KKAD 5BVPL 5D2LB 4AYBA 2ERJB 1RUKL 4P2QA 1D7BA 1ADQH 5TDPB 5HHOD 4P5TD 1FRGH 3IAPA 1XF4B 2HXAA 4QRSB 5DMIL 2BDNL 1YPZB 1CZ8H 3UTZA 2J21A 1WTGT 3ETTA 2X3BA 5IKCA 4KFMA 1YRKA 2HRGA 2Y7LA 3EDEA 5C09A 3VFPB 1JYWA 2DQ6A 1UD3A 4JGUA 4DGYH 3HS0A 3KYMB 2BP8A 2MPVA 1IBGH 4LCCB 3CU1A 2OL3H 4XZUB 3TO4B 4YSAA 2NYYC 3KLDA 5JIMA 2WYIA 3IDMA 1I7UB 4U7MA 4X5WA 1F1AA 2OXHA 5IHLB 1EHKB 5L6YL 1NCUA 5D1ZC 5D1QC 2XWEA 3APMA 4EN3A 5L88H 3FB6A 3KLHC 4FXGC 2RQEA 4J23A 3FQ2A 1SY6L 3GHEL 1KN2L 2X2IA 3BO8B 1VF5C 2WYTA 2Q7YB 2I7SA 2FECL 3CSTA 1FUNA 1JGEB 4QRRA 4X8JB 3F00A 4G72B 4FZ8H 5CP7B 4NQCD 2P46B 1RU9H 3FTXA 3NIDF 3B9KA 2WXGA 3EDDA 4JCWA 2ZOLA 1UM5H 2VOTA 3C5SA 5DDHA 1HINL 4PJXB 3F12A 3FB5B 4AM0B 4J6RL 4HH8A 4U7SA 4MD4A 3DX8B 4JM2A 4TSBH 4HD5A 4N6QA 5KZCB 3X3FL 2EKSA 3BH8A 4OCSL 3QEGL 4JZOB 1WAAA 2F5AH 1XBRA 1KTDB 1YC8A 2OMVA 5MHSE 1LWJA 3BPLC 3PRZA 3ECVA 4PY8I 4X8CA 1PLGH 3NCFB 3VWKC 2ZXWB 4OIIH 4V1DE 3QIBA 3UTSE 4R4FH 2F53D 3PAYA 3C09B 2OTUB 1QFPA 2VIRB 4PCTA 1GOGA 1SEBB 3OMAB 3PDOB 3BVDB 4L5FH 3ZDZF 2YOCA 5E5MB 3ZDYF 3VXMA 4G6FD 1WJ3A 2J6WA 3QWOB 2Q86A 4WDIA 1JFQL 2NY2C 1AD9B 1MCPH 2E9BA 1DQDL 1TNNA 3MUHL 5T3XD 3KM2A 3P2BA 2C4FT 4TLSA 4TNWF 4OD2B 2EDDA 3M07A 3LRMA 4NQED 5I1HL 5B38G 4J3OC 1IBBA 4G9DA 4LKCB 3VFTB 3OMNB 5HDBE 4GRLB 5FUOH 3VJ6A 2DQCH 3VFRB 5A7EA 3NSDA 3VCLA 1CFNA 1FO0L 2HWZH 3TN0C 4LSQH 4PWJA 5IFJB 2EDOA 1G7PB 1JVOA 1QNZH 4XCCL 4AGMA 3EYVB 4F15B 1H3TA 3DJTA 3FMGH 3VI4B 1O6TA 3CFBB 2HJLA 3W56A 4HJTA 3RGVC 2PUQT 4KZDL 4BZ1H 2F19H 3RVTC 3HW7A 4G3YL 4G7VH 1KT2B 1NPNA 4ZT1A 4XGZA 1XF2B 2X70A 2VDLL 3I6KA 4KXZH 3R8QA 2GHWB 3L7EB 3RA7L 4MCYB 4KWUA 4JFDE 2BVPA 3M8OL 2CQVA 5IM7B 3GXMA 5SWQB 2EAEA 2H8PA 4G8GE 3NESA 4UB0H 3P73A 4JANA 2PPEA 3VXRB 1MW3A 3HI1A 5CN2A 