3NIFF

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nifF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nifF01
4AH2A 3MACL 5J56B 2ARJA 3DJ9A 5HGHB 3HUJB 2R4SL 2QQLL 1KELL 3MLZL 4F57H 5C0GB 2X4SB 1EFXD 5T3ZH 4L29B 1QQDA 3CMOL 5EH1A 4Q97A 1A14H 2J7LA 3L3IB 4WTXA 4XPHH 1CL7I 3HNSL 1OM3L 1TLKA 1LO3H 4P2CG 4XI5C 2H8PB 4M62L 2VN4A 1LO0H 1Y6KR 1OAQL 5EZIH 3RIFK 2LABA 3F7YA 1YEKL 5CSGA 3C09B 2D0GA 3RWCB 1V5JA 5J9PA 5SX4H 4TTGA 2F58L 5FKAA 2ORBL 5E1AB 3HI1A 4HH9B 1GGUA 3PHQA 4OZFG 5KAQG 4DWHA 1FFQA 1CE1H 2X1OA 1WBZA 1FYTA 1P7QA 4PJIF 4P3CH 2CDGB 2XFXA 3QUZA 4HBQA 5LQBL 3BUYA 2GTWB 4RAVA 3VWKA 4IOIA 3U9PL 1JTPA 5I8OH 2VOTA 5I74C 3QXAA 3BVNA 2A9MH 5FYKD 1DZBA 4KHXL 1GYAA 3GMQA 5F89B 1RUQH 3Q5YA 3TFKD 3PIQB 1YY8B 3DXAE 4X4ZA 4DW2H 1QLRB 3HS0A 4UV4H 1CICC 3HE6B 1ZSDB 4Z7WF 1YC8A 2YBRA 4NQSB 1SMAA 1WIPA 5I1AB 2NY7H 4U6YB 4QRPA 4XNMB 2F53B 1TPXC 5EA0L 4D0CB 5C92A 4MDJA 3AS0A 1MHPL 4ZYKA 3ARFC 5EZLA 5KZCB 4R4ND 2AAVA 2D7OA 2VDNL 2WSKA 5I16B 1DQML 5JPNA 5MENB 2FIRT 2HRPL 1NEZA 1JE6A 2N7BA 3ARFA 3CGTA 3NCYS 1NANH 3VXPB 4FQLL 3ZO0A 2BNUA 1YUHA 3OXRB 4U7MA 4ETYA 15C8L 1MFBL 4PJFF 4PJIA 1DE4B 3ARZA 1S9XA 1X5XA 4YIQB 3EFFA 4PTTB 5EG6C 4ONFL 5F7EH 5AYUH 4HC1A 4ODUA 5FV2A 1FL3A 2IPKB 5INDA 4X9IA 4M00A 2WBJB 2UVFA 2XQYG 5TF0A 3BDXA 1P1ZB 3ZYOA 3GBNL 4UILL 1JRHL 1M05A 3DV4B 3M07A 1JGVL 5JIKA 3NFPB 5JW3H 3CFEA 3QCUL 3BWAA 4HDIB 3QUXD 2AJ3B 3DRTA 3D0LB 4Z7WA 1AO7A 1JL8A 1BM3L 2YPLD 1XCQA 3OGOE 4IRZL 3MLYL 5FYJH 1ZHKB 3CXHJ 1NCWL 2QHLA 5DMIL 4TUJA 1OSPL 5I8KL 4Y16B 4RGNE 1ERNA 2YD6A 4BH7A 3SGEH 4GH7B 4NC2B 1U3ZA 5DHVB 5L2JB 1HIML 2VLJA 1Z9LA 3VXRE 2WM0A 3LEVL 1FRGH 5ID0A 2R0KH 2CH8A 3BKYH 3MJ6A 2A83B 4LL9A 1S7QA 2VLKD 3ARTA 4EI6A 3MV7B 3U30B 4ETQB 3OL2A 4PJFA 3VA2C 4RDQG 1PKQA 1N8ZA 5CJQL 5E2TL 3S96A 1U6AL 4FTVD 4PLJD 3ZSSA 1NMCB 1UG9A 5EU4A 1AI1H 1VEOA 4GLRI 2CLRB 4ONGL 4RDQF 2FJFA 4JFEE 3FONB 1HQRA 4FFVD 5HHQB 2HKHL 3MYZA 5AUMB 3Q1SL 2FO1A 2GY7B 3LKQB 3S9DB 1O7SA 4LCIL 3T8XA 4WJ5A 1UWGL 3HZKB 5FUOL 3EUUA 5FM8A 4PG9A 5F7DA 3BO8A 4NSKB 3MO1B 5IMKA 3HFML 3EOYG 3W11C 1BZ7B 1F58H 3IFPA 4O2EB 5I1EH 1VFBB 1RD6A 3KYNA 5F1IB 3V6ZA 3QA3B 4KUZH 3X3GH 4OCWL 3BKCH 3ROOB 2YD1A 4PJDF 3LQZA 4LU5H 4JVPA 3SOBL 2B20A 4HV8B 3MJ7B 3SHSA 3N1GC 3BI9X 3V5KA 4H1LG 1AGEB 4I5BB 1NC4B 5T1LA 4JHWL 2DJUA 1G9EA 1HSBA 1EEUA 2NXZD 4RQQB 5ID1A 4G8GD 5JMRA 2OJZL 4WEBH 1F90L 4L4TD 5EC2B 4FQCH 2GITB 2PETA 1TJIH 4KTEH 3N1QC 3IDNA 1QBMH 4N0UE 3U1SH 1KG0B 1W0YT 4ELME 1T89A 2OP4L 3OWEA 4H20L 1DANT 3QO1A 5I30H 3K7UA 5I9QC 1AGBB 1MRFH 3U0PA 2W0KA 2BZDA 4Y5VA 2PTUA 1HN1A 1C12A 3K3QA 3KYMB 3QXVA 4JJ5A 4YGVA 2ADIB 4MHHG 2R0ZL 1FN4A 2NTSP 1U3HB 1XH3B 5JHDA 3SE3A 4NP4L 2YD9A 4F58L 5D1ZD 4JFYA 5F9DC 5FYJD 3BEWA 1J1OL 4N1CA 1A6UH 4DN4H 2O26U 1OAZH 3QUYB 4XGZB 4MNQD 4TSAL 5SWZD 1S3KL 3EO1A 4JQVA 4KJYB 2VUOA 3WUWG 5F7MC 4LSQH 1HNGA 1HH6A 4F7CA 5IBLC 1QO3A 1NMBL 5FHAL 4PJDA 4LKXA 3VRLE 4MQXD 3G6AA 3SJVE 2DI9A 5K9OB 5C6TL 3TYFB 1WITA 2MMXA 3V5DB 1I7UB 3IAQA 1RUKL 2CRIA 3P4OB 1RPQA 3TJHC 4ZFGL 5D7JD 1YEGL 4G9FD 4LPWA 3L3JA 1LK3L 4L8DA 5TE6H 4P2RA 2AXGA 1YYML 1RSFA 4CVZA 1FGNL 4ONHA 4WHTA 4WFHE 3MLRL 2O5XL 3ILQD 3V0VA 5C0EA 4Z7NE 3MNWA 3MBXH 4EDWL 1EX0A 3F65A 1NAML 3LB6D 5HHOE 4GAYB 2EE3A 4NHUA 1J10A 5DJ2A 1CFTA 3K8KA 4YAQA 2DQFA 1XEDA 2A6IA 4G3YL 3EFDL 4OLVL 3TN0B 1VKXA 3BP4A 4YXHH 1I1YB 5F97E 2P5ED 3X3FL 4TUKH 5ESAA 4UAOC 1NJ9A 4NN7C 1L0YA 3W82A 4FQJH 1BAFH 4QGTA 1J0ZA 1YQ2A 2ESVB 4Z5RA 3BISA 2Z92B 3MBEB 1BGXL 1ZT4A 4H26A 3HN3A 4X98A 5INCB 3REWB 1FGVL 4OLZL 1J0YA 3LKNA 4JFFA 1YEFH 5IQ7H 3CPLB 3MUGA 2P24A 5C0BA 4M9OA 1QOKA 1D5IH 4NZUH 1YMME 4P5KA 2HJKB 2EH8L 2VISB 3GK8L 1HDMB 5GHWL 3NA4A 1R3LA 4QRRA 5KSAC 1YN7A 1CLCA 1D3CA 4HKJB 5IVOA 3BJLA 4NPYA 5DJ6B 1NUNB 3CIQA 4OT1H 1Z5LA 7FABL 5E2UH 4OZFH 3EYQD 4QF1B 5DUPL 4N5UA 1A1OB 6FABL 3MFFA 4HXBH 1BVKB 3NCMA 2O5YH 3GBML 4KMTL 5E08H 2WQRA 4HS8L 1NBZB 3P3YA 4X7CC 5KW9H 3C8KA 5A40E 4DQOL 2AEQH 1ZMYA 4XX1E 4XP1L 3B9KB 3ARSA 2R2CA 4OF0A 2DQHH 4BZ2L 4HUKB 2V9TA 3LDBB 4BZ1H 5BV7B 5I17B 1N5YL 3ZYIA 5TQ0L 3BKJL 1HKLH 1KEGH 4NQCA 5GS0D 1JZ3A 1J8HA 1WEJH 4U0QB 3VFSA 2WWMC 3IAGC 2IF7A 1T7VA 1A9BB 4X0KB 2IBBA 3NACL 5DI8A 3BZEA 1AQKL 3B9AA 5DQJB 4LSUH 2CK0L 5DD6B 3QIUA 3UZVB 4NT6A 4KVCH 2HLFD 4LLUB 3BD4A 5C0DA 1JK8B 4XP9H 3U2SA 4PJ7B 2O93L 3MRMA 4PY8I 5E2WL 1FYTD 1P7QD 1J5OH 1I7ZA 1JCKA 2ZSVA 3QUZD 4G6FB 3FB5B 4XNUH 5IF0A 3VWKD 1CWVA 4MVBC 3QPXH 4K7FA 3L7EB 5GJSH 4QXWA 4K8RH 5IT2L 4B7IA 2CK2A 2A73A 2ZNWA 2OJEB 3I02B 1NDMA 4WVRA 2OX5A 5EFIA 1CD1A 1NQBA 2FJGA 3DNKA 1N2RA 1X5YA 4XRCB 1G1YA 2NY0D 5HDQH 3LV3B 1T5XB 3S36H 4YHIB 5F9JA 2R29H 1ZT7A 5DEFB 4YBQC 5EOTB 1IAOB 4QOKE 2FZ3B 1WFOA 2EDHA 3VG9C 1R3HB 1OP5H 2FH6A 4JFQA 2D03L 3S88L 2Y06L 5IHZA 1F02I 1JGDB 2XN9A 5BZDB 4WV1A 5MEQA 5FGCB 4UTAH 5F88B 4YR6B 3SQOL 4LCWA 4CDHA 2O5ZL 3VXSA 3D25A 3S35X 4YXKL 3D69B 3ARFD 3Q6FA 1HHJA 4U1KB 2QQNL 5A16A 2APTA 2HT4D 4ODVH 4YFDB 1RFDH 1R5VB 3VWJB 5T1MA 2DMKA 1NFKA 2D31A 5DC9B 1IZJA 1NMAH 3HTLX 4X8JB 2EDRA 4RGOH 4ZTOH 1U9KA 3E8UL 