5A7BA

Structure of the p53 cancer y220c bound to the stabilizing small molecule phikan5211
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental and Theoretical Evaluation of the Ethynyl Moiety as a Halogen Bioisostere.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5a7bA00
2PCXA 4KVPA 2IOIA 2J21A 2AC0A 2WGXA 2J1XA 5G4NA 1E50A 4IBTA 2FEJA 2BIQA 2J1WA 1EAOA 2IOOA 2XWRA 3Q01A 2AHIA 4IBWA 1HU8A 4IJTA 1GZHC 2ADYA 1GZHA 4AGLA 2RMNA 1EAQA 2X0WA 4MZRA 2YBGA 3Q06A 4GUOA 5AOKA 4IBYA 3EXJA 3KMDA 4QO1B 3TS8A 3D08A 5ABAA 5G4OA 3Q05A 4AGMA 2X0VA 4AGOA 4IBSA 2VUKA 1HJCA 4L0YA 2BIOA 4IBQA 5ECGA 2J1ZA 1CO1A 5BUAA 4AGPA 3US0A 1TSRA 2BIMA 3D07A 2X0UA 3D09A 3D0AA 2BINA 5G4MA 4AGNA 5AOJA 1LJMA 2J1YA 3VD2A 3KZ8A 3VD0A 2OCJA 4L0ZA 4IBZA 3WTUA 3WTVA 1T4WA 4L18A 4IBUA 2IOMA 3IGLA 1HJBC 1H9DA 2GEQA 4XR8C 4GUQA 3WU1A 2P52A 4IBVA 5AOIA 1TUPA 3D06A 3WTTA 2J6WA 2J20A 4LO9A 3QYNA 5AOLA 5AB9A 5KBDA 3EXLA 3WTXA 2H1LM 3D05A 1EANA 4LOEA 5LAPA 3QYMA 1CMOA 4HJEA 3IGKA 5A7BA 4G83A 3WTSA 5LGYA 1KZYA 4A63A 4G82A 3WTYA 1IO4C 2XWCA 2BIPA 4LOFA 2MEJB 4AGQA 4MZIA 3VD1A 3ZMEA 3WTWA 5AOMA 1YCSA 3US1A 2ATAA 1UOLA
chains in the Genus database with same CATH superfamily
2MSPA 5DZNA 4BHUI 3QBTB 2MPVA 3B1TA 3GBNL 3V52H 2V7HB 1OPGL 1K8DB 3HCVB 5LXGH 2GT9A 4HIEB 3RGVD 2HKHL 3I6KB 3O3DB 3B5TA 3A5VA 5K9JL 3CXHJ 4OCRH 4XBPA 3CFJB 5EF0A 3FT0A 1ZVYA 2AEQH 4RH4A 4RDBA 3TGXA 3RY5A 4UM8B 1K4CB 4TL5A 1JD7A 1MJ8L 2VC2H 3CN2A 1MRCH 2Q5BA 1CN4A 2N7BA 4D3CL 3BIAX 3LEVL 1SY6L 3GSXA 1BAGA 3NDYE 3QIBB 1OWRM 1I7UB 3JVGC 3Q6FB 4NPYA 4XNXH 3R8QA 3IAQA 6PCYA 4M6OH 3MV7E 5CP7B 3VXUD 3ZMNA 2X0VA 2A6JB 2R7EB 3B5GA 4N26A 1NGZA 3BYTA 4BH7B 4ECNA 2FYVA 3NJGA 2QSTA 3BHBA 4ELKB 5K9QI 4A7VA 1BJ8A 4G70B 3B9AA 1BD2D 3WMSA 2WQAA 3T0ED 5HGBA 2AJ3B 1IC7L 2OMWA 4S2SB 4QRAA 4OJDH 5I0XA 1DL7L 4HDIB 3EF7A 3H54A 2AXFA 2QKIB 4WTWA 5CR1A 5DZAA 5GPRA 4CKVX 2D31B 2PWEA 3QZMA 3VB9A 3KGTA 4RFEB 5K1JA 2JCCB 3EUDA 4LGRB 4NC1C 3IM1A 3PHSA 4IMKC 4KJQC 1QRNB 3NIDF 3QUYB 4MS8C 4MJIA 3LQZB 3KYOB 3KXFD 1WAAF 3PHQA 3Q5TA 4B7LA 3T2LA 4XMTA 2VH5L 2H3NA 1AGCB 1ZANH 1OLLA 4L3EA 2XZCH 1P6AB 3UG3A 2A9ML 2EDQA 4XR8C 2QSCL 4TVUA 3C60D 4UQ3A 1Q94A 1YPZA 5IG7A 1F97A 1HS6A 2EC8A 4ETQA 1IAKA 1FZOA 2F1AA 5LB1A 3UAJD 1QLRB 4MJ6A 2ZSWB 3O8XB 4WTQA 3K1KC 4L4TB 1UD5A 2VXVL 3RFRA 1EFXD 5EO1A 5MENA 1KJVA 2XUWA 1H3UA 3KD4A 1IGFL 5DQJA 2NR6A 1RAMA 4GQPH 4KK5C 4P2QA 5F21B 5B1KA 4MX7B 4GINA 3TV8A 2Q6WA 3PL6D 3VFOB 4J7RA 4BEIA 3RHWK 1NDMB 1BA9A 3QUYC 1WAPA 2E27H 2XN9A 4NBZB 3SDDA 3VI3B 1OARL 1QBMH 1J8HA 3HPJA 2CBQA 1G7QA 5CZXC 2XY1A 5T3ZH 3TZVA 1R3LB 2PW2A 4PWGA 3NCFB 3IRCA 5HJGA 3UPRA 4PJXF 1PW3A 2PYEB 4NRXB 4QYOB 4WSGA 5BJTB 2IFGA 4MMYB 2MKWA 1EEQA 2WMPB 3OR7B 4ATWA 1FFPB 2OMZB 4NJ9L 3AB0C 3CN4A 2HLAA 4IJTA 4NWUL 5E8NB 3D8MA 1A9BA 2WXIA 1OY3B 2IBBA 1GZQA 4BZ1H 2IPKB 4CSSA 2ETWA 1IQWH 4JFVA 3IGAA 4L9LB 3OB0K 4HJTA 4QO1B 5KW9H 4PBXA 5ESQB 3AREB 1A5FH 4NLHA 4GRMB 3ABLB 1GAFH 3L3KB 5C8JB 1JZHA 5FYKH 1K2DB 2CO6B 3HB3C 4FYSA 2AXHA 3K4ZA 5SWSA 3NRFA 3TH4T 5AVWB 1TJIL 1FAIH 4KPHL 4D8PB 3IDYB 4Z5RB 1NL0H 3MNWA 3OG6B 2WXGA 3DOSA 2FO1A 2EDDA 2V17L 3F85A 4N0UE 5CJOH 1I3VA 5IBTL 1S78D 3SKMB 4JNXA 5T3XL 3RWEB 1A9EA 1BZ7B 3BPLC 5KAQG 1VKXA 4KDVA 1HI6A 4Z6AT 4HXBH 2VDKL 5EUOE 2E9BA 1HYSD 3FNKA 1KCRH 3S36L 1IARB 5DEGB 1ONQB 1M71B 1FNGA 1N5AB 4FXTA 1HOCB 5HHOA 3UZEA 2QADC 4HFUH 2X1PA 2KPNA 3FQUB 4OGZA 4YDIH 3BT0A 1X5XA 1S7XA 4WK0B 3FUMA 5KUMA 2F61A 5CIPB 2IOMA 1JNLL 4RSYA 1OT1A 4AQAB 5JPNA 5EFIA 4RBPH 4HIHB 3B8SA 4AKQA 5KYWB 2EYSB 4EAEA 1YEKL 2BLFA 4YQXH 2DTSA 4KKZA 4IOIB 4KC3B 5C08E 1GZPA 4DGYL 5AUMB 4DWHA 5KOVC 4G42B 2W65B 3ZHFA 4LEOB 3HZKB 2QZQA 1T0OA 4GG6F 5EO9A 1I9JL 1X5LA 3BSGA 4W4OA 2OI9C 2P43B 1YYLH 2W07A 3TBYA 2JF1A 5JUEH 1KV7A 3OKOA 1S9XA 1WQVT 2WC7A 5DMIH 4F9PA 1H5BC 4PM1A 4HLZG 5KBLA 1DQJA 3VXUE 3MRNA 5D1ZD 4B50A 4FKHA 4HKZB 4UM8A 4NZUL 5HHPA 3ZHNA 2AXFB 1QPKA 1DUYB 2VTFA 4C55A 5F70A 1AR1B 5FGRA 4DAGL 3DGGA 2XTJB 3T6XA 4ALAC 3VD5A 1MFEL 4ES8A 2CD0A 2XWBB 5B1JC 1E8YA 2E7HA 1T1YB 4LASH 3LKNA 4KJYB 3MX0B 4M48L 1NMCB 2XFXA 1QUNA 1MCRA 4O5LH 2IOOA 4NQXA 4L8CA 3DX6B 2D73A 2X6VA 3GUFA 1YN6B 4XN1A 3RWIA 5B3JE 1KBBA 5HJ3B 5IGXL 4J1UA 1ITBB 3MNZB 1QLRA 3W56A 1W9XA 4OJCA 3ZUNC 4H25A 1YEGL 4YGVB 2FJSA 2E4TA 4UDUB 3RZCC 5I1CH 1EXGA 5AVVB 3EYFB 5BS0E 4LB8A 5DFTA 2VUKA 4H44C 4K5OA 3MLTB 4YC2B 2PR4H 3IPFA 3FRUB 3QIUA 3VXSD 5I1AB 4J2XA 3QUYA 5E4EC 3BGMB 4AGPA 5AAPA 5TDOB 3QR1A 4Z23A 3LRMA 1ZE3H 3LRSA 5F1SA 4DSYA 4UQ3B 2H0JA 5HPMB 1MFEH 2FR4B 4NRYA 4LNRA 4XCEB 2GW5A 2EICA 5KEZA 4ORZC 1BOYA 4R8WH 3X17A 3BPOC 1WSST 4BWTA 4NRXA 5JXED 2XOTA 1GYCA 1DJSA 1ZHBB 5KSBB 4XH2B 5ALCL 1KJVB 4HWNA 1KSRA 5FYJU 2OMZA 4YSCA 3HC3H 2DQUL 4U6VH 5HD8C 4BSVA 3W57A 1H9DA 4Y1AA 4N2CA 1JWUA 2L7EA 4B9KC 3L6FA 3L1FA 4L37A 4NLAA 3EJTA 1J0IA 3GRWL 4XC3L 4DESA 3OAYK 4WO4A 3OGCA 3KJ6H 2J6WA 3MCKA 4XB8A 5C3IA 5F1IA 3N41F 3V5HB 1BD2A 4ZFQA 4HIXH 1S8DA 4G2AA 4BH8A 5TPWL 1OGSA 5JHDA 3FAWA 5F7AA 5ETUB 1HL9A 1J9TA 2FIRT 4F1SA 2IH1B 4F1ZA 4JAMB 3QYMA 3DYMA 3IDMA 2H2PD 3WIAA 