1Z9MA

Crystal structure of nectin-like molecule-1 protein domain 1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
b'QDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAPA225
molecule tags Cell adhesion
source organism Homo sapiens
publication title Crystal Structure of the V Domain of Human Nectin-like Molecule-1/Syncam3/Tsll1/Igsf4b, a Neural Tissue-specific Immunoglobulin-like Cell-Cell Adhesion Molecule
pubmed doi rcsb
total genus 23
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z9mA00
5FYLH 4NHUA 1HKFA 3TT1L 4NZTL 1Q72H 1FE8L 2FX7H 4YPGB 3JV4B 3QA3A 1NGQL 4LLWA 4ORGB 6FABL 3MQIA 3VDCA 4G42A 1KPRB 4Y5XC 3FB6B 5C71A 2GAZB 2V5SA 4N0CD 1IVLA 1YMME 1UH2A 2P5WB 1DN0A 5DHVA 3KYOA 4NZUH 3RVWD 3VRIB 2ARWA 1E4KC 2YXFA 3QDGA 4N90D 1IM9A 4HG4J 3H2WA 4PY7B 5L2JA 4K9EC 3BESR 4JRYA 3A6BH 1N0LA 5I74B 3TO4A 1H3GA 3K74B 5GSVA 3LN4A 4HCRA 5KVDL 4JKWA 4MMZC 5JIKA 1AY1H 4OI8A 3STLB 2OMBA 1LO4L 3B9DA 3MO1A 1JPSL 3T8XB 2IG2L 4IOFD 2VQTA 1SYVA 2V2TB 2NY7H 2Z8RA 4K9EL 1DBBL 2ARJA 4CW1A 3FZUC 4YX2H 4QRUB 4M62L 5C0GB 4R0LC 2XTLA 1E4WL 3U82B 2LV4A 4KDTC 5CEXA 4PRAB 3PWPB 1QBMH 3EIFA 3T2QA 1KN4L 4DZBB 1U58B 1CI5A 3IFOB 3VH8B 2BXYA 4BSVA 3HHRB 5DXWA 1I75A 1EUUA 2EDYA 2MOVA 1F13A 2RIKA 4PRNB 1R3LA 1RUPL 2DKMA 3G5VB 4NQDA 3V6FB 4E41E 1WBYA 2CQVA 2F54E 4KPHL 4UAOC 4EUPB 2DTMH 5I8EB 1CCZA 1YUHB 3KHOA 5CKAA 4OLYH 4RQQB 4R3SA 4CVZA 3HNTH 1U8PB 1NCDH 1GH7A 3ZKND 1FHGA 4YXHH 3MYJA 4K23H 4X7EC 5KANI 1OLZA 3IS1X 4L8SC 4HKZA 1CLYH 1RUMH 2WK2A 3RX7A 1LE5B 4P9ML 4PFEA 5DYOB 2DS4A 3O8XA 5HHOB 5E5MB 4KKBD 3QNYA 1FDLL 3GSRB 4OCYH 2YD3A 3DVNB 3P4MB 4KJPC 4ZXBB 5EPMA 1AFVH 3QG6B 4K3HA 1PEWA 2MHAA 3UZQA 3VGDA 5IBTH 1VPOL 4LOUD 2P5EA 1V7ML 5AEAA 4WEMB 3VA6A 4Y5XB 5C09A 2R9HD 3FCTA 4UNVA 1CFTA 4GS7B 1KULA 4HWNA 2HFEA 4K3EH 5AAWA 3PP3K 1F45A 1KTRL 4J1UA 3AREA 3QWQB 2NXYC 1R3LB 1OTSC 4IRSD 4LVNB 2DYPB 5DK2A 5DD6A 4QRQA 4EUPH 1QNZL 2ILLA 2J8UF 4M6NH 4QRPA 5IUSA 5HY9B 3CVIH 3DLQR 5CJOL 3D2UB 5FKPA 5ECJE 3G6AA 4GBXD 1Y18A 3SDAD 1QLEL 4HQQH 3QP3A 4L29B 3O45B 4BYHA 5T1LA 1BVLA 2PW2A 3G5XB 4YHYB 1BZQK 4M1DL 4Y19D 4I5BB 4X5WA 2A6DA 5C0AB 2H3NB 3HNVL 4EQ3A 3QSKB 1IZJA 4JRWA 3UPAA 3IVKA 4HKBA 3AUVA 4JFDE 5DJYB 1BM3H 4DKFH 3EYOB 3MNWB 2P8LB 3BOVA 3UBXI 2AI0L 3GMOA 3FO2A 3EAKA 3U1SH 4RGND 4X99B 3VXMB 1FNEB 5GRJL 1J7VR 3EYSL 4BSWA 3DUSA 4JRYD 5HXMA 5ACMA 3SBWA 2GJ6B 2X1OA 3V6OC 5HGDB 4AG4L 1JRHI 1T1XA 4XI5D 3AB0C 3EUUA 3LEVH 1NLBL 1S3KL 5KS9E 4FTVA 4KK5D 3IB4A 2ATPA 1J05A 2OP4H 5FGBC 3FL7A 3IDGB 1QHOA 4MA3A 3T0DA 4U1JB 1H3PL 1XFPA 3BZ4A 3PQYE 4X98A 3DHJA 4YDIL 4R7NB 5MEOA 5CSGA 4CJ0A 5C92A 4QTHB 1RFDH 4Z5RA 1I1YB 1P7QA 5D5ME 1WZLA 3UJIH 5F8RC 1QEWB 3W39A 1DUYB 2I9LA 4ZD3H 3VWKA 3CU1A 5AD0B 1GGTA 3B9EA 3RWFA 5J57B 3G6JE 4JM2D 3LH2H 3IKCB 3LKSB 3KJ6H 2MPAH 1I7ZA 2OTWA 3VW3L 3BP5B 4ZDHB 1SJVA 3B2VL 1A02N 2J88H 1V3MA 1B90A 3DUSB 3NFSL 5E99H 3AS1A 3HC3L 4PYGA 4H88L 4FXGA 2BSSB 4X6CA 4HAFA 4GUPB 4Y1AB 1BOYA 5HPMB 4F8QA 5DMIL 2HRLA 5C0GA 3CXHJ 3OXRA 3ZTJH 1PG7X 1G1CA 3AS2A 1C8PA 2VQ1A 1A3RH 2R4RL 3LKQA 5EO0B 2VZ3A 1RJLB 4RGMC 3Q6GH 3MA7B 2X4QA 3MGOB 2H3NA 1JF5A 5GRUL 4MAUL 5GRVK 5KSVB 4RZCB 5HTSA 2MJWA 3NA9L 3HA0A 5DMIH 5CEZE 5D2NE 1T83C 4P46A 4P2OA 1K8IA 4ZAKC 1CXEA 2X9XA 3RUGA 4M93C 2OTUA 1XF4A 2YMXL 4M8QB 4TUOA 5EOCJ 1R0AH 1JNLH 2GJ6A 5KOMC 4ONFL 1A21A 4RAVB 3T3PE 3M8OL 3MRHB 3VFMA 3WIIL 3VMNA 3ULVF 4JPIB 4X6EA 4WGWB 3P4NB 4R0LB 4Z7NF 3L6FA 3OKKB 2IAMA 5J0BA 5EPMB 5A40E 5J1AB 3SE8L 2J6EH 1RZKL 5DJZB 2D7PA 3SDDA 5I9QB 5ACZB 5SWSA 4KROC 5IMMB 4EIZC 1XCTB 3KPOB 1BVZA 2QJDA 1AH1A 1BGXH 1RY7B 1DANT 1A6ZB 1MRFL 1JF1A 4WI7A 4ENED 5J1TC 1QO3A 3X13B 3OXSB 1W0WA 5HI4D 2AERT 5C0BB 1LWRA 1MLBA 2YPVL 2NYYC 4Y16B 3RDTA 4K7PH 4JANA 3MJ9L 3PG2A 3JWOL 1ED3A 2EDLA 3DX7B 5EZIL 5SV3A 2QEJA 1AHWC 2JJVA 4GKOA 2DD8L 3AU1B 4JQVA 3RY6C 2NXZB 1OAXH 2WZPD 1LE5A 3V5HA 5E70A 4WHDA 1EH9A 3PV7A 3JWOC 2RR3A 3MV7B 3NPSC 5JXEA 4M7LH 5LXGL 2PYFB 5K59F 3WKMH 3T77A 3IDYB 1W0VB 5KSAC 3GHBH 2A1WL 5T3ZH 1DFBH 2D03H 4F7PA 1IKFH 3BPNB 1KV3A 3HS0A 4X0KA 1JWMB 4OGZA 4OZGF 4XTRC 5FUOL 3OR7B 1A7OH 1MRDH 5D1ZD 3MV7D 3N9GH 3MOAH 2DL2A 4LHUB 3MA9H 1KG0A 1S7QA 1X5ZA 3GKWL 1IGFH 3DGGA 2BVUA 4XH2B 2APTA 4OSUL 4DQOL 4QRRA 3HLAA 3T1WA 2VR9A 5FYKH 3CFCH 1N5YL 2X1QA 4HBQA 3LMJH 4U1IA 5CS7A 1KACB 3EHBD 3MLZL 1A1MA 1M6OA 1SJEB 3G6AB 4IOIA 4MAYB 1DLFH 3UYPA 5F7HA 1DN2A 3B6SB 4V1DB 4OLZL 1VA9A 1OAQH 1EO7A 1UM6H 2I9TB 4S2SA 4IIQB 1X6NA 4KI5C 3UAJC 4A6YH 4BM7A 4N0YL 1JWUA 3VDBA 3BWAA 3PQYA 1AIFA 2NY3B 4F2MA 2FHFA 1AGFB 4ZUVA 4MJ2A 4F7PB 2H8PB 5IF0A 1VFMA 1RHFA 1JTOA 5F6IC 2RCSH 2CUMA 4HJ0D 4YHKL 3QI9C 3PHQB 3QQ3A 4QWWD 2KZWA 4EKXA 3NFNB 4XVSH 2APXA 4A6YL 2Q8AL 4PJAF 3EYFB 3LV3B 1KC5L 1LD9B 2DQTH 2BX5A 3PL6D 2NQCA 1AGDA 4YE4L 4DEPB 5GS0L 2ERJC 2HVKA 3BKCL 4ZFZA 2VDQL 1PLGH 4MMXC 3Q1SL 5A2JH 4K7PX 3VFVA 4RBPH 1B6DA 1F4YH 1LEGB 3INUL 2Z31B 4QTIH 2Y06H 1IM3B 4QHKJ 2W60B 1R3JB 1QNZH 4DVRH 4AENA 1XIWC 4QRRD 2W59A 1B2WL 4LK4A 3BDBA 1AHWB 5FK9A 1WT5C 5J12B 3HE6B 1NMAH 1EX0A 5F7WC 5I1AA 3T2OA 3ARSA 1XGYL 4KUZL 3WLBA 4X5XB 1BOGA 3MLUL 