3WEXB 4PP1D 3AFLA 1KTDB 1DFBH 5L2KA 4HG4J 3ES6B 3UYRL 3AMLA 5DK0A 3TPUA 4KI1A 4JFDB 4L9DA 3X14B 1ZXQA 3LRGA 3QJFA 4GAGL 3HB3D 5DVKA 4YHPB 1T04B 3ARGC 4LASH 5D1QA 5DR5H 3TYGL 4YHML 1KB5B 5ITBH 1AO7D 5MP6H 4LHUG 3PP3K 4APQA 4PJ5A 3TVMB 1D9KC 1IILE 4RMWA 4D8PB 5C8JA 5CKGA 5GGVH 1GIGL 1L6ZA 5GRUH 4CVXA 1G7PB 1LEIB 2VLJD 1XF2B 5HDOA 1U41A 3BP5B 5T3XH 3SBWA 4GKZB 4MLIA 5B39B 3HR6A 1G7HA 3DUSB 4LAQL 3R8BB 5FHBL 2RBLA 1PEZA 1DBML 5EIQA 5CLTA 4ISVA 3OXSB 4XCEA 4P4KC 5CJ5A 1T1ZB 1B6UA 2PYEB 4NJAH 4H1LH 1CLOL 4FQ1L 4MB5A 4K8RD 5KVFH 4H0HB 4HGWB 3W9DA 4JO1H 4LIQL 3VXTA 1FZJA 2R1WA 5DJZA 1KEML 5HD8C 2VIRA 1M7IA 4Y4FC 3TCLB 1FSKC 1YJDC 4WO4C 1UC6A 5EOCL 2X05A 5GGTH 1BFSA 3NPZB 4Y4FA 3P4MB 2C1OB 1A6AA 2CSPA 5JOPE 1N0XL 2AGJL 1Z2KA 5IESL 2L7UA 1UJ3C 1LP9B 3I85A 5TPWL 1G7QA 1Z6JT 3MLVL 3CVHB 4X6BA 3IDGA 4M6OL 2QQKL 3MCLL 3VXNB 5LBSH 4LIQE 1HXYB 5IHUL 3TC9A 4P2QB 3VDCA 2FR4B 1GOFA 3FFCE 2H1PH 3FQRA 4KPHL 1CFQB 5AG9A 1MCWM 1NLDH 3W11D 2AJZB 4HZLA 5I1CL 1ZA6A 1FPTH 4S1SH 3SCMB 2G9HB 3WE6A 1MWAB 3MRGA 4O2CA 5T1LD 5IFHL 3G6JE 4HJJH 5FDWB 3IS0X 3RP1A 1MFNA 1QTYT 4MXWH 4R0LB 3ALWA 2A9NH 4YUEL 1ZTXL 3MRFA 1ROWA 1LEGA 1GGCH 2APXA 3OMZA 1Q72L 2E8ZA 4U1SB 1P4BL 4MNGE 3AUVA 3U4BL 4M7LL 3VG0L 3L3GA 4NO0B 1NUDA 1IBGL 5JHDD 3OZ9H 1IC7H 3PDDA 3AM8C 5I1JH 5JOFA 1XZ0B 4I4WA 4R4BA 4PGZA 1P4LB 5E6IB 1MCEA 4OI8A 1AHWB 5GGQL 2QSCH 1NGYB 3NFNA 1YJDL 3DVNA 3V5HB 1IEHA 3BIKB 3L5IA 2RIKA 5EIIB 5GRVK 4I77H 2Z35A 3CLFH 3AM8A 4KDVA 4YHYC 2PO6A 2BSTB 1RIHL 2V5SA 5CIPA 3D39B 4RMUA 4YHOH 5JDSA 3IXAA 3ZE1E 5T3XD 5I1KH 5JZ7D 4ZXBC 3GM0A 4PRBA 5CP7A 1XCTA 1F8TL 1N64H 1T7XA 1IGML 3TBVB 1OGAE 3MV9A 2VLMD 4NQDA 5ERWB 4RGMC 1ACYH 3LS4H 5CJXC 5L0QB 1JNHA 3FRPG 4MAYC 4ZXBA 4M6NL 1CGTA 4ZS7H 2R56H 1O7VA 3F12A 3MPCA 3BN9C 4P2RD 1KF9B 4NN5C 4NRZB 4V2BA 4PJHE 4YDKL 4E5XA 2LFGA 2V7HB 4HS3A 3WHE0 1U8IB 1OLLA 1CT8A 5DRNA 5CCKL 1PQZB 3KPOB 2DQGH 2GSGA 1L9NA 4F15C 1ZLWH 5D96B 4FP8L 4EQ3A 1EZVY 4HHAA 4OCLC 1N5AA 1MPAH 4P59L 4CMMA 3QEQA 5B3JE 3OB0H 5EO9B 3O8XC 4BKLB 1UM5H 5LJYH 3RWIB 1QSEB 4JFXA 1CFVH 2Z93B 4J23A 3D48R 1S7TA 2WUBH 1CDYA 1MNUL 3KPRB 1NGXA 2XY1A 1TQCC 5C0RH 2V2XA 1MFCL 2AKRA 1SY6A 3G5VB 2V9QA 4NNYB 4KAQH 2J6EL 4PJXE 4Y8DC 1MVUA 4JFFD 4XHJD 1FHGA 1T0NA 2Y07H 5C0BD 2DM2A 1Q9OB 4OM0L 4Y1AA 2EDKA 4HX1B 2PN5A 4XPGL 4GRLC 4NFCA 3VMOA 4F7EA 4OZIB 1GOHA 12E8L 1OQXA 1T7ZA 3WXWH 5DRWA 4NZDA 5DWUL 1OPGL 4KJPD 1A3QA 3M8OL 3LN4B 4QRRD 1INDH 4GRLA 4M03A 1RZJC 2DQTL 1YZZA 3QHZL 1KPRB 1MH5A 2FEDC 3H3KA 3BP7A 4PJCF 4UT7H 2EYTB 4HIIB 5F7WC 4U7KA 1DCLA 5I75B 2Y5TB 3VD4A 4L5FL 1MCCA 3HPJA 1ZVYA 5LXGL 3PQYB 1MQKH 1WAAE 4OD1H 3RGVB 5JIIA 3LEYH 1KCRH 1XFPA 1X9QA 2DKUA 4YDVA 4V2CB 2Q8BH 3WSQH 4WWID 5ALCL 2B4CC 1W0VB 5FO9A 1I3RA 3KLHC 4JY6B 1CR9L 1OARH 4CADA 5IWLC 2NX5E 4EI5B 5HDLA 2BHYA 3MYJB 3RY5A 3U7AA 4ZNEA 5E5RB 1CLYH 2NYYC 3QQ9D 5A43C 4O4YL 4NQCD 1J8HD 4JRYE 4YWGL 2LU4A 5I73C 3STZA 5I19L 4YHLL 3ARDB 1HWGB 3GB7B 3TO2B 4JFPB 3ZDXF 1F13A 1ZHNA 3VFPB 4ORGA 5K9JL 1L6XA 4IDJH 1FNEB 1K3ZA 3UBXG 5D93B 4DGVL 4JG1H 3QIUD 2R2HB 2BK8A 4GJTB 1YEEH 4XCNA 5IB1A 5TH2A 1U91A 2LU3A 3NZHH 3BQUB 3E3QC 4WFGD 4PJCA 4YBHA 3K80A 5BS0A 2DLGA 5KS9B 5DEZA 1WC7B 5DA4A 3BAEL 1XF3A 1QRNB 1DQLL 4YQXH 2FO4B 2PTTA 3SGJC 3C6LB 3WN5B 1MOEA 4IRJC 4OF6A 3T0EC 1T2XA 4NKIL 1J0HA 1S7RB 4FQXA 3PL6B 1DQDL 3OB8A 5K93A 1RZJL 4HPYH 5L8JB 3N06B 1SYSB 2VQUA 2BJMH 3GKWH 3QZWB 5C3TA 5CZXC 3SGJA 2XWTA 2I60L 4PP2B 3JWOC 5FXCH 3RGHA 2JJTA 2QHRL 5GS1A 2XOTA 2H9GB 1YEIH 5BXFB 3OX8B 5ACZA 5LWYL 3HRZA 1DL7H 2EC9U 3MGOB 5FA3B 3VFUB 3LRHA 4B7LA 1A7NH 4WGVB 2Z31A 1WVZA 2MCPL 1QVOA 4NQXA 1S7UB 3AB0B 2B4CL 5C2BL 3H42L 3OKOB 4WEUD 4HWBL 5I18H 2V2WB 2XN9D 2HMIC 3LEXB 1NCDH 3MRBB 4UDUA 3SKNB 3STBA 1B4RA 4LCWD 1OAKL 4JO2L 1IAII 1QFUL 4WWKC 3VXSD 2DAVA 5CKAA 3HZVA 5T33H 5HVWA 1EGJL 1V7NL 3W2DH 5JPMA 4TQEH 3FAWA 5ICYA 1F11B 3QH3A 5F9OL 5MERB 1F4YL 4LEXH 2OL3A 4WWKA 4RFNC 2X44D 5C0CA 1IVLA 4RFEA 4PJ9C 3DARA 4FHBD 4OF3A 4OLYH 2KPNA 1EAJA 5J6HA 3AREC 5L2KD 5JNYA 2KQNA 4KKNA 2WINA 4EOWH 5C09A 3OGCB 3HE7C 1OW0C 5B38G 4XNYH 4ZFOA 3NTCH 5C70A 5H2BA 4WNQA 5BW7A 1S7VA 4JY5L 4OQTL 4EDXB 5DC0A 5D1QD 1FG2B 4M1CD 5JLZB 2NY5H 4NDMA 4Y5XA 2OI9B 5FM5O 1V7MH 5I15L 1NCAL 4APQD 4PJ5D 1EBPA 4OD2A 2QKIA 3PGDA 1AE6L 3JWOL 1C5BL 1NFIB 2NR6D 5J1AA 4ZOEA 4IHOB 4CN4A 4R97C 4TSCL 1H8OA 1EH9A 5CIPH 2VWEC 3O6FB 2VABB 2E27H 5IJVB 3L5XL 2FJHA 1WZ1L 2XQBH 5MI0C 2EO1A 5GJTH 5M7QA 3T0EE 4HUXB 3GJFB 4FQQB 4I3GA 5DEGA 3ZL4H 5I8EB 2R4RH 4FA8A 2QADB 1NH6A 2AEIT 5DSCB 1EO5A 3W39A 3HR5A 4BFEA 4EUPB 4N9OB 1ZHLB 4X99B 1FC2D 3N9GH 2EDWA 5ILTH 2IALA 5F6IC 1IGJA 2VYRE 2YOCA 3RVWC 1EFXB 1L7TH 4Y5YB 5CUSH 1KLUB 4PR5B 2AJVL 2XKSA 2GUOA 2FHBA 3OF6A 1JWSA 2ZPKH 4Y4FD 3U0WH 5HPMB 3T0BA 3MR9B 3FQNB 3QDME 5EBMB 2ICEB 5KOVC 1MHCB 4ZDHB 4WEMB 4WW2C 3RUGF 1KLGA 4OGZA 4OCYH 3LVEA 4B5EA 5DD0L 4DCQA 4Z95H 1S5IH 3L9RB 4Q9RL 4EN3A 4MJ2A 3RHWK 2MOVA 3NAAH 1KJVB 1SY6H 1IQDB 3RAJH 1ORQB 5KBNC 3GHEH 3C2SA 2DWEB 1LO2H 2C7UB 5CMAA 2IPTL 2MFNA 3MRQB 5GRJL 4RWYH 2G75B 3ZDZF 