3NIFF

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 39
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nifF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nifF01
5DJXB 2BNRD 1DQQA 3HE6C 4RMVA 4NC2B 4U1SB 3RZCB 1H0DB 3UTTB 3VFGH 1TVBB 5H8DA 4UTAH 4P9ML 5KAQF 3ARED 2E7LC 4OJFH 3S36H 2X4NA 4F7CB 1VERA 4U1MB 25C8H 4Q6IC 4O51A 3D3VE 4JPVH 4P5TA 2CDFA 5I6XB 4NO0D 4H25B 3W2DL 4HGKC 4LF3B 5EZOL 5BZWB 3QIUA 2DQDH 3VH8G 2VE6B 3RBGA 4KTDL 1QOKA 2Q6WA 1MCFA 2X89D 3DX6B 4QOKD 5IKCA 4J6RH 2MMXA 5ADPH 1WAAF 3TO4D 4CJ0A 3UJTH 3S9DB 3ULVL 5DK0B 4QHUA 1S9XA 4FP8L 5FOBA 1P9MA 2HRPL 1BPVA 2XN9E 3MV9B 1D5MB 5CUSH 1Q9OB 3BT2L 4X4XB 2ZOLA 2G5RA 4LDEB 5F8RC 1ODAA 2CRYA 4CVXA 3AREB 3IU3A 4HPOL 5GZNC 1BD2A 4O02H 1Z5LB 1GGCH 1OTTC 5FGCE 4MVBC 3ARVA 3FT2A 3I9GL 5JOFA 4RQQA 4RAHA 4ZFOL 3EOBB 2YOCA 4HUXA 4GW4B 2BY0A 3O2DH 1I75A 1KPUB 3TO4B 1H0DA 1AIFB 1TVBA 4RWYL 5KS9A 4HXBH 5GRVK 3V4UH 4F7CA 4QGTA 3GMMB 1F45A 3DHMA 1KUMA 4QRPB 4H25A 5JQ6H 4LF3A 2FBJH 1UJTA 2IQAA 2VE6A 3AAZB 4AZ8A 4NJ9L 3V5HB 4MNQB 1ZT4B 3ZDYE 4ZSOB 4JFHD 3BVNB 1N26A 3MBXH 1YEKH 3C6LD 3E2HC 1QYGH 3NMEA 1ZTXL 4PY7B 5DK0A 3QSKB 2EDXA 4QHKJ 4Q0XH 1PAMA 3D2UB 1PG7W 1N6UA 3MV9A 3UTOA 1Q9OA 2BNRA 4XPHL 4RNRA 1HXMB 2MJWA 1CLYL 3WFBH 2BC4A 3IFPB 2L0DA 3WSQL 4X4YB 1CD1B 3BEWB 4OFDA 2YWZA 3I02A 3AREA 1MH5A 3J8F7 2F8OA 3E6FB 4D9RE 3GMOB 4OLYH 1J0KA 2NNAA 4HG4K 5DVNA 4NO0A 4I3RL 4X5WA 3L3JB 4PLJC 5ALCH 5I1LB 1N64H 5E2UH 4O2CB 4KAQH 2Q8BL 4GW4A 2BVQB 2X89A 4QOKA 2E27L 1BFVL 1NMCB 3BISA 3TO4A 1AIFA 3L6FB 5C3LD 2XWTA 2DYPB 4B41A 5D7KD 4DEPC 1YJDC 3BWAB 1JGVH 2VDQL 3VMNA 2IPUK 3ZKXC 3MO1A 4YAQB 4M7ZC 1XGRA 5DZOA 4AIOA 1U58A 5C0IB 3ETBF 3H9YA 1LEKB 1BOGB 4LIQH 2E9JA 3AAZA 4R6UA 1YC7A 3H3BC 1ZT4A 4ZSOA 2HFTA 5SWSD 3ARFC 1DFBH 4PJ7E 1AQKL 4PY7A 2UYLB 5JXAH 3BN9D 1XIWD 1NQBA 4C4KT 4XBGB 1B2WL 4HEPG 1D9KD 1HXMA 3I6KB 3IFPA 2FH6A 3QIBD 2UY7A 2VOTA 1BHGA 3BEWA 3N50A 3MRFB 4JGJA 3F7YA 1NCBL 3HMXL 3PNWB 3VWKC 3E6FA 2B1AL 1Z9OA 1AGBB 4WENB 5EORH 2VZOA 3CDYA 5FUZL 3L3JA 2H6PB 1Q9LB 4LASH 1ZLVK 1WZLA 3GO1L 4NFBA 4YUEH 1OARL 3QXUA 2BVQA 5J57B 2OZ4A 3GI8H 4JDTH 4E42A 2X1QA 3U79A 4LSTL 3VFRA 1T03L 4GMTL 3ILQC 1D9KB 5DJ2A 2EZ0C 4Y5VA 5C0IA 4U7SA 1LEKA 1BOGA 5CJ5A 2HTLC 3LN5B 5BRZE 1FVCA 2DQUH 4A6YB 5J56B 3KG5A 1ED3B 2X9WA 1L4IA 2UYLA 3MCLL 1ZHKB 2VUOA 2R4RL 1EJ6A 1U95B 4XBEL 4ZO8A 2EDDA 4CVZA 2XFXB 3I6KA 5BVJB 5J12B 2OL3L 3MRFA 3JSSA 4JVPA 5DVMA 3V7AG 3GNML 3HLAA 4X6DB 5HI5D 1EPFA 5E1HB 5I15H 4DGIH 2NY1B 2J8UB 2Y36H 3G6AB 1Q9LA 1EXUB 4XCEB 3QDME 1E6OL 4K9EH 1A6PA 3VRIB 2IPTL 4FOMA 3Q6FB 4K3DL 2CIIA 1UZ6E 4F58L 3GBNH 4UDTB 5SWSA 2YZ8A 1C7TA 1F11B 5C6TL 1XIWA 4TVPE 4JRYD 5B21A 1EMTH 1OB1B 1D9KA 2ZCKH 1WT5A 2IMNA 2ZJSL 5AD0B 3QIBA 5FM5M 1YPZB 3LN5A 4OM0L 3UPRB 3QJFA 3NGBC 2DBLL 3BPLB 2GUOA 5INDA 4ZPVA 5ITFA 4A6YA 1MIEL 3FONA 1ZLUK 3UO1L 2JJSA 4P2QE 1QVOA 1ZHKA 3ME0A 3WXWL 4P4KD 3RWIA 3UZEA 3QDAA 4OTXH 3G6DL 2XFXA 2YA0A 2CKBL 3MRBB 4X6BB 5BVJA 3V6ZB 1I4FA 4EIZC 2R0ZH 4PJ9C 3HC3L 3V6FB 4JHAL 1JCKA 3H7BB 1NGZB 4JRYB 3NZHH 4Y16D 3ZHLA 3QB7C 2OM5A 5DC0A 2C1PB 1EXUA 1KFAL 5EA0H 3VRIA 3ULUD 3BUYB 3Q6FA 5A3IC 3TCLB 1JPSH 5GS0D 4GKZB 1QSED 2QHRL 1WVZA 2R15A 3BO8A 2KBGA 3OKYA 1ZEAL 1WGOA 3GHBH 1KN2H 5J11B 5AD0A 4G8FA 2ZUSA 4S0SD 2NY6C 1YPZA 1KN4L 1FJ1A 5ESAA 3SDCC 4S0TD 4AEHH 1V3LA 3U1SH 5I75B 3KPLA 1U41A 5FECA 4OM1H 4L29A 2APTA 5E95B 1HQ4B 4POYA 2G5BA 2CUMA 3QCTH 5GGSB 1R3KB 1T1ZA 5D2LA 4I77H 1UQSA 1YNTA 5D1QC 2PO6D 4OF0A 4EN3B 3TYGH 2IF7A 4HIHB 4KRPC 4R4NC 3H3KA 2L7UA 4O2EB 4L5FH 2P44B 3TZVB 1INQB 1ACZA 4JRYA 3HPJB 1T6VN 1IFHL 4GAJL 4XCYB 2A9ML 1V7NL 5KW9L 1UEYA 2BXYA 3X13B 3ROLB 5CGMA 1F42A 2C1PA 1QEWB 4JRXD 2XT1B 5GGVL 2NY4B 4NWUH 1H5BC 5DD1H 1T22B 4FXGB 1Q1JL 3LQAC 1AI1L 3WO4C 3LKSB 4GKZA 5MEQB 1H15B 1U8HB 4JLRA 1GOFA 2UUDK 4GRMA 4N8VG 4ODHH 4OCYH 3TIDA 4P4KA 3DOSA 3TNMB 2HVKB 2R1WB 5SX5K 3HZVB 3LEXA 3R8QA 1SJVA 1M6OA 4NN7B 4FQLL 2JE8A 1CGSL 4NQEB 3UZVB 5EOQH 4MXWL 1FG2B 4Y16A 5ALBL 5GSRA 1X5YA 4OLWL 1K2DB 1EVTC 4BZYA 4JM2C 4JRXB 1FZKB 3BEVA 5GGSA 1R3KA 1XGTA 5GHWL 1V7ML 3MOAL 3L9RB 5DR5H 3L5HA 2J5LB 1R0AH 1ERNA 1QSEA 2EC9U 3T2OA 4HIHA 3RL2B 4QNPE 3NIFF 3QUXB 4O2EA 3RUGB 1T66D 3VRLF 5FYKL 3TZVA 3MNVA 1INQA 5I1JH 1T3FA 4XCYA 1N6VA 1UWGH 5C1MB 3CFIC 1XEDA 2DQIH 1IAIH 1QEWA 1RZKH 3FL7A 1T22A 4LIQE 4NCC2 2DIAA 1WWBX 3OAUH 3DYPA 4HV8B 1FNFA 5MEQA 1KELL 1U8HA 4IEFB 4XVJH 4XT1C 5MHSE 4Z7NF 1QPPA 2XZAL 3RP1A 3W39A 1ZA6B 3MRRB 4I13B 1WCQA 1KYOK 4NGHH 4N0FA 2COQA 1BBDH 4PRBB 2F5AH 4PV9B 3SE4A 2HVKA 3U0WH 3BKYH 4FQ2L 4PY8I 3OMZA 4HIIA 4AIXA 2R1WA 4K71C 3V4PL 2PO6A 1TZGH 2VDOH 5D9SB 4G6KL 4FNLL 3TN0B 1QRND 3N1QC 1OAUH 4HK0B 1KLFA 4NQEA 4TQEH 3U9UA 1FG2A 1U2HA 4IDJH 3UTTE 2QSCL 4U1NB 1JBJA 5J3HD 1K2DA 3KWWA 3BGMB 4JRXA 1FZKA 5I9QC 4PLKC 5DI8B 4KQ3L 4PP2B 2NY2B 2MHAB 1BZ9B 1LO3L 4ETQB 3L9RA 2ITDA 1SEQL 4QHMB 5CD3A 3QH3A 3OJMB 2IAMC 4P9HL 3RL2A 1Q8MA 3BGAA 1GGIH 3X14B 4U1IA 4DUXA 1TCMA 3NIDF 2W65A 2BRQA 1JZ7A 5F96L 1CFNB 3TA3D 5JHLL 4W6YB 1F3JA 2H9GB 4L3EB 4OI7A 1QRNB 9CGTA 