3WKQA

Copper-containing nitrite reductase from geobacillus thermodenitrificans in complex with formate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
299
structure length
299
Chain Sequence
NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper-containing nitrite reductase from Geobacillus thermodenitrificans in complex with formate
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 102
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wkqA00
1ZDSA 2W88A 1ET8A 5I5JA 3TASA 1ZIAA 2PCFA 4JHUA 5I6PA 1XMEB 2H3XC 4DP1X 4YVNA 3TU6A 1JXFA 4KO6A 1OCCB 1W6WA 3NSFA 1GS7A 1ILUA 4GP4B 4HALA 1SFHA 2HRHA 2AANA 5F7BA 1BYPA 3JT2A 3NYKA 3AZUA 4KO7A 2E86A 1ASPA 2FQEA 4ZK8A 1PNCA 1WA0X 1OCOB 1AIZA 5PAZA 1V54B 4BDVA 2YXVA 2VMJA 4F2FA 2VW4A 1JZJA 2IH9A 1FWXA 2PP9A 2YAEA 3FU7A 1AZNA 1OF0A 1TU2A 2PLTA 5B7FA 2PPAA 4A2EA 1GS8A 3H4FA 3FT0A 1PZAA 3X1FA 2H47C 1HAUA 1AS8A 3NT0A 1AR1B 1VLXA 2WSDA 3OD3A 4YSTA 2AFNA 1KYAA 3BQVA 2B08A 4KOBA 5B7MA 4PAZA 2AVFA 5LDUA 4YSPA 3T6XA 4F7KA 2UX6A 2R7EA 4YVUA 1CUOA 1NIDA 1XB3A 3HB3B 3PLYA 2IDQA 4AKQA 3FQ1A 4K9JA 2XYBA 3GDCA 3NSYA 4GXFA 1NWPA 3QJTB 4PCYA 5I6LA 2J56A 4HIPA 3AG4B 2J5WA 4P5RA 3WG7B 4DP8X 4Q8BA 5I6KA 2EIMB 4A2FA 5B3SB 4M3HA 5B1BB 1PAZA 1PLAA 1AZRA 1QHQA 2P80A 3QJUB 2AZAA 2BZCA 3AG3B 4KO5A 2PPCA 2HXAA 2IAAC 2YAHA 1JZFA 3FU8A 3PAVA 4GYBA 3L45A 3FYEB 4DP4X 2ZONA 1A4AA 1KV7A 1ZV2A 4WKXA 3T6VA 3C75A 2PCYA 4CSPA 1BQKA 1NDTA 1WS7A 4A2GA 3NJHA 4E9QA 3WIAA 2PP8A 5AFAA 3T6ZA 2WO2B 2BP0A 2JFCA 4GP5B 1KGYE 1PY0A 2DYSB 1M9WA 3MX0B 1JVLA 5AZUA 4DPCX 1BQRA 4Q89A 3GXUB 1EHKB 2UXFA 1WA2X 2Q5BA 2YXWA 1L9QA 2J55A 1A8ZA 2XX1A 1PNDA 2XXFA 5I6OA 1F56A 1XB8A 2BWIA 4G70B 1A65A 2GI0A 4G71B 2FTAA 1GSKA 3FSZA 1W6LA 3S3DB 3ABKB 2H5UA 3X1BA 4YSQA 3FPXA 3V9CA 2ZOOA 4HHWA 3AW5A 1NIBA 2IWEA 4BDVB 1OCRB 3T9WA 3ASNB 4KOCA 4UF7C 2QT6A 4A68A 1CC3A 1V55B 5A7EA 3H56A 5PCYA 2I7OA 2ZXWB 1SFDA 2XVBA 4DP7X 3SBRA 3ZX1A 1M56B 3OMIB 3OQRA 1BEXA 5D4IA 2GB2A 5I5IA 2UX7A 2B3IA 5D4HA 3EF4A 2NRDA 2PP7A 2PPFA 4DP5X 2YQBA 5ANHA 1PLBA 1MZZA 3FQ2A 1JXDA 2FWLB 1RZQA 1TEGA 5I5MA 1E65A 2YAOA 4YSCA 1ZPUA 4YSRA 2UXTA 3CG8A 4N8UA 4FAAB 2GSMB 1RCYA 4QKTA 3IEAA 1KCBA 4ENZA 1IBZA 1OOWA 2FT7A 3FU7B 1E5ZA 1GW0A 1PCSA 3T71A 4M4RB 4NERA 3QJVB 4AI7A 1AG6A 3FYIB 1V10A 5B1AB 1JXGA 4KNTA 2DV6A 2Y69B 3KW7A 3AY2A 2XV2A 3ZBMA 3IE9A 3WI9A 6PAZA 1T5KA 7PCYA 4G72B 4E9VA 4KNUA 3FPYA 4N4YB 2YAPA 1J9RA 3ABLB 4EF3A 3SQRA 1ILSA 1XB6A 3QJSB 1FA4A 4E9SA 3H4HA 2HLEB 1QNIA 2P80D 3CVCA 2IDTA 2BP0B 1BXAA 1GY1A 1JZHA 2OCCB 5B1KA 3QPKA 1IBYA 3OMNB 8PAZA 1M57B 3NSDA 3NJJA 4P5SA 3CDZA 2EIJB 3N55A 1J5DA 1RZPA 1AAJA 1PLCA 2CAKA 2XLLA 3N2JA 4HHGA 1ASQA 3GYRA 1SDDA 3UABA 1OV8A 2CUAA 2A3TA 2CJ3A 4CSZA 1NPJA 2IH8A 4E9WA 4HCFA 2BP8A 2I85A 3MBWB 1E67A 2CCWA 3AG2B 1MG2C 4DPBX 2GC4C 1OE2A 2AZUA 2BO0A 4HZ1A 5B7EA 3KW8A 2Q9OA 1KBWA 1URIA 2XV0A 4GP8B 4TXVB 1N68A 1X9UA 2HZHA 4YSSA 1SNRA 2GIMA 2PPEA 9PCYA 5EHFA 3WKPA 3DKHA 3PAUA 2CBPA 4W9ZA 1MDAA 4RH4A 1AG0A 4YSDA 4BK5C 3DTUB 1JVOA 2IWFA 3CVBA 4E9XA 3WNIA 1BAWA 3RYMA 4DP9X 3NJGA 3NJKA 3S3BB 2OJ1A 2XV3A 2WO3B 4E9YA 1DZ0A 4HCIA 1CURA 2VSMB 1NIEA 1L9TA 2W8CA 1RKRA 1WAEA 4HAKA 1SF3A 3PXLA 2RACA 2R7EB 4JKNA 2IDSA 2YAQA 1MG3C 3NJFA 1AOZA 1IUZA 1KCWA 3NJNA 1GYCA 4AKOA 1L9SA 2N0MA 3UADA 6PCYA 1BYOA 3UACA 4WTQA 2EILB 1ET5A 3X1GA 1JERA 2UXVA 3FQYA 1OE3A 4YSUA 4YL4A 2FNWA 1YLBB 4A2HA 3CZUB 1AS6A 3TBCA 1NIAA 2UXGA 1PF3A 3EH3B 1BXVA 1TEFA 3FSWA 2DWTA 1J5CA 2J57A 3CVDA 2VM3A 2MTAA 3WKQA 4NAJA 1X9RA 2QDWA 2VW6A 2Y1AA 4G7RB 4E9TA 2FT8A 2QPEB 5TK2A 2BW5A 2YARA 2DYRB 1TKWA 3ZDWA 1PZCA 2QPDB 3TA4D 4BWTA 1W8EA 4BWWA 1A4CA 1AANA 3ABGA 3X1NA 4YSEA 1CYWA 3FS9A 4G7SB 1AQ8A 4DP2X 4A67A 1WS8A 3EH5B 1NWOA 4X4KA 2HX9A 2YAMA 1SHXA 2TSAA 1JZIA 2JXMA 1BQ5A 2XX0A 1OE1A 2IDUA 1BXUA 1GS6X 1NIFA 1ET7A 1FFTB 2FJSA 1B3IA 3IN2A 2FQDA 1HAWA 4A2DA 5IY5B 1NINA 4NB7A 2PPDA 2BP8B 2XU9A 3G5WA 2X87A 4E9RA 5F7AA 2OV0A 2XWZA 1AACA 3X2QB 4BWUA 3EH4B 1KDJA 1MZYA 5E9NA 1DYZA 1ZIBA 2BZ7A 1AS7A 1QLEB 3JTBA 4W1TA 2DWSA 3ASOB 1L9PA 5I28A 3OM3B 3QJRB 3PCYA 4L0PB 3UAAA 4QLWA 2BHFA 3NJMA 3NSCA 2FQFA 2ZWNA 1ETJA 3CDZB 1PMYA 4G7QB 1GY2A 2TSBA 3BVDB 7PAZA 2HX7A 2VSKB 2YAFA 4YSOA 1ZDQA 3SBPA 5D4JA 5I6NA 3FSVA 2CALA 3DIVA 4AZUA 5TK4A 1NZRA 3ABMB 1JOIA 1J9SA 1CYXA 3UGEA 2MRYA 1ID2A 1N70A 4F2EA 3U25A 1J9QA 4YSAA 2X88A 2HX8A 2FT6A 3ZIYA 2HRGA 1UATA 3UAEA 3SBQA 2XUWA 4DPAX 4FA7B 2GHZA 3QJQB 1SF5A 4KO9A 1E5YA 3PPSA 2GC7C 1IC0A 2VW7A 5I26A 2LLNA 4A66A 3HEIB 1NTDA 2BW4A 1KDIA 1NPNA 3S8GB 2JKWA 3FU9A 4KNSA 2EIKB 3FSAA 1JZEA 4AKPA 3QQXA 5AKRA 4HCGA 1L9OA 1KBVA 1SHWA 1SJMA 1AZCA 3PAZA 2DY2A 2EINB 4JHVA 2FQGA 5FC9A 5B1JC 4UANA 2VN3A 1I53A 3WNJA 3X1EA 4DP0X 1R1CA 3TBBA 2XXGA 1SDDB 3NP4A 1AZUA 1NICA 1OCZB 3D12B 5I6MA 3NJIA 1AZBA 3NJLA 1HFUA 3IN0A 3OMAB 3EHBB 1GR7A 3ERXA 3AG1B 1JZGA 2QDVA 3NP3A 4BXVA 1J9TA 1E30A 5B1JA 3S8FB 3T6WA 4MFHA 1L9RA 3S3CB 1WA1X 2IDFA 2GBAA 1ASOA 1ADWA 1A3ZA 2IWKA 3V9EA 4BXSV 1PZBA 4DP6X 4AX3A 3IBOA 2BWDA 1IKOP 1EZLA 4UAHA 1A4BA 4GY4A 2I7SA 2VM4A
chains in the Genus database with same CATH superfamily