2BSSB 3NCJH 3TH2T 4ERSL 3TPKA 3G5XB 4CJ0A 4S2SB 3PGCA 3U4EB 3JVGC 5ISZE 3T09A 5ADPH 1KT2B 3BSZL 1INQA 3JXAA 1MJUH 4QTIH 3NCBB 2AK1L 2ATKA 5EZOL 1J9CT 5E8EB 1HHGA 2NPLX 3JVGA 3RJQB 3FRUB 1CQKA 3B4NA 5EC1B 3RPIA 4R7DA 2DTML 2NCMA 4JO3L 2MTPA 4U1LA 2H26B 2FL5A 1EHLH 5DJ0A 1AIFB 5BO1H 1H5BC 4WHDA 2VWEE 2YUXA 3K8MA 4IBLT 1AKJA 5EPMB 3BIBX 1YDPA 2P8LA 3RUGA 4FMFA 5D2LB 3N85L 4BA8A 2Y5EA 3VI4F 2W9EH 4M6AA 2R2BB 3FB6B 2PO6D 3OR6A 1DBBH 2P4AB 4R3SA 1QHPA 3G9VA 1H5BA 4V1DA 4OSUL 5B8CA 3Q6GH 2V2TB 1H9VA 4J1UA 4Z7UE 5CEYB 4D3CL 5KVEL 1D7FA 1CGYA 4JR9L 3BH8A 3CSYB 4JG0L 5DJCB 4DTGH 1NGWA 3MV9D 4NQDD 4L8SC 3SDXE 5IK3A 1FV1B 1YPZE 4XPAL 4BH8A 5FO8B 4L8BA 1PVHA 4YJZL 5GXBB 5GGSB 3UYPA 4QO1A 4ZXBD 3DVIA 4OUOA 2I26N 4FZEL 4PRNA 3D18A 1CZ8H 1K3IA 2X4OA 2B1HL 1A6TA 5HPOA 4NM8L 1FAIH 4MZ2A 2HTLD 3QUXB 2Q86A 1YY9D 5H35A 3RI5F 2IG2L 1CVSC 3DV6B 2YPLB 3BN9D 4I9WD 3LQMA 2ID5A 5EUOE 1NAKH 1P2CB 3FJTA 4U6VL 3KR3H 3QUKA 4LDOB 5F7YC 5GRWA 3F5WB 3QFDA 4J3TA 4ORZC 3KJ6H 3QEQD 2CKBA 1CF8L 3SO3B 2UYLB 4XP4H 3RQ3A 4CNIB 1AXTH 4KKCC 4X6DB 5C0JB 4PJ8C 2AJYH 2VLKB 3TWCL 4GG6E 4WTWA 1K8IB 4P23A 4O51B 3I6KA 1OAYH 4TTDD 1GOGA 2EDYA 3S35H 2J88L 5ITFB 4PJEB 5C9JA 4X4YA 4PJ8A 4FTVB 4CMHC 1NC2A 2JELH 3KLSA 1WWCA 4YO0A 4UQ2B 1EEZA 3L3KB 3WHXA 5LGHL 2FHFA 4FABL 1KJMA 4D0BB 1A4KB 4GXUN 1FNSL 1YEJH 3NMEA 4Y1AD 2ERJB 2DLIA 1JZ5A 3NA9H 4FFWD 4UDTB 1OTSC 2BNRE 3MLXH 3HG1E 4YHNA 2Q6WA 2DL2A 4G6JL 1M71A 2ADFL 3MCKB 3RRQA 3W0WA 4U1JA 1J86A 3ILPB 4WHCA 5FA4A 3KGRA 1FO0B 5KVGL 2PW1A 5HYJE 3G04B 4XXDB 3QFJE 3BPOC 4KK8C 4GRLD 5IB5A 3WO4C 1CGXA 4JZNB 5L7XH 2DM4A 2OL3H 3KNBB 4JN1L 3T0XA 3R06B 4HIEA 3RWEB 1KB9K 2DWDB 4J3SA 2CDFB 4NKQB 3EOTL 5IMLB 2P44B 2F5AH 3TZVA 3BZFA 1AGCB 5EORL 1G7MB 1X5ZA 1A9EB 5HHMD 3WCYA 4R90L 4JPKL 3GI9H 5SV4A 2F54A 2X4NA 4DN3L 4KHTH 1MIEL 2IGFL 3RVXD 5ENWB 4QY8A 4KI5F 2HJLB 3I6LE 5DJXA 5J12B 1UM6H 3WFBL 2DQCH 1OSZB 4G8GB 3VFRA 5FCSH 3QEHA 4L4TB 1I3UA 1I9JL 1RJZA 2FB4H 1Z9SA 3G9AB 3DX7B 2GK0A 4U6XB 4P57B 5I71C 4K7PY 3NH7L 1HQ4B 2AABH 2E9IA 1UYWL 3D2UA 5F9WC 2Q3ZA 3R1GL 4FQHA 5IEHA 4R96B 3SDDA 3WFEH 4QHUA 1BD2E 3GSUA 3MXVL 2F74A 4ZO6A 2YD2A 5F6HI 5D1ZB 5GISL 1JPGA 3H3BC 1HHIB 5IW3A 5SWZB 4MNQB 4JPVH 3GSQA 1RVFL 2EC9T 1FFNB 4FQXD 3MACH 3RWJB 1ZT1B 1BVLB 1IM9A 5GS3A 1A3RL 2QQQA 3NGBC 2QQLH 2YMXL 1I3GL 3HZYA 3MLZH 3C08H 1ZVSB 2X40A 4K9EH 2A6DB 3CMOH 1KGCE 1NBYB 2R0LH 3I2CL 5HYSA 2H32A 2FIKB 4LPTA 4DGIL 5CZXD 1OM3H 4KRLB 4CBPA 2YUWA 4KUCF 5D7JB 4G9FB 3ZE2E 2Z31D 5BZWB 3RA7L 3IFNL 4KGLA 4M62H 4HWEL 2H2SC 4GRMA 1OAQH 4PJGB 4WDIB 3IETB 4XX1G 4JHBA 1EMTL 2RGSA 3QQ3B 4K3EL 2F58H 3GO1L 3MRRB 1T0MA 4ZUUB 3C87A 2RFXA 1J18A 5J1TC 1P7KB 4P5TA 1UFUA 4G9DA 2AK4A 3R4DA 1UB6A 3DGGB 4M7KL 5LQBH 1IGTA 4WWKD 4OFDA 4WU7B 2IMMA 4KZEL 5C0CD 1S7WA 1T21A 2D0HA 3LN9A 3U9PH 3CFBA 2NY3D 4LLQB 5ACMA 4ZODA 4C56A 2DQDL 3RIFF 2P5EB 4NQEE 1I7TB 2EDLA 2G2RA 1JTOA 4KHXH 2EEAA 2BP3A 2OTWB 1VGEL 1HSAB 2VL5B 4X5LA 5C09D 1R3KA 3C09C 3ZKMD 5E2VL 1WISA 3VGBA 2ZG1A 3LRSA 1ACZA 4IIQA 4POUB 1XF5A 2VH5H 1S5HB 1IARB 2YS4A 3OKEA 4L4JA 5AAWA 1DDHA 3KWWB 3ZHLA 1Q0YL 2EIDA 5EO1A 5EBLB 4ZUTB 5TQ2L 4X7TA 4JRXE 4R6UA 4W4OA 5J4MA 2BVTA 3BHBA 5FB8A 3LMJH 3DXAB 3FQUA 1IAKA 4OCRL 3EDFA 1ORSA 2VDNH 1FH5L 2X4UB 2HRPH 3CH8A 1DLFL 2DB8A 3DX9B 2CRYA 3PWJB 1MFBH 3IDJA 4LSPL 4YDJB 3HE6C 1V3MA 4YPGA 1LE9B 2FX9L 4ONFH 4MAUH 1QNZH 4GAJL 4AH2B 1JUFA 2PW2A 2ARJB 1K6QL 4RMRA 5IKCA 5CP3H 5CJBA 2E6QA 4PGJA 2X4PA 5JA9A 1QQDB 3QIWA 3GBNH 1T4KA 1TJGH 4L3EE 1OP9A 3V6OC 1FFOA 1JRHH 3OAYH 3EYOA 5FAAA 4A2LA 1S78D 3KPNA 2OR8A 2XNAA 2FX8H 3SKMA 3RVWD 3OF6D 3FO1A 4P5MA 1BM3H 3TIEA 3QP3A 3MUZ1 1PKOA 3F7YB 2CKBH 3O4LE 5DMIH 5J9PB 1U0QA 2WANA 5FKAB 3HUJE 3HI1B 2F5BL 3QPQC 1ZKAA 2A6KA 4LLDA 3PHQB 4P3WA 9CGTA 2WBJC 5DZNA 3F6LA 1WBZB 1FYTB 1P7QB 2UUDK 4U2YA 4KY1L 2X9XA 2XFXB 3QUZB 4UBDC 4ODSL 3BUYB 1KN2L 4IOIB 3DYPA 3LY6A 5SX4I 2IANA 5J57B 2IAMA 3C5JA 5DJDA 5ICZA 5C6WH 3LAFA 5HI5D 2W60A 5E2TH 1ETZA 3GMQB 4CAGA 3OAUL 3U7WH 5IB4A 3KS0H 4X8XA 5DVLA 2Y6SC 5I74B 1S7XA 3HAEG 2WWKO 4UB0L 2Y36L 4X9BA 4Y16C 4XPBL 2HKHH 2CIKA 4ZS6C 3HS0B 2NY0B 3BT2H 3Q1SH 4Y2DC 2YBRB 3BE1L 5DHXB 1MIML 1UZ8A 3V4PL 5H37H 1UWGH 4D94A 1H0DA 4MDJB 5FUOH 2A77L 4IOSD 3T2QA 5EZLB 3P30L 3QI9A 4DUVA 1GJIA 5KANI 1AKJD 3HFMH 5JPNB 1T5WA 3QO0A 2CXGA 3RX5A 1E0OB 1TPXB 1EFQA 1JMZA 4KJWC 1NEZB 4LP5A 5E4EC 3B2VL 3ARFB 1HHKA 4OUUA 2WBWB 1NMCC 4RMSA 4XPFL 2AJUL 2BNUB 4V1DD 1YUHB 4HUVA 1UADC 4PJIB 4OCWH 3O3DA 1S9XB 3WNPA 4XBEH 3EFFB 3SOBH 3MRNA 4ODUB 2E8YA 1FL3B 2F53E 4M6ML 4S10A 4OBSA 1P53A 5INDB 1NPUA 4JHWH 3UCRA 3SQBA 3I3BA 3BFOA 2AV1A 4KVNL 3V6OE 4S1RH 4K3DH 3BYTA 2OJZH 5MENE 4ZSOA 1D6VL 1F90H 1M05B 1QBLL 4KGJA 4XMKL 3O4OC 3CFEB 2NZ9C 1MCSA 3BWAB 2AXJA 4HBCL 4ODXA 3DRTB 1BEYH 3WFZA 1H3PL 4Z7WB 1AO7B 3ZTJG 4GT7A 1N6VA 1S9YB 1XCQB 1F45A 4LQFL 4TUJB 1IKFH 2XQYK 4BH7B 4NP4H 5J1SC 1MRDL 4HJGA 4TULL 4F58H 5C08A 2OZ4A 3BN3B 1QUNA 2VLJB 5KOMC 4DUWA 2Q1EA 3U46B 5EULV 4LBEA 4TSAH 5ID0B 1BFOA 2DLEA 3DRQA 1RUPL 2GHWB 3UP1A 1S7QB 5CWSA 4KK5D 4EI6B 