5A7BA

Structure of the p53 cancer y220c bound to the stabilizing small molecule phikan5211
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Experimental and Theoretical Evaluation of the Ethynyl Moiety as a Halogen Bioisostere.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5a7bA00
4G82A 2IOIA 2J1ZA 2J20A 5LAPA 4IBZA 2MEJB 3Q01A 4GUQA 1GZHC 5BUAA 3QYNA 4KVPA 4IBSA 1TSRA 2XWCA 2H1LM 4IBTA 4L0ZA 3TS8A 3Q05A 3D06A 1EAOA 1H9DA 4IJTA 2BINA 4IBVA 3VD1A 2ADYA 1T4WA 4AGMA 1HJBC 1HJCA 2J1YA 3D05A 4IBYA 5ECGA 3Q06A 4MZRA 3VD2A 3WU1A 4LOFA 4AGQA 3WTVA 3VD0A 2ATAA 1EANA 1E50A 1CO1A 2X0WA 3D09A 2J1WA 3WTXA 5G4MA 3IGKA 4XR8C 2IOOA 3WTSA 2J1XA 5LGYA 4IBQA 2WGXA 2FEJA 5ABAA 2RMNA 3WTUA 1HU8A 1UOLA 4QO1B 4AGNA 5A7BA 5AOJA 5AOMA 2YBGA 3D0AA 2BIQA 1EAQA 2XWRA 3WTTA 4G83A 1GZHA 3ZMEA 2OCJA 3WTWA 3QYMA 3EXJA 2AC0A 1YCSA 2X0UA 4MZIA 2PCXA 5AOKA 3KMDA 4LO9A 1TUPA 1KZYA 4AGPA 2J21A 4IBUA 5AOLA 5AOIA 2AHIA 2BIPA 3WTYA 2P52A 4L18A 5KBDA 3KZ8A 2IOMA 3US1A 4LOEA 5G4NA 3EXLA 4AGLA 2BIMA 2GEQA 4IBWA 4A63A 2VUKA 3IGLA 2X0VA 1IO4C 4GUOA 4L0YA 1CMOA 5AB9A 3D08A 2BIOA 5G4OA 2J6WA 4HJEA 4AGOA 1LJMA 3D07A 3US0A
chains in the Genus database with same CATH superfamily
4UTBL 2LW3A 2IPKB 3QG6A 1HESA 4LL1A 2XX0A 3V5HA 1WGVA 4RFOH 4OJDH 4LPXA 4MXVE 2XN2A 1T22B 4PB9H 2LU4A 4JFZH 2CBQA 4G1EB 3SY0B 1N18A 4KO5A 1T66C 2X5PA 2WP3T 4E9SA 1DUYA 3L2MA 1FZJA 1FORL 1FZMB 1SBSL 2WBKA 2WLYA 3GBMH 1CFQB 4FNSA 5HHNB 1BG1A 2DOCA 1TVBA 2IH9A 4PG2A 5KOVC 3K74B 3DSFL 1NCAL 3VFVB 4IBVA 5EPMB 1RJYB 2GT9B 4JJ5A 4JDEB 1DBML 4GW4B 5EU6A 2FB4H 1R24A 5E00A 1B2YA 2ZZUT 4BFIB 1WICA 4N6RB 3FHQA 2XNAB 2H0PA 1HNGA 4XHJD 4Q9QH 1BX2A 4G9DA 3CQPA 2HTLD 4FFYA 5DJXA 1AD9B 5GRZA 1RUMH 4P5TC 5EFIB 5F9WB 1OPGL 5JHLA 4QWWD 2VXTH 3D2UA 2L0DA 3W2DH 1KCRH 2XVBA 4JFPA 4QHUB 2VLJE 2P48B 1A0QL 5D5ME 2K1MA 3P9LB 3T8XA 3FFCA 1IT9L 2P8LA 4WQOA 3TV3L 3L7FB 3WL9A 1IKOP 2EZ0D 2W9EL 3CFKA 1OAZH 2LAAA 4GUPA 1TEFA 4XVUC 3VXRE 3OJ2C 5AOJA 5EU3B 2OZ4A 2FGZA 4N8VA 4OIBA 3RUGE 3RWFA 2HVJA 2A6JB 2IDTA 5D4HA 1J7VR 3WMSA 3BDYL 1CJYA 4R8WL 1NAMB 1EAPB 3I9IA 5C8JA 1HYSD 1DJHA 1XGZA 3C6SB 1MCCA 4M6NH 5FKPB 1BZ7A 3CSFA 4KFZC 4MYWB 4FTVB 4PYGA 3QUZC 3RIAF 3V7AE 4D94A 3RKPA 5I71C 3RIFK 5I1EH 3TBWA 3X1GA 4ZFOL 5IHUH 1EO7A 2ICES 2BFGA 2WQAA 4GRWE 2BSEA 2BH0A 4BCZA 4CN4A 2EDMA 3HJ0A 2HN7A 5FCUL 2VMFA 1AKJA 3FB5B 1KCKA 1WZAA 2APFA 5CEYB 5E08H 4EJ1C 4GG8B 5FYJE 4X6EA 2R1WA 5JTWA 2ZKYA 4XO4A 1SOKA 2EIKB 1KFAL 3S3JA 4R4NC 1LO4L 4PJGA 4ZFZB 3QIWD 5LN8A 1F0LA 4M7JL 1F42A 2VCOA 4HZLB 3VXMA 4IKNA 1FAIH 2BVQA 2Y7QB 5EBMB 5DZAA 3VFUA 5HDBE 1L6PA 4URKA 3VSQA 4AWJC 2Y6SD 4PCYA 2AQQA 1QLFB 4RX4D 1AGBB 2BZ7A 3QIUD 3WGUB 1G9NL 1OWWA 3MRBA 5L4FA 2A9BA 1TNNA 4OUUA 5CKGA 5L8JB 5IW6A 1A7OH 5E8OB 4TL4A 2VQ1A 3C09B 3KYNB 1QA9B 3B7YA 3O0RH 4K5OA 1KCSH 3HG2A 1KCWA 4YSRA 2V5TA 1R3KB 2ENYA 3VFWB 3QFDA 4R96B 5EIQA 3JV4B 4XHJC 2OXGB 5LNDA 3DYMA 3EBGA 2R7EA 2E59A 4NJAH 3BHBB 3ZDWA 3B6SB 3E1F1 1NANH 1RUAH 2JJTC 5I26A 4A7TA 3KGSA 4NB7A 4QWWC 3X12B 3KLSA 3QO1A 4KXCA 3ULSA 5BO1H 3FTZA 1IGFL 3ASOB 1FFOA 2PXYA 1A3LH 3QNZA 1I9EA 1UT9A 2VDNH 4HJJL 4NN6C 1YEDB 1CPUA 3VGHA 3ZQ9A 3FT2A 3W3BA 4N4YB 1PPIA 1Q8MA 3P11H 4HKBB 5DJ6B 4NHCL 5I6XB 1CO1A 2AKRB 4LLUA 4U0RB 3LCYA 1RZ8B 3FKUS 2NDGA 3U9PH 1W0VB 2QPSA 1TZ8A 4LVOC 1JMXA 4KK8D 4XNYH 5DJYB 4NNXA 4NBZB 3FFDA 3ARUA 1HYSC 1LP9B 1Z7JA 2VXQH 2XN0A 5GGVH 4MCZA 2B0SH 3HNSH 3IN0A 1E28B 4FFYH 4QO1B 1SHMA 3JVGC 1LO3H 5I66B 1TCMA 2YMTA 2DMGA 2DBLH 3LNHA 4Y7OC 3OHMB 4FOMA 3TEWA 3WNNA 4X4XB 4LLYB 5DD3H 1Z2KA 5E0FA 4YZFF 1JRHL 1KG0A 5AW7B 5HI4C 2Q86A 2ZX8A 3QXTA 2VERN 1IQDB 5B38B 2FBJL 2AI0H 2AMGA 3QI9B 4HKJB 2BVOA 3SDCA 4F7KA 2OZ4H 5HD8D 4KDTC 3HN8A 4RDBA 1M57B 3DGGB 1HWWA 2PYED 4D7PA 2WINA 3LEXB 4GXUM 4X6CE 3B4NA 3VXUB 1KWKA 1CT8B 4RFOL 5EUOB 3O2WH 3NJGA 3QIUC 5LNEA 4OGAD 1HINH 4IOFD 2CNYA 4P2OD 4U4BA 3FUNA 4D8PA 4JFZL 4E9VA 5A7EA 1A47A 4ZW5A 1DJIA 3TT3H 3Q5OA 3T77B 3ZYZA 4JQIL 5D7LA 3GBML 1RZQA 3U9WA 1YNKL 4YNYB 2WQUA 1IO4C 4PJ6A 2ZSVB 3OLDA 4N2CA 1OTUD 3QIWB 4ZRGA 3BZEA 2I9LA 5EO0A 4C8XA 3L17A 2FEEL 1JZGA 4WU7B 1IAOA 5D7KD 2ESVE 4W4NA 5IBUB 5C0DB 3PWLA 1NUFA 1ZHBB 4TQPA 5F7DB 1RQ5A 2GIMA 1KJVB 3BP6B 4GINA 1BF5A 4KNUA 4AYSA 3ZTJH 4ONHB 1DEEA 3FCSB 1RUML 3HE6C 3B2PA 1Z6JT 3VFMA 2FRGP 3CN0A 1PU0A 3W2DL 1KCRL 1T4KA 3CPLB 3U6XA 3AUVA 4XXDB 2VL5B 3RPBA 4L0ZA 4AYFA 1P4UA 3KPLB 4IHOA 4LHQB 5ACMA 2WV3A 4X5LA 3UERA 1OAZL 1MHHA 3HBZA 4F8OA 4H1LG 3SPHA 1OT4A 5J6HA 2JKJA 4D9QE 1MCOH 2X4QA 3BIAX 4IHBA 2B9BA 3V0EA 4EI5D 5KSAB 2NT0A 4KK8C 4WDIA 4GXFA 3QJRB 3MRRA 2AVGA 4ZG1A 1Q72H 1BVKB 2NNRA 5EOCJ 2KDGA 4DQOH 4WV1C 3CBJB 5D2NB 3D69B 2LAGB 3PLYA 2EKSA 4XMWA 3GM0A 4AIOA 4YMPA 4M6NL 2CGYA 3T2PA 3ELQA 2Z0UA 2HFFB 2F54D 2JKXA 3MRFB 4KKBD 2V5YA 2F61A 5INCB 4AE0A 4AXWB 3MGTA 2NYYD 1XH0A 3PY9A 4Z95H 1J18A 5E08L 4X4KA 1YEJH 5EORH 1G43A 1OP5K 5E99H 2GBTA 3O4OB 1H5BC 5ERWA 2X4PA 1SDYA 4NP9A 2WK2A 1N19A 4KJQC 5TDPB 1XR8B 3JTSB 4WO4A 2FECL 1FAIL 3MLZL 2ADJA 3H9YA 4OGAC 4RQQA 3WHE0 3C60D 2X88A 1UUNA 3NABH 1IILE 1UACH 1D7CA 3T8MA 