3WKQA

Copper-containing nitrite reductase from geobacillus thermodenitrificans in complex with formate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
299
structure length
299
Chain Sequence
NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Copper-containing nitrite reductase from Geobacillus thermodenitrificans in complex with formate
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
total genus 102
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wkqA00
2VMJA 9PCYA 2EIKB 3CDZA 1V55B 4F2FA 4K9JA 1GY1A 2XV3A 5AKRA 2QT6A 1OE2A 1KYAA 3KW8A 2DY2A 1JZIA 2J57A 2PPDA 4GP4B 1V54B 2IH9A 3GXUB 3JT2A 1OOWA 4YSSA 3CG8A 1YLBB 3FPXA 5B1JC 1CYXA 1MZYA 2HRGA 4YSUA 1XB8A 4W1TA 4HHWA 4PCYA 3FQYA 4KO7A 2XV2A 2B3IA 3EHBB 1PAZA 5A7EA 4DP0X 4UAHA 1I53A 1A8ZA 1AANA 2GB2A 2QPEB 3X2QB 3BQVA 5B1KA 1L9QA 4AI7A 3FU7B 4CSZA 5B7FA 4JKNA 2NRDA 1AIZA 1L9OA 2E86A 4A2DA 3QJVB 4DP5X 1AS6A 1ZPUA 3FT0A 3NJLA 3NSCA 2FNWA 1M56B 2AANA 5B1BB 3QJRB 2PCYA 3IN0A 5B1JA 1GS7A 3PAZA 3WG7B 2GHZA 5LDUA 1EZLA 1X9UA 5D4JA 2AFNA 4EF3A 3PLYA 4YSQA 1A4BA 1NPNA 2XX1A 2B08A 2XYBA 1E65A 4P5RA 4DPBX 1JZEA 4GP8B 1PLAA 4HHGA 1SDDA 3NSDA 2BWDA 2ZXWB 3HEIB 4DP6X 1ILSA 4YSTA 3ERXA 1BYOA 3UABA 3NSFA 3NSYA 2BP0B 2FJSA 3NJIA 5I5MA 5ANHA 1SFDA 2WSDA 5I6NA 1QLEB 1AG6A 4A66A 1J5DA 3SBPA 3CVBA 4E9WA 1FWXA 3H56A 3ASNB 5D4HA 2CAKA 4YVUA 3FYIB 4KO9A 4G72B 2XXFA 1SJMA 4A67A 5AZUA 4E9RA 4BXSV 1HFUA 2MTAA 1RKRA 3DKHA 4M4RB 3UAEA 3FSZA 1NWPA 3OMIB 1WAEA 2HLEB 2N0MA 4GYBA 4G7RB 4BXVA 3PCYA 2MRYA 3WI9A 3NP3A 4G70B 1ILUA 3WNJA 3EF4A 1NPJA 1TKWA 2BP8A 2CJ3A 1TEGA 4KOBA 4P5SA 3X1EA 4BK5C 4ZK8A 1AACA 4A68A 2HX9A 2VSKB 1UATA 3FQ2A 3ASOB 2FQFA 2VN3A 3MBWB 1MDAA 1NZRA 2UXTA 4YSPA 1R1CA 2IWEA 1B3IA 1GS8A 4GP5B 2J55A 4DP2X 5F7BA 2PPAA 1PCSA 1N70A 4L0PB 3FYEB 2XX0A 4KNSA 4HCGA 2JFCA 1SF3A 1WA2X 2FWLB 5I6PA 4BDVB 1JZGA 1AZCA 2EINB 2YAMA 3AG1B 1ETJA 5FC9A 5I6OA 1PNDA 1KBWA 1HAUA 2Y1AA 3NJMA 2PP7A 4WKXA 4DP7X 7PCYA 1KBVA 1KGYE 4MFHA 1JXDA 2DYSB 1GR7A 3QJTB 1DYZA 1URIA 2HX7A 5I6KA 2YXWA 2PLTA 5B7MA 1A4CA 1ET5A 7PAZA 4AZUA 3G5WA 3V9CA 1JZJA 3GDCA 2UXVA 1SHXA 3JTBA 5F7AA 5B7EA 2PCFA 1OCRB 1OCCB 2XUWA 2PPEA 2YAHA 1NIBA 1IC0A 2AVFA 8PAZA 1W6WA 1FA4A 3X1BA 1MZZA 2EIMB 3S8GB 2Q5BA 1MG2C 3RYMA 3T6ZA 2XLLA 4AKPA 1JVOA 1XB6A 1GS6X 1GY2A 2PPFA 1PZBA 1KV7A 4KNUA 1BXVA 1BAWA 1NIAA 2TSAA 4KO6A 4HALA 2IDSA 1NINA 1A65A 1CURA 2UX7A 3EH3B 2WO3B 2FT8A 2CBPA 2YAQA 1RZPA 1WA0X 4DP8X 3WNIA 1AZBA 1NTDA 2X88A 3QJQB 3H4FA 1A3ZA 2AZAA 3NJKA 1E5YA 3X1NA 1ASQA 1BQKA 2AZUA 2VM4A 1AOZA 3NP4A 3ABMB 4JHUA 1JZHA 2QPDB 3AY2A 2HZHA 1TU2A 2FTAA 2RACA 4GXFA 4JHVA 4TXVB 1BXAA 2YXVA 1BEXA 1T5KA 4YSEA 4NB7A 3SQRA 1AG0A 4N4YB 1OE3A 5D4IA 2EILB 2W8CA 1N68A 1NDTA 1HAWA 3FS9A 2IDFA 5TK4A 4E9SA 2BW4A 3CDZB 3X1FA 4CSPA 1GSKA 4HCIA 1ET7A 4E9TA 2IAAC 2VM3A 2W88A 1E30A 2ZOOA 4HCFA 2IDQA 2IH8A 4YSRA 4YL4A 2R7EA 3IE9A 1CUOA 1A4AA 4NERA 2YARA 1L9RA 2UX6A 3IEAA 1BQRA 3NJFA 3ABLB 4E9QA 5TK2A 2DV6A 3T9WA 1OE1A 3NJNA 3AG4B 5I6MA 3U25A 2DYRB 2I7SA 3QJSB 1ZIAA 1BQ5A 3CZUB 4PAZA 5PAZA 3WKQA 3S3CB 1TEFA 1E5ZA 2DWTA 4AKQA 2VSMB 3CVDA 5I26A 1XB3A 4UANA 5I5IA 4YSAA 3AG2B 4AX3A 2UXFA 4UF7C 4KNTA 1AR1B 4E9XA 2H47C 3OMNB 3HB3B 1ZV2A 1SDDB 2YAOA 4KOCA 1NIFA 2GC7C 3FU7A 4YSOA 1IBZA 4BWTA 2FQGA 2P80D 3BVDB 1ET8A 4NAJA 