2XYCA 4WW1A 1LNUA 5B22A 1CLZL 4P23D 4PJFB 5F96L 3OAZK 5FUZL 1NMBH 3SGEI 1PKQB 1N8ZB 4KKCD 5GZND 1UB5A 3TNNA 1IGCH 1AD9A 4PJ8D 3S96B 1NC2D 1FAKT 1CD8A 2W92A 4N5EC 5EU4B 4WY7L 3U4AA 2FJFB 5FCUH 4TPRL 1RUKH 1U3HC 5DXWA 1HQRB 4ZFGH 1YEGH 1IM3A 3IJYA 1LK3H 3W0WD 2E7CA 1YYMH 1CE6A 1ADQA 1FGNH 1UKTA 3FN0L 1W2KT 3QUYC 3MV7E 3T8XB 4WJ5B 1OTSD 5JMOC 2R69H 4EDWH 2VITA 1EK3A 1GHFL 1GC1C 3O6KL 3QEUA 3UJTH 4WTZA 4PG9B 3AS3A 3MJ9L 4LP4A 5F7DB 1TXKA 3BO8B 3CFCL 5IMKB 1T2JA 2GKIA 4Q7DA 3QNXA 4WU5A 3V2AR 5J6GA 3TZVD 3IFPB 4G3YH 3EFDH 3H8NA 3KYNB 1T3FA 4PBXA 2OZ4L 3X3FH 2I9TA 3GSWA 4UU9B 3LQZB 4CL7A 4R4FH 1BQHG 4UI2A 3C2AH 1EHAA 2F54D 2W0PA 2A1WL 5DO2D 1WBYA 4J6RH 3V5KB 5T1LB 1BGXH 4JM4H 1E6JH 1DQJA 4JKMA 4MNGA 1HSBB 5ID1B 1WUNT 2VAAA 1FFPA 3KVQA 5K9KA 2XZZA 5FECA 4YC2B 3IDNB 1A7RL 5B3JF 1NAMB 5E9DA 4YZFF 3HHRB 4Q6IA 3MLSL 3D2UD 3QO1B 4N8VG 1B90A 3U0PB 1OCWL 4Y5VB 2VE6A 1B0WA 4PLKC 2A6JA 1C12B 1UCTA 4JJ5B 4YGVB 3SPVB 2E9WA 4XAWL 4UT6L 4LLWA 4B53A 3SDDD 4JVWA 1GPOH 5JHDB 1J88A 3UTQB 7FABH 4JFYB 4L3CA 1UXWA 3MBEC 4YFLI 1FNAA 2R1XA 3BEWB 5E8NA 3D0VA 5K9QG 5F1NA 3EO1B 5IROC 1KJ2A 4A6YA 4Z0XA 1IM9D 4QKXB 4DQOH 1HH6B 4F7CB 5HYFA 1QO3B 1RZ8A 2P48B 4PJDB 4NFBA 4BZ2H 1LO4L 3HNTL 4LKXB 3G6AB 1WZMA 4FNLH 1YEDA 2BNQA 4FXKA 4I8DA 4JGJA 1N5YH 1JFQL 3N0PB 4AYFA 2ICWJ 4KI5D 1MY5A 1OT1A 1U8JA 2P5WA 4L8DB 5BMFL 4P2RB 5IGXL 2AXGB 3MRPA 4CVZB 5IOPA 5FF6A 4ONHB 4WHTB 1AQKH 3LSOA 5C0EB 5FO7A 3V0VB 2CK0H 3MNWB 5F7LB 25C8L 4DUXA 1PG7L 4Z6AT 1N7ML 3P73A 4P5TD 1T2QL 3MXWH 3QWRA 3RIAK 4M1GH 4NHUB 3IU4H 5TF1L 5JW4M 3CZFA 2AK4D 5E94A 5E2WH 3LDBC 4M5ZH 5DJ2B 3SDCA 1CFTB 4YAQB 3QIBA 2DQFB 3C8DA 3VI3E 1MFAH 2A6IB 1A2YA 1VKXB 3CFJA 3BP4B 4PG2A 3EO9H 4O5LH 1A7PL 4C56D 4P2OC 5IT2H 5D8JL 4MCYA 1NJ9B 1F4XH 3K46A 3GMOA 3PNWA 1FZKA 1KCSH 3QSKB 4ALAL 3WDIA 3JTTA 4FG6C 4X6CF 1ZT4B 4H26B 4X98B 5AWNH 1JTTA 4UAOB 3LKNB 4JFFB 3GSRA 4NN7B 2VN7A 3OG6B 2P24B 5C0BB 3CDYA 4DJMA 2EO9A 4TUOA 3IU3A 4PYGA 4P5KB 2WAHA 2K7PA 1K5NA 2WIMA 2J5LB 2Y06H 4X80H 1QKZL 1U8LA 1R3LB 5LAXA 4QRRB 4MA8H 4AZ8A 5L8KB 1PYWA 1YN7B 1YN6A 4CU7A 1PZ5B 2ESVE 3TH4T 1Z5LB 5FK9A 5FYJU 3QUMA 1MCHA 5JUEH 2LV4A 3MFFB 1I9IL 4ZQKA 5L9DH 3C8KB 1WTGT 5DD5L 4UNTA 4OQ1A 1DN2A 5GGUA 4OZGF 1ZLWK 1LD9A 3DLQR 4LEOB 3RY6A 5CSZA 3QQ4A 3VRIA 1H3VA 4IOFC 1HYSD 3QIWD 5TE4H 4LSDA 1K2DA 4I2XA 4AEHH 4LRIC 1G0DA 2HT2C 3HAEH 5E4IA 4NQCB 4X6CA 3T2PA 1J8HB 4OZHF 3TYGH 3VFSB 4K94C 2RB8A 2ED8A 1JHKL 5DI8B 1JMXA 3BZEB 5TJWK 4PRHA 4Q9BA 5DMGC 2E6JA 3S4SA 1DSFL 5D70L 4RA0C 5KG9A 2RCSH 3CAFA 3QIUB 1GIGH 4NWTH 5E24E 4OF8A 4NT6B 4H88L 1UKSA 3ZYZA 5GRXG 3QXDB 5C0DB 3U2SB 3MRMB 1OQOA 2Z8RA 1EEQA 1T7YA 1I7ZB 2ZSVB 1AY1H 3UZEA 5IF0B 1IRAY 3THML 4K7FB 2IAND 2IAMD 5FHBH 1LQSR 3BXNA 2XWJA 2A73B 4UBDD 1K8DA 4X7EC 3RWHA 1NDMB 2YZ1A 1CLOH 4U1GC 4OZGA 5EFIB 4N68A 1ODAA 2D7MA 1JWUA 4LIQH 2FJGB 2GY5A 3DIFA 3B2UD 1N2RB 5EB9A 4JDTL 3RNQA 1KCVL 4PJ7E 5F9JB 1ZT7B 1N6UA 3MOAH 1OAXL 4OZHA 4AG4L 3VGHA 4LSRH 2HVKA 4JFQB 1F42A 4XMLL 1J0KA 2AGJH 2IPUK 4OLWL 5IHZB 2XN9B 3QI9D 3VGFA 1NKRA 4WV1B 5TDNA 5AD0A 3VG9B 5MEQB 3PHOA 1JJUA 3MLVH 4LCWB 1C08A 2JJSA 4M6OH 3VXSB 1FNFA 2QQKH 2IEPA 3D25B 3MCLH 3Q6FB 1HHJB 5A16B 1WQVT 2ZUXA 1NCTA 4ZUSA 4M1DL 5T1MB 1BHGA 4K94L 4KJWD 4OTXL 1MF2L 1AFVH 3VCLA 4OCNC 5HI3C 5L2KB 1EXUB 1MCRA 3OJDA 5IFHH 1UM4H 5DK0B 1JPST 4GMSH 5FGCE 3HNVL 3TPUB 2ZUQB 1MAML 5C7XL 4NRYA 3MRIA 3I6GA 2CQVA 1QYGH 1T83C 1A7QH 1DUYA 3QJFB 1ZTXH 4PB0L 5D1QB 1FORH 1BVZA 3LHPH 2DBJA 4LGRB 1Q72H 1R0AL 4NHCH 1P4BH 4NZTL 4QNPF 1KB5L 1KCKA 1RULL 3U4BH 4APQB 1WGOA 4KROC 4PJ5B 4PREA 1AD0A 3VGGA 3M17B 1BREA 5BRZA 1IBGH 3DETC 4PV9A 5C8JB 4OI7A 4OZ4A 1OTUC 5C08D 4CVXB 4A6YH 1G6RA 2VZOA 3KLDA 5EWIL 3H0TB 1YJDH 5BQ7A 3L5WA 4JFDE 1WT5C 3VD9A 5D5MF 3SKOA 5HGAA 3DSFL 3WDHA 4R0LC 4CJ1A 1G7HB 4J3XA 2CGRH 1OTTD 3P9LA 4XCEB 1I8KA 3DECA 1IFHL 3B6SA 1IGMH 2R8SH 1B9ZA 1EHNA 3ZKND 5D7SH 4GRWF 3CNKA 1MHHA 4C57C 5E56A 4DVBA 3W9DB 4MCZA 3WNNA 3UJIL 3VXTB 4KJQD 1FZJB 2R1WB 4P4KB 5DJZB 1KXVC 2VIRB 1M7IB 2Z8SA 2W1NA 5E6IC 1AHWC 4YDKH 1U8HA 4MD5A 4ZNCD 5CCKH 1RIVL 3MZTA 4Y4FB 1A6AB 4IS6A 2YA2A 3GSOA 3VDAA 3GJFK 4FP8H 3TV3L 1QP1A 2VTFA 4U1NA 1G7QB 1UACH 1C5DB 2PYEE 4RIRA 2N4IA 5CGTA 4X6BB 1OWRM 3K74B 4P59H 3IDGB 3DROA 5DZLA 4NGHL 3CVHL 2NY4D 1N6QH 1E6OL 1XGPA 4MJ5A 4MQ7A 3A6OA 4PJBF 4BSJA 3FOMA 3EOBA 2VNCA 1ZE3C 2VXQL 5E8DH 3FQRB 2VZUA 2DD8L 4KRPD 2GCYA 3UJJL 5D5MA 5HVFB 2XTJD 4HZLB 1ZA6B 3HI6L 4MHHI 1CXKA 1GXEA 5MEPA 1T1YA 4JKKA 3WE6B 1C8PA 3MRGB 4O2CB 1B0RA 2D7QA 5SWSE 1KSRA 1MWAL 2DMCA 4K2UH 4Z77A 3BIAX 2IFFL 1LP9E 2HLAA 3FL7A 3ESVF 3L6FA 4OM0H 1B4JL 3I9GL 2C4FU 2WMPA 5IBTL 3MRFB 4U0RB 5E9DD 2W91A 1J0JA 4P2QE 2EIEA 12E8H 1LEGB 5F7FA 4S0SD 3K8LA 1JGLL 1OPGH 2Q76A 2MJWA 3BD3A 4BJLA 2VDMH 3L3GB 3AS1A 3OBAA 3QUMH 5ECJE 2DQTH 3FT4A 3FHAA 3T2NH 3RNKA 4NM4L 1YNLL 5JOFB 4I4WB 4R4BB 3GI8L 2R9HC 3B83A 3FZUC 4L5FH 4OFYA 5LXGH 3NFNB 4NCC1 3DVNB 1FL6A 3ULUF 5DC4B 1KC5L 1ZHBA 2EYRA 2YRLA 4O9HH 4PJBA 2PO6B 3IDUA 3BMVA 2C4XA 2MKLC 3CK0L 4OCSL 5CIPB 1W0WA 5ALCH 4JQIL 5D2NC 