4BIKA 4IJ3B 5DR5L 2ZUQC 1LMIA 1BYOA 3F7VB 4FFYH 1MW0A 2EH7H 4OQTA 3W3BA 1U91B 2F54E 2EE3A 4LGPB 1D3CA 4TSCL 5EBGA 4LCWD 2K4AA 5EA0L 1YMME 2FJGB 3L95A 4QOKB 1F5WA 5CGYD 3MGTB 4NIYE 3V2AR 2Z7UA 3L3HA 5HYJB 5IQ7L 3BH9B 2NXYB 4PJ5D 3GSUA 1J10A 3E3QC 3TTYA 1A14L 3A4FA 5HXMA 5TQ2L 1KEML 3TF7C 2KT6A 1U0QA 3BUYB 1GXEA 2VDPL 4YBLB 3GS0A 2RB8A 4GUPB 5IZ7A 1WZMA 4FLHA 4HPOL 4IBTA 1QP1A 1I8IB 1TZAA 4I7ZC 2AK4E 2IEPA 3Q7JA 1H8SA 1HHGB 1ZWIB 2V0AA 1B0RB 1FC1A 1GOFA 2YPLE 4FYRA 3UG5A 1UACL 1WK0A 3I74A 3MRIA 5ITBH 1HIMH 1N64L 4PV9A 3IFLH 4WFFE 1S7SA 1IARB 1Z9OA 4YHKH 3QQDA 2VDNB 3WUWB 1YQVH 4H8UA 4XNZB 3DXAD 2Y4SA 3RUGE 1ZA3A 4MJIA 2VGLM 2BSCA 1F11B 4IKIA 5IBTH 2CZNA 2DYPA 2NQCA 4KHXL 1ZLUH 1CD8A 4Y7OC 2EC9T 5C08A 2RBLA 5IF0B 2VJ0A 3TV8A 4EN2A 3G5WA 3GXIA 2GJ6D 1XCWA 2WLLA 5DHVH 4DAGH 2ZJSH 1A6AA 3E9TA 4UTBA 2ED7A 2GFBA 5JO5A 3SE8H 1ZDQA 4M6OL 1FFOA 3WL9B 2AJVL 1JF1B 1QHQA 1DVZA 2EDRA 1FPTL 1AZCA 3EOTH 4JFEE 3RG1C 4Y5VA 3U0PB 3VXPB 1BFTA 5FUCE 2C9PA 3DV6A 4X4MA 3CUPB 2AXFA 1UZ6F 2XQ0A 3QI9D 4HG4K 4UYQA 5I6PA 3T0ED 4NZDA 5E5UB 3UFIA 1IC1A 3P30H 2XTJE 3LS4L 2JB5L 5L4IA 4O02L 1ZEAH 3A24A 4NC1E 5I6XC 1CR9H 4HJIA 5D71H 3GRBA 3GDCA 2F2HA 1CLYH 4P5TB 3B2PA 2PYFA 4GS7B 4PAZA 8PAZA 4XBEH 4ADIA 3NSJA 4F93B 2R23B 4KQ3L 4KZEH 2ILLA 4LCUA 3Q8CA 1G7IB 1MRDL 3ARPA 2X28A 4XHJC 2B5IB 5DYFA 3S3PA 3WKYA 5FX3A 3JWDH 3GBML 4HG4J 1ZS8A 3CDYA 1YN6A 1MFCH 2XHNA 3PQYA 2VC2B 1DQMH 4MMXA 4OM1H 1MLCA 3WS3B 4L5FE 4RMTA 3EW3B 4PJ7B 5FYKD 3UTTE 2VZSA 4DW2H 1GZHC 1VHPA 2EDBA 4J5VA 1R3HB 2LT9A 2YXMA 4HISA 1V54B 2D7TH 4FNLH 3M1BA 1WAEA 1L5GA 2GTZB 3PP3H 4Y2NA 3NJGA 4GBXA 4H1LG 3VD7A 4N2OA 4TUOA 2JLLA 3S0PA 5DJYB 5G5DA 3J27A 4JQIH 4NQCB 3EJPA 1A7NL 5CD3B 3FH8A 1MPAL 4ONGH 2A4ZA 4GIPD 3NJFA 1I85A 