3FU9A 3N2JA 2YAEA 3OQRA 1L9SA 2X87A 3IBOA 2VW6A 4QLWA 3NJGA 1WA1X 4YSCA 3C75A 2XVBA 1OV8A 2IDUA 2Q9OA 1BYPA 2OV0A 3GYRA 5E9NA 4FAAB 1BXUA 1X9RA 3FPYA 1AAJA 2GC4C 2HX8A 2JKWA 4DPCX 2I85A 4E9YA 5B3SB 3NJJA 1NICA 1PLBA 3FSAA 2ZONA 2PP9A 3OD3A 3ABKB 1JVLA 3ZX1A 4A2GA 1ZDQA 1J5CA 3TU6A 2TSBA 2BP0A 2XXGA 4YVNA 1ASPA 3PAUA 3ZIYA 1JZFA 1J9SA 2BP8B 1NIEA 1E67A 2XV0A 3NYKA 1KDJA 1W8EA 1AZNA 1V10A 2FQDA 2Y69B 3PAVA 4G71B 4N8UA 4DP9X 2CCWA 3T6XA 1IBYA 1IKOP 2BHFA 2OCCB 2LLNA 1J9RA 3QPKA 4M3HA 6PCYA 3UADA 2BW5A 1CC3A 1XMEB 2BWIA 3NJHA 1ZDSA 5IY5B 1KDIA 3UGEA 4G7SB 1DZ0A 1EHKB 3X1GA 2YAFA 1PY0A 3UACA 3ZBMA 1JXFA 2CUAA 4Q89A 3PPSA 3N55A 3V9EA 3FU8A 1F56A 2UXGA 1RZQA 4DP4X 1JOIA 5I6LA 1OF0A 4W9ZA 2GIMA 3FSWA 3H4HA 3OM3B 5EHFA 2VW7A 1L9TA 3EH4B 6PAZA 2IDTA 3QQXA 3L45A 2GSMB 1CYWA 3D12B 3TBBA 1J9TA 3FQ1A 3PXLA 1SF5A 1AZRA 1QNIA 4ENZA 2ZWNA 4A2HA 1PMYA 2I7OA 4KO5A 4A2EA 4F7KA 4Q8BA 2QDVA 2J56A 4HIPA 1QHQA 1J9QA 2BZ7A 1SHWA 4BDVA 3MX0B 1W6LA 3T6WA 1L9PA 2YAPA 5AFAA 2HRHA 2YQBA 1KCBA 1PF3A 4WTQA 1PZAA 2CALA 4DP1X 1IUZA 2GI0A 2EIJB 3KW7A 4X4KA 3QJUB 3TA4D 2IWFA 3WIAA 3AG3B 3S3DB 1AS8A 1GYCA 1PZCA 2FT7A 2OJ1A 1AQ8A 2VW4A 3AW5A 4E9VA 3S3BB 4BWWA 1AZUA 2H5UA 4G7QB 3DTUB 4HZ1A 3SBRA 2FT6A 1JXGA 2GBAA 3ABGA 3TBCA 3NT0A 1ID2A 1AS7A 4DPAX 3FSVA 4QKTA 3ZDWA 4F2EA 5I5JA 2FQEA 1MG3C 2QDWA 5I28A 2A3TA 3WKPA 2DWSA 4HAKA 4FA7B 2PP8A 1PNCA 2H3XC 4RH4A 1SNRA 1JERA 1OCOB 2BZCA 2HXAA 5PCYA 3IN2A 4BWUA 3S8FB 3TASA 2BO0A 3CVCA 1OCZB 2P80A 1GW0A 1PLCA 1SFHA 2PPCA 3OMAB 1KCWA 2R7EB 2J5WA 5B1AB 3T6VA 1RCYA 1FFTB 1WS8A 1M9WA 1ASOA 3EH5B 4A2FA 1NIDA 4AKOA 2JXMA 2XU9A 1VLXA 2IWKA 1WS7A 3T71A 4YSDA 2WO2B 1NWOA 3AZUA 3UAAA 1ADWA 3DIVA 2XWZA 1ZIBA 1M57B 4GY4A 3SBQA
chains in the Genus database with same CATH superfamily
3WJLA 5AYUL 5C08B 4OLEA 2WANA 3HZVB 4MA3B 4PRPE 4DIXA 4YQXH 2Y3NA 4PR5B 1YN7B 4JFOA 1GGIL 3QISA 2KZBA 2QT6A 4KHTH 4ONGH 4YGVB 5E4IA 5ICUA 1P4IL 3S4SA 3W38A 1ACYL 4ZNEA 3GMMA 2FYYB 3GJEA 5F3BB 3HAEG 5ICXB 2IDCA 3RFRA 3BX7C 4NCC2 4ZFOA 5FPIA 2DDQH 3HHRB 1XB8A 2ROXA 1T4WA 5INDB 1T7XA 2AXHA 4M6AA 1TIUA 4QGYA 3KLKA 4OF0A 4U6TA 3O3BA 4LIQL 3PHOA 1HL9A 4LEBA 5KG9B 2BHUA 2Z8VC 3FU7B 4JKNA 2NRDA 1A3QA 1EZUA 1AIZA 1ZLVK 1FVDA 2GFBA 4XPBH 3DRTA 4XP4L 2AGJL 2EDWA 4RA3A 2HJLB 2W65B 3MRPA 2ICES 3K5SA 1RIUL 1GS7A 3P9WB 2NY3C 3TVMA 2CUMA 1RULH 3TT1H 2A6DB 2N1TE 4WCYL 1FNEA 1TCMA 3UMTA 2FGWL 2R1WA 3GMLB 2V9QA 2IPTH 2RA1A 2F0CA 2E5EA 2VDOH 1KTJA 4JDZB 3QYMA 4P23A 3QG6A 2VISB 4RX4A 2WLLA 3EFOA 1BV8A 4DPBX 3MI6A 2Y36L 4XP6L 4XI5C 1H8LA 1PLAA 1HCYA 2WSPA 2ZXWB 3HEIB 2XWJB 2O6EA 4LBAA 3Q1SL 1F02I 4XBMA 3EYOB 3NJIA 3MRRA 2ZKHH 5ID1A 1KPRB 1SHMA 5KSBE 2WSDA 4TPRL 1G87A 5BMFL 3MFFB 1BPVA 4RMRA 5AOZA 1W0VA 5AWNH 1XZWA 1I7TB 4AQAB 2X4TA 1WZKA 2DTSA 1TVDA 4XT1C 4IKNA 2OYMA 2EADA 3MODL 1DQLH 3FYIB 5E4EB 1SJMA 1FF5A 4L0YA 5T5NG 3UH8A 5GGUB 4R4BA 3T2NH 1NCUA 1Q0EA 4PJIE 1A3RH 1MDTA 4U1MB 4DWHA 2AEWA 3Q48A 1NWPA 1Q4NX 3N5AA 4PJCE 2XPZA 4XCCH 4ONFH 4W4OA 1F3DJ 3FONB 2H41A 2ARJB 1LJMA 3DX9A 3NTCL 5D70L 3MCG1 5IJVB 4N6RA 4PJ5B 4XMPH 2EYTA 1A64A 3JWDL 2HX9A 3H2PA 4PY7A 3VXPB 1ZSDB 3FQ2A 4LHUD 3REWB 2VN3A 3QP3A 4X9IA 3P54A 3DGGA 1GGCH 4OKDA 4GSDL 1YNKL 3MJ7A 1IKFL 4FCHA 4HQQH 4OFYA 4MB5A 3CFMA 3Q2LA 1EHNA 1JSYA 1PD6A 1UD5A 1RAMA 3Q3GA 4H8QA 5A2FA 1HWHB 