1E4KA 3IXAB 4PGEA 4KDTA 3ULSA 5JDSB 5L6YH 5GSVA 4PRBB 5CP7B 4G5ZL 1XCTB 4E41A 1CR9H 2BNQD 5DJAA 1U8QA 3MV9B 3WNLA 2LE9A 4LCUA 4NQDB 3S8WA 4WI3A 5D2NA 1JNHB 3O6MH 4YWGH 5E1HB 1RZKH 1W72A 4ZXBB 1Q1JH 4HWNA 4JLRB 5I75C 2P5WD 3F12B 1MCLA 4M5YL 4KQ3H 3GRWA 4E5XB 4HS3B 1YC7A 5I8CA 3U6RA 3MV11 3RGVC 3MRHA 5HDBE 1CT8B 3K4ZA 5DQDL 5DRNB 2QBWA 3D39E 3WYRA 3MROA 5JOEA 1E4XL 2GSGB 5K59F 2FLRT 4NN5B 2VUYA 3ZDYF 1E4JA 1DQQA 1I9EA 3QWRD 5KSUA 4HHAB 3E2HB 4S1DC 1DEEA 1N5AB 1NSNH 4UT9L 4AEFA 4XH2A 5C0IA 3SDCD 3DTXA 1BJMA 4CMMB 4JB9L 4EI5C 3QEQB 1CG9A 3X17A 2XA8L 4X7SL 2Q8AL 1S7TB 2QV2A 2WUCL 4Z7OE 1RZJH 3ULVC 2V2XB 3EJYD 3VFOA 2X9WA 2AKRB 5DFTA 1AQDA 3H7LA 4P2OD 2I60H 2QHRH 1TETH 1MVUB 4JM2C 5LWYH 5KTEL 8CGTA 5HYEA 1T0NB 1P4IL 1MELA 1HWHB 4Y1AB 5ICXA 2D2OA 4JFHD 2AVGA 1RUMH 2MCPH 3ARUA 2YWYA 4F7EB 4JM2A 2B4CH 5C2BH 3H42H 4KV5E 1QSEE 3K81A 1NL0H 4HWBH 5DRWB 3C9NA 3C6LC 3WN5C 2R1YA 3B9DA 3GSVA 4GRLB 4BELD 3PL6C 2MQCA 2PCPA 1MH5B 3BP7B 3GGWA 4JO2H 3ROLA 3IVKA 1QFUH 4ZO9A 4EZMA 2VB5A 4LSVH 1V7NH 1KTLA 3HPJB 2DQJL 3LN5A 3EOAA 4XHQA 4DGYH 3PP3H 4Z7VF 4Y4HC 2DQEH 4YDVB 2I9LA 5GGRY 5HHMB 4OZIE 1T03L 4X4XA 1SEBA 2BSRA 5FO9B 3AB0C 1EJ6A 3NZ8B 1IAIH 1IKNA 2X70A 4Y4HA 4XAKD 4CADB 5DT1L 3SKUD 4I1NB 3KYOA 4DVRL 1MCJA 4QHNA 4ZFFA 3PP4L 4OQTH 1VB9A 3STZB 3UROR 1JYWA 3WKML 1LDPL 3PQYE 1U93A 2CMRH 3JWDC 4IOFD 1MAKA 5I15H 1JF1A 1ZHNB 4ORGB 2ZCKH 1TVDA 1G6RH 4PRHD 1BQUA 1ONQA 3B9VA 3ULVL 4HWZA 2Y25A 1LO5A 5ALBH 3FTGA 3RBGA 1U8OA 4ODTL 3JWOH 1C5BH 3ALPA 3FMGH 4XCNB 3C60A 5TH2B 5IB1B 2APVA 1CIUA 1U91B 1P84J 4PJCB 2IH1A 4E42A 1CGWA 1WZ1H 3ZE0F 4MGXA 1K4DA 4G7VL 1XF3B 2ED9A 3MA9L 3O2VL 1Z3GH 2GJJA 2PTTB 4X9GA 5CFHA 4EXKA 2C5DC 1T1XA 5DFVC 1LDSA 4F33A 4Z7VA 3EJZD 4FQXB 2RAMA 3ULVE 2ZSWA 2EXYD 3TO4C 4LAJH 3GKZA 1KNOA 4MYWB 2HG5A 5A3IC 1RK1A 2XWTB 2VXTL 5GS1B 5J3HD 3TO4A 1QR1A 3HRZB 4HCRA 1Y18A 3VFVA 4ZO8A 2GEEA 5KVDL 5TE7L 4LPUA 5KS9E 3O6FC 4I18A 1FLTX 5GZOC 3ZTNH 1FCGA 2Z31B 5ADOL 1QRNE 5DD3L 1QVOB 4NQXB 1RJYA 1JWMA 3TA3A 1PY9A 1Z9OA 1A0QH 3J8F7 5JW4Q 1YNKL 3L1OL 3K0WA 3CC5A 4P3DA 4UDUB 2X4RB 2QADC 2EEDA 4G8FA 4OD3L 3HCVA 4Q9RH 4I3SH 4Q2ZA 5JPMB 4G80A 3JWDL 5ICYB 3WS6C 5E95B 3QH3B 4BK4A 4Y5YC 1A7BA 2OL3B 2WBKA 4WWKB 2UZIL 3LCYA 2O61A 4MXVF 4ZTPL 5C0CB 1AR1D 1BWWA 1IC4L 4CKVX 2JLLA 5GRJH 2NY3B 5C0AA 1R24A 4GRWH 2YA1A 3WS6A 4XNQA 5D1XA 1QFWI 5JNYB 2WINB 4ERSH 1FNLA 4RFNB 1OP3H 5C09B 1T6VN 1BQLL 1JNLH 1DUZA 1BMGA 2AK1H 1PG7X 4UV7L 5H2BB 4WNQB 2EE2A 1S7VB 1D5XA 5EZOH 3ZYJA 3PUCA 2HT3C 4PRDA 3SE9L 2DM7A 5SWSD 4QXUH 3RHWF 2XZCL 2VKXA 1A5FH 4NDMB 4Y5XB 4NO2A 3FN9A 2NW3A 3VFMA 2DTMH 4JO3H 3B43A 4Z8FL 4Q9QL 4QEGA 2V5YA 3T3MF 1BX2B 5BRZD 2C3GA 4OD2B 5D7KE 2QKIB 4ZPVA 3PGDB 2YSSB 5J1AB 4UUJB 3HI5L 3LIZL 4KROD 4O58L 1X5KA 1SYVA 1L0XA 1P6FA 3TFKC 1DQTA 1J1PL 2FJHB 3CSBA 3UTSD 1CDGA 2F15A 5KSBF 1FDLL 1QSVA 4R97B 3ARBC 1QRKA 5DEGB 3S34L 1QLEL 4MQSB 3IDIA 5KVEH 1MJJA 3DUUA 4JG0H 3W39B 5MI0B 3HR5B 1RQ5A 2GJ6A 2K3TA 3O2DL 1FL5A 1I4FA 3ARBA 3PGFH 3GRWH 1S8DA 2WIIA 3RKDD 4G8IB 2IALB 1D5ZA 1IGJB 1PBYA 2YK1L 3WFDL 4FZEH 4CDGC 1G9NC 5ESQB 2B1HH 3MA7A 3FCTA 1WWWX 1REIA 4GSDL 5EIVA 2QSVA 2YA0A 2GUOB 5DGRA 1JWSB 2IG2H 3EO0B 4WUUD 1AGFA 3BZ4A 1RZGA 4JQXA 4K07A 1AR2A 1KLGB 1HILA 4GQ9L 2X7LA 4DCQB 3ULUH 2VZTA 5HI4C 5IHBA 2VXUL 1CF8H 2AW2A 1K85A 3RWCA 3H6JA 4LVNC 1TTGA 2EH7H 1FLRL 2JTDA 3T1FA 5AZEL 5KSBA 5CMAB 1U36A 5CJOL 3OHXA 3ME0A 3ABZA 3QUXC 3V4UL 1B2WL 5KANG 2J88H 1FP5A 4OF5A 3HMWL 2C3WA 5FYKL 2W0LA 2NZIA 3PGCB 4UINL 5LGHH 4FABH 1INQB 1FNSH 1RUAL 2ATKB 3SE4A 5C0FA 2GJZA 4KZDH 2E3VA 3U7YL 4D0DA 2ADFH 1HHGB 2EIZA 3SO3C 1CFNA 2BVEA 2HFGL 3CDCA 2FNBA 3PF2A 5KVGH 4HEME 3S37L 2W9DL 4XCCL 1KXTB 2XG5A 1DBAL 4HJ0D 3MRCA 3RPIB 4AIZA 4LRNH 2B0SL 5C2UB 4U1LB 3WDJA 4ZFZA 5F7NC 1EJOL 2FEEI 2FL5B 5DJ0B 4JN1H 4TRPL 5FYKE 1HINH 4LMQE 3S6CA 1U2HA 4NQSA 1AKJB 4ELKA 4OFYD 1BOYA 1PY4A 1G9NL 3HRPA 1YDPB 4X4MA 2P8LB 3RUGB 5E00A 4I13B 2X2YA 3UPCA 1T0PB 4I0KA 4PLJC 3OR6B 4YDLB 4R3SB 4KK6C 1H5BB 4V1DB 4Y7MA 4F7TA 2ERJC 4FFVC 4R90H 2R9HD 3FZUD 2VDQH 5B8CB 5F8RC 3T1WA 4Z0BL 4J1UB 4UIKL 3NFSL 3X13A 4E41D 3BH8B 4DN3H 5A2JH 4KTYA 3OJMB 1MIEH 1NGWB 4Z76A 4DZBA 2VDPH 5IK3B 4JDZA 3RL2A 4BH8B 3WJJA 4L8BB 2IJ0C 2IBZY 3DPBA 4UQ3A 2X6MA 4PRNB 3D18B 5D2LE 5C71A 2X4OB 1I9JH 5JXEA 1A6TB 3PWUB 2FYYA 3C5ZA 1MVFA 4F57L 5H35B 3R1GH 1MUJA 5DRXA 3WD5H 4GG8A 3BP6A 4X83A 5DGQA 2IFGA 2HWZH 3CX2A 3QUKB 3MXVH 1LO3L 1KLFA 3QFDB 1LO0L 1G7LA 2ZOLB 4PTUA 1NCUA 1QACA 1Q38A 3KPLA 3V4VH 1BFVL 1CCZA 5EZIL 5GISH 5KN5A 2OMNA 5J12C 5CGYC 1MI5A 2NXZC 5IJKC 3ULUD 3PWPD 1UWXK 4JEGB 2B7DT 3UTTA 3TBWA 5E5MA 4HCRH 4P23B 3I6KB 3KXFE 1I3GH 2EE9A 2YPLE 5C9JB 4P3CL 1QSFA 4PJ8B 3MRJA 1NC2B 4GW4A 4B0MM 4DFIA 4YO0B 3I2CH 1EEZB 3WHXB 5I8OL 1KJMB 4DGIH 3AAZB 1QPPA 5GGRA 3M1BA 5T5NF 2A9ML 4FFZH 3RA7H 2Q6WB 4YHNB 4CMHB 1M71B 5D1ZC 4HWEH 3W0WB 1RUQL 4JM2D 4P9ML 4U1JB 5FA4B 4NKMA 4X6DE 2JF1A 2PW1B 2VLKE 1EMTH 2MHAA 2A2QT 4HQQL 4K3EH 3GO1H 3WBDA 4C54A 5IB5B 1CDBA 1XR9A 3ECBA 5AUMA 3UAJC 2BVPA 4J8RA 4UV4L 2IQAA 1DANU 