3WKQA

Copper-containing nitrite reductase from geobacillus thermodenitrificans in complex with formate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
299
structure length
299
Chain Sequence
NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper-containing nitrite reductase from Geobacillus thermodenitrificans in complex with formate
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 102
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wkqA00
1WA1X 1BXVA 4DP9X 3FU9A 2RACA 1OOWA 2P80D 1GY1A 2H3XC 4YVNA 4BXVA 3ABLB 3AG1B 3TBCA 1IUZA 5F7BA 1AZRA 3NSCA 1J9QA 3NYKA 4YSDA 1OCCB 2YAQA 2XUWA 4E9RA 4DPCX 1V55B 1OCZB 3ASOB 3OMIB 2HRHA 1VLXA 2BHFA 2DWTA 3U25A 4NAJA 2UXTA 3WKQA 3TU6A 4G71B 2I7SA 1L9TA 3KW8A 1I53A 2GB2A 4KOBA 4GXFA 3H4HA 3ABKB 1V10A 1NIFA 3HEIB 1CUOA 2HLEB 4G72B 1PCSA 3CVCA 2I85A 1JZHA 1AZBA 4GP8B 4YL4A 1KBVA 1PLCA 5I26A 3ABMB 5B1BB 1TEFA 1KCWA 1FA4A 2AANA 1ASPA 1V54B 1NZRA 1NWOA 4BDVA 5I6NA 4HCIA 1RCYA 3AZUA 1BQKA 1JZEA 2GI0A 3UACA 4KO5A 2H47C 3NJKA 1OCRB 4AZUA 1M9WA 3CG8A 4G7SB 2YARA 1BXAA 1AACA 3OD3A 4N4YB 1ET8A 4ENZA 2BO0A 5EHFA 2BW4A 2E86A 1IBYA 4DP6X 2N0MA 4AX3A 4M4RB 1PZAA 3S8FB 2XU9A 1XMEB 2GIMA 4DP0X 3GDCA 2OJ1A 3OMNB 1JOIA 3ZX1A 1OE3A 4YSAA 2EIMB 2BP8B 1AR1B 4E9YA 2J5WA 4YSPA 1AS8A 2FT7A 1BYPA 4UAHA 2H5UA 2IWKA 1RZPA 4DP1X 4E9XA 3FSWA 1AQ8A 5IY5B 2XLLA 3FQYA 2BZ7A 1OE2A 2XX1A 4YSSA 4HZ1A 1AG0A 2NRDA 3AG2B 2IWEA 2IDFA 2GBAA 4HHGA 3S3DB 5D4JA 3FPYA 3QPKA 4TXVB 1AZNA 2DWSA 4YSRA 3UABA 3NJFA 5I5MA 3BQVA 3CDZB 1JERA 1NICA 4HHWA 1ZPUA 1E67A 3T6ZA 3MX0B 4KOCA 1MG2C 4P5RA 1AIZA 4A67A 4CSPA 1NPNA 4YVUA 3FSZA 2BZCA 2FWLB 4G7RB 2PPAA 1F56A 2UX6A 1CC3A 3SQRA 4G70B 2JKWA 2I7OA 4A68A 3QJSB 2YAEA 2ZONA 5I6LA 2EIJB 3TASA 2XYBA 4RH4A 3X1GA 1QHQA 4HCFA 1ASQA 3D12B 1A4BA 2GSMB 1A3ZA 1IBZA 2IWFA 2ZOOA 4HIPA 1L9OA 5I6KA 5I5IA 1IKOP 1PNCA 3DKHA 1JZIA 3QJUB 4BWTA 1TU2A 2YAHA 2AVFA 3AY2A 2BWIA 2X87A 2HRGA 2GC4C 2W88A 3NJHA 4JHUA 5AKRA 4YSOA 3NSDA 2Q9OA 3NJJA 1KYAA 1GW0A 3UAEA 3KW7A 4YSUA 2JFCA 1EHKB 4WKXA 2YAFA 4WTQA 1HAUA 3PLYA 4BXSV 4EF3A 3WNJA 4GY4A 5B7EA 1XB3A 2UXFA 5I5JA 1FWXA 1ILUA 2BP0A 4K9JA 1TKWA 3AG3B 1GY2A 2YAMA 3T9WA 4PCYA 1ZIBA 1BXUA 4E9SA 1ZDSA 2YAOA 3PXLA 2Y1AA 3ASNB 1HFUA 3DTUB 1CYXA 1E65A 4KNUA 2VN3A 1GS8A 3X1BA 2DYRB 3TA4D 2DYSB 3V9CA 4AKOA 2WO3B 3S3BB 2X88A 3UAAA 3QJQB 4L0PB 3FU7A 2JXMA 4BK5C 1NIEA 1AS6A 1PY0A 2QDWA 4QKTA 2ZWNA 1NPJA 3NP4A 3EF4A 3OMAB 2R7EB 2W8CA 3FSAA 4MFHA 1WA2X 2TSBA 3FQ1A 4UF7C 1SF5A 2EIKB 4G7QB 1AG6A 3OQRA 3UGEA 2CALA 1ASOA 3GXUB 2XXGA 4BDVB 2XWZA 3GYRA 3X1NA 2VW4A 1JVLA 1N70A 3X1EA 1OV8A 2XX0A 4A2HA 1GS7A 1NIAA 3PAUA 1OE1A 3N55A 4P5SA 3NSYA 1BYOA 3MBWB 4Q8BA 3QJTB 3FYIB 2FNWA 2CJ3A 1PF3A 1NDTA 1PLBA 4KO9A 4E9WA 3FT0A 4M3HA 2AFNA 2VW7A 3FPXA 2YAPA 1TEGA 3G5WA 1ZDQA 1EZLA 1L9RA 1E30A 1WS7A 3AG4B 3SBRA 1OF0A 5PCYA 2CAKA 4X4KA 1PZCA 4QLWA 2TSAA 5LDUA 1MDAA 5I6PA 1UATA 4CSZA 3EH3B 1NIBA 3IN2A 1AOZA 1ADWA 1GSKA 2CUAA 1KV7A 1A4CA 4YSEA 4YSCA 1NWPA 1CYWA 3ZDWA 1BAWA 4HAKA 1J9SA 2XV2A 6PCYA 1B3IA 2PP9A 2CBPA 2FJSA 8PAZA 1MG3C 2QPDB 2UX7A 1A65A 2VM3A 3FYEB 2UXGA 5B3SB 1KBWA 3CVDA 3C75A 1URIA 2P80A 1SDDA 4KO7A 1PMYA 1ZIAA 2FQGA 4A2EA 5B1AB 4DPAX 1E5ZA 1T5KA 1NINA 1J9RA 1RKRA 3HB3B 3S3CB 2IDQA 2MRYA 2VM4A 5TK4A 4FA7B 3N2JA 1JXDA 3EH5B 2QT6A 2Q5BA 3FSVA 1JXFA 2BWDA 1KCBA 3RYMA 4DPBX 5AZUA 1JZFA 3NJNA 1MZYA 1SHXA 4BWUA 7PAZA 2MTAA 2FQEA 2Y69B 5B7MA 3CZUB 1L9SA 3IBOA 4A66A 4E9QA 3PPSA 1GS6X 2R7EA 3FU8A 2XVBA 2UXVA 2HXAA 2AZAA 1BQ5A 1KDIA 3WI9A 4NERA 1SHWA 2PPFA 2PP7A 3QJVB 4KNSA 2J57A 2BP0B 4AKPA 5I6OA 1FFTB 2B3IA 4DP7X 4ZK8A 1CURA 4UANA 3S8GB 5I28A 2PP8A 3QJRB 4E9TA 1AS7A 2IH8A 3T6XA 5E9NA 2OCCB 5B7FA 2DV6A 3L45A 4GP4B 3X2QB 1AAJA 1W6LA 2IH9A 1SF3A 2VSMB 2FQDA 2IDUA 2J56A 3TBBA 2PCYA 1L9PA 4JKNA 6PAZA 1AZCA 2YQBA 1OCOB 5FC9A 3QQXA 5B1JA 2PCFA 2IAAC 7PCYA 3WG7B 1XB8A 4N8UA 4F7KA 3T6WA 1KDJA 1WS8A 1PNDA 2FT8A 3EHBB 4PAZA 2PLTA 5D4HA 1A4AA 3NSFA 1MZZA 5I6MA 3IN0A 4DP8X 1PZBA 1SDDB 2FQFA 4AI7A 2QPEB 3FU7B 4GP5B 1KGYE 3ERXA 4KNTA 4AKQA 1QLEB 1SFDA 1JZJA 2EILB 3NJLA 2HZHA 4FAAB 3FS9A 4YSTA 3ZIYA 2BW5A 2WO2B 3DIVA 3ZBMA 3PAZA 4GYBA 4KO6A 3WNIA 4DP5X 4F2FA 2CCWA 5B1KA 3IEAA 1JXGA 3NP3A 2B08A 1ILSA 1PAZA 3BVDB 3H4FA 1R1CA 1E5YA 3CDZA 3V9EA 3JT2A 4YSQA 1GYCA 4F2EA 3OM3B 1SFHA 4JHVA 2XXFA 4A2FA 1PLAA 1SJMA 2OV0A 1M56B 2HX9A 1X9RA 5A7EA 2DY2A 2GHZA 2LLNA 1DYZA 2BP8A 3NT0A 1XB6A 2YXVA 1M57B 1YLBB 2HX8A 4A2DA 5F7AA 2XV0A 4HALA 4DP2X 1BQRA 4NB7A 1HAWA 2J55A 4HCGA 3T6VA 1L9QA 3SBPA 2FT6A 2PPCA 2ZXWB 5ANHA 3H56A 1JZGA 3WIAA 2FTAA 1ETJA 1W8EA 1SNRA 3NJMA 5PAZA 1ID2A 2YXWA 2AZUA 1N68A 1GR7A 2IDTA 2VMJA 5AFAA 3PAVA 1WAEA 2WSDA 3ABGA 4E9VA 2A3TA 2PPDA 3IE9A 4A2GA 4BWWA 2XV3A 2EINB 1J5DA 1WA0X 2HX7A 1J9TA 2PPEA 2QDVA 3JTBA 4W9ZA 4Q89A 3NJIA 1W6WA 5D4IA 2IDSA 2VW6A 1IC0A 4W1TA 5B1JC 3WKPA 3X1FA 3T71A 1ZV2A 1NTDA 1AZUA 1RZQA 3UADA 4DP4X 1QNIA 1X9UA 3CVBA 5TK2A 1J5CA 9PCYA 1BEXA 1DZ0A 3EH4B 2GC7C 3SBQA 1AANA 2VSKB 1ET7A 3NJGA 1NIDA 1A8ZA 1JVOA 1ET5A 3FQ2A 3PCYA 3AW5A
chains in the Genus database with same CATH superfamily