2BIPA 1UEMA 4N2BA 4OBRA 4PRID 3P77A 1KJ2L 4H4NA 2FWLB 3TH3T 5EORH 3U30B 3VMPA 2C3VB 2FIKA 3ZZQA 3DO3A 5KN5B 2FO1A 3AG1B 2VXSH 1ETJA 4ZAKA 5D1QA 4KKQA 3GSXA 2YS4A 4NQEA 4XPAL 1PNDA 2F7PA 3F58H 1M7IB 1B88A 4PIRF 2VDNH 3T8XA 3CH1A 4ZW5A 4Q52A 2WMPB 4ETQA 1P6AB 1S7UB 1JXDA 1Z7JA 3EKCA 3HUJB 4GXUM 4A39A 1OT4A 3DJSA 4ES9A 2OMZA 1EPFA 3VWKD 2C5DC 3IK2A 3UL4A 5EV7A 3F2LA 1RIVL 3A6CH 1OGAA 5TDNB 4JL1A 3OXRA 5GSVA 1Z0MA 2HT2C 4RNRB 5DJ6B 2HTLC 2X70B 2VLJD 5CR1A 3MX0A 1XGRB 3I9IA 5GS0C 2G0LA 4U2ZA 2BVPA 2XLLA 1ETB1 1UQSB 5IV2A 3CZSA 3FN0L 3WL9B 4UM9B 3F7KA 4N3UA 3PV6B 2YKKA 4LEEA 2IPUG 4I18C 4KTYA 2C9SA 4N2IA 1F4AA 2IDSA 4PTUB 3CN4A 4F2MA 4CNIA 1EEQA 3G6AB 4BQBA 3ISWA 4OZGB 4DFHA 2QVMA 1KB5B 5FDWB 1YECH 1YPZF 2CBPA 1AGBB 4LPTA 2RGSA 4Q56A 4DSYA 2G4EA 4ZQKB 2JE8A 4JN2B 2YQ3A 3ZHDA 4TTDC 2D73A 4N2AA 3WXVL 1NBYA 1RURH 2C7UA 3EYUH 3X1NA 2FEJA 3MQIA 4UBDC 4HV8B 4KJYB 4E42A 2DWYA 3VFNB 4C8XA 2UY6A 3DX6A 4QXWA 2WXIA 2GQHA 3NCMA 1EEYA 1RLBA 1K3IA 1X9LA 4LARL 1IGIH 1XT5A 4YSEA 5ICYA 3RGBA 3VD0A 2NTFB 2XPGA 1VADA 2EVJA 2D3JA 1E3FA 2VDKL 4AIOA 3ZE1B 4ZMPA 4QY8A 3U9UB 3WDHA 2NW2B 4XN4A 1WUNT 3OPZL 4QYOA 4PCKA 4QRPA 2NOYA 3KL5A 1XQ4A 5AOLA 4KK9C 1JF1A 1MWAA 2VE6B 4QJ3B 4GJTB 3T0ED 3CHPA 3CVIH 3F6JA 3EJSA 1WYJA 1NFIB 2CK0H 1H3UA 3GGWA 2Y6SD 4YK4C 2QHLA 4NKOB 5ABZA 1BZ7B 1K6QH 4IKLA 1ZLVH 4M3JA 4K5NA 3MLSL 3T9WA 5LAPA 2WXGA 4TQEH 1QG3A 2BP5M 1QI4A 4UYPA 3E2HC 1R3HB 3DBXB 5EO1B 1LEKA 3CDCA 3B56A 4BFRA 4WO0A 4NKMB 3WKQA 1C5DA 4EDXB 1MFNA 1YYLL 3U6RB 3BAEH 1QZNA 4R7NA 5DUJA 3VD9A 2BOBA 1A4JB 3N1PC 3QO1A 2V2TB 5DVNA 2ATPA 3MRGA 4HXAL 4RIRA 3WLWD 3STLA 1I1AD 3TT3H 5C0CB 2DD8H 3BWUF 3UDWA 3UTSD 2O5YH 5CBEA 4O00A 4X5WB 4E41A 4KKZA 4J6RH 4CU6A 4YHYB 5BXFB 1I7UA 1LO3L 1Q94A 2O61A 4DEUA 3IS0X 4YPJA 1H9VA 1J0HA 2JCWA 2D9QB 2ZP8A 4HUCA 1PG7L 2Z92B 1SDDB 4WI7A 4FXKB 4FYQA 3K81A 4XCYB 3GKWH 2CM6A 3TZVC 3ARDB 5ALBH 4KVCL 4EI6A 1M1XB 1N5AA 2MQGA 4X7DC 5E8EB 1CD8A 1NM9A 4MZIA 1DLHB 3W9DA 5SWQB 2CXKA 3ZTDC 4AT6B 3B9KC 5ALCL 1KENH 4RMQA 5TDPA 3AUVA 4EZLA 4CMHC 1U3HB 1JK9B 1X5GA 5T1LB 2X40A 2XQYG 3LS4H 3O3EB 4U1KB 3MLXL 4L8SC 3CN0A 4K8RC 5DHYA 4XWOD 3RDTC 3KGTA 4FG6D 1WTLA 2FBJL 4ELDA 3FQRA 4XO5A 32C2B 2I85A 4MS8C 5D7KE 1EBAA 1HOCA 2ZONA 3ZX1A 1JVLA 5HYSB 1M71B 2R56L 3SPJA 3FRUB 2OL3B 1XH1A 4PSRA 4JRXA 1D5MB 1QTSA 2JIXA 2CBOA 2VL4A 4XHJC 1QFUL 5A16B 4L3AA 2X4UA 1ZHBA 5D6CB 5MEOA 1LK3H 3EJCA 4O58L 3PAVA 4JG9A 1KC5H 4CU8A 4TMPA 3O3DA 1DO6A 2CCWA 2P5PA 4XXCC 5B38B 3L5HA 4TQ8A 3TYFA 1PKQB 2V0AA 4HPOL 4HJ1A 2QR0B 4OLUL 4ATWA 2YD5A 2PWFA 1XMEB 5F1SA 3Q06A 3MBED 3PWUB 1P9MC 1UH4A 1ZDSA 1ZJBA 3CCHA 4YXHH 3AT8A 1YNLL 3GBML 4G7SB 4QO1A 5J8OA 5L0QC 2VLLA 3SYCA 4HT1H 1CLVA 1X5XA 1SN0A 4Y5YC 2F7OA 1AKJA 1PPIA 3MREB 3IDNB 2X1QA 3QEQD 3W0WA 3ULVE 3IMTA 5C9JB 3HB3C 2R0WL 2ZKWA 3ZOAA 1SVCP 1H6UA 4IKIA 3I3BA 2GIMA 3ZDZE 2FJHA 1OGTA 3IU4H 2UY7A 4W9DC 2DMBA 1MRFL 3BLPX 2DWEB 3B4NA 5BZZA 1J9TA 1NEPA 2W9DH 5DYOB 1AGDA 3KPNB 2O6PA 3KYOB 3MA9L 4GG6E 2ZCHL 2MMXA 3P0VL 4M62H 2WN3A 4F58L 2UZPA 2BSBA 5MP6H 1EXUA 2X3AA 1SEQL 3H42L 4Z3FA 3O4OB 3ARRA 1J9QA 1QMUA 1JCVA 3F04A 4QXGL 4S2SA 3SKJH 3U79A 3WS3B 3ZZSA 4ELKA 4KK5C 4ZTPL 4G8EB 4WW1A 3PL6C 5SWSA 4UWQB 1QFWH 1XGTB 4KDTA 1KCLA 1LQBC 4WWKA 1JIBA 1C12B 2OJEA 1Z6JT 4WTQA 3WS6C 2Z93B 3MV8D 2K9UA 4NQDA 2ZICA 