3GS0A 4I2XE 3ULVF 1AP2B 2HG0A 2WQVA 1AZNA 1JNLH 1WWBX 3IGKA 4ATTA 1VKXB 2G60H 4KOBA 2YRPA 5KZCD 3RL1B 1NBVL 2WQUA 3QUML 3WFEL 2XZQL 2GUOB 3FO2B 3EYVB 1XCQA 3GSVA 2YPVH 2XZAL 5J89A 3S2AA 4WI2A 4YSAA 1FPTL 3RVWC 1UWXK 4GRMA 2IOIA 5IHZB 1E4WH 2MQ0A 3WNMA 4QUOA 4AYDC 3CLEH 3RWJB 5EC2A 1XSOA 3QS2A 4HG4K 1OSZB 3E1ZA 4ZBJA 1E6JL 4UU9A 4PRHD 5KVDH 4YXLH 3EFOA 2YMXH 3RUGB 1BVNT 2APXA 4QXTB 2L7JA 4YXHL 3RIFK 3DVGA 4NPJA 1KJ2L 4TMPA 1CDYA 5FYJH 5AW7B 3RKPA 3WS6A 1OPOA 2DDQL 2YN5A 1G6RB 1U92B 5D1XB 3I6SA 2HZHA 4KX8A 4JG0L 3T3PB 2V7HA 4QJ4B 4XN9A 1D9KD 1GJUA 2CNZA 1NBCA 4JM2D 2NQCA 1AZBA 2NW3B 2ZKYA 4LSVH 4XX5A 5SWSE 3CFDA 4J28A 1NUFA 1TLKA 3WELA 3V5DA 1S7WB 1XCTA 4Z3JA 5J3HD 1O7DE 2Y2WA 3ZQWA 4Y19B 1F4YH 1KIUA 4N86A 1PIFA 4X5RA 5LXVA 5L2KA 3LN5B 3TYFA 4UQ2B 2KQMA 4G1EB 3K6SA 3RKDC 1CE1H 2WWMC 2DLGA 4Z78A 4ZW8A 4KMLB 4H8WH 2A9BA 5E5RB 4OM1H 2ZXBA 4V2BA 2YJLA 3C9NA 5E2JA 3DV6A 3RPIB 2P8PB 25C8L 4XP5H 2ICWJ 1DQML 5D7JB 1SEBB 4MCYA 3I50L 4FXKC 3ULUE 2BP0B 2BSBA 2DY2A 4OJFH 3HZ3A 5EO9B 2F53B 1PLGH 1XR8A 2DWEA 1YPZB 5IG7B 4MYPA 1NCIA 1K4DA 4NERA 1T1XA 1C8PA 1INDL 5D2LE 2BNRD 4PP1D 5HJ3A 1HJBC 4GPVA 5CEZD 1WTLA 4KK8D 1BXAA 4E5XA 3CXDH 4HT1H 1JP5A 4PREA 1BQLH 3WY2A 1HK6A 4A2HA 3QUZC 4HCRA 4Y4FA 4Z7WF 1KDIA 3OPUA 3P40A 4PRHE 4BV1A 2NY2D 3EO1A 4O51B 1QRNA 3WFBH 4PJEA 3PAYA 1XMEB 1DVQA 5DRZB 2Q7NA 3IBOA 4H1LH 2G75B 1NC2B 3JWOC 4G7QB 4MQSB 4L3EB 3SGDI 4AQEB 4AYGA 3LZOA 2G3MA 1TO5A 4HJIA 5J5EA 2X9ZA 4Z7WA 2J8UA 3OM3B 4PGDA 1MNNA 2AFNA 1TQCB 2COQA 3OMAB 3IK2A 4ETQB 1QNZH 1LHZA 1R5VB 4R2GB 1LNUB 4V2CB 3CDZB 3BUTA 5J11C 2C5DC 1CG9B 4MA7H 2F54E 1ZT7B 1VSCA 4MMYA 4FEIA 4FABH 2DM4A 3MV9D 4DUVA 5C0CD 1NGQH 3D25B 4YXLL 2H47C 4Y89A 1GZQB 4LZKA 3RL2A 5CGYC 1Z3GL 4NI3A 2ZICA 3KAAA 4JREC 4KZDL 3IMRA 4LEEA 4X5LA 5D2NE 1AOHA 3AREA 5E8PA 1F0LA 2BOCA 2FUTA 4XWGH 5AW8B 5TDOA 3T0WA 3BSZA 5LGJA 2ADYA 3S2CA 4JG1L 5TE4H 3H3PH 3QB7C 3OGCB 1A4KB 4X5XB 2DH2A 4NUGL 2FQGA 3QJXA 3PXLA 1QFUL 3ZQ9A 3G5VA 2CMRH 4XCNB 3KPNB 2WMPA 4QY8B 1TCRB 5DEFA 1YECL 3GSWB 2ED6A 1KIPA 1A9BB 4AM0Q 4QRPD 3TESA 4FCHA 3PG2A 4I0KA 2HCZX 2GTZB 4QRSA 2OI9B 5MP6L 3MRIB 2E56A 3OKMB 3GIVA 1CDIA 3FO9A 3R19A 4B0MM 2B4CH 2R1YB 3BZ5A 2H0EA 2FEDC 3MJ7B 3TT3L 3UTSE 5GS1B 5AZ2L 3FC8A 2WGNB 4TQIA 3OG4B 1IC4H 3VFGH 1XCQB 4P2RB 4OSUL 3DUHA 3ZTEA 1A8ZA 4HOMA 4X8JB 1AS6A 1C12A 4ZSOB 1YEHL 3NJKA 5FYJD 1JK8A 5TQ2L 2R51A 3FOLB 3MCKB 3EGXB 4IDJL 4M6OL 3BZ4A 1BD2B 3WEXB 2W5PA 2L04A 2WZ5A 4X6DF 3E8UL 1G5AA 5FO2A 1BQHA 4MYWB 1G7JB 2H1PL 2A9MH 2IDTA 5F6IC 4FQQB 4FQHB 5IF0B 1RI8A 1DBKL 5DK0A 3MRCA 4AM0A 1PJWA 2VSCA 4YHKL 1WFJA 3RX8A 3NH7L 5IWLA 1IQWL 5EPMB 1JNNH 5GRZA 4PYGA 2I07A 4IIQC 1OP3K 2WANA 5TFSL 2OJEA 3FQ1A 2LU3A 4U49A 3T3PF 5DRWB 2VXTH 2A83B 1J1OH 1T21B 1PQZA 4P46B 3RNKB 2WAHA 1WCBB 2X87A 1YA5A 3PP3H 5ID0A 5I71B 2H1LM 2QPUA 3UP1A 1FSKC 2ORBL 3VMOA 6CGTA 5JDJA 5IBUG 5FHAL 4Z7UB 4FD0A 3HS0A 3EFOB 5DZVA 1D5IH 1KACB 5E5UB 2V2XB 3BAEH 4YSQA 4ZQKA 3ZN6A 3F5WB 2D0GA 3WMQA 1VF5C 1BFVH 2K0RA 1ZOXA 1RMFH 2VUYA 5E6RB 2ED7A 1WBZB 1XGPB 2YC1A 4MHHG 1ZIAA 2V9TA 4R84A 1OKEA 1KY7A 2Y7LA 1DN0A 1MCWW 3G5WA 3QDMB 4C83B 3CFDB 5CSZA 5F9OL 3ZPDA 2UXGA 4ZTEA 1CDJA 1T7VA 4MXQC 3VUAA 1FH5L 3SE8H 3TA3C 4JCWA 3K71B 2QJDA 4FF9A 1FDLH 4FXGA 2CDEA 2OMYA 3BCDA 2VB5A 4F57L 2LT9A 5JIMA 1NGYA 1TU2A 4MA7L 2NNRA 3QJSB 4FTVA 2DQMA 1NEZA 5ILTH 2NY7H 3MLTA 3OPZL 4JM0A 4KKPA 3F2LA 5BZWB 4PBWD 1THAA 3DMMD 4HWEH 5HDLA 3RPIA 4B95C 5IW6A 2ICWI 3QUKA 5I8CB 5E70A 2OL3L 3WE6B 1NUDA 4GG8A 2ADJA 4X0KB 2EXSA 3VH8B 4N0CD 3QDHA 5J57B 4HUKB 4OFPA 5E8OA 1F3JA 3QUXB 5E5MB 2Y5EA 3NP3A 3ATEA 3TCTA 1QTSA 1MCPH 2W94A 5C0BB 1HZKA 1F6AB 5FV2A 3QVAA 3H42H 3FSZA 5C9JA 3CU1A 1G9NH 4JRXA 2OA9A 5JTWA 3EFDL 1ZHBA 3BH4A 4DPCX 2WY3B 3H1ZA 4DGIH 5EBWA 5C3LD 5DD0L 3OHMB 3VX0A 4KHXL 5AKTA 1BCIA 2ZKMX 4RQQA 4OZIE 4KDWA 15C8H 4X7FC 2IADA 3D4GA 4IRZH 2BFGA 2FJGB 2RACA 4IJ3C 1NUNB 1DFBH 1ZA3B 3FB7B 3DX7B 1M6UA 1HFUA 1BX2A 2BVEA 1IC1A 5EOQH 1PD6A 2I26N 3TFKD 3W5NA 1AIFB 2J8UB 5HPMA 4OIIH 5LBVA 3CFCH 4BZ2H 2F7RA 1EHLL 4EF3A 2PPEA 4PJ9A 1A4KA 1NIDA 4PJAF 5AVYB 2FNWA 1Q0YL 2AZAA 2VDLB 4QR7A 5DCCA 5IJKA 1BM3H 4X6DE 4NDMA 3H9SA 1FFNA 3VCLA 4Y8DC 4BM7A 1JV5B 3MKKA 1CICA 1ANUA 5IP4A 5JMRA 1X4XA 2NX5A 1B4LA 1P4UA 2MQCA 4I77L 1S7UA 3MRIA 2JK5A 3OKMA 1OSPH 2QGBA 4O58L 3QS3A 1MN4A 4MQXC 5HVGB 1F18A 5J13C 1TZIB 1Q72L 1Q9KA 3P0VL 3FUNA 3L5XH 3VGDA 5LGYA 2D7MA 3DGCR 1OF2B 3GWJA 3L4TA 1QACA 5AAMA 1I8AA 2A4EA 4KK9C 5SWQA 1ZVNA 3WIFA 2YR3A 2BC4B 5GGQH 3T09A 3V0GA 1FFQA 5B22A 1HXYB 4HALA 2WSPA 3FBKA 3VFNA 2VKWA 2WLZA 4ZNEA 5EOCH 1G7JA 4XBEH 3AREC 4JPKL 4G9DA 1WS7A 3RL1A 1OB0A 5FGBC 5GGTA 1I7RA 3GSNB 3WGVB 1TYRA 3P2DA 3QIWD 5PAZA 5CILL 4JX0A 4X9BA 3AB0B 1XZ0B 2O6CA 3DX8A 4ZPTA 4Z0XB 5ECJE 3QW9A 2OJEB 3R1GL 1KYFA 2Y22A 4E36A 2Z34A 3H7BA 4QHNB 2OR9H 1SYVA 1UB5A 2JKXA 2WINA 3T4YA 1BV8A 2UZPA 4HHAB 4ABVA 5JORA 5IOPA 2E9IA 1J5OH 5DHVH 1X5MA 4RMUA 3I84A 2OXHA 3SB3A 2VW7A 3BC9A 2L3BA 5CSGA 1RZFH 1JPST 2ESVD 5SX4H 1E2ZA 4IOSA 5TTRA 3TBSA 2EVHA 4QJ5B 3MBED 3A3YB 3I6GA 3VRIA 1OW0C 2C9QA 