3QUMH 3QAZC 4DVBB 1ADQA 5L88L 3RQ3A 5HPOA 5T3XD 3WCYA 5EO0A 3VXOA 4PV9A 2CSPA 4PRBA 3T2NH 3O3BA 4MQ7B 4JFQB 4D8PA 2VLME 5ICYB 4XP6H 3N06B 2V6HA 3HZYA 3QUYD 3VFTA 3MGOA 3QA3B 3DRQB 1BJ8A 5C8JB 1JVKA 4BSWA 5A2IH 2R4SH 4HX1B 4GG6E 4U1NA 1F6LL 3TA3B 1UA6H 3BGMA 5TPWH 3QNXB 5DHYB 4M43H 4R3SA 4PP2A 1BZ9A 3B9KD 4WFEE 3RJDA 1KIPA 2JELL 3VFOB 4QHMA 4NM8H 5FV2A 1FVDA 1IQWL 3LZFL 2GK0B 3GMQA 4D9QD 4MNQE 1FO0H 4PRPE 5D1XC 2PW1A 3A67H 4F7EB 1WF5A 4HD9A 1MLBB 1QRNA 3PWNB 2Z8SA 3L5JA 4Y4FB 3GMPB 3KYOB 4DVBA 1R3JB 4IOFD 4BZ1L 5LWYH 2VWEC 1AJ7H 3FZUD 1HN1A 3TPUB 2A0LD 3TBWB 1AXSA 5HDQH 2EH8L 5I8OH 4MQ7A 5AWNL 2A2QT 5ICYA 1OAQH 4EQ2A 1CXLA 4L8BB 4MZ3A 3IF1A 2ZP0T 4PBXA 1IAOB 3DRQA 4U6VL 5C8JA 2ZNWA 5IVNA 5I76B 4MSWB 3NFPA 2R8SH 1A7NL 1T0NB 3T65B 1NCUA 4Y89A 3DX8B 3K8KA 3TA3A 2RFXB 1MRFL 2NY3C 2VLKE 5HGGS 4ODXB 1GCFA 2GK0A 5C0CB 1FRGL 1KCVH 1MI5E 5DRZA 3QIUC 1KCUL 3BI9X 2IG2L 2VH5H 2UZIH 3P0VH 1I7TA 5IB3B 1BIHA 2BDNH 4OLVH 3TBSA 2M2DA 3MLYH 2W0LA 1IRAY 1G0DA 3FT3B 3PWNA 2ADFH 1F4YL 3IDYC 1P9MC 4NP4L 5FHBL 4DFHA 2EYSB 5KVEH 3GMPA 3KYOA 4C59B 5TDPB 1DUYB 4UQ3A 5E7BA 4ZODA 2DTMH 3TPUA 5IVXB 2AXHA 2LFGA 3B9KA 3GRWA 5FCSH 4L8BA 2P5WD 2ZOKA 3JV5A 1RJYB 1RUKH 4DVRL 1IAOA 3GSXB 4ZDHB 2PUQT 3H42L 1MIMH 2LTQB 3N9GH 4U3CA 1T0NA 1ES0A 4IRZH 4M1CD 1W8OA 1BM3L 2RFXA 4NZRL 1AD9A 5IG7A 4XPGH 3EO0B 2UWEB 1IC4H 1EHLH 2AEWA 3WNOA 4O58H 4X4ZA 1WBYA 5I6XC 2VR4A 2J12B 5J6GB 2J3SA 3UEZA 5EBLB 3T3MF 4KMTH 1DL7H 2D7NA 2K9UA 1X6NA 5LVEA 4XCNB 3TP4A 3FT3A 3EFDH 1XR9B 4KDWA 4AENA 2BY2A 1OP3K 5LQBL 2DI8A 5TDPA 3KYMA 5JMOC 4I2XB 1VEPA 2J88L 4KROD 3GSNA 3MLXH 3AREC 1XT5A 4R8WH 4D0DB 4KMQA 2YEZB 4WUUD 2IBZX 1AHWB 2J8UE 12E8L 3I3DA 1AE6H 3GSXA 5CZVL 1BEYH 4FQJL 3VMPA 5DQDL 1G7JB 4FFYH 4JFDD 1EEZA 2JIXB 4S2SB 3QXAB 2OP4H 4U49A 1U6AH 3LEYL 3WS6A 3TO4C 3K2UH 3OAYK 1IKFH 3EO0A 1C5CL 1YA5A 1F6AA 1E6JL 3G5YA 1XF2B 5H2BB 1YNLH 2C3WA 5ITBH 4PTUB 3IGAB 1CDGA 1YY9C 5EBLA 1GRWA 4XWGL 4ZS7H 3UYPA 4HPYL 1JZ6A 3O6FD 4YHLH 2UZYB 5F3HA 1IC1A 4OZGE 1MAMH 3X12B 1J1PH 2EIEA 5FO7A 3U9PH 1F8TH 3IDNA 1XR9A 2MQ0A 1QD0A 2BNQB 3IU4H 3O2WL 3EGSB 4I2XA 3TESA 3OZ9H 3U36A 3VD5A 2NW3B 1LO4L 5I74C 2Z92B 3TIEB 5C7XL 4D0DA 1TTUA 2W9EH 1T2QH 4CW1B 4Z0XA 3WFZA 3LKQA 1N6QH 2PR4H 1D5BB 3SE3A 1A5FH 2R29L 1G7JA 5IB4B 1K4CA 4HCRL 4S2SA 5HHQB 1KGCE 4N90D 1LK3L 2B7DT 1I8MB 5A43C 1NMCC 3QFJE 1ND0B 4UILL 3PWPD 4HEME 3I50L 3UBXA 5EUKA 3G5ZA 1JWMB 3EYVB 3RWHA 2ZSVB 1P84K 3CD4A 2ZKHL 4Y5VC 1MHEA 2D2OA 5K9QI 1QFWH 2CK0L 3Q5YA 1ZLSH 3S4SA 1Z2KA 4WUUA 3BDXA 2B1HH 1INEL 5DHXB 2I25N 3QBTB 4U33A 4U1HB 3WNMA 2J2ZA 1LO0H 3MBEB 5F89B 2NW3A 1PKQB 4ELMB 4C54A 5J13B 3MA9L 4YXHH 5F71A 5GQBA 1OAZH 5D7IB 5TJWK 3VXME 1BFSA 4Y1AB 2VZ1A 4JFFE 3T4YB 3T77B 3GI9L 3KPSD 4XRCA 3UPCA 4Q6YA 3B9VA 3OR6B 2CUHA 4WI3A 2YPVL 4PB9H 1MCPL 3PWVA 1H8NA 5EFIA 5HHQA 3CSGA 1OAKL 1BFTA 3MRGB 4HH8A 4LRIA 1S7SB 3O6FA 5F7MC 4ZXBD 4ZFZA 2O93L 3C5SB 1CT8A 1NLDL 1YZZA 1B88A 2MCPL 4NQXB 4J4PA 3QJHA 4XMLL 1J1XL 1MRCH 4HWZA 1JWMA 4JKWA 3BN9C 1VGEL 1XIWC 5ID0B 2ZSVA 1GIGH 5BOPA 4TTDD 4V2CB 1C7SA 1D9KC 1TQBB 2DQJL 2E8ZA 1X44A 3WS3B 2ICWI 2HWZL 2D4DA 2X6MA 3F62A 5IQ7L 1TVDA 5IM7B 5D2NA 4PJIF 5E2JA 2VL5A 1T2JA 4K23L 1KV3A 4NN5B 1F90L 1IARB 1QLFB 5IMKB 1YY8B 3LKPB 2JJSC 3SEPA 3IS1X 4AEFA 2X70B 3IKKA 1PZ5B 4L4VB 2F54B 3DSNA 2YPKB 3NCYP 5KSBF 4U3HA 1T1XA 4ZXBB 5F89A 5J12C 4RGOL 3V7MA 4ELMA 2WANA 2NY0D 3PWPA 1EGJA 2AABL 1URLA 4M6OH 5D7IA 5I8KH 4EQ3A 4KK5D 4OIIH 5IEHB 1A47A 3T4YA 3T77A 4G43B 2AJZB 3OR6A 3MMEB 1WIOA 1PZUB 3MRGA 2HT2D 1S7SA 1YDPB 4LEXL 3C5SA 3H2WA 3VDCA 1EFXD 1CD9B 1L9NA 1JHTA 3MRPB 2IQ9L 4AM0B 1J0HA 2BSRA 4Z77B 5IB5A 4OCRH 3FRPA 1I85A 4NKIH 3ZYJA 3WS3A 5JQHC 3I3BA 5EWIL 4Z7VE 1GC1H 1N4XH 5CSZB 2HKFH 3RTQB 2CGRL 3ZE1F 5HI5C 3BPLC 4NNPH 4WV1B 1U8OB 4K8RH 2X4RA 1T6WA 2VXUL 3KPSA 1QLFA 4TVPL 1YY8A 3LKPA 4H0HB 2JK5A 4JO1L 1HHIB 2YPKA 2UVEA 4ZXBA 5DC4B 3SBWA 4KKAC 4PUBH 2VXQH 4WI6A 5CSGA 1YMME 3UDWC 1KENH 1YEJH 1XF1A 4MYWB 4KXZH 1I8LA 4YDIL 2P5EE 1UWXH 3VFVA 3BMWA 4G6FB 4HH9A 4PJEF 1VFBB 4APQD 3MACL 5ICZA 2VAAB 3LQAH 3MMEA 3UTSD 4KHXL 1I8IB 1C08B 1IEAA 2BRRH 2YUVA 3VFGL 2G2RB 3GIZH 4UTAL 3WMSA 4PJHE 5DD5H 2ICEA 4OJFL 3S36L 4DKEH 25C8L 5EU5B 4AM0A 3D39E 2C26A 4JPVL 5AUMA 1IZJA 2PW2B 5F3BB 3STLB 5J11C 2DQDL 3EZ8A 4X7EC 5CSZA 4L4TE 4EJ1C 5FDYA 4J6RL 5ADPL 4GS7B 4NQDD 4J3OC 4MMXC 4EI5B 3IETA 3UBXG 3UJTL 1U3HB 5I75C 4Y16C 5T1LD 4APQB 2W07A 4MXQC 1IEHA 1NJ9B 2GSIB 5CUSL 4U05A 4HIEA 1MCOH 1PKOA 3ULUC 2VNCA 5GGRY 1JZ2A 2F58H 4EN3C 3FN9A 1MRDH 3S4SG 1EFXA 2VZ3A 2D3VA 5FYJE 4O02L 4PG9B 4FQQA 3TZVC 1GGCL 4JAMA 2WLZA 3MRHA 1CVSC 3S35X 5I1AB 4LLDB 1UM6H 4BJLA 2VAAA 4PJ8D 1OW0A 3MRCB 4M7LH 1LHZA 2NY4C 4NFDA 1PEZA 3O2DL 1BQSA 3BE1H 4HXBL 4MDJA 5SWZE 3V4UL 1G6RA 5C09D 4XTRC 1FFRA 4OZHF 4XPAH 2QADD 4G3YH 1QNZH 3OJ2C 5JQ6L 4P2YA 1K9TA 2FBJL 3QPXH 1ZS8B 5KG9B 2PO6C 2AJ3A 1LO2H 4P46B 1LGVA 2YXFA 4MAYD 1FZJB 4LFHD 5I1HH 3GGWB 3MBXL 4EI5A 1YEKL 4UIMB 1QYGL 5DUPL 3RY4A 1QP1A 1U3HA 2FHCA 4Z7UA 4Q9BA 4KQ4H 2I60H 4RFNB 3BW9A 4APQA 5GIRA 1M4KA 3F58H 