1NDMB 3RDJA 5TE7L 4OM1L 2CDFB 1LO2H 5GXBB 2GITB 3ZSSA 5F0PB 3B3BA 4ANWA 3EO9L 1MH5B 4NS0A 1BXXA 1KCSH 3O0RH 1U42A 1AS8A 2VDQL 2DYPD 2UZYA 4U1JB 2NY7L 4LFHG 2CGZA 3LEYL 4DKFH 2ZUVA 3UEQA 2AV1A 3CFKB 4BELD 5A2LH 3I50L 3C8KA 3LXCA 4MD5B 3GSNL 4H8WC 3VXNA 2XN9A 1TVBA 3GHPA 4D9QE 4TQHA 3B83A 4IIQB 3V52L 2WKOF 5HHOE 4DPAX 5C08E 3WKML 2NY0C 5IMMB 2ENQA 3P4NA 5DMKA 4I3SL 4QKTA 5BV7C 2B0SH 2QVKA 1HSBB 4H40A 3RWHB 2DWSA 4HPYH 2J8HA 4YOKA 4PP1C 4N8CH 2EC8A 2NNAB 1E8WA 3IDJB 3RIFF 2BS8A 1MFAH 3VYPA 4FLSA 3V4UL 1AO7B 1TZGH 4Q6YA 3G6JE 1IAII 3C6SA 5LXGH 5GHWH 1CFVH 5DLMH 4HFUH 1J8HD 5C6PB 5AUMB 3SDCB 5DMIH 1M7DA 5E56A 5I5RA 5CGYC 1UB5B 2Y9RT 3QUZB 4UV4H 3ENEA 4B97A 4KHXL 4HZLA 4WZ9A 2WXLA 1X5JA 4UT7L 1I8UA 5CJXC 4MXQC 4FKHA 1YY8A 2K6ZA 1FRGH 4D0BA 4F57L 2VGLM 3WUWA 4AGOA 1LEGA 3D2UD 1AC6A 3X3GH 3EYVB 3RUGB 5I6MA 4M7LL 2DN7A 1NCDH 2EIKB 4YDLC 5DJCA 1ZJAA 1KCVH 1CXKA 3DJZA 5D71L 1YPZA 4HC1H 2MPVA 1KYAA 4LLUA 2XTLA 3U0WH 3P73A 4JO2H 3ULVC 4OZHE 3HC3H 3LHAA 1KGCD 3NK4A 3UTTE 1KBKA 1CYXA 5HI5C 2EP6A 2CDEB 2NMSA 5CNHA 4PJAB 5IREA 3SJVD 4OCRH 3VFMB 1Z9OA 4MMZC 1DSYA 4MD0B 5J6GB 5DTFA 2IQAA 4I1PA 4UZGA 3QUKA 5I19H 3ZLQC 3OX8A 4QF1A 1CL7H 2DICA 3K2IA 3KBPA 4YHML 2BMKA 4YR6B 4NO5B 2X4NB 4X5XA 4XGZB 2WUCL 2YRLA 1QRNB 3D4GA 4N8VB 2MSPA 2H2SD 1ZV9A 3FT1A 4BFFA 5CILH 2IH1B 2TAAA 3KYNA 1MRDH 2I24N 3CXFA 1ZPLA 4AXWA 4BV1A 1DJHA 3A21A 4YPGB 1FL3A 1QLRA 4APQD 4EBQH 1FNSH 3CDGB 3RVXC 5GGRY 2G3XA 1AY1L 3CVHL 2VRQA 1KG0A 1AHWA 4HMEA 4X6DF 1ETA1 1U4FA 5D7SL 3A6BL 3MTXA 3INUL 4J8RA 3VI4E 1MFVA 2DI7A 5DRNA 5HHQA 1MPAH 3NDYE 3SDYL 3NFSH 3WO4C 3P9MB 3IU3A 1T1YA 1A47A 5DEFA 1MCCA 4P5TA 4NOFA 4N2OA 3P1VA 3ZL2A 2CE6A 1CU4H 2Z91B 4XC1L 4AEIH 2W94A 2AI0L 1MXDA 2DQGH 2Y25A 3RGVD 3T3PF 4DO4A 2DEYX 1AQDB 2DWDA 3OMIB 3BCFA 1X4XA 5DVKA 2MRYA 3BXNB 4KI5D 1GKEA 4M1DH 4UTAL 1JL8A 5DJZA 3MUUA 4OCWL 1QFOA 1RZIB 1XGUB 1R47A 3PF2A 1AACA 4K94C 1PZ5A 2WJ7A 4LDOB 1U8CA 3IFPA 3ASOB 1GGBL 4FZEH 2IV8A 1MCWW 1ZTMA 2AJVH 3MRBB 3MSPA 2W5PA 5EUOB 2EKSA 4QLRA 4AVKA 2K70A 5TPWH 4WGVB 3B5HA 5I18H 1XCTA 2ED7A 2QGDA 1DJYA 1SXAA 4JFZH 1U8QB 4WFGE 5DUMH 4MDRA 1F1AA 4HCGA 3WY3A 4MKTA 4OF3A 5IMLA 4Z5RB 3I85A 3NN8B 4QHKJ 3AB0B 4A1RA 2NQDA 3SGEI 1T1WB 1FAKT 2AEPL 4UILH 5BOZG 5M95B 4XNMA 3H9SA 5FYKD 1HDMA 2X3BA 3EGSB 3L1EA 4OZGE 1A7OH 1KBVA 5E2TL 1B4LA 1KGYE 1R3KB 3P2DA 4OF6A 4ICWA 2HKFL 2ZXBA 4TUOB 1J1PH 1KTKE 2V9RA 4FNLH 4R90H 3QHFH 3D0VB 3V5HA 4U6XB 1G0DA 1DL7L 1XCQA 4AM0A 5DUPL 2FJUB 5E2VL 1T21A 3MRDB 4FNQA 4M93B 1GYUA 4TL5A 4EUPG 1EX0A 3H9YA 5D7LD 4PGJA 4BZ2H 2PPEA 5CINH 1NIBA 4OQTH 3LKPB 1VFBB 2XHNA 4QT5A 3T6ZA 4ZTEA 2ICWI 2R9HD 1ID5I 4YE0A 4ACPA 5IR1A 3DMMA 2VLJE 4MRBA 3P3SA 2CGRH 1RD6A 4NWTL 4H1LG 2X2YA 4G80B 5AW4B 4F8PA 1UXWB 4FXGB 1CURA 2X41A 2GJZA 4KBPA 4X9YA 4KNQA 2WO3B 1JYVA 1JE6A 2WYTA 3U9WA 5L2KD 2FX7H 4JKMA 3OKYA 2V9UA 3G08A 4EEEA 4ZD3L 4XVJL 2X88A 3OKKB 2AXGA 3HI5H 3O45B 1UOVA 5HBBA 2J8UE 4GKNB 4KKRA 1SVBA 1U91A 4PVMA 1P2CB 4WWNA 2ZKYA 4JN1L 4L5FL 4QI3A 5F71A 3WN5A 4XP5L 5BOJA 3WFEH 2XXMB 3U30C 2XXCB 3SKNA 4K7FA 4AGMA 1KPUA 4RGMB 1G7LB 5C0IA 2ZUXA 4JZNB 4Y5XC 3GS7A 1JN6A 4PS3A 4P06A 4K8RH 1D7CA 2W38A 5I1CH 5DD3H 4JFOB 3D9AH 2NSXA 3S4SB 2J71A 2ICEC 5IROA 2OX5B 5HYJD 4ODHH 5DURD 3GMMB 2V7NA 1CFNA 2BP3A 1ES0A 4WENB 3GJEB 2DBJA 3FUEA 4FQCL 1MN4A 