1G0XA 4TVPH 1U8NA 1RK0A 2QSQA 4HIEB 4FTVE 4JREB 5C0ND 3VD7A 4EXPX 5F1KC 3WO4B 3TZVB 3BZFB 3RWGA 3UBXI 4PJAE 5CD3A 5D7JC 4JPIA 2DQDH 4NYLA 1RZ7H 1X4XA 2F54B 1VGEH 2AEPH 4Y4HD 1KPVA 2X4NB 2FBJH 1VFBA 5TFSL 1MQ8A 3ZHDA 1DBJH 2E9BA 4QY8B 3IGAA 5D9SA 5DJXB 3ROOA 2VQ1A 3DHJA 2QR0A 3LB6C 3VFRB 3QEHB 1JYVA 1WCQA 4Y4KA 5F7EL 1TTFA 1ZLUK 4XWGL 1RJZB 4J2XA 1AGEA 1TIUA 4YFLF 5GGVY 3H9YA 1SVZA 3DVGA 2GK0B 5HBBA 5E6ZA 5CGMA 3D2UB 1BZ9A 5A2IH 4OCRH 4FQHB 1LEKA 2HFEA 1FH5H 5IEHB 4TN9A 1KG0A 3SDDB 5JW3L 3C60D 4QHUB 3GSUB 3HMXA 5F9WB 2F74B 2ZJSH 3ZSTA 5TDPA 2OR7A 5HY9A 3GMNA 3V7MA 5EU5A 4ZAKC 1JPGB 1JN6A 4LSTH 5FYJL 4G8GE 5GIRA 2AQ1A 3KYKL 4L4TE 1KPUA 2FX9H 3GSQB 3KPQA 4NZJA 4JHZA 4GAJH 3N1FC 3FQWA 4ZAKA 3O3EA 3QDJA 4NKOA 3QWQB 3HZYB 4UIMA 1FRGL 2R0KL 4ZD3L 3BKYL 4AM0A 2VJXA 4IMKC 3TO4D 1P9MA 1TITA 2EC8A 5HYSB 2H32B 5A3ID 2ARWA 4HT1L 5FYJE 3AVEA 4C4KO 4NWUL 3ZT6A 2UWEF 3EYQC 4GRMB 1ZLVK 4U6TA 3H9SA 3TA3D 1R6VA 2H2PD 5SWZE 2F8XC 4MNQE 3GNMH 2R15A 4H25A 2E7MA 3P4OA 3GFUA 3MTRA 5EN2A 3CFKA 5CSBA 4LLAA 1QSZA 3NIDE 5E2JA 1XGQA 4P5TB 4N9GA 4NC0B 5FOBA 3DYMA 4G9DB 4ODHH 3DBXA 2DLFL 2AK4B 4XVJH 1PW3A 2OTUA 4NO5A 1MEXL 1UB6B 4ODSH 4XTRD 1IGTB 4QGYA 4TVPD 1KN2H 1T21B 3BKMH 3CXDH 4G9FE 3CFBB 5GS0C 4C83A 3HC0A 5D72H 5C0AD 4C56B 3HZMA 5D1XD 4PJGE 5SX5K 2G2RB 1JHLH 2PTVA 1F58L 3DX6A 5I1EL 1F3RB 2ZZUT 3X3GL 3LRSB 4PS4L 4JANA 1R3IH 5FGBA 1XF5B 4X5WA 43CAA 2HLFC 3OKEB 5GS2D 1CTNA 2IADA 5EO1B 3BE1H 2Z91A 2WNGA 3D87B 4X7TB 1R5WA 3V4PH 3BHBB 3QUZC 4M61A 2HT3D 5FB8B 3FQUB 5H94A 2UWEA 3VWKC 1IAKB 4N0CD 4PV8A 3P30H 2P5EE 1F6LL 2DDQH 4FQCL 1ORSB 1TJIL 3BPLB 1F3JA 4KTEL 1QBML 3U1SL 4OGYL 1ZAGA 2OCFD 1FBIH 1CFBA 1U92A 4AMKH 4LFHD 4AQOA 1KB9J 5KAQF 1MRFL 4PRIA 1YECH 5EUKA 4HSQA 3IDJB 1MJ8H 4FQPA 2DJSA 2NY0C 1FVDA 4YPGB 1IEBA 3CZJA 1JUFB 2PW2B 4M6MH 2GJ6D 5CINH 3ARBD 4XWOD 1LILA 1SJXA 1QFWM 5FUCC 4DN4L 5IKCB 2NY1D 2SEBA 1AGDA 3SE8L 1OAZL 4KVNH 2X4PB 1ZV5A 3QIWB 1T4KB 4UNVA 4LSQL 1XT5A 1FFOB 1TVHA 4PY7A 3EYOB 3BGMA 4HIHA 1PSKL 3KPNB 4Z7QE 2R0WL 2XNAB 3B9KA 3RZCA 3SKMB 5GS0L 1IJ9A 2HT4C 4XNXH 3FO1B 4P5MB 1ITBB 5FOJA 3X11A 4M93C 3TIEB 3MGAA 1U8MA 2OBGA 3KPTA 4OIAA 2J8UB 1JRHI 2P8MA 1CI5A 2KDGA 4PP1C 4TULH 2A6KB 3QCTL 3AMKA 5AZ2L 4QRTA 5DQJA 1KIQB 4PRPA 4OZFA 4OV6F 2F9BT 3INUL 1JIBA 5HI4D 3T3PE 2DN7A 5DUML 2IANB 1CFSA 1CLZH 2IAMB 1RI8A 3C5JB 5F96H 3HB3C 5DJDB 5FUZH 1TCRA 3GJEA 5ICZB 5D7LA 1RIUH 1ITCA 1F4AA 2W60B 1ETZB 3UTZA 1VACA 2Z9TA 1MCBA 5IB4B 3ZKXC 4RNRA 1YQVL 4M8QA 1GSMA 1S7XB 5FM5M 4YXHL 2MKWA 5T3ZD 4EJ1C 4Q6YA 3DURA 2CIKB 3CCHA 3KXFD 3V9FA 3O3UN 3U36A 2Q20A 4RISL 5DMJB 1FYTE 3O41A 4QTHA 1C5CH 1RHHA 1BAFL 4FQJL 4HKXA 3FN0H 4AL8L 1H0DB 3DX8A 1GHFH 1CBVH 4Y2DB 4X6EA 3LV3A 1T5XA 4GW5A 1SM3H 3QI9B 4DKDC 4BFIA 3MJ9H 1IAOA 5DYOA 1R3HA 1T5WB 3QO0B 4NZUL 1JGUH 3QXWA 1BPVA 4OUUB 1HHKB 2X09A 3MQIA 4K8RC 3V52L 3VFGH 1HCVA 4YPJA 3H3PH 2HRLA 4HUVB 1VGKA 5B39G 5E8OA 4ACPA 4R26H 5HHXH 3O3DB 5E4EB 3ZMRA 4OT1L 3MRNB 5DMKA 2A1WH 4KK6D 4QRPE 4GKNA 5E0QA 3O9WC 5FUCE 4HC1L 2KZ1B 1HCFX 1M6OA 2Q3AA 2AV1B 5E08L 2BXZA 4P49A 3U9UA 4ZUVA 4QLRA 5KW9L 4ZSOB 2FX7H 2ZKHH 3WEXA 3O9WA 1NKOA 3WL9A 3O3BB 5JXED 5JHLL 3C5ZD 4ODXB 3MLSH 1S9VA 4ZPTA 3VGDA 3HMXH 2EXWD 3H7BA 4PJIE 4Y8AA 3RVTC 4KXZH 4TVSa 1HKLL 1KEGL 3O4OB 5IW1A 2I24N 1WEJL 3KHQA 3R0MA 2JCCF 2K9UA 4HJGB 4FQ2L 4IJ3B 5C08B 1A6VL 1LGVA 4MS8D 4UOW1 1JZ4A 4CW1A 4POZD 1MI5D 4JZOA 3FO2B 3WLBA 1BFOB 3DRQB 3DOSA 5CWSB 5F3HA 4KVCL 2XA3A 4YC2C 2P49B 4J3VA 1TDQA 3UTTD 4WW1B 1T89C 5CGYD 4XP9L 4Z7WE 1AO7E 1VA9A 1LO4H 2QLVB 3HNTH 1UB5B 3TNNB 3WJLA 1QSFD 1AD9B 4MA7L 4Y5VC 4FN0A 1NFDF 1DTUA 3KHOA 2NXYD 3P0YH 4BM7A 4JPWH 4HK0A 4K8RL 1CN4A 3SE3C 4CUCA 3GSXA 1IM3B 2VLJE 3IJYB 4RBPK 1X5GA 3QBTB 1CE6B 2BDNL 3QAZC 3UTOA 1XMWA 1KV3A 4JQVC 1NGQH 4PJFE 1MCIA 5FEBA 5HDQL 2Z4QA 1V05A 3QEUB 1PG7H 1PKQE 3T0DA 1AH1A 5JZ7C 3QHFL 2JCCA 3QNXB 4WU5B 3UAJD 5J6GB 2NY4B 2N1KA 4LLYA 4U2ZA 1T3FB 2P1YA 2ENYA 4HKBA 4UTAL 4KRPB 2I9TB 2HTKD 3GSWB 1JZ2A 3GDBA 1PJ9A 1JVKA 2RQ8A 2XTJB 4NNPL 2ZCLH 1U95A 3TNMA 1WBYB 2A0LD 4JDVA 1RFDL 4XP6L 1DQJB 2JIXA 4OB5H 1NMAL 2VAAB 4H1LA 2AJZA 4RGOL 1NFDA 4ZTOL 1FFPB 2BC4A 4Y4KD 5K9KB 2DI7A 4N8CH 3SCMA 5FECB 5HVGB 1JNNH 3BW9A 1MFEH 1BOGB 1OF2A 3GSNA 4Y19A 5E9DB 3TM6A 4Q6IB 3TIDA 3LS5H 5D6DC 2VE6B 3WV0A 4L8CA 2A6JB 5GGTA 2X4QA 4X7FC 4P4RA 4LASL 1MRCL 4HIXH 1IGFL 5JIPA 5D6DA 5ITBL 2LAAA 4L3CB 5MP6L 2Y7QA 1UXWB 2VRAA 1NLBH 2R1XB 3UTPD 1SJHA 4XHJC 5F1NB 1I9IH 1VFAA 3Q48A 5AEAA 5SWQB 1NCBL 1KJ2B 3MNVA 1B0GA 1JGEA 4A6YB 4Z0XB 4ZAKD 3RKPA 3QDJD 1OAUL 2F19H 1NGYA 3WUWA 1RZ8B 3S37X 3OV6A 4WCYH 4JFOA 2J5LC 2PXYA 5T3XL 2BNQB 4FXKB 4KJPC 2UUDH 5BV7H 5JHDE 3D39A 3LKSA 1I1AA 4NOBA 3W9EA 5F44A 4PBVC 1U8JB 1VPOH 2P5WB 5A2KH 3MRPB 1JHKH 3H9SD 4M3JA 5IOPB 4NJAL 5EBWA 3JSSA 4P2YA 5FF6B 5KVFL 1GZQA 1ZGLA 3LSOB 5D70H 3L3OB 4RWHA 5FO7B 1CDHA 2E7LA 4PJDE 4NRZA 2MWCA 3P73B 5T3XE 3CZFB 4J4PC 5E94B 3DGCR 2VDRL 2VLME 3SDCB 4HH8A 4BQCA 1L7IH 2FECL 3REVA 3GHBL 4FXGA 4LNRA 1A2YB 3QQ9C 5EZJA 3THMH 3CFJB 4L4VA 2BVOA 4NO3B 4J4PA 