1UYWH 4OCSL 2X5PA 2A4ZA 3KPRA 3DI2B 1PDKA 3GMNA 4IRJC 3T8VA 4DZ8B 4N2OA 4HIEA 5H8DA 2CQVA 3CX5J 4JY6A 2HA1A 7FABL 4Y19A 2K9FB 1HHJA 3D2UA 2YGPA 5FIEA 1NJ9B 1NSNL 2IXQB 4WFHD 4DCQB 1S5HA 4F7CA 1AXTL 4PVMA 2P26A 3FS9A 2DQJH 3IGFA 3RRQA 5C86A 3JWOH 1WZLA 4JFQB 1SJHB 2C8NA 2OL3H 1I53A 1AGFB 4QRTB 1CICC 5E1IA 5DLLA 4CA4A 1XGUA 4UB0H 3H53A 1F4WL 5D7JA 3B7TA 2A9NH 4U7SA 4BQ8A 3ZQXA 3QJHA 4AOFA 3S4SB 3NUKA 3QUKB 4M7JH 1FVCA 4LVOC 5J0BA 4M43L 1D5MB 5D70H 2J12B 4HPYL 4MXWH 1JJUA 1F3JB 1LO0L 2O5ZH 2NY5L 2QFRA 3C6LD 3QUXA 5E5MA 1VFOA 5EA0H 4S2SA 3ML8A 1F4XH 4M93B 4NQEE 4PGCB 4X7DC 1G0XA 2VGLM 1AGDB 1AXSA 5F7WC 1NFDE 1HHKB 4AI7A 1HH9A 3S88H 3ZHDA 2X2IA 5DJXB 5EBWB 2WXJA 4NO3B 4XXDA 3N1QC 4NQCE 1H3TA 4ZS7L 3HKZA 2Z1PA 3TN0D 1ZWIA 4S1RH 2DQDL 1MFMA 1VGEH 1KB3A 2DQEH 3G5XB 4W9HC 1QSFD 3O2WH 4Z3HA 3SE9H 1LQSR 2ZG3A 3DNKA 3EJSA 4D3CH 1XB6A 2UY6B 4LEXH 4LL9A 4P5SA 4ZMTA 2BOBA 2J21A 4X5XA 3TA3A 4MMZB 3KVQA 2MNJB 2R29A 4I0PC 4QHUB 2OJZL 5HDBE 4OGYL 3AT0A 5B4MD 4EXPX 2CJ3A 3KPNA 4ERSH 1M57B 1W15A 5AL0A 3ZL4H 2FLRT 2FLBT 4V1DB 5E0QA 3O2VL 4Z95H 5IQNA 5D8JH 2WUCH 4ODBD 4N9GA 1HNYA 2WSDA 4Y4KD 3MUUA 1BOGA 5IB5A 4AIXA 2Y07L 1MRDL 2R0LH 1UZ6F 2YQGA 1UENA 2ZT9C 3SDAA 1AD0A 1B0WA 3MKGA 2Q8AH 2BVQA 4MAUL 1AAJA 1LO0H 2O5ZL 4HPOH 3SY0A 1U3HB 2DKSA 4FG4A 4TUKH 1ORSA 1TETH 2JK5B 4YDZA 1HC1A 4WHDA 5CCGE 3NFNA 3BP7B 1MI5E 5DRXA 4ZTPH 2YMTA 4NC0B 4HF5L 4O00A 4EI0A 3HNVH 5LG1A 3B34A 5TH2B 4MNQA 4GAJL 4XNZB 5BZXA 1U8IB 4IGBA 1ICTA 2XWXA 3FAXA 4QY8A 4U1KA 4PR5A 1MIMH 3SDCA 2D7PA 5C0AD 2DB8A 1J0JA 4IW4C 4TRPH 1R33A 5ES4B 4U3XA 4DQAA 1F3RB 1ET5A 1AXTH 3MREA 3KCPA 5T5FH 4CKQA 4XXWC 2CKNA 5AOJA 3OKKA 2UWEA 4BKLA 3SJVA 4XAKD 1KFAL 4KQ4L 4H26A 4PJIF 1A1MA 1PX8A 3RGHA 3AY2A 3TCXA 1F11A 1I8MB 3QXWA 5ERWA 3CPUA 1P5UC 1XZWA 3FOMA 4XBPB 3MLWH 4P46A 1PQZB 3K3QA 3QUXC 5MERA 3UZQA 5I1JL 5MENE 4JFDB 4Y4FD 4NUGH 2CO6A 5CP3A 1INEH 3KH4A 4NM8L 1ZDQA 3L16A 4P2QE 3MOBH 3IDJB 3HC4H 4NQUA 5C6TH 3CHOA 4FQQA 2WJ7A 1E4HA 4KY1H 4YNYB 5GS0D 3FQRA 5DUML 1QD0A 2AJUH 1M7IA 5LAPA 4OJYA 1Q9WB 3N04A 4Z7AA 3M07A 3N0PB 1DEEA 1YMHB 3V4PB 3FQXB 1WBXB 1TT6A 5L8JB 1T0NB 4AUYA 1FE8H 1CUOA 2DWSA 3VFPA 4JPWH 5KANI 5C0GB 1G7LA 3QI9C 3CVCA 2R2HB 4HQQH 1FWXA 1N5AA 1OEZW 2YD5A 3KW8A 4Z0XA 4NWUH 1FYTD 5CJXA 3OWEA 3EBAA 4PJBF 4FXGB 3W0WE 3KR3L 1BHGA 2AMUA 2FT8A 2PTVA 4KROC 5HHOD 4DCQA 5H35A 1PLCA 2AW2A 3MROA 4NN7C 5DHMC 3QQXA 5IOPB 1I7UA 3Q6FA 2HH0H 3GGWB 4BE6A 3HZMA 1RZ8B 4HS6B 5I73B 5DGQA 4N20A 5GGRA 1D6VH 5KYUA 1E4KC 3HBGA 3MLSL 1T7WA 4RAVB 1UEMA 1HEHC 2NRDA 3JWNC 1KXQA 1UCBH 2PWGA 1HESA 1QA9A 2IPUK 4AW7A 2ZXQA 5D7KD 2CZNA 3VFGL 2QDWA 3V5KB 3OKEB 4EIZC 4K2UH 4ZOCA 4JANB 2Q7YA 3HC0A 1IT9H 3VYOA 2G5BB 4U1NB 3QPKA 2KI6A 5I1IL 2O1AA 1T2QL 4Y2LA 1IC0A 5DO2D 5IT2L 4LSSH 2PXYA 2IPTL 1JZIA 2Q76B 1LE9A 1VFAB 3B8YA 3GD1C 3LQZA 1SDYA 1KGWA 2H0PA 4NO3A 2ZKWA 4XXDB 5DWUH 5B8CC 2ESVB 3TVMD 2CHDA 3ZO0A 2VXSL 4FNLH 4PN6A 5IROD 4FC3E 2QVKA 3WDHA 4PJ8D 5I30L 4TLSA 4P57B 3OZ9L 2XA8L 4Q4IA 1D5XB 1OT2A 4J8RB 2P28B 3MDJA 5FM4A 1UWXH 4PB9L 1S7SA 3DPBA 4BD4A 3VG9C 2Q2LA 3HE7C 3RTQA 2IF7A 3GO1H 1QWHA 2ZWYA 5I0ZA 1KGJA 1AQ8A 3PQYD 3KZ8A 5AW2B 1S3RA 4L0ZA 5BO0D 4NO2A 5CEXB 5KN5B 3H9SB 5C0FA 3LB6D 4N1HB 3VGHA 4C4BA 4B6ZA 1XR9A 5D4HA 3QG7H 4I18A 5E9DE 3N42B 1CXIA 4UTBL 4F33B 3MOBL 2D7QA 4JVWA 2LABA 2OYKA 4X2UA 4OLWH 2V2TA 4WLCA 4P5TC 4DEWA 3QQ4A 1M05A 4NCC2 2Z7WA 4FNTA 1ACZA 3L48A 4JVPA 4YXHH 1UZ8B 1ORSB 2YOCA 1KENL 4NJAH 5IQLA 1WE5A 2G3XA 3APCA 3MODL 4P46D 5AOLA 4B3VA 5ELIA 2DAVA 4ZFOA 1BIIB 1JV2B 1E4JA 2GJJA 4XNUH 5K59F 3LEYH 5EC1A 3UYRH 1IJ9A 3KLSA 1CFMA 5J6GB 1MCLA 1QLFA 3VFNB 2VZ3A 4G6AD 3WIIL 1Z5HA 4CVXB 5C9KA 1FFNB 1G1KA 1MPAL 2BS71 3SDCB 3T08A 1GA2A 2HLAB 3EGDB 4RMVA 4UANA 3TO2A 5I8KL 2X42A 3RNQB 3D3VB 5I16B 4B9YA 4DN4L 1N6VA 5E94A 2VLJE 1AANA 4POZD 2Z35B 1UH4A 4P9HL 5GRJL 2OULB 5DK3A 4P9ML 1UOLA 5E9DD 4Y1AB 3NCCB 4WI8A 1A8JH 3K2UH 4DEPB 1V3KA 3W5MA 2ENYA 4ELDA 2CHZA 1OAZH 4CU6A 5KS9B 1JI2A 4QHNA 5EWIH 3DRQA 1JS4A 3REWB 1AG0A 3FCGA 5MERB 5IW1B 4HIXL 4JBSA 3VM5A 2VRAA 4MNQB 3GSRA 3I50H 4Z5RA 3SZ6A 1XF2B 5JPNB 4HCRH 3P3YA 3ZE0B 2J71A 1SY6H 2P5WE 3FFCB 5LN4A 1F5WA 1A9EB 1BZ7A 1OALA 2NZ9C 3ZE2F 5C71A 1CFNB 3V8OA 3SKUD 3GMRA 2J57A 4WENB 4D2NA 3HZKA 2GFBB 4G7SB 4PJCE 5IR1B 5DZLA 1GS6X 5E2VL 1M71A 2VDMH 2KS0A 1O7SA 3KPRB 4GFXA 3RHWF 2GPZA 3MJ6A 3DROB 4BFFA 3KVDD 2C7UA 2XWEA 5ITFA 5ICYA 3OLIA 4UIKL 1KCVH 5C0NC 3F12B 2H3KA 5CFAA 1W72A 3VFMB 1IFGA 1HAWA 3PWUB 4F7KA 2IXQA 5HHPB 4HFWA 4FHKA 5D7JD 3BAXA 1JZ2A 5I73C 1XQ4A 2VT0A 1TR7A 2B1AH 2DL2A 1L9PA 4BWWA 5H35B 4IRSC 2NQDA 3H85A 3QIBD 2WP3O 3DYOA 1KG0B 1RUQH 1WHOA 3DVGB 1K85A 4HJ0D 4PTUA 1QEXA 4N1CA 5J1AA 3HRZB 3GLDA 5EZIL 4LVEA 1Z2KA 3GJFA 4JJOA 4K7PH 3GSUA 3PHOB 4ODVH 5AWNL 4OZGA 5B7MA 2YWYA 2DEWX 4I1NB 1D5MA 3GZKA 4PJ8A 2EDMA 4TVPH 3EYSL 3W0WD 4PJAB 2N7AA 4PJGA 1OWWA 3CQQA 3OBAA 4E0RA 1BQ5A 1T83A 2VUOA 3D4CA 4P23A 2WLKA 3L7FB 2P80A 1DUYA 4NNYB 1HHKA 5CGTA 2L4OA 3BXNA 3DJZA 1SJHA 3V6OC 1NKGA 1KTRL 3IJ9A 3NJNA 4MBRA 4XNMA 2IQ9H 3VG9B 4NT6A 5D7IB 4UQBA 3ARQA 3FJTA 