5IP4A 4Q0XL 3DO7B 2GSIA 3ABZA 4QLRA 3CVHB 3L95A 3T0ED 1FNSH 1S7RB 4ONHB 3WFBL 1NCCH 2DLEA 3Q0HA 3O6KH 5DHVA 5KOMC 3Q5OA 1FNEB 1L0QA 5DQ9B 2C4XA 1WAAA 4Q9QH 1YEEH 2XQYG 3DLQR 3WEXB 3LEVH 4OLYL 3PQYB 4P59L 3UYOD 2EXWD 4LLDA 4LCWE 2HMIC 3NCYS 5ALCL 5C2UB 5E2UL 5SV3A 2K7PA 2FBOJ 1PJ9A 3MRCA 5D7LD 4KAQL 5SV4A 1HINH 4WFFD 3MR9A 3T0VA 4NQDA 1NAMA 3L3IB 3RNKB 5T1LA 4JY4B 3M07A 1KIUA 3MRJA 1JGVL 1J5OH 3T0EB 4C56B 4UTBH 3G6JE 2WBKA 4LIQL 2V5YA 4M7JH 2Q86B 3Q2CA 3GGWA 3S7GA 4XWOD 3S37H 1DFBL 1ZKAA 4NCC1 4HS8H 4WI7A 5JXAL 3B5TA 3MJ9A 2I9LB 3DO7A 4PJ8A 4R96B 3CXHJ 2HLAB 3FRPG 5AZ2H 2NY2C 1CGTA 3Q1SH 3UTZB 1KB5H 1TETH 5EZIH 1XH3B 3IJSA 1RZJC 4HUMB 1A0QL 3FB5B 5DQ9A 5C09A 1R5WA 3VFMB 3SKOA 5E5MB 3RPIA 3MLPA 3VGGA 1HHKB 1UVQA 1RVFH 4L8CB 4R7NB 2V7HA 1HOCB 4Z7QE 5F6IB 4LASL 5I8EB 1BECA 1ORQB 3GJFA 1K6QH 4PJBF 5I2IB 4MAYA 4C57C 1F6FB 3O41B 4JDTL 4LAJH 3D0LB 4U7MA 4JY4A 5K9OB 3B5GA 3QQ3B 5J3HC 5K59F 2VQ1B 5SWQA 3IRPX 3EYFB 4C56A 3T0EA 2KQMA 3B2UD 2P8LB 1ETZB 2Y07H 4OFIA 3BHBA 3P73A 5JW4M 2Q86A 4XHJD 3GSOB 4MWFB 4RBPK 3VFPB 3J7HA 2DQUL 4EXKA 2XACC 3RWCB 3CX5K 1IGJA 1MCHA 3PP3H 1NUGA 2I9LA 3BXNA 4R96A 5D7LA 5GRZA 3TA3C 3WFHA 5IBUG 2VITB 5HBBA 1A22B 4FQXB 4GFTB 2F53D 1FC1A 1XH3A 4ZUUA 3FB5A 4ZFFB 1NBQA 1YYLH 1IGCL 5I15L 4DGIL 2FR4B 3MOBH 4R97B 3JTSB 3ZSSA 3SJVB 3QWRD 4R7NA 4HAGA 2Y36L 2FZ3B 1ZT1B 4DOHE 4K9EL 3BX7C 2H41A 3PXJA 4NKOB 2GTZA 3GKZA 3PWUA 5I2IA 1F3RB 1XGQB 1JNLH 2C3HA 4XBPB 3O41A 3GBNL 4Y4FC 3D0LA 3QQ3A 5HYQB 5DJYA 3OHXB 1EMTL 3EYFA 2ZCKL 1ETZA 5TQ0H 3BYYA 3B9KC 2XY2A 4E5XB 3SCMD 2F53B 1R3HB 1FDLH 4BYHA 3S88H 3RIFK 5HGDB 3GSOA 4MWFA 4G6JH 4EUPB 2LQRA 3NPSB 3W0WD 2NY5L 3IB4A 2BSTA 3RWCA 4L8SB 4HC1H 2CDGB 2XYCA 3MCG1 3L3GB 4TSAH 4XAWH 2Z93A 4U6TA 4CVWA 4XPTH 1RSFA 4OTXL 5ELIA 1KTDA 2BNUB 1CXFA 5C08D 3QZWG 4UNTA 2YPLE 1A4KA 2R0ZL 4ZFFA 1CTNA 3MLUL 1CLZH 3FZUC 1FZOB 1WQVT 3NZHL 2FR4A 5A2JH 3WFDH 5EA0L 3SCMB 2FZ3A 3JWNC 2VDMH 3LKOB 1FFQA 5HI4D 4GKSA 2RAMA 5I71C 1XGQA 3OSKA 4XBPA 1K85A 1YQVH 5EOCJ 1IAII 4L1HA 4MJIB 2R2CA 4QEGA 4HZAA 3DRTA 3OHXA 3WJLA 3MRNA 3GHBL 4FFWD 1KN2L 5HGAA 5C08B 4E5XA 2F53A 4NRXB 1EZVX 4G5ZH 3TJEH 5HVWA 2DWEB 3RNQB 2VERN 4AEHL 4XNXH 4DUVA 3U1SL 4Q58C 1OLLA 3FRUB 1HIMH 2I9TB 3QWOA 3WKNA 1MJ7H 2LTQC 3G5XB 3CU7A 3KXFD 5DFVD 3ZT7A 3QWRA 1PG7X 4OM1L 3GMNB 3HE7D 3L3GA 3Q48A 1HNGA 3QCTL 3WS6C 2BNUA 4I77L 1UZ8A 3NFSH 4N5ED 1M05A 3TYGL 3FQWA 1NEZG 2VKXA 4L5FL 4JKPH 5DQJB 1N3NA 4XC3H 4B7LA 3RKPA 5FA3A 4NQCE 1ONQB 5ANMB 5DRNA 3SCMA 1I7UB 3DBXB 4QY8B 5DD1L 3BZFA 3LKOA 4OZIF 2X4TB 1H9VA 3MYJA 3PHSA 4UBDC 4DTGH 2R69H 3W0WA 2HKHH 2F54E 4L4JA 2W0FB 4WFHE 4WWKB 5J7CC 1FPTH 5DGQA 4TNVK 1L9MA 5F97E 4ODHL 4DAGH 4OCYL 3ZDYF 5L2KD 5LCVH 4G8GE 2Y72A 4N0UA 4M1CC 3NFNA 3MV7B 4X6CE 5J1AA 5C08A 1DEEB 4K7PY 4F15B 4YXLH 4JHBA 4LFHG 2CKNA 1P4IH 1FAIH 2DWEA 3I6LE 4LLVB 3RX8A 1AHWC 4S1QH 2EDWA 5EOQL 3FRUA 2I9TA 3G5XA 5JW4R 3U4EB 4YHKH 5E08H 1TQCB 3MRIB 4UT6H 4E0RB 5C0BE 5DR5L 1R0AL 1AGDA 5F7HA 3F7PC 3HB3D 4X80H 5CJQH 5DQJA 3B5HA 2E9WA 4TSBH 5I1JL 1ZXQA 4ZOBA 3SDXE 3PWLB 3WN5A 1ONQA 2YZ1A 3IDGB 1UWGL 5GPRA 4XP9H 2Y7QB 4UUJB 2DQIL 3DYOA 3JV4B 4FABH 3CDFA 4QY8A 4OQTA 1BBJA 1AQDB 2X4TA 1C16B 1DZBA 1AR2A 3VU2A 1H3XA 1B0RB 1A1OB 2W0FA 4JZJA 4WWKA 4XVJL 3KXFA 4PP1D 3CFCH 2XRAH 1JZ5A 2AK4B 3HE7A 4X7CC 1CBVH 2ICES 4LU5H 3BZEB 3MLTA 1MY5A 4NGHL 5CD5C 1BBDL 2F5AL 2NX5D 2BXZA 3U0WL 3BKYL 3CX2A 4X83A 3KPRE 4PJ7F 1TZGL 5D6CA 3RWFB 4NQVB 2VDOL 2DQTH 1OAUL 3QEHB 1SBBA 4TQEL 2D03H 1FL6B 3JVGA 1O7VA 4IDJL 1RURH 3HPLB 4V1DD 1VENA 3PDOB 4L9DA 4LRIC 3MRIA 4L3CB 4IMKA 1JFQL 4J4PC 2VDKH 2LU3A 2QL1A 4M8VA 2Q3AA 4NQSB 5HHME 3B6SB 1HXYB 1GGIL 1PEWA 4LSVH 4OKVB 2WM0A 5DVOA 2QSTA 3C6SB 4AY0A 1SVZA 2NX5B 4RGND 1IGTB 5D2NC 2Y7QA 4UUJA 3T2QA 1J88A 3RHWK 1I1YA 4X0KB 2WBWB 4D94A 5GS2D 1C16A 3QUML 2Z0BA 5GXBB 4Y88A 3O2VH 7CGTA 4UOW0 4M02A 1BX2A 4OB5H 3NCEB 1KC5H 3H9SB 3T2NL 1QACA 5J13C 4XP6L 3OX8A 4P5MB 2GJ6D 4Y19D 1ULVA 1D5ZA 1SY6A 2D7OA 3ARBB 3QEHA 2V9TA 5CBEB 2P1YA 2XA3A 4R2GB 1W0WB 2R4SL 5IHUH 5IVOA 3SO5A 2EC8A 4X5XB 5GRWA 3V7AE 1UA6L 5TPWL 1QQDA 5EBGA 3LB6C 3G04B 1WLHA 4M43L 2GAZA 2GYSA 1KLGB 5DRXA 2OXHA 4NQTA 2Y25A 3JZ7A 4NM8L 4WWID 3UMTA 1SVCP 2KKQA 3B6SA 3LMJL 5T1MB 4OKVA 1I85C 1IGFH 1TQBC 2A1WH 4OIBA 1ROWA 1FO0L 3A67L 3CH1A 3IXTB 2NX5A 1CYGA 4OCNC 1UZ6F 1IGTA 4UOW1 4UT7H 3EAKA 5DK3A 3TC9A 3WIHA 4JFXB 2BVOA 4YDJB 3VXRE 1Y18B 3HA0A 3DMMD 4NN5C 2UVFA 2H2PD 4IJ3B 4ZUSB 3BPCB 2XZCH 2JB5L 4K94H 2HFGH 5LWYL 4V1DA 1AJ7L 3EOAA 3VXUD 1DBBH 5KS9E 4ZXBC 2ARJQ 3SBWC 5HDQL 5I8OL 1GVIA 3BQUD 2W91A 4PGJA 1OAQL 5AZEH 3QPQD 3H3PH 1FZMA 4JJ5B 4NRZA 2BVEA 4GRLD 1W0WA 2R8SL 2MNUA 4GAYA 4X5XA 1P7QB 5D96C 2MQ3A 4R26H 3DMMB 4IMLB 1CDYA 3ULVD 4CDGC 4F7TB 1VKXB 1Q38A 2BNRE 3CU1A 3U7YH 5FDWA 1KCVL 5T1MA 3IFOB 3VXUB 2YUZA 1ZA3A 1MHHA 3V8OA 4OBSA 2VLRE 2VH5L 1DDHA 2NY0C 3P0VL 3O45A 1NL0H 2DL9A 3OJDB 2X05A 1SJEB 2BDNL 3TEUA 4OLVL 5JO5B 4XVTH 1UT9A 4ZUSA 3GK8H 2ADFL 5F1IA 3L5WA 4GRLB 1PX4A 4ZUTB 3WD5H 2XTJD 5KVEL 2ZUXA 3MV8B 1UCBL 3MUJA 5GS0H 4QOKE 4BKLA 