3H7LA 2ESVA 3IKCA 4P4RA 3WEXA 1MY7A 4NUGL 3NN8A 3QXVA 3LSOA 4NC1E 4C4KO 2EXWC 5D72H 35C8L 1N3NB 1Q0XH 4NZUL 4HWBH 1QEWA 3W39B 2I5YH 1LEKA 5JOPE 5CCKH 3GMQB 1GOFA 1C5CH 4NM4L 1SBBA 2NX5A 1OL0A 1SMOA 2VLJA 3VD7A 3MJ9H 4OQTA 2FCBA 1FPTL 3O4OC 4QHMB 2FZ3B 3MGOA 3T0VA 4XMKL 3O3BA 2NY6B 5CIPA 1X7QB 4DUVA 4NPYA 4JRXD 3OXRB 4RFNC 3NA4A 4P4KD 2Y25A 3HAEH 3VJ6B 1NBVH 3K8KA 5E8OA 4PJAB 4UV7H 3UTTD 2NY6D 4FFYL 3D2UD 3LKOB 5HHNB 1J10A 5MEQA 2EYSA 2WWMC 4N8VA 1EVTC 2N1KA 4U6YA 4ZXBC 2PXYA 4KMTL 1HNGA 3QDME 1JHLH 5E2UH 1N8ZA 4NN6C 4EN3D 5F9WB 3QHZL 4IS6A 4HUUA 1RPQA 4JKKA 1M7DB 5GZOC 4NOBA 1A7NH 4FQLL 4XGZA 2A6KA 1J0IA 5ERWA 1BVLB 3VFRA 1WSST 2UWEE 2GITB 1HILB 3VMPA 5I1JH 4R7DB 2IANB 4M5ZL 4U7SA 4UT9L 4PRHD 5C0RL 1HQ4B 1TTUA 4Z76A 4C83A 1AXSB 4HKJB 4R26L 3E1F1 3D0VA 1GXEA 1KLUA 3BKJL 4YK4B 5T5FH 1JN6A 4JQXC 5E8NA 4JRYE 1N4XH 4ODXA 2AK1H 5DQ9B 4RRPA 2UVEA 3SO5A 2HLAB 2R1WB 1AGBB 5IGXL 3MPCA 5ISZE 3LKPB 3B9VA 3DXAE 3AY4C 5HJ3B 3SGKA 3VFWB 5JW5B 1GOHA 1BD2B 4CVXB 1FVCA 4YDLC 2DLEA 1PGRB 3QUZB 2EIZB 4Z7UE 2FIKA 5DC9B 2CUHA 1K85A 1UWGH 3CFBB 5L2KA 3QUXD 5JHLH 1SYVB 3H6JA 3UTZA 1IGTB 5J56B 5KTEH 3BPLB 4G3YL 4KI5F 4WFEE 3T04D 4DW2H 5IQ7H 2GYSA 3O4LE 2HJKB 3A6CH 5E1AB 1MREL 2KBGA 4TSBL 2K7PA 4P2OD 1I9JH 4JM2B 4JHWL 3D5OF 3EO1A 4TPRL 4PJXB 3VG9C 5HPOA 5KVGL 3IU4L 2YZ8A 4WUUA 5FV1L 1OQOA 3HMWL 2R2EA 3BGMA 1OD9A 1T20A 1DQJA 5IOPA 5GJTL 3TBYB 2VXUH 4QRRE 2ZUWA 3NFPA 4YDVB 4PTUA 2CIKB 2W9DL 4JFQB 1NMAL 3O3UN 4RGOH 3CC5A 2D7NA 3C9NA 1VEPA 4I3SL 1DANU 2FJHB 4QXTA 2NY4B 4BSJA 2BNQA 2FX8L 1LEGA 3OKDA 2ZUYA 3GB7B 3SKMB 3TT1H 1CXFA 3VFVB 1IILE 3KYKH 3P9LB 1HKLL 4JJHA 4X7CC 3BT2L 4B41A 3VWKC 2P5WD 2WQRA 1X5XA 4U6HB 3OKYA 1EO8H 3B3IB 3OX8A 1BHGA 3LQAC 4DCQA 2FECL 3C2AH 5D7LB 1FG2B 3WO4B 2NR6D 3IS0X 2K1MA 3HG1B 4OZ4A 3CH8A 2VYRE 3GMPA 3L5WB 4PJ7F 1ORQA 4OCMC 4HIXL 3PWPD 3S88L 1WBXA 3KAAA 4IMLA 3MLYL 3NPZB 3LSOB 4DZ8A 4LCWD 1ZA6A 1JZ4A 5IQ9A 4OCWL 1ACYH 4Y4KA 3FTGB 3RVUC 5IHLB 4Y0GA 1IGFL 4ZUTB 5DEGB 3VFNB 2DAVA 3FQNB 3HUJA 1CF8H 3GMQA 4LCWB 3UJJH 5GS2H 1CFVL 2CLVB 1A6TA 4Y5VC 1IEAB 3OL2A 3RWDA 2IFGA 4DFHA 4U49A 3S96B 3UDWA 1MWAH 4YBQD 3ULUH 5C0AA 2FR4A 1U8MA 2VQUA 1KCVL 4LP4A 2HP4A 5I1AB 3GMNA 1MJ8L 5BRZB 5TQ2L 4GQ9H 4Y19E 1PYWA 4PR5A 4F37K 5C9JB 5DMYA 4BA8A 4PRPB 3QXUA 1CQYA 4RFEB 3U46B 1NGPL 3V5KA 3F7VB 5T3ZE 5EZLA 2VDRH 3RVTC 3RDTB 2F58L 1C7SA 1JK8B 2EDKA 3CLFL 5I1JL 1WEJH 3QEQE 4JVPA 1FL6B 4GMSL 4YWGL 5I1LA 5J1SC 1I1AA 4PJEE 4IDLA 4UZGA 4C54A 2ZCKL 3VXME 3IJSA 1QSEA 3DV4B 1WFUA 4P23C 1NMBH 1DR9A 3GSXA 2EEBA 1NUGA 4X9IA 3CH1B 2Q8AH 1SEQH 1D3CA 3V4UL 4MWFA 5DRNB 4KJPD 2A6JA 4LSQH 2FJFA 4KZEH 1IZKA 3N1FC 4YXLH 2CK0L 3OV6A 4LLVA 5KAQF 3FN0H 3WIIH 4D9LL 1EHAA 5EOCL 2M1KA 1KLUB 3IXAA 3CCHA 4FQCH 3QUYB 2GJJA 4YFDB 3LQMA 1ZV5A 4ONHB 1MIML 1YEJH 1FGNL 1IGCH 4BH8A 4DGIL 1HEZB 5AD0A 1T21B 5KG9A 2C3XA 1VACB 1XGUB 5IW6B 2VXSH 3MRNB 2H2SC 5C0AD 2FB4L 4JDVA 2XKUA 4BK4A 3ILQD 3O8XC 4OFIA 3ALWA 3T0ED 3GBMH 3IDXH 3TNMB 5ALBL 5FUZL 2QHRL 4LASH 4Z7UA 3CSPA 3TO2B 5CILL 4DGIH 2ZCHL 3WFBL 4ZQKA 3L95A 3BKYH 4DVBA 4LKXA 3WUWB 4HLZG 2W91A 5GJTH 2JCCF 5DVOA 3WIHL 3U6RB 1I3GL 2EECA 3HB3D 1MCEA 3C5JB 2R0LL 4NP4L 5IHZA 3GNMH 1OF2A 3GDBA 4PJIF 4UTAH 4OZFH 1INEH 3GK8H 1GAFH 1RUKH 1YECH 3NCEB 5FM4A 4P46B 4I3GA 1IBGH 1N59A 2IANE 4URTB 1FYTB 3FT2B 4K2UL 1E27A 1E4XH 3BIAX 2Q7YB 3U7YH 2ADGA 1ED3B 4M8QA 1KTDA 3ZDZF 5I0ZA 4MNGE 1X5FA 5DJAB 4OJFL 2K7QA 4OZGA 3HE7A 2EC9T 5ILTL 2NNAA 1OAKL 3LKPA 5IKCB 4LLYB 3QZWG 3AM8A 4TVSa 4YQXH 2VDKL 3VD4A 3VXRE 4NQCE 3G6JB 4XCNB 2APWA 1R5IA 1RZJL 4X6DB 5JXAH 5BV7B 3SDDB 4FFVD 1FNLA 1CFBA 4HXAH 4FZEH 2FL5B 3WBDA 4F15C 1DEEB 3KXFD 1P4LA 2MKLC 2NY4D 5DQJB 3P2TA 2MCPH 5FK9B 2F74B 4FN0A 3DX9B 4MD0B 1A9BB 2OL3B 1DLHA 2XFXA 4RMQA 3OSKA 4DN4L 4ZFOA 3QWRA 3HUJE 4X7TA 1MCKA 1CR9L 1PX4A 4KJQC 2ZOLB 3UJTL 5IVXA 1FGVH 1VKXB 4WIQA 4LSRL 1HHIA 3ARTA 4LLUB 2R0KL 4JKMA 4PJ7A 1H15B 5DD1L 1OPGH 2A6IA 2R0ZH 3RQ3A 1AGCA 3GBNH 3BPNC 2Y7QA 4JO1L 4X6DA 3B2VH 1F5WA 3EYQC 4EXKA 3MLWL 4YDKL 3PABA 2FZ3A 5HD8D 5E03A 2F8XC 1FIGH 3UO1L 3O9WD 1FZOA 4U1SB 1NCWL 4OUOA 2F5AH 1HOCA 4P4KA 1JMXA 4YFLF 5FIEA 2QQQA 1J12A 3TCLB 3P40A 2YRZA 3TV3H 4JHAH 4WTXA 4WHTA 5MEPA 4R3SB 4JQVC 2I9LB 2Q7YA 2EYSB 4P2YA 3UYRH 2G60L 3KPQB 4KH2A 5EU7E 1A22B 3HUJB 2GTWA 2HVJA 2XKNB 1WK0A 1VESA 4GLRI 3DROA 4X6CF 5LKNA 4TTDD 4DKDC 3GMLA 4UQ3A 1NEZG 1JV5A 3Q5OA 5EUOA 1QFUH 4NKOA 5E6IC 1RV6X 5F7MC 4NUGH 2YPLB 3TBSA 3KXFA 4HPYH 3QIUA 2R23A 1JIBA 1NGQH 5K9KA 2VWEE 4QNPE 2CIIB 4R7DA 4B7IA 1H15A 4MA7H 1GC1H 5BVJB 1YEEL 5SWZB 2OXHA 5D7IB 4S1QH 4OD1L 4NT6A 4AEFA 2F53E 1ONQA 4K7PL 1VGKB 3MUZ1 1ZSDA 3THML 1IAIH 4ALAL 3AREB 3W11C 2J12B 2WWMD 3MRJB 4P5TB 1JUFB 1I3GH 3M1BB 4JFOA 2JJSA 5I8OL 4WVRA 2K9UA 4MB4A 4MA1C 2VL4A 5JA8B 4M6OH 1RI8A 4XPHH 2QSQA 2CPCA 4HUKB 5F7DA 1MQ8A 5DHXB 1WLHA 5L2JB 5FCSH 1T6VN 3PV6A 4WU5B 3T65A 3I6KA 5E2VH 4EI5C 1Q9OB 4GRLA 3U0WH 3CVHB 2VZSA 5HVWA 3KPRB 1GJIA 1HYSC 1XGQA 1QKZL 2D31B 2ARJQ 4QXUH 5DJCA 3S98A 2EEDA 1U6AL 3MNZB 4PB9H 2FJFB 5ID0A 1KXTB 5T1LB 1C12A 1MELA 4OF0A 3IKKA 5ALCH 2CR6A 2UVFA 1NLDL 5EBLA 