3WKQA

Copper-containing nitrite reductase from geobacillus thermodenitrificans in complex with formate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
299
structure length
299
Chain Sequence
b'NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Copper-containing nitrite reductase from Geobacillus thermodenitrificans in complex with formate
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
total genus 102
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wkqA00
2FNWA 4FAAB 2UXTA 3V9EA 1MG3C 5B1JC 4DP5X 3QJVB 2Q5BA 4YSRA 1AR1B 1GY2A 5EHFA 1BEXA 4KO9A 4UANA 1GS8A 4JHVA 2J5WA 1SDDA 1XB3A 2GI0A 4KNUA 3NP4A 3FSZA 2ZXWB 2VW6A 2DWTA 2PPDA 4KOBA 3UAEA 3ASNB 1M56B 4YSAA 3EHBB 3OMNB 6PCYA 4M4RB 3FU7A 4GXFA 2H5UA 4AKPA 2LLNA 3NJJA 1AZRA 2OJ1A 2X87A 3FSWA 2ZONA 2MRYA 3CG8A 1RCYA 3NJLA 3PAZA 4KOCA 3SBRA 1PZCA 2PP7A 2MTAA 3FSVA 2BWDA 5AFAA 2B08A 2EILB 3IN0A 1MG2C 2YQBA 2FQEA 3PAUA 1J5CA 2AZUA 3X1NA 1WA0X 3AW5A 4QKTA 3FPXA 1AAJA 4HZ1A 1E65A 1L9QA 2AFNA 4DP6X 1TKWA 1PZBA 1ZIBA 1GSKA 2XX1A 1NIDA 3DTUB 2BZCA 3H4FA 2IH8A 4FA7B 4YSSA 2Y1AA 4A2EA 4E9VA 1L9PA 1IC0A 1J9RA 4G7SB 4L0PB 4BK5C 1PLCA 4A2DA 1OCZB 3IEAA 2CBPA 3MX0B 3NJGA 2FT8A 2IDSA 2PLTA 4CSPA 1L9RA 5B7FA 4A67A 1FWXA 4W1TA 3TA4D 2PPAA 1TU2A 3IBOA 4WTQA 1W6LA 2IWKA 2J55A 3T6ZA 1OOWA 4BDVB 4NERA 2WSDA 4NAJA 1MDAA 2YAMA 4PCYA 3WI9A 4F2EA 2IDUA 3D12B 3S3BB 1A4BA 3WKQA 1TEGA 4HHGA 4HCFA 3X1GA 2YAQA 3L45A 3ZDWA 1JZHA 1QLEB 3TBCA 1J9TA 1BQKA 1ASOA 1JZFA 3S3CB 3PLYA 2J57A 3OMIB 1XMEB 1FFTB 3NT0A 1PLBA 3GDCA 4G71B 1J9QA 2R7EA 1NPJA 4A2FA 3QJUB 1BYPA 2J56A 5I6KA 7PAZA 1JZEA 2TSAA 2VSKB 3AY2A 3WKPA 3DKHA 1ZDSA 2XXGA 5IY5B 3EH3B 3QJQB 1J5DA 4YSUA 3X1BA 1KCBA 1GYCA 2GHZA 1EHKB 3TASA 4E9QA 2GIMA 2TSBA 2FJSA 1MZYA 2CAKA 8PAZA 1CC3A 3SBPA 2BP8B 4P5SA 1BYOA 1R1CA 3HB3B 1HAUA 1ET8A 1OF0A 1ILSA 1RKRA 2W88A 2Q9OA 1OCRB 4M3HA 1JZGA 1KDIA 3NSCA 1J9SA 1NTDA 3AG3B 3S3DB 1A8ZA 1ASQA 2HX7A 4RH4A 3T6WA 1ILUA 4DP0X 2A3TA 1GS7A 4YVNA 1GR7A 3JTBA 4YVUA 5F7AA 2ZOOA 4ZK8A 1E5YA 3NJMA 5B7MA 2VW4A 3NSYA 2HRGA 1JXGA 3N2JA 5A7EA 1A65A 3NJIA 4E9XA 2FQDA 3FT0A 3V9CA 2GB2A 3FS9A 4AZUA 3QJRB 3C75A 1PCSA 2CCWA 1B3IA 4GP5B 3FYIB 4YSOA 1DYZA 3ABKB 2JXMA 1V54B 2ZWNA 5ANHA 4AKOA 6PAZA 4YL4A 1ADWA 1HFUA 4BXVA 3X1FA 2YARA 1URIA 4BWUA 3FQ1A 1TEFA 3IN2A 5I26A 1JZIA 1KV7A 4JKNA 1ZPUA 1PNDA 3H56A 1JVOA 2UX7A 3SQRA 4GY4A 1GY1A 7PCYA 4DPAX 4GP4B 1QNIA 4AKQA 4KO7A 5I6NA 2BP0B 2CUAA 1V10A 3NJKA 1JOIA 4UF7C 9PCYA 1FA4A 1PAZA 1AZUA 2E86A 2H3XC 1E30A 2AZAA 1NIBA 3UGEA 1AG6A 2XYBA 2FT7A 1A4AA 1WAEA 3NJFA 2PPFA 3S8GB 4YSTA 3OMAB 3BQVA 1NWOA 1YLBB 2HX9A 4G70B 1N68A 1OCOB 2N0MA 3JT2A 3NSDA 4BDVA 2YXVA 3PXLA 2YXWA 3QJTB 4HCGA 1NIEA 2NRDA 2YAPA 2QT6A 1SHWA 1PLAA 1UATA 1CUOA 1IUZA 3ERXA 3FYEB 1CYXA 1KDJA 1AZBA 1BQ5A 2IAAC 2OCCB 4DP4X 5PAZA 3SBQA 2WO3B 3MBWB 1V55B 4WKXA 1NINA 1QHQA 1ZDQA 4DP7X 3FSAA 2BHFA 2VSMB 2DYRB 1L9TA 4HAKA 4CSZA 2HLEB 1JERA 1ET7A 4HALA 2BP8A 2GC4C 2XWZA 2XX0A 2EIJB 1W6WA 3TU6A 2WO2B 1ZV2A 1XB6A 2DYSB 2JKWA 3KW8A 2RACA 2BZ7A 1AS6A 4YSCA 1AANA 3CVBA 3QQXA 3UAAA 3CVDA 1AIZA 1KBWA 4EF3A 3FQ2A 2QPEB 1CYWA 4E9RA 1A3ZA 3CDZB 2EIMB 5I6LA 1AG0A 1NIAA 4KO6A 4KNSA 1ASPA 2BW4A 3OD3A 2VW7A 3H4HA 1NIFA 2FT6A 5I6MA 1M57B 4N4YB 3G5WA 1SNRA 4DP2X 4DPCX 2PP9A 4A2GA 1NWPA 5AKRA 1OCCB 1IKOP 1X9RA 3OM3B 3EF4A 1NPNA 1I53A 1XB8A 3WIAA 3NJHA 1WA2X 4Q89A 5TK4A 1IBYA 2VN3A 2XV2A 3AZUA 1BAWA 4BXSV 2QDVA 2HZHA 3CVCA 5I6OA 4NB7A 1AQ8A 1EZLA 1RZQA 3S8FB 2H47C 4G72B 2XU9A 4DP1X 2UXVA 5LDUA 3OQRA 3PCYA 1AZCA 1SJMA 3T6XA 4YSQA 2QDWA 4K9JA 1W8EA 2BP0A 4AX3A 4E9TA 5D4HA 2I85A 1L9OA 4W9ZA 1AS8A 4DPBX 1DZ0A 2GC7C 1VLXA 1BXUA 2UXGA 3HEIB 3AG2B 1BXAA 2YAHA 3UADA 1E5ZA 1JVLA 1JZJA 2B3IA 1L9SA 5I5IA 2GSMB 4YSEA 1NICA 1SFDA 5B3SB 5B1AB 2GBAA 1A4CA 2W8CA 5F7BA 4E9WA 1AOZA 2P80D 2BWIA 2DWSA 1WS7A 2FTAA 1ETJA 3ABLB 3KW7A 4P5RA 3ZX1A 3WNIA 2QPDB 3AG1B 2PPCA 3ABMB 4YSDA 2CJ3A 4G7RB 1SDDB 4UAHA 1M9WA 3UACA 2HXAA 4YSPA 3X2QB 1OE3A 2EIKB 1OE1A 4JHUA 4DP9X 4BWTA 1T5KA 3NSFA 2EINB 3ZBMA 2VMJA 2AANA 3T9WA 4GYBA 1HAWA 2IDTA 1BQRA 3FU7B 1PY0A 1JXDA 1BXVA 1PMYA 1IBZA 1KGYE 1NZRA 2PCFA 5D4IA 1N70A 2BW5A 3DIVA 3N55A 2PP8A 3WG7B 4TXVB 3BVDB 3GYRA 3X1EA 1PZAA 3QJSB 4KNTA 2HX8A 5PCYA 1E67A 2FQGA 4A2HA 2AVFA 3QPKA 1OV8A 2IDQA 4MFHA 4E9SA 4HIPA 3EH4B 4PAZA 1JXFA 5B1KA 2XXFA 2VM4A 1ID2A 2BO0A 1AZNA 4HHWA 3PPSA 4BWWA 2IDFA 2YAOA 5I5MA 2JFCA 1GW0A 2FQFA 3FQYA 3ABGA 1ET5A 3NYKA 1CURA 1AACA 1SFHA 2YAFA 3ASOB 4KO5A 4X4KA 1NDTA 3CDZA 5I6PA 2VM3A 3CZUB 5B1BB 2PCYA 3RYMA 1PNCA 5AZUA 5B1JA 4A66A 5D4JA 2X88A 3FU8A 2XVBA 4E9YA 2UXFA 1X9UA 2IH9A 2PPEA 1GS6X 3GXUB 3IE9A 4N8UA 2DV6A 2FWLB 2XV0A 3TBBA 2IWFA 5I5JA 4QLWA 3FPYA 2I7SA 3UABA 4ENZA 1F56A 3AG4B 3PAVA 4F7KA 5FC9A 3WNJA 2CALA 3T6VA 2IWEA 1WA1X 5E9NA 1SF5A 1RZPA 2YAEA 3T71A 4GP8B 5I28A 2HRHA 2OV0A 4HCIA 2XUWA 2UX6A 3NP3A 3EH5B 2I7OA 3U25A 1WS8A 2R7EB 4F2FA 1PF3A 2XLLA 1OE2A 1KCWA 1SF3A 1ZIAA 4G7QB 4DP8X 5TK2A 1AS7A 3NJNA 1KBVA 1SHXA 2DY2A 1KYAA 1MZZA 4Q8BA 4AI7A 5B7EA 3ZIYA 2XV3A 2Y69B 2P80A 4A68A 3FU9A
chains in the Genus database with same CATH superfamily