3VW3H 3LH2L 2ADGB 1U3HC 4QF1B 4GT7A 1CXEA 1RHHA 3AG1B 3P4MB 5KVEH 5F7BA 4MNGE 2W80C 1J9QA 1OCCB 3L3DA 2A0LC 4KJQC 5F72S 5BZZA 2P8LA 3ASOB 4G3YL 4GSDH 3LV3A 3QDGD 1VENA 2DWTA 1S9XA 2DQTL 2F61A 2QKIA 1WGVA 3B56A 2J2ZB 5C09A 3GMPB 3TU6A 3CLFH 3PL6D 3GS4A 4FXGC 3ZL1A 4FD0A 3Q2CA 5GSVB 1BMGA 3LKSA 3UPCA 5IJKC 3EYSH 1N8ZA 3B7RL 3Q8FA 1RK1A 4QUOA 5FYKD 3T4YB 4JB9H 1PCSA 3PNWB 5AAPA 2E8YA 5DD1L 3ZHKA 4QRPE 4J4PA 3MLVL 4F7CA 4NM8H 1C08A 1CGUA 3ZKNC 1ASPA 2WYZA 1C5BH 1V54B 2QSCH 4JO4L 4L5FL 4LPCA 4UCFA 1H15A 3ULVH 1JIBA 5DC0A 1DJSA 4HFUH 2Z93A 4FNUA 2V5YA 1WIPA 2VR3A 4GXVH 4QR7A 2R1YA 4LEBA 1B0WA 5ES4B 2ADIB 4P5MA 3GMLB 5LNDA 3ULVD 2CG9X 4DKDC 4AH2B 4HX1A 2X0VA 4NP4L 1TQUA 3N40P 1P6WA 4XO3A 4H2AA 4KTEL 5F1NB 4PV8A 4Q9BA 4AX3A 2CK0H 4XMLH 2A1WH 4HUCA 3RE0A 4WU7B 5CIPA 1VESA 4LCWA 4QY8A 4XN4A 5KSAB 1HOCA 1R3LA 1FFRA 4IYKA 5GS3A 2MPAH 3S35L 3LRKA 3TM6A 3CN3A 3RWCB 3KPSD 4DW2L 4IKJA 3EAKA 4NWUL 2I32A 1DN0A 1RK1B 2G3MA 2VXTH 3CIAA 1PFOA 4JRXA 1CN4A 4U3HA 4YHKH 3V6ZA 3MYZA 3JV0A 4HHGA 5EZLB 1AXTL 1S7QB 1M7DB 2XTSA 3CPUA 4WO4C 4ZFZB 2PR9A 5KBDA 1WT5A 4R8WL 2FD6H 3W9EA 2ATAA 5KYUA 5EZJA 2Y0SA 3F58L 3O45B 4F80A 4E41B 1QR1A 1J0HA 4Y4FD 4Z7WF 4KJPC 3D2UB 3VA2C 5JA8B 3FTGB 3T2OA 1T21A 4KXCA 3WY3A 4WIQA 3L9RA 4PJFF 2VZVA 5DJAB 3UEZA 4U1LA 4X4ZA 4OJFL 2X2HA 3S5ZA 5IF0A 5KYNA 5L88H 1QRND 2D3LA 5AW0B 5K69A 5JPMA 1MSPA 1ZT4B 4MNQA 3DKHA 4PJAF 1QATA 1RUQH 2YAHA 4GO9A 1TZAA 4LLMB 5GZND 4L8DB 5J9PA 3NJHA 1JHLH 2VLJE 2X6AA 5JNYA 2CHNA 4PG9B 5JIPA 5JYMA 4NPYB 1T1XB 1XGZA 4CVZA 2JFCA 1R5IB 1K8DA 2QFRA 4FFVC 1NPUA 3QAZB 1MW1A 1FNFA 3GBML 3IXTA 3V7MA 2XTLA 5CU5A 1XB3A 2R23B 1FRGH 4HU2A 3QJHB 4UBDC 5IJDC 3MBEB 5J8OA 4RGMC 1P1VA 3RKDD 3SD5A 3AG3B 2PR4L 1R0AL 2DLHA 5C0IB 2QVKA 3HRZA 4H25A 1USZA 2O5ZL 1CLYH 5DR5L 1BXUA 4WZ9A 4HIQA 4Z7AA 4TULH 4K94C 4K5MA 1EMTH 4XCNB 4GI6A 1NBYB 3AM8A 2NY7L 5LCVL 3QNYB 4MA1C 1MIEL 5BRZB 3Q8AA 3PWJB 2V8LA 3FL7A 4NRYB 4WWKD 2EDHA 4N2DA 3BZFB 3GSNA 1ES0A 3IJHA 4M7LH 5CU9A 1PEWA 3JV4B 1KB3A 4I2XE 4K9EH 5FR3A 2QDWA 1D7DA 2CLVB 2HT4C 4A38A 3Q13A 4YE4L 4HWBA 1NUDA 1IC5H 3FQNB 1MCIA 5IBLC 4JK0D 3OX8A 1C1EL 4XPHL 4WI0B 3TFKC 4ZW7A 5K9KA 3GXUB 4YDZA 2RB8A 5M95B 2VW4A 3UJIH 2CCLA 2FJGA 4L2LA 4RSYA 1MAJA 1MFMA 3DIFB 3VXTB 1HH9B 2AK4A 4O5LH 1OP9A 4EI5B 1BYOA 1AI1L 3GTVA 2E9JA 3GMLA 4QXUH 2J43A 4BFFA 2DQJH 2YA0A 2IPUG 5SX4I 4DJMA 5AVZB 4OLZL 1QKZH 4OT1H 1OP4A 1UM6H 3C5SB 3EGSA 1XO8A 4BK4A 1HH6A 3FT3B 3MREB 3SQOH 3BKYH 4HS8L 2PKDA 7FABH 4BCYA 5H2BB 3HI6L 4CSZA 2A9MH 2XWJB 3SDYH 4UQAA 5ALCL 1L3WA 1OGSA 1W16A 4U6HB 4XT1C 4FTDA 3O4LE 4PGEA 2Z8SA 4LVHB 1N5AB 3RJQB 4WNJA 3SKJH 2AJSH 1GGYA 3HNTH 5A3IC 3LN9A 1T20A 4OLXL 2QHRH 2IANB 1RIVH 3UBXG 4H0LC 4OTXH 4XVSH 4A7QA 5T33H 1QRNA 2WKOF 3CVDA 1RK7A 3AB0C 4FFYL 4G1MA 1ZGLM 1MJUH 5KJ4A 2H32H 4YQXL 1G7IB 1F5WA 2FJHA 1U8MB 4OLVL 5JW3L 2CXGA 3FRUB 1OTSD 2YPLB 4IRJC 1CPUA 1T0NA 4GG8B 3V4PA 3VXUB 4KUCF 4RRPM 4FI7A 3OZLA 2XWDA 3FT4A 4XVTL 5E1HB 4PD4J 2AF2A 4PJ5E 4BV1A 1KTJA 5JUEH 1P1ZA 4GBXD 4HK0B 2QQNH 5GGTA 4OY9A 4X4XB 4YFDB 3MKKA 5HI4C 5JLZA 5F9WB 1RZJL 1QSFB 3KCPB 4IOIB 4PP2A 2QV2A 1TZIB 4OZFH 2WJ5A 5CMAA 2LR4A 4PJHE 5TTRA 1WZKA 5DJXA 2EYTB 3WFHB 4YL9A 3JTSB 3Q2LA 5CLTA 1B4LA 4BFGA 1IEAB 2WQRA 4G8EB 3WKNA 1MLCB 4ODBD 3HZ3A 2IH1B 5DK2B 3VI3A 1IGMH 5I6XC 3QWOB 3LN5B 3DUSA 4O2FA 2VDML 4A66A 3M17A 1E3ZA 3OJVC 4O2EB 1CFVL 2KDGA 2VO5A 3PG2A 2YN5A 4NKMA 1Y6NR 1YDPB 3OV6A 4G8IA 3MZGB 4OM0H 1BQ5A 2WB7A 4MXWL 1ECYA 2QHLA 4W93A 3WN6A 4FZ8L 4U7SA 5FHAL 5ECJE 4HF5H 3BAIA 2DN7A 3N0AA 2WKGA 4QRPD 5L9DL 1A4JB 3ARFB 5T5FA 3FFCE 4JDTH 2B3IA 4E42A 3ECBA 3ARSA 4DP7X 3E9UA 5FECA 5GSRA 1Q0EA 2GITA 2O6PA 2XYCA 4U6XA 5TFSH 1L6XA 3REVA 4XP6H 5E00A 2ZCKH 1QLFB 5CXPA 3LZRA 4IIZA 3IDMA 2IPTL 4YC2B 3GXNA 4MZRA 3FQWB 5GRUH 2XRAL 2ADYA 2UY6B 1D5XB 1NBCA 4DTGL 4MJIA 1MVYA 3LRGA 2W9DH 4AZ8B 3LKNB 4D2NA 1ZT7A 3OJDB 4JKLA 5C6TL 4QRRD 5B1JA 3HN3A 2ZCZA 4FQXC 3S6CA 1A7OH 2PLTA 4Z5RB 1MCEA 2LLGA 4W68A 4Y4KB 3HAEA 1BQHG 3TBTB 1KGUA 4LDLB 4AGLA 1Y1DA 2IO5A 1PX3A 2L7UA 4X5XB 2NY2D 5KSUA 4WUUD 5GIRB 1BXXA 3P40A 5DQDL 1A6VL 2FQFA 3GHEL 5F7KC 2QPEB 1CTMA 3FU7B 4OKVB 4LNVA 3AFLA 2FNBA 2W9EL 4HBQA 5DZOA 3PAYA 1EWHA 4PGCA 4QT5B 3LZQA 3RZCA 1A9EB 3FMGH 3VXRD 4FAAB 2PN5A 4OI8A 2K8QA 2M8XA 3DX1A 3V2AR 4KMTH 3ZIYA 4PJ9A 1IAMA 5I17A 5CZKA 3RL2B 3VCLA 3TWCL 3QNXB 2C9RA 4FP8H 1D5XA 1E5AA 2VQUA 4GXUN 3MV8D 3IEAA 4KJWD 2FDBP 4DOHE 5BO0D 1VZIA 3GUTA 2EDXA 4HZLA 2KZWA 1KLFB 4D0DA 4B3EA 3V9EA 1GZPA 5F0PB 1WWWX 4F2EA 4UQDA 1C8QA 1SRDA 3FQUB 4PJBA 4XODA 4XX1E 3IMVA 4QHUA 4HSAC 3AQDA 1SFHA 2FJFB 3IJEB 1QA9B 1X7QA 4Y4HD 2F53A 4NC2B 5JXAH 2Z8RA 2CUHA 1ZE3H 4X5XA 3FB6A 3JV6A 5E8PB 5I8EA 5JIMA 2HX9A 1U6AH 4V11A 4XNXH 4GSXA 1M57B 1LYQA 1ZS8A 1U8NB 3B6SA 3N43F 2B59A 3IWVA 1TSHA 4NB7A 1T83C 2BIHA 1BEYH 3D2UD 4GIOA 4JFQB 3VXUA 4PV8B 1QTSA 3FTVA 1QBAA 3FB7A 1CVSC 4H8WL 4JG5A 5I66A 3UZQB 5FO9A 2AZUA 3OKLB 1E50A 3QQ3A 4PU2A 5ITBL 2HJFB 2XOTA 1JGDA 1ETA1 1TZIA 4PWHA 4OGQC 2L7EA 3QA3A 2D7TH 3NQKA 1RZFH 4L18A 4KY1L 2VAAA 2E7LC 1ACXA 2WN3A 3QI9A 3NCXA 2NW2B 2ATPB 3GO1H 