2A73B 2YEZB 1WFNA 3AY4A 4LHUD 2BHYA 4G9FA 1XZ0B 1ZGLM 4QOKE 2DBLL 4Z7WE 5D93B 4MCZB 3X17A 1A2YA 2AEQL 4XC1H 3MRMA 4NQCD 5BZDA 4XVUC 3JSSA 5MERB 4R6UA 4TTGA 5GHWH 3MV01 2X10A 3WS3A 4BH7B 2ZUVA 2JELL 1S9WA 2EDOA 4NZDA 4HG4K 4Z7QE 2VDOH 4ONHA 2W0FB 5CLTA 5GGSA 1DLFL 3QG7H 2BC4B 3VXUE 4W4OC 3S6CA 4FTVB 4ACPA 4J2XA 1GL4B 3HC0B 3G5YB 3MFGB 4N0YH 1KYOJ 3ES6A 2YR3A 3I75A 2E8YA 3SOBH 5H2BA 5LBSH 3DX8B 2V5MA 2IJ0C 5JPMB 2FRGP 4B5EA 5J13C 3HAEG 3PGFH 4C57C 4EZMA 5JPNA 1HQ4A 3BMVA 1A7NL 2OI9C 1KTKE 5HYIA 4HH9A 3SQOH 1A9EB 5BO1L 1AXTH 5HYJA 4UBDC 1FIEA 1IKNC 3DARA 4G6AD 5DO2D 4XVTH 3KLSA 3RL2A 1ZHKB 3D9AL 4MJ5A 4HKXB 2EDWA 2A9MH 1F4WH 4ODWA 5I8EA 1WWCA 4X7SH 1WBXB 3CVHH 1WIUA 3FQUB 4OF5A 3GSNB 2HFGH 1I1FA 3U4BL 4CJ1A 5C0CB 5IESH 5DC4B 5DZOA 1XGRA 3N0PB 2P8PA 2KKQA 4N8VB 4HWBA 2WIIB 5DWUL 3ARBC 4X6EB 1RZ7H 1MI5E 1P7KA 2OXGA 3DSFH 4BQCA 3VXSA 3L7EA 3ULUE 5I9QC 3ARUA 1VENA 3MLTB 1N2RA 1H3VA 4H1LB 5IMMA 1PSKL 2B1AH 4BFEA 4N0FB 2WBJB 2CLZA 4JM4H 3BWAB 3O9WC 1K4DA 1YC7A 3GMRA 1T04A 4XMPH 4MD0A 2P43B 1BIIA 4NZTH 3FT3B 7CGTA 1NCCL 1HHJA 1P4LB 2EE2A 4PJDB 1R24B 3SPVB 1DQJB 3WHXB 2I5YL 4GRWB 1GRWA 4PJXF 5C07E 1FORL 1RULH 2AEPH 5EO1A 3C8HA 5CEZL 4NQDE 4E41A 1CGUA 2X41A 1T80A 1XIWD 4K94C 1NDMA 3BH9A 2AV7B 5D2NB 3V0AC 3T2PA 3MLSL 3BXNB 3X3GH 3GSNA 2ICCA 5HI3C 4BFIB 3FB7B 5I73C 4UDTA 1U8HA 2IALA 2BOCB 2OJZH 4OF6A 5KN5A 1Q8MA 1JV5B 4MCYA 5ID1B 4NO3B 4OZGE 1AE6H 2VL5A 1UWEL 2YUWA 4NCC2 3Q6FA 3QXAB 1F8TH 4LU5H 1J8HE 4M48L 2E9WA 2VWEC 4Q6IC 4AEIL 3X3GL 4IRJB 1AHWA 4PD4J 2P7TA 4XNXL 5A2FA 4KKCC 4AZ8A 2CDFA 5JPNB 4Y1AE 2G5BB 4G7YH 3O6FB 5IBLC 4U1KB 4DK6A 1O7VA 3I02B 1AC6A 4NQDB 5JZ7C 2GFBB 2DLHA 5HYEA 5TQ0H 1C08A 2CJUL 1A4JB 3PIQA 4YHIB 1G6RL 1OP5K 3RIFF 4IBLT 5IROA 3VGAB 3HPJA 1I1FB 2Y4SA 1N7ML 1E4WH 5J13B 3LN5A 3DX7A 2Y5EA 3BZDA 1FDLH 2X4RB 3HZVB 3WNMA 2NZ9D 4MHHI 2NY4C 3VE0B 4KHXH 2VZ1A 5HGDA 5KOVC 4OCXL 1X9QA 5H35B 2Z8WC 4JFFB 4DK3A 3E8UH 5FF6B 3HAEB 4ZUWB 2NY3C 5TJWK 5KSBF 12E8L 4MJIA 4XNZB 4KDTA 4N0FA 2DQUH 2J88L 3H9HB 4PRHB 1GPOL 3W2DL 1N2RB 1ZWIB 2V17H 4X6CB 2DTML 5HYFA 3GJEB 1W0VA 1Y6KR 4QOKA 2IAMC 5D7LE 3MGTA 1QSFE 1S9VB 1HK6A 1Q9KB 1LVEA 3CSGA 2ZP0T 3RWHA 1P53A 3D25B 4PJHA 4YAQA 4M6MH 3FONA 3NGBB 4X4XA 1D5BB 1WF5A 4KHTL 1CL7L 3ULUD 2V17L 2MKWA 5J6GA 3ZDXE 5JHLL 1I8MB 5EWIH 1T7WA 4U1IB 1H0DB 4UQ2A 5KSAD 3WXWH 1YA5A 1G7IA 1HE7A 3CFKB 2ERJB 1D9KC 3L1OL 1HHGB 1GGCL 5SWSE 1ZLWK 2X05A 3MNVA 4Q9RL 2XI9A 5ANMB 3QNZA 3B2UD 3QDHA 5LAXA 1PX3A 5C6WH 4ODBD 3RKDD 1NCNA 2GT9A 4MQ7B 5DRWB 5KZCD 3S37L 3QFDA 4RFEA 1QA9A 3VDAA 2HFEB 5DA0B 4XP6L 1CLZL 2CMRH 4Y2OA 2GW5A 4YZFF 5D72L 2AI0H 3QEQB 4Z7WA 5CZXD 2GFBA 3JBG7 3WEXB 2ZSVB 3D39A 3FO2B 5DJ6A 3K8MA 1FRGH 5C0IB 3AC0A 1EAPA 3S35L 4HIJA 2JE8A 4YDJA 4PJEB 3F7YB 3RTQD 3CH1A 1HH6A 4M1DH 3BYYA 5FM5O 2NZ9C 3DVFA 3RWJB 4EOWL 4YDVA 3OJDA 4HF5L 1FNSH 1LP9F 2DLFH 4GW1B 3VG0L 4K7FA 3JTSB 1KJ3H 3QO1A 4Q0XH 1LDPH 4MHHG 3G5XA 5H35A 2NLJA 5DMGD 4CMHB 5HHXL 3C5ZB 4POUB 4GG6E 4I0PB 2IADA 3IDJA 3S3SA 4HH9B 2QADC 3PWJB 2XZCH 4LMQE 3UBXG 1O0VA 2DJSA 4K8RL 3ZYOA 2RBLA 1WCBA 5TF1L 4EOWH 1ZLUH 4Z8FL 4S1DD 5E1AA 2X6MA 3KYOB 1U36A 5I6XB 1D5BA 3FT3A 5DS8A 4UT6H 5E2WH 1ACZA 1BPVA 2J8UE 1ORSB 1A6VL 3CZFB 4BSWB 5HHMD 2J1KA 2HWZH 5CSZA 4A2LA 5FUCE 4DVBB 1ZVSB 4FQLH 4EN3A 3TIDA 4KQ3H 4GRMA 5JHDB 3O6LL 5I1IL 3IAGC 1IARB 3WXVL 1FP5A 2EDFA 2YPLE 3ARYA 5E00A 4JDZB 5CIPB 4F7MA 4UT9H 1U95A 3E3QC 2DQGL 5JUEL 4XPGH 1ZAGA 1NGWA 3V0VA 4OLZH 3PWPE 3X14A 1HWGB 1ZS8A 3QNYB 2AJYH 3N85L 4RBPK 4ZS6C 3WFCL 1S9YB 2BMKA 2P24A 4OZ4B 3KYNB 3PWJA 1PFCA 4EDWL 1I9IH 2CO6B 5FYKD 4U1LB 3EDJA 3PWVB 5JOEA 5C07D 3RVUD 4LCIL 4B7LA 4IRSB 1NC4D 5JR1L 4PJ9B 1FSKC 4IM8A 4LLYA 5HYSA 5HHQB 1T0MA 3O6FD 1NCWH 2K3TA 5C0ND 1JTTA 4LCCA 3FQNA 5I1CL 4PJEA 2X4TB 4OZGB 4XC3H 3V6ZB 5I73B 4NN5B 1BEYH 5TE4L 2J6EL 5BV7C 3PWLA 3FT4A 3UPCA 5ITFA 2V2XB 3BZFA 4LHUG 4KTYA 2IMNA 4HWZA 4F37F 5IBUG 5F93C 1NFIB 2JCCB 4PP2B 3PL6C 1AC0A 1KIPA 4TPRH 1TQCB 1MOEA 2V9TA 1RIVH 4YHPA 4JFZH 1CTOA 3O6FC 4WHYG 1PBYA 4LGSB 3EO1B 3CX5K 4ODVH 3DSFL 3O3AB 4PRPA 4UBDD 5GGSY 4ONFH 3WNOA 4YDKH 2VXUL 4PR5B 4Z76B 3CVIL 5H8DA 1QRKA 2EYTB 4G8GB 4MXVF 3UTSB 3L9RA 5IFHH 4KRLB 1U8KA 1HWHB 4UUJA 1ZHBB 4LVHB 3NOIA 3B9KD 2XKNA 2C7UA 1DUZA 3MRNA 2DI7A 4K94H 3D1MC 4EUPG 3Q3GA 5I74C 1NKOA 3TPKA 2IFFL 2LQRA 2PYFA 4MD4A 4HD9A 5D1XB 1FLRH 3MBEA 2YPKA 2YXMA 1DQQA 4D0BB 3V5DA 1XR8B 1KCUH 3GSNH 3U36A 1Q9LB 4GRWF 1ZA3A 5BS0E 4I9WE 4S1RH 4PJXE 4N0UA 4WI4A 1AD9B 3WSQL 3ZLQC 2EZ0C 3GSOB 1QSFD 3T0XA 2QTEA 3TH3T 1CDGA 4JFOB 3QI9A 4ZTOL 3BEVA 1INQA 3AXLB 4IRZL 4IJ3C 1ZHKA 3E2HC 4AEHH 1BJ1H 3ECBB 4ZPVB 3OAZH 1LO3H 1ES0A 1J18A 4HPOH 1UQSB 4YUEL 2GUOB 3L3GB 4PJDA 4X6FB 4KK8D 1YNTA 1HHHA 1MNUL 3LN4B 3RWJA 2WNGA 1RK0A 3GJFB 1A6AA 1QLFB 1DEDA 4E42A 4X4ZA 4HX1B 3S4SG 4Z7VA 4FQPA 1CGTA 1QRNA 1WIPA 5L2KE 4P5KA 3OAUH 2MCPL 5AG9A 3TCXA 1YPZE 5DO2C 2VLRD 4TULH 1MHPH 4WW2B 5KAQG 1K3IA 5MENB 1F42A 1LEIA 3LH2L 3MJGX 2MPAL 4MZ3A 2HFFB 3BO8A 5DRWA 1DJSA 1JNNL 4C56B 1S9WB 3SN6N 2W07A 1J0YA 3S5LA 2VNCA 1DQML 4XWOC 1IMHC 1P7QB 1T6WA 5FUCC 4MX7B 3BDXA 3BZEB 