5CIPH 4YR6B 2QQNL 3LXAA 4P9MH 4KV5F 3UP6A 2H0EA 3WY4A 2APBA 4S1QH 3SPJA 5MEPB 4QRPB 2DMCA 3U9UB 3ZHNA 5BRPA 3F00A 3SD2A 1TPXC 4Y89A 4N1HB 4DP1X 3H1ZA 4FMKA 1J1XH 2D9CA 3RQ3A 4HJ0D 4YVNA 3T8MA 3UC2A 3DUUB 4ETYA 4ZFFA 5A6IA 5KAQF 1KWKA 3DOIA 3SE4C 2K78A 1UFGA 3MA9H 1I3VA 1A9EB 1PGRB 3QZLA 1U8CB 2XBZA 3KS0H 4WO4C 4HS3A 5I1DA 1ZT1A 1AR1C 1EHAA 1A4JB 2IQAB 4CC0A 4KY2A 1JWSA 4HGMA 4YGVB 4U31A 1OCWL 2AXGA 1I8KB 1VAHA 2VMJA 1MNUH 2HLFD 2WINB 4NBYB 1JZJA 3VXRE 1T1WB 2F53D 4LP4A 2O5YL 3VYOA 2D4FA 3GJEA 4XB3A 4AXWA 1CXIA 4TVUA 3TBYB 2IV9A 3IDUA 4GINA 2A2QT 1ZS8B 4OZHB 2B4CL 2E8ZA 1T4WA 4HWEL 4L3CB 1QSFB 2Q7YA 1UD5A 3VG0H 3ORJA 2F7OA 3HCVA 1USZA 3BAEH 2FD6L 4JRFA 4R5VA 3SCMD 3JWDL 3P4OA 1I7RB 4AJVA 3GNMH 1S7XB 3F7PC 2DIAA 3L3KB 4BUHA 4KUZL 4L8BB 4MDIB 2FH8A 5C7XH 4PAZA 4Y5VB 1SLUA 2DEWX 3DX9B 4YSPA 4ENED 3LIZA 4OD1H 4KKLD 3T6XA 4L8CB 4OKVA 4PGDA 3GWJA 5HDQH 2R7EA 2VDMH 2VDRB 3T04D 5B39G 1IILE 4L18A 1YVLA 4X5WB 4R4BA 1WBXA 2X6BA 5C09D 5K39B 4MAYA 3NQIA 3FUHA 1T6VN 2AKRB 4AYGA 4I3GA 5TDNA 3ETTA 1NCBL 2YZ1A 1ZHNB 4DIXA 1HHHB 4M8RA 3ARQA 4FFYL 4Y4HC 1XF2B 4M3HA 4GRWB 3RWDA 3K0YA 3BVUA 2XIIA 1AGDA 5EU6D 1QD0A 1QHQA 3S7GA 1UXSA 2F54D 2DDQH 3AG3B 1EK3A 1CLVA 2J2ZB 4PREB 4Y1TA 1MHPL 3O8XA 1E27A 1IGYA 5D2NA 4ZQTA 1BWWA 2VZ3A 4U3XA 3JVGA 4DGWC 1JFHA 3HMWL 4PJBB 4B0MM 4KBPA 3NIDE 1ZHKB 3KLLA 3OR6A 1A4AA 1OSPL 1Z32X 1RHHB 4XGZA 4AJWA 2BDNH 3PNWB 5AOLA 1CDJA 2I5YL 4AYFA 2PP8A 5J56B 3CFDA 2FAUA 1ZHBB 2CIKB 3PWPA 5HJDA 4GEJA 1JF6A 4JFXA 5E1AB 1B4LA 3QR1A 2XTJB 4ZS7L 2B1AL 4H44C 4NX0A 4Q89A 1WG3A 4Q4IA 4ZMPA 2UXFA 5SWZD 1KLGA 4DGYH 7TAAA 2DH2A 2WLHA 1CS6A 3AT0A 4JPIA 4A7TA 3DETC 4Y16A 2XXFA 1BX2A 3BKCH 3PHQA 1F56A 2BWIA 4WUUD 4K9EH 4M1DL 3IGLA 2QGBA 3PUCA 3S36H 4CVZB 3C08H 3HNSL 5H37H 2XTJC 1AQKL 1TOXA 4HHWA 4OLZH 4TVPE 1QUPA 3KGUA 1SBSL 5IMOA 2YOCA 1HX0A 1G7QA 1UB6A 4PJFB 1N8ZB 2UUDH 3TM6A 5CJXA 2X4OA 4OF6A 4J28A 5I1EL 4WFFE 4FQJH 1B6DA 4EN3C 3VQLA 1DQLH 1S3KH 4QOKB 2RBLA 2WHVA 4LKCB 1HL5A 2F08A 3KPNB 5DI8B 2HFGH 4UTAH 1ML0A 4ZAKC 3LNHA 2H26B 3MJ8A 4QAMB 3DRQA 4R2GB 4DP5X 4QT5A 5FV1L 3PRZA 5C0CD 2CA4A 1OT2A 5BO1H 4J4PA 2YUZA 5E6IA 4JO5A 5FYLL 1T1XB 1SYVB 1ZPUA 4WI2A 4PJIF 5L2KE 1HK6A 5TTRA 3F5WB 5I71B 4QO1B 2RHEA 4AEIH 3GMNA 1B2WL 4GAJH 4LCYA 4RSYA 4FI6A 3T0BA 5EU5B 4RZCA 5DMGD 1GW0A 2UY6A 3JV6B 1GA2A 3U79A 3BKMH 2CK2A 4MD0B 3RWFB 5GRJH 1RZGA 1JK9A 3IWUA 2NXYB 4RBPK 4X5QA 4YEEA 4Q9QL 3VFOB 1Q1JL 3HZKA 5HGAA 4MYWB 4CGTA 3ILQC 1NFKA 3UZEA 4MGXA 3MJ9H 4PVNA 4XO9A 5IB2B 2V8LA 3REWA 4EVNA 3SO5A 4HWEH 1T0NB 2Y72A 3OKNB 2CUHA 4TS6A 1DJHA 2BY3A 1JS4A 1OAQH 3ZOAA 4YZFE 4EF3A 5LNDA 1B2YA 3MA9L 4N8VB 3ATDA 3N0AA 2VE6A 1BZOA 5JHMA 3OAYH 1BXAA 2X1PA 5LHDA 5CGYD 2NXYC 5KANI 3QPKA 1IBYA 2G9HA 5FKAB 5TJWK 4HS8L 4CN1A 1TZHA 1PZ3A 3QPXH 4FHJA 2OMBA 3I74A 3HAEB 4XPBH 2GK0B 2WZ0A 4JHAH 4KXDA 2EACA 3I6KB 3TV3H 4DETA 5C9KA 2Q10A 4YPJA 4R4FH 4XCEB 3VXTA 2XG4B 4HF5H 1J5HA 5TPWL 1OV8A 3GKWH 2A3TA 2CJ3A 4YQXH 4PY7A 4H2AA 2WB1A 2AKRA 4MA8L 4XHJD 2CQVA 4JDEA 1H8LA 4NKMB 3TV8A 4U0RC 1ACXA 4TYUA 5E6UB 2K3TA 2ZCKH 1NEZA 1E28A 2OJZH 5CKAA 4RMQA 4DEPB 4HJGB 2DM3A 3AVEA 3TBTB 2PTTA 3L3GB 2SEBB 4W9ZA 3QQ9C 2TRYA 4Y8DC 4LASH 5L4JA 1WAAF 2K4AA 3SDXE 2KDGA 1NDGA 5D5MA 4FQHA 4HYTB 3UTTD 2CHZA 1RFDL 4UT9A 2WXHA 2NTFB 4CKVX 3GB7A 1BG1A 2MFNA 3MI6A 1VA9A 3F64A 1Y6NR 1DQVA 2H32A 3T77A 1A6WL 2CKBA 3D2UA 3W39A 4CSTA 4TLKA 4NNXB 3HMXL 2QMJA 1ETZB 4G6KL 5CSZA 2GHWB 4XNAA 5E94B 1UXWA 2YD1A 4WTQA 1C16B 4Y4FA 5KSVA 1EDQA 1ZA6A 1YEIL 4JFTA 4OFIA 4OF8A 2BERA 3AC0A 2KLRA 1AS6A 5BRZE 4LCIH 2XXCB 2ZSWB 3QEQA 3VFNA 1JMZA 1DJYA 1QBAA 1IEAB 4OZ4A 5JLZA 4OFPA 1KN2H 1LNUB 4FLRA 4G8FA 2BC4A 4JHBA 5HBBA 4ZW6A 4OJAA 2VDNL 1NKRA 2DM4A 2H6PA 4TRPL 5A2LH 1X5JA 3H9SB 4EI0A 3CMGA 1OZTG 4QRQB 4O2CA 5H37A 2FHCA 4JO2L 4OCXL 3SY0A 3BFQG 3O2WH 4I9WE 3V6OC 3NRFA 2FE0A 2H3NB 5FO7B 4I77L 1JTTA 3RWCB 4ATTA 4KQ4H 1OGAD 2Q6WA 1GKOA 1TR7A 1F13A 2FUQA 4HBQA 4PJ8D 5F2FA 3IGAA 1V7ML 4ELDA 4UQ9A 4PJ5D 4GSQA 4JFPA 5I1AB 4ES9A 5JQIB 4Q9CA 3UBGA 1J86A 4MNQA 4NQEE 5F9WB 5MI0C 1ZWIB 5DMGC 4XP6H 3D25A 5HJBA 2QTEA 4YDVB 1AFVL 1YECH 3O4OC 2FX8L 3ZE2E 2AJVL 2HFGL 3A6BH 4UTAL 4C4BA 2DBLH 1VPOH 4PJDF 1BM7A 4DEUA 2V9QA 5CO1A 5ABAA 1H5BC 3DXAE 2Z34A 5D1XA 5GPRA 1N6QH 1IEBB 5F6IB 4DO6A 3EH4B 3QQ4A 4YHZL 2WBWB 4XPFL 3INOA 1KGXA 2VR3A 4L4VB 3FNKA 3QH3A 1RPKA 4AQ8C 3O4OB 3VXMB 5IV2B 3EO9H 3DRQB 1HJCA 4JQXA 3UTSA 3B7TA 3WFEL 3NJMA 1N0LB 2Q3XA 2LAGB 1H5BB 4M4PA 4UQ2A 6FABH 4XWOC 3T3MF 3RNQB 4D3CH 4N9GA 1ZDQA 2D73A 3I75A 3SPIA 2YRPA 3FSVA 4HWNA 5JUEL 4GH7B 5IBLC 4YAQB 4YPGB 3QUMB 3P3RA 5D8JL 1YEHL 3UGEA 1ID2A 1N70A 2XICA 5I6XB 4U1GC 3ULVE 2WINA 3ZSSA 1OTSC 3S4SA 1F3DJ 2ADIB 5FM5M 1ZLSL 5CJ8A 3UBFA 2J3SA 1MCWW 4QTFA 4I5BB 3GSOB 1E5YA 1S9WB 5I1LA 2V3DA 5E5MA 3HZMA 4KKLC 3ECBB 4LVHB 4AM0B 1W80A 2ZWKA 1WFUA 3UPCA 4EVNB 2EXTA 2DS4A 3FQUB 5BJTA 4E0RB 5IQ7L 1QLRB 1FRGH 3BI9X 3OBAA 3BO8B 1EFXB 4L4TA 1G6RB 4OH2A 4V2CB 2E6QA 1YPZE 3O2DA 4UUJA 3N85L 2EIKB 5FA3B 2AJUL 2DMGA 1UACL 5ITBH 3DK0A 4BQ9A 2FRGP 1N9PA 4PJIB 1L9OA 3GS7A 2VLLB 4GI6A 1FZMA 3ROLB 