5A7BA

Structure of the p53 cancer y220c bound to the stabilizing small molecule phikan5211
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Experimental and Theoretical Evaluation of the Ethynyl Moiety as a Halogen Bioisostere.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5a7bA00
1KZYA 2AC0A 3VD2A 1EAQA 1CMOA 3WTTA 2BIOA 2X0UA 2J6WA 3Q01A 3WTWA 3WTYA 4LO9A 2YBGA 4IBSA 2BIMA 5AOKA 1LJMA 4QO1B 2WGXA 3IGKA 3WTSA 3KZ8A 3WTXA 4AGPA 4AGLA 2X0VA 2VUKA 3WTVA 2BINA 4IBQA 5ABAA 4MZRA 4AGMA 3WU1A 1HJCA 4IBVA 1HJBC 4GUQA 5AB9A 1H9DA 4G83A 4L0ZA 2ATAA 5AOIA 3Q06A 3TS8A 2J1WA 5G4NA 4L0YA 4IBZA 4AGNA 4L18A 2IOIA 4IBUA 4KVPA 5BUAA 2J1ZA 2XWRA 5AOLA 4IJTA 5G4OA 1E50A 5AOMA 2J21A 2IOMA 1YCSA 5ECGA 1UOLA 4IBWA 4LOFA 5LAPA 3QYNA 3ZMEA 3US0A 3Q05A 4GUOA 3EXJA 4LOEA 1GZHA 4AGOA 3D05A 2FEJA 5A7BA 2RMNA 2GEQA 2J1XA 2AHIA 2OCJA 5KBDA 1GZHC 3D09A 1CO1A 2BIPA 3IGLA 4G82A 3EXLA 2ADYA 2H1LM 2P52A 3US1A 5G4MA 1IO4C 3WTUA 5AOJA 3D08A 1EANA 2BIQA 3VD0A 1TSRA 2XWCA 4AGQA 2X0WA 4IBYA 1TUPA 4XR8C 1T4WA 2IOOA 2J1YA 2MEJB 5LGYA 3D0AA 3VD1A 3QYMA 1HU8A 4IBTA 3KMDA 3D06A 4HJEA 2PCXA 4A63A 1EAOA 4MZIA 2J20A 3D07A
chains in the Genus database with same CATH superfamily
4FQXC 4V11A 2WCGA 2VZVA 3UBXA 1W9XA 5DMKA 1SUHA 1TJHL 4L4JA 3FU7B 1O6TA 3SBRA 1NMAH 4LXFA 5F6HI 2QHRH 1NC4B 2Z92A 5CWSB 4AMWA 5L9DH 1EHNA 1J11A 1SF3A 5LNGA 5HDLA 3TZVD 5ETUA 1X6NA 2OJEA 1AVAA 2P24B 5E2UL 5IIEB 4ZUUB 3NFSL 3F6LA 4HS3A 1KV7A 1HXMA 2EKJA 3IDJA 5A16B 3NCJH 1UG9A 4X6FB 1BEXA 1KEML 2NR6C 1ZGLP 4X5RA 5F1IA 4PJGA 4KUCD 3DTDA 3GTNA 3U0TB 2ZCLH 3VO0A 3VMOA 3GBLA 1VEPA 4MQ7B 2DLEA 2OTWB 5CEZE 4ZTOL 5D1ZB 4Y1AD 5KUMA 4X6CE 1SYSB 5IFJB 4UM9D 1HL8A 4WI0A 1UB5A 5D7IE 1HL4A 4NXKA 5J12C 4JKNA 4L3CB 4PVLA 4MD4B 4XNMA 4YPJA 1R34A 4ZZFA 4U3XA 4LSVH 3WFCL 3MUHL 2NX5D 2FCBA 2KYIA 2FJHB 1ZA6B 5E8EA 5IVZB 2ED8A 3FQWA 5KN5B 2MCAA 2UX6A 1U8KB 3HZ3A 1BVLB 3PP3H 4IKNA 4X8JB 1WK0A 5FM5M 5C2BL 5DUJA 4NZUL 3HNVL 2QDWA 3N85H 2ZP8A 4H88L 2NY4C 5HGHA 1PGRB 4YFDB 5JLZA 2AVGA 3FOMB 4ZTEA 4B0MB 1HNFA 5E6IB 5EBMA 1JHLL 1LP9B 1NH6A 2FTAA 5C2UB 5FYLH 3ZKNC 2PKDA 1PU0A 3PJSA 4IOFC 1LEGA 4X9BA 1E28B 2FATL 4E2OA 4Y89A 3FH8A 5EEUA 1MCHA 2E7HA 3KNBA 4URKA 2BC4A 2J5LB 2XWTB 4J27A 1RP9A 3UAFA 2FGZA 1BJ1H 2BP0B 2WAHA 2V8LA 3B4NA 4FXKB 1DSFH 2WK2A 1WUNT 3BDYL 3ARBD 4YH6A 2GT9B 1I9RL 2EZ0C 1IQDB 4K15A 5D2LE 4XXCA 3RHWF 3NJMA 2Y69B 4AJYV 3TA3C 3PDOB 5HGDA 4HWUA 4YBQC 2VMFA 4MBOA 1KXHA 3EF7A 4RRPA 4XN1A 2Z3FA 2XQYG 4HUVB 2DYSB 4FCHA 1EJOH 2Q7NA 1E2WA 5F93C 1QA9A 1XF4A 3T2LA 3D18B 5IG7A 1J8RA 4YHZH 2BDNH 3VTTA 2ITCA 4I18A 5EU4A 4MKMA 1HVXA 1L7TH 4Y9EA 3FT2B 2P5EA 5DUMH 2C4FT 3WUZA 4OF3A 1ED3A 2ATKA 1IEHA 5TD4A 1AXTH 1ITCA 3VD2A 3QIUB 3VXSB 5D4HA 4LLAA 4GKSA 2HXAA 4KJYB 3SDDB 3WXVH 2JQAA 3TPKA 1DDTA 1Z0MA 1Z5YD 2X4TA 4FEMA 1VKXA 4C47A 1H8LA 3QIBA 3H6AA 3WNMA 1QG3A 3O9WC 2A7BA 4A1RA 1IC1A 4YOKA 1JTPA 2XU9A 1NDTA 3BN3B 5AB0A 3SD2A 4U1LB 1NAKH 3D6GA 1PKQE 4XNZB 2A4EA 1HL9A 2WUCL 4Q9RL 2VWEE 4XVOA 3OG6B 3JV4B 4DKFH 3O0RH 4XBPA 3KJ4C 4S1RL 2K4WA 2CR3A 1WFIA 1BFTA 1FG2B 1QFWL 3EFOA 1D6VL 5JPNB 4G7VH 4U0RB 3MJWA 1NOFA 5DLMH 1ZE3C 4E0RA 4FFYH 1HHHA 1KCSH 1OM9A 3JV6B 3MRBB 4JN1H 5DS8B 3VH8B 1HHKB 1XGTB 2AI0H 1M05B 2I7OA 2KLTA 2YQ3A 3AG2B 4Q6IB 1DQJB 4LKXB 4JN2B 2XLLA 4NJAH 3ML8A 4QYOB 1BVNT 5MEOA 4F7PB 4G80B 5AZ2H 2Y1ZA 1JWSA 3VX0A 3IRPX 5KSBF 1UXLA 3WL9A 2H1XA 2GVYA 2OMUA 3OX8B 4DUWA 4TQIA 2R2EB 1R3LB 4HGWA 3KJ6L 1P7HL 2V33A 4PWEA 2CPUA 2HVJA 4BGLA 1NCTA 1JF1A 3RWDA 3O4LB 1S9KC 1JPEA 3E38A 4DN4H 6PAZA 4EKXA 1F58H 1VADB 3CH1B 3UYRL 1ZSHA 3QWOB 4U6XA 4KZDL 2PPAA 4N9OB 3TA4D 2J4WH 5HPOA 3DX6B 4WU7A 2BVUA 5C0AD 3BYTA 4MDJA 1A7OH 4QRFA 2GW5A 3BZFA 4JFUA 3ELQA 1R3JA 3PIQA 4TNEA 1RZFL 4GKNA 4PJ9C 3IAGC 4Q2ZB 3EXLA 3D3VD 4Y5YA 1U8PB 5DZJA 1V8HA 1DLHA 3FUJA 4CC4A 4WKXA 1H3PL 2XA8H 3I6LD 3SY0A 4DVRH 5ID0A 1DUZB 3VQLA 1FZKB 1DBJH 3D08A 4HF5L 4RQQA 4Q4EA 2XWCA 4X6CA 3G3LA 3SKUD 3DJRA 3VXPA 43CAA 1KIUB 5I1HH 1AJ7H 2E6QA 3VJ6B 2AK4E 5BVPH 2C9QA 3HBZA 3L3IA 3T6ZA 1R19A 3AM8A 5DEZA 3Q8BA 4KMQA 1VHPA 4JZJA 3WKPA 4G5AA 3LZPA 4PRDB 5DXWA 3SDXA 1ORQB 4CU8A 3Q6FB 3EGDB 1D2OA 3CDGA 5EG6C 3QFJB 3R0NA 3RZCA 1E8WA 5FYKH 4H26B 1ZGLA 2CBQA 1C5DB 2VN7A 4QOKA 1H8SA 1USQA 2BSED 4WW1B 1HQRB 3AT9A 1DJSA 1DVQA 4U3CA 1DUYB 3CU7A 4GRLD 4JO3L 3N2JA 1SOKA 3AABA 2HSIA 3AQYA 4JFFD 5C0GA 2GSIA 3P0VL 4HFWA 5I1AA 4N2DA 3LPPA 1I7UA 3OR6A 2WKOA 5C0JA 3OWEA 3R19A 4ANKA 2J8UE 2I5YL 4RMSA 4CN4A 1CD1A 3BFQG 3C09B 1NCUA 4TS6A 3FTZA 1Z66A 2XKNB 1RIHH 1L9PA 3OKLA 4XVSL 5CS7A 3WD5L 1AZCA 4K73A 3ZE1B 2AQQA 5TE6H 2VDKH 3IGAA 1OWRM 1WV7T 1E5CA 2FNBA 1J9CT 5ACZA 3HZYB 3NRPA 3BO8B 1KGCE 4IQHA 1NMBH 4LSUL 1OB1B 3BH8A 1I8UA 4PJXE 5F3HA 5HXMA 5GZOC 3X3FL 4RRPM 1UWEL 2Y7QA 6FABL 3L6FA 2HLAB 3OPUA 3QQ3A 4OAWA 3OJMB 4Y2LA 4UTBH 3ZE0F 5LQBL 3BZEB 3ULUE 5E23A 1A9BA 2EDYA 3AT0A 4UT6H 1XGPB 4X0KA 1F2XK 3DTXB 4R7NB 4IIQA 5T3XH 3A3YB 4KDWA 4QRRE 4ODWA 3HA0A 3BWUC 1X7QA 3GT6A 1T3FB 3OKMB 4F7EA 4J39A 3TONA 5KBLA 1NC4D 1T0PB 5LGKA 1OAXL 4OGAC 4FD0A 4RMTA 4I8DA 3QYCA 1YEJH 4KK8C 