2FIRT 4WV1C 1DVFC 1RIHL 2CM6A 3RWJB 3DGGA 1KACB 2NMSA 1YO4A 4Q6IC 4K3DH 3CX2A 2BSEA 3S35X 2YA0A 2HX8A 2VM3A 3DVNA 3DECA 4U2ZA 4RDQG 5CUSL 5DJZB 1I9IH 3FTWA 4P5MA 4QXVA 1MUJA 2IDTA 3JBG7 5L2JA 1Z5HA 3MA9L 2PABA 1QUNA 2CBTA 3QJFA 3MLSH 2AABH 4N0FB 4QYAA 4WI0A 4BJLA 2B8OT 3QYNA 4DESA 2VXQA 5GGSY 4N2IA 4HEME 3NEEA 4HJUA 1LE9B 2HFFA 3E6FB 1N0LB 3FSVA 4O2EA 1SM3H 3OXSB 4G6FB 4FXLA 4GSDH 3V52H 3VB9A 4KFZC 5KYWB 2K9UA 3AROA 3O8XD 3RU8L 4AENA 3ML8A 5GZOC 4FQHB 4ELMF 4PFEA 4DUXA 2PWFA 4R0LB 4JAMA 1LM8V 1UB6B 1E6OH 2ATPB 3MRBB 4JO4L 5HPOA 5GIRB 4HC1L 5SX4H 3QULA 1KIPB 4K3GA 2KZKA 3RVUD 4KTGA 5LNGA 5DTFA 1H3UA 3ZW3A 4UM8A 2PW1A 5F21B 1IEAB 4V33A 2R2BB 1N6VA 3FB7B 5AW6B 5SWZD 1KGYE 1NGPL 5DQDL 5J06A 3FO9A 2VKWA 4L8DB 5DQ9B 3REVA 2N59A 3I85A 1LNUB 3GSWA 4MNQB 2DQHH 5ICYA 5FK9B 1I1CA 4BGDA 3ARTA 4HFUH 3WY2A 3K1KC 2XJLA 1WBYB 5EC1A 3KLQA 2FQEA 2D31A 4HUVB 2IDSA 2IFGA 2YPVH 2APVA 4JN2A 1CDGA 2WWKT 4JKPL 3FXIC 4KJQC 1U3HA 4L1BA 1EEZA 3GRWA 3QFJE 1OZTG 3DKHA 4JG5A 2P5EE 2BRQA 5E4EC 1B4JH 5FLVA 4NC2B 5ESQA 2B16A 2ZOTA 1FSKB 3BVXA 2DM2A 4HAGA 4PRNA 4QXUH 4DGUA 1T80A 3ZTDC 4M9PA 3EO1A 1NCWL 4UZUA 1J8HE 4LASL 1T4KB 4X50A 5CMAA 5K9OB 1GGBH 5F9OH 3V0DA 1U8OB 2FO8A 4HJ0C 4YFLF 9CGTA 1ZAGA 3NH7L 4KO9A 1PG7X 3ZYOA 2E76C 4A2DA 4Z7NB 1NKOA 3BW9A 4FZEH 1EFXB 1PG7W 3B2VH 3WNMA 2QSTA 1HDMA 4LP5A 2DQMA 4KQ4H 4PJCA 1F58L 3BP7B 4G8FA 1RHFA 4NZTL 5CILL 2YC1B 1S8DA 4BK5A 1XGRB 1NKGA 1HSBB 1VACB 1RZKH 4P4KD 4AVJA 4LLAA 4YPGA 3T9WA 5FDWA 1EZUA 2OJZL 1FRGL 1EEUA 2C3GA 4LSPH 5I2IA 4KI5F 4CC0A 3WFDL 2W38A 3MLYL 4OZFB 2QSCH 3H2WA 2BXYA 2ZTBA 3FQWB 4ZBJA 4NIKB 4KK8D 5E1HB 1LL1A 1MJ8L 3VI3E 3DXAB 4YHML 3Q06A 4LCVA 1X7QA 5IIEA 3QBTB 2ZWKA 2XVGA 1MCFA 2IPKB 2XY1A 3I3DA 3MROA 2X1PA 3OKEA 4BQ9A 