3IJEB 2IG2H 3SCMC 1TJXA 2Z4QA 1W0VB 1ZSDB 5F72S 3NCYP 4NC1C 4F7PB 4Y8AA 3BLBA 4PS8A 3BAEH 2HFGL 2YRPA 1FIGH 1K2DB 5EHFA 1BEXA 1IGFL 3LNFA 1P4LA 4JN1H 4UDUB 1AD0A 4P2RD 1FZOB 2J5WA 2V2TA 1CR9H 1CI3M 1WH0A 1TVHA 4KNUA 2ZXEB 3B43A 4HETA 5JHAA 3CX5J 4BCZA 2ZKWA 4Z7OB 4OB5L 2ADGA 1CGVA 1E9QB 4NOFA 2H5UA 3OLGA 3T3PE 4HLZH 2BOBB 3CG8A 5LXGH 2H0PA 3D39B 4RDQG 1EV2E 1FG2A 3QIBD 2AQ2A 4NJ9L 4OTXL 5FGBC 3ARDA 2HT4C 3S5LG 2J8UF 2W81C 5FF6B 1MWOA 3Q2LA 1D5ZB 2APXA 2MNJB 4H1LA 1IEAB 4KHTL 4PB0L 3TO4D 1BG1A 4AYDC 5DHVB 2NY6D 2BSTB 1PLGH 2FBJH 2D3LA 2R4RL 1KJMB 3J7HA 4OGZA 5CUSL 5DQ9A 3STBA 1G7IA 5HI5C 1JPTL 4PJ7B 3KPLB 4TTDC 1OSZA 3IPFA 2ZP9A 2DLGA 5IQ9A 3DK0A 3QDMA 4XC3H 5F89B 3QNXA 5EEWA 2YPLD 1WQVT 3TV3L 5D1XA 6TAAA 2BC4B 2G3MA 2E7BA 4W93A 3GFUA 3GMQA 4ZD3H 2O61B 2QKSA 4YSSA 3LPWA 2Y1AA 4RGND 4E41B 4E36A 3QHFH 4F7EB 5E03A 5HGHA 4Z95H 4PR5A 5D7HA 4F5CE 1T22A 3FQTB 5D1QA 2VLKB 3D0VB 3LKPA 2A9NL 3SDCA 4QHLB 1N26A 4WTZG 1V8HA 2W07B 3VXOA 3H6JA 1YQVH 5AG9A 2X6MA 1RJLB 2HJKA 3IJ7A 1P9MC 3DOSA 3FQRB 3VG0L 5L7XL 5EOCH 3U2JA 2V2WB 2A74A 3O9WA 1Z9LA 1A7QL 3T6ZA 3T0BA 4NCDA 4XN7A 5JIQA 5AG8A 2V17L 3WI9A 4ZO9A 2OCJA 1NCNA 4TLKA 5DD5H 3MXWH 5IVXA 3X1GA 3VQ2C 4QR7A 4JE0A 1MRFL 3L1OL 2MQGA 4G1EA 5E8OB 4YWGH 5FYKD 3EOBB 1KOAA 1I8KA 1BXXA 1ZA6A 4ZODA 5ICXB 4AGOA 3KLQA 5IMKB 2JCCF 5E94A 2NNCA 3QRLA 1UA7A 3NT0A 1LO3L 5IEKB 5C09D 2Z65C 3SGKC 3TNNB 5INCB 5FEBA 1JZEA 1D5RA 5I8KH 2EKSB 2ENSA 2VR9A 1UB5B 3MLZH 1J87A 4R7NB 3AS3A 4TSAH 3RNQA 1W80A 3JYBA 3DMMD 4WV1C 3KXFA 3P4MA 1MZYA 1F00I 5IESL 4JJHA 1RZJH 1E0OB 2ZKHH 4FQPA 4PGZA 5F8QC 3EOYG 3SPHA 1ET8A 4XC1H 3SGEI 4FDWA 1LEGB 1MW2A 3QIUC 2X9YA 4HCRA 4HIJB 3IT8D 4GT7A 3NSCA 1TZHB 4Z78B 4HIHA 1MCQA 3S3DB 2A1WH 1P4IL 1Y18A 4WNSA 4OJAA 3LD8C 1GR7A 5F7AA 3GSNB 2BJMH 2QGBA 1SXBA 4TLSA 3N44B 1V3LA 3SJVD 4PWKA 9CGTA 1K3ZA 4WO4A 3RX8A 1VACB 1TZIB 4I3RH 2EYRA 2H9GA 3QUXB 3MLYH 2GT9B 1AVAA 2YRBA 4LE8A 2EDKA 3J8F7 1FBIH 2NY3D 4JRXD 1RHHA 3ES6A 2YWZA 2V7HB 2Y07L 4Y9GA 1RZFH 5F93C 4ODXB 3H54A 4XP5L 5F96H 2XFXB 3AS0A 3EFDH 2EC9U 3MRGB 3VG9B 4L4TE 2LAGB 5SWSE 5DJDB 1WWBX 2AQQA 4HISA 4HPHA 3IWVA 3LZOA 4OM1H 3V2AR 5E00A 5MENE 1NCCH 4PHZA 5F70A 4IBYA 1XF5A 2PO6B 3H2PA 1IO4C 3WKYA 2VZTA 1X7TA 3WLWC 3FHAA 5HGDA 5JUEL 2OXGB 1CB4A 7PCYA 4OZIB 1OWWA 2ODIA 2FECI 1FC1A 4KO7A 5DS8A 1T1XA 5BUPA 3N85H 1IC4H 1MCOL 3NIFF 3PWNA 5E6RB 1ADQA 3UZQA 4QRRA 5HYJE 1NIBA 1T20B 2DWEA 3HS9A 4PG9A 4UQIM 4LL4A 2MCG1 3REVB 3S5LA 5TE4L 3FCTB 4CL7A 1S7VA 3FXIC 3RJQB 2YEZB 3PABB 1CIDA 2X70A 4LCWD 5KSBE 2OX5B 3GKWL 4NBZB 4NPYB 5T8IA 3NK3A 1R17A 4U6XB 1HKLH 1K4CA 1MJUH 2KHAA 3JSSA 2ORBH 5E7FA 3GHEL 4HX1A 4ZTOH 3RWHA 5IV2A 3VDBA 5J9PB 1SHWA 3O4LE 4JFED 4LEXH 5HGBA 2MQ0A 4H7VA 4IMLA 4R2GC 5E2UH 4L3AA 3MLRL 4H8WC 1NKRA 4U7SA 3KGUA 4DP4X 3MREA 4DKAA 2UZYA 4H0IA 3T2NH 4WTZA 5FO7A 5BRZE 5BV7L 4WKXA 2LU3A 2LHAA 1S7QB 5KJ7E 1GW6A 2DMGA 1CDUA 3X17A 3RWFA 3K6NA 3PV6A 5JHDB 1GGIH 5C0BA 3AY4C 5C08B 2B77A 3ILQD 3VX1A 4APXB 1IEBB 3IK2A 3U4BL 1D5IH 3MLXL 1MFCH 4XWGL 3LEXB 1HIML 4A7TA 3O45B 1T7YA 2DMHA 4I0KA 3D0AA 2W60A 2X28A 2X5PA 3DHPA 4GKNB 4KRPD 2EIJB 4XNUL 2ZUUA 4HOXA 4HUWA 2LU5A 1F3DH 1PAMA 3H9YA 3QDJD 2B4CH 3CSBA 3FFDA 3KW8A 5JHMA 4NPKA 5IKCB 4WWKB 3HOGA 3FU5A 4JY5L 2FJHA 1AIZA 1DQQB 1FHGA 2WZPD 4KMQA 1QLEL 5MP6H 5CILL 1FNEA 2HFFA 3ARPA 4QF1A 5BUGA 1MJ7L 1KLGA 5ECJE 4D9LH 3MNWB 5GJSH 4Y4FA 5EUKB 1HEZA 1IC5L 5CN3A 2F8IA 3ETBF 3H4HA 4X6CB 3FONA 4JFHD 5TF1H 1E40A 1MWAH 1SNRA 4UUJB 4E5XB 1JK9A 5KSAC 1F4YL 1NWPA 3GLZA 5CU9A 4ZFGL 4TUOA 1HOEA 1UWEH 1MIEH 1OGSA 4LVEA 5K9OB 3NJHA 3O4OB 4TL4A 3ZL2A 1WA2X 4LARL 4NQCA 4LLMA 4YDIH 2A77L 3AQXA 3QR1A 4CC0A 4KITB 4Z7WF 3K4AA 3CZGA 4UOQA 3KPQA 2PTVA 1BPLB 4G72B 3WIHH 2H3NA 1AHMA 1ODUA 4OFKA 5BW7A 4D0CA 2HCZX 3QH3A 5E1AA 3C6LC 4M7ZB 4XP1H 4WDIB 1I8AA 1BBJA 2C9PA 3X13A 4F3FB 5EH1A 2FECL 3NA9L 1L9OA 4UTAA 3LMJL 4K8RD 4ICXA 4CC1A 4ZMNA 3LZFH 2JQZA 5DGQA 3SDDB 5EU6E 3QUYD 5KYYA 1DDHB 1JF1A 4MXVE 1CE6A 1SZNA 5B1AB 5F3HA 3DX7B 2W8CA 3I6GB 1X5YA 4B9CA 1UWXK 1G9HA 2LTQB 4EI5D 1H3TA 2OA9A 2WKOF 3SE4A 5EEUA 1GOHA 3G6AB 3JWNH 3L13A 5ANMA 5CZRA 1G9NH 2VDKH 3QWOA 2VLJA 5I2IB 3K71A 5AW8B 4ZXBA 3VUAA 5DSCB 1G1YA 2AJZA 1KEML 4KK8D 3GI9L 4O02H 4X6DA 4DK3A 3JV0A 3UPCA 4K23H 3BAJA 4DP9X 4PRPB 2KZWA 2V37A 3DO4A 2Y7SA 4P4KD 1T5KA 5AB2A 1CTOA 3NSFA 2EEDA 2GI7A 5EN2A 3AQZA 1UUSA 4EKJA 4ZMYA 4PJ9D 3U9UB 3CSGA 1UVQA 3QYMA 1KGYE 5KBKA 4X7EC 1IM9A 1KWKA 3QCVL 2MNUA 1F42A 3KYNA 3NTCH 2F7IA 3WAKA 1H6FA 4X98B 2WBJD 1L3WA 3IU3B 3TP4A 1TSHA 3HKFA 2E59A 5K33A 4ZDHB 4LKXB 3PS6A 3MLUH 5K39B 5JDJA 2J2ZA 5DRXA 4ZFZB 4MFHA 4OZGF 1U8OB 2Z92B 4DF9A 4M7LH 3QI9D 2SODB 2D7TL 4I0PA 4I9XA 2PCPB 2VO5A 3BZ4A 1NMCC 2J6EL 2VDLL 1IFHH 5C6TL 2NNFA 2M8XA 5JW4M 4PYGA 3ARGC 2EXYC 1EHNA 2FX8H 4MA1B 1VFBA 3ULVH 5DU7A 4ELKB 5GGRY 4YHPB 2TAAA 4TLTA 1MPAL 1P53A 1QR1B 4ZW7A 1FZJA 2NZ9C 2VM3A 4MJ2A 3VQLA 3RYMA 3QNZA 4B9IA 2XRAL 3IFNH 2UXFA 5IMOA 2Z3FA 1IQWH 3LS5H 1WBYB 1XGPB 3IE9A 1Q38A 2WQWA 5D7IF 4UOZA 4NNPH 2ZF8A 3P2DA 2J8HA 3GGWB 1VDGA 3UC0H 3BE1L 4FOMA 2Q86A 4PCKA 