4MB3A 3RWFB 3CXHK 3UTPE 4DPAX 5FUZH 5A3ID 5J6GA 3QNFA 2X4NA 1CR9L 4JW3A 2EEFA 4OKVA 1OARH 3V5HB 2VMJA 2ZX6A 4OLXL 5F0MB 5KYWB 3TYFA 1J8SA 2Q7YA 2DMGA 5HVGB 4Q9QH 3LZFH 4D9LH 3RNQA 2PMZA 5IWLA 1A7QH 2XT1B 3W56A 3I6KA 3SB3A 4M8QA 5D1ZD 3EOYG 2GKIA 1S5HA 2CLZB 1N26A 3OKOB 3LRSA 3JZYA 3PJNA 2VZSA 1EFXA 3F2LA 3VFOA 4MAYC 2ENJA 4OF6A 1BXXA 4QYAA 1A7PH 4QTHA 2APTA 1CL7I 4UILH 1JNLL 1A6WH 1NZRA 3GZOA 4J5VA 2WBJB 1YEEL 4GLRH 4XMKH 4XMWA 3BT0A 4Y8AA 2FJFA 1F6AA 2FX7L 3BGFB 3CFBA 3IJSA 1JD9A 1BBJB 4KI5C 4Y2DA 5IMLB 1WIOA 4ZUWA 4GLRI 5E6ID 3CLEH 1OZUA 3FC8A 3LDBB 5CEXB 1G87A 4JQIL 5HY9A 1IBBA 2UZIL 3CFEB 3RVUD 1NUDA 1S78C 1U6AH 2YSTA 1E2ZA 3RX5A 2Z35A 3S35L 5KYNA 1CFBA 4FI7A 3IU4L 4X9FA 3KGRA 2QZQA 4Y19D 4BUQA 3FO1B 3FQXB 2P5WA 4XMXA 4NQCB 4L23A 3FW6A 4O5LL 3MROA 3ROOB 2O61A 3ZGHA 3C5SB 1S7WB 3PGDB 4ETQB 4FTVB 2AAVA 3BLPX 1RU9H 1EH9A 5FM8A 2OMBA 2IWFA 1T83C 4OIAA 3Q1EA 3QQ9D 3T3MB 5IFAH 4F5CE 2KLSA 3WHXB 3OC5A 1I8MA 1CTOA 1JGLL 3IU3B 3K4AA 4XN2A 4GAAA 1KBVA 2J1WA 4JFOB 3EO0A 2QMKA 1OAZH 3B6SA 3RAJL 3CAFA 1N8ZB 2A1WL 4JFQA 4LEEA 3AS2A 4EBQH 1MUJB 4GAYA 3C60A 1CFVH 2CLVB 4P3DB 1SFDA 4ZMVA 1F11B 3FTWA 3CC1A 4HV8B 5CNHA 1AD0B 2YPKA 3OBAA 3HG3A 3B7UX 2GHZA 4BKSC 1D5BB 3F6JA 4H5SA 3WLBA 1U3HB 3P40A 1O9VA 3WHE0 3JYBA 2JWYA 3WDIA 1MHEB 1NL0L 2I9LA 3M7FB 3QIUD 3VXSD 4LGSB 1ES0B 4FEIA 4D3CH 1GKOA 2BCKA 4F24A 5BQ7A 1XH0A 1BVKA 3EYFA 1K5NA 1ZGLM 1C16B 1BQLH 4HK3J 4X4KA 1NOLA 3MLUL 4RMVA 5JA8B 5JHAA 2EVHA 4GT0A 5LG6A 3OB0K 3CUPA 3BI9X 4LDEB 2F53E 4KI5E 1BMGA 5C0RH 1B2WL 1V7NL 1NLDH 1ZY9A 3D39B 2WNXA 1EXHA 5JW3L 3VW3H 1EGJH 4MS8C 3GSQB 2BNRB 5JIKA 3QDAA 5EF3A 4KVCH 4YSDA 3P77A 4TVPE 1XCWA 1S4IA 4YFEA 2LTQC 1CGSH 5LGYA 2EXSA 5JORB 2WLZA 3OKKB 1BREA 5CJXC 2BWDA 2IANB 2JK5A 4PJXA 4DP5X 1MREH 5EWIH 5IUCA 2X1WL 3ARGB 4FFVC 4QRPB 5ALCL 2WO4A 4GIOA 5DZPA 1IGFL 3WG7B 3NSDA 3K8LA 4JM2C 5MENE 4PGEB 5T1MB 5IMKB 1UJ3C 5F6HJ 4O02A 2YAQA 3ZT5A 3V6OE 5MI0C 4QRRA 1OAKH 1KJ3L 1NCBH 2J6EA 2W81C 3HMWH 2WLIA 2WP3O 3O4LD 3PJLA 4L9LC 5IF0B 4B96A 4FG6C 3HHMA 1UGNA 1QBAA 1FNGB 1UUSA 3L4UA 1MJ7H 1KGXA 1FLRL 4FLHA 4HIJB 4HK0B 2VSKB 1FIEA 1P84K 3OXSA 3LXBA 5L2KE 1KPVA 5SWQA 4YJZL 2X1QA 3VFTA 1TZHA 3WFDH 1L9MA 3JWNE 4N2HA 4JBSA 3OPZH 3QC5X 4NKOA 1BAGA 4WWOA 1IE4A 2CH8A 2L8AA 3VXNB 2B5IC 2BS8A 2H32A 3CCHA 1CGUA 1AZNA 1QSZA 4BQBA 2BY3A 1T6VN 3FH5A 2G75A 2D2CC 3LKNA 4NM4H 2I9TB 3HC0A 3W0WE 3T0EE 1YMME 3CC5B 4UQAA 4XO8A 2W0LA 3NACL 3QUKB 2GC4C 4FA6A 3OJDA 2VDRB 3QA3A 3RY5A 3BC9A 1J0HA 3L9YA 2F19L 5I0VA 2VXSL 2OYMA 1KTLA 3LVEA 3GMNA 1XH3A 1S3KH 4P3CL 3V0AC 3A6BH 3SY6A 3ZE2B 4A2DA 3VXRE 4APQC 5F7UA 4NP4H 1UOLA 2FH6A 4X5PA 1XSKA 5I1EL 5T3ZL 3Q2CA 4UOJA 1IC5L 3QFJD 4NAQA 6PCYA 2DKSA 4HKXB 3QCUH 2KDYA 2ZOUA 4YBLB 5I1KH 2JKWA 1GC1H 4MXVE 2AFNA 1MHPH 5AW3B 3D30A 2XTJC 2VDRL 5E8PB 5HDBE 1P7QB 4BKLB 1DLFH 2CR0A 5E0QA 3TFKD 2C7FA 2BXYA 3GJFA 5AENA 2ITEA 2MOVA 2AXWA 3UZVA 5MEPB 4HT1H 1T5XA 3GLDA 3RWHA 3PWUA 3V4PH 4WI4A 2PR9A 2YC1A 3QZMA 4TL4A 4OLYH 5AVQB 5IFHL 2NZ9D 1U0QA 2E56A 2PABA 2WGNB 2Y6SD 4OFVA 4PJ7E 4WJKB 3IJHB 4H1LA 4QCIB 1GIGL 4XVUC 2DTMH 2H0EA 3EYSL 3NVQA 1A6ZA 3NRQA 4JANA 2WJ5A 4Y16C 1RL1A 1MXDA 1GW0A 2FK9A 3DETD 3NJGA 1P4LB 3QJFB 3T8VA 1QKZH 2C3GA 4JMNA 3EZ8A 3FSOA 1OD9A 4PJBB 5AFAA 5I1LB 3BE1L 1TZIA 3F6IA 4AEFA 1SHWA 2QKIB 4PRPA 5D2NE 4RWHA 1H3VA 4JDTH 2DQFA 4G8EA 4PJBF 1RP8A 1ET8A 3ZTNL 1CDYA 1Q94B 1AS8A 4HXBH 1BEYH 1JK8B 4OGYH 4GAJL 1NPUA 1J86A 5FGCB 4ISVB 5L2JB 4YDVB 3MCLL 1FE8H 2AF2A 2ILLA 4O2FA 1YYLL 4AQAA 1J87A 2QHLA 5IHZA 3FCTA 4NUMA 5DJYA 2BK8A 4MNQB 4PJCE 5A2AA 3B7RL 5IV2B 3BISA 1KEGL 3CBJB 5JIPA 2A6DA 2Q76B 3MRQA 4FLSA 2YD5A 5DFVD 4PY8I 1JNHB 3AROA 3HI6L 2W88A 2F53A 4PJIB 5AD0B 3NJFA 1CYGA 1UH3A 4ZW6A 1YDPB 2YAHA 5IW3A 3L9EA 3AQDA 3MOAL 2WMPA 3P11L 2EYRB 3FFOA 1PLGL 5C07E 4P5TB 3VMNA 3KS0H 1N59A 1IMHC 4P9HC 3DSFH 1JMXA 3L9BA 1KCBA 4RAUB 2P9RA 2W9EH 3FN3A 2EDKA 2EIZB 3BKCH 4KY2A 2CK2A 4XPBL 5HYJB 3Q8EA 2IWEA 3HC2A 5EC1A 2OBGA 3DX8B 4IW4C 3TS8A 4KVNL 1BV8A 5I2IB 1E7VA 4PFEA 1BAFH 1J1XH 1G9NL 1KY6A 5DK2A 2SEBB 4UDUB 4WV1C 4YSRA 2ADJB 4MA3A 5J9PA 5A6MA 3HE7B 1T83A 5MENA 5FA4B 2BHZA 4KGLA 4MCZB 2IMMA 3FFDA 2D7TL 4FCAA 4NO0B 1OCCB 4JFVA 3V6OA 1PQZA 3LZOA 4YS4A 5JIQA 2W92A 1RHFA 1UZ6E 5DD0H 2ZWLT 2YGPA 1ZTMA 2H3NB 3DMMB 3X2QB 2OMZA 5DMGC 2AMGA 3ZSSA 3MREB 4LU5L 1U42A 5HHOE 1WAAE 3BMVA 1G6RH 3X1GA 5DJZB 4QHLB 1QWNA 2FQFA 4JPWH 4N2GA 2AJSH 3MBED 5IQOA 2A0LD 4NQEE 1L4IA 2PO6B 3ECBA 4PBDA 2FO4A 2DQHL 1UXWA 4K71C 4U1SA 3KPQB 5I76A 4NQCD 4N25A 1UB6B 2GBTA 1OF0A 4AK2A 1UOKA 4FTVD 1OSYA 1OVZA 2O5ZH 2D31B 3MFFA 3W38A 1CFSB 2Z6FA 4X7SL 4BRJA 4JY4B 3K6IA 4A2LA 5J6HB 2EVIA 3W0WA 3S37L 1YMMA 3T0EA 3DBXB 3UEQA 3KGUA 1YJDH 3MQIA 4HAFA 3OKEA 4LRIA 1VGEL 5B38B 4HS8L 1OF2B 1OSEA 3LKRB 4WF7A 1ECYA 1EWHA 1RUKL 4LPVA 4L1BA 3AS1A 4NM8H 2VLJA 4FMVA 4TN9A 5DLLA 5I17B 4QNPE 4M6ML 3MLTA 3GMOB 4UOW1 5BRZE 1RZ8B 2ZXWB 4K2UH 5F89A 1WCQA 2MIZA 4OV5B 1ACZA 4AX3A 3EOAA 3T4AA 1U8JB 1U3HD 5L7XL 4U1IA 2R69H 1LEKA 2B15A 1FHNA 1LO0L 5E1AB 5E94B 1C5BH 2IIJA 4KDTA 4IJ3C 4UT9H 3WIFB 