3N0PB 2HT2C 2DTML 4X6FB 1C5DB 2D7MA 5E8NB 4NC1E 1FSKB 2ZSWA 3IJHB 2EH7H 1I9JH 2BERA 1D6VH 5K33A 2X1XR 5I1CH 4HS6B 1RUKL 4KUZH 4EI6B 5D7JD 2FL5B 4QRQB 4JJ5A 2IALB 1MIML 3N9GL 4GKNA 3JWOH 1OW0C 3RVUC 4IRZL 5IK3A 4JN1H 5EUOE 4HDIB 4LCUB 3X11A 2NPLX 4XPGL 3DMMA 4UDUB 5BV7H 4IMLA 1J86A 1IC4L 4F7TA 1EHLL 4HIXH 2Z4QB 1VKXA 4PRNA 4O58L 5EDXA 1MREH 3V6OA 4C4KO 3IFOA 5F7FA 4ZFOB 3VXUA 1JRHH 3OKNB 4KMTL 3BQUA 1DL7L 4LKCB 4GS7C 5KSVB 1SJEA 4NO5B 4EI5C 1U3HC 4HSQA 3SQBA 2X09A 2PXYD 32C2A 4APQC 1G9MH 1AP2A 4GRLA 4ZUTA 3X3FH 3MV8A 1B4JH 4Z95H 1A3LH 4KDTC 3GMLB 4IIQA 3RDTD 5J4MA 4JFHE 1CDHA 1DQLH 3VD9A 4YGAB 1DBKH 4JFPA 4UT9H 5E8NA 1KF9B 1MCBA 4HWBH 5C0AE 3IJHA 3MLXL 3VGAB 2VC2H 1TVHA 2F9BT 3ZKMD 5I66B 4XVUD 4Z0BH 3MSPA 2WUBH 1M7DB 2ESVB 1AE6L 2FL5A 1BEYL 4QRQA 1Q9WA 5GRYA 2IALA 3CXDH 3LPFA 4FFYL 5C70A 1PLGH 2OP4L 2Z9TA 1U6AL 1V3JA 3L5IA 4J1UB 5JORB 4QNPF 1A9BB 3P4OA 2GK2A 4PJ5D 1WZMA 3BH9B 4BFIB 4Q97A 2YD1A 1IKFL 4UDUA 2DL2A 3B9EA 3EZJB 3GKWH 1NFDA 3LQZB 2H2SC 3MPCA 1YNLL 3GSQA 4M8QA 1MFCL 3RDTB 4KUCF 5ITBL 4TN9A 4X9BA 1NFKA 1BQHB 5CWSB 5D7KE 4ZS7L 4P46C 4H88H 4NHCH 1XGUB 4LKCA 4OSUH 4RSVA 5CEYB 4YHLL 5KSVA 2AJUH 4XP1L 1MAML 5I16A 2APWA 5D7JA 4RFNC 4OF6A 3U9PL 5LXGH 1F8TL 3GMLA 3IU4L 3TBVB 1FGVL 5SWSE 4QXTB 5EO1B 3QDGE 4WFGD 3FFCB 2W9EL 3RIFF 4OF7A 5I66A 1N6QL 4IRJD 1M7DA 4QRRE 1G9NC 2QADC 4ZPTB 3GBLA 1AY1H 1A5FL 1GHFH 4J1UA 4MAYC 5JORA 1WEJH 4MJ6B 3BH9A 1S9YB 2R0KL 1FQ9C 4YPGB 1MAKA 2PXYA 4CGTA 1BFOA 3LQZA 5HDLA 3OKMB 1CD8A 1U8MB 3T0EC 3HRPA 3RDTA 5FUCE 5DJDB 5CWSA 3W2DH 1T5XB 1QFWL 3QUKB 1BWWA 4GKOA 1ZLSL 3LY6A 3HG1D 2B1HL 4RX4D 1EBPA 1S7TB 3RWDA 1YN7B 2EXWC 4QXGH 1UKTA 3VD7A 5EC2A 2N56A 3QEUB 2EECA 2OTUB 3FO9A 4PJ5A 4HIJB 4MDIB 4NQUA 4YXHL 4YK4B 1VACB 1OAZL 4GG6F 3H7LA 5IMOA 4MNGE 5D8JH 5JW4N 5JDSB 1S7UB 4ZPTA 4PB9L 1K5NA 5F6IC 5ACLA 1YMHB 5FFLA 4KXZI 2OL3B 2EEBA 4MJ6A 4XWOC 3W9EB 4JR9H 2AV1B 1RJLA 1S9YA 1EUUA 1VADA 3IXAB 1MRCL 4RWYH 2EE6A 3VFSB 1T4KB 4BFEA 1V8HA 1U8MA 1GIGL 5EIIA 5D2LE 1WV7T 1BLNB 1QBLH 3RVXD 4UOJA 2BOBB 3CZFA 3IJYB 1T5XA 4EZMA 4LSRH 4IRJA 3RGVD 4PG2C 3BP5B 1YN7A 4TNVF 3O11B 3BP6A 3I75B 3RY6A 3QEUA 5TDNA 3C5JB 3UAJD 1ZHBB 5MP6H 4HIJA 4LVHB 4FQXC 4R9HA 4PJIB 4MDIA 4XX1G 1JNHA 4M6OL 5I8KL 1P6FA 4OIIL 5FKPB 2E3VA 4R97C 1S7UA 3AS0A 4X5LA 5EC1A 5KSBB 3SE8H 3MLVH 2CKBB 4M00A 4CBPA 4XHJC 2VRAA 3L3DB 3HG1A 2VISB 2AV1A 4RX4A 3RGVB 3OKEB 2YD5A 4OGYH 1P2CA 4FTVD 3VFSA 3GSNH 2AXJA 4OCRL 5B8CA 3WJLC 4NKIL 4MHHI 3PABB 4OF3A 4LNVA 4HGMA 4KGLA 1N4XL 3IJYA 4H1LB 1R5IB 2HKFL 2LABA 3RVVD 1AKJD 1TCRA 4NNPL 3NPSC 5KVDH 4KTEH 1RU9H 1KJ2B 3L7EB 2PYED 3IRZA 1M71A 3BP5A 1SEBB 1ZHLB 4G8IB 3VRJB 3O11A 3VXSD 3I75A 4P23D 3ARRA 1XGYH 1UADC 3GSRB 4Z7OE 4LLWB 4PGDB 3C5JA 1ZHBA 3FMGH 4PUBL 2VXQL 2AJSH 2GI7A 4PRAB 3RKDD 3Q6GH 1KENL 1YEJL 3OXRB 3SGEH 4RRPA 4LK4A 4HKZA 2NTSP 4OZFA 1NCDH 5FKPA 2E6JA 3SDAB 1P4BH 3CDCA 3LQAL 3SCMC 1C8PA 1DQTA 2BRRL 3JUZA 4AG4H 3GIZL 3L3DA 1ITBB 4YLQT 3W11D 3MFFA 1OARH 5DD5L 2VISA 1DTUA 5MEOA 3PWJB 3RGVA 2PYEB 3NIDE 4DKEL 4N9GA 2UZXB 3H9SE 3SDYH 5HVGB 4E41D 4PJEB 1FL3B 2XZZA 4P23B 1RPQA 3UPAA 2EYRA 3PABA 4K3EH 3T09A 4QT5B 1DN0A 2LE9A 4PPTA 5EZLA 3RHWF 1CLOH 4IHOB 1YECH 4UQ2B 3ARZA 4JQXA 3L7EA 1BAFH 1ZHLA 5EU6B 1MFDH 3NCCB 4P49A 1XF4B 1U8KA 3WFEH 3GSRA 1TXKA 4LLWA 5HI4C 1ORSB 1NCTA 1I7RB 2F58L 4U0RB 4YZFE 4GMSH 4PS4H 1S5HA 1MJUH 3ARDD 4PRAA 1OAXH 1RIUH 3OXRA 4FTVA 4QO1A 4E41B 1RIVH 2CK2A 2FH8A 3WN5C 1I9RL 2QKIB 4FFWC 3SDAA 3AS2A 2FLRT 4LLAA 5A2FA 2WINA 3EJYD 4M7LL 4U4BA 4X8JA 4YNYA 4QXUL 1IL1A 1AKJA 5IMMA 3BE1L 3MRKA 1EHAA 3HRZB 4WWKC 4D9LH 2PYEA 5DFVC 3HE7C 3FO2A 4XPAL 4YHMH 4PJEA 3VXSA 4P23A 3UJIH 4G3YL 1QNZL 4OZGF 3KPNB 1UWEH 3T4AB 2J8HA 2FWOB 4QT5A 4XNQA 2YD2A 3AGVA 4WHTA 1LO2L 1T83A 3D85D 1UWXK 5FKAB 5I1HL 1A8JH 3NAAH 4PJFE 4IHOA 2A73B 2D9QB 3HE6D 5DMYA 3JVGC 4KQ4L 4I1NB 2I60L 3UROR 1L6ZA 3F58L 4OZHB 1Y6NR 3FB8B 3QR2A 1FNSL 1TQCC 4XZUB 5BCAA 1NCCL 4IMKC 1MNUH 1QSFB 3O6KL 1VEMA 4YDLB 1I7RA 4YFDB 4R4FH 4Q9QL 4JZNB 3LEVL 2L4OA 4E41A 1N2RA 4F7PB 3HC3H 5E8OB 1KJVB 1NBYB 4MQXD 3SDDB 1KJ3H 1HSAB 2EDEA 2QQNL 3QHFH 1HINL 2CXKA 1WICA 3VE0B 3BKJH 4ODSH 1FFNA 5CJOH 3LSOB 4NN6B 1J9CT 5FYKU 3RPKA 4H1LH 5F7WC 1IQDB 3MNZA 2I27N 1N59B 4UTBL 3HMWH 3KPNA 3MROB 1KJ2H 1JGLH 3T4AA 2EO1A 5FYLD 1OTTD 2FO1A 2XWBB 4M7JL 4MVBD 3ARDA 5FKAA 3HB3C 5IB1B 3S37L 5INCB 2A73A 4HS8L 2J4WH 2R1XA 3D5OF 5AZ2L 3FB8A 3CFKB 3PJSB 2EKSA 3BESR 4KV5E 3Q1SL 4X7DC 1KB5L 1TETL 5EZIL 4WI9A 4PP1C 5CP3A 5E99H 4K7PX 1RVFL 4IBLT 1XGPB 4JANB 4PRID 2OS7A 5ETUA 1T04B 3VD4A 1K6QL 3D85A 4Z7WE 1VEOA 4NZUH 1X5AA 3WL9B 3DGGA 4D9QE 3LSOA 5K9JL 3HE6A 5M94B 3F8UB 1U8IB 4FQPA 4ZTOH 2JCCE 4OZFG 2E7LA 3A6OA 5IB2B 1U91B 2LU4A 2Y07L 1GOGA 3MREB 1MWAH 2QQLH 5FXCH 3NTCH 2W9LA 4PJBB 2OTWA 3CDGB 1NUFA 2Q20A 3ARBC 1A6WH 2Z31D 5IB1A 2Q7YB 4DGYH 1SYVB 2IPKA 5INCA 1E27A 4R2GC 4MJ4A 1S7XB 4MXWH 3P11H 2CUIA 1JGUH 3QO0B 4OV6F 2ATPB 3VD3A 4RFOL 4PY8J 5HGHA 4P2OB 1YYLL 5MI0B 2P49B 3TV3H 3VXNB 3HZMA 1XGPA 4XPFH 2G60H 4FFVD 3HAEB 3ARFD 5CS7A 3RL1B 1T04A 5DJ6B 