1J0IA 3CSBA 4LDLB 1A4JA 3GEFA 2H3NA 5BRZB 5AVSB 1X6NA 2ZCLH 4OGQC 3SDAC 4KTDH 4JFEA 4AY0A 2OMYA 1ZLWH 4YR6B 4YIQB 1NWPA 4BBWA 3RY6A 3IMWA 4HWZA 1M3JA 1B4JH 1JTOA 3F58H 3O0RL 2PYEB 1KCSL 5I5MA 5C09E 1MREH 3IU3A 3ALXA 4HZ1A 5C0JA 1MY7A 1YMMD 4H8HA 3N55A 3OZLA 4NENA 4P2OB 4NJAL 1ZVSA 4P3CH 3VWJB 4C55A 1RUAL 3H9HB 2QDVA 1E9PB 2P24A 3GS0A 4HSQA 4MMYB 5BO1L 1I1CA 1WYJA 1MCHA 3TF7C 5HDQH 3ATDA 3V5DA 4ZD3H 1A3LL 1AE6H 2K7PA 4RGMC 1C7SA 1BYOA 2VDNL 4HIPA 5MEOA 3EO0B 1K5NB 1XGPA 5A16B 3ARFD 4FMVA 2XG4A 3P11L 4JL2A 3RB5A 3L1EA 1H3VA 5E6YA 4EI5C 3RZCD 2JJWA 3CC5A 2MQGA 2OMVA 4HS3B 3EH5B 3U9PL 4JLRB 1GZQA 4XNYL 3CZLA 3DTDA 2DF3A 4JM2A 5J06A 2VXQL 1RK1B 5GGVL 2B0SL 2F5AH 3HNSL 4PM1A 1E9QA 3O41A 4FFYL 1R4XA 1RERA 1CXFA 1LO3L 4Y4HA 3U30C 3VD1A 1F6LL 4PG9A 2DBLL 3MRLA 3N1GC 1QNIA 4E0RB 3H6AA 4FQCH 4A04A 4YSEA 4EZKA 4HIJB 5I2IB 3SBWC 2LOEA 5DD3L 3BGAA 3SQBB 1S9XA 4R2GC 5ECGA 5GZNC 2VERA 2AXHA 4FQ2H 5E8EA 5TH2A 1VESA 4U6TA 3QJHA 4K8RH 4AQ1B 2AI0L 5B39B 2C3HA 5K9QG 1N6QH 2OZ4L 3QWRD 5E5MB 3Q8BA 3U82B 4QF1B 1IBDA 3ISYA 3C60C 4BIKA 3QJVB 2EC9U 2WHVA 2J1XA 4JFXB 1PG7W 2ZYRA 2BM3A 2D03H 1K8DA 3O2WL 2E4FA 1SJHA 4UQ3B 5I73B 1HINL 3O8XA 2ZUTA 4JVWA 4YK4C 1D5MA 3N42B 4XBPB 3TT3L 4M6OH 3GUFA 2KERA 2EDKA 5KYXB 3G6JE 1ET7A 2K4AA 3H9SD 4HIIB 3VFRB 5DHEA 2NQDA 2ATKB 3KXFA 1Y6MR 3WHXB 4JFYA 2ILLA 4UYQA 5C0BE 4AEIH 5K5YA 4WGWB 3D3VA 1YCSA 2XPGB 4M5ZH 4MZIA 2Z31C 5DJDB 1E3ZA 5B7MA 4DO5A 7FABH 1F11A 3WUWG 2Y2YA 2ORBH 3ASWA 3DOIA 4IK7A 1FQ9C 4NRYB 5L8LB 5JPMA 3P3YA 1ZS8B 1PS3A 3OAYK 4TTDD 3ZR6A 4LU5H 1LEKA 3EGDA 3LKRA 4Y1SA 2B3RA 5JLZB 3HLAA 1A22B 2CA4A 2IAND 2W92A 4DCQA 1NWOA 2ICEC 3CPUA 2DQTH 2D9CA 3VD9A 4V1DA 2FTAA 2OL3A 4OD2A 5IMKA 5IUCA 3IGLA 5AVRB 1UJ3C 3QQXA 4Z9KB 3RZCC 5IB3B 1USQA 1F4WH 1S3RA 3PWNA 1HCZA 3D0LB 2EINB 1NGXB 4NNPH 5AKSA 5DZNA 1G7PB 5DZPA 2VIRA 5DRNB 1H3TA 1T04A 5JW5B 2PCPA 5IVZB 1Q72L 4W6WB 1YHPA 2VYRE 4DQOL 3QQNA 3CN2A 1JZHA 1U2HA 1FNLA 4FFWC 1REIA 3IMTA 3LIUA 4U6VH 1OGTB 3GSVA 1E5YA 3ARFB 3QNFA 3VGFA 5IMLB 3JWNG 4YHYB 5A2AA 2FNBA 3UDWA 2XV2A 5IHLB 4N2KA 4Z95L 2E47A 3EJTA 4OFPA 2K6WA 4ZW3A 4QRQA 5EORL 1B2WH 5E99L 4FFZA 5EIIA 2WOYA 4QGTA 5DUBA 2E86A 5E9DB 3R19A 4JKLA 5BVPH 5C07D 1XAKA 1GC1H 3SJVD 1ZT4B 2XYBA 3E8UH 3EYSH 1ZLSH 1KGWA 4P48A 3TO2B 4MQXD 1A3QA 3M86A 3L9RA 3QCUH 5BUPA 2IADA 3ZRSA 3NABL 2H26A 1UACL 5D6DA 3BUBA 1NC2D 3LKPB 4Y5YC 4BH8A 1JV5B 1X9LA 3MRNA 4IYKA 1N0XH 2ZCLL 3MNDA 4KTDL 4KRMB 4B3EA 4WNQA 1NINA 1QLEH 2YUWA 4K15A 5IWLA 1PY0A 3WTSA 1B4JL 4NYLB 3F58L 5D7IE 1B6DA 2RALA 2XUWA 1MREL 2A0LD 3RILA 1LHZA 1NIBA 5JHBA 1J9TA 4CRPA 2X7LA 3VD7A 4HHWA 4KMQA 1WUNT 1G1CA 2HJLA 4RIRB 5HY9A 3L3HA 3BLBA 2IH1B 1GZHA 4TTDC 1NFDA 1XH3A 4P3CL 1J0HA 1F97A 4K71B 5FECA 4PTTB 4I4WA 5F89B 5IF0B 4B9YA 1CFTB 1J5HA 3US9A 3KWVA 4PCSA 2C1OA 4MX7A 5HDQL 4ZD3L 1AE6L 3KMDA 5JQHC 4MDJA 4WNJA 3ZTEA 4P0DA 1IBGL 3V4PL 4LK4A 4JM2F 4WCYH 3LKSB 4GQPH 5CWSA 3PS6A 4LE8A 1QTSA 2YC1B 4CA4A 4BUGA 4PGEB 3PPSA 3T0EE 2I26N 5EZLA 3I84A 1OCRB 2M26A 2IAMD 4WJ5B 2W1NA 5F1OB 4CBZA 4CSTA 2ZG1A 3WLBB 2MWCA 4F7EB 2F5AL 4G8GD 1G94A 4PGDA 3U83A 4TPRH 1CLZH 1SFDA 1OM3L 1SXCA 2E6PA 4NHUB 4UQ2A 1FZKB 2VN7A 3H0TA 3ILPA 4FQCL 1DN0B 5CD3A 1FNAA 1GJIA 3K2MC 2IV9A 3UZEC 1OF2B 4QRRD 5DTFA 4FQ2L 3ES6B 4Y9BA 3EFFA 3PHQA 3AXLB 4K8RL 3U2SA 1NMBH 4GUQA 1CD0A 5AYUH 1N6QL 2ZAGA 5IFJA 2N01B 1FIGL 1ZE3C 5DURD 4MQXC 3HHSB 1WBXB 4RAUA 1KB9K 1CVSC 1NBVH 4QY8A 1NGPL 3WHE1 2JKNA 2IALB 2D03L 5K93A 5L2JB 4CBPA 4MAUH 1D7BA 2NXZC 4GSRA 4XMTA 3CXFA 4RAHA 3P4OA 3HE7C 4XH2A 4M6OL 4S0HA 5JW4N 3TN0D 1RUPL 3HPJB 3WY2A 1AS8A 1YUHB 1U8JB 1BSIA 3ALPA 3MMEB 3KLLA 5CLXA 1WD9A 4QRPE 3S36H 4M7ZB 3QARA 3SJVB 4XPAH 2R2BB 3MRCA 2XPYA 3C6LB 2DQ6A 3UGEA 3GI8H 4M5ZL 5L6YH 3PJLA 4NQUA 4FFZH 3VXOA 3WCYA 1KBBA 7FABL 1DVFA 3MJ6A 4MXQC 3VRJA 3WTXA 4P5KB 1H8SA 1NC2B 2JQAA 3V0JA 2ORBL 4PGBA 4MKMA 5HDRA 4HWBA 1A6PA 1OCCB 2DEXX 1L7IH 2DH2A 3J27A 1XGYH 3ATAA 4LU5L 3BX7C 4ZMQA 4DSYA 3QJFB 5I16B 1LE5B 4MLIA 4RCAA 3VW3H 1TLKA 3MQIA 1NTDA 2P47B 4LQ1A 3VXQB 1THCA 2FYYB 5JO5A 2AEQL 5ENWA 4UZGA 1QFHA 2VN6A 4Q6YA 1F4WL 5ESQB 1QLRA 4AQZA 2XTJE 2MJWA 3PWVA 2DMBA 2FBRA 2IAMC 3NJLA 3M07A 1ZT1B 4IDJL 5DO2D 3BSZA 1ZVYA 5GGSB 1JHLH 4NFBA 1J8RA 3QQ3B 3VRIB 3L9YA 3S34H 1OGSA 2MPAH 4OTXH 5LGJB 4S10A 3CDZA 3GRGA 4DEPC 2XQBH 3HOGA 1CE6A 1X4ZA 2O6CA 4U6VL 3RGVC 3ARGD 3ATFA 3SY6A 2FQDA 3II1A 2RCSH 3ARSA 3A4DA 4A67A 3AXIA 9PCYA 5ES4B 4FA7B 4KQ4H 4JJHA 4PR5B 1XSIA 1T1YB 4IIQC 2XKUA 4Z6AT 5B1KA 4UQAA 4JM4H 5ACZB 4D3CL 2DWEA 4F33B 3AJ7A 2FO4A 2ZX7A 5H37G 4FDWA 4TSCH 5J1SC 3NSCA 2J8UE 1T2XA 4NC1E 5DD5H 1T6WA 3TGXA 4GAJH 1JYWA 5BVPL 1GC1L 4G8GB 1VSCA 4P2YA 3CLFH 4KQ3L 3U4EB 3E8UL 3EYSL 3D48R 5DMIH 1YQ2A 3QCUL 2ZE0A 3V4PH 1G7QA 2CZNA 4K5LA 2VUYA 3F01A 3FU7B 4UAOB 1N8OE 4B50A 4L8SB 1R33A 2OMWA 4QRRB 2TRYA 3DXAA 2BSRB 4YVUA 2E9BA 3ARXA 4HKXA 1XCWA 5I75C 1QLEL 1YN6A 2GJZA 1MVUB 5JDJA 5DURB 4KJYB 1NFDF 1E5ZA 1IJ9A 1UB6B 4ZSOA 3TZVD 1MIEH 2X9XA 1EJ8A 2BWIA 5FAAA 5A43C 2OCFD 1XAUA 3IRCA 3DROB 1HC1A 2R29A 3T3ME 5T3ZD 1YDPB 3JWOH 1R3LA 2NT1A 