3WNJA 2PCYA 4OUOA 4PB9H 4QOKE 4KJYA 4OZHE 5DZ9A 4PWFA 3BGMA 1T5WA 1E3FA 1YQVL 3LQAH 1FVEA 1IZJA 4U3CA 4TNWF 5KSAD 2HT2D 3DSFL 1BQRA 3TV3H 5HGHB 1FO0A 2VZ1A 3RX7A 3QUZB 2AK4B 5D1ZA 4XZUA 1OANA 1DSWA 2IPTH 1KEGH 2BSED 1SGKA 4NQQA 3AWGA 2B3IA 2DMCA 2EO1A 2CNYA 3QDJE 4NX0A 4NN5B 1K6QH 2KYIA 1CDGA 2IH8A 3RVVD 4DGUA 2IGLA 3HE6D 4NFCA 4HAGA 5AD0A 5EN2B 3MLVL 4PYHA 4AVJA 2W80C 2OW6A 3BAJA 5TK2A 2WTPA 2AHIA 2OR9L 3PGCA 3FT3B 1FORH 3F84A 4XNAA 4ISVA 1KPRB 2D3JA 3AG4B 1YEJL 4YZFE 3NFNB 5I1HH 3BP7A 5DRXB 2B59B 4BQCA 5EF3A 4BFIA 2EH7L 4LSPL 3NSJA 2FYYA 3T0DA 5TE6H 1MPAH 3OZLA 3ES6A 2X4RA 3V4PL 4PV8B 4UQ9A 5GISH 4PWHA 3CSTA 1IGIH 2P4AB 5I28A 5IFAL 2CIIA 3ZJAA 3NRPA 4IU3A 4GW5A 2R0KH 4JKWA 4I18B 1OAUH 2FX7H 2V9UA 3SJVB 3VFTA 3FTZA 2J6EH 3L7EB 1VZGA 3L6FB 4L37B 2Z35A 2Y4SA 3GSVB 4FLRA 2DQCL 2MOGA 1UD8A 2WO3B 2X4OA 1R6VA 3M86A 3QPXH 4LHUD 4JO2H 5FW6A 2OP4H 2VR3A 4LQFH 3UYPA 4CGTA 5ADPH 5L7XH 4BKTC 3LHPH 1D2PA 2W9DL 4NP9A 1L7IL 3BT2H 3ZDXE 2X6BA 3WLBB 3P9LB 1TEYA 4L18A 1XXFC 1A5FL 2EIKB 3NABH 1FHNA 3HW7A 3ULVE 1QOKA 3RZCB 4PJGF 1SXBA 1U92A 3CBRA 3G04B 5EO0A 2P8MA 2FQDA 3N85H 4H26B 1USQA 1QWNA 3V4PH 4RA0C 3VRJB 2CA4A 4F57H 2EACA 5BO1H 2PYFB 2XYBA 1G7LB 1EA9C 4FQXD 1ILSA 2HRHA 3E6FA 5KVGL 4QRQA 5KYXB 1EANA 5M94B 3F64A 1HL4A 2PPAA 2LTQB 1M9WA 5KOMC 3ZW3A 2VSDA 3RTQD 5IW1A 3CVIL 1BAFH 4ZOEA 5IEKB 3ZT5A 1NAML 5LVEA 3C2AH 3WFHA 1OSYA 2H7WA 4YO0A 1CIUA 3AUWB 5ICUA 4HUXB 5TPWH 1K6QL 4N8CH 1FSKB 3IB4A 4U0QB 4BQBA 3PNRB 4XCYA 2WLHA 4RFOL 4KV5E 5EIIG 4BDVA 4P05A 4HPYH 1IKNA 5ALBH 2PR9A 1YCSA 5FUCE 4NENA 3ZYIA 3GNMH 2WN2A 2AJZA 4X9GA 3TZVC 5IR1A 2F53A 4KKLC 1CT8B 3GSUB 3PHOA 4ZMNA 4N4YB 5GSVB 3Q8FA 4XPHL 5IK3B 5CCKH 3HN5A 3GXFA 3ZYJA 2C7UB 1NWOA 3WFEH 2BDNL 4IRJB 4X98B 3VYPA 2C3HA 3GBDA 4GQQA 3I85A 3G6JF 3MJ8B 5K9JH 4LF3A 1Z9NA 4UQ2A 4BRJA 1FZKA 3D51A 4PREB 5F93C 3TV3L 2CXKA 3ZTDC 1U95A 5H2BA 4Z78B 1CDCA 4JKPL 3GUTA 3FTGB 3GGWA 2X2UA 3AJ7A 2W0PA 1IFHH 2ZCHH 3WSQL 4ZUWB 4XNMB 1FQ9C 1P4BL 3I9IA 3MBWA 5FA3B 5HI4D 4MJHA 2XXMB 1NCWH 5FYJL 3E8UH 3ARBD 1MCSA 1XH0A 1JPFB 1EUTA 1CLOL 1R5VA 3U9UB 3GM8A 2R0WL 3CDZA 2X1OA 3U25A 4ODXA 2WNGA 3V4VB 4N8CL 4U1MA 1CBVL 5KN5A 3X3FH 5E4AA 3VXRE 2R0LL 5EOTB 3NN8A 2YPLA 1MCBA 5DFVC 4L4VD 1JFHA 2LE9A 4AJVA 4F2ME 1U4FA 4I9WE 1C7SA 3MLWL 5T5NF 4Y88A 5I15H 4LLVA 4A2MA 3ZKMD 5IB4A 5FFGA 3RIFF 2HT4D 2DYSB 4G6JL 3VFRB 5A6MA 5IEHA 2WVVB 4N9OB 1UKSA 2G2RA 1G7IB 4A2GA 1T5WB 3IDNA 2UY7A 3B9KA 2AQRA 5ISZB 4MAYC 1U8HB 1FZMA 3UTPE 5B8CA 3U1SH 2XN0A 2AEOA 5ITBL 2WQRA 2XQYK 3MACH 2M1KA 3WN5A 1JYWA 3SIKA 1A3RL 1HHHB 3V4UL 4LO9A 1EEZB 3MI6A 2UXTA 1FYTB 3PREA 3KPSE 4JPQA 5EORL 3K72B 1V7MH 3UBXA 3B5HA 4I18C 3G6AA 5AD0B 4IU3B 2FECI 5KZCB 1AFVL 2XG4B 1JUFB 4URTB 2VDNL 2E6QA 2EKSB 4FFTA 2GK0A 5DVLA 1AYRA 1G1OA 1TZ8A 2BOCB 1IC7H 5GJSL 2PETA 1ZA3A 3FB7A 3HNTH 1Y1UA 4GKNA 3ZDYF 2ZPKL 2VDRL 4XVTH 3HG1B 2OCCB 3TPUB 4Z77A 4KZEL 5J6GA 2E9GA 2R0KL 4N68A 4AY0A 5J06A 4TVSa 5A2IH 4AEFA 4GRLB 1FFOA 5FDWA 3KGRA 3GSWA 4BK4A 4F8PA 3CZUB 1RY7B 4D0BA 3TNNA 1E9OB 4NDMB 1I7ZB 4IEFA 4R4BA 1BFOA 1JWSB 1AR2A 3CFNA 4LBEA 2NW2A 4UQEA 5E94B 5F89A 4XAWH 4PHZA 3NCBB 2VE6A 1FZJA 3P77B 3HFML 3PWVA 1NAKL 1OQXA 5ITFB 3QRLA 1AGBA 1UA3A 1X5ZA 3BP5B 4R7DB 3RURA 1I7TB 1KDJA 3WNOA 2AJSH 5KSVB 1RZGA 3PP4H 4WW2F 3WO4B 5ID0B 1UASA 3PGFH 1UM5H 1KCBA 2IBZX 3LAFA 3QWRA 4ONFH 4Z7NB 4I8DA 2BSRA 2YKKA 2XKNA 3UPAA 4F8TA 4Z7OB 2GKIA 1CBVH 1IAII 1VCBC 4AGOA 3QJTB 2FJFB 4J3OC 1VZHA 1KC5H 1XL6A 4RGMC 4RZKA 2ZOUA 4O5LL 1SPDA 1VACA 3NBNA 5MI0C 3KPLA 1HXMB 1EGJH 1YC7A 4MWFB 2ARJB 1FL5A 3CN1A 2YAPA 4PRDB 1OOWA 3DROA 1QYGH 3FUJA 4WKZB 4ONOA 1NGQL 1O6TA 4JKKA 5DVKA 3VNYA 3QG7L 4LRIA 2QQNL 4U0RC 1PGRB 1GIGL 3JZ7A 4UINH 3ARUA 3PWUA 4GRWH 1KUMA 1NPNA 4WIQA 3KLAA 1E9PB 5MEPA 4Y2DA 1C1EL 2J8HA 1P2CB 4X6CA 4X6EB 5FYKD 4AIEA 4UT6A 3S3DB 4LPWA 3U6RA 2FQEA 1O0VA 1IGML 1FH2A 1GKOA 4JFOB 4YBQC 2OXHB 1WIOA 3WIHH 4C56E 5JOPD 1DQVA 5BZWA 2EYTA 4GUQA 4UUJB 1KBGL 1X44A 4ZUWA 1N4XH 1FVEB 1UJ3C 4CN4A 1GAFL 3POCA 2BY3A 1COBA 4LXFA 2HFEB 1WBYB 1PLBA 3B2UC 4K8RH 4R7LA 2YRBA 4Y2OB 3S34L 3UIZA 4E0RB 3NVQA 2AK4A 5D1ZB 4DZ8A 4KI5C 5SWZE 1QFWL 4WI0A 1DQMH 1BFTA 1EV2E 4QD2E 1ACXA 3RBSA 2MKLC 2ERJC 1Z32X 2VJXA 3MGTB 2OMTA 3NN8B 4MMXB 5LKNA 1K5WA 3P3TA 4AT6B 4B0MB 5JYMA 1YYMH 3D2UD 3LRKA 3KYMB 4O2CA 3OJDB 1MHEA 4TLUA 4KJQD 1OCCB 3OJMB 5KTEH 2BMKA 4G7YH 4MS8D 1BQUA 4YDKL 1JNHB 4XCCH 4TRPL 2B0SH 4YK4C 3CVHB 2CUAA 3HHRB 2ISDA 5AW4B 3ZYOA 4JFZL 1X5IA 5HGHA 5SV4A 4GXVL 2J1WA 1EAOA 5JHAA 1FZOB 4R26H 2P49B 1N2RA 4LP5A 1MHCB 3ZK0A 1WV7T 5C9JB 1FLTX 4AE1A 3HPLB 4YSRA 3LZPA 4DP1X 4HXAH 4ZPVB 5D7LE 1WD8A 5CEZL 4K23L 3D2TA 2APFA 3BMWA 3ZDXF 4XP4L 1P0SE 4D9LL 3QPQC 4GAGL 4AENA 2NX5D 4LAJH 3RILA 2OV0A 4FNSA 3LKQB 1IGJB 3BKCL 1A4JB 4PQXA 2DIJA 2AQTA 3L1OH 5HJDA 2GJ6A 3IKCA 1TZIA 1RUKH 1S7VA 2H4EA 1KIQA 3HN3A 1M4KA 3ERXA 5EEUA 2NQ3A 3A47A 4LPYA 4OUUA 3MVSA 2BC4A 2QHLA 1CD1B 5CZXD 5HHME 1KMGA 3QR2A 3PP4L 1RJZA 5I1EL 2ENQA 3CMGA 3ZTNL 4YDIL 4M56A 1UZ6E 5K1VA 4JZOB 1U8JB 2EIZB 1BZ8A 4LBAA 4Z7QB 3N40F 3T3MB 5D6CA 3C8HA 