5ANMA 4P2RE 2BRRH 4MCYB 2IBGA 1G1CA 5LBSL 4KKBD 4OV5A 3GMOB 4X9HA 2ADJA 3PNWB 3CH1A 1FZKB 3KPPA 4P2OB 3JTTB 3V8CA 5GGSY 1T66C 3QIUC 4JDTH 1NLDL 3KPRA 3GSRB 1FPTL 4M8VA 5FYLH 2OS7A 3EYUH 4TUOB 1OAXH 3CU7A 2WV3A 3IU3B 1XGUA 4K3JL 4DAGH 2XWBA 1K5NB 3H2WA 1D5MA 4MA3A 4HJJL 4HMDA 3WIHH 5E7BA 1ZEAL 1U8LB 5LAXB 8FABB 3NN8A 2UY7A 1PYWB 1YN6B 1I7RA 1RU9H 4XVSH 5CZVH 3BDYL 2DBLH 3TBYB 4HD9A 2YD8A 4PRID 1QLFA 3QUMB 4JFFE 4OCXH 4HZAA 5SV3A 2IPUG 5C0BE 4BFGA 1KBGL 3OZ9L 1IC7L 3ZHKA 1NGZB 1P69B 4ZQKB 3V7AE 4F3FA 5I1JL 2IQ9H 4KKLC 4GBXC 2ICWI 3QT2A 5GGUB 1RURH 4M48H 1FYHB 1LD9B 3QZWG 4GXUM 3TF7C 4N1HB 4I77L 4PLNC 5CSZB 4QRRE 3QQ4B 3CLFL 3VRIB 3I75A 4GBXA 1QPXA 1P5VA 1K2DB 4I2XB 4WV1C 2I5YH 5E99L 5IVXF 4DOHB 5DURD 1J87A 1NGPL 4QHMA 4X6CB 4QRPD 3TBSA 3RZCD 4YHOL 1Y0LA 1L9MA 3OAZH 1N64L 5F1OB 4NJ9L 1FZOA 1NUGA 4NZTH 1KB5H 1RULH 5CEXA 4PRHB 1ACYL 3NIFF 3S4SB 4CN1A 3VXUA 1FE8L 5KG9B 4ZS7L 1JPTL 2BVQA 2EDNA 3VFPA 5DTFA 4XB8A 3JV4A 2ZWLT 4WI6A 3O45A 4PRPD 2ZUQC 2DQGL 4KU1A 1CK0H 2APWA 4NQCE 1N26A 1RJCA 2DQUH 1J8HE 4FMKA 2Q87A 3RU8L 3T65A 1EVUA 5I1DA 2DKSA 1IT9L 5D1QC 5D7LD 3BQUA 4M1CC 3BXNB 2XWJB 4MJIA 1K8DB 4Y89A 3RWHB 4APQC 1UM5L 1VENA 4OZGB 3MMEA 1CFVL 1X3DA 2B1AH 1JWUB 3DIFB 3RNQB 2NR6C 2WUBL 5IVXA 4WFGE 4U1GB 5C0RL 1A6WL 1J8KA 4OZHB 1P5UA 3SBWC 2HVKB 5FYLD 3WFHA 4IRSA 5JQHC 3F7RA 5FA3A 4F9PA 5TDNB 1MCNA 5AD0B 3PHOB 1ZANH 4JGMA 2WP3O 3WXWL 2VZ1A 1OOAA 5F70A 4ZUSB 1KCUL 1INDL 4HF5H 5EU6A 2EDDA 3UJJH 1RZIB 3VCLB 2GFBA 2X10A 3HI6H 1HOCA 4XC1H 4NBZB 1WIOA 1OB1A 4LOUD 4EUPG 1F11A 1MQKL 1MWAH 3OJDB 2IFFH 2XN9E 3GSNH 4H8WH 2Y4SA 4LCWE 4NRYB 3I6GB 3MRIB 3O9WD 4XNZB 3VXSE 2PKDA 1DUYB 3IKCA 3MZGB 1EV2E 2NLJA 1MCOL 5SWSB 3EHBD 1E27B 5JO5A 3QEGL 4PGBB 4PREB 3OKKA 1AD0B 3QULA 5BRZB 4LHUA 4LPYA 4PV9B 1OD9A 1KJ3H 1YNLH 1AXSA 4OZ4B 5L2KE 4K3HA 3RVTD 1G6RB 1PX3A 4MB3A 1RMFH 4L9LA 5ELIA 4KROB 4IDJL 5KJRH 4GMTL 5BQ7B 3L5WB 4MSWA 2VERN 3RY4A 5JXAL 5LGJA 4HS6A 4JG1L 2P7TA 3SKOB 3S5LB 3UTSB 2EIBA 3MJGX 3PDOA 5KSVA 5HGAB 3CK0H 4IHOA 4OCSH 4DZ8A 4OKDA 2XTLA 2AP2A 4JQIH 4U0RC 2UZYB 3P9LB 5DK3A 5MEOA 2BY1A 2M1KA 1I8KB 4PJ5E 3F8UB 4PYHA 3MV8A 3B6SB 2C9AA 1MLCA 1MHHB 4DVBB 1IGYA 2NY5C 4MCZB 1X5AA 3IAPA 1XF4A 4XPTH 4KWUA 3GKWL 1NBVH 1U8HB 2GIYA 2R23A 4YH6A 2PO6C 35C8L 1E4XH 4IS6B 3B3IA 3B5TA 3GSOB 1P84K 1TQBB 4WUUB 1OP3K 1DL7L 5MHSD 4RIRB 1KUMA 1MCDA 3DROB 1SEQH 4JB9H 1XGPB 4MJ5B 4MQ7B 1BECA 3O3AA 3EOBB 2UV3A 3BESR 1ED3B 2XA8H 5GSRA 4W81A 2Q8AH 2GCYB 5D5MB 3NABL 3CVIH 4HIJA 5MEPB 1T1YB 5T33L 2VDLH 5FKPA 2HTLC 1YY9C 1KJVA 1BWMA 2C3HA 1DN0A 5I1GL 4Z77B 4QHLB 2JIXD 2AS5M 1LMKA 2HVJA 3EYVA 1YYLH 2HLAB 5BJTA 5IQ9A 3D3VA 4GRWB 3L6FB 5K9QI 3E2HC 4C59B 1A3LL 4FXLA 3EDEA 4Y19D 3C5SA 1OHQA 1UEMA 4JKWA 4BQBA 1NBQA 2IC2A 4Z9KB 1FQ9C 1RZFL 4XNYL 2Q76B 3NTCL 4IEFB 4WGWB 4D9LL 3BRFA 4LNVA 3CLEL 3FT4B 5EU3A 3EYFA 32C2A 3RNKB 1UZ6F 2NQCA 2BVUA 4HUUA 4U3HA 1V7ML 4TTDC 5D7IF 3OR7B 5J11B 1GGBH 4N0YH 3MJ8A 1YA5A 1FL6B 1ZHBB 2EYRB 4PJBB 1HI6A 5DF0A 1AIFA 2EECA 4J3WA 2C3XA 4FFWC 1W0WB 2YD4A 1EA9C 4OGXH 4PGEB 3ULSB 4HFWA 2E27L 5GSVB 3LQAC 2PXYD 4E41B 2XKUA 2A38A 2W65A 5DJAB 1U8QB 2XQBL 4LCUB 3G08A 4F37K 1Q9LA 1I1AD 2NTFA 3ZL4L 5D2NB 1W72B 4PJEF 4ZUWA 1LDPH 1SBSH 4TNWK 3FRPA 5GQBA 2FGWH 3HC3L 5DJYA 3CSGA 3U6RB 5CZKA 5ILTL 4OKVA 3GMPA 5GGSA 3KLAA 1L7TL 3U48A 4ODTH 5CUSL 3MROB 2ZNXA 4WUKL 2QJDA 3RFZC 1DQQB 5HHVH 5KSUB 2CKNA 3IFOA 1DEEB 2P8PA 2OYPA 5HXMA 3MLWH 2DJ4A 3MV9E 4NQDE 5C0IB 3DTXB 1PLGH 1UXSA 3U0WL 3RVXC 3O11A 5D7IA 4G7VH 1CG9B 5B4MD 4EBQL 5FGRA 1P2CA 4L4VD 4XCFL 3O2VH 4NC1C 2OK0H 1QBBA 1MREH 4J4PD 3PWPB 3UC0H 2EZ0C 3ELAT 4N0RA 4OCYL 4Z95L 1S5IL 4I48A 3QNZA 2OM5A 4MMZC 3UYOD 4RFOL 3VFOB 1AQDB 2VXTH 4I9WE 1INEL 3VGAC 5JR1H 5C0JA 1SY6L 3OPZH 3GHEL 3KPRD 3OKLA 1MFDL 3WS3A 4RWYL 2VAJA 2ZUYA 5ICXB 3QEQE 1H8SA 3D9AH 4OF7A 4PJEA 3BMWA 2VDKL 4JKPL 5ADOH 1T66D 5DD3H 3AY4C 3NCFB 4JM2B 2YD7A 4PB9L 4HGKC 4LCCC 4OGAD 5ADPL 3L1OH 3LQAL 1MJUL 4QTIL 4F7MA 3C9NB 2R1YB 3GSVB 4UDTA 2N56A 5LGKA 2ITCA 4FQXC 4KKAD 2PCPB 3ROLB 2F8VA 3AY4A 3GGWB 5IM7B 1UEYA 3IVKB 4LCCA 3RVVD 2VLRA 1SJVA 4D9RD 1Q0XH 5C07A 2AV7A 2VO5A 5EOQH 3E6FA 3ARQA 1KTLB 2B5IB 2JJTC 5GS1C 3EOAB 3QDGA 1HEZA 2UZIH 4Y1AE 4ZTPH 4NBXB 2I9LB 4Y88A 1IC4H 4NQTA 4B50A 4LARL 4G8EA 2NY2C 2Z31C 2DWDA 4R7NA 2ILLA 4X4XB 1SEBB 2BSRB 4OFPA 5T1DH 4JCMA 2X70B 2ZOKA 4U4BA 4Y4HB 2XI9A 4KKLD 4GBXD 5CLWA 1G7MA 4XBGA 1U8KA 3KYOB 3RI5K 4UV7H 4QHNB 4ZFFB 2B8OT 4YDIH 3O6LH 3VE0A 3SE9H 1LWRA 2XZCH 3WMSA 3EW3B 1U93B 5HGDA 4DTGL 1JF1B 5ESVA 1IEAA 1HZHL 3RDTC 1ONQB 4Z8FH 1D6EA 4IDLA 1QFWH 4I3RH 4Q9QH 4LKCA 1J1XL 1LO5B 2CO7B 2FD6L 3FTGB 4HPOH 5HHME 1T22A 3VXUD 1U8OB 4EIZC 2FBOJ 4OFKA 2NY3C 3UBXA 1TFHA 4Q9CA 3LIZH 3RDTA 1FC1A 3BRDA 3C60B 1FAIL 4OLUH 5IB3A 4ZNEE 4JY4A 2IH1B 1J1PH 1PEWA 4E42B 2HKFL 3ZKMC 4NC1E 1K4DB 4WFFD 3DMMA 3QR2A 4AT6A 5BW7C 4GW1A 2VXVL 5EU7C 3KR3L 3S34H 5FM4A 1T1XB 3KPSA 3BDBA 3GJFH 4F33B 1BF2A 3BQUD 4Z7VB 4Y5XC 1I75A 4MJID 2ZSWB 3KJ6L 4R2GD 4P9HH 1KNOB 1EO7A 2D4FA 3ZKQD 4D9QD 2HG5B 3NBNA 1AXTL 3WFDH 2YK1H 