5CEZH 1B0GA 2PW1A 2P45B 2YK1L 3ZE0E 2LGNA 4LP5A 1NAMB 1CF1A 2W91A 2WSKA 5CKGA 3AWFA 4PTTA 5JO5B 1F5WA 2CDFA 5A6MA 1LO0L 2H3KA 3VH8A 4JRYA 4V33A 2EDBA 1TITA 4JM2D 3TCLA 5HHVL 5E23A 4Q6IB 4QOKD 3D08A 4YDLC 1N67A 5LGYA 1U8PA 2ZXGA 5DLMH 5DJ8A 1TFPA 2CU9A 3QDME 2APTA 2WN3A 4PPTA 4LRIA 1XT5A 5D1XE 2IGFL 4LSUL 4P2YA 2GY7B 4X42A 5LWYH 4N68A 5GGVL 3TH4T 1J48A 4NNYA 3IAPA 1UWGL 3POCA 3QJVB 4XI5D 1A9BA 5ENWB 3MROA 4NRXA 3G9AB 5D1QE 2CHNA 2IH3B 1A9EB 2FSEB 5J3HC 2BERA 2YR3A 2EE6A 4OLYL 4PJXB 4HC1H 3UAEA 4CJ0A 3HS0A 5DD3H 1I7ZA 3FU7A 5IBUG 5IM7B 4FTVB 4XBPB 4WW2F 5LHDA 3II3A 1PFCA 1UOLA 2MRYA 5EBGA 3PWPD 1FNAA 3CBRA 1MQKH 5JOFB 3F3HA 4Y4KD 2MTAA 3KBPA 5IVXE 2OMXB 3JV6B 4XNBA 2VDRB 2GCYA 2QQKH 2P5WE 3CC5B 1H3GA 5AFAA 1RPUA 4GXUN 4RX4D 4PRHA 3L6FA 3TF4A 2N3JA 1TTUA 4QLRA 3WJMB 1M9SA 2F53D 3GRWH 3HZ3A 3BGMB 1BFVH 2DQIL 3L1GA 5L2KD 1H6EA 4R7LA 3FPXA 1B2YA 2R69H 2FHBA 3WEAA 3ARFA 5DF0A 2VISA 3A67L 1QW9A 2VR4A 4PP2A 4W4NA 3VJ6B 5I8OL 4GRLA 2QLVB 5LGHH 1Q9KB 1UH4A 4YHOL 3U30C 4N0UA 2ZP0T 4YXKL 4QRUB 1OM3L 1VKXA 3BUTA 3AU1A 4CILA 3W0WB 5C9KA 2VMFA 1SMOA 2EXTA 4F91B 4NI6A 4A2EA 4AV0A 2CUHA 3W39B 4A39A 2RBLA 1Q1JH 4MA3A 1MY7A 1E4XL 2H2SC 4MWFB 1J9RA 3KXFE 4JZJB 5AB1A 1UM4H 3EO0B 1TQVA 3KAAA 4PJEB 5IQ7L 3SE9H 1UCTA 2PLTA 4OD2A 5EU4B 3MRLB 7FABL 5CHNA 4JFDE 1CDCA 1NGWB 1YPZF 4S1DD 1H8NA 4ETQB 1R3IH 4L4VD 3E3QC 4YFLI 1CFTA 4FNUA 5EIIG 3ULSA 1LE5A 3S3BB 1E6JH 1HL4A 1WEJL 1BIHA 4N2KA 2D73A 2E5EA 4HCFA 1GZPA 4BSWB 3FQXA 3ZDWA 3QIUB 1KCSL 4Y5VB 5CGYC 3TJHD 5CFHA 3N42F 5I1DA 1CLOH 3BO8B 4G8GE 4S1SH 3S3CB 1AC0A 4PJBF 1C12A 2DYPA 5DEGB 1ETZA 4LESA 4YX2H 1JWUA 3QEGH 1UZ8A 3LNEA 1WT5C 5EO1B 3IKCA 1U92A 3KE0A 1PLBA 3GDCA 4ODWB 4QAWA 1NPJA 4W9GC 5LNEA 2XZCH 4MJ5B 1RFDH 4NO3B 1A6TA 3DPBA 4OLVH 1BYPA 2AXFB 7PAZA 3SPCA 2E9WA 4AEHL 5IT2H 3VFPA 5C7XH 4X9IA 5E6ID 1FSKC 2YMTA 4WNJA 3H1ZA 3BEVA 3B2VH 2EO9A 5AZEH 2FJSA 2HWZL 3PL6A 3TN0A 4B53A 4ZUSA 4F9PA 5GRUL 3QAQA 5E2TL 4N8VG 4GPVA 4LHUB 2L8AA 1GGYA 4UBDC 2JF1A 3A23A 3B2PA 5I19H 4CU8A 4M3HA 5HYJD 3RAJL 2GTWB 1QEXA 2GJZA 1WBXA 2C8NA 3LRSA 3MUUA 5A2IH 4UTBL 1ASQA 2NTFB 2WO4A 4P4RB 4WU5B 3T6WA 4QRRE 2CRIA 3PXJA 4M02A 5AW4B 3GXPA 4WI7A 4C4UA 3TGXA 2E9GA 3NSYA 3K4DA 1JXGA 3MHZA 3DROA 4HOMA 4DK5A 1XCTB 2DQDL 4Z7VB 4M4RA 2DQEL 3IMUA 3S4SA 3PHAA 1XH1A 3TLRA 3LPOA 4ZO6A 5HHNA 1IGML 3FBQA 1DVFA 1WFMA 3PWLA 2L7JA 3BCFA 5D7LA 5GGRA 3FYIB 2A83B 1HCZA 1OGAD 3MNZA 4LOFA 5EEZA 3QEHB 1KTLB 3GWJA 4PRID 4KJWC 4WNQB 4AQAA 4L4JA 5BRZD 3GTTA 4L1DA 5BMFL 3NZSA 1XMWA 4WY7H 5CCJA 1QFWH 6PAZA 1K8DB 4PBXA 3MV7E 1RK1B 1ADWA 1JYNA 3GEFA 2YGQA 4CVXA 3CZNA 5TF0A 3WENA 3QG7L 3HG1B 3L5WB 4JKNA 3EYVB 1JZ3A 5FHBH 2R1YB 3LV3A 3A47A 5CLYA 4PJ5A 3TEUA 4LHQB 2B4CC 5C0BE 3PHSA 1Z7JA 5F1KC 4AJWA 5FYJH 2LOEA 3VXPB 3H42L 3WFCL 1XF3B 1G7JA 2XICA 1DLHA 3SD5A 3QZLA 2XTJC 3EH2A 4XMPH 1WAAF 5I8EA 1DVTA 4YLQT 3BQVA 2VTFA 4EOWL 3U46B 1QTPA 1KN4H 3UBFA 5JMRA 2WXRA 4Y2DD 2FB4L 4FERA 3U1QA 1E4WL 2P8MA 2C7UA 2WB7A 3L1EA 4MJIA 2FL5A 4GRWE 4AITA 1BX2A 4WEMB 5DMGC 5I0DA 4KMTH 1CG9B 5CJBA 4F57L 1PS3A 5EO0B 4PJFB 3BKYL 1JGVL 4RGMC 4YLCA 4YDVA 4XCYA 1ZD6A 4U0QB 4F2MA 1LEIA 1KXHA 2ZOUA 3ECQA 5ACLA 2UWEE 3RLSA 3JUYA 3L2MA 1P7BA 1JL8A 3B4NA 4YHZH 4AIZB 1BMZA 4JZOA 4D9QE 4L2LA 4K07A 4JGMA 5GGSB 4ZQTA 4PGDB 2WW8A 4JFTA 3VE0A 1TOXA 1T6WA 3OAZH 4KZDH 1U95A 2ATKB 4JFUA 1AKJB 4RIRA 5TD4A 4G42B 3ZHNA 5CSGA 4XB7A 1CD8A 3P73A 2NYKA 4AEFA 4LL9A 3DTXA 5IG7B 1JWSB 1A1OA 1YO4A 5KSAB 2GSGA 1JERA 5EIIA 1DQJA 3BXNB 2OPCA 4PGBB 4BFGA 3LDBB 3R7RA 2J88H 3LQAH 3OAZK 2JH2A 4X5LA 2VDOB 1XB6A 3U36B 4A55A 4G8FB 2P52A 5IROA 3DVNB 4FNLH 3JWNC 7CGTA 1JPGA 3DRTA 1RJYB 3EO9H 4MD0A 4AUYA 3KJ6H 4AQ1B 2CLRB 3LKOB 5CJXA 3NRQA 5E7BA 4XNDA 3V6BR 1QYGL 4MCYA 1SJEA 3MRKB 4WEBL 4N2HA 2BIPA 1BREA 1EERB 1RURH 2GUOA 3QG6A 4HJUA 4Z3JA 1F1DA 3BT0A 2QEJA 4YLBA 2FT6A 3SPIA 4MXQD 4N4YB 4AYMC 5GSVA 4FLSA 3DVIA 3IDIA 5IFJA 2XKNB 4N8VA 1C1EH 3FCUB 4OCRH 1R9FA 4WUUD 4PSRA 4ZJ9A 3S34L 1FNHA 4X6DE 5DK2A 3VCLB 4M9OA 5GS0H 1A4KA 5TK4A 3ZKQD 1E4HA 3CUPA 5I6OA 1EZLA 4OI7A 3KPRD 4MXWH 4G9DB 2E6QA 4OCWL 5DQDL 3HE7B 1VPOH 3UTPE 1BCIA 1HHKA 1MN4A 3L3GA 5KVEL 4JRWA 3WJLC 4OKDA 4RNRA 3IJHA 3EFFA 2DM3A 3VM5A 1DQLH 4L5FL 3HE6D 2NT0A 1LD9A 2AV1B 1KCLA 3CVHH 4LVHB 3ZKXB 1JFQL 1WDAA 1YEFL 3W57A 4M6NL 5HYSG 2EXWD 2F58H 5MI0C 3B9KB 4QTFA 1AS8A 3UPRA 2QL1A 1UD2A 2XT1B 5KVFL 3K2MC 3O3BA 5D5MB 4BCXA 4G80A 3B3BA 3GBDA 4JO2L 4HGWA 1NICA 3NJVA 5DQJB 1T1WB 1WIOA 2K4AA 2X40A 1YUKB 3MA9L 5HVWA 3GKZA 2DWSA 3VWKA 3R4RA 4B7IA 1CD0A 3F01A 1ORSA 1YJDC 2PYFA 3MRNA 3ZZQA 3WNIA 3BW9B 3SO3C 3DX8A 3I9GL 2PPCA 3SN6N 43C9A 3FFCE 1RZIA 3T6QC 3GMPA 4K5PA 5A2AA 1EZVX 2HXAA 1WTLA 5CCHE 4LCIL 1HJCA 4J7RA 3L3KA 3C5XA 5JZ7C 1BFOB 1E5AA 2DDQH 2YSTA 4M1CC 1IZKA 2CR3A 3TFKD 1OAYH 5BZDA 3QZNA 1PY0A 5BOPA 2CO7A 2PCFA 3LVTA 1F45A 4FQXA 4H25B 3HBZA 4GAFB 1AXTL 1KEGH 4FCAA 1FH5H 4IGBC 3TBVA 4QHKJ 5E99L 5LLIC 1E67A 3BAIA 4NQSA 1P5VB 3ARVA 1NEZG 3ARDD 3RDTA 4JFWA 5IGXH 1NANI 5E9AA 3MRDA 5BS0A 4JRYE 1ZLDA 3SKMA 4JGJA 1A5FL 1G7HA 4J2QA 4QKXB 3PPSA 3AB0B 1CPUA 2JFCA 1ORQB 2EKJA 5DHXB 