3VFTB 3RGBA 4KQ4H 4XNBA 1Q4NX 2B20A 1G94A 4RZCB 5HJBA 1JUFA 1T4WA 2VE6B 2G60L 2BNUA 1RP9A 2N0KA 1MKFA 2FH6A 4MDJB 4E9QA 4UT9H 3V52L 2HJLA 2EUWA 4LARL 5DK2A 2B1AL 5CCHE 1NFKA 5D96B 5E8DH 3MV8D 2D3VA 3PQYE 3CH1A 3ZZ1A 1NFDA 3OLEA 3CXFA 4CU7A 3MV8E 2I60H 3BP6A 4HWUA 1MY5A 2IAMC 2WLLB 4NSKA 1QKZL 4QCIB 4WEBL 1MFBH 2YSTA 1FFOB 5FDWB 1SLVA 2XN2A 2PP8A 5EZPA 1ZV9A 2BHZA 4P5TB 4V11A 4Y9BA 3SDCD 2DJ4A 5AVTB 3T4AA 1M7UA 2BSTA 4QGTA 6PAZA 4OFIA 4WUUA 3AFLA 4KJPD 5IK3A 4ANXA 3CVHH 5I6LA 1JHLH 3O2VH 3O8XD 3UG5A 1JCKA 4ZNEE 1SHWA 5AVXB 2X6CA 4JQIL 1JG9A 4E42B 3T8MA 1E9QB 1FH5H 3SE8L 3A22A 2ATAA 3LEXA 4L1LA 3GHBL 3WNNA 1DL7H 3FTSA 1PEZA 1WWAX 3BN3B 1I8IA 3PE9A 5DFAA 4LGPB 3S5LB 3HLAA 1OXYA 4RWHA 2V7NA 4WI6A 2DI8A 4YVUA 1RUAH 2QQKL 1QRND 2W65A 3ARFA 2WBJD 4XI5D 4WAFA 3SKJL 4UUJA 4WV1B 2WZPD 4FXGC 4S10A 3FO0L 4JFUA 3AROA 1T04A 3SBPA 5C0EB 3I6LE 4U31A 4FQ2H 3K2KA 2Q3XA 1GHFL 1KB5H 3MRGB 4NWTL 1JK9B 1TQSA 2DYRB 3OKLB 5C0GA 4KKCD 1OM3H 3ZKXC 2EH8L 2BIIA 5EOTA 2HRPH 2R29H 3BCFA 1DZBA 2DH3A 1F2XK 3DIDA 1G4MA 43CAB 3VTAA 5LBSH 4BIKA 4IBQA 1XH3A 1OD9A 3QFJE 2F7PA 2E75C 5TF1H 2AXJA 4JRYA 4XVJL 4GQRA 1T1YA 4EQ3A 4QRRA 1JAEA 1CFBA 4OLXH 2R1WB 3NCEB 3BWAA 3N85L 4G71B 2PPDA 2VDQL 4QTHB 5EU6B 2QPSA 3IDNB 3LSOB 3WKYA 1M3IA 1M3JA 2K78A 1U8HA 2WXLA 5B8CB 4OD1H 3PPSA 1WIUA 4XGZA 4K23H 5L2KE 3HE7A 3L5HA 4LSUL 3UBXI 5CSBA 3UC2A 2ZOLA 4C47A 1T89A 4JFPB 3HVDA 2YEQA 2YIHA 5JIHA 1SM3H 2N1KA 2XTSA 3ZDZE 4B9GA 2XQYG 2O30A 3RB5A 3K72A 4YUEH 1PKQE 2W95A 3TYGH 4PJXA 3ZE1B 3BN9D 4PJ5D 2LFGA 2F7QA 1YYLL 3LS4H 1EPFA 3C2AL 4AT6A 3SDAB 1ES0B 3Q8BA 2B0SL 5E99L 3BWUC 4EO5A 3D06A 1O6SB 3QP3A 4LCWD 4ZAKD 3H55A 4YSPA 3MZTA 4WFGD 4B3EA 5CD3A 3KG5A 1NANH 1PIGA 5D2LA 4PI2A 3MR9B 2WXKA 3CCHA 2EABA 3FRPB 4MMZA 1E5AA 5IBLD 2NY1C 5E2WL 5A2BA 3TO4B 2XVGA 1DANU 1RVFH 1DLFH 2WXRA 2Z7YA 3WN5B 4OLVH 2UXFA 4LNRB 4XCEA 1ZK9A 4OF8A 2VOTA 5GGSB 3MA7B 2EINB 2NZ1A 2XJLA 1A66A 3H3PL 4XBEL 2VO5A 1I7ZA 4R4BB 3X1NA 1XTMA 2NYZA 1BOGB 2WIMA 2ZOOA 5IB5B 3UAEA 1I1YB 4EBQL 4J6IA 4MZIA 3M17B 1AD0B 3FSAA 2ATKA 1I9RL 1INQB 3PWVB 4K73A 4WU7B 5JW4N 1RHHA 2IH9A 1E2VA 4AC4A 1JDCA 1EO5A 4OGAD 4HUUB 1AHKA 1I3UA 4HKJA 4RDQG 4ZUTA 3ZZLA 5IJVB 4WUUD 1XH1A 1CFVH 1HSBB 2V17H 5CJOL 1CFQB 1PYWA 1S7VB 4JG0H 2C34A 2K45A 1U8IA 3HG2A 4HULB 35C8L 4AYSA 1XXDC 1S8DB 2E7BA 5CGBA 3WDIA 5CEYA 4GXFA 5MEND 1BIIA 2WUBL 3GMLB 1C16B 2NR6D 1QI4A 3K6DA 3LIZA 2JKTM 5GS0H 4RA3A 1RD6A 2SODB 3NIGE 1CGTA 2WTRA 2XA8H 5F89B 1W0WA 3RVXD 4HOXA 4FJZA 4JZOA 4HVBA 2BHFA 3T4AC 3TX4A 3V6FA 4EN3D 5E7FA 3ROOA 7PAZA 1BVLA 3IFOB 5TE7H 5IKCB 3PAVA 4P5RA 3SHSA 2PF6A 1GSKA 4LVNC 2QELA 4UILL 4NKIH 1YN7A 4JFWA 1BXVA 3DETD 1Z0NA 5KSVA 4PW9A 2BX5A 2XLLA 4LLUB 4YHYB 1JXJA 3EH1A 4J3UA 2IV9A 5L2JB 1EFQA 5DA4A 3PNWA 5JQ6H 3CK0H 2ZYRA 3RVWD 2RD0A 1OSZA 1SMOA 2UWEE 3MLRL 8CGTA 1RUMH 3LXUX 3OX8A 3DX1A 3GQFA 3TT1H 4AKOA 2MHAA 4QRBA 2V9QA 5M7QA 1S9YB 4WWPA 3FO0H 4KXZH 4N6QA 3S96A 3ZL1A 1FL5B 4KRPB 1BWMA 4JFEB 3VXTB 1HH6B 2NY6C 3HUJE 4J4PD 4B27A 3T4AB 1X5AA 4CSZA 3LRGA 4WHYH 5IVXA 5DRNB 2BSTB 1BJ1J 4ZFOL 4Y2OA 5I9QB 5A2KH 4G6KH 1H5BB 2ZONA 4ELMF 5EUKB 2YAOA 4GAYA 3SYQA 1H15B 2N0MA 1X5GA 2YLKA 3DIFA 3WXVH 5EF1A 1JVOA 3L3OA 5H94B 4OQTA 5HGAA 1EAJA 2V5RA 4LFHD 3SQOH 5FEBA 2HXAA 2EDJA 3EOAB 4P04A 3ZDYE 4GOSA 5JPMA 4Z3TA 3WY3A 3MJWA 4GSDH 5FHBL 4LOEA 3NJJA 3RKDD 5I6XC 3FCSB 1CXHA 3QQ3B 1VAHA 3BIKA 4OI9A 4LP4A 1V54B 2R9HD 3FB6A 3QJZA 3V0EA 1UFUA 5IMOA 3GI9L 5CNHA 2ICCA 3CFQA 1Z9SB 4PLOB 2VDPH 3F7VA 2FL5B 5F0JB 3U0WL 1D5XA 4WWKD 3ECBA 3WDJA 5I6XB 4OZGB 2NSXA 3F83A 3KWUA 1AS8A 3RWFB 4HEMA 2P5WA 1CFVL 2OTUB 1W6LA 3D30A 2JQMA 2Z31D 4XGZB 1FCCA 1AQKH 1GYWA 5BV7C 4UTAA 4XE0A 2JVUA 3B9EA 5D7HA 5FOBA 4PJ5B 3FQWA 3S37H 4F8OA 4NBXB 1OTTD 1BSIA 2DLFL 2BNRB 1NIFA 2DLEA 3TOPA 1V7NL 2CIKA 4O2CB 2AJSL 2ZOKB 4AKPA 4GIOA 1CLCA 3QEHB 2W9LA 2X4TB 4GBXA 3LNIA 3FB5B 2G75A 5DJCA 1ZLEA 4B97A 1JNHA 1DUZA 3BIBX 3LN4A 3NZHL 5EH1A 1TSHA 1YECH 3BVUA 4ZUSA 2R1WA 1KBKA 1OD7A 1J1OL 5I0DA 3HZVB 1UACH 3LNGA 2CRYA 3MV7A 1N64H 3QFJD 2JE8A 4JHWH 3ETSA 5HYJA 4LKXA 1J5CA 5EC1B 4Z7OF 3ETBJ 2G2NA 4PJHA 4UM9B 3UJIL 1VFMA 4ZMAT 2BY1A 4QXGH 3S7GA 2JH2A 4ZD3H 2RALA 3WFDL 4BQ9A 4QRRE 4WWOA 3FTVA 1P7KA 5EBMA 3D25A 1WIPA 5INCB 1I4FA 3IF1B 1PZ3A 3DX9B 1E90A 4BZ1A 3GRWH 4XC3H 1AQDA 3N1FC 1FIEA 4XMUA 1RHFA 2MTAA 3UJTL 3NGBC 1HVXA 3BSZL 1X9UA 3A6BL 3VSTA 1FNAA 2VAAA 4Y2DD 1BEXA 4NO0B 2WUCL 4YHZH 5A1AA 2VMJA 1Z5LA 1UD3A 1IL1A 3H3BC 3TO4A 1TTUA 2V5MA 3IAGC 3VFWA 1HINH 3UO1L 4Z7QF 2J25A 1C8QA 3UYOD 2QMKA 2YQ2A 3BQVA 1PSKL 1KCLA 1CFNA 2Q8BL 5C0RH 5CCKL 1KIPB 4G8GB 2HMIC 3E6HB 3FUIA 3GSNL 4L23A 3ZT6A 5DD3H 1WC7A 2JI3A 1N64L 1HILB 2PXYC 3KEDA 1W0WB 3V95A 2QQLL 5JZ7D 3MYZA 5LCVA 4J3SA 4NQEA 5F3BA 1F13A 5I1IH 3ARGD 3WFCH 3WTXA 4W6WB 1X5JA 1E65A 2M2DA 4GY4A 2Z64C 4X8GA 3FYEB 1SHMA 4OVVA 4H88H 4NZTH 5D1QD 4NM4H 4XP9H 1AO7D 3P4NB 1MCNA 4HFWB 3QULA 4HEPG 3WEXA 5DD0H 4CGUB 4EIUA 1IUZA 2CBPA 1J8HE 4P2OC 3RE0A 4Z3IA 4XVUC 5DI8B 3N43F 3DXAA 4P4KB 1IGTB 2R0WH 3HC2A 4YDNA 4A6YA 2GABA 4PTUB 5DC2A 5DJ6A 5DMKB 4RBPK 1L9RA 