2K8QA 3ATEA 2WKOA 5HI3D 2AEQH 3FUKA 1RUQL 3MCKA 1PBYA 3QJSB 4ZSOA 4E9SA 2FEEI 3CZUB 3PHOB 4A7TA 4Z7OF 1CXIA 2ZP9A 3RWFA 3TA3B 1FVDB 2DAVA 2GFBB 3DRTB 43CAA 4B9JA 2NX5B 2MCPH 3CVDA 3MRPB 1DDHA 3Q2NA 4HU8A 3TVMB 4X4MA 4Y89A 3QZWA 3V4VL 2OK0H 1F3JA 1HHJA 3OLGA 4IGBD 1VSCA 1CR9H 1FNEB 2R1WB 4LFHD 3AG2B 5D96B 4QXUH 5AQ0A 5LN4A 4MJ6A 2P47B 4OJAA 3WSQH 2A4ZA 4OR1A 3VWJD 4P23B 3UTSE 2WLLB 3TURA 2G75B 3HG5A 4RLDA 5KS9A 4FL4B 4EKXA 4JR9H 4MQ7B 2D7NA 1G9MH 4P5KA 5JDJA 3HRZB 3LRGA 3VSUA 4YMPA 4ADIA 3VWKC 3MRRB 3MLZL 2L0DA 4YDZA 1PKQE 5ID1B 4PREA 3DX3A 4GO6B 5E24E 4W6XB 1FP5A 4DCQB 1W0VB 4FI6A 2ZKMX 1UGKA 4AJ0A 2B1AH 2X4TB 4TRPH 1MNUL 2Q8BL 3IBOA 5T3ZL 2OSWA 4B0MM 3TBTA 1W91A 2OMTA 3QPQD 1RZKL 3PQYD 2K6YA 1FH5L 4PJ8D 1I3UA 1RIHH 1UVQA 1SOKA 1SBSL 1QYGH 4R4BB 3OQ3B 5CS7A 3I6SA 3FAXA 5A6MA 2VZVA 1TMCB 3HI6L 2IOOA 3N9GH 1NUNB 3HFMH 2VXTH 3MZGB 3PHAA 4YLBA 2OMBA 4R4ND 1O6VA 3QORD 4NNYB 3C60A 3NIFF 3UEZA 3EDKA 2HFFA 4R2GD 1A7QL 3DX9B 2P8PA 4JQVC 4JO1L 1NIEA 2CRIA 2JJTA 4N6RB 3T8MA 2EYTB 3GPEA 3DVNA 3E6HA 4PY7B 2J1KA 1JGDA 4G71B 4JY6A 4RISH 5ERWA 2JTDA 3DGGB 4H8WH 3GUTA 3BH8A 3DX0A 1L7TL 2I9LA 3MJ7B 3S5LG 2OCCB 2CMRL 1AXSA 3GRWA 4IOIA 4NPJA 2WLJA 2ZX9A 4HF5L 3VVVA 3SE3A 3TESA 2G5BA 3Q3GB 1CXEA 4S11A 1CG9A 4WUUD 3P77B 4XVTL 5TQ0H 5BV7H 2VUOA 4YHYC 4HYTB 2YAFA 4X6DA 2FIKB 1OAJA 3T3MB 4JRYD 3L3GA 4ZAKB 2WBXA 5D1QB 3GSXB 1XTMA 2W91A 3HS8A 1GL4B 4PH8A 4MAYC 1RZQA 4X4ZA 1ED3A 3T8XB 5J1TC 4FXKC 1P4BH 2YGOA 4U1HB 5IQ9A 3NA9H 3ARED 3H4HA 4K71C 3D85D 1AI1H 3ARDC 5HYQA 3V0WL 5CLYA 2ZG3A 3QDMA 3QEQE 1U4EA 1UJ3A 3TBBA 1KT2A 2OMZB 5BNXD 1UH3A 2HRPH 1KIQA 4FEIA 4OLVL 1XBRA 1IB5A 4GBXC 4LVNB 1OGAB 4GRWF 2WZAA 4UNIA 4A2EA 1N8OE 2CD0A 5GSVB 3OXRB 1CN4A 5LKNA 1CFQA 3WV0A 5BUGA 1K9TA 4AG4L 4QRFA 3MX0B 2Y1YA 1DJSA 1WLHA 2HA1A 4LSDA 3T6WA 1HEJC 2UVFA 1S6NA 4H13C 2BVPB 4GAFB 2NY6D 2YD7A 3AQXA 5IV2B 3RWDA 3WLWC 2WZ5A 5I30L 35C8H 3HN3A 4AYID 2JKIS 1QEXA 5G5DA 4L0ZA 1JZ3A 2QMKA 3ULVH 4U6HA 5C0BA 4P4KD 1CXFA 4F2MB 3MV8E 4CNIB 2OJZL 1PQZA 1BM3H 1E4XI 5KBPA 4KKNA 1E3ZA 3X3FL 4B7IA 3IJSA 4QRQA 1O6TA 3F3HA 2E8ZA 4KTDL 1OSEA 4ZUUA 1MY5A 4BWWA 5M7QA 1JZDC 5D7HA 4EOWH 4F7TB 1DO5A 1NBYB 2C7UB 3WHXA 1Q9WA 3GTTA 4XB3A 2P5EA 3WNPA 5IB5A 1MNNA 4E42B 1OSPL 3KGSA 1RI8A 5C0AD 1TETH 3RUGE 3VYOA 2UY6B 3CFNA 1ND0A 3DX6B 3FSVA 3FL7A 4B5ZA 2BSED 1EEYB 3MHZA 4R6UA 3US9A 4B7LA 4LSUL 3DX4A 4HISA 1MG3C 4ABUA 2A3TA 2Z31A 3MVSA 5ICYB 2DQ6A 2PP8A 1UD3A 5BQDA 4N0YH 1NA8A 3DDGA 4RH4A 4HVBA 1N2RA 2XPGB 1VADB 2A9NH 1AOHA 4EDWH 1QRKA 4YXLL 4J2XA 1QA9A 2BZCA 4QY8B 1N0XL 4CKQA 3S8FB 4FG6C 4MA8L 2RCSH 5BRZD 3CVCA 4QYOB 5C8JA 4QRPB 5JHLL 3AMLA 3P3UA 1FIGH 3LHPL 1MWAB 3R8QA 4N2KA 3ZZ1A 3W2DH 3UTOA 1ETZA 5FFLA 3GGWB 3V6BR 3AXLA 3DIFB 1F4YH 4N5UA 4I89A 1J8HE 5K33A 3FBKA 1E43A 2QPUA 2PABA 3MYZA 1H9DA 2FZ3A 1QBBA 3DXAA 4BK4A 2SODB 5F7MC 4FABH 1K8IA 1C5DB 1M57B 2HWZL 5GRZA 1VGEL 3FMGH 4U0RB 5BS0A 4R7NB 2OW6A 4UTAA 2LQRA 2BOBB 3QO1B 2GJRA 2ATPB 3MRGB 1C1EH 3ARGA 4OGXH 4PWJA 4RIRB 5JYMA 1DBAL 3STLB 2F9BT 3UAFA 5EEUA 4WY7H 3L9EA 4OIIL 5A2CA 5ILTL 1HVXA 4HXBL 4QIRA 4UT6H 2N3JA 4QCIA 5CBEB 3K8KA 4E41B 3GXUB 2JMRA 1OOWA 3IJ9A 1EVUA 3CG8A 1G9NL 1I7UB 4OZFB 4XNDA 1W9XA 2DMHA 2O61B 1XR8A 1MZYA 1OALA 4HMDA 4BSJA 1C5BL 5IF0A 3PWPA 5EEYA 2HVJA 4K94H 2LV4A 3QEHA 3VW3H 1KGCE 3EHBB 2VSDA 