3AB0B 5EOTB 1J8HD 4HF5H 3KNBB 4QTIH 5KN5A 3L7FA 2Z31B 4IJ3C 3BRGC 1JNLL 1S9VA 3VFUB 5IJVA 2GT9B 4Z7VF 1QR1B 1U8IA 3QULA 4QCIB 1B0GB 3VWKD 5K9KB 5TQ0L 4H8WC 3R4DA 3RWGB 4YFEA 5DD0H 1S8DB 1FDLL 1OGAD 4PJBA 3S88L 5IV2B 3BKMH 2Q7YA 4GRWE 5DJCA 5IVZB 4C83B 4PRIA 4Z9KB 3Q3GA 4Z5RB 1G6RH 4N0YH 4XAWL 2P5WE 4CAGA 1D6EB 4XPTL 5MENE 1OQXA 3QO0A 3DMMC 5DMIH 2H2PC 2ATPA 2IBGA 1UACH 3ILQD 4LNRB 1JK8B 1LO3H 1DUZB 1A4JB 2HTLD 1WIPA 4DKDC 3V6OC 1CLZL 5CHNA 2HA1A 1WWAX 5C0JB 4Y5YB 5D1ZB 4WU7A 3WFDL 4P5KB 1A7RL 4PJHF 3HAEA 2Z8VC 2VDML 3CPLB 3R1GH 3QPQC 2ID5A 4ORGA 5ISZD 2Z31A 3PP3K 1YQVL 3GB7B 4GRLC 5DHVH 2V5RA 3U6RA 1ZANH 2GT9A 1QR1A 4IIQC 2E9IA 4PJAA 3HR6A 4QCIA 1B0GA 4S1SH 5K9KA 4X6EB 1I3GH 4X4MA 3U4BH 3ULVC 4G5ZL 3TJEL 3D3VB 2A6KB 1QUNA 1IGIH 1CE6A 2HTKD 4XNXL 2YD3A 3ROOB 1HIML 4JZOB 1MJ7L 5IVZA 4M6NH 1RI8A 4JHZA 3PDDA 1K3ZA 4C83A 3ARFA 4Z5RA 4WUUE 1D6EA 1J8HA 5TH2B 1AD0B 3NFSL 2QLVB 3U7AA 2XN9B 4JFDE 1JK8A 4JKPL 4XNMA 4XC3L 1A4JA 1X5JA 1QR4A 3RWEB 4OGAD 2X4PB 5JPNB 4UIKH 1LD9B 5D1ZA 5HY9B 3VWKA 2C7UB 1LP9F 1U8NB 2VLJD 3LCYA 1HCVA 4JJHA 4TSCH 1OGAA 3GJEB 1FE8H 5FUOH 3DXAD 4AT6A 5FGCB 4DTGL 2R69L 3SHSA 2HKHL 5HD8D 1A64A 1IM9D 1MUJA 5MERA 1FPTL 1V3KA 4PRHB 4YGVB 5B22A 5TQ2H 4DAGL 5IFAH 4DWHA 4HZLB 5LCVL 3CFEB 4PJ9D 4ODUB 4PV8B 4MZ2A 1DEDA 3O0RH 3MXWH 4YXLL 3VGAC 4D9RD 3CMGA 4OZIB 1P4IL 1FAIL 3QNYB 1LMKA 1AO7D 1OTUD 4X9HA 4D2NA 1S7VB 4S1QL 2CDEB 1AGCA 1FV1A 5E9DE 2MWCA 4JZOA 5A3ID 4KDVA 4YHKL 5HDBE 2X7LA 2Z8RA 5E08L 5CIPA 1F4XH 4UT6L 3P4NB 3FOMA 1X4XA 3QG6A 5ISZA 4J3SA 1X7QB 5JNYB 3KPQB 1IM9B 5CJQL 4N90E 1EBAA 1JUFA 1DLFH 4N1EA 1Q9KB 3RDTC 2QTEA 3RWEA 4TSBL 1KTLB 2X4PA 4M9OA 2W59A 5HY9A 3PWPE 3QT2A 1KEGL 1U8NA 4M6MH 1KT2B 4FABL 3ZKMC 5IUSA 3GJEA 4XVUC 4NOBA 1NCWH 3O4LB 4WJ5A 4ELKB 1BF8A 5LGKA 2BOCB 4QTHB 1C12B 3G6JF 1Z3GH 5CAYB 3CFCL 2XRAL 1F4YH 4M1GH 3V5DB 3OAYH 2DJ4A 4YGVA 3T8XB 4LU5L 1CBVL 4R4ND 1QLRA 3T1FB 4BQCA 2XOTA 4HULB 2HN7A 4JQIH 3CAFA 3EJJX 1ZE3C 1ZWIA 3O3UN 3QQ4A 2CXGA 1CE1H 3QNYA 1T0MA 5F1OB 2DQTL 4KTYA 2A6DB 2D03L 1S7VA 4UU9B 1MAJA 3P4MB 1JMZA 5D93B 4QF1B 3I6GA 4J3WA 1VGKA 3H42H 3IDXH 3RWJA 1HILB 3BRFA 3P4NA 4PJ7B 2DWDB 5DS8B 3KPSE 1RK0B 2VDKL 3DXAA 5J1TC 1WBZB 5JNYA 1CCZA 3U46A 1GGUA 2DM2A 2Q1EA 1SMOA 1IM9A 2Y5TA 1CU4H 1EEQA 3U4AA 2RCSH 3AXLA 4LSVL 1FP5A 2AERT 4IRSB 4PTTB 5HHNB 2FO4B 4HCRA 1KTLA 4PJ9A 2A74B 4LVNB 3GMRB 3FO0H 3LN4B 4ZO7A 3FT4B 5CEXB 1XZ0B 3JXAA 4IRJC 4S1DD 4UAOB 1AO7A 3PL6D 1T7ZA 1RY7B 4LHJB 4MJ5A 4PGBB 5AEAA 3QIWB 1C12A 5TGBB 3DVNA 3JWDH 4X7TB 2D0GA 1A21A 2OI9C 2X4OA 1HI6B 3O2VL 3RY6C 5ENWA 3MUZ1 1NGWB 3THML 1RV6X 4XI5D 1N8ZB 4OB5L 1KC5L 3S96B 4LDOB 4NC0B 3CGTA 4YK4C 4RGMB 3FN0H 3WUZA 3QO1B 2CLVB 1NANH 5E5RB 2YD7A 4DW2H 4UU9A 5IHUL 3I3EA 2NXYD 2YRZA 2ADJB 5HDOA 5BRZB 3ARGD 4RDQF 1VDGA 3ZHDA 1HILA 3P9LB 4PJ7A 5DS8A 3VGFA 5BW7A 1XF5B 2DLFH 4N9OB 5B8CC 1I7ZA 4PTTA 1IGFL 2A1WL 2FO4A 2BHYA 2A74A 4OCWH 3GMRA 3LN4A 1M7XA 4KH2A 3UTQA 5CLWA 1RJZB 5CEXA 1ZV5A 1CVRA 2IH1B 2JJUA 4XWGH 5CJ8A 5I1DA 4GJTB 4YHYB 1JRHI 1H5BA 2XZCL 2R2HB 4DUWA 4K94L 2HFGL 3QDMB 1HI6A 3MQIA 3ARGB 2C4FU 1DBBL 4U1KB 1N8ZA 5HYJD 3V0VB 4LVHC 5EOCH 1YNKH 5AZEL 1G84A 5TF1H 2ZG3A 5C3TA 4HJ0D 2MKLC 3H3PL 5GRXG 1EDQA 1H8SA 2HFEB 3QO1A 2CLVA 1TMCB 1UH2A 3RVXC 2FYYA 4NT6B 3LRSB 5TFSH 4CADB 1ZGLM 2YKLH 3K4AA 4DCQA 1F02I 1R3LB 2VXSL 2APXA 4EDXB 4N8CH 4Z7UE 1H3TA 4R26L 5JPMA 3P9LA 4FQHB 5D70H 3RGVC 3PL6A 5J06A 1U3YA 4P2QB 3UTSE 3K80A 4UILH 3U7YL 4MNHA 3QCVH 5JTWA 4AQ1B 2HG5B 3WBDA 1BZ7A 3UAJC 4X8XA 5E94B 1NL0L 5E2VH 1MLCB 3TYFB 1RJZA 4GLRI 4R0LA 4XVTL 2IH1A 3GK8L 3K2MC 4JQXC 4OD2B 4JHWH 1MCWM 4LGRB 4HHAA 3WD5L 1ZLWH 5GS0L 1LWRA 3DV6B 4K3JH 1JI1A 4NQDE 4NYLA 3ARGA 2IJ0C 4RFEA 4U1KA 1NC4B 2R2EB 4Q7DA 1IAIM 4LP4A 1B3JA 2ICWJ 4M4RA 1VFUA 5D1XD 3STZA 1MVUA 2EH7L 1I9JL 1D6VL 5I1CL 5FA4B 2CLZA 2X4QB 4KUZL 2HFEA 1MF2H 3VGDA 1FFOA 4OQTH 3ZE2F 3SDAC 1W2KT 3JWOL 5CZXC 2IAND 3O8XB 4JN1L 3S8WA 3RVVC 4EDXA 3IDUA 4GBXD 3TPKA 3U48A 1NDGA 4B50A 2OK0H 3MUHL 5BV7L 1SBSH 4OKDA 1CDCA 4HIXL 1KLUB 5DJZB 5DD6B 2VKWA 4P23C 1MREL 4H5SA 2HG5A 5EN2B 1DBMH 1HWHB 1OWWA 1JRHL 3HUJA 4JKLA 1T83C 5C09E 4AEEA 2Y9RT 4LL9A 3RKDC 1MLCA 2ICWA 3PHQA 5L8JB 1FIEA 5IEKA 5DMKA 1KCRH 2BVUA 3WV0A 2WW8A 4I0PD 1G9ML 2WIMA 4M48H 4X6CF 3X3FL 1J11A 5GGTH 1B4JL 1J87A 2WV3A 4Z95L 1A3LL 3EIFA 2OR9H 5HVHB 5TE4H 5HXMA 4I4WB 1DQLL 4I0KA 5AG9A 3CUPB 2R2EA 4GBXB 2GEEA 4UT9L 5KSUA 3W11C 1KNOB 4HWBL 1OY3B 2VC2L 1FC2D 2V2XB 4Z0BL 4WVRA 5I1KH 1A6UL 5HJ3A 3D25A 4I48B 2V7NA 3CXDL 4N8PA 3OAZH 1QA9A 4LPCA 3F7RA 3V52H 1S7QB 3MRDB 1R5VB 3REWB 4Z76B 5MHSD 3SDXF 1Z9LA 3GKWL 4LEXH 3KLHD 5D7LE 2OX5A 2A83B 4WFFE 2EO9A 5DJZA 5DD6A 1SY6H 4PREB 1PDKA 3O2DA 4DN4H 1DLHB 1RHFA 4YJZL 4H88L 4NHCL 4OSUL 3E3QC 3QI9D 2AJUL 2IBZY 2P7TB 4MX7A 3RZCD 4EVNB 3UTTD 3N1FC 2HJKB 3ZKQD 5LXGL 5DEFB 2R2BA 3LPWA 3H8NA 2IANA 3ZYOA 3EJYC 3MJ7B 3QRGL 2RGSA 1JYNA 4I4WA 1HHJB 3CUPA 4RAVB 4GBXA 2D31B 1G0XA 2B4CH 3ALXA 4YDLC 3PP4H 1KNOA 2WZPD 2V2XA 3C5ZB 1WUNT 2N7BA 1AY1L 1EIBA 2FATL 2ZUUA 1IZKA 5GGSY 1GHFL 4L3AA 