5I8EA 3GJFB 3QQDB 5J13B 2VR4A 2VSMB 4GAGH 1BEYH 3K8MA 5JQ6L 3LKRB 4NI6A 1A6AB 1XD1A 5ICYB 5C0AB 1P9MA 3QJFA 5AAMC 1E3ZA 3VXPB 1YN7B 4Y8AA 4YBHA 2J3SA 1WCBA 2K9UA 2DM3A 3KPTA 2J1KA 5G55A 4U4IA 4BKSC 1CZ8H 1NTDA 4GQ9L 2Q1EA 3NCWA 3PDDA 4NNYA 5T1KA 2VDLH 3LPOA 1H8SA 5EF2A 1NICA 3T0EE 1ZE3C 2CO1A 3DJRA 1XH3B 4YE4L 2OX5A 4AUUA 4MJJA 1NCCH 5DMIL 1RURL 3VD4A 3CXDL 4HT1L 3RA7H 1A6UH 1MG2C 3MUZ1 5E00A 4EI5A 3M8OH 1A65A 1OM3L 1N9PA 1TYEB 1NCHA 3CUPB 4JE4B 5F9WC 3B2DC 1GKEA 2I9TB 1WUNT 3VXSB 2B77A 4MKTA 3WY4A 3K7UA 3X1FA 1L5GA 5JIDA 4OJEH 1UH3A 1GVIA 5DRNA 3MRGA 4PJDB 5GSVA 1EZLA 1QASA 4GQZA 2YZ8A 4IM8A 2EAEA 3OC5A 4H4NA 1D6VL 3KXFA 4PJCF 3VGAB 4P9MH 5ACLA 2F9BT 2BXZA 3H4FA 4EVNA 1JF1B 1IIIA 3ZOAA 4A7GF 3O6FD 5AVQB 3FW6A 5EN2A 3UC0L 2DW5A 2J73A 2KDGA 4OGXH 2CBTA 2PWFA 5KVGH 5AOZA 3FTGA 5IVNA 3S37X 1REIA 2ZOKA 3PV6B 1CL7L 1D6EA 1KYOJ 4DW2L 3FB6B 3I75A 2R27A 4NKOB 1KCRL 1WFMA 4GG8B 5IROA 4HK3J 4Y7MA 5LDSA 4U2YA 2EC9U 4R5TA 2R83A 5MEQB 2AABL 5HI5C 4BFKA 4OY9A 5KVEL 1NCOA 4BFBD 4XZUB 4PRPD 1XV8A 3GHEL 3ZHLA 2DI7A 1SVBA 3QCVH 1M9SA 5C08A 3UACA 2KLSA 4M62L 1PZCA 2Y7MA 1JCVA 3WLWC 4HETA 4B9CA 2YS4A 1N10A 4RQQB 1O6SA 1FLRH 4IU2B 3SD2A 1U3NA 4N28A 2C4FU 4LLAA 3QJRB 3VW3H 4OLXL 2ZNWA 4CMMB 5BVJA 1OP9A 2Y07H 1M7DA 4KROB 3EO0A 3CCHB 2IQ9L 1HSBA 1N18A 3UYPB 1XL4A 4RGND 2XICA 3LQMA 5DT1H 3MV7B 4QXGL 4RMSA 1A3ZA 4X5WB 3H9YA 2EDYA 4MRBA 4ELME 2H2SD 4UDTA 4KVPA 5C7XH 1DBML 3O11B 1CR9L 2B8OT 1X5KA 4BSJA 2BSDA 2A9DA 3F01A 5DHVA 2KZ1B 1YY9C 3ZMRA 2DBLH 2DF3A 2X4PA 2R59A 3QHFL 4Z7VF 2EDWA 4BFRA 4Z3GA 4F58L 1XHHA 3FTUA 3RZCA 5LBSL 1HHGA 4WEMB 1E4XI 4KRPD 3ROOB 2YAMA 2Z91A 3IFOA 5K5YA 2DD8H 4DP4X 3Q3GA 1HILA 3X1EA 3RG1C 1BG1A 2EH8H 3VXMA 4YFLI 1KLGB 1UATA 3BO8A 4PJIA 4ZMLA 4PJ7B 2B2XH 3A4EA 3EYSH 4WZ9A 5E7BA 2GK0B 4O9HH 5BS0A 2JCCE 4QRQB 4ANUA 5KYXA 3HNTL 4MQXD 2AXWA 5GGTH 4DGIL 4Y0GA 2O5XH 3LYRA 3X13A 2HJFA 3ZL2A 1LK3L 2X4NA 1WH0A 1H0DB 1S5IL 4YEEA 1N70A 5T1KD 2Y6SC 1AO7E 4E9TA 1ZD6A 4Y4HA 3ET9F 5EU3B 3G04A 1QZ1A 4OT1L 2WB1A 4W6XB 4YN3A 3QWQB 4EN3B 4Q6YA 4JFEA 3TNNB 3ARED 2WN3A 4QF1B 3VXTA 5I8OH 4JREB 4AXWA 4IMLA 2FTAA 4TL4A 3U2JA 1PX4A 3T0AA 2HJKB 1HEZB 1BVNP 1E2WA 1JHKH 4APXA 1NMBH 1BQHG 1OHQA 1XB8A 3AXIA 3O0RL 4E9WA 1GL4B 3GDBA 1E7VA 1H6FA 2JJSA 4OIAA 5DC0A 1URZA 4JRXD 1IEAA 1VA9A 1QBLL 1JI1A 4UYPA 1MIEH 2MHAB 2VR5A 3FU8A 4NN7B 4QRPA 5GRUL 1SNRA 1S9YA 3OQ3B 5K69A 2WP3T 3ESUF 3HA0A 1JGDB 1N68A 3PABB 2I5YH 1KYOK 2DOCA 4UOZA 5T3XE 4KRLB 2PYEE 2X88A 5I23A 4GI9A 5CWSB 2AJZB 5ANMA 3EXLA 3QIUC 3MXWH 2R23A 1DSFH 4XOCA 3WV0A 2A6IB 5HGDB 1N6QH 3DUSA 1A6AA 3U9UA 3AW5A 4XVOA 4EQ2A 1AY1L 1MLBB 1ZXKA 1UM4L 2CO7B 2YPVA 3LN9A 3MRLB 4GW4A 1F1AA 2OSLA 2VLJA 3LXBA 4OCNC 3WUWA 4ZW6A 2EVGA 1ZJBA 1IO4C 1DFXA 5C7XL 1L0PA 1BVOA 4QGYA 4IBLT 2B14A 3US1A 2J5LC 2DBLL 2X28A 2J4WH 2VIRA 3CZLA 2VXQL 4OTXH 1FJ1A 3ZRCC 4JY5L 4NYLA 3VXNA 3PV6A 1J9QA 3CUPA 2EDHA 2WV3A 3I75B 4ZG1A 1UFGA 1CI5A 5IOKA 2GHZA 3MLYL 3CFMA 3G6DL 1L7IH 3BT2L 3PFQA 4AGLA 3MQIA 1QI3A 2R2EA 3VRLF 5AYQA 1N7ML 3U7YL 5IIEA 1BJMA 3UGEA 2VLRE 1UKQA 1S7QA 1V27A 4DETA 1LK3H 4MMZC 4PJHF 3Q5YA 4LLVB 3O3AB 4Z8FL 1S2EA 1B3JA 3O41B 3VFRA 3K0WA 4RAUA 2VLLB 3JZYA 5HPOA 1Q90A 3AS3A 1HJCA 5AVRB 3KBEA 2G2RB 1D6EB 2P48B 4EZMA 2JKSA 4NUMA 2UY6A 5C09D 1N6UA 3GKWL 4AC2A 1EK3A 3H56A 2XG5A 1KCUH 4G6KL 5MEQA 2ZXEB 3CVIH 1GGCL 1ROCA 2K7QA 4S1DD 4F58H 1QABA 4F9LA 3ULSA 5C2BL 3ATFA 4PSPA 2GBUA 3CMOH 3QR0A 4GRLA 3B9KC 1FYTA 4IOSD 1F1DA 1Q9OA 1D7DA 2X38A 4P2CG 5EN3A 3NP4A 4JDVA 2OS7A 1ADQH 3L3OC 1YPZF 3DDFA 5AKRA 1GGIL 3ARDC 1WGOA 3VXMB 3GS4A 3JV4B 2XTJE 2NUPB 3L4VA 4JRYD 1IX2A 5T1DL 4EXKA 2GJ6B 3HG1A 1YNLH 1FGNL 1OAQH 4L8BB 2EDTA 1I9IL 3K6OA 3I02B 3VWJD 3DK2A 1TJIH 5D93B 3Q5OA 5GSRA 2VXQA 2IDCA 4PRHA 1TJMA 5AAWA 5FO8B 4A7UA 3KEHA 1DBBH 4HQQL 4UTAH 1IKFH 2GBAA 3QUMB 4OF0A 4RMBA 4U1HB 4DEUA 1KB9K 1P4LB 3CX5K 1MHHB 3MTXA 2NW2B 3ARSA 2JXMB 4XMVA 3T2QA 5LGHL 3D9AH 1OF0A 2QTEA 3CZFA 3IETB 1CB4A 3DOHA 3TH2T 4WKZA 1G43A 4LVOB 3QDJA 4PRIA 5A3ID 5I66A 3F7LA 4YX2L 4B9ZA 5SX5K 4TTGA 4LU5H 3RPBA 2WXPA 3WD5L 4LMQE 3D3VD 4GBXC 2BDNH 1S5IH 4M8RA 4KTYA 2WLIA 3RWDB 1E7UA 2H5UA 2M26A 1NFIB 1TVHA 4ZX5A 4Y1TA 4EI5D 4HCFA 3L3DB 4M6ML 5F8QC 1BGXH 3ECWA 5DMKA 5DJ6B 2EYTB 4KY2A 2HFFB 2ZUTA 2CGZA 2W0KA 2JCCA 1C08B 5DJZA 1PY9A 1WVZA 4R4FL 1E5UI 3FQTA 4Q14A 4ICXA 1B0RA 3NIDB 3PV7A 4M00A 4U1JA 5ANMB 5F96H 2B7DT 4MA8L 5E1AB 2C1PA 2EIMB 1CD8A 2BSSB 2FBJH 4L2LA 5DS1A 1U33A 4N22A 1RURH 1XGYL 1MIEL 2CRZA 3W37A 3SPVA 4AJYV 1J8RA 4PLJD 5T1KB 1N0LB 1IZKA 2YGVA 5F9DC 1AZCA 3F04A 4UTBA 4DO6A 4J3BA 5FDYA 4G8AC 5CD5C 5TDPA 5FGSA 4R7VA 5I1LB 2Q8BH 1Y18A 1MCHA 1PNCA 2XZZA 2VN3A 1GR7A 1J8HD 1MHEB 1SN5A 4O2EA 1I9EA 3BPNB 4UNUA 5KYUB 1RIUH 1J12A 1SRDA 4WNSA 1WAAA 4WTZG 5HGGS 4I2XB 3FUKA 1DQKA 4ZS6D 5JOEA 3GKZA 5F7BA 3V0WH 1P5UA 2K6WA 1BXUA 5LQBL 3BVVA 1N2RB 4FNPA 3PJSB 2AI0L 4KDTA 5DQ9B 1DVUA 4TN9A 3M46A 3Q2WA 32C2A 9CGTA 5TQ2H 3OKLA 1RJCA 5K39B 1JF1A 4I48B 3UTZA 4UT7L 3BVXA 1IEBB 2Z9TA 2NY4D 4OTXL 5JIKA 2Q76A 4R4ND 3RZWA 1AMYA 3PWPE 3QUZD 4R83A 5F0LB 3RI5F 4WUUE 