2XZAH 4ODTL 5A16A 4XVUC 4KMTH 4HK3J 1SHSA 3VFVA 3KNBB 2AK1H 5AZ2H 2OJZL 4U0QB 3V4LA 3WXWH 5HYFA 5I1KL 2D2CC 5MEND 1JZDC 4P05A 2AK4A 4LHUD 3S3CB 4URKA 2WKOF 4HZLB 2GIYA 3DX3A 4X83A 1XH3B 4G6MH 3VAEA 5ESAB 2NDFA 1OM3H 5JZ7D 2V7NB 4TSBH 1A3ZA 3HC4L 2F9BT 3ECWA 1I1AA 4DCQA 1HU8A 4WWKC 3RE0A 3CFBB 4M1GL 2EQDA 3BUYB 4JO2H 3N42B 2CGRH 4GY4A 4HXAL 4YBHA 2VM4A 3KWXA 4QTHA 4BH8A 2Q87A 5CBAA 3ULVL 5AG9A 1PKQA 1CTNA 2DLFH 3M86A 4L2LA 4AV0A 1OWRM 1Y18B 3ARFB 2PCFA 1B9KA 5BRZD 5HHVL 3IGAB 2RA1A 4OZIF 3BRFA 3BP5B 1LJMA 4Y5XA 1GS7A 5D6DA 2KI6A 3VD5A 4GSDH 4PRNA 1SY6L 1IAKA 3U4AA 1UM4L 4XP6L 4ONHA 3T2NH 5C8JA 3WMQA 1UEMA 5I18H 3NK4A 5D96C 3SKNA 3NG5A 5D7SL 2Y5TA 4WGVB 2XBTA 5D6CB 2Y25A 1U41A 4PJ5E 2VW4A 1YNLL 3FH7A 1ZLUH 1NCOA 2AEPL 4FXLA 4NZTH 5TDOB 1RZ7H 2DLHA 2OMUA 4G5AA 5F89A 3LRMA 2Z7YA 1PZAA 4YDZA 5C07B 4GB9A 1NFDF 4GW4A 2WWMC 3O6MH 2NX5E 3IDJA 1YAZA 4HWBH 3HUJE 1B0RB 3ECVA 2A73B 3D9AL 5KEZA 3FU6A 5I8KH 5B7MA 4Y2DB 3KWVA 5CEYA 1I8MA 1G7LB 5K9JL 1J5IA 3QIBB 5KUKA 4OY9A 2W0FB 4QEGA 2C9AA 3EBGA 2A77L 1NAMB 3J2PA 2WGNB 4BIKA 4P9HC 3L5XL 5FGSA 43CAA 4CMMA 4JFXB 3QZWG 1XR8B 3AG4B 3INUL 2QR0B 5GZOA 1A4KA 5EZLB 5AVWB 3UEQA 4YZWA 4KVCL 3N0PB 4D0CB 5B3SB 5H37G 5TGBB 3F85A 4UILH 1CFQA 1FL3A 5F1NA 2EXSA 2H7WA 2PPCA 2WCGA 3ECBA 4QGTA 5JPNC 2QGCA 1S7TA 5DUPL 4NI6A 5F96H 1SLWA 5DEFB 4AQ1B 2EUZA 2PCYA 2P5WD 1TVBB 3ZE0B 4WK2B 1IX2A 1TPXB 4E9QA 5CLYA 2E46A 3QAQA 3L17A 3GSWB 2F19H 3MOAH 2YK1H 3KPSD 2Y1VA 2GK0A 2DYSB 1TJHH 3OKOB 3G6JB 2NZIA 2DTML 3E6HB 1UT9A 2BFGA 4J3BA 4QXGL 5JPNB 5HJ3A 2HUHA 4EIZC 1XD1A 1UOVA 4FNUA 3GXNA 2VLJE 4P3CH 4Q4EA 3O45A 3QDME 1FG9C 3VMOA 1FLRH 1OQXA 1BM3L 5HD8C 3EJSA 3VGEA 3B5HA 5I1JL 3IPFA 3SDAA 2VISA 4AZ8B 3RVTD 2AQSA 1T66C 3TN0A 2XWJA 3RWJA 5DK0A 1QA9B 3RILA 3HS8A 1DVXA 3L1FA 3U36A 5MHSE 4HUXA 1HESA 3IF1A 3TS8A 3HC4H 5LG6A 1JK8A 2XACC 2ZF9A 4YDLB 3OSKA 2X3AA 2YRZA 2AEIT 4EQ2A 1C1EH 2VQ1B 3RB5A 3BVVA 2XN9D 1RERA 1MFDL 2XYCA 1CICB 3L4WA 5CJOH 4JFFA 3WS3A 4F8TA 1DDHA 2FJUB 4R97C 3EDDA 3G7TA 3LIZL 5HHNA 1RHFA 3MOBH 4RDQF 3ZN6A 2NRDA 3CXDH 4XODA 2G5RA 2UV3A 4P2QB 4U3SB 2X4QA 1RLBA 1YPZF 2V3FA 4JQVC 4UM9A 1JUFB 2ZCHH 3LPWA 5BUAA 1O9WA 2FWLB 2A74A 3V5KB 3MRGB 1XIWA 2JJSA 4LSVL 1E6JH 2WZPD 3CG8A 4N8UA 2VLKD 2VRKA 5IWLA 4NUQA 4HV8A 2J73A 1OSEA 1SDAB 1IBZA 4ZNCD 2YFNA 5B39B 3UTSE 2AXHA 3G5XA 1HI6A 1XBRA 4W6YB 4P2RD 2OXGB 1SZNA 5B1AB 3DDGA 5GGSB 1UWGL 5IMLA 3NFPB 3KW7A 3VSUA 1MW2A 1F11A 4RNRA 4V11A 1ID5I 4F9PC 4H40A 5EO1B 3ZMNA 1TLMA 5BUPA 5DK2A 5CUSL 2ADYA 1AOHA 3BEWA 4O58H 1FA4A 2WB7A 1KPVA 3LNGA 2Q76A 3H55A 2Y07L 4MMYB 2MTPA 4E41E 2DQHH 4KK8C 4PJ9B 4LT7A 5I2IB 1YHPA 5KVDH 5SWQA 2D8KA 3F2LA 1MFBH 4AUUA 2I24N 4NQEA 5D7JC 2P45B 3EFDH 4AIEA 4NQCD 4YHLL 5I66A 3N2JA 2J6EL 4R4ND 3QUZC 3TA3B 2JK5B 1RUAL 2GG1A 1RZKH 2WXIA 5DD0L 1ESOA 2R8SL 1KG0B 2IPTH 3KGTA 5DWPA 2YPVA 4ZUSB 3V4PH 5IHZB 4JKPL 1TJIH 1CL7I 3AXHA 2BP8A 3KGRA 4NO3B 4NI3A 2JKTM 1T6BX 2XRAH 1OTSD 2OMZA 1URLA 2EEXA 4FYSA 3OG4B 5D7JB 2VC2B 3QUMH 3ZL4L 1FGNH 2YZ8A 4OT1H 5JHLA 1FQ9C 2AI0H 4H1LG 3SKMB 1ZE3C 2AF2A 3D39E 3TCTA 3O6FA 3MGTA 4G80A 5D71L 4NBZB 3MRBB 4R2GC 2R15A 1CT8B 3L4XA 3MRIB 4QHPA 3V5DB 5MEPA 2GTZA 3IJEB 3GSQA 1WFJA 1Y7VA 1CZ8H 4LP5A 4WW2C 2WD0A 2HT2C 2NSQA 4K94L 1FP5A 4WCYL 3X13A 1YEFL 1KNOA 1OAZH 3NZHH 1O6TA 1PFOA 4HIJB 3IFLL 5JOFA 1L9TA 4OCNC 1UD2A 1JF1B 1U8IB 2RACA 2QVMA 2B15A 3L8QA 4JFYB 5CMAB 5I71C 4UIMA 1N10A 2WQRA 3B4NA 4BFKA 2DJMA 1MVUB 4F8OA 2V5MA 3QZWA 5AB2A 2N0MA 4AEEA 4KZEH 2D3NA 1K6QH 2A7BA 1F1AA 2C5DC 2XNAA 3RHWF 1E9PA 1RZJH 4D0CA 4GKOA 4M8UA 4OGAC 5L6YL 2Z65C 3PQYB 1NFDE 3FSWA 2BHZA 4OVUA 4WKZB 3WFBL 3PUUA 3MJ7A 4C56A 5IB2A 4AH2B 1JSYA 1LEKB 3B7UX 4YDVA 1YPZA 3APMA 4IOIB 1Z3GL 4WWID 4FZ8L 3UTZB 3EAKA 3ZL1A 3QHZH 3UBHA 1B6UA 4Y5VA 1HH9B 3MJWA 4P46A 1GGUA 3FT3B 1SXBA 3MOBL 4PLKC 5JHAA 4HUNB 4XMLH 3PDDA 1MRCL 4KQ3L 3DO4A 2G30A 4M61A 5BOZG 5KYXB 3KPRB 2WXGA 4OW6A 3FJTA 1CYWA 1N7ML 3GBNH 1Q9KA 2OS7A 1A6TA 1K8IB 4LSSH 4HFUL 4M6NL 4XMWA 5IV2A 5TH2A 4FXGB 4N8PA 4A7SA 5IFHH 1YZZA 4PJHB 5DD1L 1IIKA 1SXAA 5HYIA 3RTQB 4KROD 1ZSDB 2BPBA 2TSAA 5D7KE 5E2TL 4Z18A 3E8UL 3THMH 3QAZC 4HSQA 4ZNEA 1DVUA 2CLRB 1R47A 4P23D 5FS5A 4BGLA 2YN3A 1ZT4A 2PYEB 1GSMA 2W0KA 3BN9D 5TF1L 2XZAL 4ODTH 1U8CA 3KEDA 4FFVD 4P2QE 4AY0A 5TE4H 2EXWD 2ZWLT 3PWVA 2APFA 1I1YA 2XWTB 1UB5A 3G5WA 4OJCA 1AQDA 2X6CA 5I16A 5IGXH 1GRWA 4BWUA 2DLEA 1PAMA 1WGVA 3K80A 4PW9A 4IU3B 1ZIBA 5IVXA 3UGXA 2XPYA 5HVFB 3AT9A 3QAZB 3A4AA 4OCRL 4B5EA 4MNQD 3ULVF 2FYYA 4MMXB 4Z77B 3NSCA 1HN1A 1A3LH 1W72A 1PX8A 2N3JA 3QC6X 4JPIB 4BA8A 1UXMA 2JKSA 3NIGF 5FYKE 4KI5D 1S6NA 2HKFL 4K7PL 3SBPA 1NCJA 1AI1L 5TK4A 4H1LA 3ECQA 5JIHA 1B0IA 1BQLH 2CZNA 3KDMB 4Y4HA 1FO0L 5EUKA 2XXMB 4HXAH 4BFEA 3KE0A 1JNLH 4KX7A 2A9CA 5FM5O 4YSAA 4FG0A 1NCDL 1BZ7A 1BZ9B 3IDMA 3QULA 1RULH 3HBGA 1Q0EA 4L1DA 4PJDE 4DUWA 5BVJB 2YLKA 5IUCA 4PLJD 4PJ5B 4JZOA 1SF5A 2KBGA 2Q20A 3AY4A 2ZYSA 3ZL4H 4PEEA 1WCBB 4F7TB 3NSJA 5IK3B 4POZC 4BFOA 2OMTB 5IWLC 2BIIA 2LLNA 5A6MA 1JZ8A 3UTQA 4HQQL 2O93L 3FHQA 2UZIL 1HSBA 3L3DB 1DLHB 1EO7A 1AH1A 1YEKH 3T8XA 3KLQA 1LEGA 