1GGYA 5BW7A 1GGCH 4PJEA 5HVHB 5AAWC 3TN0B 1AVAA 4NIYE 1NIAA 4AGQA 3C5ZD 1R5IB 1GY2A 3UTZA 2V8MA 3MRGA 1XSJA 5HYEA 3H3KA 5C0CE 3EJCA 4F5CE 5EU7C 1E7VA 1HXYA 4NQXB 3VI3A 2XC8A 5A3ID 4WCYL 4DKFH 4QCIB 2JB5H 2GHWB 2HT3D 3I9GH 1R9FA 1MELA 2MKWA 2UXFA 1W72A 1MCLA 4U1HA 1AZVA 1HU8A 3OV6A 4PEEA 3WY1A 3PDOB 4ZX4A 3R1GH 5C9KA 3GSOA 3OR6A 4BCYA 3DOSA 1EXGA 5G5DA 4X5WB 3CN3A 4GSXA 5B3NA 1U36A 3LEYH 4LASH 3B34A 3T5WA 2OMZA 3FQNA 4TPRL 1CLZL 2X38A 1VKXA 3OKKB 4Q6IA 4ZS6D 3RTQD 1JI1A 3WFCH 2B3IA 2F5BH 2DW5A 3B2VL 1UFUA 3RPIA 2WBJB 5ALCH 5HJBA 5IVNA 5L8KB 2DEYX 1K2DB 4JGUA 4K55A 3SOBH 3IXTA 3AM8C 1S5IL 3TJHC 3HMXA 1NMBL 3AB0C 4XGZA 1RURH 5F1NB 1NANI 5AYUL 2X4SA 2Y4SA 3CK0H 4WIQA 5DSCA 1IKNA 3ARBD 2OI9C 4Y1TA 1NBVL 3ARGB 4OV5B 3G5XA 5D2LA 2I5YH 3NZ8A 3D85D 5T8IA 4N90D 4U1IA 3L5WB 3WSQH 4MAUL 1AIFA 1MCBA 3SDXA 4MA7H 3QFJB 5E6RB 4JN1H 2PO6D 1KCUH 1GYAA 5E4EB 1MCJA 5JIQA 1T7YA 2QADD 4XVTH 1PLBA 3ZDZF 4P99A 2DQGH 1PBYA 4MB3A 5HYQB 1G4RA 5CIPA 1JPEA 3S36L 4XPAL 5DRXA 5JIHA 5D4QA 2OMXA 3BFQG 2BOCB 2YFNA 3IMUA 3VU1A 5L6YL 2NXYB 2A1WH 4FFZL 1KXTB 2NY3D 4KVPA 5D1XB 2Q3XA 1T1XA 1MCRA 5IG7A 5CO1A 4Q89A 1QX1A 4O51B 4RSVA 3PL6C 4KBPA 3AS0A 2WWKO 1BXVA 3SPGA 2HTKC 4WWPA 4JW3A 4OAWB 1XGYL 3OGCB 2QPUA 2XZQH 3IWUA 3NIDB 1IGTB 4ODWA 3ZO0A 4PWJA 4ZDHB 3VW3L 2ICWJ 1T5XB 2JI1A 1SOQA 3TZVB 4LCYA 4NQDE 1PKOA 2BX5A 4PRHE 2F7IA 5EU4A 1O75A 4KI5C 1BF2A 5I8CB 2C34A 3MBED 1D5ZA 3VXPA 1SY6A 3L4CA 4U3SB 1OL0A 2AQ3A 4JRYE 5GRWA 4AX3A 4JKNA 2XBTA 1JHLL 1QUNA 2XBDA 4QHKJ 3C5ZB 4WEUD 4J2XA 1FL3B 3T1WA 3WLWC 2Z34A 3S34L 4F1ZA 2MPAL 4J3OH 4OTXL 1JGDA 1WIPA 2XQBL 1A6VH 5A2FA 1BXXA 1ILUA 4X5XB 3RTQC 1OAXH 2RCSL 3NCYP 1U8PB 3EJJX 3MJWA 3AC0A 4N0FB 4DJMA 1WFMA 2GYSA 4KQ4L 5TDNB 4N1HB 2IVFC 1EV2E 1JJUA 3LKNB 5C0AA 4HS6A 4N3UA 4GQ9H 3POHA 4WFGE 1KIPB 3F5WB 3T1FB 1AHWC 3D33A 2X2IA 1YYLH 3WNMA 5DD5L 2AJSL 4DWHA 3F7VA 1W72H 3QQDA 4GAJL 3MRQA 4JFFB 4NO2B 2GBUA 1HHJA 2NY7L 3CLFL 4L9LB 3ZDXB 4AUUA 1UZ6F 2R0WH 3EHBC 5DMIL 2LLNA 1TVHB 2WQVA 3NIGE 2W95A 3DPBA 1M71A 3O9WB 3PHOA 4GRLD 4YBQC 3MA7A 1QSFD 3IJEA 3MV7E 4HUUA 4XT1C 4OCRH 2CDGB 4AVIA 3VI4B 5IJDC 1GOFA 2PO6C 4OFVA 2GTZB 4P46D 5E4IA 1FBIH 3AADB 4NO5B 2IOMA 3AMLA 3PV6B 2A9AA 4GJTB 1YA5A 3THMH 3ZZ1A 3MJ8A 2WTOA 5IW1B 1F5WA 3GTTA 5DVLA 2FDBP 1XMEB 2J6EA 1IEBB 2G4EA 2P9RA 1AR1C 4J3OF 3L3OC 3LNIA 1D6EA 2SEBA 1YEFH 4PJEF 4NZFA 3ARBB 1LGVA 1MIEL 3P77B 2EICA 3HMXH 5BZDB 4MA3B 2VSKB 3D85B 3KYKH 3MU3A 4PS8A 3JWOL 3NIFF 4NO0D 1JK9A 1WBZA 3GSWB 4B95C 1GGCL 1NGWA 3BZFB 3P4LA 4Y9GA 3BP7B 3ZTCC 1URZA 3VI3F 2QADB 3MV9A 2WXJA 3TVMC 2KH2B 4BZ2A 1DVSA 4EI6B 2IDCA 3MOQA 2O5YH 2EUXA 4N2BA 2WLLB 4BM7A 3TNNA 3IJ7A 4TVUA 3QEQE 1XT5A 4NLHA 2WZPA 3J8F7 1NBCA 4LVEA 1U8MA 5TQ0H 4WLCA 2NY3B 2H2PD 2JB5L 1R5WA 4DKFL 5J1TC 3HZKA 3I9GL 5CIPH 1RJCA 1EVTC 3FQ1A 4ZNEE 4OJAA 1H8NA 4OUOA 2EXYC 1IEAB 2EEXA 3QIBD 3R1GL 1PW3A 2D73A 3QPQD 4JFTA 3VD3A 4K5PA 3C9NB 4X8CA 1UZ8B 3GUTB 1I7ZA 3GLDA 4NC0B 3MV8D 4LASL 3UADA 3N43B 1OSZA 2MH4A 3TLRA 1LWHA 1JDDA 3L5HA 3RDTA 2VW7A 1CFMA 1P7KA 3WFCL 2F5BL 5F7NC 3KWTA 3MBEB 1PX4A 2E27H 1FPTH 5ALCL 3LKQB 4DVRH 1OP9A 2HJFA 3SOBL 1Z3GH 3B7SA 3QHZH 3D2TA 4XOEA 2HFEB 3UAJA 4I3RH 1UD8A 2RQ8A 5D1QE 1RURL 3RVVC 4P07A 2WGXA 2WBWB 2ZPKH 3SDXF 3I6GA 1SY6H 3O6FA 1ZDQA 3CK0L 1NJ9B 4G8FB 3SGDH 4X9YA 4X0KA 4OV6F 2YAPA 2X53A 2I5YL 4MZ2A 2GITB 2QJDA 4HJTA 5CN2A 4P46C 3WSQL 3BP5A 4A2FA 3HPLB 3V4VA 2E9IA 4HK0A 1B4TA 4JN1L 1KCUL 3SBPA 4EQ2A 4XVTL 3CG8A 3VGBA 2DQGL 2XXCB 4JCMA 5DUPH 2QQLL 3MRKB 5IEKB 3FT4B 4GI6A 5B8CA 4R4BA 2E7DA 5AOLA 3VWKB 1DJYA 1U3ZA 3IFNH 4LHJB 4GRLB 1JXGA 2X41A 4OF8A 2A1WL 4UT6H 2WXFA 4AT6B 2IGLA 3CAFA 4IOSA 4ANWA 4XVOA 2WCGA 4PRNA 4ONFH 3FTGA 4AUJA 2GTWB 4P59H 3EBHA 2G9KA 4MYPA 1YUKB 1W16A 2XZQL 3QEHB 3LNFA 3RJQB 5BCAA 4D8OA 2O30A 4C4KO 4BSWB 4MJID 1BV8A 4AGOA 3BPLC 4P2CG 3VG0L 1E2WA 4HLJA 4JMXA 2J6EH 5F0JB 1GY1A 3Q43A 1B3JA 5D1XE 4NO0B 1U8KB 5FFGA 4Z0XB 3P4NA 1JZ8A 3QPQC 4IMLA 3JVFC 5JNYB 3W5MA 3BRFA 3UPCA 3OC5A 2BHUA 1IVLA 2KC0A 4JFOA 5GS0C 2PYFB 4ZUWB 2CWRA 4HF5L 3HRZA 1N4XH 3WELA 1A6VL 4FLHA 1FO0B 3ULUE 3AAZB 2QGEA 5B38G 1OAXL 4MCYB 4PJXF 4HAGA 2CO1A 3JUZA 3NACL 1KBVA 1RKRA 1F4YH 3V0FA 3MRMA 3QIBB 2J1YA 2J5LC 4GQ9L 1KIQA 1G7JA 4J3WA 4F93B 1YYLL 4F7CB 4HPOL 1QG3A 1W72L 3RL2A 3VE0B 4L5FE 3SPVA 1J11A 2GBAA 1XF4A 3GMNA 2R0WL 2P5WA 1VEMA 3W11D 3TURA 3G5WA 5HHOB 4JPIB 5IVXB 1A6TB 1MFAL 1FL5B 4DUWA 3MCLH 4OCRL 2F58H 2NR6A 2DM7A 4JKMA 2W38A 5BRQA 1FBIL 3JWNH 3WNOA 3L3JA 5IBUG 1QSZA 2VRKA 3ROLA 3II2A 3THML 2XWBB 1Q9WA 1GVIA 3DVGB 3QCVH 4MGXA 4NSKA 1S4IA 2ZOKB 4DO6A 4JFFE 3UGXA 4EUPA 4UV7H 1YEFL 3LB6D 5L2KE 5HHQB 2DWDA 2HKFH 3CVIH 3F7RA 2EVGA 3HMXL 2O93L 1EFXD 4ZXBA 3DX3A 1WWWX 3BQUB 3GSQA 1FAKT 3KYKL 5CN1A 3RY5A 1QOKA 2X1WL 3TFKD 1L9NA 2IH3B 3E7JA 3FQ2A 2UXTA 3IPEA 3TTSA 2VDKH 3ZKXC 4DEUA 4MQ7B 1WC7A 4G11A 5KBKA 3IFOB 1U93A 3LTVA 2O5YL 4NQED 2FD6H 3V4VH 2P5ED 3K8LA 5BZWA 1T1WA 2GUYA 3MUGB 4KKCC 2C3XA 1OHQA 2IPTH 3DX6A 4JO5A 1I8MA 3SYPA 2APSA 1T0MA 5TQ0L 1MXGA 2R1XB 4OU3A 3VXSD 3CZFA 5GS1A 3U4BH 4L0YA 2K45A 2V2XB 4PN6A 