2J6EL 2EAEA 5B38G 2DBLH 4W9ZA 1H3VA 1KBPA 1EXHA 3W5MA 3OPZH 4JY5H 1OZTG 4TQHA 2I07A 5D4IA 3WNOA 5AW6B 5EZPA 2E9IA 1IC0A 1RPUA 4WNQB 3WS3B 4N0CD 3OR6A 3ZTEA 2AJZB 4XBGA 5E5MA 1P53A 1NTDA 2N01B 4QRAA 2O6EA 3HC4L 3TIEB 1K5NB 1T5XB 2BY2A 2H26B 1ZD6A 1XDTT 3RWFB 1BEXA 5EF3A 3SBQA 2HFGL 1NCJA 1CDBA 5KSAA 3MCG1 3GRWL 5IBTL 3BGMB 4FQHA 4MAYA 1GIGH 1UOWA 4NN6C 5KVDE 4DZ8B 5F7FA 3S4SB 3SEPA 4AYSA 2C1OA 5IB4A 1G9EA 3QDJD 2EKJA 4PBVC 4WO4B 3ABLB 1P7BA 4NIYE 4UT9L 5BQ7B 1QO3A 2MCPL 3RWGB 2NYKA 2BC4A 2M83A 4E9RA 2DQFA 1DVFD 3D30A 2FL5A 2BHFA 3WFDH 3V52L 1TKWB 2W0PA 2FBJL 3A4AA 4X4YA 2OMWB 3KS0H 3HG3A 2ZOKB 1IBHA 3CFJB 1CUOA 1J1PH 1DCLA 4NPYA 4GQPH 3U9PL 2GBTA 4BFEA 3OXRA 3LB6C 3NIGE 3MRMA 5FCSH 1BDYA 4LSSL 4XMPH 2ICWA 4FGMA 5FAAA 4L8BA 3MTRA 4JHAL 3VD7A 4JE0A 4DKTA 1X5GA 1F41A 2PTTB 2V8MA 3L4UA 5EUOB 4UUJB 4OR1A 5I6NA 4Y16B 3HBPA 4BJLA 5C0RH 1RCYA 3AZUA 2BCMA 2WINB 1JHTA 3UACA 3UTOA 4ZQKA 2LFEA 4NT6A 2GSGB 5AYTA 4M3JA 4N90E 1DSYA 4PJGA 2ZUQB 4P2OD 3DRQA 4XCEA 4XGZB 1XX9C 3ULSA 5HGHB 4ZMYA 4Q97A 4IRSB 3LHPL 2HMIC 2E86A 2CJTA 4K3DH 3G6AB 4QYOB 5E23A 4RZCA 1ES0B 1Z2KA 3IJHB 4WO0A 3ZGIA 3FW6A 4GBXA 3J07A 4TNWF 2EVHA 4K2UH 3UZEA 1U41A 5LHDA 4G6KH 2GT9B 2DS4A 3IXTB 3VGAC 3VDBA 1F11A 1P5UA 3JV5A 2EIMB 3LEVH 4R4FL 1WWBX 3HPJB 4LBEA 3ULUH 2GEQA 4TVPL 4AW7A 3P1VA 5IW1A 4YIQA 3KPMB 4NZTH 5ID0A 5D7LA 1UB6B 4KK6C 4KPHH 5A40E 3RJDA 2IBZY 4JFSA 43CAA 3WFDL 4KAQH 4P2CG 1UXWB 1HT6A 1T2JA 3P9LA 2AQPA 2YGOA 3A67L 3HJ0A 3KPOA 2O6FA 2Q6WB 4OZHA 5GRUL 1A3RL 5CHNB 4X5QA 1BA9A 4KMLB 3K4DA 4YE0A 5GS1A 3DDFA 2NTFB 3TBYA 1JERA 2JKNA 3TNMB 3F65A 3V4VA 1OWRM 4MD5B 1GIGL 2GSGA 4I3RL 4K2UL 2DI7A 3MNVA 2NNXA 2I7OA 4HF5L 1A1OB 4JZJB 3QJSB 4AMKH 4KGLA 1R3KA 4GPVA 3HC4H 4ACPA 5DC9B 1FZOB 4OCWH 4ABVA 2H6UA 4L1DA 1BZ7A 2DMGA 3DLQR 3WDJA 5DDHA 1P5VB 4U0RB 3MAWA 5AKSA 2VDPH 1JZIA 3QJFB 3VXPB 4HKZA 4OJCA 1QHOA 2AVFA 4MBOA 3FCBA 4HW6A 4IOFC 4K15A 2A77H 4E68A 1RUAH 2EIZB 1MREH 1WFUA 1YPZA 4OZGA 1ONQA 3T77B 3EUUA 3GMMB 1LLAA 4K71B 1MPAL 3L1GA 4MJ5B 4YSUA 1EHKB 4WU7A 1UVQB 3BVUA 4PY7A 4KK5D 4WSJA 5IQ9A 1X6NA 2H26A 3KPOB 4FKHA 4AGNA 2K4WA 2EYSB 4RVBA 1BFSA 1CE1L 2X3CA 4AG4H 4H8WH 3U1QA 1R24B 1GA2A 4AV5A 4OM1L 4X42A 1OK8A 4HUUB 2C3XA 4AGMA 1VHPA 1NMAH 4E9SA 2WANA 4IJTA 4P23A 1T03L 5CIPH 2OLDA 1CFQB 3B1UA 2AV7B 4UDUB 3BZ5A 3NBNA 4F7CB 3UAAA 2EEBA 4DK6A 2YK1H 1ADQL 2ZOTA 3QJQB 4LSTL 1H15B 2F1EA 3R4DA 4Q58C 2VZTA 2YD2A 4JGMA 4L4TE 1B2WH 3RHWK 1RFDH 2XC8A 2X1WL 4RAVB 1BZQK 5D1ZC 4KXZI 4TN9A 3VXPA 2HG5A 3TV3H 5ACMA 2Z7ZA 3TF4A 3MRIB 2X12A 3QZMA 5E4OA 4Y5XB 5B3NA 3DHUA 3PUCA 5JO5A 1H3UA 3HI6H 5D2LE 2CO6A 2ODHA 3KYOA 4IIQB 3LZPA 2K9FB 2XFGB 4PLJC 3EXJA 4HSQA 5D7SH 3BKYL 2BSTA 2E76C 2XG5A 5K59E 1WG3A 2HT3C 3H2WA 4UMSA 4YO0A 4JVUA 5LGJB 1HINH 2VLRE 5DD6B 2OYKA 3ILEA 4EIUA 2D7TL 4QJ5B 1N26A 4JFFB 2J73A 3ZHFA 2DMCA 4K9EC 4B5ZA 2BS71 3QJTB 2EO7A 1EK3A 2JKSA 3EG9A 4GUCA 4MNQD 2CBMA 5DMJB 5DS8B 5T3XE 1WYJA 3BH9B 1N0XH 1D5IH 2V17H 4HGWA 5DI8B 1OPGL 4Z77B 1MWAA 4YDJB 2WAQA 2CAKA 3HI1A 4RMBA 3FCSA 3AADB 2OL3B 3OLIA 5DUJA 2BFGA 1ZSDA 1X5LA 1TCMA 2ZUXA 1WZ1H 2V2XA 3G6JE 1G7HA 1MFBL 3QULA 2Z7WA 1T22B 3DXAD 4EZKA 1UADC 4GG6A 3BKML 4KHXL 4XO8A 3WUWB 4M8QA 2KDYA 5C8JB 1BAWA 5DK0A 4BGDA 4G9FD 3KGRA 1HEZB 2X4NB 1LO2L 5IJCC 1QSFD 4TTDD 4S2SA 4AEIH 4MXQD 3A4EA 5CKAA 2EVGA 3F6LA 2JI1A 5DJ0B 5F6HI 4EI5C 2V7NA 5CBAA 1QFHA 1QSZA 5CFAA 2NY7H 5LCVH 2ZCKL 1W0WA 1IC4L 3H9SA 4FXTA 3P3RA 4JRLA 4NFBA 4G80B 5DFTA 2IAMA 3JV4A 5TFSL 4J5VA 4JGNA 4GAAA 3VRLE 2WXFA 4N2IA 3WJJA 4QNPF 2EADA 4UM9D 3RL1B 4OBRA 4ZTPH 1T5KA 1J9RA 4DFHA 5SX5H 5FYKU 4H8WC 3KVDD 4WFEE 4X9GA 5J1TC 4N26A 2XV6B 3BEVB 1F42A 4MXWH 5D2NE 1CXKA 2CHWA 3TN0D 2CO7A 5F88B 3V0VB 1BBDL 1K85A 1JFHA 5K9OB 1S9KC 3O3AB 3WHXA 1NM9A 5C6WH 3EOTH 4KKCD 2VRQA 3NCFB 4DEPB 4KRPB 2YBRA 1AYRA 4K7PL 1EUUA 4JFTA 1JV5B 1MWOA 1QPPA 5LWYL 2Q76A 3KH3A 1TSRA 1M9SA 5I0XA 3RZCB 1SHXA 3CZGA 3OZ9H 5I0WA 1J1XL 4M8QB 3KHQA 4Z95H 3NACH 3WEAA 4F3FA 1G7MB 3ZE2B 4K5NA 3RDJA 5EULV 4PJIE 5IR1A 1K4DA 2WSPA 3B6SB 1YY8A 2J8UE 2WXMA 3VB9A 1UXSA 3HHRB 1WBXA 4NJ9H 4J8RB 4KKAC 1CFSA 2YXFA 3MGAA 1SHWA 2CQVA 4IK7A 4KDTA 3SCMC 1AR1C 4MSWA 2CIKB 4QCIA 5IVXF 1KBGL 3DNKA 3LKSB 4A1RA 4F8QA 3ILQC 3MVSA 1CF8L 2X09A 3PIQA 2MNUA 3X12A 3MGOA 2BHYA 2OL3L 1E4HA 1KYFA 2NNCA 3E0GA 3T6XA 3TH2T 4ATTA 5EU3A 2ZZUT 3S37L 3FNKA 4PTTB 1JNLL 2J56A 6PAZA 1I8MB 4PP1D 4OFDA 2I07B 2EABA 3MRCA 4FKEA 4FRWA 1P84K 5IJVA 2FAUA 3GINA 3QZNA 1PNDA 4KRLB 1WK0A 4YXHL 2AVGA 3R0NA 5AWNL 1HNFA 4K73A 3NSFA 1JZ7A 3BYYA 1PKQA 4L2YA 1J8HB 1ML0A 4Y19D 2ICCA 2ZXDA 3SOBH 3BN9D 1HEHC 1AP2A 4RFEA 4PP2B 2EZ0C 3SQBA 4AI7A 3NK4A 5IOPA 1T6VN 4ISVA 3H42L 4MD4A 2W95A 4QTFA 3ZR6A 4IRZL 3ERXA 3L4YA 1GAFL 2HTLC 1ZJBA 3K2UL 3LX9A 4HS6A 2QV4A 3NJLA 4NN7B 5E2UL 4GXVL 1X5AA 3KZ8A 2X0WA 1TF4A 2J21A 4TQEL 3X12B 3TZVA 5C3LD 1ZA3A 2DWEB 1TPXC 1YECH 3AT9A 4TPRH 1HI6B 3RIAK 3QXAB 5B1KA 1Q94A 4QRSA 5TE6L 1LJMA 3MLTA 3OJ2C 3UEQA 1TNMA 4HFWA 4JB9L 5BCAA 1KGCD 5IHZB 3GZQA 2GITB 2QZ5A 4KXZH 3L5XH 1Z9PA 2VR7A 2X4OA 4LL1A 3B9KC 3KM2A 2CBOA 4Q9QL 3TJHC 5M94B 4PJCB 1A8JH 