3C08H 2OCFD 4C4KT 3BXNA 5CKGA 2NNAB 4EDWH 1RJYB 4AY0A 4Y4KB 5FYJL 1T7VA 5DJXA 4TTDC 4M6ML 4DTGH 1KIQB 4FG6C 1JBJA 3LN5B 2C9AA 3T1FB 4GUPA 4D0CA 1JZ3A 3TH4T 3EDKA 3V0VB 1U8MB 5IEKA 3WUZA 4PJCF 1MAKA 3WFZA 1AD9A 1FNFA 4KK8C 4M43L 4PRPE 3U36B 1JGDA 3ZDZE 5IBUB 4LVHC 1L7TH 5AZ2L 4APQC 5DJ0B 5GGUA 5KSAA 1OVZA 3GSUB 1JN6B 4JO4L 4O5LL 4GKNA 4PJ5E 5GS0H 5I6XC 4M6NL 4Y16D 4HC1H 2X1PA 3W0WB 2AJSH 5IHBA 4GKSB 4R4FL 4R4ND 2C1OB 2IEPA 4GAJL 4TSAH 1S7TA 3SE8H 4ODUA 4RSVA 5HYSB 1XGRB 3FMGL 8FABB 2AXJA 5E0QA 2BRRH 4Q6IB 2NY2D 1AO7B 5DD0H 4KTEH 4OZFG 3AU1A 5GIRB 2ADJB 3SDXE 3Q48A 4WFED 4GKZA 2ZPKH 1R3IH 1UB5B 4CN6A 3U9PH 2WP3T 4HJ0C 5F9OH 3DURB 3CCHB 2J4WL 1YEHL 3HC4L 4ODSH 1KOAA 4LGPB 5DHVB 3ARGC 5IVZB 1J1OL 1OGAA 2Q6WA 4NQXB 5A3IC 3JZ7A 1Q1JH 4JFEA 1CD1B 3O4LA 2IQAB 3KPOA 3LS4L 3MACH 4I2XE 4OZHA 4LARH 2FH8A 1X5JA 4MXWL 5HDQL 1Q9KA 1TZIA 4KAQL 3GSWA 1INDL 5CUSH 1B0GA 2G9HB 4O2FB 4HUMB 1R5VB 2NZIA 2BFVH 2YD1A 4HIXH 3VXNB 4DZ8B 3ARFD 4PJ9A 4XMKH 3FB7A 4KUCD 2QL1A 4OCNC 1A0QL 5DUML 3UTSD 2WWKO 1HHKA 5HGGS 5E2WL 4J3SA 4C58B 4FABL 4RGNB 1SY6A 5T3XE 2EKSB 4M5ZH 4PP1D 3ARFB 1ZLWH 1UA6H 2OR8A 5JDSB 4KPHH 3QIUB 1CFVH 4ZD3L 1HI6A 3E2HB 1ZA3B 2UZIH 2YD2A 3PWNB 3QDGE 3QZWB 5IM7A 5EOQH 3FO9A 4ELME 4LSSH 1KG0B 2VLME 1RHHB 2X2YA 1R3KA 1F3RB 1Y0LB 5FO8B 4PJDE 3I9GL 3NABH 5F1IA 5DJ8B 4OD2B 3SDCD 4JPWL 4WUUE 4F80A 4OGAD 5B38G 2PXYC 1NDGB 2Z35B 2XNAB 1ORSA 4F58H 2AGJH 2P42B 4KXZI 5ICXB 5C8JA 3I6KB 1OM3L 2ZKHL 4E42B 4DWHA 3MBEB 3QQ4B 5F70A 1RIHL 4D94A 5F96H 1DBKL 5I1EL 3O8XD 1KPUA 2Y7QB 4HFUH 1QRNB 3ARBD 2ZNWA 3SQOL 4Q2ZA 1PEZA 1Z9LA 3TZVB 1LO5A 5BQ7B 5SV4A 5FB8B 5FYJH 1CXHA 1CS6A 1X3DA 3QIWA 1I3RA 3BP7A 3PHQA 4Y1AD 4WW1B 4IDJL 3MRMB 3DO7B 1SEBB 3S5LB 4NUJA 3IF1A 4XCCH 1E0OB 4M7JH 2R8SH 2E9BA 4C56A 2F8OA 1I1CA 3R0MA 5E4IA 3STZB 3IFLH 4CVXA 2HT4D 2V7HB 25C8L 4GAYA 1ADQA 4XCEB 3F7QA 3PIQB 4YHIA 1AGBA 1IAIM 3DROB 2YBRA 2Q8BH 3FQWB 1CFNB 1P9MC 3SJVA 4YFLI 4KRNA 3VXMA 4BUHA 4XT1C 5FDYA 3HTLX 1TTGA 4MWFB 1W2KT 5DRNA 1FNGA 1RMFH 5DDHA 1OOAA 3K80A 3MRRB 5KVGH 5L8JB 2YD4A 2XG5A 3ZO0A 3GO1L 4WW2C 4E9LA 4LRIA 3PWNA 1RUQH 2P5ED 5EU5B 2A6DB 5CMAB 1MI5D 3H9SE 1LDPL 2AXGA 3HKFA 3I84A 4GAGL 4HK3J 2J8UA 3BD4A 3BPLC 4GKSA 3DX6B 4AH2B 1QO3B 3X13A 1N64L 1CK0H 3QJHB 2LU3A 3KPSA 1A4KB 4KROB 4ODHL 4J4PD 3GRWL 4HGMA 3L3HA 1T3FA 5LWYL 3FZUD 1KB9K 3SKMA 5C8JB 3O4LD 4UAOB 1GC1C 2IBZX 2WQ8A 4FZEL 1MFBL 1LO3L 2I07A 2NY0D 1Q9WA 2X4NA 3VWJC 3SQBA 1A5FL 2DBLH 3PWPA 3P4LA 2GT9B 4ODHH 2AEIT 5EU6D 4CBPA 1ZANH 3OR7A 4Y8AA 3O3BB 5GGQL 3U6RA 1MFDH 4WI9A 2EICA 3MNVB 3QCVH 1MHCA 5INCB 3DJ9A 4OCWH 1WICA 4JAMA 2OL3L 3BP7B 1TMCB 3VFUA 4JFFD 3IVKB 2F53D 3U30C 5MI0C 4NZRL 2ATKB 2IPTL 5D7IA 3P30L 3ZT6A 2XTJC 3MRBB 1CF8L 5EUKB 4PGEB 1MFNA 1JPGB 2UYLA 4JN2B 4D8PB 4ZFFB 3B9KC 2JIXB 2E8ZA 2YRLA 3VXTA 3HRPA 5IJKC 1TJGH 3WS6C 3SGDH 3G5ZB 4IOIB 1KB5A 1KELL 5I1KL 4MNHA 4HSQA 1FO0L 1BQUA 2BNQE 3CUPA 3CU7A 1IEBB 3DV6B 1CG9B 1UYWH 3IFPA 4I18A 4XPTH 1H3WM 4MD4B 5I30H 4RAVA 4Y4HC 2IBBA 2ICWA 5FOBA 6CGTA 5LQBL 4FFVC 2A6JB 3VD3A 2ZZUT 1CD9B 4JY4A 1D9KA 2NTFB 3SOBL 3N1MC 1MF2H 4FQXA 5EFIA 2YUZA 5FKAB 1BZ7B 3BDYH 2X1WL 3LPWA 3TJHC 5E4EB 2V5RA 5CZVL 4HEPG 4LVOB 1ETZB 3MODH 5IVZA 4YPJA 5KSBB 3W5NA 3UC0H 4PJCE 1FL6A 3W9DA 4ZSOB 4XP4L 4LVEA 3SKOA 5FCUH 4NQEE 3C60A 4WTWA 4LLDB 3INUH 5DS8B 3RVVD 4XVTL 5CILH 1VADA 3NIDF 1RZKH 3QUXC 5L2KD 4NO2A 3D2UA 4MQSB 5FKPB 3SKNB 5IP4A 1MAML 4KJYA 1OSPL 5KVEH 4QRTB 3S36X 3O3DA 2MCG1 5L2KB 5ENWB 4FTVE 3RTQB 4J4PC 3MV9E 1U8NA 1IQDB 1MHCB 2HN7A 2N4IA 4ZPTA 4X80L 3G6DL 1NL0L 3WFHB 4K71C 3QUYA 3KDMA 5LGHH 4PRHA 3PP3H 5JPMA 3TJHD 4L4VD 2VR4A 4I0KA 2LAAA 3MOBH 1SVCP 3KWWB 3WUWG 4DEPC 2D0GA 5IM7B 5KW9L 3QWRD 4QRSB 1G7JB 3VGFA 1CDHA 4HIHB 2V7HA 4TQEL 4TSCL 3SCMA 5IROC 3MLSH 2YSSB 1IAIL 3STZA 4ALAH 4KJWC 3PWUA 3FO0H 1CU4H 4N1EA 4BKLA 4U1NA 3A67L 5I1DB 2Z0BA 3R06A 5E5RB 4YJZL 3OKLA 1BVKB 3N9GL 1T2QL 3E6HA 4YHYC 1JTPA 4LPUA 4XVJH 4NNPL 1A3QA 1NFIA 4WFGD 3TZVA 4I0PD 3KG5A 3DRQA 4L9LB 5FYKL 3WDHA 5D1QB 2FWOA 4EXPX 3EYSH 1YN7A 3MV9D 5BRZD 3Q0HA 1NPUA 2DKSA 4O51B 2A73A 2FD6H 2YEZA 2Y07H 1SY6H 3R1GL 5DT1L 4BSVB 4OM1L 1U3HD 3LKOA 2VDKH 2NW3B 1FBIL 4OF7A 5D4QA 3QPXL 3RGVB 1QPPA 4JRXB 4OB5H 2YWYA 4NRYA 1EZVX 5D2NA 2DKUA 4QCIA 5IW3A 5FGSA 1BQHA 3LKRA 2GSGA 5E2TL 4L5FH 4KRPC 4YGVB 1VFOA 2OR9L 5IB2B 1ZHBA 4L1HA 4RMVA 2GCYB 5EU3B 1BMGA 2BSTB 1FBIH 2R56L 4N5ED 4EDXB 3DV4A 3ZTJG 4K7FB 2AEWA 1N5YH 3MLXL 1Z6JT 3LKQB 3MC0A 1L0XA 5K9QG 5D70L 5LGJA 5E2TH 3PQYD 3RVWC 4P3CH 3KYMA 2WANA 1KC5H 3UBXA 4HXBL 5GGVH 3RWGB 4JKPH 4KWUA 5FGBA 4ELMB 5TDPA 1DBKH 4IOFC 2X4UB 4LL9A 1CR9H 4PJAE 5C09B 1QPXA 4PLKC 5EN2B 3O6FA 4HIHA 3SCMB 4MQTB 4P5TC 3ZT5A 1AD0B 4TUOB 4F15B 1S8DA 2Y72A 1T5XA 5JQ6L 4L3EB 3AM8C 1MHHA 2B4CC 1JNNH 3MRPA 5IBTL 3RWCA 1VGEL 5F1NA 4LSQL 1QFUL 1AGEB 1J5OL 3ZE2F 3F62A 3OG4B 4YK4C 2UY6A 2XZQH 1ITCA 1FIGL 2P46B 1KIQA 2DF3A 4W70A 4EVNB 2KQNA 5JIHA 4XVSL 2VKWA 5ICZB 4KRMB 1WTLA 1UM5L 4RWYH 4M1GH 2ORBL 4J23A 2CRMA 2VLJB 3OKNB 4JAMB 3ET9F 1TVDA 1U3JA 1FV1A 3ZYIA 5T1MA 5HI5C 4I5BA 1ZLSH 4I2XA 4P2RA 4YGAB 4OZIB 1I3VA 