4XNXL 3FT2A 2NNAA 5JPMA 2F2HA 3MRMB 4BHUI 2W59A 2L7QA 5T8IA 4IYKA 3MNWB 5T1LD 5IBTL 4PTTA 3CFBA 1YUHA 2DY2A 1GZPB 1BFVH 3WNJA 4OQTA 3X1EA 5BO1L 1CLYL 4OLXL 3BWZA 4OM0L 1HSAB 1S9YA 1W8NA 1DBBL 1FC2D 3JUYA 4L1BA 4B50A 1JGUH 2CK0H 4MAZA 4W6WB 4YLQT 2OZ4L 3ES6A 3NJIA 1YO4A 4X6CE 4XP5L 1D5BB 5FIEA 2N1KA 1Q9OB 1FG2B 5D7HA 1IC4L 1J0YA 4BSWA 4HISA 5K9JH 4MTMA 5K1VA 1X5MA 1OIOA 3D2UD 3SGDH 1IEBA 2A9AA 4LQ1A 3LXCA 2CO6A 1IGTB 2WLNA 3A6OA 3MJ6A 5F9OL 1IAIM 1PZBA 2X42A 2P4AB 1G6RH 5J6GA 2C3VB 2X70B 4LGSB 2FO1A 1BD2D 1E8ZA 2DMKA 3C60D 3ZRSA 4KXZI 2JTYA 4LAQL 1P84J 2VR5A 4OCSL 3GLZA 1M3IA 5JDSB 1F02I 1RP9A 2BNUA 2D0FA 1EHLL 2FVNA 3W9DB 5KN5B 3FTWA 3F12A 3EO0A 4B27A 3Q2VA 5FOBA 1JZ3A 4U1LA 5SX4H 3O9WB 2HYMA 5BOPA 1MCJA 1G4RA 4U1GB 3IFOA 4H25B 1EANA 1NUNB 1PY9A 3CZFB 4JKLA 4GP4B 4WEBL 5E6ZA 5IFHL 4HIHA 5DUMH 5I73C 2MCPL 4LEXL 1E4WH 2FCBA 1LO4H 5F7BA 2E9JA 3RVWC 4M6OL 2E59A 1ZVNA 2DLIA 3R8BB 2YQ2A 2FQEA 5SWZA 5EZOH 4WUUE 4Z0XA 1PCXA 5D1QA 3ZE2B 3ZUCA 2DTMH 3F3HA 2WWKT 3DXAB 5GS1C 5BZXA 2IH9A 3O9WC 3HZMB 1DJXA 3O2VH 3S0PA 1TU2A 3CZEA 2MHAA 1O7DE 3LH2H 4TVPD 2DM7A 1T1WA 3JZYA 4ABQA 5I73B 2NW3B 3G5ZA 3NT0A 4CA4A 3W5MA 4ZNEE 4W70A 1VLXA 5E8PB 2W60A 3OKEB 5J1AA 5I24A 1SOKA 1Z1WA 1D5ZB 4M00A 3PHOB 1IAII 3BZEB 5GS1B 4G9FD 4J8RA 1MCRA 1RURL 4X8XA 3KYOA 4QRRA 3HVNA 4F7KA 1DSFH 1MLCA 5C08A 3VXPB 3NZUA 5KVFL 3GTVA 1T7XA 3BMWA 2ID5A 2IALA 2IO5A 3RA7H 3KDPB 5CBEA 5D2NC 4JN1H 4Q9RL 1SJEB 3BFOA 1U92B 1W72H 3MX0A 4WI8A 4R7DA 1CFNA 1J8KA 2AITA 2OLDA 4JJ5A 1IM9B 5IW6A 5IZ7A 3KNBA 1CGTA 5T33H 3G08A 4Q8BA 2ZXCA 2YWZA 2KT6A 4PB0L 5B1BB 1U8OA 4XBPA 4QHKI 3VO0A 4BZYA 4DFHA 3HHSB 3A4DA 5JHDA 1ZVYA 1GYUA 4LDOB 2YD7A 2YAHA 2EYRA 1J0JA 4K7PY 1JZ6A 4MDJA 3LQZA 4GYBA 4R7NA 1FV1B 5D2NB 3D87B 5IBUG 1MNUL 4U6XA 3C75A 3JQOB 2AV1A 2CPUA 5JOPD 4JLRA 3OKKB 3WIAA 1CXKA 1HNFA 1CD1B 3MRJB 4XGZB 2WO2B 4XO8A 3VUAA 3VXNA 4GP5B 4L8DA 4RAUA 4HK0A 1KPUA 4H8WL 2CIIA 3TX4A 5GGRB 3HNVH 2D7QA 3SGJC 1SY6A 1DBJH 4U7MA 4N2NA 4OTXH 2VR6A 2J20A 5F7MC 5EUOE 4CDGC 2Z8VC 2UWEA 4OCYL 2RFXB 3MC0A 4UQ3B 5E6YA 2FSDA 3L6FA 2VZSA 4OSUH 4GIAA 3UAJD 2N59A 4WRLA 3W0WB 4MA3B 4G71B 2M26A 1UKTA 4U05A 5IB1B 3M1OA 4GBXA 5EEVA 5JQ6L 5FYJD 3KAAA 1EH9A 4G8GD 3QUKB 2HPOA 1MPAL 2IXQB 2UUDK 2ZOOA 2AXJA 3AW5A 3OQ3B 3QQ4B 4RDQG 5JORA 2E9IA 3LN5A 3LNDA 3B9KD 5K9KA 3GI9H 2X4PA 3V6OA 1NC4B 3ZDZF 4ODUA 1E3FA 3MLVH 4MXWH 3AB0B 4DP7X 4N8VG 3UL4A 2PR4L 1T5XB 5FF6B 3ZX1A 3HBZA 3V4UH 1WZKA 3A23A 4NXKA 1NGWB 2VAAB 4PG9A 1UEYA 2DWEB 4YH6A 2UX7A 1D5XB 3QIBC 4P3DB 5HI3C 5DJ2A 4LPTA 2PYFB 3DURB 4FG4A 4IW4C 2FATH 1I82A 5DEGB 2H4EA 1I1RA 4G6JH 1NM4A 3L9EA 1E4XI 2BSDA 2CXKA 2QHRL 3EJQA 1NGYB 3CCHB 3KHOA 3FBKA 4QXWA 2ZOWA 2AXGB 2P42B 2D2OA 2J43A 3PHSA 4XN7A 5E08H 1A4KB 1QKZH 2HFTA 1VFAA 5DR5L 1X5YA 3VGFA 2K7PA 1S46A 2D3JA 2JCCE 1PCSA 2CKNA 4MJ6A 2WNKA 3ARUA 4AI7A 2XSKA 1UWGH 2IGLA 2AV7A 3OAZH 4ZMVA 3GSRB 4JDTH 1ZLUK 5GISL 3H3PL 1UKSA 3EO9L 1PX3A 5BS0B 2Z8RA 3IE9A 1T5KA 2OR9L 1FZJB 3KPOB 4U7SA 4AQ1A 4AYSA 4U4IA 2O1AA 1NH6A 2VABB 35C8L 2JJUA 2JKIS 5KTEH 4K71B 1JHTB 4PI2A 2K70A 3Q5TA 1WHOA 3UX9B 4FABH 2R39A 3UPRB 4ZTOL 2R29L 5HYJB 5KAQG 1HHKB 2Z93A 3TZVB 3BUPA 3QDGD 4GSRA 3IJ7A 3RUGA 3D4CA 3C08L 3D4ZA 3HNSH 5F9AC 3C5ZB 4OF5A 1DVTA 2VQ4A 3GSNH 2PW1B 4MA1B 2P46B 2XLLA 4P48A 1AGCB 3STLA 1SDDA 2Z0BA 4DZ8A 1UQSB 3BKCL 3VVVA 3TWCH 1DN2A 4JG0L 2XT1B 2FIKB 4I89A 4WHYG 2C34A 3HUJA 3U7YH 4XCNB 1A7RH 1WJ3A 1AQDB 1MG2C 4LRNH 1QI3A 3SDDD 4DN3H 3ARYA 4CJ1A 4LSSL 2CO2A 3FH5A 1KBWA 4UMGA 4OGXL 3NCJH 1ZEAH 4YXLH 1CICC 3BUYA 2K0RA 3HG1B 2YSSA 1M6OA 2VB5A 1VDGA 3N43F 3THML 3CZLA 3ARFD 2CBPA 3BKML 5ANME 5DYOB 1MDAA 2VTFA 3FU0A 3KR3L 5FGCB 1F4AA 1Y18A 3ARFA 2CMRH 4YSDA 4BK5C 3RGVC 5JNYA 3HG5A 1F8TL 5I76A 1BQHG 5DDHA 3DV4A 2H8PA 3DYOA 4GQZA 4XZUB 5I1GL 3NJKA 1NGQL 2ZXEB 3DROB 3EYFB 2ZSVA 4IS6A 2NQ3A 3CNKA 4Z7VF 4ELKA 3DOSA 3R1GH 4NXSA 4Y4FC 2HFEB 3CHOA 2X89A 3BYYA 4FGMA 1MCFA 2ZUWA 5GJSL 1Q38A 2GW5A 5C0AE 1MG3C 1AD9B 3B2UC 3TYFB 1KSRA 3O3AB 1HQRA 2ZKHL 1KCWA 1C12A 4OGZA 2XWEA 3RGVB 1LK2B 2JQMA 4LHUG 4X6CF 1SJHA 2EDFA 2GABA 2YRLA 1G7PB 3K6FA 4LDEB 2AGJH 3SYQA 1FE8H 1EHXA 4XCCH 1WLHA 1NKOA 2RCSH 5LAXA 2DKMA 3F58H 3SJVB 3EO1B 1CIUA 4WU7A 3M45A 3L4CA 4AVJA 3UIZA 2I9LB 3ILEA 5GGRY 5FK9A 2VDQB 4RNRB 1J5CA 1R19A 1J8HA 1RPUA 3OL2A 2ICWJ 2DI7A 3DA0A 3E2HC 5FCUH 2D3LA 4JM0A 5BZWB 5GS0D 1AXIB 5EFIA 2AK4B 3JBG7 1X9RA 1P1ZB 4WI3A 2WXKA 3VSTA 5ITFA 1A0QL 4JHAL 2W80C 2YBRA 1CFBA 3TJHD 2WKOA 3ULUC 4IJ3B 1THAA 5EO1A 5B38A 1LE9A 3KYNB 2VM9A 1T7VA 5KVEE 1CK0L 5JW5A 2YPLE 4XX1E 5JW4R 5JW3L 4FHBD 1MWAL 3U6RB 3KPLA 4YXHL 5TF0A 1LM8V 1LVEA 4HT1H 2KUTA 4NZUH 4QO1A 2DQFA 3E2HB 1P7HL 4G7SB 1CDUA 3RJQB 1FYTE 3EGDB 3JWOL 1SXSA 4KDVA 2EKSB 4C83A 2HMID 3CN4A 3GKWL 2BVPA 4MD0A 3RWFA 5IIEA 1BD2B 1CG9B 4X4KA 5DFVC 3DVGB 4WHCA 2XX0A 3D4YA 4ZQKB 5F88B 5CEZL 4MNQB 3B83A 5EOCL 3K1DA 4ZUTB 4L4TE 4BQ6A 3QUKA 5D7IB 1DQIA 4PIBA 3UJTL 1T5WB 5B3NA 3IGFA 5JIIA 4APQD 1BBJB 2GJ6D 5EZIH 5F1KC 3LYRA 2X2UA 1BVKA 1KTLA 4HAGA 5IHUL 3QCVL 2C9XA 2FJHB 3BJLA 4U4BA 1S7VA 4V1DD 3NUKA 3OB0K 3UZEC 1QLEB 1NGWA 4PV9B 