5A7EA 3ET9F 3EJCA 2YO3A 4MASA 1KWGA 3X3GH 5KYYB 1W0VB 2E59A 5A2IH 1KJVA 3DX2A 1MWAH 1D6EB 4LOEA 1E7VA 3NRFA 4YJZL 2XSKA 4GKOA 4WK4B 4JO1L 1TT6A 1IEAA 3WNNA 3VXSB 3ARGA 3NJMA 1T7YA 3FULA 4U31A 2X4SB 5L2KB 2JJSC 3CFQA 4P04A 1DVQA 3T2NH 2CJSA 1KULA 3OKKB 4FYSA 1ZJAA 5AFAA 2WTRB 4L3EB 3X13B 1HHKB 3L2LA 3REWB 2HX7A 1F3JA 1AGDA 2ALWA 2EDOA 2FHCA 3MOBL 1T2QH 4QYAA 4NAQA 1UGNA 1YEIL 3FFOA 2JQMA 2X4OB 2AK4D 4GAJL 5C9JA 4I2XA 4PJBF 3AQYA 3L7EB 3FOMB 4QEGA 3S4SG 5LGYA 4LIQL 5AL0A 1PW3A 3R4RA 4FNSA 1QPKA 2FK9A 2H2SD 1WLHA 3BUPA 4OB5H 1IM9D 2JCCA 3MJ9A 1I7ZA 1BCIA 5B39B 1YMHA 5IQNA 3DBXA 1ZMYA 4HWBL 5JIKA 1I9JL 1G4RA 1DVZA 4HKXA 1E3XA 1EMTL 2CUMA 3WSQH 2F53B 1AO7E 1YNKL 3WJLA 5D7IA 3F84A 5IVXE 5DFWH 4KI5D 1K3IA 3BZEB 1JGUL 1A1MA 1WAAE 2JKXA 3GM8A 3WKQA 2XFXB 4GUPB 1AFVH 1TETL 1OSEA 2Q10A 3F7QA 2L0DA 2JKJA 2ARJA 1NKOA 5ICXA 3GBMH 3O0RL 3D4GA 4JFWA 4Y5VC 2Z1PA 5GXBB 4PJEE 1BVZA 4JREB 4X4MA 1XGTB 1FQ9C 3QUZA 1AYOA 2V9UA 5IFAL 3DGGA 4HUMB 1TEFA 3B5GA 4PRHA 43C9B 4C83A 2C3VB 2QADB 1HSBB 4O00A 3DO4A 2W0FA 4B0MB 4I18C 2NOYA 3C08H 2XWEA 4AZUA 1NOAA 2Q8AL 1ROWA 5J1AA 2IBZX 1MJ8L 2ZSWB 3L3KA 2J4WH 1G7LA 1PZ5A 3OF6D 2YRZA 5HGGS 5LLIC 1RAMA 1DBAL 3ARBA 3MLXL 5GZNA 1TTAA 4E36A 1BQUA 1CL7L 3RKPA 5EU5A 5DHMC 4L5FH 5DHVH 4XP4L 1T20B 3ZQXA 4U6TA 1KCSH 2R2BA 3O0RH 1NBQA 3HG5A 1ETZB 1TETH 1KJ3L 1MF2L 2E47A 4HYTB 3SYQA 1LHZA 2XBZA 5DD1H 2HCZX 4Q0XL 3F58H 4B95C 5ELIA 4KFZC 1N0LA 2Y07L 4K94H 2FD6L 2X7LA 4NRZB 5GRYA 3BUYA 1H3TA 1A0QH 2H5UA 3BD5A 1YNKH 4QXVA 4C56E 4FN0A 1MJJB 2BCKA 1CGWA 4HKJA 4OH2A 4AJYV 5C3IA 1FFQA 4B97A 3FQXB 4L4VE 2E7LA 3WSQL 2XX1A 1QO3B 1AG0A 2XVLA 3AG2B 3KCWA 4MMZB 1I4FB 2NY6B 5C0EA 3JXAA 4P9HL 4PY8J 4WW2F 5F3BB 5J6GB 1IGCH 4HLZH 5D1ZB 3WHE1 1U8HA 3TZVD 2NY5C 4Y19B 1UURA 1RURL 1NC2D 1XF5A 1E67A 1I1FB 4U3SA 5CJXC 2UX6A 3OXRB 1UWEL 4I0PA 1L0YA 1LO0H 2WNWA 2DKMA 2P44B 1Z9MA 3DX8A 3FFDA 4I7ZC 2J44A 4GKZB 3NK3A 4EQ2A 1DQDL 3ARDB 3DOSB 4NCC1 1M6UA 3VD9A 4WNQA 3D09A 4AEHL 2PTTA 1T4KB 2E6QA 3FQTB 5JQ6H 4HT1L 1MCDA 3J2PA 5ISZB 4JUTA 1LEGA 2BERA 2IALA 1HILB 4OD3L 5I5IA 2V3DA 4PLKD 1D7BA 3SE8H 1HQRB 1NAKH 3P4MA 2A6JB 2IEPA 2JIXA 4OLUH 4KNQA 5HYEA 1MUJA 5IK3A 3LKRB 3VTTA 2GC4C 3RLSA 2E75C 5INCB 1OPOA 3DV4A 2Q9OA 5C0FA 4L3ED 3UO1H 1PZ3A 3MLSL 1X9LA 5AOKA 5I71C 2CGYA 3GI9L 4YUEL 1MWAL 1TPXB 1CGTA 4XCFL 2BFVH 1I1RA 4Y4HA 4NZ8A 4DT2A 3ETSA 3O45A 3IDUA 4P9HH 3LNDA 1V3JA 3APCA 1RMFH 4P2QA 1FAIH 3UERA 1RZ7H 3CFBA 3M1BA 3VXOA 3GK8L 1FIGH 2D7QA 3CHQA 3DRTA 3HAEB 3HLAB 1HFUA 2APTA 2Y5EA 4XPGH 1AGCB 3PP4H 4APQC 4Z18A 5CINH 3ZSTA 3QUKB 5GGRA 5IG7B 2YLKA 3WFEH 3VW3L 1T1ZA 4AKOA 1GGIH 5E7BA 5TE6H 1RZKH 4MA8H 3HG0A 2ROXA 1BP3B 5EU4A 3FUIA 4Z7WB 5IB3A 3D05A 4RDQG 3OGOE 5AB0A 2RQEA 3LZFH 3ZKXC 2F53D 4OFPA 2Z91B 2LVCA 1UCBH 3MRGB 4OZIF 2OYPA 2QPSA 3EDKA 5DHDA 3CZEA 4X99B 3AXLA 3FQ1A 3V0WH 3UP6A 1AG6A 1RSFA 3DTXA 4WGVB 1AHWA 2COVD 3I9GL 2AEOA 2DMKA 3RNKA 3MNWB 2GIYA 2XXGA 1GZHC 3FRPB 4FLRA 1WC7B 1DN0B 3VFWB 1I1AC 4LPWA 3D18A 1A64A 5DT1H 1UD2A 2QR0A 2AJYL 1H3GA 3OKDB 3MO1A 1SOQA 2OCJA 2KHAA 5F89A 2W07A 3UROR 1JF6A 5BVPH 4UTBA 3WTVA 1A6TB 3HRZB 4H25B 4XOBA 1F90L 1HU8A 5LN8A 5IB5B 3NN8B 2F7OA 5EFIB 1ZDQA 2HFEA 3BWUC 3NH7H 3SCMB 1WDAA 4KI1A 1XCQA 3H9SD 2ADJB 1A6AA 2EQDA 3ALWA 4NKIL 3KYAA 2EZ0D 3QFDA 2D8KA 3GS7A 5TF1L 4Y2DA 1JXKA 2LU5A 1P0SE 1YJDC 2PYFB 4XX5A 4NENA 4UZUA 3V95A 4LARH 4IDJH 4XAWL 3B83A 4OJYA 1MLBB 4HJGB 8PAZA 4XNUL 4ZAKB 3AXLB 3MNVB 1M6OB 4JAMB 1KN2L 4NUQA 3II1A 4RNRA 2UXGA 3RY5A 4KZ0A 1SN2A 3C75A 1T7WA 4EXKA 2AQNA 1JNJA 3I75B 2WYHA 3TPUA 3P73B 1Y6MR 4MJID 2JXMB 3K3QA 4MJ4A 5EZJB 4K4KA 1HCFX 3QHFL 4TUKH 5F7HA 4TTGA 4RMQA 1BD2A 3QI9B 4A04A 2HG5B 5DZJA 2X05A 3ESPA 3UYRL 4N2LA 2CCVA 1U8KB 3ILQD 5CN1A 3HIZA 1K8DB 4EZLA 5D1XD 4U1JA 2F74B 3CHRA 3UAJA 4JJ5B 3NIFF 3U4AA 3WLBB 2AJZA 2X2YA 4OFYA 3EDDA 1ED3B 1YEEH 6TAAA 3W39B 1KTKE 3CZFB 2V33A 1F45A 1QLEL 4MYWB 4PY7B 5FUOH 1NLDL 1UM5H 3V0DA 4RMRA 4ZNEA 5IQ9B 1AIFB 3BCFA 3FK3A 2V5RA 1KLGA 3HE7C 1AKJB 4ZUTB 1JGLL 5E2JA 1R24A 2CO2A 5AW4B 2FO1A 4HP5A 1IGIH 5CILH 1MH5A 5CJ8A 2DQIL 1RI8A 1MW2A 4FABL 2WNGA 1ZXKA 4M56A 5E4AA 1YMME 2VR4A 4O51A 1AXSB 4AQOA 4E5XG 3RHWF 4FQXA 4P05A 1Q9WB 2V2WA 4GI8A 5H37A 2YPLA 5AVVB 4W9KC 3MV7B 1RVFL 4CAGA 5B4MC 3HLKA 2HTKD 2ZKMX 5JHDB 2DQUH 2R29A 2NZIA 2PP8A 1FP5A 1W72B 4GS7B 4P8QA 3VG9C 4JQIA 2GFBB 1BW8A 3DIFA 4MMZC 4M1CD 5L4IA 3GI8H 2OCCB 3L45A 4Z7UA 3EXLA 1XIWB 4QMEA 1EJ6A 3VGDA 2GG1A 3QFJA 1CB4A 3UXFA 5DMGC 4QWWD 3T09A 2PCFA 4LCYA 1XSIA 4XI5D 2ZUYA 1KDJA 3H53A 4H8PA 4PJAB 5DWUL 1Z9LA 2L7QA 3P11L 4YHLL 2HN7A 3GMNA 2GJ6D 1SM3H 1VFAA 5ETUA 3T0ED 3NIGB 4W70A 1ZLWK 4YN3A 3MV9A 2Y2TA 2HPTA 3U82B 4BSJA 2F58L 2F7PA 2L7JA 4P3WA 4MDIB 3T04D 4MMXB 2EJ1A 2H3KA 4TVPE 4BHUA 3QQDB 2K6ZA 3ZGHA 1L0XA 4Q6IB 3O2VH 1BPLB 4GP5B 3TP4A 1CI5A 1AJ7L 1KGYE 1EZVX 4PRNB 3O6LL 3OAUL 4X98B 4HETA 3PWNB 1Z5LA 4F9PA 5FYLE 4YIQB 4NDMA 2WQUA 3KXFA 3B5HA 4B7IA 3DO7B 1T6BX 3QG6A 3GRWA 1D9KD 2ADGA 2XN1A 1KB9J 4J3OD 5KVGH 2CXKA 4GAYB 1FYHB 2ICWI 1MI5A 4Y88A 2HT3D 3A4DA 3WNIA 1RFDL 1A7PH 3KPRE 1IIKA 4P23D 4PCSA 2EH7L 5DRZB 3HW7A 