2XYCA 4FQ2H 5DRZA 3U30B 5LGKA 4G8IA 2XTJB 2LE9A 4G8GD 1GGYA 1XEDA 2ZPKL 3NIGE 3LIZL 3LV3A 1R6VA 1KUMA 3ARGD 4UIMA 5EBWB 3VRIA 2C1OA 3B9AA 2ICEB 4M5YH 2BHZA 2HVJB 1YNLH 4KI5D 1MCQA 3B5TA 2XTJD 4OCSH 3RZCB 3RBGA 2WMPA 3PGCB 4G8FB 2BNQB 3P0VL 5DK3A 4XCEA 4R4FH 4PD4K 3H7BA 1YN6A 5C7XL 4G6KH 4M48H 1KTLA 5CGTA 1UJ3C 1YYLL 1IC7H 5EZJB 1RK1A 1L0YA 1I9RH 3DMMC 1E4XL 4GXVH 4TN9A 3U7YL 4R4NC 1IC5H 1PY4A 2IPUG 1RZ8A 3KXFB 1NC2A 4AIZA 1UACL 3DHMA 5CSBA 2BP3A 3WCYA 3GMPB 3U9PL 5FFLA 4M7LT 4Y4FA 1OAKH 2MFNA 2HKFH 2P45B 1NBYA 2H6PB 3ZKXC 1ZT1A 1ZLVH 1UXSA 3VFSB 5FHAH 3WHXA 1X5IA 5C0FB 4RISL 4NQED 4WY7L 3I02A 4YHLH 1RZJH 1FNEA 4YEFA 5FUOH 5D7JD 2YD8A 3EYQD 4GAYB 5F7EL 5T3ZD 3RWCB 3J7HA 4P3DB 3KNBB 4PRBA 3TIDB 4RQQA 3RIAF 2XQBL 1TCRB 1MCDA 3O3DB 3ES6B 2B1HH 5BVPL 4IIQA 2FYYA 5I66B 1L6ZA 2DQEL 1G0YR 4FQIL 3NACH 2D4FA 2QSTA 4LSUL 4UTBH 1F4XL 2JLLA 1LMKA 3BFOA 3IDMB 3BZ4B 4JGMA 5E08L 2NXYB 2VXVH 4JEGB 1FN4A 1JWSB 3KYNA 4JFDB 3NVQA 2UZXB 3LD8B 3O11B 2FHCA 4XX1G 1AXSA 1F58H 4ZXBD 1S9KC 4QO1A 3WN5B 1BIHA 3GSQA 3L5IA 4RZCA 5IMKA 1JE6A 3HZYB 2GUOA 3L3GA 1IL1B 1UB6A 4UU9B 3V4UH 4ORZC 1V3LA 2C3WA 3RKDC 4G3YH 4GRMB 4J1UB 3REWA 4KHTH 1DQMH 4M6AA 4Z7OE 2BSTA 2FLRT 5HHOD 2AK1L 3IJYB 3L7EB 2UZYB 4JHWH 3TYGL 4U05A 4FFZH 4GSDH 1FGNH 3G5YA 4JHZA 3FRUA 3BVNB 4UILH 2JIXD 2Z9TA 4ZAKD 1QTYT 2OZ4A 3KPMA 5I1EH 2VLKB 4HT1L 2P5WA 4P9MH 4QOKB 5IB1A 1RQ5A 4X9GA 3HNSL 2D7OA 4OKVA 4RX4D 1MCFA 2FEEL 4GG8A 4M1CC 3V6OA 3SE9L 3IJHB 4O51A 1IAII 1AKJD 1JGLL 1FQ9C 5EO1B 5I2IB 3LQZB 1U8KB 1YC8A 4Y19B 1PQZA 4FQHA 2AJUH 1RUQL 3M1BA 5IMKB 5I17B 4YPGA 1M7XA 4FMKA 3CFJB 4OLUL 3ISWA 4O2CA 5CJ8A 1U93B 2XV6B 2NY3D 1AE6L 1IFHH 1NFDF 1VADB 3TFKC 1BQHB 2DIAA 3LKRB 4YDJB 4P5MA 3QNXB 5I76A 1CLCA 5JW3H 1NFDE 1BP3B 4KRPD 4MD5A 3T0EC 5FECA 2ICWB 5FOBB 2YPLA 3QDMD 1FFPB 1S78C 4N0UB 3P9LA 2CDFB 1NJ9A 5SWZE 4NFCA 2R1XB 3JWDC 1A6UL 1MCHA 3RNKA 4IRZH 4P2RE 5HHPA 4V2BA 5E2VL 2Z4QA 4XB7A 1BBJA 2BHUA 3OKEA 3MFFB 4OIBA 2CK2A 3D69B 4XNQB 4OCRH 2FH6A 5MERA 2VIRB 3VFOB 1S7TB 4A2MA 4OZHF 4GO6B 4KK5C 4GJTB 3UTTA 4FTVD 5KJRH 1SJEA 5ICZA 2D9CA 3AS3A 5BV7H 1TJIL 4KZDH 1VFAB 2V9RA 5DD5H 5EIIB 4Y4FD 5DUPH 3TBVB 3CFCL 3EFDH 3X3FH 4MDJA 4QF1B 1CICD 1HQRA 5EZJA 2DWDB 1A3LL 1FG2A 1KB5L 2NY7L 1KEGH 3KPNA 3BVNA 1I85A 5KSUB 3QCTL 1G9EA 2XQBH 4EBQL 3FB5B 3MGTB 5B3JF 2PO6B 1A9BA 1B88A 1UKSA 1MJUL 5IF0B 3LRSA 3QR2A 2DTSA 5DQJA 4TNVF 3FAWA 4F58L 3HE6D 5DQDL 4I48A 5I1CH 5DTFB 5IR1B 4GXUN 4ZUTA 4UB0H 1ZKAA 3QHTC 2XRAH 3CUPB 1NGZA 4KZEL 4M61B 5JLZA 3MBED 4YXKH 5HYJD 4J3OC 3CPLA 4HFUL 1J0JA 1QFWH 1FJ1B 3BE1H 3OZ9L 1FO0H 1AXTL 1QRND 1UM4H 1A1OB 1YEKL 4NRZB 3TV3L 1KJ2L 4J3VA 3L5JA 4NYLB 1JF1B 2DQJH 3BP6A 1NGWB 3HCVB 4R2GB 2V7NB 4LHJB 2QKIB 3MRBA 5EUKA 5H37H 2NPLX 4WENB 1T1ZA 2HKHH 2R9HC 1R3KB 2Z4QB 3VFUB 5DUBA 4LIQH 1U41A 3OWEA 4AM0B 3IDIB 1I8LC 1V7MH 4F7CB 1IAKB 4P4KB 2C5DC 1QVOB 2BNRE 5CGYD 2FO4A 5DD3L 5CBEB 2VN7A 3DECA 5IFAL 2HLFC 2FIRT 3GJFK 1B2WH 3BKML 2VDPL 1AP2B 4GFTB 4KY1L 3REWB 4XCCL 2D9QB 2IFFH 5HGAA 2HKHL 5F7NC 4RMSA 4RFOH 3D0LB 4L3AA 4UUJB 2FLBT 3KPLB 2GJ6E 2DI8A 4XMPL 4HK0A 4KROD 5ADPL 2VDML 3EJZD 2VZOA 3D3VB 4NDMB 5DD0L 2EO9A 4K8RH 2VH5L 4ODTH 2EE3A 3SCMD 1PG7W 4LPXA 3BQUB 4RGMB 1FRGL 5C08A 3QIWB 2PYEA 4PJ8B 2NY0B 1XH3A 1K4DB 2HAZA 2NTFA 1SQ2N 3IJHA 4QT5A 2VOTA 1F4HA 1S5HA 2B0SH 5IW6A 2G5BA 2D7TL 3LRSB 1PAMA 2VH5H 4ODTL 1L7IL 1MVUB 4MDIB 2CUIA 4ZAKB 2OJZL 3LS4H 2YC1A 4OFKA 2IGFH 4PRNA 3T4YB 3TYFB 5CSZB 5ETUB 3D85D 2YBRB 2M26A 4NQSB 5D1ZA 3UPRB 2PR4L 2OTWB 3VI4E 1RZGB 3KLAA 1GAFL 3W9EB 5IQ9B 5IHUL 2DQFB 1DBBH 5EIQA 4DN3L 1U8HB 2IALB 3I2CH 3V5HB 3BAEL 2FX9L 1CFNA 3QFJD 4OLWH 1NBZA 4POZD 3ARFA 2R4SH 4CU7A 1H5BC 4IHOB 1NFDA 2ED8A 4FP8L 1T4KB 3ALPA 5IK3A 4R4BA 2OSLB 1EMTH 4F9LA 4FXLA 3OAYK 5FF6A 1E6JH 1AQKH 2BY1A 1KT2A 2DMKA 1V05A 5KSVA 4K55A 1MJJB 4X8JA 1U8QB 5LVEA 1JZ8A 4MLSA 5BW7C 1IGJA 2XN9B 4PGDA 1MIEH 4P57B 4FQJH 4ZYKA 1FH5L 1RIUL 3W11D 3JVGC 3TA3A 1DLHB 2A77L 1AGDB 1INQB 3AXLA 3GKWH 5HJ3A 1AQKL 3H42H 1T0MB 4P59H 4CU6A 1V8HA 3KLHC 3DYPA 1FL5A 5BZWB 2JJWA 3O9WA 3HC0A 2DQUL 5TGBA 3SDXB 4X4YA 1JYWA 3L3HB 3QQ4A 3FQXA 2BRQA 1MSPA 2YZ1A 1RZGA 2X4OA 3F7RA 5CLWA 3ARVA 4L4TB 4F7TA 4QYOB 3D9AH 3GSXB 5GSRB 5IB3B 3QPQC 1KF9B 3WHE0 1JI1A 2L7UA 1I3RB 1U42A 3PABB 2QQLH 3MFFA 3GMMA 4U1GB 2PW2B 4N0UE 4P23D 4WUUB 4YHOL 3QZWA 2DQDH 3OXSA 2Y06L 2VIRA 4KKCD 3VFOA 4GT7A 1P2CA 4WJ5A 4H26B 3C60D 5D7KE 5J6GB 3OKEB 3UO1H 2ZOLA 1ZHLA 3RGVA 1NAML 1BLNA 1G7HA 4H0HB 3NN8B 1SBSL 3GMLB 1FLRL 3QIWC 1OSZA 4NWUL 2D0HA 3UTZB 2Z31C 1L9MA 3G6DH 3C5JA 1UEYA 4HUWB 4XX1E 3S37X 4FFWC 1KJVB 1ZOXA 4KY1H 1BBDL 2R0WL 1JGUH 3BD5A 4P2QA 1J9CT 5I71C 3RTQA 2OZ4L 3P73B 5DJ0A 4R7NA 2IAMD 1WZMA 3MUGA 3ALXA 1MEXL 3JWDH 3VWKD 3BEVB 1V3KA 3WNLA 3NMEA 4IMLB 5F3HB 4ZUUB 4OKVB 4I0CC 4IOSD 4NO5B 1CZ8H 3RDTC 3MBXL 1R5WB 1QQDB 4LPWA 1CDJA 1NDMB 1RVFH 1QLRB 3GNML 4XP5H 5TE6H 4LRNL 5EBMB 3B5HA 4UTAL 2IPUK 1IGML 4G6JH 4JFXA 3LRGA 5HI5D 4NIKB 3PHOB 5C0IA 2VAJA 4UQ3B 4UNUA 1W72L 3IGAB 4S1DC 4OF3A 4WUKH 1GIGH 1CK0L 4XHJC 3SJVD 4DGVH 5JHDD 5MEQB 2DMCA 4FXGB 3H9ZA 3EJYC 3ZDXF 4M61A 