4DN3H 1BF8A 1WAPA 3SZ6A 3H0TA 1QW8A 3MV01 2V5MA 4UCFA 5KSBF 2GJ6B 3V4PA 1R19A 1BZDA 2M8XA 2OL3L 4Y7MA 4IEFB 2CO7B 4UBDC 5IFHL 5EOCH 3K81A 3VXTB 1QSED 4XOCA 3HEIB 3HPLB 3T6XA 1F86A 1E4KC 3IDJB 5CZXD 5L88L 3JWOL 1ETZB 3PDGA 3RVWD 4H40A 5DHEA 4AQAA 3QI9B 5BRPA 2VLMD 1IBYA 3E3QE 3C75A 2WLMA 4LHUB 4J4PC 1L9QA 1F90L 5FCSH 5CWSA 4FZ8L 2Q8AL 1RU9L 3JTTA 1T0MA 4HHAB 5GISL 5KJRL 1T83C 3EJJX 1UM5L 3VXUA 4PJ8D 2PWGA 5DD3H 3ULUD 3BZEB 3QWRD 4DP0X 3K4DA 4R9HA 5AWNH 3HZYA 5JPNC 3K5SA 2GCYA 4NQVA 1QPXA 3GXNA 5GXBB 3U6XS 3ET9F 2X2JA 4X0KA 3UAJA 2F5AL 3SQBA 4LLYB 2CH8A 1TZIA 2P42B 4F7MB 4L1SA 4UT9A 5DLML 4ZUTB 2J8OA 4R7VA 1IILE 3CFEA 3RKPA 4F58H 5FYJU 1YECL 5FA3A 1L0QA 4R4FL 1JN6B 4NZFA 3LN9A 4ZUSB 4BXSV 3CLWA 5CGTA 1I1AD 1Q1JH 2R29A 2CKBA 2D03H 3C12A 4Y2DC 5IUCA 4OZIA 1A6ZB 4PSPA 3F7RA 4E0RB 4LXFA 4HEPG 1OP5H 1MFBH 4YSQA 4H8WH 5INDA 1DLFH 1GMEA 1MCPL 1A25A 4IOIA 3TA3A 1ND0A 2XTLA 5IQMA 3D4GA 1NCCL 1ZOXA 4FQXD 2IBZY 1FHGA 2ZCZA 4U7KA 3VB8A 3NGBB 1QPKA 3NCJL 4TULH 5KTEL 5ABZA 5C0CD 3GJFA 2WSDA 5IHUH 1AE6L 3QCUL 1KELL 2HWZL 4PJEF 4A2LA 3QEQD 5KS9E 1FYTA 2FTAA 2YFOA 1FGVL 1QA9B 1WSST 2XICA 4DP5X 3II3A 1DN0A 4XB8A 5C2UB 5AZEH 1NSNH 1T6BX 2VLRD 4HJGB 3ZL4L 3OR7A 3PWVA 4DO6A 3T65A 4AEIH 1KLFA 2WMPA 3LS5H 2BP0A 1KYFA 4JFFA 1WGOA 3G6DL 3L1FA 4RFOH 3S5LA 1CDHA 3D51A 1T1YA 3S3BB 1KPVA 4R97C 5DC2A 2X1OA 4M1CD 1A5FH 4E9WA 1MCNA 1IL1A 3FQNA 4XBMA 3QNZA 4J2QA 3X1BA 4YDIL 4KJWD 4UB0L 1G7QB 2WWMC 3C5ZA 3ATEA 2NX5D 3ROLB 4I3SL 4JVWA 1IAKB 4GW5A 2WJ7A 4YXKH 4FKHA 3VGHA 1OPOA 3E80A 1Q9KA 3BKYL 4KTEH 3D4YA 3IAQA 1N5AA 4FFYL 4IOSA 2R1XB 3NJKA 1XGPB 4NRZB 1ZHLB 3WNNA 1BXAA 2EDQA 4X6EA 1P4LB 4NYLB 4UWQB 5SWZB 4FLSA 1BJMA 1KCVL 1YY9D 4MDJA 2E75C 4MLIA 4MJ2A 3KS0H 1PFOA 4PJDE 3V0VA 1M9SA 