2SEBB 5TDNB 1ZHKB 1LD9B 4PGBA 3H4FA 3P9WB 2CIKA 3Q8EA 4QCIB 4MWFA 4M6OL 4ZDHA 3RIAF 4MQXC 4PGEB 4G83A 2ZP9A 3Q6GH 2BDNL 3SCMD 3OM3B 5K9QG 3FXIC 1TQCB 3QIWB 3VNZA 5CJXA 4GRLA 5DZLA 4MJJA 5CZXD 3SDAB 4F27A 3CVHH 2VN7A 1BIIB 4AQEA 2LLNA 2HKHL 1F13A 2DEWX 4HLZG 4JGUA 4GSUA 1XB6A 4I18B 4PW4A 3RX8A 2YR3A 4OIBA 5A6IA 4M48H 4FZEH 4HALA 4I0CC 4OCYH 5F6IB 4PJDE 1XGUA 3QP3A 4NCC2 5JZ7C 1QP1A 2VZ3A 4YR6A 2GTWB 3A23A 2JCCE 2X4TA 3IGUA 4IBLT 1E9OB 3SBPA 1H3PH 1NGWB 1WAAF 1BAFH 1XGTA 3U0TB 2G3XA 4TNWK 5I19H 4EVNB 1J1XH 4AQAB 1FIEA 1YG9A 2AMUA 1W91A 5KBKA 2YD4A 5DEFA 3QPXL 5D7JA 5DMKA 4XBMA 1ED3A 1G7QB 3PAVA 1Z7JA 1KIQA 4KK5C 2O6DA 4N2AA 2FGWL 3BPNC 4EJ1C 1HVXA 1AGBA 1FFNA 1J9TA 2R1WB 3CFEA 1C16B 4OCWL 1BBDH 3BKCH 4L3FA 3SB3A 1O9WA 1UGKA 5D7HA 3GMQB 2X1OA 3QZOA 1GMIA 3LKNA 1ZV2A 3FCTB 1KIPB 4IU2B 2JJSA 1DSFH 1XH3B 3EOBB 3BPOC 4QXTA 1UJTA 4ELME 4JFPB 3D2UA 4ZW5A 2VSKB 4OFVA 3L48A 5JORA 5DA4A 4PREB 4PJIB 1J7VR 3VQ2C 5IB2A 3QYCA 1O5DT 2ENYA 2HJLA 5LQBL 2H3XC 2OTUB 4YVNA 4Y9FA 2ALAA 3TBCA 4P5TA 1IUZA 4F8TA 2VLRA 2E7MA 4KQ3H 3FCGA 4PJ6A 4HSCX 2HJKB 1G9MH 3QQ3B 5KYXA 5F3BA 1N6QL 4BH7A 1DL7H 3S8WA 4EUPB 4KK8C 3NA9L 1I3RB 3O9WC 2YFNA 3ZQWA 4YZFF 4NPJA 3T4AB 4MZ3A 5ECGA 1Z9NA 1FG2B 3RVUD 1AD0B 4KK6D 1AY1L 2I9LA 1NC4B 1XEUA 3FT2B 5HYSB 5L6YH 2IH3B 3MJ7A 2A9CA 2ROYA 4PLJD 2H0PA 4FG6D 4UILL 4CA4A 1DJGA 3STZA 4QLRA 4HMEA 3WCYA 4DZBA 5BZDB 3VXRA 4F8LA 2DPKA 1JZEA 3E2HB 3ZL4H 1FORL 4JFPA 5DZAA 3QC5X 1KTLB 4NNXB 4JKMA 4QOKB 4NIKB 1I9IH 2IADB 1PIFA 4LL4A 2XZQH 3IDYB 3OD3A 3UTSB 4N0RA 5IK3B 2CLZA 4NQEE 1Q9LA 4P4RB 5KAQG 1EDHA 1HEZA 2X4NA 3LSOA 3Q5OA 3VFRA 2WW8A 1PYWA 2VN5A 5C0CE 3WJMB 5DWPA 4A7TA 2WV3A 4OZFB 5KS9E 4XTRC 3MCKB 2G5BB 2W9LA 5MEQA 1N5YH 3NPZB 4JQXA 3Q05A 1T7ZA 4XXWC 2W38A 3BGAA 4JFFD 5C08B 3UYPA 3KJ4B 2XLLA 5FO7B 1JYWA 5DZVA 2AGJL 2B1AH 2BNRB 3HS9A 4G59C 3HA0A 4UT7L 1X5XA 3QIUD 2XTJE 1D2OA 4ZO9A 3VSTA 3E8UL 5D4JA 4LKCB 2JTYA 5T1KD 1CE1H 3L3OA 3HVNA 4AG4L 3UABA 2H9GA 4YHPA 2LOEA 3O3UN 4A67A 1HXMB 1QSFE 5MI0B 3T6ZA 4YR6B 4G8GB 1MPAH 1E9QA 1E9OA 2G4GA 1FVDA 4G70B 1PSKH 2J8OA 4PJ5B 1Z9OA 5CJOL 4A68A 3IMUA 2R1XA 2EIJB 3MCLL 3CAFA 4XO5A 1OARH 2J2ZA 4M7KH 3CIQA 3AITA 4EAEA 2VGLM 1SUHA 1LO5A 3LVEA 4C4KT 5HYJA 4HIPA 1IGJB 1NA8A 4YHZL 3FOMA 4LCIH 2FWUA 2NY0D 5F9WC 5GRJL 1WJ3A 3ULAB 3RWJA 3SGEI 5AVSB 3D5OF 3QJUB 3TO2B 3RVTC 3KS0J 4JHUA 3VWJD 3SKMB 4CMMA 5DEGA 3L17A 4JQVA 3EGXA 2AEPH 3CBKB 4PJXA 5HDQH 3IFNH 5I71B 3HR6A 2P5EE 4RWHA 2Y06H 4UWQB 5IBUB 2XPGA 4WKXA 5EC1B 5EOQH 1E5CA 1HAUA 3NCWA 1Q1JH 2R9HD 4YMPA 4GY4A 2Z4QA 4HH9A 4EDXB 2P8LB 3NFNB 4P2RE 4PJ8C 5H37H 4YHYB 3BQUB 3EYQC 5BUGA 1JFQH 3CX2A 5J5EA 5ESQB 5IHLB 2H9GB 5F9JA 4S0SD 1MCRA 2IAMC 4N0UE 2FGZA 4FX5A 4DSYA 1P6FA 3CSGA 3IFLH 3X1BA 5CD3A 4JY6A 5HJ3B 4N3UA 3ML9A 3TA4D 3U36B 3UG4A 4DGUA 5KSBB 4KZDL 3P2DA 1HIML 1IVTA 1WISA 2HVJB 4Y16C 4QPEA 2VXQH 2OR7A 4NQEB 3DRQB 1T5WB 2YFOA 3PABA 4XCEB 4XGZA 1JN6B 3RFZA 5DDHB 4YHOL 1HCYA 3AABA 1NIEA 2F6AA 4FP8L 1H5BA 4FG0A 1NPJA 4XVJH 2JB5H 2HT2C 1S7XB 2Y24A 3T1FA 1UT9A 4K3DL 4PI0A 5CAYB 3BRFA 1INDH 4MA7H 4UF7C 2EIKB 3D51A 1JK8B 1OT2A 4KMTL 4RFOL 5AG8A 2D4FA 3EYOB 3OQRA 1DSWA 3O6KL 3UGEA 4KJYB 2CGRH 4RSVA 1XIWC 1NM4A 4MAUL 1GCYA 4ZOEA 4OCSL 2P24A 3EZJB 1CVRA 4P5SA 5DRWA 4HH9B 4I0PC 1S9VB 2ZPKL 4FYTA 5E0FA 4U0QB 1J5OH 3A6CH 2I60H 5DQDH 1FJ1B 3VA6A 4QHPA 1CLVA 3LQAC 3PWPD 2FNWA 1U8PB 2XWBB 2AABL 2BVEA 4Q9RH 1GGTA 3PDDA 4R6UA 3IU4H 2BMKB 3VSUA 3EJTA 4NQCD 1DANU 3U9PH 5LBVA 5CCJA 1J1PL 5KYWA 5JR1L 2PYEA 3V6ZB 4LLQA 5D71L 1MJ7L 3TBSA 4KQ3L 5CD5C 3AXHA 3EH3B 3DMMB 3GMNB 4ZRGA 4NPKA 1F11B 1P5UB 3QWRD 4GQZA 5C0ND 1SBBA 2UZPA 4BCZA 3B3IA 1G9NH 4C4UA 4NUGH 1SXZA 3VFUB 2JI3A 3ZTDC 4B9IA 1FDLH 1A6PA 4MTMA 2J88L 1FFPB 2PP9A 3VWJC 5I8OH 1B0RA 4XP6L 4ZAKC 3ZMEA 1FLRL 1BVKB 4A6YL 3AQZA 1E8XA 4Y5XA 2MKWA 3IMWA 3N9GL 3ARGB 4R3SA 5T3ZH 2N59A 2YUVA 4JDTL 1KXVC 2NY0C 1JAEA 1WRFA 4IMKA 4AUYA 1NSNH 2ISDA 3FQTA 3VXME 3TO4A 1ZLSL 4Y2DC 2YMTA 1MFEL 2Y5TB 3G5YB 4PG2A 2CSPA 5EA0L 1E5ZA 2C26A 3IPEA 3V4UL 3IPBA 4AUUA 1OF2A 1O7SA 4U1GC 4HIXH 3S3CB 3QIBB 3FO9B 2NZ9D 2EH8H 2ZAIA 3QGVA 4BZ1H 2HYMA 3VH8A 3QG7H 1W9XA 3ULUD 5TDNA 2H0FA 5HDRA 1TEYA 1FYTE 4LOFA 1JXFA 3MMEA 4S1DC 3WKYA 4ZMQA 3S34H 2NQCA 4M8UA 1A25A 2C7UA 1DQKA 4XP9H 5CM1A 3ARED 1I1AA 4QTIH 3IMBA 4LO9A 4K71C 4J3TA 1HKLH 4N9OB 4LSUH 2IIJA 2QMKA 3VFUA 1UACH 2NDFA 1SLUA 1L9SA 1WAAA 1CIDA 3HC2A 4OD2B 1ONQB 1EHLH 1DQQB 5JDSB 1PIGA 4HCRA 3G6DL 1RV6X 4NERA 4OCXL 3KLLA 3KGUA 5SWSD 1BMZA 4XPTH 3P0YH 5E4EC 1U58A 2VQTA 3BWAB 3MRIA 5F7NC 2EEFA 2Y5TA 1VIWA 4IBQA 4POUB 4HJSA 2QHRL 3EJSA 1TG8A 3DTDA 1G94A 4YXKL 1VADA 5I1IL 1A66A 3MYJB 3QJRB 4DF9A 3TEWA 1OTSC 3F12B 5D4QA 4XXCC 5CZXC 3SKJL 4FMKA 3MU3A 2YRPA 3I9IA 4NZJA 4PJEF 1ZLEA 3MRJB 4A63A 4EN3A 2VSMB 4JKNA 2C3VA 4JN1H 1X5YA 5KVFE 1RJYA 4HJEA 1EHNA 3LS5L 4XPFH 4CC1A 1CDGA 5ALCH 3E9TA 2X4RA 4G2AA 2VXQA 5D93B 1YN7A 7FABL 1FCGA 4P23C 4NC1E 3ZK0A 5L8KB 2R0WL 4L1BA 1MZZA 2XQYG 4JHWH 3HZVB 2AI0H 3UTSE 1UM6L 2HH0L 2AW2A 4Z1PA 3U4EB 3BVVA 1SJEB 2D0GA 5CEZL 1TO4A 3WO4B 3HB3C 3IN0A 1BOYA 2XNAA 1KELL 1X5MA 5I0ZA 