3GHBL 5JLZB 4Z77A 1MHEB 2HRPH 2DM7A 5FDWB 5AWNH 1CN4A 4JFHE 4IRJA 1AKJB 5F9JB 4U7MA 3O2WH 4JZJA 4Q97A 3JTTB 1GHFL 1JWUB 1UH3A 1LEIB 4DN3H 3NCFB 4HZLB 1DBMH 4LNRA 3I9GH 2YD5A 3FCTB 4NQXA 3IU3B 4L8BB 2AV1B 2ITCA 1U92A 5CWSA 2DM2A 5I2IA 2BJMH 2DYPD 3EKCA 4FP8H 1F4XH 2JJSC 4I4WB 1BQHG 5EOQL 2D0FA 3GHEH 1GHFH 4UOW1 4ODXB 4P9HL 5CP3A 3P30H 5J11C 3RZCC 1TIUA 4IMKC 1G0XA 3CFJA 3NABL 5E6ZA 1RK1B 3VXMD 1N8ZB 5JIIA 2DMBA 5I8KL 1EEYB 1ADQH 1T0NB 1AIFB 3H7BB 4OD3L 5DR5L 1OLLA 3CX2A 3TP4A 5MENA 5L9DH 4HC1L 3HC3H 2IF7A 1PZUB 2RJMA 5C0BE 3RWEA 4RFNB 4JDTL 4K3JL 1T83A 4P46C 4XVUD 4PJBE 4JPVL 1M05B 2VXVL 4X5XA 1CVSC 3BEWA 1A14L 5DWUH 5GZOD 4XAWL 5F1SA 2XWJA 2LU7A 2A83A 1OD7A 1QQDA 3DXAB 4RDQF 3SE4C 5C0FA 1ZT4A 5H94A 1WQVT 4ISVA 1GZPB 2DRUA 2OTUB 3I50L 2G5RA 4NFDA 3VXUA 2O61B 4Z7UB 2IMMA 2LAGB 2Z31A 3QUXB 3IXTB 3U7WH 4HUVA 3I3DA 3MO1B 1R0AL 4NO0B 2CRIA 1OB1A 4EVNA 2V2XA 3ARWA 1Q1JL 1FFOB 3WFDH 1IGIL 1KPUB 1AJ7L 1CICA 1NSNL 1U3ZA 5FKAA 1ZTXH 1J05B 3GSUA 4M02A 4TSAL 4KK9D 5DI8A 3HZMB 3GEWB 1INDH 3E0GA 4NO0D 1XR8A 2ZCHH 4GG8B 3SY0B 5T1DL 3AAZA 4QKXB 1GZQB 4CMHC 3ZTNL 4E41D 3ARGB 4PG9A 1MLCA 4KTEL 3RY4A 3VRLE 4G43A 4F8TA 1XCQA 3H3KA 1EO8L 5J3HD 3LKSA 3RKPA 5GGRB 1T5WB 4U2ZA 5ESVA 1FZMB 1UC6A 3CDCA 2FGZA 2J4WH 2D2OA 3JWOH 2B20A 4M62H 4RMWA 2EDBA 3G6JA 4DUXA 3O2VL 5EO9A 5EC2A 4G9DB 3H3PH 1FORH 1RULL 2GY7B 2OQJB 2CDGB 3EGSA 4XP5L 5TE6L 3WNPA 1XZ0A 3EOTL 4JG0H 4PJ5A 4QYOA 4OUUA 4JZOA 4OZIE 5D7IE 3E3QE 4X0KB 5I16B 3ULVD 5D6CB 5DD5L 5LXGH 3JVGA 1U2CA 4KI5E 1FYTA 1CIUA 4GXVL 3SKUD 2ADFL 2VLKA 2W9LA 3SPVA 5ACLA 3L3IB 4HGWA 3S9DB 3ARRA 3B83A 5C6PB 2IG2H 3NCMA 2JJTC 2JTDA 5I19H 4OFVA 1GZQA 1RAMA 4EI5A 2EXWD 5DQ9A 1I7ZB 3R8QA 1TZIB 1K8IB 1EGJA 1MVUA 4MDIA 1I7TA 1DBAL 5KS9B 4XCFH 3F12A 1S7VA 1EGJH 5FHBL 5H37G 3N85H 5IMLA 2UZIL 4UTBL 4N0CC 4RX4A 3CK0H 3K7UA 4EDXA 3DYMA 5IMOA 5D93C 2B4CH 1IEBA 4A6YA 3W0WD 4MAYC 1J8HA 3VXSE 1BVKA 1HI6B 5EO9B 5DUPL 4X5WB 1S9YA 4HZAA 5DK0A 5F3HA 1KGCD 4L3CB 4XWGH 2AGJL 5F6HJ 4OLVL 4LSVL 4PY7A 2Q7NA 2BNRA 4JQXA 5TF0A 3IXAB 4DFIA 2F15A 3GZKA 1A9EA 5HVFB 4F7EA 4G43B 1GGBL 4P2OC 4JREC 4JO3H 4OBRA 4PGZA 4ZNEA 1UXWA 1IC1A 4P3DA 4PRBB 2XXCB 2BSED 1YZZA 2Y36H 3GBLA 5JQ6H 5BJTA 4LCYB 4DOHB 5L8KB 2PF6A 2DWDA 2HT2C 3QDGD 3OB0K 1CQKA 4MB3A 5A16B 1F3JA 5IHZB 3RBSA 2XZAH 4DKEL 4PRAA 1P7KB 4ZMAT 4TUJB 1RUAL 4ELMA 3MOBL 1FZKA 5TDNA 3IDUA 3W82A 3HE7C 3OAYH 1XR9B 2C4FT 3QFDB 3TT3H 2ORBH 4ONGH 2FEDD 2DJUA 3OF6A 5JW4Q 5E8EA 4OGXL 3WFEH 5D7LA 3FMGH 1CFQB 4M5YL 1BZ9A 1H3UA 1S9XB 1IGYB 5FA3A 4K94L 5J9PB 4I18C 5D71H 1T7YA 3PJSA 3F8UB 1MRCL 4FXKB 3UMTA 3BH8B 5ESAB 1LO0H 3NTCH 5KG9B 2JF1A 3CAFA 5B38B 2P8LA 1J0KA 2F19L 3F7YA 5KW9H 1H0DA 4UQ2B 1ROWA 3IU4H 1JZ5A 2VISA 4CVZB 5GS0D 3DGCR 1JYNA 2O5ZL 3MRCB 4NJ9L 2N7AA 3F12B 5CJBA 1DE4B 5ID1A 1NCCH 1CZ8L 4GQPH 2DD8H 2X42A 5L0QB 4WV1C 5DJCB 5EC1B 4Y4HA 5JO5B 4V1DA 3LS5H 4BFIA 4RFOL 3TA3C 1QRNE 1C5CL 4AMKL 3RFZC 3MCKB 2O26U 3MRGB 3IFOA 5TFSH 3HZMA 3RY6A 4L3CA 5IJVB 1X7QA 4Z7WB 1F90L 4EI5D 5T1MB 1ZS8B 2HRPL 2GJZB 1IKFL 1Z2KA 3C6SA 1HZHH 5MEOB 3O6LH 5I1IH 2F54A 4DAGH 4M03A 3STBA 1JK8A 1QSFB 2AXGB 1E6OL 3LDBC 5JA9A 3D39E 1UT9A 4P23A 4RMTA 5CP7A 5F7UA 4YX2L 4TUKH 1MUJB 5FHAL 2AQ3A 3L3JB 5I30L 4RRPG 3UROR 5CBEA 4UDUB 2PCPA 3EFDL 4LEXL 4NM8L 1OTUC 3MXWH 2CDEA 2IAMB 4RNRA 1BQLH 1S7UB 2PR4H 2KH2B 2WIMA 1Q38A 2YS4A 4D3CL 4UOJA 2B1HL 5BVPH 4JCLA 2NCMA 2DOCA 3UJTH 1CL7I 3RWHB 3MLXH 5I16A 3MX0A 1FC2D 3RIFK 4JR9H 5A2IH 5CZXC 4R97B 2BOBA 3EOAA 1BEYL 1CLYL 1DSFH 4P0DA 4YE4H 2ZCKH 3GGWB 3N1GC 3WN5C 3CD4A 3WHE1 5MEND 4PGEA 1DQDH 5KS9A 4OM0L 1QSFA 3BE1L 3OZ9H 2CD0A 4GG6F 2NX5B 2GSGB 2ZCLL 3RNQA 2WUBL 4GSDL 1CDBA 1FAIH 5K9JH 1F6LL 1T7ZA 4LBEA 4M8VA 2FIKB 3I6GA 4JO2L 3D85A 4H0IA 3OPZH 5GZND 1DQDL 2DBJA 3HNSH 1CG9A 5EOCH 5EUOB 1WGOA 2CGRH 4PJ7E 3LEXB 1TPXB 1YJDC 3GB7A 4Z95L 4LIQL 4KGLA 1F3DJ 2HMIC 2NY5C 1LK2A 2A0LC 3DMMA 1EA9C 3TA3B 1JNLL 4UT7H 1IKNA 1GSMA 1J1PH 4CUCA 5M7QA 4JM2C 4RMUA 3OR6B 5M95B 3PGDB 1AJ7H 1U8QA 2J2ZA 2Y23A 5MEPB 1HCFX 5E5UB 2E3VA 3A67H 2R2EB 3BGMB 2J8UB 5EBWA 4C56E 1OP9A 3C5ZC 4D9QE 3RHWF 2PYED 1ZA6B 2J8OA 4DGYH 1NL0H 2QADB 2W0KA 1YUHA 4NQVA 3AMLA 2DM4A 3BPOB 2CKBL 4QXGL 1BD2D 5BS0A 1XF2A 2KDGA 5GSRA 4HWBL 4NP4H 5D6DC 1A7OL 1H8OA 4N9OB 4Q6YA 5DDHB 3S35H 4X6DF 4HS6A 4YO0A 4HK3N 1PW3A 1YDPA 1EEUA 2X70B 2XA3A 3MOQA 4HFWA 2B2XL 5EZIH 2BCKA 1U8JB 1UADC 2XQYK 1T22A 4JLRA 1T66D 4NGHL 4YHLL 1T1YB 4HWEL 1MQKH 3ARBA 3MV8E 4ZS7L 2BVYA 1X4XA 1AXIB 4AM0A 2C3GA 3P0YL 4WI3A 1GGIL 1RURL 4P2OB 2O5YH 2O5XL 4FXKA 4PLKD 4Z7VE 3LZFL 1L6XA 3NZHH 4ZFZB 3VWJD 4X83A 4FQHB 1L4IA 2GCYA 3KPRE 5MP6H 1OTSD 4IRSC 4ZNEE 4I77L 1GGIH 5D70H 1V7NL 4DOHE 5E6IB 1G9MH 5KJRL 1PDKA 4HK0B 3GIZL 4ZUSB 5C6TL 3OB0H 3MCKA 1WC7B 1EUTA 3I2CL 5E5MA 4XAKD 2WP3O 2HJKA 3EGSB 4JVUA 5HGHA 3U0TA 4O9HL 5HSFA 2EEAA 4KVCL 3AAZB 1OT1A 2Y1VA 1T21A 3AREC 5DJ2A 3CFIC 5DJYA 4OTXL 1WEJL 5F7LB 4YWGH 3ZT7A 3I3BA 1MFEL 5CJQH 5GRXG 3VA2C 5IT2H 2XQYG 1FVCB 4XPFH 4P23B 1U3HC 4EI5B 1SYSA 4N8VG 1EHLH 3WV0A 1TQCC 4QEGA 1B0RB 4EIGB 1KBGH 2R0ZL 1GOGA 4MDJB 1KPRA 1SMAA 4D0CB 2PNDA 