2BRQA 1FL5A 1EFXD 1ET5A 2ICEC 3D9AL 3SGDI 1JNJA 5I66B 1G9ML 1Q9WA 4BZYA 1T0MB 1D5BB 4ABUA 3J27A 1RHFA 2H0FA 5CZVL 2XQBL 3X11A 4L8SA 1EDYA 1ZHKA 4J27A 1KGWA 5D8JL 4ZBJA 3CZUB 1UURA 1IC7H 4HVBA 5F21B 4ENED 4JHWH 5BNXD 1CDIA 2R2EA 3SDCD 1NUNB 2HFEA 4K7PL 1GS6X 5C0DA 2EIEA 1MF2H 3SKUD 3VRIA 4JO8A 4JM4L 2X6UA 2PYEE 1BYNA 3HBGA 1GGBL 2DJSA 1KTRL 4PWGA 3CFKA 4NXKA 4HEMA 5IJDC 3TZVC 4ENZA 3UYRH 5FUOH 4YHMH 3PAVA 3IFLH 5FC9A 1CF8L 5ID1A 1ERNA 2VN4A 5CWSA 3HC0B 5DVKA 3D7PA 2YAEA 1BM7A 1FP5A 2PXYC 2YD7A 4NN7B 3T71A 5J6HB 4HCIA 1PYWA 2M83A 2EIZB 3HR6A 4E68A 3HMXH 3QHZH 4CSSA 4JNXA 1JV2A 2I7OA 4OJEH 3ZDYF 3X12B 1PF3A 4KUCF 4HJTA 1OM9A 2Z9TA 4PRHE 5ISZE 3ARBC 5F9JA 5TK2A 5TE6H 3IKKA 5CLWA 1KBVA 5ITBH 2C9UA 3PHOB 4D0BA 1KG0B 2Q7YB 4OV5A 4Q8BA 1S9WB 1ZHLB 1KYFA 1MJJB 1RV6X 2AC0A 1QI5A 1QI4A 2EYSA 2I60L 3L3IB 3AM8A 2HVBA 4HBCH 4M1GL 4GW1A 4N0UE 4FFYL 5C6WH 3O3DB 3QQ9D 1B4JH 2VMCA 5GGTA 3WGVB 5GS1C 1TJHH 1BIIA 1KB5B 4Z77A 4YSRA 3V6ZA 1ND0A 2FLMA 3ULUD 3MYJB 2V8LA 2Y23A 5JNYA 3THML 3ZLQC 3TO2B 1I31A 5J11C 1ZK5A 1TQWA 4FLHA 1KB3A 3LZLA 5HYSA 1ECZA 2GYSA 3IDNB 4MCZA 3DJZA 5FCUH 5J5EA 4WFED 2FEDC 4JQVC 3VI4F 2H1LM 4Q9RL 1OAUL 4HLEA 6PCYA 2JI2A 4J8QA 4FMKA 3W82A 1H9VA 2YFNA 4WO4D 3NJJA 4OLUL 3FSWA 4OJCA 4MZRA 1KWGA 4JG0H 1JRHI 4LBEB 3TBWA 3M46A 4JFSA 2RHEA 2Z7WA 4ZAKA 4K8RL 3WTXA 4JPWH 3NEEA 5ITFB 3WTWA 1EJ6A 3VW3H 4RMBA 2NY5C 1XL4A 3F7YB 3BKCH 2A6DA 4A2MA 4MASA 2YQBA 1RU9L 2WCSA 1P4BH 4CUCA 1N7MH 4WF7A 1AC6A 3CHPA 1CZ8L 1FVDA 3E6FA 1HQRB 1E65A 4MGXA 2QTEA 3MCG1 1LO4H 2WTPA 4J3OF 2NNXA 2P26A 3MRIB 2DQHH 3EBHA 2JQMA 1UGKA 2H26A 4FS0A 4OLZL 4DN4L 3TM6A 1N6QH 2MCAA 1KNOA 3BYYA 4M56A 4OM0H 4KKCD 4HUUB 2X0UA 4JL2A 4QDGA 2CCVA 5C0CE 4J3OH 3SZ6A 1NKOA 4NO2A 5FAAA 3WS6A 1BVKA 2G2NA 3OXRA 4XPGL 2ENQA 3MX0B 1BVNP 3NJGA 3K2IA 5DS2A 1XR9A 4HU2A 2RFXA 1A7PH 1AXSB 1R24B 4TVPE 1NEZA 1OD7A 4LIQL 4LSVL 1JAEA 4XNMA 4JVPA 5DJ2A 3IBOA 1FV1B 1W6LA 1L6PA 1Y6MR 2CZNA 5EU5A 5TDPB 5ICYB 2YAMA 3MGTB 2FZ3B 1IVLA 4PUBL 4PJIE 1TJMA 4E9LA 1IGIL 4BH7A 2YAQA 1PY4A 3JBG7 3U2SB 1KCRL 3BFQG 4Y19A 1FZKB 4KZEH 1UJ3A 4EE2A 5E5UB 1TLKA 4L1SA 4RCAA 1HNGA 3H9SB 1FIEA 2RJMA 3PIQA 4LHJB 4PJ8A 3QFJA 4NJ9H 2OTPA 4OTXH 5K59F 4RZCA 2OJEA 3FN3A 1XAUA 1HHIB 5L6YL 2UVFA 4R5XA 4MQ7B 1ACXA 3ORJA 1KCBA 4PB0H 3BAYA 5EORL 3SDAC 5EC2B 2R4RH 3N43F 5C0BD 2CAKA 5CUSH 4DQOH 3TVMB 3NDZE 4KDVA 2ZOWA 4PJ5E 5C0EB 1OF0A 1QSFA 1R3LA 3PWJB 1ML0A 3EYUL 1MOEA 4O2CA 1GAFL 3IMWA 4UDUA 3O6KH 4RH4A 4A1RA 1FZOA 2I9LB 4MB3A 5E08L 1QW8A 5DC9B 4M3KB 4YVUA 4ZK8A 4APQB 3UJJL 5B7MA 3VMNA 3PDOB 1HL8A 4O5LL 1ZJAA 3IRCA 1Z32X 2A9NH 4XH2B 3RZCC 3NJIA 5C7ZA 1XH2A 5B3NA 1S3RA 1BZOA 1NFIB 4NZ8A 3Q8AA 4G5ZL 4UMSA 4BRVA 5GZOA 4B27A 1QA9B 4WI8A 1CL7I 3CZSA 4ES8A 1B3IA 4KY2A 4LXFA 1J05A 4Y4FD 5EUOB 1JRHL 5FF6A 3TV8A 2WJ7A 3C08L 4M6ML 1ZTXL 3D69B 1IEAA 1T7WA 4GBXC 2V17H 4CKVX 2BSTA 2AGJL 2AXGA 1KJMA 5DMKB 4R96A 4YL9A 1UKQA 3KPLA 4JCMA 1CK0L 2AJSL 4ZOBA 4HIXL 3L1OH 3OGOE 4NQCD 5I0ZA 4PJHE 3RBSA 2QQQA 2XTLA 1RULL 2BC4A 2DWYA 3CE1A 4TUJB 1RIHH 4GY4A 1R3KA 4ALAC 1LO3H 3P3YA 4Y4HD 2ED6A 2JSFA 5E8EA 3BJLA 5K9KB 4I87A 1DJSA 2DBJA 4LOVA 1IGCL 4CVUA 1JOIA 3FQTA 3BDYH 2NYYD 3CHQA 1OTSD 1ZT4B 1BG9A 5I71C 3NCJL 4DGVL 2W07A 2XYBA 3K4ZA 3S8GB 1X5MA 1RJLA 4HK3N 4NGHL 1HH6A 5K9JH 2ADIA 5HHOA 4IRZL 4G70B 5IESH 2V2WA 3EHBC 4C4BA 2Q20A 5KBPA 4L1TA 4QO1B 4WEEA 4ZMXA 3D2UB 4PCTA 1G1KA 1T1ZB 3QUML 4R97C 1GIGL 1BJ8A 1KJVB 4P04A 43CAA 3MOAH 1JWMB 2EYTB 1UATA 2DKUA 5ESVB 3MSPA 4KFMA 1X5XA 5GS0C 2VLJD 3CPLB 5C71A 4ZXBD 4NZRL 4AYEC 5ICXA 3NSJA 1I85C 5IMKA 4NKIL 1HINL 3N9GL 4HXAH 3V8OA 5IEKA 5JA9A 5KVGL 2JJVA 3DO3A 1MFNA 3QZOA 3QUKB 4J3VA 4TSCH 1FZMA 3TNNA 3EIFA 2NXYD 3OHMB 4DP7X 5FECB 4PLJC 2EKSA 2Y07H 1YY9C 4GG6A 1UB5A 2E46A 1HN1A 3FT9A 4XP5H 2ATPB 4R7NA 3WY3A 2E7MA 1IM9D 3BVNB 1FJ1A 3Q5TA 4CW1A 1L5GA 4YXLL 4U6HB 4JO1L 1GOGA 4IBUA 3OWRA 3EGSA 3BIKB 5AB9A 2P8LB 2Y36L 4KQ3L 4WHYG 2EVJA 4BYHA 3OG6B 2VDQB 5C0GA 1J0HA 1LEGA 4PVLA 1LWHA 1ZE3H 4NQEB 2BHYA 4OD3L 4RFOL 4MD5B 5DR5L 4Z78A 4ZZKA 3RIAF 4KXZI 5JUEH 3EO1B 1HTYA 3QXDB 1NC4D 1UXMA 1XTLA 2NXZC 4CA4A 3GK8L 1TNNA 4MNQE 5DO2D 2IH1A 2I32A 1D6VL 3E8UH 1MCOH 1MLBB 4AMKH 2H0EA 1FDLL 1KLUB 4QT5B 1RIVH 1ACZA 1R0AL 2HTLD 5I6LA 1TZIA 3Q2WA 2E0PA 5TE4H 4EIZC 2Q1EA 3BLKA 3RJDA 3CD4A 5GRYA 1B0WA 5H37A 1KIPB 3V6OC 3RGVB 3DETC 2OI9B 3WTVA 2XFXA 2BLFA 1IAIL 5GJTL 2P28B 2LV4A 3HUJB 2N01B 3GHEH 3SO5A 3FO1B 1WWAX 5DJAB 2QADB 4Z3HA 2ARWA 2G3NA 3N1QC 2P43B 1JCVA 5DWUH 4Q4EA 4I77L 2KZKA 5EIQA 1JMZA 4F58L 3Q43A 4G6MH 2PO6A 3MLRH 4GAJL 2WLHA 5HHXL 2BNQE 2YS4A 1ZS8A 5DK0A 4OZIA 1QX1A 1J9CT 5BV7H 2HUHA 4RSYA 4YHKL 1TQSA 1A3RL 2D7MA 1H15B 35C8L 4XVUC 2W38A 2I07B 3J07A 4NENB 4E9TA 4AG4H 3K6IA 3RBGA 5D4HA 1JZ4A 2UY6B 1R4XA 5JXEC 3JWDL 4FKKA 2ZCKL 2ISDA 5BS0E 5KSUA 1L7TH 2Y0SA 2YEZA 3SPJA 3U4BH 2FD6H 4P2QD 2GFBA 2IPTL 2KS0A 1ZOXA 5HD8D 4QXGL 4YAQB 1DSYA 5JHLL 4NPYA 3SY0B 4IGBB 2P7TB 3O8XB 1BEYH 2AMGA 1H9DA 1XGYH 3PP3H 3JV4A 3DSNB 4S1RL 4QRSB 2R1XB 3EJUA 3ABLB 4JAMB 4U7MA 4MTMA 3SGEH 1QFWM 5J9PA 3NOIA 5E4EB 4ODUB 2CJ3A 5LAPA 4JY5H 2AABH 3VGEA 