2DQGL 3Q2VA 2NY2C 1EAJA 1RUMH 2YD1A 1WIUA 4H20H 1AI1H 1BOGB 4KK8D 2YRLA 4YHNA 5DMKB 5HDBF 3GIZH 4X6DA 4UQBA 4Z0XB 3MREA 1K4CB 1W8NA 2A4ZA 1X7SA 1TJGH 1YUHA 1QLEB 4XNMB 1CD8A 4ZS7H 2ITFA 1ZGLP 3E1F1 3WJLC 2OM5A 5LG1A 3FS9A 4W9GC 5E1GA 5EU7E 3WL9A 5A2CA 1U8OB 1U3YA 3N42F 1ZPLA 4GRMA 1ZK5A 5IKCA 4WV1B 3QBTB 1UA6H 4GYBA 5IMOA 3IU3B 3AMKA 4HOWA 3Q5TA 1J48A 1M6OA 2CMRL 4ICXA 4CSSA 5FYJU 3C6SA 2I24N 1TIUA 4ZXBB 1GCFA 2IH1A 5DK2A 3CDZA 5IREA 4K5OA 5EU7C 3PJLA 3AAZA 3OKEB 1OB1A 3NCBB 2VAJA 4I0PB 5E8EB 4RWYL 2QEJA 3KLSA 1PLAA 5MERA 3LY6A 4KU1A 3K6NA 1OM3H 2WINA 5I15L 3ROOA 1MOEA 4LZKA 4AK1A 1ND0A 2IQAB 2WXRA 2LLLA 3CE1A 4DUWA 4WWKC 1VF5C 3B9EA 4PH8A 5E08H 1NGYB 2DMHA 2DQIH 2XCMC 3ESVF 1S7TB 2F54D 5FHAH 2XV0A 2F2HA 5J7CC 5CIPB 1W72L 4D8PB 1VSCA 5DJXB 5JIQA 5IR1B 1M2VA 2OSYA 3GXIA 2FT6A 1NH6A 2EDRA 1OTUD 2ARWA 4H44C 5F6HJ 3GZPA 1OGAB 5FEBA 5JW4M 4ZNCD 4ODVH 4RDBA 1IGML 4GRMB 5IKCB 1ID2A 3KBEA 4P59H 3QZPA 4MMXA 3QUXB 5HI4D 3WS6C 2RHEA 2VMJA 4HWUA 1EAOA 4YX2L 4MA3B 5KBNC 1UB6A 1QRKA 3SHSA 4WKZA 2EINB 5EEXA 1YEDA 3T6QC 3IRPX 5FO2A 2EO1A 3KDMA 3MFFA 2Q86A 2H32A 5F0MB 1JZDC 1RZKC 3NJXA 4CN1A 1YMMD 1JGEA 1U30A 4FG4A 1UQSA 4AYDC 4JANA 2O5XH 5J12B 1I82A 4HWZB 4PS8A 1IAII 4Y7MA 5ITFB 3SDXA 2HKHH 3WUZA 4I0KA 3RWEB 3DVNA 3WIIL 1QNIA 1MHCB 2X2UA 1KV3A 2VXUL 3RPBA 3VJ6A 1DLHB 4M5YL 2FLMA 4NN5C 2IFGA 4YXLL 4U1LB 4YQXH 4Q14A 1P4BL 4CMHB 3BSZA 3T0EE 3BDXA 2RACA 1OOWA 4KKNA 3HNTL 5DTFA 3RNQB 4HUNB 5EUKA 5MENA 1VEPA 3LPWA 3U7WL 1T7VA 3KR3L 1BLNA 3FO0H 3V5DB 1XL4A 4MYPA 4O9HH 1QRNE 3ECUA 3ZY7A 5AAWA 4BINA 4YNYB 2NYYD 5C0DA 1REIA 1GKEA 5E1QA 3S35H 3QQDA 1PG7W 1HH9A 2AK4B 3H4HA 5J4MA 2ZNWA 3SZ6A 1EXUB 2FJFA 3QH3B 4ZMAT 1S7RB 1S4IA 1KBVA 4Z7QE 3HG2A 3NN8A 4HEMA 3ZE2F 1FNLA 2BLFA 4OZGF 1CD9B 1SOXA 2EDBA 1RXLA 5KBLA 12E8H 2A38A 5DU7A 2X6CA 5GS0D 2B59B 4LE8A 2BNQE 1C12B 4P3DA 2H8PB 1NBYA 4XXDA 3V0WL 2HT4D 1SM3L 2DIEA 3FB5B 3FQRA 3N91A 2GTZA 5HHVL 2YHGA 4P2OC 5AL8A 4JS7A 4Z7UF 1G6RB 2WQWA 5EOCH 3KPSE 3MLVH 5GS0H 1YMHB 1QFPA 3WL9B 3VD0A 5BMFL 3C5XA 3H9SE 5LKNA 3V6OE 2HWZL 3FQUA 1EA9C 4PJBB 4PV1C 5CJ5A 2R4SH 1A3QA 1D5BB 1ACZA 3BWSA 1FO0L 4UDUA 3KYMB 3LRHA 3KNBB 1JCVA 1J1OH 1NCIA 4NFDA 5H35B 3S36L 2DQTH 3FFCA 3KEHA 1JD7A 1ZXQA 4U6YB 4Z7QF 1G6VK 1QW9A 5D2NA 1AS8A 3ZHNA 5FF6A 5DUPH 5IIEB 5I1DA 4DP1X 1DJXA 3GMOA 2DM2A 4ZPVA 2YMXL 4IEFA 3E1ZA 2NRDA 4RCAA 3WFZA 4FQCH 4BKLB 1H9VA 4MJIE 1FAKT 2PUQT 2UUDH 3GI9H 3HE7D 3SPVA 2ESVD 5CEZD 4HXBH 4PJCA 3EJYD 3VG0L 2CDEB 3L7FA 3FPYA 1ZV9A 2P5ED 3NIGF 4OZ4B 5J1SC 2F5AL 3KPQB 4X6BA 3Q48A 4PWJA 3W39A 4LNRB 1IGIL 2FSEB 1A5FL 5HDOA 1JK9B 4YO0B 5BW7C 5LGJA 3VQMA 3MUGB 5DHYB 1FG2A 4BUQA 2DWYA 4M5SA 2EVJA 1FF5A 2WPGA 3D85D 1CYGA 3FSZA 1AR2A 4F15C 5ACZA 2APBA 1NAKL 4HK3J 5DGQA 4YPGA 3CUPA 2ZX5A 2R0ZH 3ARRA 3VQ1C 2PW1A 5D72H 4AYEC 3X1GA 2OR9H 4QHLB 3FCTA 1ZWIA 3HZKA 3OAWA 3ULVF 3RU8H 3AREA 1VEOA 3EJQA 3D85A 3KWVA 4JZNA 2CDFA 3BE1H 4WI6A 3ZRSA 2YD5A 4N8VB 5H4ZA 3FU3A 4WY7H 4K8RL 4L9DA 3MTXA 5J6SA 5EEWA 3MV9D 4MXVF 2CZNA 5A2BA 1Y18B 4G1MB 1MHEA 3VD3A 2XWXA 3ECBB 1I7UA 1XGYH 5I30H 1U2YA 4G42B 5I74C 3DWTA 1WVZA 3REVB 1QTPA 1DCEA 1A1MB 3GLEA 4UUJA 5GPRA 3QWRA 4HOMA 1LQSR 4RIRA 2ICES 5D8JH 4Z3FA 3DVNB 3EFDH 3MRKA 5C0IA 3SSGA 3I6GB 3IETB 2NY4B 4DCQA 3L7FB 4PJGB 2QQQA 1FWXA 4M7JL 2GBVA 2FJUB 1U8HB 3IFPB 2X10A 1RK0B 3C5JA 4NQTA 5FYJL 3DXAE 5CZRA 3QS3A 2LGNA 2O30A 3VVVA 2D03L 2PO6C 2F19L 3F5WA 2F53E 3ASNB 3JTSA 1UKTA 3DUHA 4GSRA 4LB8A 4PRPD 1KJ2H 3HG1D 1XCTB 3KLDA 5K9JL 4XP4H 3L8QA 3LIZL 3W2DL 4OI7A 1ACYH 2IG2H 3WEBA 2BSRA 5IW1B 2ETWA 3OKNA 1FN4B 3UTZB 3F7PC 1RU9H 2AKRA 3WTSA 1DBAH 1UHVA 1E9PB 1MCJA 4LCCC 2W65B 3WD5H 4DGYH 4NSKB 2A6JA 2JIXB 4PRHD 3O4LA 2R7EB 3QUXD 4PRBA 4RAUB 1G9HA 2MQ3A 4KUZH 4W9EC 1WA2X 4D0CB 1PG7H 5DHXB 1E4JA 4JVWA 4AITA 3DPDA 3B2DC 3TIDB 4FJYA 4IOSA 2B14A 5LAXA 1OLZA 4MSWB 4N2CA 3VWKD 2VMDA 1OSPL 4NRZA 2L3BA 5FW6A 3UGUA 1HS6A 1YY8B 4PSPA 1N70A 1OV8A 4P3DB 4A2HA 2NY5H 5HYQB 1RU9L 4X5LA 5K93A 5TJWK 2W60B 4ALAL 1OZUA 4AW4A 4L3EE 1EGJA 2ZWYA 4FQQB 4IS6A 1KTBA 5BJTB 1S8DB 4CMMB 5D9SA 3IXAB 5IBUG 3ZE0E 3FF7A 3FPXA 3AG4B 2Y7SA 3SBRA 5KW9H 3DX7B 3GSXA 4L37B 4X7CC 5M7QA 4FYQA 4XNBA 4C58B 2D7PA 2BX5A 1DQML 3ES6A 5K9QI 4CKQA 3GFUA 4MS6A 2Z4QB 1SJHA 1V7ML 5IEHA 3ECWA 4M7JH 2Y7OA 3U1SH 2AQTA 3UJJH 5I8KL 2H1XA 2KQMA 2YD8A 3L3OB 5JHLH 1J0KA 4Z3EA 2X7LB 1NWPA 1N7MH 1YPZB 3NZUA 2XIBA 3KJ6H 4O02L 2PO6D 4RGMB 3QYMA 3FN0H 5JQIB 1RPQA 4L9LC 5E5LA 2Z31D 2EXSA 1CR9L 3AVEA 5HYFA 1S9WA 3I74A 3K72B 4ZMXA 1HQRA 2EYSA 1MCOH 1T04A 1UWGL 3EJZD 3MRLA 4OCLC 1HJCA 4NQEA 4EN3B 1Y0LA 4FTVA 2WLYA 4JRWA 4TKWA 2IXQB 2F54B 4LAQL 2A6DA 4JVPA 2YSSB 3HHMA 2NZ9C 4YBLC 3UMNA 1QUPA 3ZLQC 2ZSVA 4HIEA 3NA4A 4B3VA 1UD4A 4DIXA 4HS6B 3WAKA 1P4UA 5E6YA 2ZWLT 3DX8B 4FA7B 1J05A 2R0ZL 2XZZA 4P0DA 1JXDA 4KH9A 4F33B 4UV4L 3N04A 2QVTA 2Z31C 2CNZA 3BPLB 2WUCH 4TUOB 3W56A 4ZXBA 1U8LB 3VXSE 2RD0A 3KH4A 3NPSB 5LBGA 3QARA 1E40A 3D85B 4JZNB 4HLJA 5D1QB 9CGTA 5TE4L 4GFTB 4N0FA 2F5AH 1IQDB 5G5DB 4N6QA 5JIIA 4X6FA 5FLVA 3QNZA 5KZCD 1QSVA 5DVMA 1KXQE 1OCWL 3GSOB 5B7MA 4ELDA 5F9JB 2DKSA 