5F0MB 4I3RH 4X6EB 1WC7A 3ASOB 4L1SA 2ICEA 1QQDB 2HJKA 3TNMA 1S5IL 4LESA 3DURA 2BWQA 1HHKA 4LSRH 3GMOA 3FRUB 2EDOA 3HUJF 1H8SA 4OI7A 4HCRA 1DLHA 1BAFL 3WD5H 7PAZA 3GRGA 4JFQA 4JFSA 1E43A 3VXSD 5D4JA 4UZGA 5GZOC 2FWOA 4YL9A 1W0VB 4NKMA 1EGJA 1NZRA 1U8HA 3ABMB 3R06B 1JN6A 1DN0A 3KCWA 4PRPE 4L29B 4TPRL 4YE4H 5DC2A 4OF0A 3U25A 2I07B 3BAKA 4MNHB 5HDWA 2CM5A 2E4FA 4DW2L 3DO3A 1HKFA 2QPUA 3VI3A 1IKFH 4K8RL 5KJ7E 2AQ1A 1BECA 5L7XH 1JRHL 4C4UA 3ES6B 5DEZA 4GO9A 4DWHA 3I6LE 4X5LA 4R8WL 4B9FA 2GC7C 2ZX5A 1P6WA 1JD9A 2QQNH 2VW7A 4PN6A 1A6AB 4JFEA 3EF7A 1E3ZA 2EDQA 3GFUA 3AREA 3I2CL 4K23L 3LRGA 3SDXB 1JWMB 3ZKND 2WTPA 4F33A 4X7FC 4CL7A 2RAMA 1HWGB 3M1BA 4AVKA 3D3VB 2QBWA 4S1RH 3ARTA 1F8TH 2AJSH 1T21A 2H2SD 2QKSA 3VH8G 2VQUA 4WI4A 5JR1H 1HKLH 1LEIA 4KKCD 5E8NB 2A74B 2Z91A 5IVNA 4MB5A 3BW9A 4FXGC 3GIZL 1SVBA 1X5FA 1OW0C 3CFCL 1VCBC 1FYTD 4JHVA 3GM0A 2JKXA 2GBVA 1U4FA 1GGYA 2ZG1A 2FHFA 4Z7UE 3N50A 1CVSC 3DUHA 2VYRE 1UQSA 2CLZB 5DLMH 1EEYA 5IW6B 1ZA3B 3EHBB 5LAPA 3VYNA 4W9JC 1KIUA 5EEUA 1NOAA 1HTYA 2R4SL 4KHXH 4M43H 3IDGB 4A6YH 3QR2A 1IC5H 1L9RA 4XPGL 3SO3B 5I8CB 5CP7B 1Z2KA 4WJ5B 5FK9B 4NRYB 3SKUD 1J1OH 2XZCH 3U2SA 3N5AA 4TKWA 1S9XB 4CSSA 4HJ1A 2CKBH 3FTZA 4OZFA 4Z7WB 2BIHA 5GHWL 1E27B 1IGYB 1BZQK 4N2DA 5EBLB 5E70A 4TQ8A 2V5SA 3Q0HA 3VFTB 3N41B 4PJ7B 2Y7SA 2O5NA 5IVXE 1UURA 1EZLA 3UMNA 2I7SA 3KYNA 1LILA 2WTOA 5AVRB 2I5YH 1ET8A 1KENH 3Q9PA 2CE6A 2R2HA 2ZX8A 4Q14A 3SDXF 2COQA 1XMEB 3ZZSA 2VDQH 4GKLA 4M5ZH 2ITCB 1HHJB 1NCBH 2GT9B 2W95A 3I84A 1VB9A 3A6CL 2DQIL 2GUYA 1VEOA 3DMMA 3QUGA 3QB7C 4JW3A 4NQDB 1MI5E 2X4NA 2Y2YA 3ILPB 1BCIA 3CFUA 5D1QE 3V9FA 4HEPG 4MJJA 2JTDA 3QFDA 3WUWA 1V7NL 3QYNA 1QSVA 4J3TA 5FECB 4NWUL 2K3HA 4PRAB 3VI3E 4F7TA 5IB3A 2VXTL 3EOTL 4GEIA 4TVPL 4OLZL 1P1VA 2YMOA 5F7LB 4BFIA 4WTZA 2VT0A 1JHKL 5ITFB 3ZT7A 5HHME 2NTSP 2H47C 2ADFL 2CD0A 4XBPB 5AW9B 1DQML 3LZFL 5CCHE 1VJSA 5ITBL 4O4YH 1GC1C 5J6HB 3T0EA 4NUJB 3IDJB 1S8DA 4TQEH 3WENA 3L2LA 4LSRL 4S0TD 4TULH 1CN4A 1XZWA 4AGPA 1NANH 4U1NB 3T6QC 3G3LA 4YBLB 3QUMA 4IIZA 4EZJA 5DHVB 2DQCL 5F3HA 3SDCC 4AYDC 1F6AA 2UX6A 4AQ8A 3AAZB 4G6ML 1JIBA 1RJYB 3FQ1A 4K9JA 5I2IA 1E9OA 3G04B 4Q9RH 5DO2C 4PJ6A 3LH8A 3EH1A 2OL3B 3S34L 2PKDA 3HZYA 3GSNA 4PD4J 2N4IA 3RIFF 2BSBA 4N3UA 2CNZA 1T1ZA 4K8RD 1K4CB 5GRXG 3VSQA 1T80A 1TZIB 3P77A 3S2CA 2E7HA 4LSUH 2Z31D 1H9DA 3P3UA 4LLYB 4GFTB 5L4FA 4JK0D 4P2RA 1SJXA 4NKIL 2WVSA 3GHEL 3QUXC 5IEHA 2WXLA 2BNRE 2AXFA 2B5IB 4IBWA 3L95A 1NL0L 5K9OB 4BQBA 4H8WC 1IRAY 2CUMA 3K7UA 4AV5A 2IANE 1PIFA 3WLWC 2EEAA 1KTRL 4X9HA 1H6UA 5TH2B 3CFNA 1AZVA 3SQBA 1CT8A 1KUMA 4JQIA 4PJ8A 2BVYA 2GVYA 3PWPE 5CHNB 3LXUX 1QSFD 1BOYA 3GXUB 5DVPA 4I8DA 3MNDA 3ZKXB 3O41B 2B5IC 3MGOB 1J18A 2R1WA 5HI5C 1ZT1B 4YS4A 1H6TA 3S37X 1WFNA 4XNQA 3HI6H 4NQED 2OYPA 2I07A 4DJMA 4RGNC 2D9QB 4WHTA 5ILTL 3HPLB 3FMGL 3FSZA 2J71A 3PIQA 2CO1A 2H5UA 5TF1H 2EIZA 3N1MC 1MAML 4DO4A 2VMEA 5I8KL 5F1SA 3W1ZA 2V17H 1SBBA 1YUKB 3RWJB 3ZKXC 3TEUA 4HZAA 3BISA 5E2WL 4KOCA 1UT1A 4WHDA 1M3JA 1SEQH 3GHBL 5AAWA 3NESA 4ZUWB 4JJOA 4XT1C 3RUGE 1H9VA 3MLWH 2XIBA 2MHAB 4ZMOA 5JHLL 4M6NH 1L7IH 2CWRA 1A6ZB 3OMIB 5DVMA 3P9WB 3LY6A 1V3LA 2WQUA 3E3QE 4IOSA 3UTSD 3AQYA 1EJFA 2AQNA 5E2TH 4IGBD 1HCVA 3TJPA 5AW8B 5DF0A 2VITB 4OZFH 2G9KA 5FDYA 3RAJH 2CHDA 2CRZA 4PHXA 3FRPB 2CKBB 1E2WA 3BZFA 1A7PL 5FPIA 4PJHF 2UXTA 2XZCL 5D6CA 3BUQA 4GKNB 1E4XH 4WWNA 4APQA 4A55A 1NUFA 4EDXB 5ACMA 1XGQB 2HT3C 3ALXA 3P30H 5KS9F 5TDOA 3V0JA 4X7SH 5AW2B 2WN3A 4ZODA 5FW8A 3T71A 3QJVB 4BH7A 5F7HA 2VC2L 1AIFA 4EI6B 2MKWA 3BOVA 4NN5B 2OTWA 2NXZC 4FFZH 1NCWH 3T8VA 3MR9A 4TVPH 3CLWA 3M1CA 4XP4L 4AT6B 4G42A 4NT6A 1H8NA 1IFHH 2ZJSL 1LDPH 2H0JA 3IK2A 4KNUA 4KDTC 3TCXA 1J9RA 3UDWC 4HUVB 2YD4A 2BCKB 4I0PC 4M7ZB 1QNIA 1PD1A 2X5PA 2Z1PA 3VMPA 4AC4A 3UAJA 1GY1A 5B1KA 1YYML 1PVHA 3MV7B 1NGXA 3TO4D 4OJDH 3FFCB 2EH7L 5FO7A 4LLDA 1KFGA 4OLEA 2OR7A 3DX8B 3HE7B 4NHUB 1RZPA 4HJUA 3FO9A 1PLCA 2IOMA 3FTYA 4OF3A 1D5BA 4EJ1C 1KJ2H 2RFXA 4UQ3A 2D7TH 5KBPA 4KXZH 3GNML 4YDJB 2QSTA 4TUJB 1IQDB 4AL8L 4CU7A 3NACL 2GY5A 3QJHB 5TGBA 2O6FA 1W15A 3CC5B 4F1SA 1F4WH 4WGKA 5E6SB 2H1XA 2VDNH 3BAYA 3MYZA 1XVSA 3STZB 3U0TB 1XXDC 2ZAGA 4NQUA 2DM2A 4MA3A 1D5MA 3FF8A 1MCLA 5GRYA 5A2IH 4OCXH 2Q9OA 3AQXA 2BSRA 2O5YH 2WQAA 4GP8B 1XFPA 4JM2D 3ELQA 1K4DA 1N6QL 2WLKA 3O3EB 4OIFA 2JCCA 3I9PA 3APCA 4LSPL 4NO0A 5DJCB 1TF4A 3CVBA 4XPFH 3BXNB 3RFRA 3WNIA 3MRBA 4WSJA 5JW4Q 4ZDHA 2R69L 2FEEI 2J4WL 2PYFA 2OJ1A 2WO3B 1MFAL 43C9A 2EVFA 4GO8A 4WW2F 3FUKA 1DVFB 1E6OH 4P59L 5JHDD 2VSMB 5LQBH 1RUKH 2ED7A 3LHAA 4FI8A 2NY3B 3P2TA 1DHKA 2LHAA 4XR8C 4KI5E 3H9SE 1UM5L 3PJSB 4YHKL 5IB4B 1GYCA 1L9SA 1KMGA 2WPGA 5JDJA 1MJUH 2CPCA 1MRDL 1NEZB 2ITDA 3J7HA 4JY6B 1ET5A 3C60C 5E56A 3WUZA 2VLKE 4M5SA 4UTBA 1C5DA 1EEZB 2NYYD 2BOBB 3TBCA 5IFAL 5IP4A 3L08A 4M5YL 4FQXA 2UXGA 4TSAH 1G7JB 2ATKA 1NBVL 2KERA 3V4PL 2EABA 1A7NL 1TENA 2VLME 3QWRA 2D7NA 3TN0C 7CGTA 4RMVA 1I85A 4S1DC 5T3ZD 2VZUA 5FOJA 3GZQA 5BMFL 4E9TA 5KSAB 4G7RB 4FYQA 3BKYH 1KB5A 2RR3A 4O58L 2OBGA 4JO8A 3TBSA 1M1SA 2BW5A 3RY6A 4DKEL 2V4LA 5D93B 3LNFA 2NY2C 3OLGA 1MWAH 2WQWA 4DOHE 