4QYOB 2Z8SA 3AMLA 2NDGA 4DEPC 4H8HA 1QLEH 2MMXA 2Y24A 5CILH 5E8PB 5MEQB 1MJ7H 3RA7L 3T9WA 1A2YB 5FYLL 1XX9C 4Z3FA 5HTSA 1S7QA 4GEIA 5DRZB 2ZUXA 1MAJA 3B2XA 3QYCA 2PWDA 4HEME 3QNYA 4HPYL 4KROB 1S5IL 5FM4A 4NT6B 5IW1B 3D18A 2RAMA 1GA2A 5JHDA 4JB9H 1Q72H 2XN0A 3L3OB 4F9LC 4L9LC 4APXA 1HXYA 3OJVC 4OAWB 4XN2A 2AVFA 3F04A 2D2OA 3LEXA 3QULA 2HJFB 2A77H 2XHNA 3MO1A 3S5ZA 5CP7A 3ZHFA 2BP5M 2H41A 3MA7A 4FLQA 4MQXC 2XNAA 3SHSA 1TKWB 4R26H 5IKCA 4WWKA 2APVA 2F54B 3MTRA 4MLSA 1XF4B 1S3KH 2NYZA 3D85B 3QDAA 3MLVL 4KI5F 1E8WA 3DXAB 2VXQH 1A6ZB 3BD4A 3LMJH 5CEYA 3K8MA 5KTEL 2HRPL 1XIWA 1IBGH 3MNWA 4OGYH 5B1BB 3TBTB 3HG3A 5D4JA 3ZZ1A 2H32B 4CBZA 5DMIL 4UUJA 1FFPB 2VT0A 3ZU8A 2X1WL 1OAQL 3BMVA 1ZY9A 3MJ9A 5CSBA 4R7XA 2YOCA 1QTSA 3FTWA 5K9OA 5L9DL 4DCQA 5I1GH 1THCA 3QWRA 1NCAL 4HGKC 5F7YC 3RY5A 3FBKA 3KHQA 4X8JB 3RWDA 4NUMA 4XPTL 3LEYL 1W0YT 2UZXA 5AVRB 1KEMH 3TWCH 3V4VA 4I9WE 5DC2A 5GS1B 4UV7H 1JP5A 3LB6D 3V55A 5E9NA 2LR4A 1XR8B 4HEPG 2D7PA 1JE6A 1N0LA 4JVUA 1LWRA 1U8MA 3AREC 3Q6GH 2QQNL 1S7RB 4AC4A 4ADGA 4DAGH 3PJLA 4D9RE 4F8TA 2ARJB 3U25A 4WDIA 4U1IB 2IJ0C 2IFFL 4M03A 5LVEA 2F7QA 3QCVH 4XR8C 1ZIAA 2AK1L 4DP8X 5A2CA 3V0GA 3Q06A 1D9KB 5E9DA 2DY2A 2E74C 4J3OC 5CLZA 1VGKB 4LFHG 3SDDA 2VXTH 1KJ2L 4PGCB 1P7QB 4X9YA 1DDHA 2Y69B 3MR9B 1PZ5A 2F1BA 1NCJA 3CXDL 4Z7QF 5HPOA 1RJZB 3DX7A 2E75C 1M2VB 1SY6L 3CNKA 3HKZA 2HYMA 2D7TH 2GIXA 5CP3H 5B1JC 3PL6D 3TN0D 5I0YA 5GZNA 2J6EH 3G6AA 3GHPA 3IS0X 3VMPA 1I9RL 2YN5A 1UOWA 5C6TH 2XETA 2Q5BA 2Z91B 4GW5B 5JOEA 2WYTA 1PJ9A 5JDSB 5HJGA 4BK5A 3NCBB 1BGXH 2ESVB 3R4DA 4ODHL 3VD3A 3B3IB 4G3YL 2GI0A 4PU2A 3L3DB 2K3TA 15C8L 3B9VA 3NP4A 4GFXA 4PRPA 5KUKA 3HRZB 4KV5F 5AZ2H 4HKZB 1MPAH 2XIBA 3OLIA 4M8VA 5HVFB 2DWTA 4JMNA 2X1QA 3IWUA 5A2JH 1WZAA 3V0FA 5HI4C 2G5RA 3JTSA 2LLNA 4A6YL 2F7RA 4IRJD 2X87A 4U1KA 5DJZB 5J7CC 3K5RA 4G9FD 1EAJA 3SBRA 4LEOA 2ZYIA 2DM2A 3F12B 4X98A 3IU3A 2APWA 2H1PL 3APFA 2G3ZA 4N9GB 4LF3A 4ZDHA 5JW5B 1DVFD 3QB7C 1EDQA 3IDYB 3OKNA 5D7LD 5FUZH 3TBYA 1B0IA 1XHHA 4Y19E 4ZFZA 3E2HC 1J8HA 2CHXA 2Z92A 3L9YA 4XVJL 1WA0X 2XZAL 3LCYA 4U1SB 2YK1H 1AAJA 3V5DA 4U1GC 4AGNA 2JKJA 1D5MB 2PCPA 5HY9A 1V7NH 3GMOB 4PJDB 1ZWIB 5K5YA 1IGYB 4MMXA 4JPIB 4Z8FL 3QFJE 4QWWC 2IEPA 5ES4B 2X05A 2BY1A 3E1F1 4RISL 2V9TA 2ZUYA 3L3JA 4AK1A 2NPLX 4CU7A 2XI9A 3LQZB 4V11A 2D31B 4YHPA 5KYXB 4IK6A 3LXCA 1AZZC 3Q44A 3N1PC 4A2DA 4EJ1C 1J5OL 5GS2H 2CBPA 4FQHA 4F37F 1Y7VA 1BECA 4OZHB 4PYHA 4RGOH 5FO9B 1PCXA 1DJYA 3UTSA 1E27A 2VL5A 1QSFE 2WLKA 3VGAC 5BVJA 3L8QA 3QCUH 4P5KB 4ELMF 1LE9A 1AGDB 1CCZA 2BPBA 4J3SA 4QTIH 4IJ3C 3CSPA 3LPPA 5GGVH 3HFFA 4Y1TA 1UWGH 3F7LA 4MNHA 1EEZA 3GGWA 3ETTA 3IU4L 4PCYA 3SCMA 1NGQL 1IQDB 1A4BA 1HDMB 1L9NA 1NDMB 2FX9H 3ELQA 3GSRB 5EZIH 1U3JA 4MJID 5B1CA 3R06A 1KJ3H 2CPUA 3CMGA 1NCBL 2RMNA 1NAMA 4LQFL 4OLYH 4Z7NF 4XTRD 4M29A 4XCEB 3CQQA 3KYMB 2W9EH 4M5TA 5CD5D 4GIOA 2WMPB 1JZ7A 1ZVYA 1AGFB 3L9RB 4ERSL 4Q6IA 2BVEA 4YGVA 3WKPA 3DKHA 4MMZB 3TA3C 3WLBA 5CN2A 4ZX4A 1TLMA 2NX5A 4KZCA 5FGBA 2BM3A 2EDQA 5DHDA 3LHAA 2DQIH 1G7PA 5I9QC 1NJ9A 1Z9SA 1I9IL 4N20A 3QZMA 5HI3C 1ILSA 1XSKA 3OLEA 2RALA 1FLRL 5I8OH 3FOLB 3BAWA 4YHOH 5ENWA 1OAKL 2MKWA 3LZQA 4HZLA 4YXKH 3ZL4L 3RURA 4O2FB 1A9EA 4OFVA 2FSEA 1E6OL 2G30A 3MOQA 3O11B 4AV5A 5CBAB 3N41B 1AZVA 3WNOA 3KJ4C 4UQ2A 4AE1A 1IKNA 2VW4A 2DI7A 2E8YA 4LLUA 2CUIA 3FUHA 1MFDH 5HHOE 4PJCE 3BAXA 4M8QB 3TJEL 4KX8A 3QR2A 4HAGA 5IM7A 3QEUA 4FTVA 4XBPA 4XPFH 3O3EA 3C6SB 1ANUA 2XSKA 4I48A 3RTQC 5JOFA 3U6XA 1JXJA 2XPYA 3JV6A 3UAJA 4PBVC 4PS4L 3GB7B 3W11D 1P9MA 3UTZB 1DLFL 1FVEA 1NSNH 5F1OB 1UD5A 1WEJH 1G0XA 1I7RB 3BGMA 5FB8A 2P4AB 3DLQR 3ZDXB 4RESB 5DHEA 3FQ1A 1TEFA 3VJ6A 4I1RA 4AYSA 4XXDA 3ULUL 1JZIA 3NH7H 1LEKB 4QRUA 4P8QA 4P9HH 3W0WA 4GG6E 3PDDA 1L0QA 1J8KA 1RZ8B 3MUJA 3GBML 3OAUL 1QFUL 2CUAA 5E2VL 4Q97A 2PWFA 4AEHH 4MWFA 1PAZA 4AJVA 5F7WC 1HYSC 1OP9A 3LYRA 2VH5L 4L05A 4PJEA 3NIDE 5D71L 1A4AA 3SGKA 5DWPA 1K4DA 1JN6B 2GJ6D 1MHEB 1Y6NR 2HWZH 5GRUH 2AKRA 1NGWA 2ZCHL 3GMRA 1JPSL 1TT6A 4L3ED 3T0EE 3VA2C 2VSCA 4WWPA 1M71B 1MIML 3NSDA 4KPHL 1VIWA 1NOLA 3V4PB 1PZDA 1UZ6F 2IANB 5SWZD 4F8NA 1I75A 5FFLA 4UTBH 2OSLB 5F7EL 1OHQA 2G75B 3VWKD 4JUSA 3ERXA 3CCHB 3QIUA 4FQIL 3NACL 4Y5VA 3WDJA 3BO8A 2IAAC 2F7OA 5DEGA 2OCCB 3WE6A 4XPHH 3FQUB 3T65A 3D50A 5JMOC 4ZW5A 4PLKC 1MRDL 2DQDH 4ODWA 5EO1A 4EUPG 2BXYA 1DQML 1OAJA 2BVYA 2DQEH 4U2YA 1TMCB 1MCPL 2ODHA 1XGRA 3CGTA 3IGAB 2AXFA 2UY7B 5BV7C 5C0JB 2E7HA 2UZIL 4Z3IA 5FPIA 1IBDA 1S78D 5FHAL 3TT3L 4FQXD 4I18B 4K5MA 1E9PA 4CSZA 2HLEB 1YDPB 5BMFH 32C2B 5EF3A 4LHUA 2OSWA 2GC4C 3GRGA 1F4HA 1DDTA 2BVOA 4RMWA 2P44B 3NFPB 2GTWA 5JTWA 4IBLT 5F7FA 5LBVA 1U3HC 1E7VA 2GPZA 4LLAA 4P4RA 1U33A 3M86A 5HYFA 3BP5A 5JXAH 3RHWF 1BFTA 1AANA 3G5VB 3ZKSD 2VR7A 3D34A 1X7QA 3WU1A 4U0RB 2JV6A 5AOMA 3T3PB 4K3JH 4HFUL 2KI6A 1O6VA 4X7SH 4FQJH 4HS8L 4YC2B 3WFCH 4K71C 1XCTA 4IOFD 4JRFA 4J39A 2FJFA 1HEJC 1I82A 5EEYA 1TQTA 1IC1A 1MFEL 4YFLF 1HJBC 2K7QA 3AWEA 3DIFA 3SDYL 4A2GA 2R51A 1PG7H 2A83A 5ACZA 4QY8B 2PNDA 2FB4H 4TLUA 1T4KB 1E4WH 1X4YA 3FO9B 5C07D 4CADB 2ETWA 2BSRA 4WNQA 5AOZA 1F4WL 1KTKE 2A99A 3FSOA 