2WTPA 5F3FA 5BOJA 5C0NC 2YMXH 4WO4A 3RVVD 1J18A 1IGCL 1RHFA 1UKSA 4XNYH 4LLUA 4O02H 4P46D 1FGVH 3HJEA 4WWKB 1MCSA 4BFRA 5JYLA 3DI3B 3R06A 2F8VA 1ZVSA 2O5NA 3UP1A 4M1DL 1AGFB 4PMFA 1IC7H 1HESA 3B3IB 1QVOA 2DQEL 5KYYA 5I6OA 2DJMA 5EZOL 1W0VA 4M8VA 4LQFL 1F4XL 3QA3B 4BRJA 3EOAA 5A2AA 3ENEA 1HN1A 1OGPA 4HJ0C 2RALA 2NMSA 3E38A 2WM0A 3KPPB 4X6CE 2R2EA 4JZOA 2EUVA 1NUNB 2IH8A 5EU6B 1J12A 3LKPB 1XGRB 1NC4D 3G9AB 2MOQA 5E03A 1YUKB 3G3LA 5HJGA 4I9WD 4ZI8A 2RFXA 3APDA 5HHVH 2CA3A 3A6BL 5I1CL 3G5XA 2ENPA 4L1SA 3PL6B 3WUWA 2IAAC 3RG1C 1A6UH 1KCUL 1NGPH 4PD4K 4PG2C 3SGEH 4OV5B 4NQDD 1E9PA 1GGUA 3DVGA 2R29L 3C8KA 3RWEA 3KWWB 5HD8D 3K2UH 3HRZC 3SE9L 3C08L 5HGHA 3ULSB 4FQLL 4JDZB 4XVOA 3VVWA 1YEKH 1MH5B 3FUHA 3UC0L 3VI4A 2YQ3A 4FQJL 3QIUA 4HGWB 3CVHB 3WD5L 4LRIC 2JCCB 4ZSOA 4BH8A 5EDXA 1ZHLA 4AWJC 4LHUD 3VFPA 3UTPE 4UM9A 1MDTA 3O2WH 4QHMA 3O6FD 5CZVL 2QR0B 1CD1A 4PRAA 2K70A 1T0MB 3FQNA 5IEKA 2ADFH 2B5IC 4PB9L 1AFVL 2AC0A 3MFGB 2BW5A 2WO2B 3IPFA 1KGXA 5B8CC 2NY4D 3DBXB 1JGUH 4C56B 1RSYA 1BZ9B 2G4EA 3ZRFC 3L3GB 5DEJA 4PBWD 1XQ4A 1G7PB 1LVEA 2BJML 2R1YB 1I9JH 3GSWB 4TVSa 2QLYA 4F2ME 3OG6B 5C07D 3LZOA 3RWHA 1LEIB 1RJLB 5ACLA 3EO1B 3WO4C 4MLIA 1NFIA 1FH2A 3L81A 1MRCH 2D7OA 4P5TC 4LIQH 4BE5A 1A14L 4FC3E 5I0DA 3Q6FB 1DE4A 1UXMA 4DVBA 3KL5A 3S2CA 2I9TA 1M56B 5AQ0A 3U2SA 4PRHB 3L1OL 2YXVA 1MFUA 4OCMC 3QEQB 4LASL 1OAYH 1RZ8B 1SEQL 2HG0A 4M9OA 4ZS6D 1MCBA 1GH7A 3ARBB 3NACL 3CQQA 3CMOH 3KVQA 5AW7B 1AR1D 3TO2A 4QRTA 3OHXA 1WCBB 4K07A 4QRRB 4AJ0A 2BK8A 4U49A 2PTUA 5I23A 1K2DB 1NDMB 1T80A 2FCBA 3DBSA 3SYPA 1O5PA 1U8IA 1M7DA 3DX0A 4ZFZA 3WEOA 4IGBC 3KNBA 4JEGB 5GRVL 4F7MB 1BF5A 3HCVB 1G7MA 1I8LA 4OI9A 3T8XA 3F7RA 5E99L 3QISA 4P57A 2VLLA 4R90L 5HVHC 4N0UA 1W72H 5FECB 5E6IA 3DO3A 3SD2A 4RAHA 3Q3GA 4UQCA 2P8MA 2DW5A 5F1SA 3B9KD 4JPSA 2FYYB 1T21B 2AK1L 2RJMA 2BIQA 5AZEL 3FQWA 1NUFA 3QNZB 1P1ZB 1M05B 4NKQB 5GRZA 2VW6A 5B1JC 1IT9H 5HGDB 4PHZA 5E70A 4X4XA 4HIIA 5JLZB 4FXKB 2OMZA 3GSUB 3TN0C 3SKOB 3ZE1B 1PL3A 3PWPB 2RGSA 3ZU8A 5JW5B 1BFOB 1JZ2A 3CVBA 4Q9QH 4OBSA 2ESVA 3QB7C 3BLKA 2GJPA 3T2PA 5CKGA 4Y8AA 3AW5A 1BFVL 3AS2A 4MX7B 1BXVA 1UZ8B 3FU9A 3I6LD 3KXFD 4LOUD 3VE0A 3LKQA 4BZ2A 3T1FB 3K6OA 4MXQC 2BY3A 4QOKD 1JYNA 4ONFL 2CR3A 4GKZA 1WIOA 1HHHB 2B1HL 4TQ8A 1Y18A 5D7JB 4OSUH 3GMMA 3JQOB 4G6JH 3TVMB 4QAWA 4ETYA 1L6ZA 1P4IL 2C1PB 1JWUB 2ZWZA 1CE6A 2QVMA 3PQYD 3CVCA 2QZQA 2PYEE 3HMWH 3JT0A 3KWWA 2OP4L 4NNYB 1DQTA 4FQIH 5SX5K 2COQA 5TDOA 4TRPH 5I26A 1ULVA 3EFFB 5B1BB 2QGEA 2OMZB 2DQHL 1X5HA 1V5JA 5J11C 4CDGC 4CNIB 2NTSP 5IMOB 3O11A 4BH8B 1FL3B 4WAFA 4ADIA 1EGJH 2P49B 4KO5A 2H47C 3RI5K 1HZLA 1HQ4A 4ZUVB 4N6RB 4YXHH 1Y1UA 3BVNB 3IMTA 4M8RA 4PVLA 1SXAA 2F1BA 3GTTA 4O9HL 5GS2H 4L23A 2BOCA 1UZ8A 4NZDA 1N64L 1HDMA 5TE7H 2C3HA 1MY7A 4XC3H 1JNLH 2NUTB 4LPUA 2H1PL 4XWOC 3QCUH 4AL8C 1MFCH 1PZAA 1QYGL 3ZPDA 1XH0A 4K23H 2XU9A 2OMXB 1MI5B 2J6EA 2V7NB 4WWNA 2FX7L 2K4AA 4NSKA 4RAUA 5AAMA 1FSKB 5I1EH 3MRGA 2BSSA 2TAAA 4WW2C 2IF7A 1VKXA 1LEIA 2BSTB 1XH2A 2XG5B 4JFHD 1U8CA 3ZDYF 4OM1H 2IWKA 4N2KA 3TIDA 5I2IB 1IEHA 4G5AA 1AQ8A 4F5CE 3WTWA 4ZOCA 1P7QB 3V4VH 3V6BR 1F2XK 1J8RA 2ZOLA 3PQYA 4J12A 4X0NA 3U83A 1CWVA 2G0LA 3CJJA 3MDJA 1HJBC 2GBAA 4PVMA 4FERA 2HB0A 4KKCC 4QTIL 3NZSA 4OFYD 5FUCC 3ARQA 5I82A 4Z77A 3BQVA 4HCRH 2YA2A 1I7TB 5I1HL 4NJAH 4UZSA 1TTCA 4WFGD 3HPLA 2AJ3B 1RHHB 4PJ9C 5LWYH 5DJYB 5T1DL 2BHUA 4MGXA 1CC3A 3QFJD 3SQRA 3W0WB 4KITB 1BD2D 3QG7L 1H8OA 4L9LB 3WIFB 1S3KL 4WDIB 4DK5A 5I8EB 4CU7A 5I6LA 1D3CA 2YA1A 5I9QC 1G7IA 3V4UH 4AV0A 3IGLA 3CCHB 3V8OA 1ZT1B 1A3ZA 1YC7A 3EDFA 4IOFD 2XIIA 1XCQB 5FGBA 3SZKC 3MCKA 1EEYA 3H9YA 3UC2A 5DJ8B 2WLLA 5AVUB 2GK2A 1F02I 2W88A 3QDJB 2NW3A 4UAOC 2FZ3A 5D6CA 1MQKL 1N5AA 5CP3H 1FPTL 2YGVA 3RBGA 3B2XA 2ZE0A 2WXKA 3MYJA 3F83A 4Y2DD 5DFAA 2A6DB 3EBGA 4ZAKA 5FUZH 2LU4A 4PR5B 4ODSH 5MHSE 2R83A 3MSPA 4J3OC 1GPOH 2E3VA 1NC4A 3FT2A 5I5JA 4HUXB 2BP0A 2A9AA 4FXLA 2MPVA 4LCWD 3VMPA 1I8AA 3N1GC 4Q74A 1ITBB 1E0OB 2YAOA 3VWJA 1CYXA 3W0WA 5KSBE 4P5TB 2JELH 2B15A 2CDGB 3U0WL 3GSVA 3HMXA 5EU6D 4Q9RL 3PGFL 1XAKA 1T5XA 2XNAB 3N44F 3VFNB 1A4KA 4ZS7L 4ETQA 5IP4A 2CDEA 4N68A 3GXTA 1TJGL 3WYRA 3GHPA 2WD0A 4D9QE 1N0XL 3D52A 4LNRA 4NQDA 1E8WA 5F1NA 4KK9C 1CIUA 1IGJA 4ZJ9A 3LHPH 5TPWH 2IBGA 4JDVB 4AV4A 3MCYA 4R84A 5MEPB 3M7OA 2DQGH 5E00B 2WLLB 2VIRA 1QSEA 4LU5H 3RIKA 4CILA 2P5WA 3NG5A 4PJAE 3MLUH 4PGJA 1HL8A 3BH4A 1BLIA 5HHOD 4DN4H 3AGVA 1KTDA 5B8CA 4DK3A 4TYUA 3OJDA 3AREB 1DBML 1O75A 5MHSD 3VFGH 2DEYX 4TLTA 1GS7A 2D7NA 4WI2A 4Z23A 5DUBA 3O6FB 1QI4A 5HTSA 3GMRB 2GUYA 3MBWB 5BV7L 1NKGA 3HAEH 3VWKA 2X4PA 3OSVA 3WXWH 3N85L 4D0BA 4E42B 1JE6A 1WO2A 5DJ2B 4Z7IA 2GAZB 3V52H 4PJDA 4LEOA 3GSVB 3AU0A 3LB6D 2AEQL 4KI5E 5TQ2H 5I6PA 5EDSA 2WZ0A 2MCPH 1UATA 2JB6A 3ABZA 3KD4A 4RA0C 5E2VL 5KSAD 4CN4A 1F8TH 5AKVA 2CUAA 1FH5L 3H7BA 4PWIA 5E2VH 1K5WA 4NBYB 3BO8B 4QRFA 3SYAA 4Z3HA 25C8H 3D06A 1IU1A 4Y9BA 2BNQA 3ZDWA 4NFCA 1DP0A 2C9XA 5C09D 4HS3B 5HDQL 3Q2WA 4AC2A 2ZOUA 1O7DC 4IBZA 1F4YL 1KOAA 3H9HB 2XTJB 5KJRL 4FL4B 4ES9A 2FX9L 2E46A 5CR1A 3FTWA 1HKLL 2WUBL 1L6PA 3NIDB 1INEL 5T1LA 4AIZB 3NESA 