1M9SA 1SN2A 3IDMA 5I1GH 3PWPE 1GMIA 2OSWA 4ATTA 3BZ4B 2BSDA 5DLLA 1HWHB 2IBBA 1N3NB 4ODUA 4O02A 1O5DT 3MNZB 4HJGA 3GMOA 2G5UA 3QCTH 1JHTB 4OJFH 1DVQA 4I18B 4K7PH 4YJZL 4ZPVB 1IARB 1A6ZA 2Q2LA 1N2RA 2EKJA 2VJ8A 4WJKB 1I1FA 4JFVA 3HS0A 3NJIA 4Y19B 4AM0A 4PCTA 1HI6B 1HEHC 2E27L 1FPTL 3PABA 4UU9B 3UTQA 4CSZA 2I85A 1TSRA 1I1AC 3BGMA 4DVRL 2C4XA 1N70A 4BD4A 3FB8A 1Z3GL 1SEBA 3TCLB 4I3RL 2C7UB 1BIIA 2EJ1A 3CLEH 1F6AB 32C2B 4GBXB 4JL1A 2GJ6B 2ZPKL 3MNVA 2WO3B 4ZOCA 5HHVH 1SY6L 1DE4A 4E9LA 3MRPB 2NSXA 4G7YH 2RQEA 2VLJA 4F37F 1TTFA 2C9UA 2OQJA 3Q3GA 4XCNB 1AGCA 1NUNB 5D5MA 1XF5A 1HXKA 3AFLA 2KI6A 1SEQH 4XN4A 1INDH 2K9FB 5F72S 2YPVA 1XD0A 3IDGB 3VXRA 5FYKH 1TQCB 4LCIH 3RUGA 4P5MA 2D0GA 3H7BA 4JFHE 1MEXH 1QBMH 4GH7B 1KDJA 4XP6H 4NUQA 5HHPB 2PWEA 3MX0A 7PCYA 4EOWH 2BNRB 2AQRA 1YYCA 3KPNB 4RMTA 2YD3A 2YARA 3Q1EA 2IOOA 3IFNL 4U1LB 5C71A 3SD2A 3UZQA 1XMWA 2OYMA 4FMFA 4I87A 3WIIH 4U1MA 4UT6L 5DQJB 1E0OB 4QRBA 4XPGH 3D0AA 4L8BA 1HQ4A 1AS7A 5H2BA 3PYCA 1XF3B 3DJRA 4X8XA 4YGAB 3ZKMC 4HGMA 3SE4A 5FO7B 1X5JA 1FJ1A 5C1MB 3P3RA 5ID0A 5KVDH 2FL5A 2FT8A 3ZLQC 3EYOA 2Y7SA 2O61B 1XIWC 4KTYA 3ZKSD 3JV6B 1EFXB 2Q87A 4W68A 1PZUB 5F3HA 3BVXA 5C0GB 2AEWA 2WBXA 4HIHA 4YSPA 4EUPH 4Z5RA 2NY6D 3AT0A 4BKLB 1AO7D 2VT0A 4KX9A 4DVBA 4LEXH 3GB7A 1UEYA 4QGYA 4LCCB 2YPLA 3N5AA 4NQEB 4XOBA 3RJDA 2PCFB 2BY0A 2F9BT 5C7XH 2BSBA 3AACA 1N4XL 1Q0YH 1VZHA 4LCWD 3Q5TA 2CK2A 3QQ9D 4Z78B 1JNJA 4U1NA 4UM8B 5B39G 3VXSB 2C7FA 4HULB 4RFEB 3RI5F 4YO0B 4KU1A 4ABWA 3L6FB 1MW3A 4MBOA 2ZCKH 2DQFA 3MNWA 1F4YL 3KYOB 5FV2A 3OHXA 2YHGA 5GZOD 2AQ1A 3IXAA 1U4EA 3F3HA 4YFDB 1UWEH 3RP1A 1DSYA 1BPVA 1Q1JH 3E8VA 2J1ZA 4LB8A 2WVTA 3GMPB 3V4LA 2APXA 4DO4A 1SN5A 2VW4A 2GC4C 3ZT6A 2CXGA 1MXDA 3IS1X 4HKZB 4CKQA 3NCXA 4UT7H 3BO8B 5JMRA 5IR1A 3V0VA 2I32A 3DSNB 3MCLL 3TJPA 4YGVA 1NKRA 2V5MA 5EO1B 1AYRA 3MBXH 2WVSA 3B2DC 3I9AA 4EBQH 4XC1H 3TIDB 4NLAA 1KTKE 4IBLT 4Z7VE 2WVVA 4DAGH 3QCVL 3LIZL 5KYWA 4WENB 3Q0HA 2NQCA 3IDYB 4P9MH 1MJ8H 1ZJBA 2DB8A 4JRXE 2XN9E 1HL5A 2XQYG 4UV7L 2HKFL 3CVIL 3FU5A 3WEXA 1G0DA 4UOW0 4MZRA 3T0XA 5HHOE 1KLUB 4M7KH 5TJWK 3UG5A 1G7IB 4PWGA 2X2YA 4N9GA 1MG3C 3TL5A 3UTPE 1Q9LA 2H32A 2D7OA 1LDSA 2BSSB 2V6HA 2VDKL 1A4KA 2BJMH 3D18B 1CR9H 1OK8A 2XLLA 4OZFB 5G4MA 4Q8BA 4DP2X 1XXFC 4ZUVB 3KPRE 3TOPA 3R4RA 3NPSC 3LHPL 2ZP8A 1OWRM 4Y5XA 4MXVF 5CEXA 1AZBA 3P1VA 2X89A 1FUNA 3IB4A 2IPTL 4FQXC 1PMYA 4U1GB 5IQ9B 1J9QA 2UZXA 3CHSA 3RHWF 2AS5M 2XWRA 3DRTA 4X6CA 4JFDE 3TA3D 5KYUB 4R97C 4U05A 4O2CA 2NY6C 3U4BL 4OZIA 2BDNH 3SGKC 3T04D 1IM9A 4JDZA 3UC0H 1S7UB 3W82A 1I9IH 2ZOLB 5I1GL 3SZKC 1A7NH 3FUDA 1DDHB 4UTAA 3BIKA 43CAA 3QCTL 2XKNB 3WS6C 1R3HB 3NZHH 4OJFL 2CLRA 5MEQA 4K7PL 3VH8B 2BSTB 4JG0H 3AREC 1R5VA 4JREC 5GGVY 3EYFB 4ZMZA 3CZUB 3V6OE 5GGRB 2P52A 5C0IA 4DZ8A 2ESVA 4NBYB 2ZUVA 4X6BA 5AKVA 3KH4A 5FYJH 3NYKA 3EOAA 2XPZA 1AO7B 4GQQA 4NOBA 3X11A 4ZQKB 2Z93B 4FYSA 3AU1B 2CNZA 5D5MF 3CLEL 4MJ5A 1MFBL 1U8CB 5HHVL 3IJ8A 3EOBA 3OZKA 2CHXA 1ZHKA 3E2HC 4YL4A 4G7YL 3RNQB 2Y2WA 3RUGF 4CJ0A 3EIFA 4OLVH 2QLYA 4PJBB 3IJYB 1RJYA 4PBVC 1QP1A 4JDEA 4JB9H 1U91B 4LEBA 3PP3H 3BPNC 5D1ZC 5F1IB 3VDAA 1SEQL 2WVUA 1INDL 2UUDH 4XB3A 3APDA 4ONOA 4D0CA 5FYKL 2V0AA 1KJMA 2AJUH 1UB5A 1X5KA 1MEXL 1NLDH 1QBML 3VXNB 4PJFE 4NN6B 5BMFH 5BUAA 1NEPA 5MENE 1A4AA 4UDUB 2RTTA 4HUCA 1ASPA 3HZVA 3VB9A 4EOWL 3S97C 2Y3AA 1C16B 4GRWF 4KO9A 3DIVA 4WKZA 3X13B 1YMHB 3O2DA 3O4LE 1AD0B 1WISA 2XXMB 1H9DA 4LRIA 4IGBA 3NFPA 4MA1C 3FRPB 3D0VB 3EYQD 5KVGH 3P9WB 4XPGL 3BWZA 1YJDH 3L7FA 2BVEA 2B1OA 3MJ9A 3MOBH 4XNDA 3ZTNH 2CDFA 1NDGA 2NY1D 4OIFA 3FO1B 4R3SA 4XMPH 5SWZD 3EO9H 2ALWA 2DKMA 3HVNA 5KBPA 4H0IA 5HDBF 2BHYA 5KVDL 4PRPE 1NAMA 1JWUA 3VTMA 1EAPA 1CF1A 2VZ1A 3JYBA 4OCLC 4PRIB 3DHUA 3UEQA 2GBVA 1B6UA 1AGFB 2J1KA 3C6EA 3FUFA 3OKOA 3N0PB 2H4EA 1C08A 1Z9LA 4TULH 4E9QA 3QORD 2Y0SA 3NUKA 4LEXL 5GISH 5DZVA 1PYWA 4CC1A 1U42A 1DVTA 3UP6A 1EAQA 2Z64C 2H32H 5C7XL 1M1XB 5M7QA 3RWEB 1F2QA 1Q0YL 1SHXA 4I7ZC 1CBVH 5DJAB 2YGNA 3QWQB 2IQAB 4N1EA 3PQYD 5DS8B 1RZ7H 5C09A 4HZLA 3LN5B 3TA3B 1V3JA 2IPUG 3IPFA 5DEZA 3WTWA 2EH7H 3DI2B 1AY1L 2ZCKL 4K9EL 5BS0D 3TBBA 3TA4D 4AQAB 1QLFA 1RSYA 1BDYA 2J25A 1UWEL 1NH6A 3L3DA 4NZRH 1PJWA 3C8DA 1KBGH 5F7EL 4CL7A 1ZGLP 1U8OB 1HHIB 1JXDA 4KY2A 1VACB 4IEFA 4GW1A 5G4NA 3SE9H 2A2QT 1M7IA 4UT7L 4UTAH 2WWNA 4LSDA 4BK8A 3LNDA 3HC3L 1G9NC 1ITCA 3MBXL 5CSZA 4R96A 1E6JH 1TENA 4X42A 4XNZB 5HDWA 2H7WA 4QJ4B 4EBQL 1XHHA 2EXWD 1X44A 4XC1L 5IBTH 3ZHNA 4HWNA 2G2RA 3MXVH 4DAGL 1FVCB 4HMCA 2J6WA 3I6SA 1G9MH 2IWFA 2JKTM 3ROOA 5BOPA 4P9ML 1MJ8L 5AW0B 5ISZD 1URIA 1A64A 2A74A 2ZWZA 1UT2A 2Y72A 5INDB 3QK0A 2COQA 4DHLA 4M7KL 2J20A 3BCDA 2GK0B 4OVVA 1YEDA 2YAEA 1J1XH 1S7WB 1QFUL 2GUOB 2MQ3A 4MHHI 1T89C 2BJML 3CVBA 1CR9L 4PGCA 3WMPA 1B0IA 1V5JA 3TC9A 5T1LB 1ETA1 4X6CF 5FKAA 4OZIF 3QNYB 4KZEL 3DURA 1CURA 3KLHC 2XZZA 1LP9A 1NKOA 4OT1H 4WTXA 1G7LA 4Q97A 3D39E 1W6WA 4U31A 4QHLB 5IJKC 4QO1A 3HAEB 5AYTA 3MFFA 4C56E 1I1RA 1Y18A 2OA9A 2ZOUA 4PREA 5KANI 2ATPB 5TGBA 2BDNL 4BCXA 3KL3A 5B4MC 3SPCA 3UC0L 3IDJB 1I9IL 4C57C 4M4RB 1ZA6A 2NY1B 1A7NL 