5I8OH 3OR7A 4UAOB 1KJ2B 4OQ1A 5SWSD 1G0XA 2CXGA 2AABH 2MCG1 2PLTA 3SDCB 3GBDA 4X50A 1O0VA 3F7KA 3ZRCC 3O6LH 5KEZA 2JI3A 5BUPA 1NEZG 2IPKA 2GFBB 4ANUA 3WEAA 4AGPA 2FLMA 3MRNA 1BXAA 3K6SB 3RTQD 1VACB 5C0IA 1W0WA 2CGZA 3B9KC 2G4EA 4PIBA 5LO7A 2XQBL 4PJ7A 4I13B 3H54A 4A7VA 3D39D 1TG8A 3S5LA 2FEDC 1M57B 3V0FA 2WTOA 1KJ2L 3BRDA 2CBOA 2BNRD 1GOGA 4L0ZA 1IKFH 1IBZA 3HN5A 4BZ1H 3HI1B 4NZ8A 3WY4A 2OSLA 4L5FL 1BQRA 4Q58C 5D2NA 5CLWA 3BH9B 5HDWA 3WEXA 1J9QA 1NEPA 3Q8FA 4NSKA 2Z4QA 5HJ3A 3X1EA 4ZFFA 4YK4B 4JKPH 3D2UB 3V5KB 4AH2B 3ARGD 8FABB 4XZUB 1ZHKB 3ETTA 4G8GD 5AOMA 4QRPD 5IEHA 1DQDH 1RFDL 5GGSA 3ME0B 5FR3A 5J13C 1V55B 2XQ0A 3HNTL 4JHAH 4HSQA 3CBKB 1CS6A 2N1TE 1JJUA 1XDTT 1TJHH 2IBBA 3JTTB 4PJCA 1DN0B 2A83B 3MV8D 3BPNB 5FUCC 1S7TB 2LU4A 5GISL 1F1GA 1WS8A 4PRHA 1IAKB 1NUFA 3AGWA 1GZHC 5DO2C 1AOHA 3S3JA 5E2UH 1IGIL 2XX0A 4O4YL 5C6TL 2EJ1A 1YHPA 5IVNA 1J7VR 2J55A 5CGBA 5JW4Q 1M71A 1OE2A 3NCBB 2J5WA 2ED9A 4PGDA 5E99L 3ZDXF 1KEMH 5FM4A 4LQFL 2YEZA 1SEBB 3JWOL 4K5NA 5CZXD 3EUUA 3L7EB 2R59A 2Z7WA 1QTSA 3QO0A 1OALA 3PABB 2MNJB 2F8IA 1RK7A 3V6ZB 2ADGA 5F21B 1LD9A 4ZTOH 2BRQA 5GRJH 5AG9A 5IGXL 2JJSA 1Z1WA 1E65A 4HJJH 3ZTEA 5T3ZD 5JHLL 1LE5B 2WKGA 4J1UB 2WQAA 1DE4B 4PY7B 3ETBJ 3CSGA 3WFBH 4NCC2 3UBXG 4PJ5E 4NIKB 3L5XL 1BSIA 1QPKA 2YD7A 4Y16A 4ZAKD 3ZDYE 4Z7WA 3L5WA 5AVWB 1Q1JL 4W9GC 2DQTH 3TBWA 4NZUH 3FYIB 5J1TC 2JQMA 3BW9A 1REIA 3D0LA 4EI6A 1CI5A 2MOGA 2X4PB 1E9OB 3DRTB 3MXVL 3F58L 1JHLH 2FBJL 3GB7B 1GS8A 3O3EB 3GSUB 1EMTL 5HHOA 4DERA 1WAAA 1IM3D 1W91A 5DQJB 2FATH 5HHVL 5JW4N 3FUEA 1P7QD 4MJHA 5FGBA 4OZGE 4NQEA 3QRGL 2O30A 4MSWB 1O5DT 1N70A 3NG5A 3EYOB 4KH9A 3SKJL 3C6EA 4GKOA 4HCRL 4IBQA 4OFYA 3BDYH 5ABAA 4LRNL 1I9RH 2X4SA 2AEQL 4FYQA 1MDTA 3KCPB 2OMYB 4N85A 1ZLDA 5FYLE 4GKZB 1FO0A 2K70A 3CG8A 2HTKD 4I89A 1D7BA 2APSA 3QNYB 5CJOL 1XWVA 1KFAL 4PI2A 2H26A 4X8GA 2CKBB 1P5UA 4MJJA 2ESVE 2R8SL 2X9ZA 5JHBA 2YN3A 1QR1A 3M45A 1RURL 8PAZA 2JB5H 4MMYA 1F6FB 3F7VB 3TO4C 1BQHB 3PWPB 5DJCB 1T7WA 4JLRA 1NFDA 5IQMA 5HI3C 1YY8B 3AG4B 4FP8L 3NP4A 2P80D 4N5ED 3V52L 1TPXB 1C8QA 4U1GB 4BRVA 4L8SA 5F1NB 1UGKA 3W82A 1ID5I 2CKBL 4YEFA 4KMTL 1ZHLB 4L8DB 4WV1A 1I7RA 2BXZA 3IFOA 3P0YL 3ZL1A 4C56B 4H8QA 3EH5B 2XBZA 2J88H 3RY6C 2D7QA 1CFNA 1YQVH 1TYJA 2JVUA 2JCCB 1QHQA 3KW8A 4L29A 4N90D 5CCKL 4HAKA 5I1JL 4DPBX 1FNAA 5KANI 1E2VA 2OMWA 3HG2A 4XN5A 4Q9RH 1BZ9B 2R23B 3MRRA 1JHTB 1ONQA 1MY5A 4AQ1B 1B6UA 1VCAA 5F96L 2P8MA 4Y2NA 1LGVA 1QWHA 2R1WB 4G6AC 4N0UB 4S1RH 3UMTA 3QEQD 1BA9A 2OSYA 4V2CB 4RRPG 35C8H 3RVTD 5ANMA 3MRHB 5BVJB 5AZEH 4IM8A 4YHMH 1D6VH 4D9QD 4HIHB 2WD0A 5CUSL 2G2PA 1IAII 2BNUA 4QRQB 3Q48A 1FN4B 1BX2A 4GMSL 5HYJD 1J12A 4JUTA 4Y4FB 3RU8H 4F8LA 2J20A 1RQ5A 4HW6A 3UEZA 4KJPC 2VDPH 5KSAC 3T1WA 1IT9H 3EGSA 3HE7D 5KVFL 1NBYA 4AIZA 5AVSB 5CLTA 1YAZA 2P5PA 2VQ4A 2Q8BL 1WBYA 4Q8BA 2NUPA 2QSVA 3ARDA 4XMPL 4NO0D 2CGRL 5H8DA 3KJ6H 3LN5A 5C0FA 4LLWB 1Q0XH 4LVOB 3KM2A 1PKOA 4M5YL 2FUQA 5IVXE 3T8XB 5DQDL 4M3HA 4X6EB 2W65B 3BDBA 1BF2A 3AREC 4ZJ9A 4LCVA 3UYRH 4KZDH 1KB3A 2IDSA 3KYMA 4QIRA 3TJHC 2QFPA 2IDUA 1FFOA 3MBWB 4IRZA 1RAMA 1G7IB 2G30A 5FHAL 1KJMA 3L5JA 1CVRA 3NCWA 3EDFA 1NCGA 2PO6D 4AL8H 3CD4A 4GW1B 1M56B 1I1RA 3APMA 2X6CA 2L0DA 1H9DA 5FM5O 1VPOL 4P2YA 4U1HA 1N3NB 3V5DB 4D2NA 4KKBD 4L1SA 4HF5H 1IBGL 4P0DA 2Z9TA 2JB6B 3ERXA 3KEDA 3MXWH 3T1FB 4YAQB 4ECNA 1UJTA 2J1KA 2IDTA 2MQGA 3B9KA 3MJ9A 2NYZA 1S6NA 3CSYA 4XCNA 5ENWB 4CSZA 1ND0A 3DUSA 1JPGB 3AB0C 3TP4A 4AUUA 1S7XB 4PJ5A 1PIGA 4NGHL 4AW7A 4C59B 3SGDH 1IKOP 1JPSL 3MA9H 3CFMA 2APBA 2QSCL 3D34A 1RSFA 1EHXA 1Q4NX 4WWPA 4P2QD 1DTUA 2B14A 1BWWA 4FE9A 2EIBA 1P4IL 3BUYB 3VI3E 5TQ2L 1R5IA 1T1YB 3Q2WA 3GSNA 4MAZA 5I73B 1J5IA 1K3IA 1U8IA 3OMZA 2K1MA 3H3PL 1KCUL 4KHXL 1CD0A 3RUGB 3AVEA 1SJHA 2J72A 4JO3H 1J05B 4MB4A 3FOLA 4OZGA 5EMYA 4LPTA 1U93A 2ADYA 3P0VH 1KBBA 4H8HA 4QWWC 3OMNB 1LO5B 4BSJA 2XKSA 3MV01 1T4KA 2RTTA 4QD2E 4PHZA 3BOVA 4DP2X 4FNSA 2J8OA 5GGRY 3M1CA 1QATA 4YGVA 3ATBA 5FYKE 3A23A 3HTLX 4FYRA 1MH5B 2XN9B 2FO1A 1F5WA 3V4UH 1W72A 5FK9A 2FD6L 4XVSH 2V3DA 4ADIA 5D1XC 2FWOB 1A4AA 4OZFH 4XO4A 3UJJL 3VRJA 2JKTM 3MRLA 1QO3A 3IFNL 3LOWA 3QR2A 1EAOA 4MXWL 3O41A 4CVZB 2BRRL 2RFXB 4N1EA 5IB5B 1YEDA 5KBPA 3GC3A 2FT6A 4LSUH 4W9JC 1GSMA 5F71A 2HT4C 1WIUA 4GQ9L 5IW1B 3HPLA 1UWEH 1YEHL 3AY4A 1B0RA 6FABH 3UX9B 4QLWA 5JOPE 2X5PA 1KWKA 4U6VL 4IU2B 3QFDA 3GMLA 1FL5B 4WIQA 1Q9KB 2DOCA 3HRZA 1RY7B 3DXAD 1HYRC 1PDKB 2VIRB 3B3BA 4PY8J 4EZJA 4JG1L 3DOSA 3DIFB 5IHUL 4M8UA 3CE1A 1SVBA 2E27H 3O45B 1B0WA 1OAXH 3N04A 4I0PA 3QUYC 2Q86B 1HEZA 5GRXG 2LGNA 2C7UA 4UIMA 4Z23A 3SO3B 3ARWA 2F18A 3GWJA 4MDRA 1OGAE 5FEBA 4QY8A 2H0FA 4XCYA 3TV3L 5EO0B 3KS0J 4LHJB 2I25N 4OLXH 4Z7UE 4AYEC 2X2UA 1DDHB 4AUYA 1D5ZA 4JG9A 5D96B 5EIVA 3F01A 3ILEA 4EN2A 3AACA 4X5XA 3D69A 2FR4A 2KZWA 2DLHA 1YAIA 2G3XA 5HJGA 4GBXC 1Q90A 4PJAB 5D7JB 4PJ8A 1OCWL 3UTSB 4Z78A 5K69A 4HVBA 5LAXA 2NY2C 3PWLA 4LFHG 3VFWB 4HK3N 4L4VE 1ZVSB 3RG1C 4LCUB 2DQ6A 1UQSA 4PJAF 1EX0A 5D1XE 2W95A 4Z1PA 1JNLH 3IYLW 4UIKL 2BSRB 1G5GA 5ESAB 1HKFA 5ISZA 1YEEH 1IZJA 2GY7B 4FFYA 4PRIB 3MR9B 