1B9ZA 5E00B 1WEJL 3H0TA 2KQNA 4NN6C 5KSAB 3REWA 4P9HC 4Z76A 4YDKH 3QDJE 4I0PA 1A7OH 1OVZA 1JWUA 4M93B 3KHOA 2DQCL 2VLMD 1CDBA 1A6AB 4PREA 4LSQH 3ARYA 5DDHB 1ZVYA 1JHKH 1T21B 1Q72H 2FIKB 4NOFA 5E0QA 2P7TA 2RIKA 2VN7A 4MQXC 4QXGL 1N5AB 4I9WD 4D0CB 5GS2H 3PE9A 1V05A 1MFEH 4KMLB 3EO1B 5EU7E 4HKXB 1HHJA 4OT1H 1G7IA 4RAVA 4QRPD 4PGEA 1IC5H 2DOCA 4LVEA 1YY9D 3VXTB 1MHCB 1PSKL 1FL5B 1NC2B 3KPMB 5K9QG 2D9CA 4HXAH 4MNQD 4ZNEA 4PRPD 5D8JL 1JMXA 3KJ4B 4MCZA 3D87B 3KVQA 3SGEI 4KJQC 3B3IB 1CTOA 3RX7A 3D2UD 4KKBC 3WUWB 3QI9A 4P2RE 5DJXA 3CNKA 3D18B 1SJHB 4JR9L 4PRHE 3U83A 2IFFH 2AKRB 4GG6B 4U1SA 3RZCA 2V2WB 3UTTA 3BPOB 2XTLA 3IDMB 4K07A 2RR3A 1J7VR 2J6EH 1QBLL 4U1MA 4OBRA 4LKXB 4P3DB 4OZIE 1WC7B 4PGCB 4URTB 5CP7B 4XC1H 5BZWA 4FFZH 4ZUVB 2AP2A 4LSRL 5J0BA 4PRPB 5KS9F 3DX6A 3P40A 3MLWH 4AK1A 4B7IA 3LKNB 5I19H 3VGBA 5DUPH 1N5AA 5KZCD 2DYPD 1CN4A 5HHOB 4LLYB 4R90H 2OYPA 1D5MA 4HKXA 3W0WE 5MP6L 5MEPB 4X4XA 4EDWH 4M9PA 1XF3B 4M1DH 1MI5D 3VXTA 1XR8B 1ZMYA 3KPMA 4N0UE 5GGQH 5MI0C 4HBCH 3DARA 3HZKB 5B39B 1Z5LA 4JKKA 3FFDB 4RBPH 3O4LE 1UXWB 3MLVL 3SE8L 3SO3B 4P59H 3B3IA 3VFWB 3WUWA 2Z31C 3EOBA 2C3GA 4K2UH 3P0GB 2NYYC 2AKRA 1KPUA 2EDYA 4GG6A 2V2WA 1B0WA 4OGYL 3HN3A 4LSPL 2QR0B 3GSNL 5KZCB 2NZ9D 3MCKB 1BQLH 2DF3A 5AYUH 3FOLB 4NRYB 1DANT 3GMMA 4PGCA 2VLKB 4QRPA 1DQDL 2IADB 1AGFB 1D7FA 3MRQB 3NCFB 1MI5B 5EIQA 5ESVB 3V5HA 5KVDL 4KTEL 4MNQA 1S3KH 3MJ6A 4PRPA 1RU9L 5IFJB 1CG9B 3BVNA 1A7QH 1UJ3B 4FFVC 4C55A 4XPBH 4J8RB 4E9LA 2WSKA 1XGYL 3ZHKA 4F8TA 3BPNB 3D2UA 2NXZD 3FMGL 4KWUA 5MEPA 3OKKB 3KXFE 1XF3A 2AJSL 4XMPH 4X4YA 1CD1A 3Q6GL 1XMWA 1XR8A 5EUOF 4DKFL 1A0QH 3H9HB 1NCDL 1XCTB 2X1PA 5D1ZC 4F80A 1P4BL 3GMOA 3GSUB 4RCAA 1JGDB 4LCCB 4U1JB 1UXWA 5TE7H 3GSWB 3OKDB 4AG4L 5I1LA 1OT1A 1FNLA 4FXKB 4O2CA 4KRLB 4U7KA 5M7QA 2ORBH 4LSUL 4MCYB 1D5IH 2I5YH 3SDYL 3L6FA 2QR0A 2YD8A 2ERJB 4PD4J 3QRFM 2DYPA 2P45B 1K4DB 3FOLA 3BWAA 4K3EL 2NXZB 4DZBB 4KI5E 2NY1D 4YAQA 5C07E 4TUJB 1MELA 4ZAKD 2VXTH 4O2FB 2AXGB 1AGFA 1CLOL 3MRQA 1MI5A 5L2KE 3FAXA 3HFMH 1NGQH 2ARWA 1YECL 1NGXB 1ZGLB 4F9LA 1BAFL 1UB5B 3HNVH 4HK3N 3OGOE 1MFDL 1S9KC 3DUUB 3QQ9D 3WFEL 2C3VB 5FK9B 1MOEA 4XBGA 4GMSL 1WSST 4PS4L 4WGWB 3S36X 3IFLH 1MJUL 1T7XA 5A2KH 3MV01 5DD3H 1OAXL 1RIUL 2BSSB 2BVYA 4I5BB 4UNVA 5C0GB 1RIVL 3WJJA 3W5MA 2F8VA 3H9HA 3PNWA 1IGCH 4KVNH 1JGDA 1AGBA 4LCCA 4K7PH 4CVUA 4ZAKB 4RISH 2H6PA 3WO3B 2HTKC 4HLZH 4D9LL 5GGUB 4KKAD 3GM0A 4YHML 2P47B 5C0RH 3UJIL 1JPFB 3MXVH 1K4DA 4JY5H 4PJCE 3TFKD 1SM3H 1UWEL 3NN8B 5FGRA 2VYRE 5J1SC 4NUJB 3MX0A 3W82A 3ARSA 1RZ8B 1RFDL 2AXGA 2VJXA 3NAAL 2P24B 4YQXL 4OGAC 1GGTA 4YXKH 3TH2T 4YBQC 1D5XB 4YC2B 1I1AB 1NGXA 1ZGLA 1KGCD 5JZ7D 1GL4B 2NY5H 3E1F1 1ED3A 4MQSB 4OZGB 1JHLH 1O7SA 1MNUL 2C3VA 4QHNB 1U95A 5EBWB 5EO9B 1OM3H 1DQJB 2XIDA 3LPGA 5HD8C 4R4FL 1B6UA 4V1DE 2CRZA 3MLRH 1FGNH 1KXQE 5C0GA 4PJDE 1OAYL 4X6DA 3MLUH 1AXIB 1A6VH 1KJ3L 1VPOL 3SPVB 2Q76B 3QHFL 1F00I 4MXQD 5E6ZA 3S5LB 1NCNA 5GZOD 2J8UA 3BKJL 4FG6D 4ODSL 4ZAKA 5CJOL 3G6AA 4XCEA 1AR1D 1OTUC 2ADGB 5LGJB 4RGNE 4JPKL 4EN3D 1TTFA 1E4KA 4UDTA 5F7LB 1EGJL 3ESVF 4XB8A 3QFJB 4X98B 3HMWL 1F11A 3TZVD 1KJ2L 1JGLL 1ZVSB 1I9EA 2FX9L 5F9JB 3BAEH 4KZEH 1OB1A 3VXMD 3QUMB 1E4XH 2X5PA 2NY4D 2V5TA 5HYSB 3UPRA 1EAPB 5D93C 2J4WL 4MA7H 4LEOB 2GJ6E 4Y19E 1R3IH 4XTRD 2BZDA 4P4RB 2PTVA 4QHNA 3MRMB 5BW7C 3TM6A 5EBWA 5EO9A 1KACB 5DJAB 3MRBA 4RA3A 5E99L 4X6BA 4Y4HB 3V6ZA 2YRPA 4IRSC 4CKVX 3UDWA 1TPXB 3EYSL 3V6FA 4NQED 1YQ2A 4NHUB 3H7BA 1NGZA 2WWMD 3SPVA 2AEPL 3VXMB 2LAAA 1C5BH 2RJMA 4JFFB 4NZUL 1CL7H 5D2LF 4JO2H 4UAOC 4NBXB 3E6HB 4Y2DD 5I8CB 2ADGA 3BUYA 1HSBB 4JREB 3TCLA 1FO0B 3DYMA 4ZTOL 3QUXD 3VW3L 1U92B 1MWAL 2QQLL 4JM4H 4J12A 1NEUA 3NTCL 4LLUB 3IFNL 3ILPB 4RGMC 2HMID 4W4NA 1A6WL 3QUMA 1DVFD 1P4LB 3EYQD 1P69B 4DGYL 3KPOB 2XQYK 4ODWB 5HYSA 1EAPA 5FGSA 4CU8A 3QG7H 1MQ8A 3ZT5A 3P11L 4P4RA 1JGUL 4KJYB 4S1DC 1HQ4A 3MRMA 3PL6C 4PJGE 4Y2DB 3T0AA 1NBZB 3LS4H 4BQ9A 3VI3E 1FN4B 4EN3A 1KSRA 4NKQB 4XI5C 3TV3L 5JUEH 1P1ZB 3TN0D 3MGTB 4XPFL 2G60L 2RHEA 3ULVE 3HPJA 3VXMA 4R7DB 4HF5L 4HS3B 4FQ1H 4R0LC 4QTIL 3X13A 2VDRH 3ROLA 4CNIB 2FSEB 4J3VA 1DVFB 4HWEH 4YHYC 3E6HA 2H32H 2NY2D 4FXGA 1HSBA 2NXYC 1FO0A 3LKSA 1MQKH 3ARGC 4W4OA 1H15A 3S34H 4LAQH 3VXPB 2UV3A 5FF6B 5HI3C 1U92A 3OR7B 1NFDE 5DD0L 5B3JE 3TNMA 4UZGA 2XTJE 1QFPA 2OQJB 4OI8A 1HE7A 1J1OH 3BKML 3HZVA 5SX4H 1KTRL 5BQ7B 1P4LA 4X9IA 2P43B 4OFPA 4Z7OF 5A2LH 1FYHB 4I8DA 4ODWA 3EJZC 4M03A 4JVWA 4L3ED 3DURB 4Z7VB 3H6JA 3QQNA 3AUVA 1G6RL 3L5XH 4N0YL 5E4EB 2FHFA 4W6WB 3CLFH 3EYOB 4NKMB 4KJYA 5DMIL 3R0MA 3TBYB 1UACL 2R0WH 2PF6A 4KJPD 4Y2DA 4EBQH 1JFQH 5CEZD 1FN4A 5FO9B 3ZZ1A 1EV2E 2WUCH 3DV4B 3QUXA 3RUGA 4TUKH 4L4TD 1YMMB 3R1GL 3EYUH 3PGDB 4Y7MA 43C9B 2P5EB 4HJ0C 4R7DA 4XMKH 4CNIA 1DVFA 1E0OB 1CFSB 3F5WB 5B38B 1ZANL 4XAKD 4LCYB 1RMFH 4HV8A 4PJHB 4S1SL 3NIGE 5FF6A 1I3GL 1ZA6A 3MRRA 4N68A 1ZGLP 3OR7A 4GG8B 3O9WD 3U4BL 3V2AR 3D39B 1UB6B 4D3CL 1NSNH 2E9BA 1IGIL 4ISVB 5BQ7A 5D9SA 2YBRB 3DURA 4YZFF 3TN0A 4L4TB 4M6NL 4HK0A 2ZUQB 1JZ3A 4Y4FD 1T7VA 5SWZD 3EYOA 1WJ3A 5DI8A 