2CK0H 4MAUH 5BS0B 1XF2B 5IT2L 3DRTA 4LLMA 4OF8A 1D6EB 2HJLB 2GEEA 1NKRA 4HZLA 4H8WL 32C2A 3I50H 3FOMB 4L4VB 2GHWB 25C8H 5C0DA 2NY6C 5HHMB 1S7QB 4PRID 4JZJB 5D8JL 5SWZA 2WBJA 3B2UC 1HDMB 3HMXH 4P4KC 3BISA 3A0OA 1Q0YL 4Y5YC 2VC2L 4NOFA 3O41B 3ZKNC 3TVMD 1JMZA 3V6FA 3RVTD 4N9GA 5IG7A 3EFFB 4PJGB 5AYUH 2KL6A 3TBTB 4JHAL 4XXCC 3GO1H 4U6TA 5DD3H 5CEYA 5C0CA 5LGHL 4WTZG 5GS1B 3B6SA 5T33L 3C09C 5CFHA 5D9SB 5DYOA 2DWEB 2SEBA 3EJZC 5F1KC 1FAKT 3HNVH 1FV1B 5D1QD 2MQ3A 3SHSA 1DVFA 3IDXL 5FGRA 3RWIA 4GAJH 4MQ7A 4KXZH 1FJ1A 4L8SA 4BUGA 5IB4B 3REVA 3DETC 3C5ZA 1NH6A 1MY5A 4I13B 5CMAA 2FJGA 1O5DT 4U1JA 1I8KB 2A6KB 4ETYA 3WIHH 4P5TA 1KEML 1MCPL 3L3DA 3H8NA 4OCRL 4MCZA 4OQTH 4WFHE 5EBGA 2E6QA 3V4PL 2OJEB 5HGBB 2AP2A 4MYWB 1YEEH 1HH9A 1OAYL 5CIPH 4HIJB 3U46A 1MEXH 4ISVB 4OLEA 3SE3C 1UXWB 5L7XH 1A5FH 1KCKA 3QUZA 4Y2DB 4OKDA 3TPUB 3EZJB 4QHLB 3VXNA 1F6AA 1HXYB 2P8MA 2OL3H 3IETB 2NTSP 1QR1A 1HZHL 1OAYH 3N1PC 3U9UA 1E6JL 3A6BL 3MRQA 5LJYH 3VRJB 4R96A 1GIGL 4CAGA 3GJFA 3MCLH 3WD5L 5AUMB 3GJEA 4ORGA 4ZTPL 4NO3A 5TQ2H 3HN3A 4BQ8A 2CSPA 4ZFOL 1P84J 1CD1A 3O4LB 1NAMB 3BPCA 4QT5B 1TXKA 1XF5A 1DQTA 3SJVE 5E56A 2DQIH 2QQKH 3NIGF 4ERSH 4AK1A 1MLBB 1GYAA 1LO5B 3WXVH 4U1LA 5E8EB 4BH8B 4BZ2H 5DMKB 3QXDA 4MZ2A 5D96B 1G84A 1JRHL 3U0PA 1FZOB 4U1SA 1CGSL 2UWEF 1KB5B 2BVQB 1DBML 4M4PA 4XC1L 4GQ9L 2XA8L 5I0DA 1NAKH 4ZOBA 1FNHA 4PJIB 1YEDB 4KVCH 1FGVL 5HI3D 1K8DA 3GSVB 4XCYB 1MCIA 3CIQA 4Z0XA 1CWVA 4PV8A 4YNYB 1JGEB 3QO0A 3MLRH 3TN0B 3T0WA 2Z35A 4FFZL 2EC9U 1A3RL 1U8IB 1RJCA 1TQBC 4X6DE 4K8RC 4JFFE 2RCSL 3CFDA 4F9PA 3G9VA 1K2DB 4HMCA 3PWLB 2EH7H 4AENB 2XWTB 2HG5B 2IPKB 1E4JA 4Y4FC 5F8QC 5GGUB 5KSAB 3QIBC 1VGKA 2ZCLH 1OWWA 5LCVL 1A14H 3M17A 3MROB 1CFSB 4HMEA 5LAXB 3BPCB 5D7JA 4HS8L 3BHBA 3MLWH 5FM5M 5HDBF 1XGUA 2W9EH 1U8OA 2ZWLT 5B4MD 4Z78A 5I1GH 3QXTA 3FQUA 4Z7VF 4WDIA 2F54D 3VG9B 1UM5H 1FFNA 1NCAH 3RRQA 4NQTA 1II4E 2WINB 3QDJE 4ETQA 4U6YB 1UWXK 3L7FA 1NGXA 4E41B 4UILL 3U7WL 4PBXA 4GW4B 1YNKL 5TPWL 3GI9L 4X80H 3QUKB 4LSPL 2UV3A 1VFBA 3BP4A 3QO1B 3UYRL 2W1NA 4LDOB 1S5IH 5HDLA 4Z7QF 3N06B 3Q3GB 4HCRH 3ZSSA 2DB8A 1HH6B 3IFLL 5IB3A 3WFHA 1A6PA 1NUFA 4F2MB 5CJXC 4FQQB 3SDXF 3MLUH 3MRRA 5T1KB 2R1YB 2R1XA 4O4YL 1U58A 4S2SB 2IH1A 2NYYD 3MUJA 4PJCB 1XF3A 4Q9RH 5DFVD 1DL7L 2AJVL 5CJOH 4QTHA 1G7MB 4KQ4L 4B53A 5GRJH 1JVKA 4XPHL 2R0LH 1KGCE 3BMWA 4MA1B 1QBBA 4EQ2A 3DI3B 4WTZA 1IFHL 5F44A 2ICWJ 2W0FA 2HLAA 4J7RA 1QLEH 1QLRA 3LEVL 4O4YH 2QSCH 2PTUA 4BKLB 4M1CD 2MQCA 1F00I 3KR3L 5CEYB 1AP2A 1YNTB 3LEYH 1WISA 1A6UH 3DIFB 5FO9A 1KFAL 1U95B 4G6JL 1RURH 5ILTH 1D9KD 3O3EB 3QWOB 2E27H 3CMOH 2NY1D 4S1SH 5ERWB 1W72H 4L4VE 3MRFB 5IHUH 3JTSA 5I1HL 2XKSA 4P99A 2FYYB 4G7YL 4BQ6A 4Y5VB 3IAPA 5DJZA 2I60L 4NSKA 2YD6A 1A7PL 3TJEH 2I25N 3V79C 2PYEB 1WIOA 4PJ8A 4S1SL 3FJTA 3MR9A 2BZDA 4Z7WF 4OGAC 4NBZB 1N6QL 1UA6L 4WDIB 2WSKA 3QHZH 3HE6A 4G80B 1UFUA 2DQHL 2Z8SA 3K2UL 1LO2H 1IRAY 4ZUUA 3L3JA 1NMBL 1EERB 5FO8A 4R8WL 5FAAA 5EIIA 4OV6F 3ZYZA 3E8UL 4WI2A 3KPPA 2YPLD 3QDMA 3QCTH 3T4AA 4QRPB 1NFDB 3PGFL 3CZJA 1P6AB 5JR1H 1VCAA 2FJGB 3HI5H 1NGPH 5E00B 3TBSB 5IJVA 5AUMA 4NHCL 2EDNA 2PO6A 4XP4H 4ZODA 5EB9A 2H2SD 4OLVH 4F7TB 3MLRL 2OSLA 1FN4B 3WLWC 1DVFB 1KN2L 1U2HA 1JF6A 2VR5A 3QDGB 2H32H 1T1ZB 4WFFE 4H1LA 5HGHB 5C70A 3WDIA 3F5WB 1QHPA 4H1LH 3LB6D 1NC4B 2YA0A 4NBYB 5E6ID 5A2KH 1PD6A 4NKMA 2ZG3A 5ALBH 5FUZH 5KS9F 5LCVH 4WWKA 4I1NB 3T3PF 4WNQA 5F7DB 2OX5A 4JO4H 4O5LH 5F6IB 1QBLH 4X6BA 4OGYH 5BCAA 5KN5B 1OP3H 3QUML 4TSBH 3GFUA 4M7KL 2DIBA 3EOBA 1B4JH 4NDMA 2LFGA 3QDMB 3JV6A 3NAAL 1LP9B 3OKLB 1FFRA 1ERNA 1UH4A 2GJ6D 5BVJA 1E28B 2GTZA 3U9UB 4PRDA 3HMWH 1X44A 2XWTA 1BFTA 2EXYD 2B0SL 2VXSL 4MNQA 3GRWA 3W0WA 3PF2A 1JP5A 3L5WA 3QIUD 1QYGH 4NWTH 4ELKA 2VSDA 4XXDB 3MJ8A 3P11L 2H1PL 1QVOA 1I8IB 1BIIB 5HHPB 5D7KD 4UV4L 1B0GB 2G9HA 3MUHL 4O2FA 4XCYA 2UWEA 3ETBF 3FO1B 3TYFA 5CEZD 4H25B 1D5IL 4CVWA 2BC4A 3FHQA 3PDDA 2VDLL 1KCSL 5GGSB 1A4KA 3H9SA 3GIVA 2MNUA 2R2HA 1MCRA 3SO3B 3W81A 4NO0A 4X6FA 4P5MB 2Z31D 4AMKH 1NUDA 3BIKB 4JHBA 1CE1L 4YHZH 4PRIE 3E6HB 1UG9A 3T3ME 4WUKL 1WWBX 2GSIA 5ITBH 5IK3B 3QYCA 4RISH 2D7TH 1F90H 2H26B 2DWEA 4CL7A 5JDSA 1AR1C 3O8XB 5F7KC 5HHOA 3H3PL 4NN6B 5GRYA 5DVLA 1NBYB 2A6IB 2H6PA 4W68A 3JV5A 2EH8H 4YH6A 5HDOA 2XZZA 5F88A 3D25A 4PJHB 3VXUD 5I75C 2XTJE 1CE1H 4X8XA 4YHZL 1UJTA 2BMKB 4AIZB 3UZVB 2P47B 5EULV 5HYJB 4DN4H 2BNUA 3SGJC 2YD9A 4G6AC 3M07A 1HYRC 3BHBB 4WHCA 2NW3A 4OD2A 1XF4B 2VZUA 1CE6B 4OFDA 4XB8A 4FNLH 4H0GA 4NCDA 1UJ3B 5A1AA 4I48B 5JW5A 4C56D 4PGJA 4CU8A 4NQEB 1MHHB 4JG1H 4PV9A 1M71A 1XGPA 4LEOB 2EIZA 4XMLH 4U1MA 3CXHK 1I1AD 3BP4B 4QXWA 4QGTA 3MJ6A 4HFWB 1G7QA 3HAEA 1MI5A 4YBHA 5D7SH 4JFDA 1P1ZB 5I8KH 2AJ3A 1EHLL 2JCCE 4OCXH 2W92A 2HTLC 1TZGL 3KYMB 4JM2A 4MA3B 3GSQB 2DQGH 5JUEH 5F9WC 2FATH 2NY1B 1GGBH 4U6HA 1BQSA 4I2XB 1XF5B 3NZ8B 3SDDC 3V7AG 5D7SL 3CLEH 2B5IB 3LQAL 5GSVB 1KJ2A 2A38A 5SX5H 4PY8J 3EOAB 4YGVA 5C0BD 5DJAA 4HLJA 5IMLB 3GIVB 3ESVF 4NKDB 3CC5B 1H8NA 2AVGA 4WWID 1S7RB 4PLJD 2VC2H 4QHLA 4D9RE 2A9NH 4FZ8L 2BVEA 1ZTXL 1P69B 4LP5A 5DEGA 3U4BH 3VFNA 1FVDB 4JQIH 2WV3A 2IC2A 1EEYA 2Y36L 