1JFQL 3PWNA 4GO9A 1FYHB 1B0GA 2EE6A 3P3YA 5F0PB 3RIAK 5IVXA 4KV5F 2N7BA 4NRXB 1P7KB 2BOBA 1JZEA 3N44B 3P3TA 2V8MA 3IWVA 4WNSA 3GSWA 2PW1A 1MPAL 1U8OA 4ONHA 5JO5A 5CBEB 2ODHA 5C9JA 4JQIH 3MPCA 4OFQA 4M61A 3QQDB 4X83A 4YHIB 3TIDA 3G5ZA 4LL1A 4RA0C 1R0AL 5IZ7A 4OD3L 1CXHA 1E4XI 4C55A 1X3DA 3OKNA 2BZ7A 3GUTA 1FORH 4WUUB 2DI9A 1L0PA 2DWYA 1F3DJ 1S7SA 3TT3H 2APXA 3GYRA 15C8H 1CJYA 1T1ZB 4QXUH 3IXAB 1OCZB 2PW2B 3PHOB 4N6RB 1T22B 1U21A 2XICA 1USZA 4KROC 4NT6B 3APNA 43C9A 4Z7AA 3BP7A 1KPUA 3OZLA 4HA1A 1KJVA 1IGCL 5TK2A 1EUUA 2RGSA 3BD4A 3EBAA 3HFFA 1BAWA 3MDJA 4U31A 3RAJH 1MJJA 2L7UA 1MVYA 3FCGA 3O3BA 1P1ZA 3PWPD 5FOBB 3RWEA 2C26A 3CSTA 3IKCA 4PTTA 1JPFA 2QQNH 3DROA 3VI3A 4OLWH 3WTYA 2HJFA 3IMVA 1MWOA 1TTRA 1NL0H 2R15A 2AQNA 1G4MA 4JY6B 2QPUA 3K6OA 1MIML 1AO7B 1AGEA 2KL6A 4FI8A 4KTYA 2X41A 4J3OF 4C56D 3UH8A 5GGQL 3HAEB 1S7RA 1ZS8B 4DP0X 1YPZB 4KUZL 4YDJB 2W0PA 3MLUH 4K7FB 5GS1C 4HAGA 2XNAB 2M1KA 4IBVA 3KVDD 2UWEB 3V4VB 2YXFA 4H0HB 1B2WH 3DUHA 1XF3A 4ORZC 4U1NA 1S9YB 3QDJB 2NSXA 3BQVA 4ABUA 4EI0A 2WZ5A 1IFHH 2R0ZL 3CDZB 4FXGB 4NUGL 3ZK0A 4BFNA 2F9BT 1Q72L 4HXAL 1QLEH 3BPOB 3QXUA 4PRBA 5FO9A 1IGML 3CN4A 3WUWB 4M1GL 4DOHE 5LN8A 4W93A 2B77A 2IMNA 3AU1B 4TNVF 3CHXA 1Z9SA 3RWGA 4B95C 2OQJA 4G1EA 1QOKA 4JFXA 3AG3B 4IS6B 4MNGA 4TNWF 5ALCH 1IX2A 5GRYA 3EBGA 3RI5K 1SDAB 4AVKA 2NZIA 1BM7A 4I85A 4OIIL 5F7YC 3GMRB 5T5FH 4W9FC 3EGXA 4F15C 5I71B 4DP8X 4YNYB 1CG9B 2XWDA 3OQ3B 3NSJA 4N2AA 4JDZA 2J2ZA 4P23B 1KSRA 4WTQA 5HHMB 1KJ3H 4WDIB 3CFDB 1S7UB 3APCA 3GXPA 3IDNA 5FA3A 3AS3A 1Q9LB 5EEWA 1PZAA 1XMWA 1D9KB 1PSKL 2BY0A 1GC1C 2E46A 1FLRH 2NY5L 4CN6A 2Y3AA 1OGAA 2ICWA 2A9ML 5DHYA 3GMPA 1DR9A 2VZ1A 1HOCB 4IBYA 1NAMA 4Z7UA 3MTRA 1FL6B 3M17A 2VTFA 4UQ2B 4PJFA 3ULVE 5I6KA 4UDTA 5I6MA 1HFUA 1MFUA 4K8RL 4RGMC 4BFGA 4NN5C 5IKCB 4GB9A 1FC1A 3K46A 3ARFB 2H0JA 3UGXA 3DLQR 1UD8A 1AR1C 4BWWA 4OI7A 1M2OA 4CKVX 3QUZA 1LK2A 2ZUVA 5DYOB 5D1XA 3OF6A 4XO5A 2H8PB 3LNHA 1EO5A 2QZ5A 3KBEA 5DA4A 1HNGA 1LK3H 1N6UA 5I1EH 1I7ZA 4N8VA 1WAPA 4PVMA 3V6FB 4TLSA 1IC5H 1L6XA 2IV8A 1A6AB 2LLNA 1I4FA 1M53A 2DIAA 2F74A 3FB7A 4XODA 3VWJA 2VDRH 2AKRB 2MHAA 4AEEA 2IFGA 3QO1A 4NZTL 3QHZL 4OBRA 3TPUA 3P3RA 2CUAA 4DPCX 2Z1PA 4Y1AE 3BIAX 3KVQA 4LP8A 4PD4J 1H3GA 2WAQA 4R83A 3VFMA 1CXEA 2YRLA 1M9WA 4NZRH 3IKKA 4NOBA 5I8KL 4OZIB 5GRUL 3EYSH 5B1AB 2JKLA 2EXYD 1GYCA 3G6DL 1XV8A 4RMUA 1JNNH 4OZIF 4X6DF 2ZUQB 3QH3B 1HAWA 1SM3L 4HIXH 4BQ8A 4UV4L 2R1YA 5BRPA 2CDFA 1ZK5A 1U8LB 1Y18B 3CN3A 1T03H 4YPGA 5LAPA 1KXQE 1OM3H 1XTLA 1PFCA 5DD6A 4XI5D 5HD8D 1QSEB 3QZPA 4JFHD 4QXGL 4GAJH 2XWBA 4OR1A 3V0VA 4R0LC 4UQBA 5GS0D 1MVFA 3IEAA 1T66C 4JFPA 1NBCA 4TVSa 5K39B 3ZVVA 4XNQA 3GPEA 1YYLH 3N42F 2FYYB 4NC2B 1I1AA 5CN3A 2NY1C 4P5KA 5L4FA 1J0KA 3L45A 5B39B 2X2JA 3MAWA 3SZ6A 2ARJA 1HH6B 2AK1H 2UZXB 4UT7L 1LO2H 1MCFA 2D3NA 8CGTA 3QNXB 4H1LG 3QQ4A 4PP1D 3OGOE 1MG2C 1K72A 5EORH 1BXVA 3L95B 3LS4L 3SDAC 1XIWC 2OI9C 2K9UA 2LU3A 1PEWA 3ESVF 3HHSA 3P11H 2WXMA 3N43B 4DKEL 2NSMA 4AEHH 4QRUB 1URLA 5I6XC 1A9EB 3WEBA 2DN7A 3HLKA 3D07A 4WHTA 3SDYH 4KVNH 3VXMB 4NPJA 1UZGA 2Y07L 1BPVA 4Y4KB 2ICES 2M26A 2CCVA 4XNUL 4PS3A 1DVYA 5D7JD 1C7SA 3JTSA 4MA8H 1YJDC 3H2WA 4YDIL 4I4WA 3VRIA 1RUAH 1TR7A 2D7TH 2VR4A 3TFBA 2CO6A 3HPJB 3US9A 2JI2A 5H94B 4PRID 2COVD 3GI8L 3HC4L 1I8LA 2VDQB 4HISA 2CHXA 1S46A 1ZDQA 2B59B 1CGTA 2Q3AA 3GD1C 4XP4L 1EHAA 5IBLD 1RLWA 4LU5H 1P4UA 4EMZA 3MA7A 1SY6L 3P9MB 1ESOA 1BOGA 4I1RA 1SYVA 1ASQA 1D6EA 4UOW0 3MRCB 1ETZA 2H4EA 2GY5A 3L3GB 2X6MA 3ABMB 4UMGA 2CIKA 3TT1L 3ZW3A 2VDQL 4WUUD 3QEGL 4M03A 1TQTA 5LBGA 3UFIA 3WXWH 2K0RA 4OZ4A 2XI9A 2RAMA 5HGAB 1INDL 3O6KL 3STZA 3ZKMD 2TRYA 1AMYA 3OB0H 3UP6A 3OV6A 3RNKB 4E42A 3DO7A 2DL2A 3PNWB 2Q2LA 4X7SH 1BHGA 3CTTA 4FXLA 2EUWA 4A2FA 2GBVA 1P5VB 3G08A 4KRPB 1TQCB 3O8XC 2ZUUA 3BAEL 1SMOA 2VISB 3DI2B 1JZFA 3R06B 1BIIB 4JJ5A 4XOCA 5KAQG 3BEVA 5IB3B 3LEVL 4NDMB 5EUKB 4WW2F 3UTTB 3KWTA 1BYOA 3WN6A 5F44A 4M6MH 1KPRB 4N0YL 3TZVA 3TWCL 4HP5A 3QUXB 4JJHA 3EOBA 3ZKXB 2AQ2A 3BKJL 4KNSA 5AQ0A 3WE1A 2YAMA 1K8DB 3OAYK 4K3EH 4J3OD 5IK3A 5L7XH 5E8OA 2BNQB 2W60B 2LV4A 1LO0H 3RJOA 3WBDA 1Z5HA 1CC3A 2DWDA 1AO7D 4CVXB 3JWNG 4PEEA 3D3VE 3FT3B 3NN8B 2WQWA 2CJ3A 4LCIL 5E00B 2V7HB 2C3WA 1NEUA 2NY0D 4WFHD 4Y1AA 2IO5A 2VLRB 4DGVL 1NDGA 3DX2A 5DU7A 2YD9A 4UM9A 1GZPB 1X4YA 4AVJA 5BRQA 4FC3E 4UWQB 2VDLB 3P3UA 3VU1A 3QDJD 4EN3B 4U0QB 1G7MB 2A74C 1EEQA 2NX5A 3AADB 4DGYL 4TKWA 5HVHC 4GRWE 2LW3A 3HI5H 2PYEB 3JVGC 2ICCA 1AQKL 1CTNA 4HHGA 2EDEA 3NJXA 4OM1L 3SHSA 3T3PF 5L0QB 2O6FA 5KYYA 4N2OA 3CZNA 4CDGC 1AE6H 3V4PA 5FB8A 5JDSA 2WBXA 5FYJU 4JPKL 4H2CA 5BZWB 1EO7A 4W9ZA 2B0SL 2VDLL 2XACC 5I66B 3C5JB 2ZSWB 2WHVA 5EPMB 4L2LA 2WC7A 5IROC 2VDMB 2BHYA 2JJTC 2ICWI 1KLGA 3M86A 1C7TA 1RFDH 4P2AA 2BVOA 4LDOB 3CHRA 2EVJA 1ZHNA 1JWUB 1S9WA 4JFFE 2HB0A 1BMZA 3VXOB 1DJWA 4MVBD 3BZDA 1SHXA 3QG6B 4NQUA 4CW1A 3ARBA 5HHMD 3SOBL 3VDAA 1MSPA 2NYYD 3ECQA 4JRYB 2CNZA 1D9KD 2HLFC 2VDML 4K8RD 3S5LG 4A37A 1IGIH 4O4YH 5C6TH 3NABL 1FGVH 4WWID 1DJHA 1HHJA 1JGUL 4P49A 5KSVA 2UV3A 3O2VH 3UDWA 5DK0B 5E99H 3TN0B 1T1XB 4LQFH 