4F57H 2Q7AA 4D8PB 3KLHD 1RK1A 3FTZA 3V7MA 1U30A 4KTDH 3KEHA 1OZTG 2AXHA 3L5WA 1OD9A 4LCCB 4KTGA 1OTUD 3D0LB 1SXCA 4K5LA 1LO5A 1XXFC 3IFOB 4K9JA 1JGIA 5HP5A 3MPCA 4PJGA 4Z76A 1FO0L 3QO1B 3IE4A 2DTML 1UT9A 2GC7C 1XF3A 3DV4A 4MQSB 4OBSA 4HQQL 2Z31C 5CINH 3DBXA 4NUQA 1JZJA 2H4EA 5BZWB 1MH5A 5LO7A 1E3ZA 1YA5A 3AY4A 3PG2A 4X5RA 3O6FC 4CVZA 1EVUA 4JKLA 1HSAB 4G8EB 4HS3B 3FB8B 4WCYL 4XPAL 5C0AD 1CG9A 1WWCA 3D2TA 1HZKA 5LG1A 5EO0A 4F8PA 4K9EL 3EJSA 5FYKH 3PGCA 4UAHA 1C9SA 1QSED 2OXHA 2DRUA 3IDXL 4U6VL 2H32H 4MZIA 3WN5B 4X8CA 1TYJA 2J4WL 4AIZA 2CO3A 2KZ1B 3CN4A 3G6JF 3QUZD 4PGDA 5CR8A 3H0TB 1S4IA 4F20A 1EWHA 4FXKC 4B9JA 2XWBB 5HVHC 1S8DB 1E43A 1KYUA 1NCWL 2ATKA 2NMSA 3QBTB 3ET9F 2FWOB 1AKJA 3QISA 2DKSA 5FXCH 1CICC 4X5XA 3SKOB 1J5IA 4YQXL 1ZLSL 3QXTA 4PWHA 4D0DA 1X5IA 1TPXC 4YE4H 2PTUA 3GYRA 4LVNB 4PJAB 4UTAL 5PCYA 3ZE2F 3QAZC 2F15A 5I74B 5KSAA 2PN5A 2HLAB 3EGDB 1RXLA 3BXNA 4PGBA 3EZ8A 1PL3A 4P23B 3AXLA 3HZVA 3RVUD 1KIUB 5I6XC 2VNCA 2GBTA 2AQSA 1OSEA 2XN9A 4OCWH 4XNYL 1B90A 3U36A 2ERJC 1AZNA 4W9LC 5DFVC 5GRJH 3S36X 5FR3A 3B34A 2X41A 5I73B 1RJYA 4EUPA 5E9DE 4PM1A 2WTRB 4R3SB 2FX7L 4G6FD 1A02N 5TDOB 4QHPA 3ATDA 3LKOA 4XB3A 1TJGL 1JFQH 4M7JL 3KL0A 4L37B 5BXFA 3QFDB 4X4KA 2EQDA 2WLNA 3VXUD 4LCUB 3C6LA 3MRKA 3OKKB 1XZ0B 3KBEA 4W9HC 5KVFH 1U8IB 3FU8A 4TULL 1EHAA 4JO2H 3BIBX 1XQ4A 4L4TB 1KT2A 4R0LB 5SWSB 3QIWC 2EH8L 2XKNA 2PPEA 3BQUB 3OTTA 4H26B 3F05A 4XMVA 1BAFL 4HLJA 3QPQD 2OMBA 2QFPA 3T3MF 3VCLA 3L7FB 2NY1D 1ZJBA 5MENB 1QKZL 4HUXB 1DCLA 4DN3L 3I9GH 1EHLH 2J3SA 3DX1A 2H6OA 2EO7A 4OI8A 4AMXA 1UWFA 4X6BB 1FE8H 3FCGA 3ZRCC 4LCIH 1DHKA 1QLRA 4IU3A 2ZOLB 2R8SL 2XWJB 3Q6FB 4XMUA 1PX4A 2HT3D 2XPGB 3IPBA 4OR1A 4QD2E 4POZD 2V9UA 3IF1B 3TJPA 3IBEA 5GSRA 3TNMB 4N9OB 5DJ0B 1D3CA 2CGRH 3ZSSA 1SUHA 5AAPA 2QKIC 2X4PB 3LS4H 3MGOB 1AHKA 4N0CD 3P9MB 1J8HE 5KSBB 4GAYB 3PNRB 2VO8A 5E99H 5D5MA 1WCBB 2FBOJ 1Y07A 2W1NA 1CT8A 5F7NC 3O2WL 2C4XA 3CHRA 5EU3B 3AAZB 2BCMA 3APMA 4FAAB 4LSSL 4GSDL 3S0PA 4BZ1L 3O4LB 3ULVD 1J1PH 1OSYA 4QRTA 1WZ1L 4L8CA 3V0AC 1I9JH 2XIIA 4BJLA 3BW9A 2GABA 5HDLA 3ZT5A 1GS8A 2KDGA 3H3KA 1HYRC 3D9AH 4XBMA 3WUWB 2XQ0A 3TIDB 4NC0B 2CO6B 2BNRA 3NESA 3UTSE 4Y5XB 2OL3L 1P7KA 1A6WH 1BFOA 3FSZA 4HJGB 4ODBD 4PRDB 3OSVA 3A6CL 2LU7A 2CK2A 3MCLL 2VXVL 2Y3NA 5CEZD 1WHOA 3HCVB 1W16A 4K7PH 2ZXAA 4Y7OC 5HHPA 1QATA 3V5KB 4DNLA 4R9HA 4NC1E 2CKBA 1HSBB 3DJSA 3S9DB 5GZOD 4IIQC 3E1ZA 3D39D 3VD4A 1P5VA 1P84J 1U8CA 3KBFA 4AENA 3RU8H 2VB5A 3RFRA 4IJ3B 4RAVB 2JI1A 1MUJA 1KACB 2OMVB 3C5ZB 1CF8H 4NAQA 4TMPA 1YAIA 1A7OL 4RMTA 3WS3A 4HPOL 3FMGH 4Y2LA 4EVNB 4NM4L 3E80A 2WQVA 3DX4A 3VXME 1T66D 1CFMA 3SQBB 1USZA 3R0NA 1W9XA 3GXDA 4ISVB 5K1VA 4AJ0A 3HAEH 4F27A 2IAMB 4E9VA 5ADOH 1N6UA 1YY8B 2NX5E 2J43A 4E41D 4F1ZA 2JIXB 4N86A 4MB1A 4HYTB 4Y16C 2WBXA 3NEXA 4K0OA 4MJ6A 1IX2A 1SEQH 3TBSB 4CSPA 4JG5A 4A67A 2VLKD 2JE8A 3NQIA 4N2BA 1BOGB 5EA0H 3TA3B 4M1GH 2EH7L 4Z3GA 2P47B 2FEEI 1T2XA 2D7NA 5AW0B 1CQYA 4EBQL 3ROLB 3HI5L 2WLZA 1P0SE 3VWJB 4F2EA 5HYIA 5I9QB 4OUUA 1OP5H 3GPSA 3FT2B 5SX5H 3MZTA 1YMMA 1JZHA 2F1EA 4XMLL 2YN3A 3HC0A 4FTVE 5DJYB 1EAOA 4NZUL 4R4BA 5DXWA 4FADA 5J6HA 5SWQB 4NFCA 3RTLA 4NKMA 4PRNB 4WFGD 1OAUH 1HL9A 2EIZA 2EVIA 4GSRA 1U2CA 1DJWA 4G71B 4QXUH 1J9QA 2EDHA 5D1ZC 4IRSC 4B97A 3MUGB 4JJOA 5EU6B 5ADPL 5SX5K 4K8RH 5B4MC 2XTSA 3N40P 4JG1H 5K9QG 2Q0ZX 3PHOA 3RQ3A 3C8DA 1KG0A 3DHUA 3EH3B 5G4MA 1SM3L 1JDDA 1WUNT 5JIIA 5CZXD 1MJJA 4X9HA 1GXEA 4NLHA 3L3IA 3SBPA 4Q0XL 4KVNL 5DZ9A 4FQLL 3O3DA 1DFBH 2CIIB 4UT6A 2JCCA 4FEIA 5A2BA 5INDA 1KB5A 4Y0GA 1A4JB 1EZSA 1WD8A 4OLZH 3OBAA 2XA3A 4G43B 4DN4H 1A8ZA 1GJUA 3MYJA 2EDTA 1YMHB 2ZNWA 2Z1KA 4AVJA 1IJNA 1NL0H 4IKLA 4PBDA 1BJMA 3NJMA 5D7JC 3SGDH 4D7BA 4OCXH 2JWYA 3K91A 1NFDA 4P57B 1A65A 1E5UI 1EQWA 3V4PH 5DZJA 2VRAA 2HPTA 5C0IB 4LBEA 1YEWA 5DHYA 3QUXD 3VFWA 3C75A 2CHDA 5CCKL 1VFUA 1I7TA 4AM0A 3BN9C 1OCWL 2Y1VA 4UB0L 3WFEL 4DGYL 4I13B 3GMMA 2Y1ZA 3RGBA 4B0MM 1NFKA 1AJ7H 4OZFH 4AIOA 2B2XL 1C5CH 4KRMB 4R7VA 1VSCA 4XMKH 3MBEB 1PW3A 1SBSH 4LPWA 1INEL 1KCRH 3GO1L 4V1DA 3SGJC 1TENA 3ZUNC 3G5YB 1KGIA 1JD9A 4MZ3A 3GSQB 1U3NA 4IKIA 1KXVC 1T0NB 2O5YL 3O2DH 1HU8A 4WLCA 2OSXA 1W15A 2A5UA 4HWUA 4UQAA 5KEZA 2AEPL 2PO6D 3QW9A 2Z4QB 1YAZA 1QNIA 4FFWD 1FA4A 1ZEAH 2V5SA 1P6AB 3GIZH 3JWNG 1GTFA 1AZUA 3FH5A 1C16B 3MX0A 3RPIB 3VFGL 4OJDH 4L48A 1P4LB 1AXSA 1R24A 3ML8A 1AD0B 2ZUTA 4LCYB 3U6RA 4NHCL 2V2TB 5AVSB 3D5OF 3VD2A 1QI3A 1NWOA 1TVHB 2FO8A 1FV1A 3QIBC 5TDPA 5ICYA 1KPVA 3VB8A 2FEEL 2YMXL 3ZE0B 3O41B 4GEJA 3IMTA 1O75A 1MKFA 2BOLA 3EYUH 2YAPA 3TO4C 1GAFH 1HWHB 4DH2A 3U7WL 4JM2F 1URLA 2NSXA 2YBRB 1PVHA 3FYEB 3I9PA 3APDA 4MBOA 5E1IA 3T04D 3WMSA 1ZCRA 4H1LB 1P1ZB 1GKEA 4O5LH 3AWGA 3M8OL 5KZCB 1YEDA 2IG2L 2VJXA 1G7IB 3H9SA 4HDIA 1QHQA 2Z34A 2WGNB 1EEUA 1ZDQA 3ESMA 4RGNC 4KKRA 5IQ9B 3QDMB 3BAEL 1RSFA 5AKTA 1JRHH 1FIGL 4Q14A 2ZOKB 2WY3B 3ML9A 5D1XB 2HB0A 3C08H 3GHBH 4M6MH 4MQ7A 4JN1L 3GMQB 3SKJL 4LK4A 2AGJH 5EC2A 5ABDE 5JHDD 4YBLC 2QHRL 5C08D 3TVMA 2G3XA 1JG9A 4N25A 12E8L 3PREA 5HGHB 2AJSH 4PR5B 4XB8A 1PSKL 2XX0A 1PKQA 1T22B 2VDMH 5D1QB 1BAGA 3LKPB 2ITFA 3D52A 