3O2DH 1E5UI 5DC2A 5SWZB 1HHKB 2BRQA 4KRPC 2KZBA 3IJHA 1JPFA 2GVYA 3G6JA 3T4AB 2J56A 4NC2B 5I0XA 4HC1H 2KMWA 3FONB 4EN3D 5T3XH 3REWA 3WAKA 2DM4A 3TO4A 2XCMC 2NY4D 3X14B 3LEXA 4K73A 5FYJL 1NAMH 2V9RA 3CSYB 2DLHA 1XGUB 4QXWA 4F7TA 2PLTA 4OIIH 3KH3A 4RSYA 4IJ3C 5A6LA 5AB1A 3UPAA 2R39A 3S4SG 4L3AA 3LV3A 3KPQA 1I8IB 2ZUSA 1WT5C 3VGAC 4OZ4B 4APQD 2E4TA 3PQYB 4OLVL 2XWXA 4H44C 1JZJA 4JB9L 5DMYA 3QDJB 2J8OA 1N7MH 1MUJA 4F8TA 4LO9A 2JJUA 3MAWA 4XZ4A 1BBJB 1ZHBA 4ZUSA 5F21B 2G60L 3CX2A 5BS0B 8FABA 3BP6A 1U41A 4UUJA 2BP5M 2AJUL 2X70B 2B2XH 3LRKA 2EH8H 1QD0A 2R0LH 5H4ZA 1NLDL 4ZNCD 1AG0A 5BMFL 1BD2D 3OL2A 4ONHA 5TDOB 3GSXB 3H2PA 1K85A 2QVTA 4ODVH 2UXGA 4PHXA 5C97A 1U8NA 1SLVA 3CPLA 4DFHA 3T2NH 1E5CA 2GIYA 4UOW1 4XXDA 4JGMA 5AVYB 1I7RA 5JIMA 4P4KD 5KN5B 5KVGL 1YJDL 4HT1H 1EEZA 2NX5D 3MOBL 5A40E 4EDXB 2ERJB 2B1AH 5C7ZA 1TYEB 3IRZA 4JHBA 2Q76A 3Q8CA 2KHAA 4YE0A 2X9ZA 5CU5A 1FNFA 3ZTNL 3SCMA 2V4LA 4XMPL 3CZGA 3EO9L 4LMQI 4A2HA 3JTBA 1GXEA 3DX4A 5DS1A 1I31A 1G5GA 2BS71 4N2AA 3JYCA 4PSRA 3WKPA 2YJQA 1PLCA 4JR9H 2QQNH 1FCGA 5F3BB 2H0JA 5CMAA 1KPVA 2AP2A 1IGCL 4TOYH 2R15A 5AW2B 4OCNC 4PYHA 2XT1B 3LH8A 5HSFA 2VWEC 3KPPA 4XNMB 5EU6D 4TULL 2D0HA 1CQYA 3AQYA 1FSKB 4N68A 4YHZH 5GISL 5EBGA 5AB0A 2AABL 5CLTA 5SWSE 1JZ5A 1WS7A 5I82A 1Q9KA 4HVBA 2E7HA 4KRNA 1CBVL 4U7MA 5D7IA 2NY4C 4XCEB 1UA3A 3MODH 5JQIB 1X7QB 3JTSA 3KLAA 4NRZA 5AL0A 2A77L 3D2UD 2BO0A 2EIEA 5L7XH 3ABKB 2EH7L 1P7QB 3BISA 1K4DB 4GIPD 3AY2A 2X0WA 2ARJB 4APXA 4FI6A 3SB3A 4S0SD 1QVOB 4NUJA 3FFCD 2YAOA 1E8XA 1N59A 5PCYA 3IGAA 3CCHA 2WQRA 1CICA 4K3GA 4NZRL 4U1SB 2VDLL 1S78C 4RDQG 3BAJA 1KBGL 1YNLH 3GZOA 1TEGA 5CZXD 4YR6A 4HIEA 5F6IC 3DO7B 4CVXA 1GS7A 5D1ZI 3DHJA 3KW7A 4EN3B 2X9YA 1DJGA 3PGFL 2Q8BH 3SE9L 4C59B 1IC5H 2HLEB 4A7UA 3BRGC 1KN4H 4LARH 5BQ7B 3RIFF 4GAYB 3PIQA 3S5LA 3FZUD 4CAGA 2GJJA 1KPUB 2ZX9A 4EIBA 2QPEB 4GY4A 3U0WH 1E6JL 1SYSA 3P3SA 2FJSA 3HG1E 5IBTL 4JPWH 1PQZA 3T0EA 5AB2A 1J9CT 1MW1A 3MXVL 4FXLA 3RBGA 4LLVB 1EMTH 1MLCA 3VWJA 3EXJA 4W9JC 3N41F 1G9ML 2BSED 2YSSA 1JZ6A 1BW8A 1M53A 2JFCA 4HSAC 1AKJD 4PRBB 2QV2A 4APQB 1FN4B 3ZE2E 2G75B 4P4KC 4X4YB 2Q20A 2LLLA 3D5OF 4N28A 4GG6E 3QC6X 2A6IB 3GGWB 1A6WH 3QAZB 3CN1A 5BVJB 3MRJA 1LP9F 2ALAA 4BFOA 2BIMA 4PTUB 3S37H 2OX5B 4HS3A 3MRHA 2XG5A 2RIKA 4RMQA 4YC2C 2RACA 3HJEA 4OT1L 4Y16A 3U79A 1EEQA 2Y5QA 1HE8A 4OLYH 5IV2B 1J05B 2V33A 4XN7A 5FWRA 3H54A 2WCPA 2AZAA 2UZYB 2UYLB 3V9FA 4I77H 4UIMB 1ZGLA 3G6JF 2VITB 2ZQKA 3OG4B 5TK4A 3WN5A 4PUBH 1YC8A 4YDLB 3QG6B 3APMA 4HIJA 1CL7I 5GHWH 3V5HB 3S5ZA 3O2DL 2HG5A 3SOTA 3BKYH 1J5OH 1WIUA 3PCYA 3FYEB 3GZKA 3QUMA 2WKLA 1DUYB 4HC1L 4PLJD 2KS0A 4MNHA 4QRPA 5AAMA 1HEZA 5T3XL 2YXVA 3IE4A 4XBEH 4QF1A 3T0VA 3PPEA 1TVBB 3LX9A 3SQRA 2PXYD 5DJ8A 3A21A 4KITB 4ZS7H 5KWYC 1NAML 4UQ3A 5EU6B 1U21A 1R24B 5E00B 3E6FB 3PXJA 3NA4A 1MI5E 4OIIL 3U36B 4MD5A 3PF2A 3B1TA 4LIQE 1JSYA 1F58H 3MPCA 3P69A 1IUZA 1D9KB 4HIIA 5T5FA 3BAEL 3I74A 3HHMA 4G9DB 4A6YA 5DJXB 1TO4A 5J1AA 1OP3K 3RVXD 4AV5A 1TTUA 3D2UB 1N7ML 1CXKA 1BFSA 3S3DB 2KT6A 2XPGA 3DMMD 2D4FA 3UTTB 3FFCB 5D7KE 3UJTH 2P8LB 2B08A 2B2XL 1VENA 2EH8L 2R0LL 3WL9B 4GUPB 5FLUA 3CFKB 3LPPA 2LU5A 4BFGA 4DP9X 4JFQA 3U1QA 1D6VH 3OTTA 4IQHA 5EMYA 3RWFB 3O45A 4KXZH 4N8VB 4ODVL 4A7QA 4AMKH 2HVJB 2UY7A 3CFBA 3P73B 5IFHH 3T2NL 2OP4H 1NA8A 3LKOA 3AUWB 3SDCD 5C8JB 4BINA 5ETUA 5IB3A 1OTTC 1XWVA 4HT1L 2KBGA 3ZGIA 2B1AL 3X1BA 2X10A 3B1UA 3EJPA 1SMDA 3ZIMA 3R8BB 5BQDA 3F7YA 1WJ3A 3W1ZA 5JW5A 3FT3B 2YD8A 4G3YH 2HN7B 2J8UA 1AKJB 3G6DH 4JR9L 1MCSA 2HLFC 4X6EB 2R1WB 3EXLA 4N8CH 1OGAE 4U2YA 2BFVL 4N8UA 4PJGB 4TOYL 5JDSA 4NZTH 3VXMB 2ARJQ 3UH8A 2BVQB 3CMOH 5D7IF 1BAWA 3QFGA 3VFUB 4Z3JA 2F54E 4YHZL 3K2IA 1AQKL 2VLKE 2J57A 4PAZA 4PLJC 3L3IA 5HXMA 1RAMA 1ZA3B 4AYEC 1T21A 3MRBB 5F44A 4J3XA 5E9DA 5EWIH 4YHPA 4W4OA 4JY5H 4OUUB 5IW6B 2W8CA 2XWZA 4ZFFA 2HH0L 5L7XL 1TR7A 2YKKA 4XTRC 1F02I 4LHUA 3OJDA 1PG7H 4PGZA 4IKKA 4FHBD 2NY2D 2MOVA 3QFDB 1GR7A 4K8RD 4JPKH 3EOYG 2F1EA 2FK9A 4KV5E 4ORGB 1YNLL 2FEDD 5EBWA 1QFOA 3RVXC 3VNZA 5C0CA 3QO1B 3ULSB 4WTZA 4F5CA 2Q8BL 4H26A 3SDDA 3FOLA 1FFOB 1IC5L 2PXYB 2LVCA 3DMMC 3HG0A 3QNZB 4LARL 5DFAA 4KQ0A 4NNYA 4N87A 1EHLL 3GC3A 2XBZA 3UBHA 4PY8J 2FQEA 3U0WL 3ESNA 1ASQA 2H6PA 2L4OA 4JPWL 4AUYA 1CTOA 1KTDA 1YMME 2DYRB 2X3AA 3FT2B 1NGQH 1YEHH 3JV5A 4M1GH 2VM4A 3TFBA 4QDGA 1ANUA 1OGPA 4I0KA 2YXMA 4XWOC 3B8SA 3K7UA 2ADGA 5SV3A 4NNXB 5C92A 1PIFA 4JZJA 3ULAB 2CSPA 1UWGH 3FFDB 3APCA 3BH4A 4DUVA 2XA8H 4Y2DD 4MCZB 1A6WL 3EYUH 2EEAA 5KVMC 3LKSA 2PTTA 1KBWA 2EEBA 1NQBA 2J5WA 2G5BA 3S37L 3CUPA 1E4KA 3QUYC 3L9BA 5EA0H 4BFFA 1TFPA 4WJ5A 1FIEA 3U4KA 4YN3A 5AVWB 2PR9A 1ETZA 3G7TA 4WW2C 3FXIC 4OM0L 4OLYL 2Q86B 2E7BA 4JFED 5DHYA 2QMKA 4I77L 4AITA 2BVOB 3SDCB 4AH2B 1V7NH 1L9SA 4XMUA 3DX2A 1NCBH 1IC4H 2WPGA 2WINB 3QDGE 3PGCB 3ARDB 4GYBA 1IFHH 2WMPA 3PUUA 3ARVA 3DX8B 1RZKL 2WLMA 5F9OH 3BKYL 4D8PB 5DEJA 1CDHA 2ENJA 2C1PA 3MV11 2PABA 3NT0A 2N59A 5IROC 4WF7A 1G9EA 5D7LB 5JR1H 2J3SA 2MNJB 3N42F 3HHSA 5JIPA 5DHDA 1T3FA 1UOWA 3GXIA 4J3VA 4F24A 4ZS7L 5ABDE 2I9LB 5EO0B 3BZEB 2GHZA 3U7YL 