2CPUA 3LKQA 4JKMA 3ZUCA 1BFVL 3NQIA 3MLPA 1AR1D 1B0IA 1E27B 4OGYH 3QEUA 2WIIA 3V10A 1Y0LA 3W11D 4R5VA 2FVNA 3RWCA 4OFYA 4PVBA 4IKKA 4MHHI 1S7SB 2JCWA 3BKYL 3GHPA 4P99A 5CMAA 1UJTA 4LRIC 2X40A 3E80A 1MHCA 1DCEA 2HPOA 4HLZH 1HNFA 1JXGA 2EEBA 4JFHD 4PJEE 5FYLL 3T0VA 3WJLC 4NO2B 4BFEA 2BERA 5CEXA 1XAKA 4K8RL 4N8VB 4P4RB 1TQWA 2ZJSH 3VI3F 2ZOLB 4PRPB 2H26B 3D4YA 4OCRL 5B39G 2VO8A 3BLPX 1P1ZB 3L2LA 1G9EA 5CN2A 1MCJA 1EHKB 2Z4QB 3GMOA 3KJ6L 3A24A 4S0TD 5A16B 4M5ZH 4PJXB 5J12C 4IU2A 4AQOA 1ZS8B 4IGBC 1IAIL 1BBDL 3NEXA 5BRQA 1HI6B 1F4HA 1A6UL 4PJ7A 1NLDL 1E50A 1E6OH 1CLVA 4HCIA 5HYSB 3DO4A 1IGMH 3N91A 4TQHA 4A38A 4HLEA 1KIQB 5IB2A 1PX3A 3CSPA 1ONQA 1A7PH 3ULUH 2G9HB 1C1EH 2PO6C 1ASOA 3FRPA 3O6FB 2O5YL 1IGYA 2Z7ZA 3WJMA 5DHVB 3AXLA 3ECQA 1DO6A 4FTVE 2NYYD 2X4PB 3QO0B 4AYID 1WP6A 1JTOA 3IN2A 4G6AC 4MXVE 2OTWA 2P80D 4W9IC 3RNQA 1FPTH 3OXRB 1R5WB 3TTSA 4L1SA 5JQIB 4HP5A 3GI8L 3ZDZF 2W92A 1XIWC 1ZA6A 5CS7A 3SDDC 5LNGA 4XRCB 1Y6NR 2RFXB 3ULVH 5EBLB 3AQYA 2JB6A 4LCIL 5F7DA 4QHMB 2ICES 2BH0A 4CN1A 4MD5B 5BW7A 3ULVD 1LP9F 3JV4A 3LPFA 1PPIA 4KDTC 3ULUC 1JGUH 3DRQB 3OB0H 3NRQA 4M6MH 5DMJB 3NCJH 3QZWB 4KJWD 1WRFA 4L3EE 4TLKA 5HVHC 2W0FA 1O5DT 2BP3A 3P69A 2FECL 4OZIA 3GMRB 3U36B 1KGCE 2NZ9D 4LVNB 4YHIA 1NAMH 4YGAB 4YX2H 3OMNB 2OTPA 1TQUA 3VXQB 4PVNA 5C70A 2VLJD 4X99A 3H4HA 2NOYA 1Z7JA 3QDAA 2RAMA 2WWOA 1QWUA 3HG0A 3MRRB 4Y4KB 1VPOH 4I3GA 4XHJC 3TBTB 1YN6A 3GJFK 2WLIB 3RWDA 3V55A 1H8OA 3BE1H 4V1DD 5D2NB 1KXTA 1NFIA 4GP4B 1Z9LA 3QORB 1CGXA 3Q9QA 1PBYA 5A7BA 1N8ZB 2AS5M 1NL0L 1DANT 2I25N 4OT1H 4ZYKB 5LNDA 4MVBC 3RWHB 4WF7A 1QMUA 5JHDE 5BQ7A 3S96B 1LP9B 3FQTB 2NY3C 4I2XA 1ZRUA 3HI1A 4N2AA 3ZKSD 2BS8A 3L9YA 4R2GC 3MV9E 3SQBA 1NINA 5IIEB 1CC3A 4H7VA 2J56A 4HYTB 4N24A 5IVOA 1TQCC 3D5OF 3HLKA 4JFPA 5CLWA 2Z93A 1S7RA 2RHEA 2X10A 3FMGH 5HGAB 1MXDA 1U8NA 2AANA 5D1QA 2Y1ZA 4XO3A 4IBWA 2YPVL 3QK0A 1ES0A 1ND0B 1FA4A 1XEDA 4NT6B 1TITA 2QR0A 1J5HA 3GTVA 5LWYH 1T3FB 4U7MA 3U2SA 4XVSL 25C8H 4XP5L 5AKSA 3H9HA 2AVFA 2IH3B 5EU6A 3M45A 1A7QL 4XMLL 3IJHA 5IMOB 2WW8A 1OLZA 5A40E 1NMBL 4NOFA 2R2EB 2APVA 1ZHLB 1FNSH 1OM9A 1YHPA 3D85D 3PJSA 5ECGA 2QT6A 2F7IA 3BAIA 1LE5B 1Y6MR 3I2CL 4KI5E 1OZTG 1EERB 3IKKA 3O4OB 4TOYL 4CVZB 5JDSB 4Q0XL 5GRUH 2EXTA 4LE8A 2VLLA 1EMTH 3UBFA 2KMWA 1PG7X 4UB0L 3X2QB 5KYYA 2AV1B 1G6VK 4KQ3H 4NOBA 4AQZA 3B6SB 2GIMA 2Y06H 3AM8C 2VZOA 4JY5H 4P3DB 4YDLC 5ID1A 1KZQA 3PGFL 2B59A 4PRAB 4BFIB 3I3DA 4OH2A 5F1OB 3WHXB 1BQKA 1OGTB 1BVKA 4UBDD 3HHSA 1KNOA 5IMLA 3ES6B 1E5ZA 4EOWL 4PY7A 3EDJA 1OTUC 5DS8A 3GMLA 3JWDL 2VQ4A 4YL9A 2IDUA 3ZGHA 3VXOA 5JW4Q 5DDHB 3BAWA 4IBVA 5GRXG 2YQBA 5L88L 1LO3L 1W72H 4PI0A 5SWZA 4A67A 3JTBA 4BELD 1ADQA 5DR5H 3U30B 1KCSH 1UJ3B 43C9A 4AX3A 1JF5A 3MODH 4CVUA 3D4ZA 3O9WD 3W0WA 1PFCA 2F8VA 2X7LA 2CLZA 2EECA 4F5CE 5IB2B 4JG5A 3VJ6A 5EB9A 3C60C 4OCXL 3GHBH 3KPMB 1EMTL 1BF2A 2DV6A 1PJ9A 1X3DA 3P2TA 1AD9B 1MUJB 3UAJC 3WS6C 1AFVH 4PV1C 3IXAA 1R0AH 4HV8B 3CN3A 4OBSA 2CDGB 1I1AD 1WT5A 2EP6A 2XPYA 1C5CL 1PVHA 1QLEB 4G1EA 4FFYA 5F9JA 1FNFA 3HI5L 2WGXA 4G3YH 4OIBA 4OQTL 4AL8H 4MAUH 1JWMB 2OSYA 5GS1C 2BP8B 2BSSA 1A6TB 3U1SL 4Q2ZB 4I1RA 4OFDA 2SEBB 2QGEA 3GZOA 2RMNA 3KJ4C 4GAYB 3MRBA 4R7XA 4XMLH 5ILTL 1W2KT 2YD0A 5IMMB 4ALAH 1BDYA 4TKWA 5JMOC 1CTMA 4PP2A 4R97C 1AVAA 4NNPH 1YYML 3LZRA 3MLUH 4U6HB 3VWKB 1IC5H 2MTPA 3NEEA 3S35H 3WO4C 3OTTA 4YO0B 1MI5D 3IT8D 2CUMA 4BFOA 1L9TA 3QG6B 3CV5A 1QG3A 1AG6A 1MH5B 3L2NA 1SEQL 3MU3A 3ZBMA 4IKLA 3K6FA 4NP4L 5BQ7B 5DFWH 1CU4L 4JPIB 3TZVD 1LDPL 4M9PA 5IFJA 1MWAL 4N0UA 4ODTL 4ZT1A 4JN1H 1CWVA 1EXUA 3QSKB 4PGDB 3VNZA 1G87A 3BZEA 2CKBL 1N12A 4H8WL 3T6VA 2AP2A 3D12B 5ACZB 1T22A 3HUJA 4IK6A 1KXTB 2AEQL 3IS0X 1W6WA 4KI5F 4TV3A 4ZW5A 3L3IA 4XO8A 3IXTB 3POHA 4DFIA 1QR4A 2UUDK 4MXVF 1TO4A 1EDQA 2HKHH 1ND0A 3TXAA 1NMAH 2BK8A 1NBYB 2NTFA 1E30A 4J4PA 1TTBA 1Z9SA 5LGHH 2I24N 2FL5A 5BNXD 1J86A 1E28B 3ARYA 3HZVA 4YVNA 3L1GA 1HYSC 4GO9A 1P5UB 1DVXA 4NUPA 3NACL 1IEHA 5HYJB 4WUKL 2DWDB 4WU5A 1MCPL 3L4YA 3O3BB 1GXEA 5EUOB 3F7YB 2MWCA 5DD5L 5GGRB 2A2QT 2HTKC 5C3TA 3FQ4A 3EBIA 1MREH 1BIHA 1U36A 3TJEH 3AM8A 3EJZD 1YQVH 4NUJA 1G4RA 2FX8L 5FECA 3NA9H 3OMIB 1BGXL 4UMGA 3DA0A 3C6LB 2FRGP 5CJBA 4UT9L 4B9IA 4MD4B 3ZKMC 4M6NL 1MOEA 2CLVB 4GSDL 5FHBH 4KKAD 5HDQL 4TNEA 4DW2H 2BIHA 2VAAB 1UURA 4L5FH 4LCWB 3MBXL 2BFVH 1QNZL 3WTWA 3FO9B 4NO0D 2YUWA 5ID1B 3BGAA 2W9EH 2RJMA 3GXDA 3PUCA 4XXCA 2ERJB 2HG5A 5A43C 3GXIA 2Z31A 4M93C 5AENA 1KXQE 1Z66A 1G7PB 4FTDA 4P4RA 3U4BH 1ESOA 2V5YA 4FKKA 2ZYSA 3D9AL 3QZOA 2X05A 3MFFB 3C5ZD 2MPAL 1MCOL 2Z4QA 3GMOB 2F5AH 4YWGL 3OXRA 1T2QH 1RZKL 3QFDB 5I1HL 3L95B 3U1QA 4XMKL 4MB5A 3CHPA 4YDVB 2E4FA 4GUCA 1HCZA 5H4YA 1LO2L 4WEEA 5L4FA 4HC1L 3B6SA 1A7NH 1T0MA 3ZRSA 3UOAB 4UOJA 5EOCL 3QFJA 3TONA 2B5IC 3LVTA 3CK0L 3QZWA 4XP1L 4I9WD 3LH2H 3APNA 3QULB 1Q9LA 4JK0D 1DTUA 3DDGA 4ETYA 1FNHA 4KUZL 3ILDA 3VA2C 5BUAA 1EJ6A 1MCQA 1TQBB 3P0YL 4JO8A 4DP5X 1R46A 4UDTB 1JZGA 2NY0B 2D0FA 3KPMA 4W68A 2MCPH 5DEZA 3ETBF 3R06B 1AD9A 1MUJA 2CGRL 3GJEB 3EJCA 3KE0A 4RIRA 4JM4H 4KVNH 4RRPG 4C4UA 5F3HA 1NWPA 3QQDA 