4N2GA 1OXYA 2X12A 1BX2B 1DQLL 4HHGA 4OGAD 3U0TA 4BZ2L 4E41B 3VG0H 2WW8A 1BD2B 1P1VA 1RHHB 1XCQA 2NNRA 1GGCL 5IFAH 3LCYA 1J7VR 2J43A 3QXTA 3D0LB 1IVLA 2M2DA 3ECBB 4BQBA 1K9TA 2IO5A 5CHNB 2D4FA 4NFDA 4WHTA 3BEVA 4P48A 3L16A 4UTAH 3I75A 1WZ1H 2FSEB 2EVFA 4QEGA 5I16A 4JN1H 4GAYA 4NKIH 3MBEA 1RK1A 5EH1A 2OMUB 5TE6L 4JRYA 4WO4D 5GS1C 3T3MF 3G5ZB 1JG9A 5KBLA 1H3GA 1MWOA 7PAZA 3II1A 1AGBA 2WUBH 1T03H 1BLNA 1SN2A 2G3XA 4V2BA 1F1GA 2BP5M 3Q1SL 2DEWX 4W9FC 1GC1H 5EU3A 2APSA 2X0WA 2W94A 4DAGL 3AY4C 1PW3A 4JG9A 3CLEH 2QHRL 1A9VA 4HIQA 3SE8L 5K9JH 5KSUA 5DGRA 4QD2E 2JXMB 3QIUD 4OJDH 4X7TB 4E42A 2B4CH 3EH4B 5KG9A 1DQQA 2F58L 2D9QB 3HLAB 3Q8BA 2DTMH 1JV2B 43CAA 1L0XA 4TYUA 5A2JH 1UT9A 4HSAC 1JZ3A 3HE6C 3LHAA 1SXBA 3P30L 5CFAA 2DKMA 3EGSA 3WY3A 4UF7C 1DUZA 1IU1A 2ZWNA 1KBGH 1LO4H 3UZVB 5KYXB 3BX7C 1CFTB 1T5XB 1ZS2A 5F93C 3TWCL 3EJUA 4D0DA 4AYSA 2YO3A 2J8HA 1L9MA 2YA1A 3W1ZA 2MJWA 4KZEL 1JNHB 2XZQH 4PRPD 2J1WA 5DMKA 4PI0A 1S3KL 4DKTA 3UPAA 1XZ0A 3FO2B 4M4PA 3OZ9H 4NJAL 1G7MA 5I24A 3DWTA 3RTQC 4G80B 3PL6C 4MS8D 1PKQE 3OAZH 5L8LB 4WWOA 1J86A 1DQKA 2UXTA 2JE8A 5DD0L 2MHAB 4EPSA 3UIYA 3QEUB 5AOIA 2XYBA 4LVOB 4WWKA 1YJDC 3BCDA 4TNWK 5F89B 2QMKA 5BQ7B 2H6PA 5IB3A 2DRUA 1NFIB 2P5WE 1HHHA 2B08A 3H56A 3LAFA 3NFNB 4B9JA 2GW5A 1MFVA 1SHXA 5TDOA 1VZHA 3IBEA 3WHE1 4LHQB 3CFMA 3HBPA 2Z4QB 1RPUA 4MRBA 2ZYIA 4L3FA 2WBKA 4BCZA 4GP5B 4ONGL 3JYCA 4K7PH 3X12B 5EF1A 3L48A 3MV7A 3T0BA 1AO7E 1DSYA 2YRLA 5D1XA 3DRQA 3HAEA 4WFGE 2V7HA 4CA4A 2OMZB 5EV7A 4POUB 4EZKA 3KR3H 1X4ZA 4YSTA 4K3DL 4B6ZA 2DLEA 4LRIC 1BZQK 2NY4C 4BRVA 2W59A 3S37H 1XD1A 3CFUA 3GDBA 3MU3A 4M93B 3WTUA 3PDDA 1GCYA 3W0WE 3DX6B 4NKDA 4HOZA 2IGFH 5LDUA 4AIXA 3ARBD 1F4WL 2GB2A 2MCG1 1AKJA 3EUDA 2G2PA 2APTA 5JHDD 1KC5L 5HVGB 