4QRAA 3CU7A 4X99B 1FGNH 1D2PA 3OKLA 3PWJA 4XHQA 3VXOB 2CJTA 3T1FA 1DBMH 4PJGE 2HJKB 1NAKL 3DOSB 1MCEA 5LXGL 3RIKA 3CVBA 4MHHI 3WFHA 4NWUH 1CS6A 2A74B 3F84A 4FLOA 4APQA 3O9WB 4WWKD 3PDOA 3HN3A 4OQTH 3PY9A 2Y2WA 4XH2A 4DGVH 1KFAH 1UOKA 2CR0A 2K8QA 3FC8A 4KI1A 4MMYB 4WAFA 1U0QA 1AI1H 2Y06L 4Y7MA 1QUPA 1QA9A 2P5WB 3FHQA 3NQKA 4IRZH 4XC3L 2EJ1A 5M95B 2ICWA 1FHNA 1ZA6B 2VR8A 3FOMA 1HZHH 4LU5H 4DKEH 3ARWA 3QUMH 4ZD3L 1EJ8A 1GIGH 3WN6A 4IS6A 1QLFA 1KCVH 3LPFA 5DMKA 1FFQA 1SPDA 2R56H 3QHFL 2B9AA 2W65B 4Z95L 4TVUA 3AROA 4LVOC 4MS6A 2NW3A 1PEWA 4DVBA 4NZRH 3CLEL 5LN8A 2CHWA 1HINH 3CFDA 3N9GH 4TUJA 1DUYB 4JREC 3RNQB 3KXFB 3P4MB 3U4AA 2HKHH 1E8ZA 5EOCL 5G4OA 5KVGH 3SOBL 4WFFD 1DBJL 4AX3A 4QGYA 1KYOJ 5I75C 4JFDB 2WXJA 4JJ5A 5DRNA 2HSIA 2VN6A 4DPBX 3HEIB 1DQTA 1RUAL 2YAHA 3KLAB 1Q9OB 2FJUB 4BHUI 5JYMA 1Y18B 3AFLA 2XN9E 4XP6H 1M42A 4NFBA 1O9WA 4YXLH 1O7SA 4W6YB 2ZKXA 2AQPA 2NY3C 2Z64C 4MAUH 3SDDD 2Y36H 4X0KB 4QO1A 1HL5A 3D2UA 2NR6C 4RBPK 4KXCA 3A22A 4OD3H 2H9GB 5FA4A 5DR5H 3UBXG 1G7MB 1JUFA 4G8GB 3M45A 4O4YL 1NMAH 3CPLA 1S7XA 4YSPA 1W72H 3MLZL 4D2NA 5IB3B 1D6VH 1S46A 3LEVL 2P5PA 2VDLB 1RUPH 3U9PH 1N0XH 4PRPD 4W9JC 4BEIA 2UYLB 1IZJA 5CXPA 1RZJL 4U1LB 5D4IA 1HK6A 3C12A 2QV2A 3K7UA 2WKOA 1CL7H 3WG7B 3OR6A 2ATPA 3BVDB 5M7QA 3QJSB 4YNYA 2BSEA 3TXAA 3QIWB 5C92A 3S35H 3KVQA 2BJML 5DS8B 1T1XB 3W5MA 1FC2D 2P8LA 5F7LB 5LJYH 4I77H 3JUZA 5DJ6A 3NCFB 4QRRB 5T3XD 4IBSA 3S5LB 4NQEA 3RX9A 4MD5A 4G6AC 5JIHA 1H3PL 4HUNB 4H2AA 4ZFOL 1S7VB 4HOWA 1E7UA 1FBIL 1YC7A 2HA1A 2RH0A 3QXDA 2X70B 4PWEA 5CGBA 4C59B 35C8H 3I6LE 3R19A 3WJLA 3F7RA 1MLBA 4NNXB 4AGMA 3JWDH 2ZCKH 5DC0A 4HX1B 3VMOA 3RWHB 3PJSB 4PW9A 4PLNC 4YS4A 3HFML 2OYKA 1KIPA 2IPTH 4OM1L 4QXGH 4IMLB 4H8UA 5CJOL 1IE4A 2J6WA 3C9NA 3FQ4A 3MV7B 5B39G 2FWLB 3MREB 1MI5E 1E8XA 1YNTF 2UZYB 3HUJA 5FO7B 2OW7A 2BNRE 3FO1A 3AG4B 2EDOA 1SXNA 2IBGA 1J0IA 2DN7A 5DJAA 5F1NB 1Z1WA 1A66A 8CGTA 3RWFB 2QVTA 3QP3A 3PV6B 4KRPC 1MRCL 1SF5A 3GJFH 4FFTA 3CFJB 4GP8B 4UT9L 5E56A 3HBQA 2I27N 2XUWA 1CO1A 3W56A 2R7EB 1H15A 2ZWZA 2I07A 4HPYH 1MCBA 1MJUL 1WYJA 1VF5C 3PUCA 4HUWB 5D7IA 4XZUA 2UY6A 4XCFH 4HA1A 3MNDA 1XSIA 2ORBL 3FFDB 2R0KL 1MZZA 1CE1H 2WP3O 1NH6A 3II2A 5EEVA 4YAQA 2FJHB 1B6UA 2VDPH 4GRWB 5DD0H 5E2UL 3SY0A 4IGBA 4M00A 3ARZA 3O8XA 3DSNA 1FNEB 4QF1B 3T2NL 1KLGB 3D4CA 4JAMA 2X4TB 2UWEB 1HEZB 2J8UE 4HKBB 3FONB 4ODUA 1QFOA 4KKBD 1I1AB 3Q3GA 2DH3A 1XB3A 5HI5D 4NCC2 4KXZH 5DVMA 4QYOA 3MLVH 1LO2L 4AEIL 1F97A 5MEQA 2ZAGA 2ICEA 2J5LB 2PPDA 4R4FH 1MFCL 4LLMB 3KYOA 4NQDA 4AKPA 3OHXC 2HUEA 2OJ1A 5IBTH 1AY1H 3PAZA 3NJLA 3C09B 5IW1A 5HYQB 1OARH 2PP7A 4FTVD 1OAQH 3HN5A 2VJ0A 2B4CL 3PDGA 5AL0A 2H3NB 4K8RC 1YMME 1CDHA 3PHQA 4OAWA 5E1AB 4D0CB 4CMHC 1A47A 3UAJD 1ID5I 3CV5A 4XPTH 3SPVA 3LEYH 1BBJB 5DD6B 4PH8A 3AW5A 1BD2B 2JB5H 1TKWA 3T4YB 4D9LL 3B37A 4EI5C 4XBEH 1AMYA 3GMNB 2W0KA 3KPMA 2QQNH 4TN9A 3LXAA 5TF1L 2F54A 1JYVA 1JF1B 1ZV9A 1CE6B 5H4YA 2VABA 1XF4A 5F3HB 3ZTEA 4XGZA 3D85A 4KK8C 3WDIA 2IFFH 2PXYA 1TTGA 3DXAA 4FF9A 5F1IA 1L9PA 1OVZA 2R69A 3ATEA 2AK1H 3W0WD 3IM1A 4PMFA 5A2LH 1AO7A 4XVSL 4K55A 4P4KC 3QWOB 5D1ZB 4YDIL 2IDSA 1KJ2H 2AJZB 4KBPA 4X6DB 3ARBA 2JCCE 5IIEA 1FFPA 4HG4K 4PJ9C 1CFQA 1FF5A 3CXDH 4S1QH 5LBGA 5D2NC 1AQ8A 1MVUB 4HJJH 3A6BL 2TRHA 3WIHL 1SY6H 2VLME 3PF2A 3S2CA 2WBJC 4UV4L 4B9FA 3BPOC 4I3SH 3DARA 3L9BA 1I9RH 4PGEB 4GQ9L 1XXDC 3OB0K 5L0QC 2YOAA 3T0DA 1JJUA 4ODHH 3JZ7A 1NFDE 5GS1A 1ZPLA 1QSZA 3US9A 5IHLB 1XD0A 4LSTH 4XHJD 1UB6B 3DX6B 3QI9C 15C8H 3WBDA 4ZMPA 3FO2B 4KUZH 3LZFL 3HI6H 3QIUD 3FHEA 5HBBA 3AT9A 2J2ZB 5DRXB 4U1IA 4QTHB 4XN5A 5ERWA 5KJRL 4I0PB 4JQVA 2MEJB 1NCDL 2NSMA 3DUUA 1G9NL 2VDKL 4KK9D 4Y1AA 5B39A 2PMZA 1BVLA 4A38A 4PGCA 2OZ4H 1P7QA 3E3QE 1H8SA 1U2HA 4O02L 4V1DE 3CTTA 4M9PA 3VAEA 8PAZA 4JO3L 4BFOA 1VFBB 5AW2B 1H5BC 1M2VA 1R1CA 2FVNA 4PJBA 3FFCB 1KXTB 2ENYA 2FLBT 1FZJB 4LHUD 5HDOA 2O6EA 1NUDA 4Z8FH 4K3EH 3DHMA 4UAOC 4BZ2L 5AUMB 3VYPA 2CSPA 4QJ5B 1IT9H 1ILUA 2D7QA 2CE6A 2MHAB 1GGUA 3B3IA 3ZE0F 2QMJA 3LXUX 4GFTB 4GS7B 1MDTA 3HRZA 4RAHA 3Q5YA 4HKZA 3VVVA 1CGXA 1CXEA 3MLUL 3LHPH 4ZUTA 1BDYA 2Z35A 3WLWD 1B0GB 4JANB 1MHHB 4M7LL 2FWUA 1SOKA 2WUCL 3E38A 4CC4A 3FS9A 4JM2C 4NUGH 3UP6A 5K93A 3IAQA 4YSOA 5CGMA 4TQHA 3UOAB 4PTTB 5JW5A 3IJ9A 2CDFB 2Y7MA 3IU4H 2X4RA 4JRYB 2VZSA 1KGCE 4GKOA 1XGTA 4YL4A 3ULVL 3TCLB 4WVRA 4U1SA 3X1FA 1IGJB 1JYXA 1U8PB 2NNAB 3GMOA 1ZWIA 1VFMA 3H9SE 2DL9A 1QFPA 3UEQA 2E7LA 4JPIA 3DI2B 4XI5C 1TXKA 3IFNL 4LGRB 2MNWA 1IQWL 1YHPA 3HG1D 1MELA 1GY1A 1BF5A 4XCCL 2F7PA 1OIOA 3HZMB 4LDLB 1WLHA 4ODSH 2Q2EB 3QQ3A 3LQZA 1V10A 4ORGB 4TF4A 5FW7A 4J3BA 5IHZB 4NNYB 3DPDA 1VJSA 2WANA 4LDEB 1A9BB 4TQPA 5JPNC 3N50A 1DJGA 5FO9A 4OZHA 5CEZL 1P7HL 4LT7A 2PYEB 3GT6A 1PKQE 1A6VH 2IADA 2YPVA 2ZUVA 1HZLA 1A1MA 1F3RB 1YLBB 1E4KC 3FTUA 2HVKA 3E9TA 2H1XA 5IVXF 4I8DA 1I9IH 4Y4KC 5T5FL 5A2KH 1FFNA 3TH3T 3SDAA 2YXWA 1ITBB 1G7LA 4OD1H 1J1OH 4ZX3A 1I7ZB 3VFOB 3ZL4H 1NDMA 1U4FA 5IHUH 2MWCA 3WIIH 3C2AH 3DWTA 3HN8A 5T1DH 5D96C 2XOTA 1N8OE 3NZHL 2HJLB 3BUBA 4G6JH 1HKFA 3CMOL 4PRHB 1P6WA 1WAAA 5ISZB 5CIPB 3TJEH 5IR1A 2XTJE 1V55B 3M1OA 2WMPA 