1U8QA 5HI4D 4YHPB 3U6RB 1B6DA 3LEXB 3UZQA 5HHQA 3KXFB 2IQ9L 1XR8A 4KI1A 4K23L 2EUVA 2V2TA 1FNEB 5IGXH 2EC8A 3EJTA 3HB3D 3EJYD 3N6YA 4U6TA 4WO4C 4BH7A 4PB9H 2LLGA 4UB0H 5JHLH 2J5LC 3C6SB 3SE3A 3ZXAC 2X9XA 2LHAA 3ARFD 5I74B 1CXFA 1N18A 1UA6L 3U36A 4J8RA 3L5XH 5D7IF 1XSOA 1WICA 2DTSA 3PRZA 2A9CA 5G2NA 2XETA 3KH3A 1I3RB 4I7ZC 4F9PA 3HMXL 2YD8A 3REWB 3QQ9C 4DVBB 4N0CD 3D09A 4WI7A 3F58H 1ZWIA 1WZLA 5H35A 2ARWA 4YSOA 3NGBB 4G1MB 3DJ9A 5HHVH 2NRDA 1PYWA 1TJMA 3QRGH 4HFUL 1HTYA 2A9BA 4U7SA 5GGVL 1WZKA 4FQXB 1TVDA 4TLUA 4ZPVB 1UYWH 5FF6A 1N0XL 3PDGA 4HCRH 3SKJH 1CDCA 3BQUD 5BZDA 2K78A 4EUPB 4LRNH 2AEQH 4YQXL 3DECA 3LNGA 2ATPA 3FRPB 2JKRM 2CRYA 4XCEA 3SDDC 1EEYB 2PTVA 4E9TA 3T5WA 1PLBA 1JERA 2GAZA 5TJWK 5D2LF 5E1IA 4JFTA 1LO3H 1KFAH 1XGRB 2A77L 3KD4A 1PX8A 5DUBA 1X9LA 3BEWB 3RY4A 4JG5A 1DQLH 4XNZC 1R5WB 4YBHA 4H13C 2N7AA 4E68A 2ZKHL 3IDUA 4ACTA 1R5VA 3V52H 3ZHDA 1LP9E 3IDYB 2WLLB 3AAZA 4DGUA 2DW5A 4QRTB 2XQYK 1Q1PA 3P69A 5EU5B 1TFHA 4JHBA 5JPNC 2ZPKL 2CKBH 4U0RC 1TJIL 5C0AA 1CF8H 1QI5A 4KMTH 4N2CA 5J12B 3H3KA 1IJNA 3MRDB 3O2DL 2QMJA 5JXAH 3BAIA 4D8PB 4Q6IC 2FLBT 5DRNA 3J7HA 2DKMA 1BFOA 5CCKH 4KKCC 2M8XA 3RDTC 5KS9B 3OVUB 2E7BA 5M94B 4PJHB 3M07A 1HYSC 2DYRB 4Y4HD 2NY4B 1ADQL 3OXRB 1OE3A 5F96H 3N0AA 5KS9F 4DCQA 5HSFA 5DD3H 2YA0A 4AL8C 3S0PA 1NKOA 3MRKB 3IDXH 4QAWA 5CUSH 2RD0A 5AW2B 1Y6MR 4GMSH 4KMLB 1X6LA 1N9PA 2WNKA 3K5SA 3VXMD 2W8CA 3WJLC 4Y4KD 4ABQA 4KOCA 3AGVA 5J4MA 1N67A 1PX3A 3VXSE 2BSEA 4P57A 1Z6JT 4MB1A 5C1MB 4PRNA 2HRPL 5KVFH 4GRLA 3TA3B 4MAUL 1EZVY 3UBGA 1KLUA 2GQHA 1OK8A 1U92B 4JFFA 5D6DA 2CGRH 1DP0A 4Y2OA 4WU5A 4YWGL 4OFPA 3KPLA 4WI3A 4HS6A 4KC3B 5DHDA 2X09A 3MGOA 2WTRB 4M5YH 2EE9A 4XO3A 4G82A 2K3TA 4MDIB 2YXWA 3KBPA 3VCLA 4FQ2H 4NHUB 4NI3A 1JK9B 3FTGA 3W5MA 2D4DA 4TPRH 3EF4A 5DJ0B 3E6FA 2F15A 3BX7C 3ZRFC 4G7YL 4NIYE 5SV3A 5E2TH 2D7NA 5EUOB 2EDJA 4L2YA 5EZOL 3NIFB 5ID1B 4P06A 3L17A 4RGNC 3EW3B 5F7AA 1NWPA 1Y0LA 2ZIDA 3W11C 3ZTCC 4I87A 4S1QL 1IJ9A 1IBGH 3NIFF 4Z76B 4KKAC 3Q1SH 1JGIA 3SO5A 3T0WA 4KRPD 1DCEA 3I50H 3PGFL 2DL9A 3TJEH 3KJ4B 5DJAA 1FZMA 2WQ8A 4AZUA 4NGHH 2G5UA 2PYFB 4FGMA 3FU7A 3MHZA 1JRHH 3NCCB 4GP8B 1JPSH 3O4LE 2FWSA 1NC4A 3UTQB 3BUBA 1CB4A 3ILPB 3P3SA 3UTTD 1L9OA 1M42A 3FUKA 3WN5A 4PP2B 2YARA 3DPDA 2QLVB 2EDNA 3EKCA 4FTDA 4P04A 3L4YA 1MCDA 1JRHI 1P4IH 2XWJB 3QUXD 5IIEA 1CK0L 4R3SA 1FFRA 4AQ8C 1IQWL 5FW8A 4CU6A 4PWKA 2R7EA 5A16A 1TZ8A 1JXGA 2BNQD 2EDQA 4X6FA 2JJTA 3WFHB 1CLCA 5D9SB 3WKML 1ROCA 2D3VA 3RGBA 3U0TA 4B9KC 2AQ3A 4MQ7A 3VFRA 2OTWA 4KKLD 4P9MH 3VDCA 2QSQA 5D1ZA 2VLRD 2IAMB 1SYSA 3B2MA 5IFJA 3LZRA 4XPAL 4C8XA 4M5SA 4L3CA 5MP6L 5F9AC 3CXHJ 4MD4A 4QHUB 5M7QA 1GGCL 4JM4L 3WJMB 1AACA 2EADA 4EN3D 1OQOA 2HVKB 2Z0BA 2FD6H 2E9BA 2J8UF 2FJHA 5B1JC 5KN5A 1UWGL 3PFQA 4NQQA 3Q3GB 2WN3A 1U8KA 1KB5A 4WEUD 1BVLA 4MXWH 1E5YA 3FQ2A 4X8JA 3GTVA 1BQSA 3ARYA 5AW5B 5I1DB 1DQVA 3WY3A 1YEGL 4RFNC 1XGQB 3FOMA 3QFJE 4KKQA 5E6IA 3S3DB 3LRHA 4GQ9H 1YEHH 2W5PA 4W9EC 1PG7H 4ZK8A 2OFQA 2APVA 1E28A 4BINA 4NEHB 4E36A 2AANA 1JTTA 2XWTA 3PAVA 3R1GL 1S8DA 3BVDB 4W9LC 1KTCA 1URZA 4ZSOA 4XB8A 3MRFB 4Y19A 3FTUA 1OTTC 2BP0A 5I15L 3N1QC 4Y8DC 3CDYA 4FXKA 2VB5A 3US1A 4JG1H 3TEWA 5IHUH 1O7SA 1IQDA 3TVMB 3GXFA 1DBAL 2OTUA 1L3WA 1DBML 2P1YA 1FAKT 1RJYA 4J4PD 4JRYD 3WY1A 4DTGL 4M7LT 2VSMB 3PDOA 1T4WA 3ECVA 2JJVA 2Y22A 1QMUA 3ZE1E 1KLFB 4YX2H 2VJXA 2WBJC 1NM9A 1O7VA 1KBKA 3TBVB 5A2JH 2WV3A 3TN0D 5EIIA 1QNZL 1JVOA 3JUZA 2M2DA 4JFYB 3BGFC 2ICEA 2YR3A 4Y88A 4B5ZA 4YHNB 3O3AB 3U7WL 3NK4A 3SBQA 1E3FA 3PP4L 3LDBC 2WYIA 2ZUYA 3BPLB 3FT2A 3I6SA 2B1HH 3BUIA 2EINB 4M62L 5J1SC 2A0LC 4O2CB 3QIUA 3NFNB 3VXSA 4MJIA 4PV1C 4XHJD 3P54A 2ZWSA 3PPEA 4K3DH 4KAQH 4GI6A 4A38A 3NRFA 5KYUB 2OP4L 5DJXB 4UIKH 2BIMA 4JEGB 2DLIA 2J44A 4B5EA 4S0HA 4Z7NB 5C0ND 4U1LA 3FBQA 4L8BB 2CJTA 1RSYA 4JAMA 1NC2B 3N50A 3KWWB 1BQ5A 4GW5B 4Z7NF 2KKQA 1MPAH 3F84A 1TETL 1N64L 4MXQD 4AGMA 2WXRA 3NA4A 2C3HA 1R0AH 1FG2A 1YEIH 3ZPDA 1MLCB 3G5XB 3IE9A 3L3DB 4XPHH 3NDYE 5LBSA 4G83A 4ZS7L 4ZMOA 3AMKA 2Y0SA 4XN8A 1FFNB 5DS8A 4J3XA 4TUJB 2AEPL 5AOIA 1A1NA 1M05A 4FQXD 1FCGA 3B7YA 3IJYA 4Q6IA 1DQJA 4QYOA 4JN2A 1EJFA 4HPOL 1R6VA 2XUWA 4F7PA 2ZUWA 4G80A 1JV2A 1RULH 3QULB 4Z18A 3GS4A 4GO8A 2VLKB 4RNRB 4S11A 1VFAB 3N1GC 2O6DA 3BWUF 4P4KB 2X4OB 2AVFA 3I9GL 1ZLVH 1J0YA 4KO9A 3GS7A 1LE9B 1CE1L 3K74B 2R2EA 1EZUA 3NZ8B 1R3LA 2LU5A 2RALA 2CPCA 2HFFB 5F1SA 2F1EA 2RH0A 5F9JA 2G3MA 1NJ9A 2NR6D 3O4LA 2D3JA 4KRLB 2ZKXA 1A6VL 3CH1A 3KEHA 1WD9A 2DD8H 2ZXBA 3QWOA 4F7CB 3PQYB 3V7AE 1V3MA 2EYSA 4KBPA 4RAHA 1V05A 1MIMH 4UNTA 4FYSA 2B39A 1FVCA 2ZE0A 4NQCE 1U8PA 4YO0B 2IJ0C 4H20L 3TU6A 1M7IB 3G5YB 4FTVE 1X5MA 3P4MB 2WZ6A 1TFPA 2H6PB 3LKSB 3T3ME 1KIUA 2NY4D 4DP6X 4QGYA 4B6ZA 3FO2B 1CYXA 3VJ6A 3RILA 1AGFB 4N2FA 5KJRH 3ZKND 1GOHA 2HWZH 2R0ZH 2IH1A 4KI5F 4JFSA 4IOFD 4KVPA 4NUGH 4OD2B 2YS4A 3HAEH 3EAKA 1QQDB 4LNVA 4HXAH 5I0ZA 4BJLA 4PRDA 3FHAA 3Q6FA 1AXSA 3EGDA 4M1GH 4NFDA 4X99A 2ICWJ 3NPZB 3QFJA 2JIXB 5L6YL 2FJGA 1NCJA 1OANA 1E5AA 2X3CA 2ZF9A 4H26A 5GS3A 5EFIB 3LZLA 2ZSVB 3HRPA 1HQRA 1ACCA 5F7DA 1DUYA 1DJZA 