5EIIG 3C5ZC 4UQBA 2VABA 1OKEA 4M7JL 4PG2A 5J6SA 5J6GB 1IFRA 5JIPA 5DC4B 3KMDA 2DMBA 2EC9U 5T3ZL 3V4PA 1IBGL 3K2UL 2K6WA 1AO7B 4P2QD 3LS4L 4UV4H 1WRFA 1RZ8B 1T1YA 2D03L 2XWXA 4M61B 4UTAA 5FO8B 5I1CH 1NEPA 4OF7A 2ICWB 1W91A 4N2AA 1CFNB 1WS8A 1WVZA 4DKFL 2HTKC 5DYFA 4O2EB 1TETL 1CICD 5JR1L 1BPVA 3O6LL 2VL5B 4LBEA 4FXGA 4R4BB 4U1LB 4K9EL 1EAJA 2IDUA 5IMLB 1NIFA 1GHFH 4OQTH 1FFTB 5T1LA 1B3IA 3OC5A 4NSKB 5E4EC 4F8QA 4PB0H 5D72H 1R33A 4FG6C 2GAZB 3WS6C 1HYSD 5AVSB 1WTGT 4YHIB 2WZ5A 4M7LT 3D50A 4E9RA 2J2ZA 1OAUL 4QHUA 2OV0A 5C07D 3SKJL 3VI3B 4FJYA 4O51B 5DCCA 4LCWD 1WITA 1XL6A 5BV7H 4DQOL 1EEUA 4HU8A 1ZHKA 3OR6B 5F1OB 4KZDL 3IU4H 3N1GC 1Q1JH 3DMMD 1FIGL 3G6DL 1AGFB 4QTHB 5CBAB 3BUTA 3WD5L 3V95A 3U0PB 3RZWA 3O6KL 1KG0A 3SQOH 2RJMA 3BVDB 2Q3ZA 1Q1PA 2OMVB 1HQRB 5LLIC 4JMNA 1MAKA 3PGCA 1IBFA 3SHSA 1XSOA 4JGJA 4H26B 4PRDA 2WANA 1M7XA 2IH3B 3LPOA 4X5WA 2R9HC 2ZOLA 3HE6C 1ZD6A 2OK0H 2LAAA 3LZOA 4ZFOA 5FYJU 4S10A 3NVQA 1IB5A 2F1EA 3L4ZA 1A9VA 1RLWA 3PWLA 2V2WA 4KVNH 1H3VA 1NSNH 2EICA 1FFRA 1NTDA 2XQBH 3IWVA 2PCXA 3AUWB 5E6IC 1AGDB 3LVEA 3NIDF 4HFUH 5GRVL 4YX2H 2OMTA 4HIJA 5I17B 4RAHA 5BZWA 1TYEB 2IDCA 3MODL 4I1PA 3BXNA 2YUVA 4QOKA 3SD5A 1ZLWK 2D7PA 3VFGH 1FV1A 4WLCA 3VFWA 1KBVA 2ZF8A 5FGBA 4PJGB 3W9EA 4UANA 4RFEB 2BS71 2FGWL 4GFXA 3PS6A 2ZCKL 1SYVA 4R4FL 1AZUA 4AMKL 2EUVA 4JRXB 2EE3A 4BCXA 1NICA 2HSIA 3BP6A 5DQ9A 2E7LC 4I5BA 5FWRA 4QRRD 3O3BB 4M3KB 2NUPA 1T83C 4ZTEA 2VUOA 3ESVF 4JY6A 4CMMB 5JHDE 4Q6IA 3CDYA 3HG0A 4UV7H 4FKEA 2B1HH 1QVOB 4F58L 4ZMYA 1KBGH 3NGBC 4W9HC 5EO0B 2WXFA 1OF2A 1S7WA 3NQKA 1J0KA 4LL4A 5D1XB 1MJJA 1K9TA 4KFZC 1WIUA 4FL4B 2BS8A 3QO1B 2IWKA 1NCUA 2F5AH 3RZCA 1ZTXE 5A2CA 1VZIA 2X1QA 4K2UL 5KYXA 3IAGC 4NUPA 1BVKB 4HOWA 4HEME 2VGLM 1WTLA 4G6KH 2XFXA 3UTSB 3NGBB 3RL2B 3X11A 3HZVB 3EJYC 4FYTA 3TASA 5C0CB 4PV9A 5CHNA 3VACA 5BRZA 3C8KB 2KL6A 1KYUA 2G9HB 5FKAA 1IZJA 4JFQB 3SYPA 1J48A 2YGPA 3PABB 3WO3B 4JANA 3VNZA 5ACZA 3F7YB 5GGSY 1MKFA 4KO6A 1W0WB 4GT0A 1BZDA 4Q97A 2P47B 4LL9A 1TETH 1ZLDA 1ILUA 2DW5A 5EB9A 1CFTB 5K1JA 4ZW8A 4IRJC 2ZP8A 4ZMZA 4GRLB 1HCFX 2BINA 3FQXB 2HT2D 4TOYL 1VFUA 4BRJA 2GSGA 4OJFH 3MV8B 4MJIB 4K23H 1C5DB 1EEZA 3JWNH 1FIEA 2APVA 3FL7A 5F7DB 2VCOA 4ZUVA 4LVOB 5HY9A 1QBML 1S9WA 5FYJE 5I1LB 4JGMA 3GTTA 3N1QC 1ERNA 4KGJA 5E1HB 1MDTA 2NZ9C 1BJ8A 4IRJB 4GRLC 3LDBB 4KTGA 1TMQA 1IFGA 3FZUC 4YZFF 3GEWB 2WSDA 1WPCA 1C7SA 3IU4L 4PGBA 1F97A 2L04A 4JO4H 4LLMB 4YSTA 3VG0L 1AGFA 1BMGA 1O6VA 1U8LA 2DQDL 3EADA 2VLLA 1FL6B 5DHYB 4RISL 4OKVB 4LIQH 3B9KA 4LIQE 3VD3A 5AALA 4MCYB 2IAMB 1SLXA 2F7RA 5E8OB 5HYJA 1VESA 2VR8A 3PL6B 4JR9H 2E75C 3BKJL 4QRRE 5CR8A 3NSYA 1LWHA 1HDMB 1IGIL 2QQKL 1YRKA 2OMWB 1LE5A 4DUVA 3CVIH 4WU7B 1OARH 3SO3C 1TTUA 3RJDA 4PJ8B 1CQYA 4NJ9L 4Z7UA 2CLZA 2J5WA 1YNTF 4LAJH 2P8MA 1CMOA 2LLGA 1ODAA 1XR9A 4ZD3L 4HZLA 2ZKWA 1UXSB 1QPXA 3UTTA 1Q90A 2R27A 3KGSA 4X0KB 4G42B 2NQCA 4N0FB 3C12A 1M7UA 1HOCB 3PL6C 2HXAA 1WZLA 1LEGB 3F7VB 3O6KH 4BBWA 4H7VA 2D4DA 3G9AB 5SWZE 4NRYA 4TL5A 5EG6C 3HG1E 4ZXBB 3L54A 4ZX5A 1N18A 1FSKB 4NQTA 3E9TA 5EF2A 3HI5L 3KPQB 5JUEH 3T2PA 4KKAC 4H88H 3L48A 4QKXB 3UJIL 1UCBH 3KJ6L 1CK0H 2BDNL 3CFMA 4FEIA 2CUIA 5E1AA 3P11L 3QUYA 5INCB 8CGTA 4J3OG 2J5LB 4ES8A 3RIFK 5HSFA 3AXIA 1KXVC 4JDVB 1ZY9A 1DO5A 4PIRF 2X0WA 1VSCA 4DPCX 4L1HA 1RK1A 2DYPA 1QMUA 3EFDL 3UCRA 2X38A 5BPPA 2J55A 3K6OA 4K73A 3TA3A 4KX8A 2OJEA 2GTQA 1TQBB 5I6OA 3QIUD 4F7EB 4X7TB 4FTVA 4DVRL 3KYMA 1MHHB 1A0QH 3IMUA 4MJ5A 3QNYA 3NPSB 1G9NL 5ADPL 4U6TA 5J1TC 3NSXA 3HAEG 1QI5A 4OLYL 1KEMH 3V9CA 2EE2A 4DF9A 1M05A 3UZVA 2IWEA 2X6MA 4F24A 4DUXA 1JNJA 3IDIB 1KTJA 4GKSA 4W9EC 2QT6A 4GW4B 3GT6A 1D5IL 1YC7A 1TQBC 1V55B 5IHUH 5I1HL 1KULA 2I9LA 3QI9D 4LLVA 4WEUD 1DBKH 1KPRA 1EMTL 1PD0A 4YBLC 4HOXA 4PV8A 3HR5B 2B3IA 4MD4A 4K3GA 5SX5H 1ECZA 2AAVA 2BNQB 2F18A 5DHVA 5DJ8A 1PLBA 1JWUA 4CADA 4Y88A 1C08A 3GLAA 3BSZL 3MRNA 3CVHL 2KQNA 4I0KA 5FDWA 1I8IB 4M1GH 2QZ5A 3EYVA 3SCMA 2FZ3B 5CKGA 1QX1A 1XDTT 3EOBB 2IOIA 2P5EB 4FD0A 3H9HB 5EDSA 2OTPA 3Q1SL 32C2A 1E5ZA 1FFPB 1JPSH 4I1NB 4Y1AA 5IJBC 1YSOA 1CE1H 1ZK5A 2OSYA 4M4RB 3KLSA 1WBZB 4TL4A 4N0CD 2DQEL 3FYIB 3VDBA 3G6AA 2JJVA 4QYOA 5ETUA 1CFQB 5F1NB 5FUOH 4LU5L 2WQ8A 2I60H 1BQSA 1T1ZB 4JFFB 4CJ0A 2XV2A 3GSRA 3OKEA 4YXKH 3WI9A 4PS3A 5DEFA 3ISWA 3P77B 3QS2A 1IGCL 3QIWD 4MCMA 3TH2T 3G5YB 3L7FB 4ANXA 4L3EB 4PY8I 3V0WL 1Z66A 5GGVL 2PYEE 3P3TA 3K91A 4ELMA 1XB6A 4IHBA 1JUFA 3GQFA 2B2XL 4E9SA 3H2PA 3H6JA 3AS1A 2DJUA 1I7UA 2YPVL 3CVCA 1AD0B 3I02A 2XPZA 4OSUL 1TCMA 1LWJA 4YHNA 2BP5M 1KTDA 3VXPA 1UFUA 5HGDB 1IBHA 1MWOA 3UO1L 4HWBA 4PW3A 2BY2A 5TDPB 5I0ZA 4DKDC 2A83B 4KJWD 4YR6A 1Z9SA 2PF6A 3O6ML 4FCAA 3DPBB 1QQDA 5JMRA 4HGKC 1B9ZA 1MHCA 2JE8A 5IOPA 1K8IA 1NANI 1BV8A 2JELL 4L9LC 4KAQL 1I1FB 3ET9F 4HLZG 3L3OA 5CCKL 3MRLA 4QHLB 5C70A 1I7ZB 1MFMA 5CZXC 4JDZA 4HWBL 5AZEL 2AJSL 4XN5A 1P9MA 3BT2H 3CHQA 4XZ4A 4ALAC 4AK1A 1XD0A 4HETA 4RISH 5DUPH 1NEUA 2HZHA 4OUUA 2ADIA 5F96L 5FKPA 3S5LA 5I8OH 4XVSH 4ZXBA 3HFMH 1JGDB 1QLRA 2WVUA 1KGWA 4QJ4B 3V0DA 3KPQA 4OJYA 4XRCB 1WUZA 1EDYA 2QVKA 5GZND 3OF6D 3ESNA 3CVIL 2ITCA 2D3VA 2AEQH 