1UASA 3RILA 4MZ2A 1AGFA 1KTDA 4WFHE 1WJ3A 43C9B 2WNXA 3ARFB 4P2OC 2VISB 4PP2B 3MV9B 1IB5A 2IQ9L 4MMZA 4GRLB 3C6EA 4N0UB 4PS4H 3TEZA 1AKJD 1L9TA 1SYVA 3ULUF 4UDTB 5G4NA 3AU1B 4Y2NA 1JXKA 4JDZB 3VFTA 3EYOB 2BDNL 4JFVA 4MA3B 2X1PA 4OGAD 2WVSA 3O6LH 5KSAD 4S1DC 4GBXA 5IOPA 1M4KA 3M17A 5IJBC 3SPGA 3IPEA 1FYTA 5DD3L 3ULUH 3LNGA 4OD2B 5FGCE 2AQ3A 5CHNB 4O2FA 4YSCA 2GW5A 1HHJA 3BIAX 2WNKA 4IDJH 4B95C 1MQKL 1QZ1A 2BX5A 2YD8A 4PSPA 4NP9A 5CBAA 1QFUH 3POHA 2YQGA 3TJHC 3RWJA 2QQKL 1A8JH 3WGUB 1J86A 5F71A 3QZWG 1VADB 4C56A 1AG0A 1LE5B 1NIAA 1TYRA 4WHCA 4N8PA 1BFVL 2BW4A 5CSZB 3RL2B 2J8OA 3FQXB 3H2WA 1IBHA 4UQ3A 1JPSH 3GUFA 5I1DB 3RB7A 1EXHA 5LGHL 2DYPB 4KPHH 1YEIL 2R29L 1Z5HA 1JWUB 5E6IC 3UTZA 1UZ8B 3BJ91 5FM5M 1I53A 1U92B 4RFNB 4Q89A 5F7EH 3REWA 1Q1JL 3JWNE 1G6VK 4EDWH 4NB7A 2XWXA 4UOW1 2OMUA 1U8HB 4H13C 5D6CA 4DP1X 3NK4A 2CBQA 3SE9L 2NCEA 3L4ZA 3BEVB 3L4XA 3KLLA 4RDQF 5C0CB 4FXGC 3GS4A 4ZUSB 4Y9BA 3HG4A 1MCPH 1XGUA 5DCCA 5BQ7B 1I85A 4AW4A 1F58H 2XY2A 4PG2C 3UTOA 2XWTA 1R3IL 1D6EA 3CIAA 3GSNL 3CZLA 2L04A 1R5WA 4Q6YA 2WWKO 1WBXB 1V7ML 3LRSB 2R83A 5FHAH 3B9KD 2DW5A 3Q48A 3JWDC 3B83A 3BI9X 3CVHA 4YK4B 3UIZA 1OP3H 4NWTH 4RETB 4PJIB 1ESOA 2CUMA 4FFZA 1M71A 5BJTA 3S37H 4HWNA 1QUNA 3DROB 1BJ1J 3MRPA 4KHXL 4YX2L 3SQOL 2JCWA 2FTAA 3TONA 1MCHA 2WCPA 4TSBH 1YNKH 1CVRA 4UMGA 2E9BA 2XZCL 1RFDL 2F0CA 5IMLB 2R0ZH 1XF2A 5HHNB 3BUPA 3CCHA 3C60B 3PWLB 2EIDA 1WG3A 4MAZA 1Z5YD 5GGRB 3MNZB 5C7XL 3L7EB 1OP3K 3EBIA 3ASWA 4OZGE 5AD0B 3FQUA 4NZDA 1S7TB 1A3QA 1KENL 3QHTC 5AZEL 1D7DA 4NN6C 4ZW3A 4CVXB 2NY2B 3IGAA 5C0JA 5I19L 1N70A 1ZHNB 1SMDA 2DBLH 4UTCA 4F8OA 3LKNB 4KVPA 3JT0A 3LV3B 4KNTA 4W9DC 3V6OA 2QGDA 2YD0A 4PJ5B 3NCMA 4QHUB 5IBUB 32C2A 2KUTA 2FJGA 3KPPA 4WW1B 4J3OG 1TZGL 3UDWA 4OIIL 4Y2DC 1QD0A 2Y2YA 1G7JB 4U1NA 3LPGA 1MCRA 1CXHA 2KQMA 5I8EB 5D7IE 3G5VA 3ETSA 3NYKA 2O6CA 1MCFA 5CLTA 3L4YA 4A37A 4QIRA 1CXFA 3L4UA 1G6RB 1LLAA 1FO0H 2P8MB 4GAGL 4W4OC 2C7UB 1VHPA 2VDNB 3HC3L 3O0LA 2DTMH 3Q1EA 3VXNA 2FL5B 3OKDA 1BX2B 3FT3B 5HHME 4WY7L 2PCYA 1QFWL 1KV3A 3BH9B 3EF7A 1E50A 5I1HH 3VYOA 4HH8A 5KUMA 4YDVB 1LEIB 3INUL 3RIFF 1TU2B 3EOTL 4E2OA 2CPCA 2YA2A 2DV6A 1T5XA 2XG4A 3FO9A 1EUTA 4JZOB 4GMTL 4TS6A 5FHBL 3WFDH 4CADA 4NUPA 5F44A 2X7LA 4Y5YC 3KEDA 4XX5A 4X6FB 1F56A 4PJHB 4D8PA 1N59B 1E28A 4K9EH 1TUPA 1KN2L 2EABA 2H7WA 3FAXA 4EN3B 5FYJL 4ADIA 5I76A 5FW8A 3VI3B 2IWEA 1MCJA 4NQDE 2YPKB 2J4WH 2YGVA 5FX3A 3RNKA 2HRHA 4FLRA 4XMPL 1A1OB 1HXMA 1QAWA 3D0LA 3QZWA 3V0HA 1EZVY 2GSGB 1DQJB 3NP3A 1AE6L 3WUWG 3ZY7A 2HP4A 2BNUA 1KN4L 4MLIA 1NCWH 2B7DT 1EVTC 1TTRA 1OE2A 4OKVA 1W0WA 3QO1A 4NC2B 4ZPVA 1M6OA 3WFBL 1UXSA 4KMTL 5CAYB 3OHXB 5I0VA 4UTAH 4ZT1A 3DOIA 5F7MC 3P9LB 3K1KC 5BZWA 3DRTB 1K85A 4MD0B 4MXQC 5E24E 4YHZL 3S6CA 3CDYA 4ZOEA 4FP8H 3FH7A 1XCWA 4G8EA 4LLVA 4XNYH 1SJEB 4CMHB 4P46B 5IJKA 4X7CC 2VERA 2GUOB 5IHHA 3CHSA 4KZDL 3M6DA 1AO7E 3IDIB 2WAHA 2FX7H 4GUQA 4KI5D 3A4DA 4N8VB 4N0RA 1TJGH 5IF0B 4JDVA 4M7JH 3WN5A 5MHSD 5IWLC 3A6OA 2V33A 4RLDA 1OTTD 2B20A 1T04A 1Z9NA 1TTFA 2VW6A 1A4KB 1DEEA 4J4PA 2XWBA 2EDRA 1S8DA 2XBZA 3HNSH 3CUPB 1TZAA 4TULH 4BQCA 4KKAD 4U6YA 3HE6C 3LQAL 1F41A 2FWOA 2ZNXA 4G8IA 3D07A 4U1JB 5LCVL 2EH8H 3SKOA 4GQZA 5JOPD 2EXWC 1RI8A 2CBMA 2YUXA 5B8CC 2PKDA 4NI3A 5KYWB 2QV4A 1HHKB 4PJAA 2YD9A 2YA0A 4RNRB 3IJHB 1QKZH 4ZX6A 3EFFB 2B08A 2HLAA 4HK3J 4CGUB 5C3TA 3KJ6L 3IN0A 3G5ZA 5L4MA 2YSSB 4JQIA 1ZGLB 4LKCB 2WIMA 1Y1DA 3R18A 4Y89A 1PIGA 2ZTBA 3BMWA 3EZJB 1T0OA 4DP6X 2QLYA 1M3IA 1YPZE 2XX1A 4MNQB 3O3BB 3JTTB 3ZTJH 2R8SH 5DT1L 3LNIA 1GL4B 4G80B 4I1NB 5EF2A 4HGWB 4BH8B 2Q3XA 3CH1A 3UMNA 1Z2KA 5TDOA 4Y1AE 1ZVNA 1JGDB 4L37A 3HMWH 4OCRL 4GQQA 3AREA 2WVVB 3GEWB 4LLWA 1GCFA 2WXPA 4FZ8H 7TAAA 1TQUA 5JQHC 4IBVA 1OT1A 3OKKA 1ORSB 2PYFB 1XZ0A 1OANA 2FT8A 3QQNA 5HJ3B 1L9RA 1U8IA 3P9WB 4PJBE 3TFKC 1CXKA 4JZNA 1FWXA 4GMSL 1RZIB 2HKAA 1UUNA 3O2WH 4R0LA 3IJYB 5SWSA 1EIBA 2CGZA 3BQUA 4MXWL 4FNPA 4H26A 2YEVB 5KVDL 1VPOL 1Z5LB 2E47A 3HPJB 1OOWA 3L3KB 3MOBH 1P2CB 3NGBB 4NAJA 3PPEA 3DDGA 3NPSB 1DQLL 5BZDB 4P49A 5EDXA 1FRGH 3FTXA 3ARDC 4AL8L 2CO7B 3COOA 5EB9A 2F58L 2BNQB 3L45A 4P3DA 5TDNA 3JWOH 4JDEA 4UAOB 3TBVB 2OL3H 4M4PA 4N22A 1OT4A 3MDJA 4A7UA 3B5TA 4UIKL 3Q6FA 3A6CH 3HTLX 3RDTB 3TL5A 2FBRA 5IHBA 3MCLH 4HWBA 1QWHA 3IF1A 3TNMA 3EYQD 3MRDB 5BS0B 5E8DH 5H2BB 2BFVH 3FK3A 3B1TA 5DZVA 1CFSA 2ENJA 4KWUA 5DUBA 3AY2A 3GMLA 1G7HB 3H9SD 1G94A 4GAYA 4TVSa 2AF2A 1II4E 1WCBA 2GHZA 1FL5B 4X6EB 3QZPA 3V95A 4ENEC 4FG2A 3V8CA 1MW3A 4ZNCD 1DVQA 2MSPA 5EU3A 1G1OA 1MHPL 3NZ8A 3SDCC 3U2IA 1A7OH 1BYOA 3HB3B 3O4LA 3AS1A 1FNSL 2VAAB 4HPOH 3ZKND 2C4FT 1ZHKB 3TVMD 3WV0A 5DEFB 5GHWL 1OAYL 1SJVA 2ADYA 1WF5A 2X12A 3UYPA 4TNWF 1TQCB 2WLLA 2R2EB 4LBAA 1Z3GL 3QSKB 3WUWA 2HFEB 2WWKT 3TIDA 2Y5EA 1T7VA 4OZHE 2VMEA 1FH5L 4Y5XA 1YQ2A 4I2XA 1FUNA 2O6FA 4HJGA 1NAML 1VCBC 3CFKB 4PRDA 5A7EA 4APQD 1V5JA 1IIKA 5FYJE 3VXTA 4OT1H 5ID1B 3PNWB 5CWSB 1V3MA 3BPNC 4XAKE 1YNLL 1HSBA 5JPMB 2CH8A 2N1TE 4RAVA 2H6UA 3C5ZA 4M5ZH 5HDBF 1YEJH 2X0WA 1XEUA 1WAAE 3HBPA 5F9JB 4XMLH 2J1WA 2DWDA 1CGUA 2RTTA 2WXIA 3Q1SH 3QQ9C 2L7QA 1KC5L 4LPCA 4JHWL