3TA3D 3CLFL 4OIIH 3K6FA 4B0MM 4YBQD 4L1LA 1SJVA 3A6CH 3ALWA 4W6XB 1R3IL 4P8QA 3PUCA 4MWFB 1CDUA 5EU3B 4OZHB 3BT2H 1WO2A 5K1NA 5DC4B 2QTVA 4Y5VA 2G3ZA 4A6YH 1RUML 5DYFA 3MTXA 1AXIB 2P26A 5FKPB 2ORBL 4I77L 3D39E 2XKNA 4LDLB 4OZHF 2NY5H 5KBKA 3MLWL 4FFWD 5AVRB 2BNRE 1QTPA 2AZAA 5CCJA 4LLUB 2MWCA 3DHMA 3U9UA 4W4NA 5G4NA 2A9MH 3GEWB 2R4SL 12E8L 3HZYA 1E9QB 1IM9B 3H2QA 3DURB 1OB1A 2IANE 4MJ6B 1LM8V 5L8KB 4GQZA 5CSGA 4NKIL 3SYOA 4YBLC 2BSTB 4K8RH 4ODSL 5TE7L 3X17A 2O4EA 3LIZA 5SWZB 4QRPE 3FUHA 2HLAA 1YCSA 3TH4T 4HKZB 3SGKC 3WE6B 5IREA 2Q1EA 2GJJA 4HUKB 4BGDA 1MWAA 3V4VA 3CFUA 5EBWB 1XGPA 1A02N 2AK4D 3DTXA 3MKKA 4M6NH 4R7NA 5G55A 4C4UA 4DW2H 3L3KB 2VDOB 3IDMB 4KO6A 4QUOA 5D7HA 1H9VA 3TEUA 2FAUA 2XN1A 4PWGA 2FGWL 4JG0L 5D1ZI 3ZTDC 4POYA 4K94H 1A3RH 5FECB 4WZ9A 2HTKC 4X7CC 1QFWM 3X1FA 2NNXA 1ULVA 3RWFA 3GO1H 1T5WB 2P8PB 1FPTL 1UT2A 1AIFB 2IG2L 3T77B 1MAKA 2NXYC 4XPTH 1JZIA 4XMLL 4RH4A 3AMLA 2VDOL 3H9SB 2QGDA 3EYUL 2HUEA 3L5IA 5KYWA 3UGUA 2AP2A 5J1AB 4MXVF 3ZDZB 4D9RD 4N5EC 3QHZH 4D0DB 3D48R 4JM2F 5MI0B 4P07A 2IAMD 5CMAB 3ZDZF 1JDDA 2CLZA 5T3ZE 3OKOA 3IFLL 4L9LB 3RJDA 5FDWB 1G9EA 1HKLL 4XXWA 2X7LB 5TE4L 2V9UA 5F9DC 1KIRA 2XIBA 2C9XA 3RWIB 1FF5A 3U9PL 4NUPA 4GYBA 2AC0A 3G6DH 1U9KA 3WIHH 1MW2A 3MRIB 2QR0B 3DSNB 3B2UD 4L1DA 4XTRC 2HG5B 3ZE2E 3ZO9A 2VSDA 4OJEH 1XH2A 4N8VG 1KTKE 4PJ9D 2PWGA 1BBJA 5IMLA 3ILQC 1UACL 4DHLA 3B9VA 2B5IB 2DI7A 2XPGB 3RVTC 5CEXA 5CIPA 1I82A 3BJLA 3EO9L 4Q52A 3CXDL 4P5TC 4OBSA 3CFEA 1ZLUK 4HU8A 3FO0L 1TLMA 3MBEA 3WV0A 3QIWC 4ZW3A 2VMEA 5CN1A 2HCZX 2BCMA 4UV7L 1TJXA 4TTDC 5LGJB 4O58H 1J9TA 3FO1A 3FQXA 4PCSA 2OK0L 2OYKA 2FJSA 1UKQA 3C5SA 1RZPA 2DS4A 2DEWX 1OP4A 2AV1B 3PGDA 4FTVA 4ETQA 4F37K 3HE7C 3G5VB 5ITBL 5IHHA 5FXCH 3TH2T 4AV5A 4BH8B 4HOXA 2WZAA 1DZ0A 3WIAA 2Z8SA 1DVZA 4JFOA 5HHNB 1QFWI 1TITA 4PJBE 2DQJL 1EVTC 1SEQH 1HAUA 2WVTA 1N8ZA 4DKEH 2XTJB 32C2A 3CVIH 4KGJA 1MUJA 4KJWD 5J57B 5CP3H 3DMMC 2GI7A 1Z3RA 3HS9A 1MN4A 3MLZL 4P3DA 1F11A 4HV8A 3GJEB 5FW7A 1AD0A 2W9LA 2DV6A 2ADFL 4NQVB 2LFGA 1QLFB 4XNUH 1U3HA 3M1OA 5FGCE 1N4XL 3NJLA 5CR1A 3L4TA 3HS0B 1JZ2A 3UCRA 5SWSA 4MNQE 3MOQA 4RGOH 5ICXB 1C16A 1FNHA 4N90E 2R56H 3HC4H 3GI8H 1SMDA 4YFLI 5TF1L 2XZQL 2GTWB 3RTQA 1IILE 4R96B 4PJIE 5GRZA 1J8HB 4XP4H 1NC2D 2FNWA 3BWAB 3C8HA 1M7UA 3D39A 3QEQE 1BZDA 1WTLA 4Z0BL 1EZVX 3QHFL 2WQXA 2R29L 4C83B 4JGUA 2BNRA 4D9QE 1Z0NA 1IC4L 2KC0A 2HYMA 3F12B 4Q89A 1FVEB 1WAAF 5HYJE 1PPIA 3LAFA 2GJZB 5JORA 2BWIA 2DMKA 1WT5A 2JXMB 3E2HB 1INDH 4KX8A 3O6KH 2H45A 5INDB 3ARGA 1TQWA 4ODTL 3B5HA 3KG5A 2GC7C 4G8GA 4FADA 3F00A 4QRPA 1TENA 4OGAD 2VLKD 2NXZC 5DT1L 4P4KD 4UAOC 4PGEA 3SDCC 5IMKA 4KK8D 1PD0A 3FRUB 3KGSA 4H44C 5E56A 3IMTA 3O6FB 4ICXA 3BAEH 4XPFL 5GIRB 2WYHA 3T6QC 1EIBA 3MV8A 3GHEL 3LEVH 5IF0A 5I0XA 1WHOA 4N0YH 5GGRB 1P6WA 1FNGA 5LBVA 2QSTA 1F4AA 4HK0A 2NTFA 4HIJA 1EZSA 3BKJH 5AEAA 4PW3A 4OCRL 4QNPF 1KBPA 3V0GA 5H37A 3QJUB 1WUZA 4I9WE 1FFPA 3GBEA 2C9RA 5FKAB 2DBLL 4MAYD 4P9HL 1HHIB 4G59C 4LARH 5GGTL 3VXNA 4LCIH 3WS6A 2VXVH 1B2YA 3WMSA 5I8CA 3SODB 2VE6A 4ICWA 1I3GL 4HC1L 4DGVH 2YJQA 4WRLA 1KMGA 4KRNA 2I9TA 4KI5D 3CC5A 1TQVA 3MJ6A 2NLJB 2WXOA 3MVSA 3F85A 4H40A 2FL5B 3QUKA 3WDHA 4RCAA 4ZAKA 3X1BA 4DGYH 3BP6A 2E0PA 3ABGA 5DHXB 1S78D 5IBTH 2OZ4L 1AQKH 4HUUA 4QXWA 1J5DA 3KYNA 5EEVA 3RWCB 4MLIA 3RPIB 2J73A 3FFCB 1S9VB 4DWHA 1BYPA 3HZVA 4K71B 4TSBL 1WWAX 1I1CA 2JIXD 1IFGA 2OR8A 1NWOA 3BD3A 1HINL 2B0SH 3N0PB 1IM3A 4K9EL 3H0TB 3S8FB 2VABB 1S5IL 3MUY1 4GEIA 1P7QA 4BKLA 3QVAA 4X9HA 3GI9H 3DYMA 5MEPA 4YSCA 3D33A 4M7JL 3T71A 3MSPA 1KGUA 3AG1B 5F7KC 1X9UA 4L5FE 3FSZA 1N5YL 1GPOH 1PFOA 4S0TD 2KZBA 1J5HA 1GR7A 4QCIA 2VDMH 3QJTB 1BOYA 3LD8C 3GMQB 3ZL2A 3NABH 2FHBA 1ID2A 1UZ8B 2K4AA 1P4LA 3QJFA 4FRWA 1EUTA 5IQ7L 4JO2L 5L2KD 2CJSA 1JGUH 3L4VA 4LQ1A 3BKYL 5I1LA 1QAWA 3TF4A 4PJBA 4DGIL 3RKDC 1VGKB 3LMJL 2QKIA 3BGMB 3RIKA 4IJ3B 1GY1A 1IM9D 1B0IA 1YEFL 2CDEB 2W59A 5DHVB 4RSVA 2NW3B 1DANT 3T6VA 2FQGA 1ZRUA 4LVHC 3X14B 4CNIB 2P80A 1Q94A 3H7BB 1EAQA 4GINA 1KCLA 4R4FL 4FMFA 2QVMA 2ZOOA 5CO1A 3GSRB 1JK8A 5SWZD 1Z5LB 2XFXA 4LLVA 4K7PX 2PWDA 4I3SL 4ISVA 1KOAA 5LWYL 3Q43A 1H0DA 3SQBB 1T7XA 1VZIA 1HILB 1Q9OA 2YD0A 4MS8D 2NDFA 5IV2A 5I6OA 2FH8A 4M48L 2QHRL 2L4OA 2K9FB 4AITA 2X10A 5L9DL 1QD0A 1A9VA 2Q76A 4LK4A 5FO7B 5E2JA 4PJIA 2QKSA 2DQMA 2MQ0A 1RZKL 3QJQB 2CIIB 2L7JA 3SE4C 3QEQA 5LCVA 7TAAA 5E08L 3VM7A 2EYRA 1QHOA 2PTUA 3QDGB 2PCYA 4FFVD 4FJ6A 1EHLH 5B3SB 3H9SD 3S98A 4PCYA 4RAUA 1YNTB 3H85A 4BZ2L 2EIZA 3INUL 2ZCLL 2FLRT 5GGVH 5HYJA 3NPSC 4PAZA 4FFZL 3U82B 1KELL 3SEPA 5I2IA 3B1TA 4LHQB 4P2OC 5AOLA 4OZGF 1S9XB 2BZDA 3P9LA 4RZCB 2DAVA 4UDUA 2ADJA 3K71B 2P8LB 3KPOB 3RPKA 3TBYB 3HE7A 2RHEA 4N2EA 4LSVL 3B8SA 4IBWA 1D5RA 3CPLB 2VMCA 5FA4A 1PY4A 2FB4H 4MCZA 5D1QB 2OLDA 2QJDA 4NO0A 4YVUA 2V5MA 5HTSA 4EUPH 2ZKHH 3BFOA 4AQ1C 1F4YL 2VR3A 1SOQA 3MREA 1EEZB 2E4TA 3GUFA 5JQIB 3D0VB 4LT7A 2VXTL 3G04B 4QHLA 2ZPKH 4MZ2A 1TJIH 1T89A 3QZNA 1R1CA 2X1XR 3FQTB 3P73B 4HZLA 3B7TA 3O2DH 1NLBL 2PO6A 4YLQT 1Y1DA 1MLBB 4O2EB 4Y4FC 3KPQA 4A55A 1ACYL 4M6OH 4L48A 4NJ9H 1UB6A 