3T1WA 4RLDA 2IBBA 2NT1A 3FCUB 4M7ZB 1LP9F 1ZWIB 4ZS6C 1NUGA 2JLPA 4KO7A 5DHVA 5TQ0L 1P7QD 2B0SL 4BHUI 4FA8A 5A43C 2DI8A 1LWJA 2KC0A 4MQTB 1HI6A 1KN4L 1U95B 4MZIA 5HHXH 3UBXI 2V37A 3LRSB 4OZIA 1G0DA 2EH8L 2P4AB 1GTFA 1TVBA 4U1IB 3FOLA 4HWZA 5FV2A 1GZQB 1IJ9A 3E6FB 4GAFB 4K3JL 1KCBA 2FX9H 3QDGA 3BVXA 5T1MB 4ECNA 3GUFA 3ZO9A 1NCWH 1TXKA 2HFFA 4PGBB 1YAZA 1OAUH 5CD3B 3E80A 3V0FA 1BEYL 2ZX9A 4WWOA 1VFOA 5CD5D 1ZANL 4RX4A 1R3JA 2AGJH 2B1AL 2VL4A 1ORQA 2WVVA 3KBPA 1SLXA 4L37A 5CUSH 1FHNA 4Z7VE 3ZSSA 1U92B 4QJ4B 2AEQH 5TQ2L 4NKDB 4U1MB 4JMXA 3VXTA 5EC1A 5EMYA 2A74C 4XPAL 4WEMB 1S5IH 3BN3B 5F89B 4DAGH 1G1OA 2B8OT 2EDFA 1MJ7H 1WBYA 2WXHA 4QRPA 4HPYL 1RIHL 5HDBE 4AY0A 1NCUA 2DH2A 2DQMA 2IWGA 3S88H 4GQQA 4KRPC 3MRNB 3HVDA 1S9WB 4IJ3B 4LVNC 5DD6A 4LHUB 3VXNB 5CEYB 1DBMH 4TL5A 3BAWA 3DJZA 4PJXF 2W0FB 2HT2D 3BIKA 4ZFFA 3MLUL 4F8NA 4GT0A 3ZL4L 4X7SL 2JKRM 3MRRB 3POCA 2R0KH 4ELMB 3KPNB 2DLIA 1J0YA 3ECQA 4X5RA 5TPWL 1AD9A 4I77L 4KTYA 5C9KA 1G7HB 3II3A 1LNUA 3GHEH 2JJVA 1PZBA 1SDDB 4XVJL 3HOGA 5JMOC 4BCXA 5EUOE 5JOPD 5IVZA 3PY9A 4Y2OB 4OLEA 4HBCH 2ICEA 2JELL 3IS0X 3OAZH 2VITB 2VDOB 5BXFB 2Y22A 3FT4B 5BS0A 4GINA 1HIMH 4UNVA 1A2YB 4PN6A 4LCCA 1RIHH 2ENQA 3H54A 4QXWA 3SODB 1KC5L 3NJVA 1PEZA 2APSA 5D70L 5AB9A 1Y7VA 5HHMD 5TD4A 2DIBA 3RFRA 2DZEA 2W9DL 3SO3B 2CWRA 5IHUL 1I3RA 4ODSL 3GSNH 4P9ML 3R06B 5HSFA 1R3LB 3MC0A 2YD6A 3QXTA 4AJVA 5FYLD 4NRXA 1ILSA 1NLBL 1UASA 4OV6F 1VAHA 5FCUL 4PY8I 1CMOA 2NZ1A 1R1CA 4Q56A 1E5YA 4ZXBC 1N19A 1G1KA 3DX6A 3CFNA 4YSQA 5T3ZD 1DVFA 3IFNL 1CD0A 3GRWH 3F00A 4LF3B 1N67A 4NBXB 1AC0A 1HE8A 2IV9A 4DEWA 1ZGLA 3HZVA 1FL3A 1JZ3A 4BE6A 3CZSA 3O6MH 4L3AA 4F93B 4QRQB 2F74A 4XR8C 4MXVE 3EYFB 4EKXA 1NBZA 5GGUA 3S96A 1SXBA 4JQIL 3UG3A 5E2TL 3G5XB 5DYFA 4LEXH 1S3KH 5JHMA 5F7AA 4YHZH 2J55A 1JWUA 4NQVB 2P5EA 1A7QL 5IF0B 1AZZC 4Y5XC 1JZGA 1PSKL 2W81C 1W8EA 3HNVL 5EBLB 3U4KA 4G7YL 1P4IH 3BW9A 3ESNA 3SGJC 1JP5A 4QGYA 1G7JA 5IVXA 4L4JA 4JRXB 4JHZA 3UDWA 3UYPB 4OJEH 4FZEL 1PJ9A 1I1AB 3FFCD 1KEGL 1HHIB 1CCZA 4XVTH 3PXHA 2FIKA 3N50A 4Y4HC 4XN8A 2FLBT 4F91B 3N42B 4OLYH 1XV8A 3H3PL 4FTVE 1UH2A 4YEFA 1OB1B 3KPMA 4OLVH 2GUOB 5BOPA 2IFFL 1DTUA 4CBPA 3BHBB 3NVQA 2BDNH 2Y36L 3TH3T 5H94A 2E6PA 3STLA 4M6OH 4JG0H 4JM2F 4WCYH 3WJJC 3WMPA 3MLZL 5KBPA 1A8ZA 2NQDA 2LFGA 3PCYA 2ZYIA 3U9WA 2ADIA 3EO1A 4POZC 3OMZA 3AY4A 1WA1X 2G3NA 2NTFA 4DP9X 4GKSB 4J2QA 3CFKB 5FYLH 5FYJD 2KYIA 2YQGA 3OAYH 2VDRH 4N1HB 4WRLA 1F6AA 5A3ID 3L9YA 1B4JL 1LD9A 1CFTA 3BW9B 4XRCB 1SQ2N 1CDCA 4MD0A 4Y4FB 1VGKA 3OAUH 4W4OA 4V1DE 4HC1H 1D7CA 3EBAA 2GB2A 4QXUL 1YEDB 2ZAGA 3H55A 4GXFA 5E99H 4DESA 1D9KC 2AJVL 3P69A 4MNQE 4FA6A 2B16A 1WFNA 3QQNA 1QFWI 2VOTA 3IJYB 5C0GA 3O8XA 4XNAA 1P4LA 2XETA 1CGXA 1FNSH 1QX1A 4LFHD 1YA5A 2MCAA 1XGPA 4K0OA 2JQZA 3CVIL 3B4NA 5D1QE 5DWUH 3LEYH 3RZCD 3H3BC 1N18A 3GEWB 4X6DB 2ZICA 5T1LD 5FDWB 3NZ8A 2ZYRA 5FOBB 7TAAA 1IAIL 2DTML 4I3SL 2DJUA 5GQBA 5I66B 1AMXA 1JPTL 2B77A 2WQXA 3MLYH 3OKMB 4N4YB 3DYPA 1BFVH 1RJLA 4FMVA 4L3CB 1T1WA 4YEEA 1ZVNA 1UJ3A 2CPCA 2E0PA 1DQJB 1MHPH 3SYOA 1KIQB 3EIFA 1YCSA 1XMEB 3CSFA 1JRHI 1MIEH 1NDGB 1Z0NA 1XHHA 5HGAA 4PJFE 4LKXA 3SBWA 4EQ3A 1QACA 4MQ7A 2HVJA 1C16A 4OJDH 4AVJA 3I75A 2BP8B 4NRXB 4YDIH 4HAGA 2A99A 3U0PB 4UAHA 4YK4C 2XN9E 4EN3D 4PJ5D 1JYXA 2XI9A 2AK1H 1C5DB 1P5UC 2HTKC 5AZEH 3UTQA 4BD4A 2VQ4A 1EH9A 5FM8A 4PJHA 1YPZE 1S7XA 4YZFE 1TTUA 4GI9A 4QTHB 5D1ZI 2EC9T 1LDPH 3S3DB 4UB0H 1JHKL 2GCYB 4XMWA 4PEEA 5J89A 4CSPA 1OAQL 1YEEL 3GNML 5JZ7D 2FWLB 3AS3A 4AIOA 1VZGA 3SJVE 2PETA 2OW6A 2D9QB 2NLJB 2WNKA 2YD0A 3BGFB 3O2DA 4XCNA 2OZ4A 3RWGA 1DLHA 2JKWA 5E94A 2EUXA 4AYFA 3U7AA 3I2CH 4L48A 4E0RA 3VRJB 2R69H 4H88L 5AALA 2C1OB 5GHWH 5IB4B 2VABB 4NQED 3VYOA 2G60L 3VFTB 2IWFA 1URLA 3FCSB 4J28A 5T1KA 3BLBA 4XWGH 1PNCA 2IANA 4MQXD 1MQ8A 4MCYB 4ZW6A 3ZZ1A 3WAJA 4UOW1 3KDMB 4TSCH 3HR5A 5D1XC 4RDQF 2XBDA 3LXUX 3OKYA 3VI3F 2PO6A 2X4PB 3NSDA 5JW3H 2TRHA 4XNUH 5DZ9A 3QSKB 5DK0B 1BIHA 4RBPK 2ZAHA 2OTUA 3FTYA 3VXRB 2A4EA 1CU4L 4OTXL 3K91A 1NFDE 1QQDA 2MKLC 3MUHL 3QWNA 4XVSL 2DQEH 2YBRB 3LKPA 2UV3A 1U95A 2W59A 1FNAA 1UCTA 3I9PA 4NI6A 1B3JA 4XN2A 4YHKL 1Z1WA 2IADA 4ZX5A 5TE7L 3UTSA 3VD4A 2EH7H 1DQLH 4LOVA 1CICB 4PJCF 1JK9A 3VI4E 4D9LL 1DVXA 2B1OA 5GS0C 3DGGB 1KIUA 1E43A 3PJNA 4Z3TA 3J27A 2CJUL 3MLWL 2XN2A 3CFKA 2GY5A 2YC1B 4ZSOE 2MJWA 3WELA 1R3HB 1EEUA 4LP4A 3H9HA 3FONB 5D7KE 1ZV5A 3MV9B 4G8FB 3MJ7B 3TN0A 5C0BA 5JPNC 1F97A 4YBHA 5D5MA 4XMLL 5AZ2H 2BVOB 2Q7YB 5F88A 1LO4H 4J1UA 1GXEA 2FUQA 5K9OA 4WHTB 1NBVL 3FF8A 4L0PB 3SJVD 5CBEA 1INQA 4QKTA 1JPGA 4WTZA 2LTQB 3ULUE 4HC1A 4QWWC 1DVYA 4O5LL 1F3DH 4HKXB 4N90D 3X3FH 4FQXB 5AAWC 4GW1B 3SY0A 4HFUL 1EIBA 3CC5B 4JKPH 1TVDA 3E6HB 3QUZD 1Q9LB 4XOEA 2NXZC 1I1AD 4ABWA 4OD2A 4JO4H 3HS0C 4BDVB 2XWZA 4ONFH 3V0IA 4Q6KA 3HG1A 2K6WA 1JI1A 2XT1B 2Y7MA 2BVQB 1PYWB 5EBWB 4XZUA 1EEYB 5B4MD 1NIAA 3ZE1F 3PAUA 1R19A 1VDGA 2AEWA 1OL0A 2EDYA 4FQ2L 2AJXH 4MDRA 4PGCB 4CGTA 5DRXB 4NGHL 4KQ4L 3MN8A 3LMJL 4ZFGL 3QIBD 2H41A 3BWAA 5CINL 2FZ3B 4R4NC 1PF3A 3PDOB 4XPGL 2IQ9L 1QBMH 3FKUS 1XSOA 2VWEE 1C08B 4GRLB 4JRYA 3L95A 3QUYD 1E30A 1A7RL