1DHKA 3FHEA 4GRMA 4WEMB 1REIA 5IFHH 3ZY7A 4S1QH 5EWIH 2BVTA 4EI6B 4PRHA 1N5AB 2ZUTA 1ZD6A 1MELA 3SJVE 1D2OA 1FCCA 4M1CC 5LO7A 1CXHA 4Q9QL 3W9DB 2YRPA 4JNXA 1R3IH 3O4LD 5I1KH 4FZ8L 3L4ZA 1JZ5A 5TDPB 1HHGA 4U1IA 3O6KL 5DHYB 4WI8A 2XYBA 1BZ8A 3P4LA 3FQRB 3SDCC 3II3A 5EO9A 3K71A 4MWFB 3M7FB 5E51A 3ARBD 1HOCB 4XAWL 5AVXB 2BWDA 3QS3A 5JPNA 3QO0B 2OYLA 4NQCA 5HVHB 5D1ZD 4G6JL 2AQ3A 4JAMA 4JRXB 1IM9A 3DIDA 1LMKA 3PHQA 4KZEL 1MQ8A 2JIXB 1B6DA 1HKFA 4LCUB 4LSRL 4G8AC 5AVZB 1A02N 4LZKA 3C5ZA 4LQ1A 4FJYA 2H6UA 2XN0A 4TNEA 2O26U 2XG5A 1R6VA 1SUHA 1ZHBB 2GJ6E 2X4UB 4TUJA 4A66A 1T7ZA 3ZGIA 2VM9A 2CA4A 3NQIA 1BEYH 4NNXA 1JRHL 3O3DB 4MRCA 4Y4FD 4UCFA 2BXZA 4P3CH 2R69H 1UT1A 4QHUA 5C3LD 3PNRB 1OD9A 4HBCL 1OW0C 3CCHB 4N9GA 3GBEA 2LVCA 4F15B 1QBMH 4QO1B 1RJCA 3ZQXA 2QVTA 2NLJA 4CC4A 2ZX8A 1IGML 3D3VD 3UBXI 1AKJB 4FE9A 1F90L 3W0WB 3RG1C 1INEL 2OBGA 2LAGB 5LBSA 1NLBH 1T66C 2IVFC 5E94A 4A7QA 3FT3A 3AWGA 3HMXL 3QHZL 3MRLA 2FJHB 3MR9A 3VSTA 1HKLL 2BVQA 2UXTA 4B41A 5C3TA 2IWEA 4GP5B 2YMTA 1A0QH 1ZV5A 2MNUA 4NZ8A 3I3EA 1PCSA 4HOXA 3VFWA 3SGJA 3KPQA 1AYRA 4HS8H 2EEDA 4XMZA 4X6BA 3UJTL 4AVIA 2V17L 5B3JE 2ZWLT 3SODB 2F08A 1TQSA 1EXUB 4NKDA 2BRRH 4S2SB 5D72H 1NKRA 1FLRH 4ELKB 1T83A 3SE4A 1K4DB 4RVBA 2NY5L 2ESVD 3APDA 3T2LA 2BFVH 1A6VH 3KPRD 2R2BA 5E2JA 4WWKB 6FABL 3FKUS 2OJEB 4Z77A 1K72A 1UOKA 2Y1AA 3C6LD 4U1LA 4QHLA 3AU1A 4NQDB 1TPXB 5DMYA 4JPVL 1CICD 4CSSA 4AYSA 3P4MA 4GMSH 1QKZH 5FYKE 3IAQA 1CPUA 3O6ML 4JKLA 2UZYB 1MCJA 3OLDA 1N67A 1SHXA 3ETTA 2WM0A 3DOIA 5L7XL 2AP2A 5F7AA 5F9OH 2FCBA 1G7PA 2AV1B 1NCCL 4UOJA 3WJJC 1G94A 4OSUH 2EUVA 3EDDA 2AVFA 3KHQA 5IG7A 2XN9B 1AR2A 1ECYA 1TVBB 3M46A 4UZUA 4G8GA 2EIMB 4B9PA 1KGIA 2QLVB 3KDMA 3KYKH 5D7LE 3CU1A 2A77H 1MCLA 2PPFA 3P4NB 5DMKB 4DGYH 4KNUA 1DJZA 1UA3A 4G6KL 4POUB 4PS7A 1AE6H 2AABH 1ZT7A 3B5TA 4LQFL 4LNRA 3B7YA 4L4VD 3EBGA 3TXAA 5MEOB 1VGKA 3N85L 3EXJA 4F7MB 4R8WH 3Q6FA 2XZCH 5IEKB 5GRUL 3HZ3A 4WJ5A 3VD3A 3DX1A 4JQIA 3Q0HA 3CHRA 4WHCA 4DP8X 3RVWC 5IHUL 4GUCA 1D5XA 4X8CA 5CCJA 3P11H 1JZ8A 1IGJA 1M7DB 3NJKA 1NBVL 3HE7A 2L7UA 2VERN 2Y5TA 5FGBA 3ZKND 4P0DA 5IJCC 1MI5A 4NUGH 1CE1L 4FD0A 4YDVA 3ABMB 2X6BA 4HZLB 4FLQA 5DI8A 1IO4C 2H26A 4C83A 3EJUA 5FKAA 5D5ME 1HSAA 2NX5E 5KUMA 1YY8B 4YQXL 4D0BB 2V8MA 3WUWB 3AB0C 4L9LC 4ONGL 1LEGB 3EJZC 4G2AA 3H9HA 4HIJA 5CEXA 2WQXA 1I3GH 2BW4A 3O6FA 3EJJX 5HYSG 5TFSH 4HCIA 5DJCB 3K8LA 4UNUA 4DVBA 1O7VA 1RVFH 2VM3A 4I0PD 5EU6A 4LLUB 3JTTA 1FUNA 3M88A 4P48A 3L3DA 3P73B 2WQ8A 1N6QH 5CUSH 4QNPE 3Q7JA 2X9YA 3WTWA 3WEMA 3HNVH 3HBZA 4M93C 4C57C 4PWIA 4UTCA 2GIYA 3FAWA 4YL9A 4XPBL 4NHCL 1KJ2B 3U25A 4GH7B 5D2LF 3WEAA 3MKKA 2AITA 4Y2DD 4UB0H 1A22B 4M7LT 1HU8A 2IQAB 5DTFB 4M8QA 3FTGA 3QUKB 4M29A 3OX8B 3S3CB 4QF1B 3SSGA 2QQNH 3NIDB 2BMKB 3TT1L 4X9BA 1ZVHA 3MUHL 4X5XB 4LP5A 3FU6A 3BVTA 1MVFA 3VXRD 4YHZL 4PRDA 1XIWA 5DZNA 3S35H 5E9DD 4FXGC 3KYNB 3DA0A 3GNMH 4TUKL 3EOBA 2BM3A 4FG2A 4BZ1H 4KMLB 4Z0XA 3GZQA 2IBZY 3NPZB 2HT4D 4KVPA 1FL3B 1QLRB 4LMQE 4OGQC 4Z7QB 1G6VK 3HIZA 1CXLA 4GEJA 1YY9D 2D4FA 4DUXA 1KG0B 1AHWB 1W16A 2DQDL 1A1OA 1KTCA 1MW0A 4J8RB 3QXAA 5J3HD 1OD7A 3VXOA 5DRNB 1CBJA 1B4JH 4R7LA 4PMEA 5HHQB 3FU9A 3JUZA 1VDGA 2VLKA 3IGFA 3KPPA 4RGMC 4ZZFA 2E7HA 5L4IA 3IU3B 1T1YB 3T2NL 1I9IH 1Q1JH 5DEFB 3NEEA 4P5TB 3C75A 4HFWA 3RB5A 2BY3A 3MUZ1 4ONFL 4AMKL 