4CNIA 2G75B 4Y4KC 2KMWA 4ZQKB 4E9SA 4ZX3A 1A6VL 3OPZL 5FGSA 2FL5A 3HB3D 4ODSH 4ZNEE 4X6DB 5D7IB 4UIKH 3ULSA 5KN5A 1A4KA 1RIUH 4N90D 2MQ3A 4WHDA 3UBGA 3MZTA 5J56B 2VW4A 1I7RA 4N28A 1AI1L 2LLLA 3VDCA 4D9QE 3V52L 4PGCA 1G9NC 1VSCA 2W07A 2AJSH 3HVDA 3EXJA 5TQ0H 3GZOA 5FYLH 2GTWB 4OSUH 3FUDA 1OW0A 1VFBA 4FQXB 1KTJA 3OLEA 3N1PC 2I60L 3L3JA 3T4AB 4P99A 4ZYKA 2WXOA 2DMCA 1ORQA 1PX4A 4OF5A 5C0CB 5ADPL 1H6TA 4Z95H 3QUZC 3EBIA 1PIGA 3QA3A 1FBIH 4YNYA 4Z0BH 5FYJE 3H2QA 1AXTL 3NJHA 3B7SA 2V2TA 2VLRB 3C6LA 1CK0H 1NBCA 4CW1A 4HFUL 1CVSC 2Y7QB 2BWDA 3J8F7 3MKKA 2Y5TB 3O3DB 4ZPTB 4I0PD 4LARH 4L29A 2B77A 3WJLC 3G9AB 4GW1A 4X6CA 3ABGA 3MNVA 5HDQL 3MV9B 5C8JA 5IVXE 1P4BL 1HFUA 3RNQB 4Y4FA 3NABH 1CDYA 1LD9B 1FCCA 4MS6A 5KBPA 3GSOA 2J2ZA 4M43L 4FQPA 4QY8A 5E1AA 3K80A 2I9LB 1BYPA 4IRJD 1UEMA 3N41B 3HE7A 5HJ3B 5FOJA 4WSGA 4QXUL 3RFRA 4TUJA 5DRXA 4JG0H 1Q94A 2YGOA 4BDVB 2MPAL 3NZHH 4MB4A 2XA3A 4L4TA 4WNJA 4WTXA 2WGXA 4IBSA 3KXFE 3UPCA 1Y6NR 2BIIA 4N0YH 1GS7A 1IKNA 1KXHA 3QQ9D 4HCRH 4XP1H 4YSOA 4UDUB 1B0WA 4U6XB 1YEHL 3V9EA 3ZE0E 4G6ML 4XXCA 3WJJC 3G04A 3EUUA 5EF3A 1KJ3H 1A7PL 4FQCL 2FEDD 3R1GH 3UTSD 5BV7C 2CGRH 3X14A 4GFTB 3E0GA 3KPSE 3T3PB 1Q4NX 5HHQB 2C4FU 3UC2A 1EJ6A 1P4UA 4IMKA 2VISB 2XOTA 5ICUA 2J12B 2NY7H 2E0PA 1WCBA 4U1SA 4NKMA 2YSSA 2IANE 2VR7A 4GH7B 2NTFA 3OKKB 3K8MA 1FNEB 3IXAB 4Z0XA 3EJYD 2OSLA 5EB9A 2V3FA 4K3JL 3ARDD 5EO0B 2ZG1A 3LIZL 3OKYA 4WK0B 1IVTA 1FO0B 2UYLA 1W6LA 3GSXB 3PPSA 4HFWA 1G9NH 1I9JH 1UZ8A 3BGFB 4L3EE 3ZX1A 3QDGB 2XWXA 1Z66A 4XXDB 3QHZH 2YD8A 2MQ0A 5EOCL 2IQAA 2WP3T 4JDTL 3ALPA 1SFDA 3IJYB 3QIUB 4JVUA 1T1WA 3QZLA 3EG9B 1ORSA 4K5OA 3ILDA 4DSYA 1HE7A 4WI2A 1UVQB 3U9PL 2DZEA 1I8KA 2Y6SD 1ES0B 3CZUB 3TBWA 4U0QB 3SDCC 1KN4H 3DX9B 4B5ZA 3H3PH 3MLUL 