3D3VA 1X7QA 4FQIL 1YJDC 4DK3A 1KCSH 2QVTA 1NIEA 3QRGH 3RWGB 3V5KA 4EOWL 3WY2A 4MWFA 4H5SA 4L3EE 4DGVL 2IQ9L 4PRPA 2WLIB 1LO3H 4RGMC 3ZTEA 4APQB 1HS6A 4LSTL 4OM1H 2CO7B 4ETQA 12E8H 3BDYL 1EXHA 4YSUA 4HKJB 1RZIB 1QFWL 1DBAL 2B39A 5DRXA 5HHPA 1SEBA 3DARA 4ZG1A 2K6YA 4LPXA 3UERA 4XO4A 3BVTA 5I1JH 2VM3A 1IM9D 3HIZA 2ZX7A 2FDBP 5E0QA 3T0EB 3QRLA 5BXFA 2L4OA 5CIPA 4HULB 5I8CA 1U95B 2CHXA 5HTSA 4XXDB 2Y9RT 5CD5C 1J0HA 3V0AC 5C7ZA 4PP2A 1J05A 3PXJA 3MHZA 1W8EA 4OLWL 5DU7A 1DCLA 4WJKB 1MCPH 3EBAA 4S1QL 4CAGA 4G9FB 4XOBA 2X9WA 4GAYB 4X99B 5FDWB 1RVFL 1MSPA 2FO8A 3MRRA 5DS2A 3VDAA 3BCDA 4PB9H 3FCBA 3QDMD 3ELAT 4Z3TA 3EH5B 3F05A 4OM0H 4L8SB 3P02A 1I8LA 2OR8A 4OI9A 1SHXA 3SE3A 1FYTA 1TZIA 3KL3A 1IC7L 3GO1H 1JHKH 1ZLWH 1A7RL 4KZCA 4YDJA 1WGOA 4J4PD 2W0PA 2Z7ZA 2NX5D 3A6BL 4N2FA 1D5MB 2NY3D 2OZ4A 4X8JA 4LLYA 2IH3A 5E5LA 1G7MA 2OYLA 4XPHL 3MV8E 3QQDB 3NCYP 1IGJB 5IKCB 4ODXB 4NO2A 1CGWA 4ZFOB 4MHHI 4WFEE 3H9ZA 2H0PA 4MXQC 1KPRB 5EN3A 3CPUA 2G3NA 5DD6A 4FA6A 3MACH 2B59B 2C8NA 1DVFC 4YK4B 1V3MA 4Y4KD 3I02B 2DIBA 2VNCA 3EH2A 4LMQE 5I28A 3Q8BA 4KK8D 4LLQA 5EU7C 1AY1H 4EIGB 2GFBB 1JGUL 2CK0L 4PGCA 3SBWA 2CA3A 1HXKA 4G7QB 3MO1B 3ULAB 2LVCA 3BQUD 5FFGA 3PGFL 4OIAA 2VSKB 4A63A 4FQXD 1B0WA 4C58B 1X5LA 4WUKH 5I6NA 1OVZA 2F68X 3DIVA 5IOPB 1FBIL 2GSGB 3FO1B 4YK4C 2Y07H 3GDBA 4F8PA 2Q2LA 4E41A 5KOMC 2PW2B 2J6WA 3B5GA 4HIIB 3UEZA 1M7IA 2HX8A 5B38G 1IMHC 1R46A 4GUOA 1G1KA 5AZEH 1U2HA 1VFBB 4LPYA 1ES0B 2GHZA 2A99A 3FDWA 5DQDH 4DPRA 25C8H 4HPOH 1A3QA 1GCFA 4PHZA 4RZCB 1OD7A 5FYKU 4J2QA 5I26A 1G6RA 1MHPH 3APFA 1TMCB 3NCFB 2XKNA 4Z8FH 4EZLA 3U7WL 3BT0A 1CLZH 3HZKB 5HGAB 2ZSVB 4IS6B 2JKWA 2LU7A 3LIUA 4UM8A 1GZHC 4F33B 4UQEA 2VH5L 3CSYA 4FFWC 4X6DB 4C57C 2X12A 3KYKL 3WN5C 5HYJD 5L9DL 3NA9H 2JELH 1S7QA 1KIQB 5INDA 3EJCA 1VACA 2RQEA 3TN0D 1IE4A 3FB7A 1FCGA 3OKYA 1Q9KB 4FEMA 3J27A 1RAMA 3ILDA 3PAZA 3RNKA 2QLYA 2Y6SD 5EO9A 3WU1A 4IJTA 5DUBA 1MREH 3JWOH 3KH4A 1TJXA 4D0BA 1MHCB 4IEFA 3QC5X 1Z9MA 3QUML 1RZKL 4CVUA 4FKKA 1O5DT 5TDNB 3CHRA 4K94H 4WCYH 1S7SA 4JZNB 3FH8A 3MRFB 4W6XB 3IRPX 5CEZH 3BHBA 2IF7A 4M7KH 1LYQA 1BAFH 4HUUB 3WV0A 3OX8B 3NN8B 4MMZC 8FABA 1P5VA 1P1ZA 5AL0A 4Q0XH 2AK4E 3FU5A 3IMRA 1E9QB 2IC2A 4NOFA 1B4JL 1FGNL 5KVFE 4EI5D 1I3RB 3UO8B 4B95C 2BCKA 4Q2ZA 5J7CC 3TBWB 3N06B 1MFVA 4JN2A 4UT7H 2R83A 3ZDXF 4G11A 1EPFA 5D71H 1MW1A 1KB5H 4JRLA 4GAGH 1JPFA 2GJ6E 4HUXB 4M6MH 2WBXA 2XKSA 3L2MA 4YVUA 1IL1A 5AD0A 1TVDA 2WCPA 3BE1L 1BFTA 1R4XA 1I9JL 1JVKA 5ABZA 4HSAC 2KC0A 3DHPA 1W0YT 2VMFA 5EOQL 5G2NA 4E42B 4X4XB 1MFCL 3OHXA 3G6JE 4GAYA 4HK0B 4Z7UF 3NFNB 1CFMA 2CHWA 3CSPA 4GNKB 2UWEE 3TZVD 5E8DH 4HD9A 1PZUB 1TIUA 2MPAL 1OCCB 3Q6FA 5FYLH 2VDRL 4IBUA 1ZV9A 1IAKB 1HHJA 5DWUH 3FBQA 3OWRA 5D5MF 1EXUB 3L3IB 2UVEA 2ZKYA 3ARDA 2AANA 1YMMD 5BZDB 7FABH 5LG1A 4GAJL 2O5ZH 1KIRA 3ZR5A 1QUNA 4YHPA 3QVAA 1D2OA 5PAZA 4PJ5A 5L7XL 3CMOH 4JZJC 5IMOB 4WAFA 1NMAL 2EEFA 5IMMA 2C9QA 2WLLB 3TEXA 3CD4A 3I2CH 1J8HD 2X7LA 1UA6H 1G87A 1N3NA 3CFCH 1WIPA 1WAAE 2PLTA 2Q7AA 4ZPTA 5JDSA 5B7FA 3P4LA 3GI9L 3QXDA 4NQCA 3B1TA 1UH4A 1N7MH 1I3GH 4L5FL 5GGTH 2C1PA 1P7QD 5AOZA 5T1KA 3MNVA 2ITEA 1U8QB 2I69A 3JYBA 1AMYA 5E2UH 4NP4H 3LHPH 3TOPA 3H3BC 3MXVH 1G7LA 4HX1A 1EVTC 1LMKA 1RFDH 4ONGL 4RIRA 4HK3N 3KWWB 1DP0A 4I2XA 2HKFH 5C08D 2HKHL 4MNHA 1CUOA 2NPLX 4AKQA 2JF1A 4LCVA 3O3BA 1RJLB 4HUCA 3VU2A 5E2JA 4A6YB 1BXXA 1KLUB 2NY7L 3FO9B 4LOEA 3G6AB 4MNGB 5D1XC 2IMMA 2RQ8A 2DRUA 1OF2B 1S7WB 2WXQA 3D3VE 2V2XA 3SDDB 3BRDA 1OPGL 1A6UL 4LRIC 1ES0A 1J88A 3GZPA 4I3SL 3QORC 1QSFA 4TUJA 3T3PB 1AZRA 5C0JA 2AV7B 2BY1A 4PTUA 5IJVB 4JQXC 3L9YA 1U4EA 1DL7L 3GMPB 3WSQL 5IQMA 2UY7A 5A3ID 3KWTA 4RFOL 5IF0B 1ZV5A 2HJFA 3U4EA 3UYOD 4CBZA 1NDTA 2EEBA 1JG9A 3BAJA 4JS7A 4PJDA 2HCZX 1X7TA 3I3EA 4LQFL 4W9CC 1OP4A 5TQ0L 4QD2E 3QORB 4XC1H 2K45A 2OI9C 4MB3A 2G4EA 5AG8A 5EBWB 1SJEA 1JF1A 3MX0B 5K39A 3MZTA 3VDCA 1BF2A 4KRNA 1TJHL 1CFTA 3WJMB 5T3XE 3OWEA 1CDCA 2LTQB 2XX1A 1PNDA 4L5FE 3UMTA 1IT9H 4LVOC 4FFTA 3TO4A 2LLLA 1KGUA 1CLZL 4PJ7F 5DK0B 5HI5D 4O2FA 2YPLB 1FF5A 4N5UA 5BVPH 3PJSA 2XKUA 3F83A 1U3ZA 2ZUQB 5FWQA 3X1BA 1Y1UA 3NA9L 1F3JB 4CC1A 4N2IA 3KL0A 1T7WA 1TNMA 4AH2A 1KN2L 5I16B 4FERA 3G5ZB 1RIUH 3OKDB 2NW3A 1EEQA 4YXLL 1Q72H 1CC3A 4M4RA 1BFVL 2LQRA 2GEEA 3PQYA 2H6UA 2ZXWB 4XBMA 3RPBA 2GQHA 2NNRA 1KZQA 5KBNC 3OQRA 2H1LM 4U3HA 2Y7MA 3WEXA 1KLGB 1YNKH 5CZVH 2PP7A 4J2XA 2QSQA 2IH1A 5EPMA 1L0PA 5JIKA 3OHXB 1RIVH 3NCEB 3FQ2A 4ODSL 4OR1A 1RZQA 3NIFF 1KYOJ 1HZHL 3DPDA 5E1GA 5GJSH 4F15C 3VH8A 2BHUA 3QIWB 1KTDB 2Z0UA 3KLKA 5L0QC 5KBLA 3FCUB 2AQ3A 1IM9A 2NY0D 2SODB 3WHE1 3D0AA 5DO2D 3TT3L 3FU7B 2OK0L 1CL7L 1KCSL 1BREA 4LEOB 3TH3T 2JB6A 3MLTB 3HHSA 1F11B 1BGXH 4AEFA 5AAPA 3BE1H 5JPMC 4JZOB 2RMNA 1XSJA 1QO3B 1FSKC 2Y69B 2VL4A 5I17A 1AP2B 3L3OB 5CWSB 3RWDB 2BSTA 1DVFD 3ZBMA 3EDFA 3JWDC 4CNIA 3OZLA 5M94B 5CUSH 3U4BL 1QEXA 2BJML 5FO9A 1A1MB 3GLDA 4Z3FA 2XETA 4PREA 2H3NA 1SMAA 2BZDA 4U1NA 3QEQD 2CDEB 2YD6A 4N2MA 2HAZA 2YBRB 3GZKA 1WEJL 3VB8A 1FVCB 1I75A 3FUFA 4MD5A 4RFEA 1JZHA 1F6LL 1YEHH 1NGPL 4DKTA 1HWHB 2UYLA 3IKKA 4Z9KB 3EGSB 1J5DA 3BP6B 2AW2A 4D3CL 