3QISA 2CIKB 2MHAA 4ETQA 2YK1L 3K4ZA 4PJ5E 4OFYA 4UIKL 1GGYA 3DV4A 3T2PA 3ZDZE 2YD4A 1M1SA 2GW5A 3LMJH 3X14A 1A02N 4G9DB 3O9WB 4TSCL 1TDQA 1EZVY 1FE8L 5FUOL 3BN3B 1CFNA 5HHOE 4ZMAT 4KK8D 2H9GA 4L3EA 3F5WA 5B38A 1RUAH 5IFAL 5TQ2L 1EO8H 2JB5H 5HVHC 4J3TA 3SGJC 4A2LA 3TLRA 4PJFF 1LP9B 3IS0X 5C0CD 4GBXC 3O0RL 3MXWL 5SWZB 1P53A 4ALAH 3EDFA 5F6HJ 3K4DA 1I1FB 4GG8A 4HKBB 2ZPKH 4JFQA 3D39A 1UB6A 3HKFA 3KPPB 3DSFH 3KS0H 1F4AA 5IESH 1MCSA 2ARJB 3QA3A 2PKDA 2YBRA 1GZPB 5C9JB 3WFCH 4L4TA 2YN5A 4WFGE 4BSVB 1F4XL 3ECBB 4TULH 2AGJH 1NANI 4HX1A 1DBAL 4M62H 3C8DA 3QNXA 3T3PE 3PG2A 4WO4B 5DHYA 3QEGH 4I0PC 1E28B 2CIKA 5I18H 1DLFL 2FD6H 3VFOA 2AI0H 5D72H 5F70A 3K81A 4XCFL 4M6ML 4G9DA 3O9WA 4F7EA 3FQXB 1JL8A 2O5XH 1NCWL 2DLHA 5CMAB 5T3ZH 1CLCA 3B43A 4LCWB 5LAXB 3WDIA 3CIQA 4MA3B 4F33B 1LQSR 1Z3GL 1MLBA 1MCEA 4M1GL 3PV6B 2I07B 4Y4FA 5DT1L 1YEGH 2EYTB 1UCBH 4NZJA 2AV7B 1R3JA 5SWZA 1KB9J 2EDQA 4JQIL 3OL2A 1I1FA 5FB8B 5I1GH 4HKBA 3TBWA 3KLHC 4ZD3H 4JFEB 1KXTB 1CE1L 3KPPA 3C5ZC 1S5IH 4F8QA 2ED7A 4KV5F 3D0VB 3G6JB 4CMHC 1BVZA 4UBDD 2H1PH 1QLEL 3MLZH 5I76A 4MD0B 5IF0B 1KPVB 4MSWA 5IBLD 3IDXL 3ECBA 3ZLQC 3QI9C 3T65A 5ABDE 5KSAC 3DX8A 5ERWB 3RZCC 2X10A 4WO4A 1LEIB 1UGNA 1CU4L 2IC2A 3RX5A 2RCSL 4BFBD 1FFPB 1SJXA 4M4PA 3WYRA 4Z7WF 5L6YH 4ODXA 3FQUB 4XVSH 3FO0L 5C0CA 3NBNA 1G7HB 1JI2A 3DTXB 3GJFK 2JIXD 2JCCF 3M17B 4JPWH 1CZ8H 2ATKB 5ADOH 5IB3A 3O3AB 1J10A 4MA3A 5T5FH 3JWDL 4XH2B 3VGEA 3OKLB 4LCIH 3PV6A 2I07A 2FJFB 2F5BH 2EYSA 3EHBD 4MD5B 4OCXH 5T1KB 4J2XA 2AV7A 2GJZB 1DUYA 1T7WA 4YFLF 1EH9A 4WCYH 3INUH 4Y5XB 3FN0L 5KVGH 5IVXA 3OGCB 3OWEA 1G7LB 3C60B 3KJ4C 3P2TA 4DW2L 1RJYA 3D0VA 15C8L 4M61B 1JTPA 4ZDHA 3WE6B 3FCTB 1HZHH 3V79C 3FAWA 1JN6B 3VDBA 4RMTA 2BNQD 5LBSH 5CD5D 1YJDH 5ERWA 4K8RD 3BPOC 5FYJH 2XWJB 3NCBB 3QHZH 2DLFL 1MY7A 2UWEA 1FYTE 3KYNB 1IM3B 4KRNA 4K9EC 4OCWL 5HHPB 1MFCH 5F7KC 3ULSB 5J6GA 1G7HA 1HHGB 1TTGA 3FKUS 4FTVE 5IIEB 3NZ8B 3M17A 1RIHH 4NKDB 3EDJA 4XP1H 4ZO6A 4DOHB 2PTUA 2EDHA 4J4PD 4XCNA 5BJTB 3U2SB 1T0PB 3MYZA 1PW3A 3KYAA 1A1NB 4XH2A 2X4SB 4MD5A 4W68A 4LBEB 5EOCL 1YNKL 4GRWF 4H0IA 1FGVH 5BS0E 5TF1L 4Y5XA 5F88B 3VXSE 3GHEH 3OGCA 5D1QB 2YEZA 3QEQE 5HPMB 5TFSL 3DROB 1AHWA 1HKLH 2YKLL 4KFZC 3WE6A 3FCTA 5IGXH 4JY6B 1OTSC 2JIXA 4N8CL 1YYMH 3QXAA 1RAMA 3CVIH 4G9FB 5D70L 4ZOEA 3MBED 5F9WB 1YN6B 3C2SA 2XWJA 2R0KH 2GY5A 2OLDA 3QCVL 3L1OH 3KYNA 2FGZA 1NGYB 3JTTB 1NUNB 4LHUB 4Y1AD 5H2BA 1XF2A 1TZIB 2YPLB 1HHHB 3ULSA 4LSSH 4YHZH 4PTUA 3IGAA 5E2VL 1OGTB 1QBMH 2GTWB 3NZ8A 4LSDA 3LB6D 1QFUH 4JHWL 4F9LC 3EOTH 3ZTJG 1CXEA 2P48B 3X12A 1F2XK 3MNWB 4K3JL 2JF1A 5BJTA 1A1NA 1X9QA 1CFBA 2X2YA 4XNUH 2BNQA 3ZDXE 3HS0B 3VH8B 3EGSA 4BQBA 4U3XA 4MB3A 5C2BH 5F88A 5F8QC 2Z92A 4NQCD 2NZ9C 3TIEA 3FQTB 3WJJC 2WMPA 1MF2L 4OQTL 1LILA 4PJXE 4CW1A 3DECA 2FJGB 2WBJB 2EDBA 4HT1H 4LCCC 4PB0H 1ZAGA 1D5BA 3ELAT 4BA8A 2OJZH 3SKJH 3ARTA 4NPYB 4JY6A 1QHOA 5IB4A 2SEBB 1BZQK 4OF5A 4L4VD 2F54D 4ZOCA 2OK0L 4ODBD 5J6HB 1I8MA 1SBSL 1ZK9A 3FHQA 3SGDH 1ND0A 3IVKB 3AU1B 5DEZA 2D7TH 8FABB 3EYVA 1NGYA 1DBML 2NXZC 3NA9H 2YPLA 5TDOB 4JG1H 3WNLA 1FLRL 2BP3A 1HWGB 3I6LD 5D4QA 3WDJA 2XKNB 3U0PB 5GSVB 4NQCB 1KCRL 2AXFB 1JPGB 3DVFA 3C2AH 4M48L 4CU7A 5GGTL 5JIKA 5DUBB 3MNWA 2OR9L 5TE4L 3TVMD 2FLBT 4XB7A 3FN3A 2Q8AH 4U1HA 3VH8A 3MBEA 5T1DH 1PKQA 5HDBF 5I9QB 3MRLB 5I1KL 4G8GB 3RTQD 2DM7A 3V0WH 1EFQA 4DN3H 4X6CB 5F1KC 1W72B 2V5SA 5JW4Q 4JQVA 4Y1AA 2NY1C 1DJSA 2IAMB 2XKSA 1P7HL 5JHDE 3V52L 3F12B 2W9DL 4NPYA 4ZAKC 1WK0A 2SEBA 5DMJB 1ZLWK 4M3JA 2YXMA 2DJUA 1E4KC 5F7YC 3IVKA 3LH2H 4NQXA 5T3ZE 3AU1A 3QQ9C 5C0BB 3TVMB 2HFFB 1SY6L 3KPRD 3B8SA 1RZKC 1E4JA 1Z0MA 5ID0A 4DN4L 4G6FD 3QAZB 5TDOA 5IBTH 2XKNA 3RVUD 2FX8H 4NIKB 5IM7A 1Z6JT 2W0PA 4NQCA 4QKXB 3SDXB 2ZNXA 3PIQB 2AXFA 2HH0H 2XNAB 4HAFA 2ICCA 5FYLE 4XNYL 5IMKA 5E8DH 3OF6D 3IDJB 2X70A 1PZ5A 4L4VA 1EJOH 2B4CL 2F54A 3PP4L 4TVSa 1T80A 4HFUH 5DA4A 5FM5O 3K1KC 3B8YA 1JNJA 2GY7B 4Y4KD 2H8PB 5DK2B 4WUKH 3TFKC 2GQHA 4X6CA 4EI5D 3KPRB 4H0GA 1U3HD 4WW1B 5IEHA 1T5WB 4G43A 1DP0A 2AJZA 3F12A 1KB5B 3A0OA 4WRLA 3D69B 4YDKL 5HHXL 3EDEA 4PRIE 1YDPA 1WWWX 3FB6B 5JZ7C 3BOVA 5F72S 1A7OL 5E03A 4QRSB 3ZE0E 3MRPA 3TVMA 2HFFA 2C1OB 4U31A 5I0DA 4Z77A 4H26B 4LSQL 2HJLB 4JO3H 3DIFB 1JYWA 1JGEB 5HHMB 1JHKL 1Q72L 5JLZB 4Y4KB 3RTQA 2A6JB 3MC0A 5DJ8B 1HK6A 3OAZK 2XNAA 4WV1A 1MCLA 4P57B 5BXFB 1U8OA 4NCDA 1VA9A 2E8YA 1MFEL 2H2SD 5GZOC 4FG6C 2W38A 3IDJA 2E7HA 1AR1C 4OT1L 1QO3B 1QBBA 3C09B 1HHIA 1IC5L 1CI5A 1DQQB 5E6ID 4W6XB 1EA9C 3NABH 4PJAE 4P46D 4HXAL 4XP5L 5DK2A 1W8NA 4RMSA 2X4NB 3KPRA 2DQHH 4ZOAA 4O51B 1T5WA 3ZKSD 1VFBA 1I9RH 3LOWA 4P5TB 2CDFB 3VXRD 4P48A 4LMQE 2FGWH 1KB5A 2B8OT 4ZFGH 1I8IA 1C08A 2IFFL 4QXUH 4WI8A 3VFNB 5IKCB 2A77H 2G2RA 3QCUH 4JREC 1LP9E 4OUOA 2PCPB 4W4OC 2CR6A 5A16B 2J6EL 4QRSA 3OF6A 4QHUB 1S9XB 3UX9B 5EU5A 2C1OA 1J0YA 1JYVA 2HJLA 3IAPA 3DIFA 2ZOLB 2PW2A 3PQYD 1Q0XH 4XC1L 5F3BA 1REIA 5E6IB 3STLA 2QQKH 5DXWA 4FA8A 1U3JA 4FFZL 2IBBA 4Y4KA 3X17A 3MLWL 4NN7C 2A6JA 5DJ8A 4CVXB 2F19L 5I19L 4U6YB 4P57A 1BD2B 1OGAE 5BXFA 1BMGA 2WWMC 