4UNTA 3EIFA 4OCXH 3GUTA 1BG9A 4K3EL 4XCYA 3WFBH 4JFDD 4N8UA 3R0NA 4ZSOA 1DTUA 4G8GD 5DD3L 2HT2C 3O9WC 1XR8A 3D39E 4CVWA 1F4AA 1O9VA 2X2UA 2ARWA 3CVHA 1UCBH 5ID0B 1NAMH 1XSIA 3EADA 3ME0A 1HT6A 4UT6L 1QAWA 4PRPB 4F80A 1AIFA 1FNGB 3QIWA 1QSFB 4EZLA 2F54D 1GAFH 4U05A 4U31A 5DK2B 5I15H 3VU2A 2C7FA 3KPPA 1FQ9C 4NUJA 2H3NB 5I9QB 1YHPA 4PEEA 3BQUA 1IT9L 2CG9X 5TK2A 2I9TA 1TFPA 1CXHA 2BY1A 1U9KA 5D7LA 5KBKA 5IMMA 4KK5D 2VAAB 3KE0A 5DRWB 5E6SB 1KJMB 1AHWA 2HN7A 2L7UA 3MJ6A 3AT8A 2XBDA 5EN3A 5IG7B 3P4LA 4NPKA 3U1PA 5FYLE 4AZ8A 4PRBB 4ZMTA 2VLKA 3CN4A 2VLJA 1G9MC 3ARGA 3FYIB 3S2AA 2EXTA 3E6HA 3O6FB 2GC4C 1NOLA 2FX8L 3FBQA 2BS9A 2HJFA 1GJIA 1ZHBA 4MMZB 1GZQA 1CTMA 2YKLL 4YQXH 1MAMH 4WFFD 2EC9U 4R90H 1WITA 3STZB 1G5AA 1ZT1A 3MR9B 3SDXB 3WKMH 4JM2F 1HXMB 4NJ9H 3VFOA 4HAKA 4Z7QB 2OTWB 2ESVE 2DI8A 3DSNB 1IGYB 1A7RH 4EDWH 4MTMA 5EU6D 4HX1A 1YEFL 2NW2B 5BMFL 5AZEL 4YWGH 2FH8A 5IW1A 3R4DA 3DUSB 4KROD 4DCQA 3Q2LA 3APFA 1XFPA 4O51B 1E5YA 3LS5L 1MHHB 5HD8D 3H55A 4AEIL 5JHDB 4PG2A 2VN3A 3RX8A 1D6VL 3HKFA 3QXVA 3QUGA 4ZTOH 3QPKA 3HB3B 1CYXA 1FVCB 3S36X 3ZZ1A 1F2XK 5LXGH 2XNAB 3DO3A 3CHOA 1OAXL 2E59A 3ZMRA 2XTJD 3IMVA 4AMKL 4Z3HA 5JOPE 4AQ8A 4PLJD 4BCYA 4J3TA 5INCA 4FG4A 2JKSA 4KTEL 3NN8B 4EOWL 3U9UB 2XFGB 4PM1A 4P23C 4W4OC 1KCLA 2NSMA 4UNIA 3LY6A 3TNMA 5IHZB 4F7TA 4M62L 2A74A 4BSWB 12E8L 1SUHA 1ED3B 5HTSA 3Q6FA 3EHBD 4FOMA 1TCRA 5IOKA 1E90A 3TZVC 1LO3H 3DVFA 4KXAA 5FAAA 4PRID 1G6RH 3DETD 2Y1VA 2V3EA 1HJBC 3VG0L 1OK8A 5HI3C 1QLRB 4KUZL 2FECI 2BX5A 1NTDA 3PWPE 2HFGH 5FYJL 3SCMB 1Z3GL 4YZWA 3UTTD 2ATKA 1IC7H 4BFRA 2CJUL 4NLAA 1EJOL 4W9DC 3QISA 4YHYC 4XWGH 5E9DA 1ZVSA 5BXFB 2F8IA 3DROA 5JA9A 5CSBA 1AAJA 3CHPA 2GEQA 2G5RA 3ORJA 4LPCA 4NKIL 1DJYA 3MRRA 2C3VA 5HGAB 2EYSA 4R5VA 