2Y1AA 1CQYA 2JFCA 4IRSB 3E8VA 4F3FB 1KYUA 2E6JA 1MNUL 4OUOA 2XVKA 2YPVA 4APQD 4C4KO 2IV9A 2G5BB 1L9TA 1J18A 1ADQH 1TQBC 4H0IA 5C08B 3S3PA 4ADJA 5J6HA 4PG9B 1P4BL 3BWZA 2NNCA 3DBXA 3QJHB 5DR5L 2EO1A 4O9HH 3GFUA 5B38A 3LKRA 1EJOL 5C07D 4OLUL 2XTJD 2K8MA 5JOEA 3PWPE 2BDNL 4JE0A 2OSWA 4LESA 2DWSA 1K8IA 4KZEL 5I17A 4P2QA 3DVNB 3BUDA 1MG3C 2ZAHA 4N4YB 4YEEA 1RZ8A 2EEAA 2FO8A 5FYJH 3RIFK 2PN5A 3PAYA 4JHUA 5DUML 4DIXA 4L8CB 4OV5A 2YBGA 5I6NA 1L9SA 3X11B 3B8YA 2ZX5A 1GMIA 5A6IA 2HRPH 5E1AA 3KPPB 5E94A 3WIFA 1WITA 1JGEB 4MAUH 1KJ2A 4C56E 1T21B 5LDSA 1BGXH 1L9RA 1MCIA 2JCCE 3WMPA 1HH9B 2EABA 3OJ2C 2R39A 3K6SA 1VACA 1RZ7L 5F7EL 2YMTA 3U6XS 1J8HD 1WWWX 2IBGA 3ARXA 4KZ0A 4PJEB 1WDAA 4AWJC 1OT1A 3H8NA 3O0RL 4N0UE 1NIEA 3OAYH 5KVFE 1OIOA 4LB8A 4PJEF 1F4XL 5L4IA 4I3RH 4IKLA 4WFED 4ZXBB 5DLML 3HI1A 4AYBA 1KCSL 4JN1L 2AI0L 3GXTA 1E50A 3BH9A 5EZOH 3ZLQC 1KCWA 4YIQA 5I73C 2J21A 4LMQE 1AS6A 4X98A 3V5KA 5AZ2L 8FABA 4S1QH 2XZCL 3LNDA 2WIIB 1ZHKA 5HGGS 3WY2A 4WHYH 5KJ4A 4BSVB 3Q5TA 3O3DB 1WZ1H 4PU2A 3PGFH 2AJZB 3DXAA 1XF2B 1FBIH 1AP2A 4NFCA 2X44D 2F7QA 1DN0A 2BSDA 1DEDA 3QXAB 1RK0A 2MCPH 3H42L 1S7TA 2NQDA 5GJTL 4YXKH 4OCSL 1F58L 1I8KB 1IAKA 4JVWA 3VWKC 1QZNA 4P5MB 4X7EC 5BRZD 1CK0H 4ZMZA 1HNYA 2J4WL 1T0NA 1EANA 2PWEA 2ZWKA 2EC9T 3FUIA 1CCZA 4BQCA 2DLGA 5C0EB 2WZPD 4HPHA 3RBGA 3CHOA 3L7EA 3VD1A 3WKMH 2VDNB 4EZLA 2AJXL 2FZ3B 1CTMA 4KK9C 3D06A 1CT8B 1F6LL 3L1OH 4TSAH 3V6ZA 2XA8L 3ATDA 5KVEH 3UPCA 1DBJL 3I9IA 3MRJA 1BCIA 3IXTB 2W1NA 4LCCB 5I1HL 4XPAH 3QDMB 5MP6H 5JHMA 1W0YT 5BQDA 1LE5A 2J56A 4J1UA 4PY7A 1DE4A 4JM4H 2BOCA 4WKZA 3F7YB 5DMGD 5B21A 1WISA 2WW8A 4LF3B 4YDLC 4U6HB 2XKUA 2AXGB 5JPMB 1UWGH 2VDNL 4JRWA 4N6QA 4G6JH 2HT3C 3L9RB 4IOSD 5DEFB 1YEGH 1V7ML 3VDBA 4KFZC 3FFCD 2HFTA 4HCRA 2YBRB 3GLZA 2J71A 1OT4A 3CFQA 5IESL 4GUPB 3FNKA 2CUHA 1E9OA 3IPFA 3ZMRA 3O3EA 3T65B 1SVCP 2A3TA 2PXYC 3RUGE 4HDIB 2EXWC 3Q5YA 4KWUA 2YXVA 5D96C 2EIDA 4D7PA 2Z92B 1U36A 3R1GH 4RAVB 2QGBA 4MSWA 2QQLH 2VDKB 4POUB 3AB0B 2J43A 2C1OA 1GH7A 1I7TA 1FQ9C 1JZJA 1TZOA 2APWA 5D7JC 4H8WL 3ZHNA 2NQCA 1N6QL 1DBMH 5FGSA 1ZKAA 2P49B 3IJEA 3KCPA 3L7FB 3MLSH 4AGNA 1AGDB 4GKZA 4UF7C 2XN9E 4KQ0A 4Z3JA 1S7QB 4PJGB 4KZCA 1JFHA 1JF5A 2XXGA 4P4RA 3FHEA 4JQVC 2VDKL 5TE6L 1K9TA 2DQCL 4FLQA 1U41A 1MF2L 1P9MC 1QNZH 3LX9A 2ED7A 1SFHA 3F7VA 1R47A 2F68X 1NMBL 1UB5B 5DJCA 3PAUA 2ZX9A 3I02B 5ESQB 1GS7A 3U7WH 1YY8A 4GUOA 1FNFA 1ML0A 1QASA 2MMXA 2XBTA 4JFHE 4Z8FL 1KXTA 1S3RA 2RMNA 5E8EB 4M62H 4X2UA 4XNYL 3GRWL 3LKQB 1ZHLA 2Z7YA 4E9SA 1E67A 1QLRB 5IVOA 3FS9A 2OP4H 2VITB 5T3XL 3TC9A 3VFSA 2FEDD 2CCLA 1NBQA 2CALA 3D1MC 4GNKB 5JLZB 2IDFA 4ONFL 3KPSB 4HWZB 3DI3B 1O5PA 3WTUA 2VR7A 3V0WL 2L7QA 2AXJA 1BZ9A 5AUMB 5IR1B 1YEJL 2Y1VA 4LLDB 1JHTA 3Q9PA 4LOUC 4CSPA 2PR4H 3KL3A 3GKZA 1CVSC 1ZIAA 1TETH 2R1WA 1N64H 3OHXA 2V17L 4N0UA 2OPCA 4NWUL 5JMOC 2Z31C 4XMUA 1OARL 4GPVA 1HU8A 4B9YA 3MRHA 3Q13A 3QDGD 5EIIG 1VERA 1AIZA 5IJKA 3E3QE 4BFRA 4N2BA 3GRGA 3SPIA 3OG4B 1XR9B 2H7WA 4QRQA 1FN4A 4P3WA 4Q9QL 2N3JA 5EBLA 3ETBF 4B9PA 4D9LL 1CICC 5C7XH 4R26H 1A7QL 3IFPB 4L3AA 5I5JA 4HIIB 4JQXC 4BXVA 4M5TA 4HPOH 3MLVL 3U4KA 4PJAE 2C9VA 5DC9B 4FQLH 3UTSE 1TQUA 1CL7L 1CD8A 3QUYB 1OAQL 5EIQA 1JYNA 5FYLD 3I9GH 5DO2D 1YUHA 1A7PL 3W39B 1RH8A 1CE1H 2ITCB 5EU4B 3M88A 5HYQB 4UILL 1FYTA 3LTVA 2ESVD 2GJ6B 4PRIE 4LLWA 1F4WL 4XMKL 5AOKA 4OIBA 1K4DB 1UWFA 3NFPB 4PV8B 3T8XA 4B97A 3LRLA 4X6EA 2W65A 2HFGL 1AC0A 5A2CA 2X4TB 4GBXB 4FXGC 2DH2A 2MRYA 3QIBB 3MBWA 3NIDB 4MJ5A 1G7IA 3BPOC 4WI6A 4U1MA 3FUMA 2NY2B 3RVXC 4WUUE 4GW1A 4NZJA 4J28A 4DESA 1CU4H 2CUMA 1AG6A 2NNAB 1AI1L 2ARJQ 3FF8A 4XBPB 1N3NA 3D87B 2VXQA 4IRSD 3V5DA 1RU9L 4KPHL 2J1ZA 4XBGA 2JB6A 2NY5C 2VNCA 3EFOB 3T1FA 4YAQA 4GG8A 5C08D 1DFBL 3HN3A 2E74C 5ENWA 3T4YB 2PETA 2YFNA 1HHHB 4P46C 5I71C 5ESVB 1LILA 3U1SL 1S7XA 3VG9C 4P23C 5EU7C 3T0XA 3OAZK 3IAPA 1T5KA 4UTAA 1DL7H 5MEOB 1ZVYA 1WGOA 3SPGA 1OHZA 3N1PC 1AY1L 1X4XA 4M5ZL 1QPPA 2BOLA 1BMWA 4K8RC 2ZXGA 4FQJH 2CG9X 4IU3A 2DKUA 1T1YA 4ANXA 3VYPA 3P2DA 3BPCA 1CO1A 1UFGA 1XO8A 2NY7H 1AO7E 1KYFA 2CA4A 4KROB 4XCCH 4D3CL 4ZQTA 1JF1B 2G9KA 2GEEA 3CLFH 1IKNA 3SGJC 3UACA 1BJMA 2D0HA 3P4LA 4X80L 1YPZE 3FN0L 1R3IH 4WFHE 1A4KB 4K94C 3VA2C 5E03A 4XR8C 3EJYC 3NCXA 2UWEE 3TO4D 4MMZA 4WU7B 1RUMH 2EQDA 3ZQXA 4FERA 5C0RL 4JVUA 4MDJB 5HI3D 4I77H 3MCKB 5EHFA 5AAWC 3QDJE 1UUNA 4UZSA 2YGVA 3MNVB 3MLWH 1M4KA 4OGXH 4V1DB 2YD2A 4DAGL 4KVCL 5ES4B 3Q2LA 3ARRA 4NO2B 3SY0B 12E8H 1R3KB 4QRBA 4CVZA 4KXZI 5ID0B 3MODH 3U0WL 3LPOA 2DYPB 2J25A 4N0CC 5CGYC 4F8QA 1EQWA 3AUWB 4JFZL 5A6LA 5A7EA 5AW6B 4NKIH 5KVGL 1MREL 3B43A 2DQDH 3MX0B 1HSAB 5GS1B 4NQDB 3PE9A 3P30H 4JZJB 4LO9A 4I5BB 4Z7VB 4YSSA 4LEOB 4AEIL 1FL5A 1TTGA 2EDMA 1Q9KA 3PL6A 3SDXB 2ERJC 1ZV9A 4G6AD 3K1KC 3KZ8A 5EU7E 2VIRA 5GZND 5HHME 1FI8C 4G6KL 1JL8A 2H41A 1G1CA 3DIFA 3HMWL 3LCYA 4HWBA 4Q56A 2Q86A 3O45A 2FGWH 4JG0H 4QOKB 1RPQA 3WAKA 3E1F1 4UQ3B 3DX3A 1LWJA 3C2AH 2B08A 4WI5A 2ZG2A 4ZYKA 2HFEB 1JHKL 1SHMA 3Q8AA 5C0GB 1BZEA 2IG2H 2GSIB 4GRMA 4PBVC 3SN6N 4P99A 5E7BA 4L9DA 1ZLWK 3WNIA 4KJPD 5EO0A 3OR6B 1I7UB 