3FT9A 1IAOB 3NP4A 3PWLB 3AWGA 3WENA 1UFGA 2Z7YA 3HHRB 1F58L 3CH8A 3HPJA 3FQRB 2C9VA 1NGZA 3DX7A 1DEEB 4KI1A 1JGVH 1F6FB 3MYZA 4IKLA 4JM2D 3H9SE 5FGCB 1PNCA 4NQDA 3C6LA 1T4KB 1DSWA 4PRHA 1ZIBA 3T08A 2BIHA 1ED3A 4AYFB 4ILDA 4Y4HD 3ZUNC 4N3TA 3VO0A 3UJTL 1AC6A 5DFWH 4IHOB 3OAYH 1FFPA 5HGHB 4JRYA 5AL8A 1T2JA 1D6VL 4AMKL 1WTLA 4ZO6A 5J6HB 2X4QB 3GXPA 4AI7A 4OFKA 1UXSB 1HX0A 3QJFA 5IFHL 4QYAA 2DKSA 3MRRB 2A9MH 4Y2DC 5MHSD 2OP4L 5TD4A 2G3ZA 2JB6B 3VFSA 1S7XA 2XWJB 4NUGH 1J0KA 2WO4A 2IANE 2EKSB 5ESQA 3UTTE 2J8UF 4H88L 1UC6A 2ZXEB 1N6UA 4YWGH 5LCVA 1T0PB 3ZKNC 4DF9A 1WCQA 1PFCA 4ANVA 3F00A 1ZRUA 2ENSA 2G2PA 3GKZA 4WUUB 1HH6A 1MF2H 2X2HA 4XO5A 3MGTB 3QQ3A 4G3YL 5FDYA 1XTMA 3G6DL 1EZLA 2E9WA 5DK0A 3UZVA 2F53E 1UOLA 2C4FT 5ERWB 4G8IA 1Q4NX 3KXFD 1BQ5A 3MV7A 4WO4B 3CMOL 2VC2B 3D3VD 4R7XA 3ML8A 2GJRA 3BEVA 4PR5A 4UYPA 4GAFB 4UNTA 4D9LH 1X5YA 1A4JB 3NQIA 3IMBA 4F33A 3F6JA 1BVNP 4HEPG 2H3NB 3T3MF 4PCKA 3E38A 3WFEH 1MPAL 5EWIL 2DI8A 2OMYB 1JZ2A 2MNUA 5EZIH 1ORSA 3NESA 5C08E 4BK4A 2NLJA 2ZYSA 4HWZB 5IB1A 2WWMC 5C07E 1PG7L 3HNTH 4V1DD 3AWEA 1MHPH 2GI0A 3IU3B 1TJIH 5C0JB 1IGIH 2VJXA 4Z3IA 2QVKA 1FF5A 4JPKL 4NENB 4G6FB 1OSEA 2H1PH 2PWHA 1GC1C 2NMSA 3E0GA 2VLRB 2BHFA 3GIZH 3OKNA 1ZVSB 3FTSA 4I1NB 2P24B 1MVUA 2XI9A 4I2XE 1U0QA 3QEQA 4YFLI 4AKQA 3EADA 3QJQB 3M1OA 5H4YA 4WGVB 1U92A 1TJGH 4OVUA 2BERA 3V5DB 5I8OH 3L3KB 4L4VB 4NN7B 2XZAL 5L9DH 5TE7H 1BMZA 4N2NA 1GYVA 1YDPA 4NOFA 4ZNEA 4IU2A 5EB9A 1XGPB 2IWGA 3VX0A 1NCDH 4M5SA 2XG4B 1RZJH 2VH5H 3RVTD 1NGQL 1YEHL 3B43A 4M1GL 4W9ZA 3S48A 5DRWA 4ACTA 3K1KC 3OPZH 3WI9A 3VA2C 4N25A 2OMVB 2H5UA 1R5IA 2A73B 3O3DB 1GZQB 3B3IA 5DVKA 2LFGA 4NQCD 5GS2H 2Z1PA 4JM2B 1UWGL 2XA8L 1CVRA 4ZMNA 4R7LA 1JPTL 4QOKE 4L1BA 3EYUL 2DQEH 1E9QB 3NRPA 4QCIA 2CALA 3O41B 5E70A 3V9CA 1DYZA 5L4MA 3ZDYB 3KS0J 2CBMA 4U0QB 4YFEA 3M7OA 5EA0L 1PAMA 2A3TA 4UQIM 1KB5A 4WFED 5KBNC 1I82A 5KVFH 1OW0C 1BQRA 3D05A 5D1QA 5LAXB 5KJ7E 5EEVA 1S9XB 1PZ5A 3EF4A 1DBBH 4X5WA 2Y22A 4I48A 5E8EB 5TH2B 3WU1A 3D8MA 2EQDA 4UT9H 3QJHB 1XXDC 4NKDA 4NFCA 2ZWYA 1V7NL 5MI0B 5I6NA 4PJ8C 3ILEA 5JXEA 1IC4L 2N0MA 1IFHL 5F9OL 4GS7B 1SJHB 3O8XB 5KSUA 3B56A 4DZBA 3ZYIA 1D5MB 3K6DA 5FS5A 5F1NA 1ULVA 2Q7NA 1FC1A 1HZHH 2FSEA 5CZXC 7PAZA 1AHKA 1AP2A 5LCVH 5JR1L 2CHWA 3IU4H 4M43L 3ORJA 5K9OA 2WIMA 2CQVA 1BJ1H 2WUBH 3AQXA 4JFYB 2FT7A 4DP6X 3L5WA 3QDHA 3L3OB 3D3VB 5GRXG 4WWKA 3ETTA 1MJ7H 3DNKA 1CIUA 3DHPA 4W9GC 4DP4X 1A3RH 3WJMA 1MFCH 2X4RA 4A68A 4NI6A 1LEKB 1JGVL 2WSDA 2R8SH 3GJFK 1BG9A 2A7BA 3TVMB 4E5XA 3HLAB 4MMXC 2VOTA 4AEEA 3T65B 5ADOH 4DCQB 2YQ3A 3BMVA 2VISA 4Z7UE 2CKBA 1KXTA 2BHZA 5D1XA 4V1DB 2OL3B 4OD2B 2D31A 5IMKB 4PSPA 4MRBA 3PWNB 2FVNA 1D7FA 1EDQA 1G1YA 3CFEB 3CFDA 4H8WH 4WSJA 1WBYB 5FO2A 4NCC1 1RV6X 1OAYH 2BXZA 3P0YL 1T04B 4HMDA 2PCPB 4OZFG 1T5XA 2AJZB 2A9ML 4CNIA 1X5GA 1OD7A 4JRWA 2WLHA 4JPVH 1RIUH 1QHQA 2ADIB 4NUGL 1QNZH 5IB2A 1KZQA 2CJTA 4FKHA 1W15A 1OB1A 1ONQA 3GSVB 3BQVA 4YWGL 4QTFA 1INQA 5EU7E 2E6QA 4BRJA 4XMVA 3WO4C 3DVFA 3O81A 4MCNA 4M93B 5D4IA 4RBPK 1MF2L 5MERA 3L9EA 4GO8A 4B97A 3HFMH 3AZUA 4QRQB 5EN2A 1WFTA 1QRND 1XSKA 5EIIB 5DUBB 1A2YA 5CEZH 4FQJL 1NUDA 2V7NA 3MROB 4PJ5B 1RP8A 4FNLH 4BYHA 1FG9C 4P2RD 3GJFB 3L9RB 2ZSWB 4N5EC 3W5NA 2IADB 2ICWA 2R56L 3OB8A 4WFHE 2H26B 5D7HA 4E9YA 4D9LL 4YHLH 4FGMA 3F5WA 5GGTA 4PHZA 1SJEA 4WUUE 4BH8B 3MRNB 3WFEL 3AVEA 4PJ9A 4JFFA 5JPNA 3S8WA 1PZSA 4NO2A 5L2KA 4WNQB 4PY7A 3NCMA 4M7LL 3QXDA 2E7MA 4K5NA 4XCCH 5B3SB 5EZIL 1KB5H 1TTRA 3BVUA 2VNCA 2FGWH 1FH5H 3BWAA 4JG1L 3HNTL 1XBDA 5IEHA 1MHPL 1YECH 2ZKWA 1IGIL 3HUJB 3GMRA 4OF6A 1NCJA 3QHTC 2X7LB 4NO5A 5E0QA 2BVUA 2QGBA 1SHSA 2M2DA 1RHHA 3RFZC 5F7AA 5I1CH 3DX0A 3VXTB 2H1PL 2HJLB 3GIZL 3VTAA 3GLEA 5HY9B 3CDYA 2FR4A 3GT6A 4WI4A 3WXVL 1NFDB 1XH3B 2CIIA 4Z7NB 3WFHA 3B8YA 5FECB 4I4WB 4P23D 2AERT 2CBTA 4PJCE 1YEGH 5TQ2H 5GGQH 2C1OB 1L0XA 3BPOC 3P77A 4MX7B 5JYMA 5KZCD 3GDCA 4V11A 1NSNH 5L9DL 5TE7L 4AYBA 4TLTA 1NCDL 3BZFA 3PWPA 1RZJL 2VH5L 5EDSA 3BP7A 5CWSB 4BQCA 3UG4A 1S7SA 3FRPG 4CC4A 3OPZL 3O3BA 3HS8A 1FYTB 2KUTA 2VLRE 3K2KA 3RX8A 3VYOA 4BH7A 2ZTBA 1NL0L 4X6DE 5EZLB 2FIKA 2AQ2A 2Y9RT 1CFNA 4TVPH 4KKAD 3FQ4A 2FUTA 1F45A 4JG5A 3OC8A 1C7TA 3D30A 1EERB 2F68X 2ZCHH 2DQEL 4FQHA 4L4VE 4RMVA 4OFQA 1KV7A 1WFIA 4EIGB 2VDMB 2R4SH 5DC9B 1IEAA 4UQ2B 5CD3B 3H0TB 3ILPB 4PVNA 3TP4A 5KVFL 2B8OT 4MASA 4TM9A 2LR4A 2NY0D 4PV9A 4KI5E 5DTFB 1A4CA 3E3QC 3DXAD 3SGEH 5KS9B 1FLTX 2V3FA 4UT9L 3EFFB 3PHQB 3U2SB 2J5LB 4HK3J 3DTUB 4N22A 5IFJB 1SFHA 1UH3A 1FFNB 4HCRL 3SO3B 4PJHE 1G7MA 2EEDA 1YY9D 4RAUB 1HXMA 2AJVH 4QY8B 1QATA 4WK2B 3LKQA 4L29A 1A6AA 3ULUH 7CGTA 1HL4A 2L04A 5CSGA 2HFEA 3ME0A 4H13C 3K8KA 5DWUH 3P4OB 4J3OD 1ZVHA 4XH2B 4OF0A 4QRFA 4NAQA 1HZHL 4DN3H 4E41D 5F88A 3C75A 4W81A 3F64A 4G8FA 1EWHA 4EF3A 2YN3A 4H5SA 4PJIB 2NCEA 1C5BH 4M8VA 2WUBL 4H25A 4MRCA 5IGXH 3VD2A 1HZKA 4DW2H 3DWTA 3ZDZB 3PAYA 1ACYH 1MJ7L 3VXOB 3IAQA 5J89A 1DVFB 3VRJB 1A3RL 1N8ZA 2JELH 4MCMA 2AMUA 4G7SB 4G59C 1MFCL 4OH2A 4PGBB 2E8ZA 4FNQA 1M7DA 4P23C 3MZTA 4PJAB 4RGND 1AZZC 1IX2A 4FLQA 2R8SL 2CCLA 3Q2NA 3GHPA 