4APQD 1G7JA 3OHMB 4WW2A 4RAVB 3UTQB 4CBPA 5H94B 4ZI8A 4IGBC 2OTPA 5ACMA 5D2LA 2XWBB 2R83A 4RX4D 5FW7A 4AWJC 1INEH 1YPZA 1XH1A 2UZIH 2UX7A 2DWDB 4JHBA 4S1RL 4K5MA 3QRLA 2N0MA 3JWNC 3QHTC 2X4RB 2H32H 3U6XA 3VFPA 4JY6B 4QR7A 3WD5H 2J6EA 2Z7YA 1IAOB 4N68A 4MJ6B 5LXVA 3KYMA 3VFGH 3H9SE 3N85H 4GLRH 4NNXB 3UTSB 2ZXDA 3TO4A 4BM7A 5CFHA 2I5YH 4LLMB 1TENA 1I7UA 4L48A 4DTGH 1TQCC 2JQMA 2NYYD 2VSMB 4XBPA 5FOBB 2D9CA 4FNPA 4LCIL 4FEMA 3FL7A 3WN5B 4ZX6A 1DCEA 5H35A 4PMEA 2YUWA 1DEDA 5D1ZD 5D1QD 3TTSA 1TITA 2WXRA 1CGWA 1IFRA 2OFQA 3BO8A 3KLHD 1Q0YH 1V7NH 4MA8H 3FOMB 1N6QH 4NAJA 4X8JA 4UINL 3HC0B 5CP7A 4AGPA 2GK0A 4RMWA 1J5IA 1T1XB 1MQ8A 3JYBA 4L2LA 4YDKH 1E5AA 5DLLA 5DVLA 8CGTA 1MW2A 3OZ9L 1EK3A 2M26A 2CA3A 2DQTH 1KB5L 1DCLA 2XIDA 4FRWA 4PJXA 5DEGB 3FB5A 5HDBB 4AM0A 3VD0A 4HJJL 3DX8A 2ZG2A 4RFNC 1EUTA 3N5AA 4JEGB 2OMXB 4OUUB 1HQRB 5EHFA 3ZTNH 1KTDA 4NP9A 1E4WL 1DQVA 1HWHB 4JO1L 4TVSa 3GI9H 4YZFF 3NK4A 4XB7A 5ECGA 3N44F 4TLKA 1SOXA 4HUUB 3VWKD 1NEZG 3KVPA 5ICXB 3A3YB 3U46B 2OTUA 4AEEA 1PZ3A 2VIRA 2CGZA 4JFDB 1SEBA 2CHNA 1SQMA 3COOA 1HILB 3MACL 3PDOA 2HB0A 1B3IA 4PBXA 3QFJD 3BAWA 4G8GB 4BA0A 5B3JF 1L9RA 5IOPA 2JJWA 3QWOA 3X3GL 5KVEH 1AD9A 1KXQE 2NY2D 1YY8B 3I02B 2ZAHA 1SLXA 2W0KA 3JQOB 1F41A 4OD2A 2F54B 3S37L 1ZV2A 2DYSB 2BXZA 3MOAH 4HW6A 4LKCA 2IGFL 3Q5YA 2QEJA 1FC2D 4KY1L 3VFTA 2YRBA 1U58B 2WINB 4J3OD 3MRLB 3VFRA 5DCCA 1I3GL 4YJZL 4IBYA 1YEKL 4HXBH 3STLB 5GQBA 1JPGB 1JSYA 4AJYV 5IFJA 1KYDA 1G7PA 3EOAB 4IKLA 4ODSL 5E2WL 3TN0D 3EYVA 5B3NA 1OP3K 3WMSA 1EDYA 3H9HB 4UIKL 3MV8A 3T04D 3VI4A 5CEZE 3CFBA 3INOA 3GB7B 5IBUG 4QHNA 4QXTB 2PCYA 1D2PA 3JWNH 1KT2A 1U8CB 3RVTD 2AJSL 2AK4B 4LDLB 3P11L 5E08L 4Y5YC 1XF2A 1JGIA 3DUUB 1RK7A 2YPLB 2CHDA 4E36A 4OSUL 5TDNB 3H54A 1NUNB