3SCMD 5HDQH 3RU8L 2JKWA 2AQRA 2HFTA 2R9HC 2ODHA 3NJJA 3N0AA 2EE3A 2AS5M 3ZKQD 1IC1A 2AHIA 4X4YA 5CCKH 1Z0NA 1OAUH 1FI8C 3HC0A 2O6CA 4YDMA 5IB3A 2Z7WA 4KVNL 2CKBA 5JR1L 3SGDH 1MCIA 5MEPA 1ASPA 2B39A 4HLZG 3UAJA 4NDMA 5DJZB 1TTGA 1U8JA 3P2TA 1INQA 1RL1A 1PZ5B 5K9OA 2XA3A 1IFGA 2FQDA 1BF8A 1JGUL 2IGFL 2WYIA 5SWZA 1S4IA 1U8CB 2CR3A 3IFPB 2R1XA 4JM2D 2F8XC 2EKSB 2WQVA 2VDKB 3O2DA 5EORL 2LLNA 1XCTB 2BWIA 1UM4L 1J0KA 3SBWA 3WU1A 1V7MH 2EKJA 2Y7NA 5J06A 3VXUA 1DLFH 1VAHA 2XBDA 2HKHH 5CKGA 5LB1A 5GISL 2EQDA 1CB4A 2VDNL 5IMLB 1X7TA 4QPEA 3RX8A 4HKXA 1IV8A 2FUTA 5JUEH 1U41A 2YBGA 1BZQK 4FL4C 1KXTA 1NFDF 3H9SB 4XNMB 4OZIE 4DP4X 2A9MH 3TLRA 1BQLL 1WFTA 2YC1A 3ETBJ 3HRZC 4MJHA 1VPOH 3EH4B 4JRYE 3CFCH 4HH9A 3RILA 3SOBH 4GSXA 3RFZB 1EDYA 1NH6A 4AGNA 4ECNA 3HN5A 4I1NB 1QR1A 3L5WA 1UFGA 4HJEA 3D30A 4WW2F 3V5HB 1SMOA 4RFEA 3TWYA 4F7KA 1XCQB 4AM0B 5HHNA 1T21B 4Y19A 4XN7A 2VZ3A 3W56A 1MFBL 1ADQL 5HI3C 1K2DA 3F8UB 3IJYA 4K5MA 5FKPB 3VD1A 1G84A 3RTQA 3ALXA 2R2CA 3ARXA 2X89A 4QT5B 4V1DA 1MWOA 2YQBA 4J3OC 1UYWH 3GB7A 3DMMB 4WGWB 3WYRA 4AQ8A 5ACLA 1HT6A 5IR1B 4ZUTA 4C4UA 2DS4A 2AQSA 3AC0A 4P4RA 1YECL 1ULVA 5C09D 4ZFGH 1PX4A 2DMGA 4HWEH 2A9AA 1MJ8L 3L3OC 1RURL 3EYUL 3RI5K 3EXLA 3UTQA 1MCSA 3VDAA 5EU5A 2Q2EB 3S2AA 4N2DA 1RMFL 3G08B 2BHYA 4LVEA 4Q7DA 5T5FH 2AXGB 4UM9D 3SBRA 1IGIL 1U91B 5DZLA 2FT6A 3ATAA 1ZHLB 2VAJA 3WN5B 1H3PH 4E5XA 3HJ0A 1YC8A 1FYTD 3K4ZA 1HH6A 2E59A 4WAFA 3AS3A 1A6UL 3GUFA 3SKNB 5I5JA 4K7FB 1KPUB 3BGMA 2UWEE 4EVNA 1JK8A 5D1QC 2YEQA 3HJEA 5C0IB 3X12A 4PG9A 1RHFA 5K5YA 1JN6B 1AGCA 4PJ8C 1Q9KA 3T0WA 2E9JA 1QPKA 2BNQD 3CVIL 3SB3A 3J7HA 4UQDA 3UBXG 3QARA 5LNEA 3LNGA 2NT0A 2DL9A 1B4RA 1K6QL 5HYEA 5BO1H 5BVPL 1FHNA 1LO4H 1PLGH 2HFGH 2YPLA 4F24A 5LJYH 4DVRH 2QSCL 2J73A 1OWWA 2YRBA 5AB9A 2V7NB 1CFNB 3H8NA 1ES0B 4L3FA 5I74B 3QORC 5BRZE 1U3NA 5D8JH 5CKAA 8CGTA 5AVYB 4AKOA 2AJYL 4GRLB 3G5ZB 3V0DA 5T1KA 1W2KT 1BVKA 1KYDA 1IGYA 1KXQA 3MCKB 4ZSOB 4R26H 5KBKA 1NCOA 1ZIBA 1PG7X 2DD8L 3TT3L 2WXHA 4GY4A 5I0YA 2F53D 5JA8B 3MGTA 4B3EA 4DF9A 43CAB 4QXVA 4J6RL 4JHZA 1QSFD 3HMXA 1DDHB 3MLYL 5E1IA 2X7LA 1U8LB 3QZWB 2IH9A 1OARH 4O51A 1ONQA 3QQ3A 1FDLH 3FPXA 4YSUA 3MOBH 5ALBL 1T22A 4WHYH 3L2NA 2IGTA 5KS9B 2VC2L 1U0QA 1QSEE 3F05A 1CF8H 3ZZLA 3QS2A 4UAHA 5CJQL 5LGHH 3SY0B 1IBBA 4P5KB 3BQVA 3COOA 4ZT1A 5B1KA 3X2QB 2VRKA 3DYOA 2B2XH 1XCWA 3QZPA 4D8PA 2JI1A 2ITCA 3ILQC 4PREB 3D1MC 3O6LL 4GMTL 4PD4K 1GYWA 5FYJD 4G6ML 4LGSB 2FH8A 5CZXC 1PZUB 4KZ0A 4LVHC 3TBTB 2E75C 2OMTB 2ZP0T 1EZLA 5HHVH 2WNGA 2VDQB 2X9ZA 3T77A 2GPZA 3O4LE 5EF0A 1UVQB 1E6JH 1NBZA 2F54A 2LTQC 2NXYB 4ADJA 1YUHA 2NY6C 5IB1A 4BQ8A 4XO9A 1T7YA 1DJIA 2I5YL 4QOKD 2K4WA 3FFCA 5D2LA 3WFBL 2CU9A 3GJFK 2MH4A 1EJOH 1LK3L 2K6WA 3C60B 1KC5L 2HFFB 2I60L 2P8PB 2PTVA 4U1GB 3HFFA 3WIHA 1AG6A 1JJUA 4KJWC 4MYWB 4XNYH 3ZE0F 2WVVA 4BGLA 1UM5L 3DVNB 3E6HB 4LASL 4RCAA 1JGDB 5FV2A 4JY6B 5ERWB 5F44A 5GJSH 1UCBH 3BH8B 3GUTB 2I9LB 2CKNA 4PI0A 4PB0H 4Z7WE 4HT1L 4ZDHA 2CCVA 2Q3AA 4Q6IA 4XNAA 2F68X 4E9RA 1EJFA 2V5SA 2G5BB 3SOTA 4AQEA 1UA6L 2A2QT 5J9PB 3KLLA 1CG9B 2GBUA 4I2XA 4Q0XL 4IBSA 1JF6A 5I0DA 2BX5A 1TZOA 4GYBA 4X6DB 5L4JA 3ULUL 4PP2A 5D2NA 2VIRA 4LIQE 2ZD0A 3NCXA 3ZE2F 1RP9A 3L3GB 3IU4L 4J3UA 1DQVA 1N64H 4EN3A 4PJ9D 4NO3A 3ZTJH 3L5XH 4BK5C 3UYRH 1KFAL 1ED3B 5L6YH 2EDDA 1BD2A 2QADC 