4R90L 5D5ME 3VXRB 1NJ9A 3MJGX 1MFNA 1W72H 2WWKT 3FT2B 1QO3A 4C56D 5JOFB 4KDTA 4RQQB 2GIYA 4EDWL 4Y2DC 4HUXB 4M1DL 2J5LC 5KS9B 5GGQL 3FHAA 3VGHA 4HBCL 4WTZA 1H3GA 4LRNH 2VLRD 2YSSB 3QUXC 2B39A 4Z7UF 3WXVH 4PG9A 4ZS6D 5FO8B 3N1MC 4BZ2H 4GW1B 5I1AA 5F1SA 1DVFC 2IQAB 2QQNH 3EYQC 4EKXA 4K2UL 3GDBA 1K8IB 3VFNA 2PCPA 2C9AA 1BQLL 5AYUL 5A16A 5ISZE 2QSVA 1UYWH 2ZG1A 3OKOB 4JFEE 5A40E 4LQFH 2BNRB 2VQUA 3R8BB 4AH2B 4RNRB 1OHQA 5E6IA 1ZS8A 5KG9A 4F9PA 2BC4B 1GAFH 4P46A 4XXCA 1KOAA 1OCWH 1S3KL 3NACL 1HNFA 5KJRH 3QXVA 1FZJA 3I02B 2VLRB 4YH6A 5JW5B 1MH5B 3TN0C 1A7QL 4UIMA 5FCUH 1F13A 4U6YA 1PY9A 5E4EC 5T5NG 4XPBL 1LE5B 4XHQA 2AW2A 2NNAB 3VXRA 4NO0B 4X5WB 5FGBA 3CVHA 1MCJA 1S7RA 4ONHA 4MHHG 4XMPL 4QOKB 5CCKH 4HC1A 2CRIA 1FNEA 1NLBH 2XWTB 2YSSA 3WEXA 5JR1H 3BIBX 4V2BA 5FO8A 3MLSH 1V3MA 3MO1B 4GW1A 5TE7L 1XGRB 3PQYA 1JPTH 1X5XA 3OPZH 4YO0B 1U58B 2B5IB 3MUY1 2OTPA 3UP1A 2ORBL 2VZTA 1D5IL 1K8IA 2VLJE 3L3IA 2I5YL 4FQXD 5EUOB 1VFAB 5K9JH 3RNKA 2M1KA 5EULV 1ZVHA 4P3WA 5C0AD 3DXAE 2MKWA 4M7KH 4RWHA 3OKOA 2NTFB 3SJVD 2BHUA 4KJPC 4AH2A 2FECI 2VXTL 4QXWA 3VMOA 1XAUA 2ZUYA 3KHQA 4YEEA 3HFML 1NGQL 5I74B 3N1PC 3MA7B 2VLRA 3F7YB 5JW5A 3MOQA 2ZUQC 3HNVL 1VFOA 5JOEA 1E4XI 1LE5A 2OBGA 4N8VB 4AEIH 1AO7E 1IE5A 3TT3L 3LVEA 2HLAA 4WEMB 4OD3H 2DLGA 5LKNA 1A3QA 3IFLL 5DD3L 3KDMB 3UTZA 2V5MA 3A6CH 4RFOH 3C6LB 4E42B 3G08B 3VFMA 2HVJB 5C0AB 4NZTH 5E5MA 3VFRB 3HI6H 4KVNL 1HHKA 3O9WC 1G9EA 3BYTA 4K7PL 4OZ4B 4JO4H 4L8CA 4J7RA 1HOCA 4RISL 4YO0A 5DJ2B 4Y5VB 4ZQKB 5I8EA 4HLJA 5A1AA 5EG6C 1ORQA 1FIGH 4KKCD 4XP4H 1TJIH 1BJ1H 5EUOA 1VFAA 3UJJL 1FVCB 5C0RL 1CL7I 4GXUN 3MXVL 4JY5L 4BQ8A 1SM3L 5K9OA 3F7QA 2VQ1A 5C6WH 3QDGD 2CQVA 2NTFA 5C71A 1OSZB 4OLXH 2P8LA 3RFZC 4CVZB 1F97A 4QRRD 3V4VH 2C4FT 4HKJB 5I17B 1BF2A 4YXKL 5DWUH 3VFPA 3MA7A 3HLAB 1Q94B 4G9FE 4OGXL 4PG2A 4OFKA 4MJID 1JHLL 4N8VA 4NZDA 1VFMA 1OM3L 3S3JA 4WO4C 2L7JA 3QUZD 2Y4SA 4KK8C 2VITA 2ADIB 3KDMA 3MLRL 4FQXA 1FGNL 2XG4A 2CIIB 1DQMH 3C6LA 5SWSB 2QBWA 5KAQG 4MQTB 3G08A 2HVJA 5C0AA 1A6VL 3QDGB 3AMKA 3NVQA 3JTSA 1XIWB 3SJVA 4OZ4A 1A7RH 4QRRB 1OL0A 4ZQKA 3CSYB 1ZT1A 2JKXA 3QIBB 4WY7H 4NKOA 3ESUF 2QQQA 4G6MH 1MSPA 3QJFB 1UKQA 4WTZG 3V5KB 1RZFH 2FECL 2GUOB 5ITFB 4ZPVB 5INDB 1CDJA 3FONB 1S78D 5E2TH 5HYQA 3BAEL 5IQ9B 4U1LB 4KZEL 1QVOB 2EDLA 1OSZA 3QUZB 3RWIB 2FEEI 1E4XL 1R3HA 3PGFH 4HKJA 5I17A 1I4FB 4HUKB 5HGDA 1SYSB 4EUPA 4MA7L 4UINH 1Q94A 4WWKD 4L8SA 1R3IL 4RZCB 2CDGA 5SX4I 5GISH 2LVCA 3CSBA 3EDDA 3O4OB 4WEBH 1X5HA 3MV7D 3ZE2E 5C0EB 2ADIA 3BO8B 1RUMH 3QDGA 1FZOA 2CJUH 4NBZB 1C5BL 4MNGB 3S37X 4QRRA 1CL7L 4JO2L 3CSYA 1CGWA 4G8FB 5CKAA 4NJAH 4UI2A 1FJ1B 5ESAB 3BDBA 3V5KA 5IBLC 3CJJA 4MJIA 3G9VA 1A7PH 1KIRB 3KPLB 5FECB 4L29B 5IQ9A 3OQ3B 4JM4L 4U1LA 5KBNC 2G5BB 1OF2B 4Y5XC 3QUZA 1U3ZA 5GS1B 1T1ZB 5D2LB 1NMAH 1UQSB 1YNTB 1BIIB 2W0KA 3C60C 5HYJE 4NRXA 3HUJE 3RNQA 1QSZA 1SYSA 5EPMB 4MB4A 1GH7A 2DAVA 4W70A 3CFJB 3QG7L 2NQCA 2OZ4H 4RZCA 2R23B 5L8KB 3GMNA 1JV5B 2AK4D 3I84A 4GQ9H 4HBQA 3VCLB 1JF1B 1KIQB 1JJUA 5DVLA 4ZTPH 4KK9C 4YBLB 3LS4L 5C0EA 4I18B 2DI9A 1WZKA 3W9DB 5JUEL 4PLNC 3EHBC 3P77B 4DK6A 2NR6D 4JLRB 4GRMB 3TIDB 4P4KB 1KEGH 4FQ1L 5I1IL 2RQ8A 4MNGA 2VDRL 5ANMA 1YEFH 3BSZH 2YUWA 4HWEL 1I7UA 3LEXB 3BIKB 3DBXA 4Z8FH 1M6OB 3SOBH 1CIDA 2YD6A 1MQKL 1A2YB 2FEEL 1GC1C 3S34L 2BJMH 4LAQL 4Y16B 5GSRB 3CMOH 3REVB 1KIRA 3BP4B 3QDHA 2EIDA 4K8RC 4KKNA 1OF2A 3BEVB 4QGYA 3MV7A 5GS1A 1XGTB 1J1OL 1DEEA 4N0CC 1BIIA 4RMQA 1QSEB 1MVFA 4LLVA 3PXHA 5EPMA 4HUWB 4PBWD 5CZKA 3L5XL 3CFJA 3MNVB 2R23A 4KPHL 4JB9H 1I1CA 3CLFL 1T3FB 3U4EA 1JV5A 5FHAH 2R0WL 4NFCA 4S10A 4KKLC 3VCLA 1JF1A 3H9SD 1KIQA 5F9WC 4NUGH 3TWCH 4EBQL 1DCLA 4E0RA 2IANE 1BOYA 2R1YB 2PTTB 5CJXC 4I18A 3WDHA 5F7EH 2WUCL 3ARBD 3W9DA 2VWEE 4KY1H 3P77A 4TUKL 2X41A 3CK0H 4G7VH 4KI1A 3W39B 4OFVA 4K7FB 4R2GD 5KTEH 3EYUL 3PWLA 3TBTB 1S7WB 4N0FB 2V17H 5BV7B 3IDGA 2Y6SD 4A6YH 4XMKL 4YDVB 5IROA 2AAVA 3JV4A 5DO2D 2NY7H 4HIIB 5DVKA 2PO6B 1SQ2N 3BIKA 2YS4A 1AQDA 4KI5F 4J3UA 4OIAA 4HMCA 2JB6B 1RMFL 2JJVA 3S97C 5CLTA 1A2YA 1A1OA 1B0RA 4MAUL 2E7MA 3U9UB 3FJTA 3REVA 2AK4A 3THMH 3BP4A 3BZEA 1IILE 3KWWB 3MBEC 1NSNL 2VZSA 3DHJA 3RWFA 1LDSA 4NQVA 4CMMB 2ITDB 5CD3B 3QH3B 4JQVC 2WBJC 4HUWA 3V8CA 1FL6A 5IOPB 2ED9A 4U1IB 3RZWA 1NKRA 2W65B 5KANI 3HPLA 3PDOA 1AC6A 4I0CC 2O61B 2DLIA 4L3CA 1UM5L 2O5YH 1BWMA 2CO6B 2R1YA 1F3JB 2PTTA 1CQYA 1GZQB 4H20H 2KZWA 4WTWA 4EUPG 4NQSA 1BVLB 1HXYA 3C08H 4K7FA 1I9IH 3C6SA 5EO0B 4ZNEE 3TBTA 2XI9A 3VXOB 1S7WA 3F7VB 2P4AB 3O3BB 4D8PB 4YDVA 1BD2E 1P7QD 4PJCF 5LGHH 4X0KA 1FLTX 3HZYB 3VFTB 3MGOB 1IVLA 1RUAL 2JB6A 1EO8L 5HHVL 5F7NC 4BSWB 2JJTA 4HMDA 4ALAL 4HQQH 5FOJA 2ZPKL 3H9SA 2VDNH 3DSFL 4R3SB 5IESL 4P5MA 4DGVH 1KIPB 4CMMA 4O4YH 3ARBA 3TH3T 1FVDB 3WFCL 4AL8H 4LPWA 5CBEA 3GMQB 5IOPA 4PJFB 4AQOA 4TULL 3MV8D 4HWBA 2AGJL 3RI5K 2PW1B 4PJDF 4M62L 4M5YH 4G7YH 5D6DC 4YPJA 2VXSH 3G04A 3QEGL 2O61A 1EHXA 1WFTA 4ERSH 4PIRF 1KLGA 1NMBH 5I18L 2FD6L 2Q87A 1H3PH 2AI0L 3MV9E 5D72L 3TVMC 1GZQA 2OMBA 1UXSB 2AJXH 2EDFA 1BVLA 2I26N 4BUHA 2XY1A 3HC0B 3IXTA 3WLWC 4WTXA