4DGYL 3FQWA 3GXFA 1FORH 2VLJB 1NEZG 2W9DL 3EFOA 2ZYIA 5F1IB 4AJ0A 3CK0H 4PUBL 4TVSa 3SOBH 1RURH 1L6PA 3BP5A 5IJKC 1G7MB 4AL8C 1DE4B 3FQRA 3RAJL 3JV5A 4KJQD 3RURA 4D9RD 3S35H 4FTVB 1A7OH 3CSTA 4J8QA 1E4XL 2IVFC 4KMTL 5SX5K 1CGVA 3LQAC 3TJEL 1OM3L 4ZT1A 5HDRA 2ZCLH 5I1IH 4XP1H 5HGGS 3D39A 1G6VK 3VM7A 5AWNL 2VIRB 4GMSL 4R9HA 3LN4A 4OQ1A 3IJEA 5F9JA 5DRXB 5HHPB 2IANB 2V2WB 1WCBA 2YUWA 1JVOA 2IWFA 1AHWA 2AEQL 4JZJA 4ZYKA 2W65A 5EF0A 5DJ8B 3US1A 1Z9OA 2W07B 4MQXD 1FPTH 4MD4B 5D5ME 4GO6B 1ZRUA 2YLHA 3SY6A 1M4KA 2YA0A 3FT2B 1WBYB 4N2LA 1GYWA 3CE1A 4U1JA 5I75B 5HDBF 2XHNA 1MFUA 3V52H 4AVIA 1W0VA 2CXGA 1WDAA 5KZCD 2IAND 4NQDD 4W9FC 2N0KA 1J10A 2UZPA 3GJFA 4XC3H 3VI4B 3X1GA 1Z7JA 6CGTA 1YEEH 1QW8A 3LQAH 2PXYC 1KJ2L 3FUEA 2X28A 5AQ0A 4QHMA 3LEVH 3HS0C 1LHZA 1J1PH 3SE8L 2ZTBA 4Y1AB 2BOBA 3NACH 2BK8A 5IREA 4BD4A 3JYCA 3P4OB 3QEQE 3RFZA 2V9UA 4LHQB 4PJFF 2F5BL 3UROR 3P9LB 3SYCA 2QPEB 5TK2A 2CDGB 1KIQA 3IYLW 2DQUH 3RVVC 2ENJA 3REWB 4KPHH 2CCLA 1Y1DA 4HVBA 2MWCA 3QORA 1PQZB 1EO8H 5EOTA 2XVGA 25C8L 3VWKC 2OX5A 1A02N 1U8MB 2OW6A 3FFDB 5JXEC 2BSSA 5IHHA 1PU0A 2DMHA 3ZQWA 4FMVA 4LLUA 4OTXL 1VCAA 1MPAH 3VH8B 4LLQB 1S9VB 2Y06L 4MAYB 1GJWA 4PJ9D 5TDPA 3W9DA 3OKOA 4C59B 5KN5A 3HAEA 1BMZA 1U0QA 3POHA 3MNZA 4LNRB 3V4VL 1KJVB 3VWKB 4JFEE 3UG3A 4WV1B 4OZGE 1KIUB 2IQAA 5CP3A 5ALCH 1I1YB 3TFKC 3TPUB 1S4IA 2QGDA 2MNJB 3MRLB 4JN2B 2VKXA 5KANG 3BWSA 3VRLF 3LTVA 1CD9B 4HCRL 5F7AA 4H8HA 2IFFH 3X2QB 3QQ3A 4L1TA 2VDOH 4HWZA 2VDLH 4LSQH 2NY0B 4F20A 1IGFL 1UZ8A 4NRZA 5J8OA 5KG9A 3TEWA 4TQHA 1HH6B 3F84A 2J6EA 1A2YA 5TE6L 4OFYD 4E5XA 4N2EA 2BVQA 1X6NA 2NY1B 4GRWF 5CGYC 5DJYB 3UAAA 4QLWA 3WNMA 3HNTL 3RHWK 1PMYA 4P49A 1EJOL 1JV2B 2AQPA 3O3DB 4PGDB 1I9IL 1X7QB 4M43L 1JGLL 1SQ2N 3RGVA 4K7PH 2F7QA 4HIXL 5E99L 3DJZA 1CLOH 1JFQH 5MEQA 5EBGA 4Z7QF 4AC2A 1HVXA 1XF4A 1WAPA 2X4NB 4F7MB 1IAOA 3CN1A 3EFFA 3FSOA 4BFNA 4G2AA 2CJTA 5CNHA 4EIBA 4DPAX 4FA7B 5C0GB 3V5HA 4Y4KA 3ESOA 3Q3GA 5A2BA 1SEBB 1XGYH 1NMCC 1XAUA 4BSJA 1KEML 4BFFA 4TTDC 3HHMA 2DH3A 1GGTA 2VXTH 3ARED 1XGRA 3EOTH 4HQQH 3MUJA 4GMSH 2YN5A 3WDHA 4ZW3A 4L0YA 2R1XA 3CFKA 1D5IH 1T7YA 3GMOB 1SQMA 3WJLC 4IDLA 5JHBA 3WFDH 1J1XL 1JWUB 1JZEA 4I2XE 4YNYB 2YEZB 4CADB 4PVBA 4Q2ZB 3EYUL 3I9GH 5AKRA 3L9RA 3T0AA 4TULL 2DQFB 3D85D 1A6VH 3NIFB 4U1IA 4QDGA 5DJ0A 5EC2A 4ZMLA 5I1CL 3F5WA 3NCYS 2TRHA 1KGJA 4A7QA 1DBBH 4A04A 5FW6A 1R1CA 2QVFB 4G8GE 4ORGA 5F3HB 5JIDA 5CILH 1OPOA 1XAKA 1MCQA 5CM1A 2F53B 1EERB 2MNWA 1AHMA 3MRRB 2R2BA 4N0YL 1HFUA 4UOQA 3WCYA 1INQA 5BRQA 3GBLA 2NDGA 4K7FA 4MHHG 4BXVA 3BUBA 3FQUA 4R84A 5BJTB 3ZDZB 4YDKL 1MIMH 1WA1X 5CJQL 3O11B 3OAZK 3S96B 4UZSA 4NC1C 3HG1D 5D8JH 3ZTJG 1TYRA 2WQSA 2WWOA 3GMPA 1O0VA 1F58H 4NJAL 4NQDE 1N4XH 4JEGB 3BESR 3RFZB 5F9JB 3FHEA 3FHAA 4LRIA 4GPVA 4NKIH 5HGDA 1YY9C 2EEDA 1ZGLA 3PL6D 2ZP9A 3BD5A 4LSVH 1KXQA 4WTWA 1BVZA 3IFPB 1I7TB 2WC7A 4X4YA 3VXUE 4IIQC 4BZ2L 3BPOB 2ORBH 2XDHA 3ZY7A 2EYTA 2PMZA 1SMOA 3UZQB 5JIQA 1PG7W 1AHKA 1I9RH 4BKTC 4F57H 3X13B 1N5AB 1QR4A 3TJHC 3V6ZA 3VXMD 1N0LA 3ULUD 3WHXA 3K6SA 1W6WA 5LDSA 1T1XA 4JANB 3VTTA 2E6JA 2YPLA 1V27A 4JDZB 1BYPA 5DXWA 3JT2A 1OALA 1IGCH 4WV1A 4HKXA 3BPOC 3U30B 1WA0X 3PQYD 4JDEB 1IARB 3DJTA 1H3WM 1OY3B 1K72A 3EOBA 4HIIA 1FGVL 4XNZC 1K5NA 3T2LA 5JW3H 4HJJL 3AWGA 2ODHA 4FI7A 4G1MB 3FCSA 3GMMA 2VQ1A 3O0RH 2IFFL 2AI0L 1JD7A 4YX2L 3KLAA 4X4ME 1T0NA 4FZEH 3WEXB 1MUJA 4HHAB 4UOJA 1F90H 1AR1B 5E00A 2XKNB 3QJFA 1QYGL 1ZXQA 1LEKA 4P8QA 1DVZA 3EXJA 3RVXD 3HS0A 4Z6AT 5J3HD 4WWKA 4BK4A 4TM9A 1VEMA 2B08A 1CR9H 4HDIB 4HUWA 4WWKD 2WLIA 1LD9B 3OXRB 2XY2A 4MDIA 1N64L 5E9AA 3ZKQD 4F3FA 3RJOA 4A37A 1AKJA 3ESPA 3HB3B 1U36A 2XN2A 2IDQA 4YHLH 5DTFB 4BE6A 1FZMB 3O3AA 1QLEL 1ZA3A 5EO9B 1AQKH 1X44A 3CSGA 4M93B 5CSZB 2A83A 1TITA 1R3IL 2LABA 3NJVA 5I8OL 4JKPH 4F58H 3HUJB 1ZA6B 2OMUB 5EOCH 4JZNA 2A6IA 2KMWA 1XIWC 3NFPA 3LZRA 4MZ2A 3GUFA 3VD9A 3AFLA 1O6SB 1CZ8L 4OLVL 3LKOB 2AZAA 4WO4D 3MSPA 4U49A 4K5LA 3IDXH 4TPRH 5HVGB 3LEXA 1JZFA 4ADGA 2ARJA 3EJUA 2ARWA 5ECJE 1YQVH 3ZZQA 5KG9B 2G5BB 4S1RL 3U82B 2EO9A 3OZ9L 1ETA1 1UD8A 4NCDA 1WS7A 1RJCA 2DLFL 1D2PA 4Q9QH 4KRLB 2GUOB 4NQVA 3ZDYB 4EAEA 3RIAF 1XEUA 2ICCA 2MOVA 1PY0A 4BH8B 2OL3A 4NNPH 3ZE0F 1M9WA 1UC6A 1JVLA 2WGXA 3DX8A 3HE7A 3QPXL 3STBA 2Y0SA 5HI4D 5L6YH 5IT2H 2Y36L 5I19H 1L9QA 3DO7A 1GZQB 1RXLA 4PJCB 3CN0A 1BQUA 1FO0A 4NRXB 1K6QL 2DD8L 3A24A 2WUBL 4X8GA 1EXUA 3IM1A 1S7TB 1AZZC 4F7EA 1KCKA 2CBQA 3S3DB 5IB3B 4ODHH 4O9HH 5J9PB 5EZJB 1IGIH 4ETQB 5DRZB 5E7BA 4PP1D 3T0ED 3MLXH 1N8OE 3AS2A 5IJKA 2R0WL 2E9BA 4UF7C 1T2JA 3QH3B 2VLKB 4ZYKB 4NDMA 4YBQC 1ZK9A 1U8QA 4GKZA 3S6CA 2W9LA 4MXWL 4YNYA 3L9BA 4N68A 3GSVB 1PZDA 3BVXA 5I5IA 5EFIB 3MRKB 2P44B 4N0YH 1W0WA 1T03L 3O6FD 5ABDE 1U3HB 1JI1A 5IGXL 4ZD3H 4YAQA 2QHRH 4JPWH 4I4WA 3HE6D 1IC5L 4Y2DA 3NIGE 5I5MA 1UENA 4Y2DD 4J3OC 4A6YA 2ZUUA 4L3ED 1XT5A 4WY7L 2NR6D 3VM5A 3AREC 1BD2A 1MOEA 2CKBL 3D85B 2A9ML 1D7BA 1OHQA 3KPMB 4K07A 5KVEL 2DEXX 3K8LA 1U3HC 3ML9A 4GMTH 4UT6H 2HH0L 4XPGH 4MCNA 4N2KA 4N8CL 1Q94B 4JFVA 4TSAL 4BE5A 3RBSA 5JXAH 5I0VA 1KC5L 2A0LC 1L0YA 3AXLB 2EH8H 3LKQA 3PDOB 1QFUH 3AREB