4HUNB 5HGBB 2AJYL 2ZP0T 3TO4B 1QR1B 1ZT1A 2IMNA 4GOSA 3VFVB 3P40A 4PJCE 1OAYL 2FLBT 4GSDH 5BS0E 5DA0B 1G7JA 4I18B 2NNAA 3VXMA 2V7NA 2XKNA 1RJYB 2JELL 2WLYA 1JWMB 3TA3B 3E3QE 1F6AA 4IRSD 5TDOA 1YEJL 3CC5B 4P3DB 3S3PA 2GI7A 4G8FB 1VHPA 3HCVB 2HFFA 3WNOA 4Q2ZB 4RRPG 4G80B 4LDLB 3SN6N 2B2XH 2BCKA 5EU6D 2I27N 5I0DA 4HAGA 4QT5A 5JTWA 2O61B 5AZEH 2OL3L 3JV0A 3MGTA 1S78C 6CGTA 3Q0HA 4M3KB 4K9EC 1JF5A 1R24B 3LKOA 5CD5C 3G5ZA 1O0VA 3MLUL 3NCCB 4XNQB 1UQSA 5I1IH 3DGGA 3GMMA 5FYKH 3IJSA 2F5AL 1FG9C 4J3OC 5HHNA 4UINH 1DUZB 2BMKA 4PBWD 4U1IA 1UGNA 4ZFOL 2KUTA 1D5XB 3GI9L 2FWOA 1VADA 4PRDB 5B38A 3UO1L 1Y6NR 3BOVA 5IV2A 4EN3C 4NO2B 3ET9F 4KHTL 3S37H 2NW3B 2W9DH 3P4LA 1DBAH 1DBKH 4NOFA 3VFMB 3TH3T 2B0SH 5C0CE 3SDAC 1IMHC 5ETUA 4N1EA 5DJ8A 1EJOH 2DQCL 1GGIH 4LHUD 1IAMA 4TRPH 1FJ1A 4ZPVB 2CLZA 4F80A 2FB4L 1G9NH 3SDAA 5HI5C 5C09E 1SYVB 2AABL 3DXAA 3VJ6B 4WENB 2IWGA 4G42A 1X6LA 4R8WL 3K4DA 4Z0BH 5CEZH 5I1HH 1MCQA 3EKCA 4UIKH 3NFSH 1UWEH 3IDIB 4JZJC 1MJJB 4C58B 3DUUB 3MV8D 2EICA 4G6KL 2GJ6B 3AXLB 2APFA 1FL5B 1I4FB 3ARBB 2WQ8A 5T1KA 1S8DB 2WIIB 2NY1B 1D5ZB 3JWNC 4JPVL 4JZJA 4NRXA 3UX9B 3OKMA 2XV6B 3MA7B 3FCTB 2HH0H 2YXFA 4YHZH 3MODH 3C08L 4QXGL 4DKFL 4K9EL 4YDLC 1S9WA 3E6HA 3U0TA 1KTRL 2ARJQ 2R0LL 2V5TA 3FB8A 1JZ7A 4TNVK 1AGFB 4KC3B 5B8CC 2ATPA 1M4KA 3BZ4B 1RZGB 5IVNA 4N90D 4LSSH 1HILB 4G7YH 2X7LB 1NEZG 1BFVH 1FZMB 4RAUA 5L88H 4XBPA 3L3HA 2AJXL 1KFAH 2UY6A 4LPCA 2X1XR 4JHAL 3T1FB 5CAYB 4RGNC 4MJ6A 3S97C 5KSBB 5LKNA 5JORA 1G9MC 2AERT 3OHXB 1CL7L 4UMGA 4LVNB 4H0GA 3I3EA 1ZOXA 1UJTA 2EDJA 4WFED 3F7QA 3D3VD 4ESKA 5CP3A 1WK0A 5IIEA 5C0FB 1VFOA 2GJZB 3KXFB 3V8OA 3VXRA 2HN7B 4D0DB 2EIZB 4HXAL 4P9MH 5DVNA 1CFNB 3IYLW 4AIZB 1FO0H 3MRCB 1CGSH 1GGTA 4HQQH 1S7SB 2VH5L 4ZFZB 1CDCA 1TENA 4JAMA 4KK5C 2R39A 3AGVA 2J3SA 4P23C 1JP5A 5GZNC 4ELKB 5E00B 2H41A 4JFEA 3LMJL 2EYSA 5J13B 3P11L 1CICA 3VFNA 4ELMF 4YE4L 3C6SA 2ZCHL 3OKYA 4F7TB 4L3AA 3K2UL 4QYOA 3QG7L 5IMMB 5FGSA 3X13B 1MJ7H 2A74A 4MWFA 1ZS8A 5IP4A 2CIIA 5TFSH 4DZBB 1C1EL 4Z76B 3PJSA 4JDZB 5CEZD 3RL2B 5HTSA 4PJAB 4MAUL 1QNZL 4UQ3B 3T4AA 1NUFA 4KQ4L 3RUGE 1RV6X 2YZ8A 2AQ3A 4XWGH 4JREC 1EUUA 2Y23A 5LVEA 1LHZA 4GFTB 2FYYB 4OBRA 3C5ZB 5DLMH 1MLBA 3TZVC 1PD6A 1G9ML 4V1DE 2GAZA 1MUJB 4NQVA 5DRXB 1TJGL 4GG8B 3VRLF 3BP6B 3QRGL 2BOCA 3MREA 4FFYH 2JK5A 2FX8L 3H9ZA 5DO2C 2M26A 3ZDZE 1G7LB 4PTUB 4YHKH 3KPLB 1FNGA 5KN5B 5I1LA 1S9YA 3BYYA 2CKBL 3KYKH 2VSDA 1MI5B 4KK9D 1JV5A 3EYSL 3GEWB 4N0UA 4ELMA 2VZVA 4XZUA 4Z7NF 3P77A 3TBWB 3UTTB 2BHZA 1CXFA 3MRDA 3R0NA 4U33A 5CILL 5E5MB 4Z78B 2NXZB 2LQRA 3U46A 1DEDA 1QA9A 2EZ0D 2YKLH 3FFDA 1QSFB 4ZD3H 3MRJB 4HEPG 4GW4B 4JCLA 1EO8L 1G0YR 2NXYB 3HPLA 3GIZH 3MUHL 3SDDC 5GGRB 3M1BB 1X5IA 2BX5A 3FT3A 4HT1H 3TT3L 4M7LT 4NWUH 5CBEA 5JIHA 4ODBD 2X1QA 3F58H 3VI4E 4NKMB 5HGGS 3U7WL 1J05A 1E4WL 4HLZG 1JZ8A 4PLOB 2MHAB 2Y9RT 3PG2A 1UCBL 2EDTA 4MX7A 1K9TA 5BS0D 5CBAA 1XR9B 3ECBB 2BVPB 4J8RB 2IQAB 3IDMA 4NUJB 1AJ7L 3BT2L 2VLRD 3HLAA 4QCIA 1UA6H 3SJVA 5C07D 1U8NB 3QXUA 2ICCA 1RK0B 1HH9A 2DLFH 4PIRF 4AQ1B 3AC0A 1MEXH 2HP4A 3U82B 1EEYA 1TNMA 3QDGD 4DFHA 3FO0L 3RWGB 3MRKB 2R4SH 4KI5C 4MXQC 1KELH 4P46C 5CD3B 4JPIB 4JFZL 3W0WE 4NYLB 4C55A 2FSEB 2VLLB 2E5EA 1KPVB 1IC5L 4U49A 3HNSH 4P46A 2P46B 4LVEA 1II4E 2W0FA 5HHOA 4PS4H 2NY2D 2NY6C 3IGAB 4M02A 5D9SB 4MD4A 2VQ1B 3QG6B 2QR0B 4UU9A 2C3VA 4XBEL 2JJVA 2GSIA 4P5TC 4QXTA 4Y4KB 1YEKH 4AENA 1F3DJ 3DVGB 1SVCP 1KN4L 2ORBH 3FB7A 1YNTA 1P7HL 1SHMA 4S1RL 4K3DL 1BZ9B 1UH2A 1LEKB 2HFEB 2H45A 3CFIC 2F54E 3RDTD 4OGYH 1NAMA 4BQ9A 2G5RA 4YX2L 1BEYL 5TDPB 3F62A 1CS6A 4MDIB 1H15A 5HY9B 3GMNB 5EU5B 1JN6B 3SPVA 5GIRB 4IIQC 3DMMD 4QHKJ 1IKFL 1KPUB 3KPSD 3KPQB 3UTQA 1YMMA 3FQWB 4ZAKB 3O3EB 3QDJB 2PR4L 4W4OC 2MSPA 3SY0B 4NKOB 1C16A 4UIMB 3SE8H 3P4NA 2ZUUA 4AM0B 3BPLC 1YMHA 1LE5A 1PSKH 4P99A 2R0WH 5EA0H 2J8OA 4QRSA 5GS0H 3VXMD 1MHPH 3RJDA 3V7AG 1IGCL 1VESA 3BRGC 3LH2L 4EVNB 5IVZA 3H9SB 1DQMH 1L0QA 4H25B 5FCUL 2QEJA 3SDYL 3G6DL 3L7FB 2LU7A 4FQLH 3CFKB 5EN2B 1XGQB 15C8H 3QCTH 4N9GB 5AZ2H 1F3DH 5FOBB 3DBXB 2X1PA 3O0RL 5DDHA 2OTUB 1M7DA 4NO5B 3WKNA 2IH3A 2R69L 1HYSC 3QIWC 3INUH 3IDXL 4G6AD 4KI5E 2Y1VA 3SGDH 3UJTL 5DUMH 4C83B 3HC0B 4OIIL 2CD0A 4HKZA 2LVCA 1T1WA 3PV6A 4K23L 3DSNA 3HZMB 4J7RA 4UILH 3DX6B 1JGVH 2OQJA 2YPKA 4XC3L 1YQVH 3QCUH 5IBUB 1Q94A 4EEEA 5CD5D 3G5YA 4JANB 3CUPA 4X5WB 1JI1A 4R4FL 2PUQT 43CAB 4RISH 2L0DA 2AK4E 3C2AL 1N59A 3MLYH 4IRZH 2IADB 4J6RL 1O5DT 4AEIL 1NCWH 2Z91B 3BEVA 1CYGA 4MD0A 2G5BA 1OSPH 5I8KH 4AL8H 1R5WB 1HXMA 1ES0A 4JM4L 1E6JL 4M61B 3D85A 5H94B 2UWEB 3VXQA 2OXHA 4C56E 4EN3D 4PV8B 1HIMH 2IAMC 1I8IA 2J4WL 1HHHA 3FT2A 1F3JB 3LEVH 3SDAD 4MLSA 1AP2A 1U92B 2YEZA 3DXAD 4RAVB 3VWKB 4PRIB 3V52H 1GZPA 3UPAA 3QXAB 5EUKB 5CJQH 3BVNB 3F7PC 3B2UC 3QJHA 3VRJA 1PZ5A 1GPOL 1U6AH 4QOKA 4NZRL 1FVDB 2RR3A 2AI0L 1IEBB 5DD1L 5CHNA 3IJHA 4LVHB 5IB2A 4QWWD 4ONGH 5KSAA 4HC1H 5T1KD 4IMLA 2XRAL 2SEBB 1AGDB 1FVEA 2X5PA 4GS7B 4U7SA 4RMVA 3QI9C 5EBGA 2YR3A 4LLMA 4LCIH 1UWXH 1TVHB 5DURB 4PY7B 3BGMB 4HIHB 1CXLA 4TSBL 4QRPB 5JHLH 3RZCB