4XMLH 2VDOH 1DDHA 5C0JB 4ZDHB 1B4RA 3EYUH 2X05A 1JZ5A 3NTCH 1KTBA 4NKQB 4X9YA 1OKEA 4PJDB 4X5WA 1Z7JA 2VERA 5F7WC 2XWRA 3O6ML 3NZUA 4CU7A 4I3GA 2WLJA 3TNNB 4E9VA 1F45A 4MB5A 4OSUH 4GXFA 1KCRH 4PJAA 5D7JA 1AMXA 2ED6A 1HKLH 3NJVA 1NGPL 3Q6GH 4GJTB 3QDMD 1TMQA 3SZKC 5FYKD 3ARED 1JDCA 3VFWA 5TDOB 5ACZB 4AV4A 3RWJA 1ZVSA 4LCUA 3LB6C 2VR6A 4CJ1A 3TJHD 1M7XA 1SDDB 1KCVH 1KGWA 2BSRA 3I3DA 3F05A 5ESAA 5F3HB 5BOJA 1WJ3A 5A2KH 1TXKA 3IB4A 3FBKA 4PRIA 5TFSH 1KT2B 3A6BL 2VJ8A 3VFVB 1FIGL 4NRXA 5DWUL 1UACH 3WDJA 5I24A 3CSBA 4OF0A 2D4FA 2R9HD 3QCUL 5CLYA 3KW7A 2HT2C 4X0KB 5CBEA 5I1KL 4FZ8L 1GC1L 4RGMB 4YHIA 3QQDA 3QUMA 1X7QB 4NN5B 4ODXA 3TXAA 2HX7A 1UA7A 5EB9A 4QHMB 1NBZB 1QRNB 4ABWA 5IP4A 4WUUA 2XWZA 2UVFA 3IK2A 1A6TB 3OSVA 1E6JH 2XY2A 3HJ0A 4Y4KC 4Q6YA 5FW6A 2PW2A 3V9CA 5GS2H 3DGGB 1T22A 3FONA 3GJFK 3AU0A 4OKVB 4OZIE 4R7DB 4OUUB 5T33H 4YDMA 1GCYA 4G2AA 3T2NH 3WNJA 9PCYA 3KR3H 5T1LB 3II3A 3RGHA 3LEYL 3BESR 1VRSA 2Q7YB 4HOMA 2VRKA 1QKZL 1X7TA 2F54B 3VA6A 4CMMA 1QWUA 4M8QB 4QKTA 3V0IA 2O6PA 5T3XD 2AMUA 4AIXA 3ARVA 3QCTL 5FOBA 3FH7A 3B83A 1EFXB 4QWWD 3VFOB 1QSEE 3P2TA 5A2FA 4OGYL 3V7AG 4UYQA 2MNUA 1TCMA 3L4ZA 4JY6A 4W4OC 3NK3A 1AO7A 1MRFH 2B3IA 2V5SA 5JOFB 3L54A 4L4VD 4Z3TA 1F6AB 3IJSB 5FO8B 3RRQA 4AW4A 1IARB 3V8CA 3CFJB 4QPEA 4FQCL 3KPSD 4LSTL 4JKWA 4K7FA 1LYQA 1PX4A 4PB0L 2XNAA 4PD4K 5HY9B 1Z9NA 2DQEH 3T0VA 1U4EA 4KH2A 1Q0EA 3CVDA 4YUEH 1TQCC 3QDJA 4F9LA 2HT4D 4TUKL 1A0QL 2LQRA 3O2WL 2P5WB 2WPGA 2R29H 3GXMA 3CDZA 5TGBA 2GYSA 2KHAA 3MROB 4OJCA 1KDJA 3WUWA 1OOWA 1CLOH 3M1BB 5IMOB 5DRXB 5F2FA 3VXME 1OLZA 1TOXA 5FO2A 3ZKXC 2NY1B 3AU1A 3H2PA 3UZEC 1I8MB 4GQQA 1J1XL 5CZRA 5JXEC 1D3CA 3ABKB 4LHUD 2IPUK 5E6ZA 4ODTH 4IS6A 1TTBA 2MPVA 5CILL 1FG9C 1PZDA 2UY7B 3QUYD 3EBIA 3CFNA 2DM2A 2VQ1B 4JFQB 4GAYB 3GMRA 4HZAA 5INCA 4DF9A 4XPFH 3AQZA 5KBDA 2GJ6D 3MLRL 3SKMA 4WDIA 1WHPA 3CFDA 1YVLA 4XPGL 3CX2A 4JDVA 5DD0L 1GS6X 2I9LB 1D9KA 1J0IA 4EN3C 2KERA 2BCKB 3MUZ1 5E5RB 1M2VB 4GBXD 5ILTL 1BVKB 1H5BC 3EYFB 1K5NB 4LLYA 4JPWL 4OCRH 5DRWB 2X70B 1IGJB 2AJSL 3C6LB 1NTDA 2RBLA 3KAAA 5L0QC 1RUQH 2NY2D 5EZPA 1F3JB 5D4IA 1HEJC 1WGVA 1FL6A 2Y2YA 3FT4A 1SVZA 2YUXA 5GGTH 4UQ2A 5MEQB 3DV6A 1NEZA 2OA9A 3D50A 3IGUA 2B7DT 2OMXB 4FMKA 4ZNEE 4N8CL 1KYAA 3SYAA 4XX5A 4Y1SA 5IKCA 2ZT9C 1NDMB 2J57A 3ARFA 3V79C 3NA9L 1NPNA 5FUOL 5DYOA 1FH2A 1RZIB 3QZLA 4Z3GA 3R4DA 2H8PA 1XCXA 3OKYA 1YNKL 1E40A 1HOEA 2IQAB 3UTTE 2YRZA 3FTVA 4FHJA 4PQXA 5B4MD 4X5LA 1UWXK 2WXIA 2XFGB 3FU0A 4K2UL 4PH8A 4TSBH 3V6FA 4ZUTA 5CJQH 1INEH 4QXTB 2P28B 1HINH 2ZKYA 4XP6H 1ZXQA 3CFTA 2BNQE 3ZHLA 4K9EH 2R69L 5H37G 1L6PA 4LLQB 3UTOA 3ZUCA 2X88A 4KROD 2AKRA 3E8UH 5LXGL 2WLIB 4QHNB 2Y23A 1TT6A 4RISH 5DUPL 1N10A 3O8XB 2YGQA 3O6LL 3QI9B 5K59F 1VDGA 5IHWA 2FSEB 2VLRE 3BQUA 2HAZA 4XH2B 3QJOA 5CLXA 1N5YH 4PTUA 5AB1A 1MW0A 2XDHA 5SWQB 2Y5EA 1YN7B 1W8NA 4MA1C 4J3SA 5I74C 1UURA 4OZIA 3QRFM 2YFOA 1Z32X 2Q0ZX 4K7PL 2GITA 3TCLB 4HUCA 1XFPA 4NKOB 4NKMA 1JG9A 4G72B 4V1DD 2VC2B 1WE5A 5IQ7H 2DLTA 2PYEE 4W9CC 3A47A 4JREC 2OCFD 2VL5B 3QH3A 5C0NC 1AGCB 1MCLA 2X4QB 3CCHB 3D85D 3V0JA 2F8XC 1YEFH 3D12B 2DYPD 3EXJA 1U8LA 1Y18A 1IEBB 3WKQA 1BDYA 1DZBA 1UHVA 2E76C 5B8CC 4MS6A 2E7CA 4AY0A 1KIPB 4NQDD 1DQDL 1O6VA 4KDVA 4OVUA 3WENA 2E5EA 4I3SH 5CKAA 2H3KA 2VC2L 5K39A 2ITFA 4PJ6A 2EAEA 4GEJA 1MNNA 1KTLB 3GMNB 1ZT4B 2A74B 1F2QA 4N20A 5DHVH 5B39A 4UUJA 5HVHB 1PMYA 4M48H 1MFVA 3VD0A 4JRYE 2OL3A 2YAPA 4LEBA 1XL4A 4DZBB 3BDXA 4Y4HA 3QNXA 1WFJA 1CD9B 4CSSA 1JAEA 2ZOTA 1RZKH 3L95A 3UZVB 3RX9A 4XB7A 5ITFA 1ZLUH 3GDBA 5E08H 3RWHB 1IU1A 1HHGB 3PWUB 2CO3A 1ZV2A 2HKAA 2EDRA 3UYPB 3IPBA 4BZ2H 2B9BA 1A9EA 3INUH 1KULA 3IDYC 5HHPA 4H1LB 3I3BA 3KXFE 4TQHA 4FFZH 3VXMA 1CXLA 1KELH 3DV4B 2YQBA 2OXHB 3GM8A 4AT6B 5GRJL 1MFEH 1W16A 5L4JA 4HJJL 3MU3A 1CLYL 3WJJC 1TZIB 2DRUA 1SY6A 4PRPB 3WFBL 1EVUA 4JM0A 1TO4A 2WQVA 2DQFB 5I1GH 3DRQB 2E8ZA 4S10A 3HPJA 4NO3B 2YMOA 5AWNL 2DQTL 3MLYH 1XCTA 4OJAA 5IMMB 2IPTL 4G6FD 4NAJA 1WFMA 2X89D 5KG9B 2X0VA 2B16A 1F4YH 3BSZH 4PG2A 4U4BA 2ZUXA 4O2FB 4AQAB 3MNDA 3LRMA 4ZFOB 2VXTH 3N1MC 3FCTB 3P9MA 5AB9A 3KH4A 1SHSA 4WO4B 4OIFA 1LP9F 4FULA 3ZJAA 3L3GA 4K5OA 1AKJA 1NLBH 3IN2A 3Q8CA 3VG0L 1QRND 1DQMH 3MRQB 1AR1D 1K3ZA 2NPLX 5CGMA 4N28A 3EH2A 1ACYH 1Z2KA 3BRGC 4KITB 1TU2B 5EZJB 1A3LH 4IJTA 4WCYH 1HYSD 4ZOEA 4ZNEA 1MNUH 4ZFOL 3RNKA 1MW3A 2WMPB 4G7SB 4Z7IA 3PNWA 1CXKA 3DWTA 3F62A 4IDJH 2EO9A 1P5VA 5T1LD 1P4BH 5DR5H 2PP7A 4H4NA 3BVNB 1JZ7A 4WW2A 3L1FA 2VISA 4ZW8A 1XB6A 2ENPA 1BIIA 2F54D 3NCYP 4OLUH 1P1VA 1B9KA 2A6IB 2JB5L 2A4CA 4NDMA 5EUKA 4YL4A 5CD3B 2NW2B 5DK2B 2Y36L 4YC2B 5GQBA 3UTTA 4KZEH 4U49A 1KPRA 4MA3B 4AC2A 3D4CA 5BXFB 5J9PB 2DQGL 3TEYA 3QUXA 4FFWC 2DM4A 5DJDB 3FU9A 3HFML 1JN6B 2W07A 3CBRA 2BNQA 4HUXA 5HYIA 4MQXC 3WI9A 1JZ6A 4HKBB 3NN8A 1SJXA 2BIQA 1SOXA 4BQ9A 4JPVH 2J88L 4AGQA 2OMZB 4FG0A 5D71L 4F1SA 2MEJB 4ZFGL 4KXDA 1YQVL 5K9QG 2D9QB 5E8DH 1G7HB 5KS9E 2VLRA 4PJHE 1G6VK 4HJ1A 4U1JA 3UL4A 1RZ7H 2JELL 4ZOBA 5F7EH 3UXFA 3KLAB 1CYWA 5AVZB 3SE9L 3LKPB 3KYAA 5IB2B 1IAIL 4EN3A 2VDPB 1G7MA 2PCFB 4YSAA 35C8L 3LQMA 1MELA