3LZPA 5DQDH 2WN2A 4PJ7E 1YN7A 5ADOL 2A4ZA 2F1AA 8CGTA 1F3DJ 4LKCA 4U2ZA 4A55A 5JO5B 3H6JA 4AT6A 4JO3H 4OD1H 5SV4A 4TF4A 1QLRB 1ZS2A 5I74C 2FNWA 2GTWA 1AANA 1BREA 2MPVA 3PWVB 4XX1E 3ULUF 3GBLA 4H8WL 5D96C 1EHNA 4AYGA 1YZZA 4FG4A 1EJOL 4X99A 1OAYL 1RY7B 2Q8AH 1JNLH 2BCMA 5HPMB 4EZMA 5HYFA 4NCDA 2PTUA 1PVHA 2YMOA 5BRPA 1RMFL 4JPVL 1RIUL 1Z5YD 1QNZL 2Q7AA 5KZCB 3CDZB 2FSDA 4GFXA 5HHMB 1CE6B 5H94A 4DGUA 2P1YA 5JXAH 4KO7A 1CG9A 3HAEG 1IAII 1TJHH 1JK8A 1JYVA 2Y1YA 5EF2A 5LBSA 3EGSA 4F9PA 4Z7OE 1MHCB 2RFXA 2NY5C 1YNTA 2QPFA 4U6YA 4LGRB 1D5RA 3M46A 3HFML 3WFDH 2DWEB 4X80H 1WSST 2BIOA 4NXKA 1U2CA 1OAQH 4NM8H 5E51A 2XWTA 2XN1A 5DUMH 5CEZL 3LVTA 3FAWA 4FXKC 4MCYA 1NIEA 4FNLL 4AW4A 4CVZA 1G6RA 1KYOK 1G7QB 4ZW7A 3ZDXF 3NCBB 2D3LA 1E30A 2LABA 2QEJA 4YHLL 2G9HA 2H0EA 4Z7VA 4JRLA 1MNNA 2NY0B 3NDYE 2OMWB 3DXAB 3VI4F 4AC4A 2C4FU 5F9AC 2ZUWA 4JRXA 2XN9A 4HKXB 3IJSA 2XWCA 1FNSH 4XCCL 1VJSA 4ZMYA 1KB5L 1YN6B 1BVNT 2CJ3A 2GJZB 1JV2A 2FGWL 2ZNWA 1FH5L 4JPIA 1S5HA 5HHOA 1A6TA 5EF0A 5MP6H 1GAFH 1FL5A 1KYOJ 4PJ5E 2E3VA 1JUFA 3AY4C 1YECL 3Q7JA 3WKQA 1QSFE 4CC0A 2G4GA 1AXTH 1R3LB 1XH1A 2WNGA 3KPRA 1ZV2A 3Q6GH 4PJEB 5F7FA 3MXWH 2ZOKA 1JYXA 3L95B 1YEGL 1P4IH 4RH4A 3QUXD 5GGQL 3UTZB 3RX5A 3MRGB 3UEZA 3NCYS 1NSNL 1QQDA 5GSVA 2KPWA 2VXSH 1HXYB 4NWUH 5LDSA 3VFPA 3K4ZA 1O7DC 1UEMA 1T7XA 4QXUH 2BP8A 4LVHC 3VA6A 2JIXB 1W72B 2FWLB 4EE2A 4B3VA 4U1HB 1IC1A 5C0AD 3WFBH 4RGNB 4Z7NE 2EYTB 5KAQF 3GSOB 1RZFH 4TVPL 3MUGA 3OR6B 1CGUA 3FT1A 3DOSB 5G5DB 2CLZA 3AGVA 1UH4A 4NRXA 1MVFA 3B7RL 2ZCHL 1VA9A 3JZ7A 5J6SA 4NWTH 2OMZB 3FQNB 1KJ3L 3MNMA 4YDZA 1VKXB 1PEZA 4Q6IB 2R4SL 2I25N 1T83A 3BZ4A 5E6SB 3BJ91 2UZPA 4XXWA 3L1OH 5DVPA 1FYTE 1R47A 3NSJA 5F7YC 1EBPA 4P9HH 3IXTB 5C0FB 3ULVC 4I18A 4F8NA 1WPCA 4XGZB 5AVVB 2YBRB 3AU0A 3FJTA 2QKIC 4Y5VA 5E6IC 1QAWA 3REVA 5E7BA 5DSCB 1BQKA 2FWUA 3MV8E 1OB0A 3FQXA 3P3TA 2AJVL 5IHWA 2EVFA 5D2LB 4HDIA 2Q10A 3C5JA 3G5VA 3CN4A 4KAQH 3TCLA 1AIFB 3SDXB 2DTSA 1M1SA 4PJFA 1OE1A 1MHEA 2FX8H 3Q9QA 5T3ZL 1NLBH 3NN8A 4AW7A 5MENA 3L7EA 1JFHA 4DERA 1UKTA 2VLLA 2DI9A 5KS9E 3WNIA 1TZAA 2O26U 4QTIL 4FG6D 5LBSH 1J12A 3O4LA 4RRPA 1C5BL 1XF2A 2JV6A 4JKKA 2VR3A 2WZPD 5DRXB 3KE0A 5IGXL 4DW2L 1HNFA 2OMXB 4L3CA 4MXWL 4ZAKB 5DFTA 1ZTXH 3GBNH 1ACYL 3HB3D 5I0VA 2JE8A 4QAMB 1KGCE 1FO0H 1T1XB 2H2SD 2WXPA 1TMCB 4Y4KC 5IG7B 4B9KC 2JELL 2JCWA 3MSPA 4POZC 5IT2L 2A9CA 4PRPA 3QUXC 3BRDA 2YKLH 5B1JA 5DQDL 1HVXA 4GSDH 2CUIA 4U1LA 5BJTA 5GQBA 3P40A 1VRSA 2ZUUA 3OG6B 3NPSB 3PXHA 3W38A 1KXHA 5CCKH 4LCYB 4JO3L 3I75B 2FCBA 5D7JC 5T33H 4OD1L 3BUDA 1ZWIA 3BD3A 5EU4B 4FQXB 1CCZA 3ZX1A 3RDTD 3SKJH 1OM9A 1URLA 4OCYH 5I6PA 4LLQA 2J72A 4HBCL 3BWUC 1IL1A 4KXBA 5FO7A 5EUKA 3HCVA 2Q8AL 3AW5A 4ELME 3UAJD 3EJZC 4PJAE 1IC7H 1QUNB 1VPOH 4GLRH 4H2CA 3L8QA 4ATWA 3JV6A 1Z5HA 3O6FD 3GFUA 1JGDB 4GO9A 5D72H 1YNTF 2YXWA 2Z7WA 1AXSA 3GXTA 4MJIE 3AREB 5JXAL 4OB5H 4K9JA 4BDVA 5F7BA 1IZKA 4AEHH 5CUSH 4CMHC 3ZZQA 2NPLX 4NAMA 3RNKA 3ZHFA 5I9QC 4HS6B 3B9KC 3WFDL 3ZMEA 4L3EE 4X80L 4ZW6A 4LNRA 1OAQL 4NM8L 1JDAA 2K7QA 5DUML 1IGJA 4Z7VF 5ICXA 3F7VB 3QQDB 3MRQB 4I3SH 1HHJB 1PKQB 1CD1A 1OT1A 2ZYHA 4AQ8C 4Z18A 4OI9A 2W0PA 3GSNB 5CZVH 3GK8H 1M71B 3PHOB 3TPKA 3LMJH 1OAUH 2JLLA 2WIIA 3IJEB 3KYOA 3MA7B 4HUUB 4JKPH 3BESR 2EO7A 5D1ZB 3BPNB 1CYXA 5IVXF 3X17A 3LRGA 5CJQH 3ZOAA 3QG7H 3AWFA 3GMPA 1TZIA 3DK2A 2EACA 5HI3D 3MJ8B 4FG6C 2PN5A 3C8HA 3S3CB 1DR9A 5C70A 1FNSL 2JI2A 3ABGA 3FQTA 1JF6A 4ODTH 4CMMA 1D6EB 1GKOA 1JI2A 2YA1A 4P5TA 3MDJA 4GUOA 3DSNA 3HB3C 3D34A 4JQVC 5G4OA 2HB0A 4R7NA 3TIDA 5IB5A 1AXTL 5DS2A 1JK9B 1WBZB 2ITEA 3E6HA 3R0NA 3DX1A 4WU5A 3UACA 3WNJA 3Q6GL 4P57A 3MXWL 4IKIA 5IREA 3MV9B 2WNKA 2O61A 3D39A 4G82A 1P4IL 1ZT7A 3VYPA 4BE6A 1AR2A 2EDNA 4HLZH 1ACZA 3JWNC 3EYVA 3KDMA 4N8VG 1BLIA 3TNNB 1KLUA 3GSRA 5DI8A 3UXFA 4C56A 2VXSL 4TQHA 5FYKD 4NWUL 4I1PA 3GMLA 3GXNA 3R7RA 5M95B 1S9KC 1U8MB 2BSSA 4YDKH 1EHAA 1R5WB 2N7BA 3HZKB 4QXUL 1QSVA 4DPBX 3QUZA 2DM2A 2BINA 2YUXA 4F1SA 4UOJA 1RZFL 1MH5B 1LVEA 4KKPA 3N1PC 4FXGC 5D93B 4IRSD 1OCOB 2X2UA 1IGMH 1UGKA 3OXRA 1ZOXA 5HYJE 4NWTL 2TSBA 1U8IA 2P5WD 3H9ZA 1OSZB 3HI1B 1ADWA 3TWCL 2PMZA 4KPHL 3RDTB 1DANT 4F57L 3A67H 5AW3B 4F2MB 2Q5BA 3BYYA 2NR6D 4L4TB 5ALBH 5FO8A 2JI3A 3L1OL 4KKLC 2K3HA 3DX9A 3ZTJG 4QNPF 2HJFB 4P9HL 4FXTA 3G9AB 3CSPA 3K91A 3VH8A 5BZZA 3LRSA 4H0LC 4R26H 1BYNA 4PBWD 5I17A 1GL4B 5GGRA 5KSVA 1CD9B 3O6FB 4PJFF 3NJVA 4MNQB 1H6UA 1PNDA 4ZXBD 5E23A 3GWJA 3BP5B 4H2AA 4NN5B 3V4VB 4HK0B 2FX8L 1DFBH 1NLBL 4GIOA 2JJSC 1JNHB 1VFUA 2OW6A 5FCSH 4LP5A 3H3PH 1KXVC 3RWJB 3CD4A 4B5EA 2MCPH 2F74A 5DYFA 3VAEA 3ZQWA 1LTXA 4E42A 3QRGH 2JJTA 5LBSL 1P4BH 5B8CB 4R4BB 1WCBA 3IDNA 5LB1A 4JANB 1C5CL 1ZTXL 3GBNL 2LU3A 2NQ3A 1FO0L 2AAVA 4GAAA 3SPIA 2E56A 4PRNB 4Q0XH 1LO0L 3EJSA 1S7RA 4UDUA 1PZBA 1LO5A 2ZF8A 2X0VA 2YD6A 1C16A 2YKLL 3UBXA 1HAUA 4GSDL 3HRZC 1ZEAH 3FYIB 3X13A 1DP0A 4HHGA 3TBYA 1RUQH 3COOA 4D9RE 5CCKL 5T33L 2LGNA 3CSGA 4HOZA 1S46A 4OD3L 2FJGA 3SHSA 4OCYL 4R7VA 3JVGA 2NSMA 1GW6A 4IMLB 2VZOA 5SWSA 1WRFA 3V95A 4JFOB 1IC7L 4IRSC 4LSRH 3RX7A 1UD3A 5J3HD 1VPOL 4M6AA 