4J6RH 5FO9B 5EWIL 1OF2B 2FL5A 3SO3C 4RIRB 5E9DB 1DQQB 3VFPA 4JO2H 4JZJC 4U31A 4NQDD 4PJHF 1URLA 2XICA 5DFWH 1MJ7H 4PJAA 4O2EB 2VDQH 3AGVA 4P2RB 4OZIA 1QZ1A 4M93B 1I1YA 1PSKH 1CDYA 2IQ9L 4F3FB 1I7RB 1IGMH 1A4JA 4JM4L 5EUOF 1NGYA 3ECBA 4XNMB 5DFVC 2QR0B 3G6JF 5F3BB 2ICWI 3QUZD 4CMMA 5I1DA 4UINL 1ZVSA 1HKLH 3IDNB 1JPTH 1EHNA 2EDRA 5H94B 4Y19A 1LNUB 3ILPB 5DK2B 1YN6B 3ESUF 1T5WA 2NW2B 4TVPL 4KC3B 2F19H 4B0MM 4P2QD 3KLAB 2SEBB 1QBAA 1EAJA 2R39A 2HKFL 1QFPA 1QSVA 3FB8A 3MNZA 3QEUA 3UCRA 3JUYA 1MPAH 2EE9A 3MMEA 4NGHH 3PHSA 2XPGA 3OQ3B 4WFFD 1G0DA 4QHUA 1HDMA 5EU6E 3SY0A 5I8CB 1P4BH 2MHAB 5DEFA 4LGRB 2OM5A 5DI8B 3EOTH 3N1QC 4HKXA 4PJ5B 3MCG1 3SKJH 5HGBA 2R69L 5C0BA 2IBZY 4P9HH 3TNNB 4TUKL 1HOCB 3I6LD 1W0WB 2FX9H 3A6OA 1MJJA 2ESVE 4WEBH 2RFXA 3V2AR 3OR6A 4TVPD 3RJDA 3S34L 2VE6A 5J9PA 5E2JA 4PJGE 4U2YA 2DQIL 4U7KA 5C0CE 2Y07L 2HT3D 5T1KD 3SKJL 4LSTH 2W65A 3R1GH 5DT1H 4ZS6D 5DR5H 1KCVH 12E8H 1NBZB 2BFVL 2HVKB 3F58H 1DBAH 1Z9MA 4NKOB 5DEZA 5E9DA 4JDTH 4K3JH 3ZKMC 2Z91B 2JELH 2EO1A 5F7EH 3KJ6L 4G6FB 1KNOB 4FABH 3M45A 4QF1A 4S0TD 4LHUA 4FQ1L 5CBAB 5F9JA 2H9GA 2M8XA 4JRXE 1G6VK 3SDCA 4HWUA 4XPFL 5F7FA 3W0WE 1NFKA 1QFWL 1RHHA 4XBEL 3MRJA 1YEGH 1MUJA 2C4FU 2ZUQC 1EV2E 4JFED 4Y4HD 1OAUH 3U83A 3SGDI 4JR9L 3EO0A 2PO6D 5LBSL 3ARDA 2BNRB 3SBWC 1M7IB 1ZMYA 2R4RH 1RUPH 3UTSA 4JO1H 3VXUB 5FYJE 1CDIA 5CZVH 1G9NC 4LOUC 5GIRA 5D2NC 1MWAA 4Q74A 3C08L 3QRGH 3TVMA 2NY5L 1B0RA 4LCCC 4KDVA 4JPVH 5E6IA 4WO4C 3BP5A 1QR1B 2IADB 4I0PA 4PTTA 4PB0H 1C12B 2WBJD 4YC2C 4WW2F 3WJLA 2NLJB 2ZG2A 3ZHKA 1LHZA 2CMRL 5D1XA 4PRIB 3QFJA 1BJMA 3BIBX 4KDWA 5JMRA 3B8YA 4NQCA 1TPXC 4XBGA 2JB6B 2F53A 3IDIA 2AEPL 1T04B 4MSWA 1HSBA 2ICEA 4OCLC 3GSWB 5DJ2B 5CBAA 3FFCE 5FYKU 2VMFA 2QHRH 2VLRA 4LASL 5MHSE 1TVHB 1EAPB 4BH7A 4XP9H 1NEZA 2C1PA 3IF1B 4ODVL 4PV8B 4YNYA 4HLZH 5I15L 2RFXB 3BUYB 4HPYL 4QY8B 5A43C 3O2VH 3WE6A 1H3TA 1JGUL 1I9JL 3RGVD 5I1LB 2B1AL 1OGTB 3T4AB 1PVHA 5IFHL 3G04A 1YJDH 4JFXB 1XGYH 4KUZH 4M7ZB 5FO7B 4J3XA 4OD1H 5HVGB 4I8DA 1FYHB 1MAJA 5E94B 4ZOEA 2IBGA 4JB9H 2QSCL 1MWAB 5MI0B 3VI3F 1I9EA 1FVDA 1QFHA 3HFML 2QHLA 3EHBC 1KPVB 4D2NA 3VG0H 3FO0L 3R0NA 6FABH 4RIRA 4UOW0 2YK1L 4R9HA 3RA7L 3KWWA 4P2QE 2OR7A 3PQYB 2HT4C 3ZE1F 4WWKD 4PREB 2APBA 3OGOE 5D2LF 3KPQA 1L0QA 4CMMB 4NBXB 2QR0A 1VFBB 3FONB 3DO3A 3S5LG 3PHOA 3RAJH 4HUXB 1HHIB 1N6QH 2EDEA 1RK0B 2CR3A 1U9KA 3PNWA 4NQVB 2FWOB 4TULL 1TJGL 1AGCB 4PRDB 5MP6L 3TN0D 3HRZB 1BZ7A 1ONQB 5FB8A 3REVB 3C6LC 2F58H 3VXSD 5E2UL 3OKMB 4GMSH 1I7RA 4R4BB 2PXYD 2CLZB 1MFEH 4XPGL 4UI2A 4Y7MA 2H2PC 4QLRA 4HGKC 4FA8A 4YDLB 4XBGB 1OAQL 3PXJA 2AK4E 2EE6A 3QCVL 1MCWM 3NACL 1HIMH 5AAMA 5JTWA 3CK0L 1TNMA 3TCLA 1P4IL 4L3EA 3CNKA 3HUJF 1N5AB 1G9MC 5B39G 3QEHB 4CADA 2IPTH 5ICXA 4OD3H 3SDAA 4HV8B 2JB5L 3WLBB 4YBQC 3IJYA 4RGNE 1VERA 3CDYA 1LO2L 1YEDA 3TO4C 1FL5B 5BZWA 3WS6A 4O58H 5E94A 1C16A 2KQMA 4OM0H 1YEIL 5HBBA 3RZCD 1A1MB 2VB5A 3RNQB 1IQDA 4LSVH 4ZPTB 4RNRB 4OAWB 1C7TA 5DSCA 3QXAA 3O3EA 3QWOA 3C87A 3DMMD 5F89A 1UCBL 4M7ZC 3GUTB 3T0AA 1NAMA 4L8DB 5CD5D 1ZSDB 3O6KL 4N1CA 3TYGH 3R8BB 2GY5A 5ESQB 4R90L 1LK2B 1RIVL 1K4CA 2PTVA 4Y88A 1L7TL 5AZ2H 4I9WD 4JJ5B 2CKBB 3HR5B 1C08B 4KKLD 2BRRL 1ZT4B 3SDYH 3D39B 1OAZL 4L9LC 4XNYL 2PETA 3K3QA 4NNYA 1BF8A 1AQDB 5DRXB 4CADB 3P11H 4WU5A 4LEOA 4XHJD 3T65B 2VXTL 3TN0A 4ONGL 4Z7VB 4Y4HB 3Q6FB 2P49B 5BMFH 1LP9A 1A6AB 2I27N 3ZTNH 3GSRA 1XGTA 5I15H 1D5IH 1EJ6A 4U1GC 4JZNA 4QXGH 1DL7H 2AJVH 4HMDA 4LDLB 4RAUB 4KQ4H 5EC2B 4KMQA 4MJIB 2W9DH 4F57H 1U8NB 3IDJB 4L4TE 1R3IL 5A3ID 3PWVA 4L29A 2D4DA 5DF0A 1T2XA 1DQLH 4J3WA 2HWZL 4HHAA 4QCIB 5J06A 1BZ9B 1NMCC 1S9XA 2A0LD 3QXWA 4QY8A 2JIXA 5AWNL 4Y4KD 4PLOB 3KHQA 5IW1A 4MXWH 5FYJD 5HDQH 4CNIB 2C26A 3PL6A 1WJ3A 4HV8A 3W9EA 4LU5L 5DD6B 3UTPD 3ARDB 1HXYA 2BVOA 2P8MB 5IWLA 5GZNC 5ELIA 2YKLL 3ARZA 2DQCL 4QOKD 1ZANL 1EBAA 5I66A 2EKJA 1LNUA 3LRHA 4JFPA 2ADFH 3EJJX 3ME0A 4PJGF 1YY9C 1QBML 4QRUA 3S34H 3OF6D 3H9HA 3QA3B 3T77B 5SWZD 3UBXB 1CXIA 1WVZA 3TGXA 4JY4B 4MJIE 3DX8A 4RGNC 3TO4D 5AG8A 1IM3A 4Y89A 3WJJC 4HS6B 4MS8C 3DVGB 4GBXB 2DQCH 1JHKL 1TJIH 3TLRA 4P5TD 5D1ZC 1I8IA 4ZTPH 2X9YA 3BW9A 3QG7L 2OP4L 3HI6L 3NCJH 4XCFL 1NAKL 5L0QC 2QSVA 1WAAA 1RZJC 4JPWH 3TO4B 4R8WH 1TVBA 1DVFD 3O3AA 1EMTL 3FFCA 4KRPB 4EBQH 3C6LA 3KPRD 4I4WA 4NRYB 3RL1B 3CPLB 4F9LC 1GVIA 4MLIA 4H88H 5HYSG 3BUYA 4HS3B 4XZUB 1HIML 1S7VB 1NGZB 2GSIB 3VXPB 4PJEF 2BSRB 2YN3A 5T5NG 3BPOC 5C3TA 3HNTL 2EC8A 4NFBA 1AGEA 4H8WH 4MB5A 4PJ5D 4D0BA 4M43H 1TENA 1I4FA 4ZOAA 1TNNA 2CDEB 4P59L 3ULSA 4TYUA 4QHUB 3EOYG 4MCYB 1U8LA 3MODL 1J5OH 4RDQG 4TVPE 5FGCB 3UC0L 2H32B 4M7JL 2R8SL 4UIMB 5E8OB 4MVBD 1JZ7A 4EJ1C 1FAIL 5K9JL 3V5KB 1ULVA 1NQBA 4HUNB 1WCQA 1D6VL 5HDBE 1GGCH 2Q8BL 5BOPA 4P46D 1ORQB 3WMSA 3FN0L 3OB8A 2YSSA 5GRVL 3QIBD 1QSEB 5I17A 3UP1A 3NIFF 5GGTH 5L6YH 1HSAB 2F5AL 5EZOH 2IQ9H 1KTLB 2HTKD 3U48A 1EXUA 2E7HA 4PGBA 2XWBB 3G08B 5B8CC 5CD3A 3KPPB 1IGCL 4G5ZL 3MJ7A 3RU8L 5D1XD 2YMXH 4OAWA 2MTPA 1QBLL 1FVEB 3SDYL 2XZQL 3BUTA 3EDDA 2G2RA 5AZEH 1CYGA 2ZNXA 3C8KA 4OI7A 1D5ZB 1Q0XL 1MHEA 3UTOA 1PKOA 1LE9A 4JFEB 1H3XA 4RA3A 5GGTL 1Q94A <