5DJ0B 4LLQA 1U3HC 4JO3L 4BK5A 3FH8A 3P77A 5MI0B 2OYMA 4UI2A 1GMIA 4U1GB 4RGMB 1EBPA 1NGPL 4GSXA 3LHPL 4WWKB 1BYOA 4FN0A 4XCFL 3RP1A 3TL5A 2A3TA 3QA3B 1OP5K 2JLPA 3HCVA 1RZGB 5EBGA 3GXPA 3WXVL 2ZQKA 5BS0B 1MEXH 4MNQD 4K3HA 2LW3A 2PNDA 2AJ3A 1OAKH 2Q20A 3IPEA 1LWJA 3X13B 4PG9A 1W8EA 2ENJA 1KJ3H 2ODHA 1GOGA 4L5FE 2P1YA 4A2DA 2VITB 1XGQB 1VACB 2PCFA 2F54A 3GK8L 4ONGL 2GJZB 1MCEA 2X4SA 2WXHA 2QZ5A 3EJPA 5CU9A 3PP3K 3KDMA 2UZXB 1GY1A 2MQ3A 4QF1A 1MJ7L 5JLZB 1RZIB 4JHWL 4NZRL 5HDRA 5KSBE 2CBOA 1ZGLB 4ZQTA 1CXFA 3MRBB 1FBIH 4MDIA 4RRPM 4E5XG 2JCCF 1IEAB 1QBLH 5B21A 4LNVA 2KZKA 3II2A 1BREA 4XWGL 2JELL 2OX5B 3SE4A 4U6HA 4AV5A 1CFSB 5GIRA 1HHIB 1J10A 4FFWC 4NZUH 2AC0A 2YD1A 1Z9MA 3DO7B 2MNWA 4XPFL 1VERA 2Z7UA 3PDOA 1JBJA 3TCLA 4AYFB 4YZWA 2CKBA 2VL4A 5DJ8B 2FJGA 4FS0A 5F9OH 3Q44A 2HX7A 4J3WA 1DBJL 4WY7L 4I3RH 2R23B 4F93B 3Q06A 2TSBA 2Q86A 3CHSA 3SDDB 1URLA 3QDJD 4HPOL 4PRID 1KJMB 4PLKC 4F7MB 5JO5A 5EWIL 2YUZA 1XT5A 3FUFA 2W8CA 3UDWA 1Z9PA 2W38A 3AWFA 3LQAL 1GW0A 3QJUB 1U8NB 5ITBH 3VWKD 5MEOA 1EWHA 1DQLL 5FX3A 3EF4A 1P1VA 2D0HA 2P45B 5I74C 4PLNC 4NM4L 5BJTA 2WCSA 3NCYS 3U2SB 4OCLC 5EO1B 3DVNB 5MENB 2ORBH 1P7QA 1GYVA 3D0LB 5BVJB 4WSKA 1OAXL 1M2OA 3F58H 1ODUA 2EKJA 4G5ZL 4P2QB 2KPWA 1FJ1B 3TVMC 3P73A 2NX5B 2BCKB 3C8KA 4ODWA 3HMXH 1JZEA 1XBDA 3BEVA 1CXLA 2E7MA 1QFUH 3N9GL 2CG9X 4PCYA 2CMRL 3T3PE 2ZUQC 2VQ1A 3NG5A 3VXOB 3M7OA 1R24A 3O81A 3QJOA 1U8CA 2XRAH 3B2VL 5SWSB 1JMXA 3QNXB 1BM7A 2JJWA 1A1OB 2F1BA 3KNBB 5DLMH 4M7LL 3HNVL 3RDTB 2WWMD 5F44A 4AG4L 4Y19E 4FQ1H 1HZLA 4MNGB 4RISH 5DTFA 5HY9B 4CMMA 3TYGL 1I75A 4TUKL 5IGXH 2IPKA 4FI7A 4G5AA 1UXWB 2RCSL 2ZKHL 3JWOL 1T0MB 4ZOBA 1A6VH 3QAQA 4QOKA 1AC6A 3DSFH 2W1NA 3E2HB 1YEIL 3RWGA 3DX8B 3SE3A 1Q9LB 5AALA 4NQDB 1YSOA 4MGXA 5L4MA 1JPSL 3WKML 2VH5H 2DEYX 3MGOA 4K5MA 5C09A 4BGDA 3T6ZA 1BP3B 4NN5C 1YPZE 1NCNA 1M2VA 1QHQA 1ZAGA 5BZZA 3PWPD 4NPYB 3WTSA 3UO8B 1VGKB 2AJYH 3NIGF 1P7HL 3MA9L 3K8LA 4L4VE 4L9LC 1G0DA 5F6IB 4K9EC 2GSMB 3GBEA 3L95A 3W81A 2HJKA 5DJYB 1FDLL 3ENEA 4KKBC 4IHOB 2C9XA 3VI4B 2MH4A 1CGYA 4POZC 1RH8A 5E6ID 5AOMA 4NZ8A 4EUPB 4MAYB 3L9EA 5DUBB 4K94L 1OT4A 4HZAA 3OKOB 1HOEA 3E0GA 1RZ7H 3L3GA 5TGBB 1U8PA 3EOTH 3L3JB 4QHKJ 2LVEA 4FL4B 4HX1A 3QZWG 4OFYD 3LS4L 3STBA 2ZSVA 4IKJA 4A66A 1EAQA 4XBGA 5EU3A 1NAKH 3TNMB 2AI0H 3IMTA 4U1HA 5JHLH 3OVUB 3N55A 5CJQH 2KH2B 4O02B 1MJJA 1NGPH 2WM0A 3PHQB 2F54B 3QCVL 2MQGA 1H3XA 1YLBB 3OKDA 3RVTD 1AGCA 4JDEB 3WAKA 4NBYB 3SO5A 3LXCA 3LKNB 4BUGA 4DNLA 5D7IF 4WWKA 2XWDA 2XPGB 2WVSA 3IVKB 4E42A 1SXCA 4LLYB 1WZAA 3QO1B 1OO2A 5EZOL 4F37K 4MDIB 3CZJA 4QEGA 4K5NA 2ADIA 2C1OA 4IKIA 4XVSH 3K80A 3O6KL 2DKUA 4XPBH 1GS8A 5GQBA 4WDIB 1FLRL 2VIRB 4PGBB 2V7NB 1QYGL 1MH5A 1NBYA 4D0DB 4NNXA 5HI3D 3QIBC 4JQVA 4OD3H 3ARFB 3KCWA 2PCFB 2A4CA 2GYSA 4U4BA 4HJ0C 4I13B 5H37H 3V0VA 1SDAB 1WICA 5AW5B 3FKUS 4JB9H 4L48A 4AV4A 1BZ9B 3L3HB 1CCZA 1HKLH 2DYPD 1MLBA 1FUNA 1J05A 3VG0H 3OSKA 5KVDL 4F7EA 4LPTA 3LRSB 3UPRB 3QEGL 3UADA 2FGZA 3W3BA 3QQNA 2VXSH 2PCPA 1MAKA 4FNLL 1BAFL 3UTSB 4E9SA 4ZXBC 4JDZB 3S3BB 4Q6KA 1SYSA 1EFXA 1JGVH 1RVFL 5C6WH 4WNQB 3QUMH 3Q2LA 3HIZA 4ZSOE 4ZFZA 2J5WA 3BPNC 4KXCA 5BVPL 3D52A 2B5IB 3PDOB 5F7LB 3NMEA 4W1TA 3CFUA 4BXVA 3RDJA 5ABZA 1V5JA 1HAUA 4DQOH 3C8KB 2CUHA 4F7PB 1PSKH 4ODSL 1NOAA 2C9RA 4S1SH 5B1BB 3ZTJH 3P2BA 4HUVA 2KLRA 2ICEB 1RUAL 5ICXA 3MNWB 3D39D 1TLMA 4QAWA 1YEIH 3SPHA 2BWIA 4W9JC 2HVKB 5T33L 4NUJB 2B16A 2MIZA 3Q8EA 4DT2A 2WD0A 4PJBB 3BN9C 5FKPB 2XZCL 2GK2A 4OLZH 3S9DB 2NXZB 1SJXA 1E6OL 1NBQA 3DVNA 5B1JA 1R5IB 3VDCA 4I88A 1Z3RA 3QEUB 3S48A 3TC9A 3BX7C 1UA6L 2DMGA 4G6MH 5J9PA 3EGSA 3VFSA 4PJEF 1Y7VA 3CVHL 4MB1A 2XG5B 4FXLA 3P1VA 3K6NA 5EU4B 3T0EC 2V3EA 1GW6A 2BSEA 4MZ3A 4PGEB 4G3YL 1FG9C 2YAHA 3DWTA 5E6YA 2DIBA 3RDTD 3FFDB 1FNEB 2VM9A 3A4DA 4N0FA 1MCKA 3HE6A 5FO7B 4AGMA 1AY1H 4PJAE 1L9OA 1KPVB 4OIIL 2JXMA 1MWAH 2P5EB 4YSDA 2XSKA 4DKTA 3ARBB 1UQSB 1RL1A 4M1DL 1AQMA 3VRLE 2H6PB 3D85B 5IHUL 4MQ7B 4AZ8B 2HLFD 2IAAC 2CALA 1IT9L 3SKJH 3WO3B 3U82B 4GAJH 5IJVA 1T2XA 4PJHE 1QO3A 3QEQA 1WBXA 1UWEL 5D7IE 4MAYA 5FHAH 1YUKB 3DHPA 3WS3A 4PG9B 3EHBB 3V5DB 4HKZA 1QW9A 2VSKB 1R3IL 2R2BA 1TKWA 2YXMA 3IWUA 3GJEA 3VD3A 5I15L 5D70L 3TBWB 4ESKA 4XCFH 3QHZH 1J87A 1RULL 4RIRB 4YLBA 1V7ML 5TF0A 3MROB 4RETB 4OLYL 3NCYP 3BP4B 1O6VA 2BVTA 2UZYB 2E8YA 3GO1L 1QHPA 2VDML 2XIBA 3H0TA 3MNVB 2AKRA 1H3PH 2D03L 3THMH 3W39B 5I19H 3WU1A 3QDJB 4KK5D 1ZSHA 1P7QD 3MX0A 4PRIB 2M83A 4TUOA 1LGVA 2CUIA 1GGBH 4LLMB 4X6DA 2WXMA 3KLHD 4E41A 4OKDA 2ZPKH 5C09E 2VLMD 1PKOA 3D05A 4K3DL 3O2WL 4PBDA 3I9GH 2WLJA 4JJ5B 3PWJA 3OKEA 1WO2A 3NZ8B 3L3DA 2OW7A 3BAKA 4Y5XC 4NC1E 5IHHA 5DUMH 1KIUB 1XGQA 3MSPA 4Q4EA 5IJBC 1E4KA 5KVEE 4JW3A 4GW1B 5FKAB 2FIKB 1ML0A 1DVFD 3KDMB 4ZUVB 1SQMA 1N5YH 5DJ8A 4O51A 3EYOB 3VVVA 1A6WH 1YY8A 2VRQA 1TTFA 5C0CE 3NSYA 3RAJL 5LCVL 1XAUA 3SGDH 2XVKA 2ZKXA 3NPSB 2ZAGA 3CMOL 2DYPB 4XPTL 3VGEA 2AEPL 4H8VA 1Q0XL 1XR8B 3PWLA 4AV0A 4DK6A 1ZLSL 4J2QA 4EDXB 1DLFL 3TIEB 2EUVA 1OAKL 3HB3D 4LLYA 3QO1A 3CAFA 3K0YA 3ESPA 5CP3H 3MRDB 3E9UA 5IB3B 4OZIF 3FCSA 5EEWA 1VFBB 2WLNA