3EBIA 2Y24A 1ZV9A 5LKNA 1AMXA 1X9RA 3B5HA 3IKCB 1MOEA 1AGEA 1E6OH 5H35A 1GSKA 2VLJD 4MAYC 5D72L 4I9XA 4OB5L 2VDPH 4KDTA 4AEHL 5CUSL 5EIVA 4L8DA 2A6DA 3AG4B 2AANA 3MYJB 4O5LH 3ZW3A 3RWGA 4YXHH 2WJ7A 3VXRD 3MRMB 1FHNA 1MRCH 2FATH 3QIUA 1KIQB 1G7JB 3RBSA 3RWEA 2BLFA 2WQ8A 4JJOA 5C9JA 4OZFH 3EO1A 1C1EH 4UOQA 4Y4FC 5E2UH 5I8EA 1XGRA 3RL2B 1ZDSA 3M8OH 4POUB 3SPVB 1XF4B 3GMNB 3KHQA 2P5WB 3DYPA 1XR9B 3BUPA 4LCWE 5D6CA 3GK8L 3LMJL 3UIYA 1OAUL 25C8H 3HG1A 4JKPL 2A83B 1R1CA 1JZ4A 4OM1H 2WYZA 3LRHA 4S2SA 1WK0A 1OTSD 3F7QA 1H3GA 2DJMA 4E36A 4PVBA 3VFGH 5CJQL 3L3JB 3ROLB 3OZ9H 3QG7L 3WE6A 5JW4M 3EH4B 1U3JA 1Q9WB 4NSKB 3R0MA 2X6UA 3OBAA 4KGJA 4ODTL 4K9EC 5FYJD 3HE6A 4GG6A 2DWDB 3HC4H 4KGLA 3NDZE 2P8MA 4ZXBB 4OBRA 1J8HE 2WLJA 3GSQB 4BZYA 1U6AH 1HCFX 2OTPA 3DJ9A 4X5QA 1QPPA 3LH2H 2XWDA 5FOBA 4DN4H 3MCKB 4UWQB 5FFOA 1WC7B 2QT6A 1L5GA 2YPLD 1U93B 2DMHA 2H6OA 4LNVA 5BZWB 1QSEE 2ED8A 1WE5A 3DX6B 4TNEA 1I8MB 1NKGA 4NPYA 1T0MB 4WV1A 4YDKL 3CZFB 1E4XI 3KWWB 5F0LB 4YLBA 3LVEA 5GS1B 1FDLL 4KROC 2P42B 4HA1A 4I0PC 1RCYA 1P53A 3IDMB 4N20A 5LGHH 5T1LA 4WSKA 5EEYA 3KPSD 1IB5A 5J3HC 1P5VA 1SLXA 3M6DA 5DF0A 3EDJA 3PP4H 4O02B 4ODUB 1IBHA 4QHPA 5LBVA 4HJGB 3GMOB 4HJEA 3L5JA 4YXKH 1IGML 3BLPX 5F7MC 1MLBB 5I1KH 1N2RB 4HFWB 3EF7A 3ETBJ 4B9ZA 1H5BA 1I1FB 2E7CA 3ARPA 4N5UA 2MEJB 3V9EA 4AM0B 4E9WA 3LD8C 4POYA 1MI5A 3CDGA 5ALBL 3UTQB 3BGMB 2RJMA 3FB8B 5L0QB 1SEBB 1Z0MA 1P5UC 2H1XA 2H1LM 1BIIB 1F56A 2PPCA 3CGTA 4EMZA 1EVUA 3UO1H 4YLCA 3UPRB 4R26L 2IDUA 2ZWLT 2BOBA 4MS8D 5E03A 3SDAA 2MFNA 4LPUA 1TTBA 2VLJB 1N10A 4H8PA 1IM3A 1INEH 3L5IA 1AGCB 3WBDA 3MJGX 5D5MB 1XF5B 2P46B 4CU8A 4LEEA 2F8VA 3HG5A 1A9BA 1OTSC 1XGUA 4F2ME 2X9WA 2Z7ZA 1IBFA 4L4TE 4OGYH 1V27A 2BPBA 4PRAA 3VXRB 5ITFB 1DFBL 4W6YB 1JFQH 3RUGB 4YPJA 4P5MB 3H7BB 1I8IA 2W94A 5LHDA 4YQXH 4L0PB 1M4KA 2MCPL 5LDUA 1I3UA 3MX0B 2P4AB 2D3NA 1CXEA 2PUQT 2J12B 1IGYA 2HUEA 2X89D 4KNSA 1BVLA 1KTBA 4MNQE 1JPSL 1Z9MA 4QRUA 3FTUA 2QGDA 4OGXH 4U1MB 4YUEH 1X6LA 2YD5A 2X70A 4JUTA 1PLAA 1H15A 2ITDB 3VCLB 1WEJH 1HQ4B 1TPXB 4L8BB 4H20H 1IM9D 3MLYH 4Q0XL 2X4NA 1P1VA 2CHDA 4GRWB 5H2BB 3ZVVA 3U25A 1OCWL 2EXTA 1UGNA 2N1KA 1B9ZA 1FJ1B 1MZZA 4KK6D 2V7HA 4B9FA 1ZEAL 3CU7A 4AYDC 2FL5B 5ID0B 3RKDD 3H2WA 1G6VK 2VR8A 1GGUA 1OGAA 1RUQL 2AK4E 3H4FA 4F15B 2XJLA 5KN5A 3NK3A 5F3HB 4HXAH 5LWYH 2ESVD 5GRVL 3CX5J 4HIHB 1XBRA 2BY2A 1VF5C 2F54A 4AJWA 1J5IA 4DGWC 4Z5RB 3WDJA 5CP7A 2VLKA 4PBXA 1I8UA 2WNWA 4DVBB 4RFNC 3BD5A 3WJLC 3X1FA 3GBDA 3GB7B 4LSRL 3SBWA 4CN6A 1A3ZA 2AJXL 4NJ9H 3EJRA 1YJDC 3JSSA 1DHKA 3KJ6H 2R0ZL 1LD9A 5GRJL 2HRLA 4L1LA 5EC1B 4WEEA 5GZNA 1E6OL 4JPQA 4FP8L 3FUHA 4D0DA 4U1NB 1NFAA 3BE1H 1H6EA 2VDPL 4QHNA 5T5NF 3FUKA 5TFSH 3CMGA 4YXHL 3WGVB 2YWZA 2DQFB 3MNWB 4J5VA 2PTVA 3FK3A 2CO4A 2O1AA 3OHXB 1MRCL 2FATL 3MA9H 5JQ6H 2W59A 2HX8A 1X9QA 1YQVH 3DTXA 1L3WA 2XOTA 1WZLA 3ARWA 1ZHLA 3LPGA 1W9XA 4XXCC 2ICWI 3M8OL 1X7QA 2YMXH 5CJ5A 5LO7A 3V79C 4U6HA 3K6NA 4OF3A 5A6IA 3CHXA 1SXSA 4DEWA 4KNTA 4U6XB 2ARJA 25C8L 2WAQA 3V0VB 4IGBD 1QVOA 5IR1B 5FX3A 4YGVB 5CJ8A 5DFVD 3ZE2F 1YMMA 4OM1L 3L4WA 4OCXH 3UYRH 1I7UA 4GG6F 3TBVA 3VFGL 2Z31A 3NCEB 3OZ9L 1WF5A 3LSOA 3GS7A 5DJ0A 4HUNB 1MIMH 3R4DA 5T3XD 5KYWB 4QHKI 4RLDA 4BQ6A 3E9UA 3DK0A 3HC4L 2DM3A 2YAHA 1KPUA 5CGYC 5DEGA 1BF8A 2GSGA 3DUSA 1E9OA 2ICEA 1U6AL 4LPVA 3SO5A 3CFJA 4J2QA 2HT4C 4N9GB 4UILH 2E76C 2H32B 4XO8A 3CVHA 1WA0X 3LH2L 1A4KB 2VSCA 3RZCA 1HQRB 1KMGA 2UV3A 5HJ3A 4RMWA 1A6UL 4PRBA 3IE9A 4ADIA 2W60A 4Y5XB 5CEXB 4X4YA 2DQIH 3QE5A 3CIAA 3SE8H 5ISZE 4RZKA 1QWNA 2BSCA 4L1HA 2UZXB 1I53A 2QSQA 5C09D 3DRTB 4X6CB 3QDGA 4DNLA 4AM0Q 3LZFH 5LGHL 5CJXC 4IS6A 4OLEA 4JDZB 2OSLB 1KGXA 2VUOA 5F6HI 4A2DA 3K3QA 3PP4L 2EE3A 3BIKB 3BH9A 4OGZA 1RIVL 1V55B 5MEQB 4YXKL 2CLRB 4PP1C 2UZYA 1GSMA 3V6BR 1R5VB 3QWRA 4M3HA 5I1KL 5C0IB 4DZ8B 2ESVB 3BGFB 4X6BB 1A1OA 3TF4A 5DMKA 2BVYA 3EOAB 5FM8A 3LNEA 5HP5A 1K8IB 3EJUA 3Q2LA 4HX1A 3P0GB 3X11B 4BWTA 3AGWA 3GPSA 5CFHA 2VWEE 4M02A 4QTHA 1ZANH 3UO1L 4MJ5B 5F9WC 5G2NA 1VGEH 1SMOA 4Y5YA 3EOBB 3JV0A 4ANXA 3H9SA 1ZHKB 1XV8A 4L4JA 3KVDD 3CNKA 2OSYA 5FW8A 1INEL 1DANU 4LRIC 1OAJA 5DFVC 2BVPA 3ZE0E 4Q56A 4CSSA 1U3YA 1KLFA 3E6FA 4ACPA 4OGYL 2EDQA 3U36A 2ZF9A 4LKXA 4D0CB 3PJSB 2HRGA 1JFQL 1KJMB 1UB5B 4LEOA 1JZIA 1D9KA 4MD4A 4DQAA 5D55A 3OSKA 1KCLA 4CW1A 4G7RB 2I9TA 4JO2L 4AVKA 3FL7A 3HZVB 3BN3B 2OJZH 1C8PA 4IBTA 3TT1H 2IANA 4WKZB 4FZEH 3GLAA 5B21A 3UTTA 4TUUA 2EDXA 4OGXL 4IGBB 1I9JH 3NFPB 4WY7H 4YUEL 2Z7UA 3SQOH 5J5EA 3H8NA 5LBGA 5DA4A 1WEJL 3MREB 4H20L 3MLYL 4XP4H 3LPFA 3HZYA 2CDFB 3JXAA 1NDGB 3VU2A 4R3SB 3OKEA 2Y2TA 4C83A 4BFBD 3P73A 2IBGA 4FEIA 5T1JA 1LE9A 2WQXA 1BD2E 2HUHA 1CDIA 3QUYB 4G70B 4N2LA 1L9TA 2DWTA 1MCWM 2F53A 3FO9A 4CILA 1JWUB 3QI9D 2MMXA 1F2XK 4J7RA 4WFFD 1E50A 5K1NA 1JP5A 1J8KA 3TO4D 1BWWA 5I1AA 4HXAL 5LWYL 3WYRA 5IHHA 4TUKH 2NTFB 5CHNA 3VXUD 3S2CA 3WIFB 3OKOB 1PAZA 4B0MB 1Q94A 4YZFE 1C08B 2NX5E 1SF3A 3DHMA 3QZBA 5BV7B 2FX7H 3FT3A 3KLDA 2JCCE 1PYWB 4NQSA 2ZX6A 4NJ9L 1R0AH 3UZEA 4Q4EA 3KJ6L 1U9KA 2FH6A 3C09C 2AW2A 3CVHH 3NJKA 5C08A 1KELH 2V9QA 4KV5F 4JO1H