2ENYA 1F8TH 2KPWA 4M62L 4P9HC 4XNBA 2ZAIA 3KS0J 5HYQB 3CFDA 3QDMB 3V6ZA 4FTVA 4PJXA 5HDBB 5JIMA 1UJ3B 3SKJL 1KT2B 5L8JB 3NESA 2C1PA 1KIQB 3NG5A 1QFWL 3BKJL 1UJTA 4HG4J 3UTPD 1BF2A 2CQVA 3LOWA 4TN9A 3T3PB 5I75B 2VABA 4TSBH 2AK1H 4L2YA 1CFQB 5KJRH 1FFOA 3MOAH 2VB5A 1XF4A 4H20L 5I6OA 3NCFB 5D7IF 1WD8A 1HAUA 1KCSL 4WKXA 2FB4H 2ESVE 2XSKA 3RWDB 4NCC1 4N2NA 4ODBD 3O3UN 1DVFA 1N19A 1RSYA 2QKSA 1MCRA 3KPRE 4DKFL 5HVHC 4XBGA 5G5DB 3UMNA 2ENSA 4LPYA 4U6HB 2G2RB 4NI6A 2COVD 5C0BB 5B7MA 1FBIH 1PQZB 2PUQT 4LCIL 4MZ3A 5GZNA 5E6RB 4PUBL 1IIIA 4LGRB 2AF2A 3IJSB 4QRQB 3RVVD 4JZJC 1F1DA 1MHPL 4MNQD 4ZUUB 4A7GF 2WCSA 4U7KA 2IO5A 2LOEA 2H0JA 3TL5A 3RE0A 1Q9WB 2P5EB 5IB5B 3MV9A 1MG2C 3RYMA 4F15C 4PGEB 4KDWA 1XD0A 1ND0B 5BZXA 4L8DA 4FYSA 4JLRA 3GSRB 3LMJL 2CK2A 1XR9A 5BVJA 1TZGL 1FPTH 2Z31B 3OVUB 4HALA 1QQDA 3FFDA 5KTEL 4LXFA 5LXGL 3F7YA 1A65A 1CFVL 3OHXA 4RFNB 5DLML 1N2RB 1J5HA 5DMIL 1QA9B 4WW2A 2XWCA 5IIEB 2ZX5A 4ISVB 4UV4L 1CCZA 2FECL 4HHAA 5C8JB 3CK0L 4LLVA 5FYKH 3QJQB 4L4VE 4LRIA 3VRLE 3D69A 4DEPB 1UURA 3C2AH 1ETZB 2C9PA 3AXLB 4ZMLA 5D1ZC 3R1GH 1HINH 4NZRH 4P46D 3OLEA 3SPIA 3NIDE 5I76B 3UG5A 1KCKA 4P9MH 1NCDL 3NCCB 2FZ3B 3DXAB 1KCVL 1CO1A 2W0FA 2W1NA 1K8IB 1HESA 2DLGA 5DJAA 3RP1A 3QWRD 5BS0B 1HAWA 1KULA 4Z8FH 1T20A 3ARGB 1J86A 1EMTH 3QUZD 2KT6A 2W88A 2C7FA 4Z7QE 4NJ9H 5B39A 1O5PA 3L6FA 4QCIB 1CUOA 2YARA 4N3TA 1XR8B 3QDGD 2F8VA 3V0IA 1NDGB 2R0KH 5TK2A 3UROR 3NJNA 5IF0B 3V0FA 1CL7L 3PWPB 2HVJB 5IGXH 3QEHB 4NEHB 3AABA 4GRMB 4KXAA 4NKQB 5E2WL 5K1VA 1XGQA 4NBXB 3S6CA 3CZJA 2RMNA 4JKWA 1NC2D 4PRHB 1MRDL 3VX1A 3ARFD 2EIZA 3CHSA 4AKQA 5AAWC 3BE1L 3GI8H 4P3DA 1FNSL 2WLNA 5DD0H 2D03L 3PDOB 1QTPA 4YSAA 4YHOL 2WVTA 3UERA 3GJFH 3DSNA 5GGVH 3JZ7A 3VXRE 1TQTA 4KX8A 3IPFA 3FQWA 3KLDA 5E9DE 5FUZH 1AR1B 3FZUD 2F15A 3MLTA 3OMNB 3K71B 5EO9B 5IHBA 1MPAL 3K4AA 5JPNB 1QRND 2P45B 2DM2A 3NFSL 4NQCB 4BWTA 2Y4SA 3B7TA 4Z7OB 4LBEA 1IM9B 4YO0A 2FRGP 5E4OA 5GGTL 3PHQB 1EAQA 3D25A 3UPCA 1CU4L 1PZDA 3C5ZB 3I6GB 4JM4H 3KXFD 4RRPG 2XQ0A 2OKMA 3DVGB 2XG5B 2VW6A 4AEIL 2I25N 3CLEH 2DQGL 4NNXB 2NTSP 2IDUA 2OV0A 3JWDC 1CGSH 4P5MA 4QHUB 5D6DA 3KYAA 1CFTA 1MFMA 3EOTH 5DO8A 4J3OH 2HMID 5E7FA 5J57B 4N9GB 2FLRT 4A6YL 4M1DL 3P30H 4H7VA 1E9QA 1A3LL 4NN7B 5KYYA 3RTLA 5ISZE 2P24A 4JFVA 4QRRA 3TO2A 2KZ1B 2HLAA 4FZEL 4WV1A 4XVUC 2AJVL 2R2HB 1CFMA 4MMXC 5E6ZA 5TPWL 4ABQA 2X44D 4S1RH 4PJGF 4KROD 4U6VL 2XKNA 5F1KC 1Q9OA 3FT3B 1JGLH 3MR9B 2H8PA 4N8UA 2BVQB 5DUML 3A4DA 3T6XA 1CS6A 1JPFA 1QBLH 4G7VL 3BUQA 3WNNA 4Y4HD 4M3HA 3TBYA 3VFWB 3KPQB 3OWEA 3WO3B 3NJHA 3ZKNC 4X6BB 3CU7A 1HH9A 4CC0A 3CN3A 1IBGH 4UILL 4HUKB 5LQBH 4JDTL 3U7WL 2Q3ZA 3HCVA 2Y5EA 4JO8A 1A7OL 4NKIL 3ZBMA 4IEFA 2YN3A 2PETA 2R2BB 2BIIA 3WEBA 5T3ZD 3NIFB 1J1PL 1RLWA 2XOTA 1FORL 4NRXA 4OFVA 1QABA 4U1LB 3QHFL 3ZKSD 4AE0A 1GH7A 4QHLB 3AU1B 1I7RA 1UT2A 1URZA 5I6LA 4LSPL 1OGSA 1RP8A 5EG6C 1V27A 3ARWA 3SGKC 3E9UA 2FIRT 4YDKL 2IV9A 1CFSA 4KRPB 5GSRA 3TP4A 1XD1A 3OKDA 1OPGH 4MCYA 4N0CD 2ZXAA 4OQTL 5FWRA 3V6OE 3LZNA 1TJHH 1ZS8A 3JBG7 3WEXA 4D2NA 2J56A 4BK8A 2TRHA 1FZJB 1G7PB 3VAEA 1SJHA 1BFOB 4WUKH 4L4TD 1OAQH 5F7HA 2VKWA 3IMSA 3QCUH 3HG1B 2G4GA 4Y2DC 1L9PA 4K3EH 5IG7B 3ZRFC 1I31A 3NZUA 4G8GB 2WXJA 5E5MA 3KDMB 3BAJA 1WWAX 3GIVA 3RY4A 3GO1H 3LRLA 1MJUH 3SO3C 3T8VA 1B2YA 4LESA 5C07A 3RKPA 2EICA 2FX7L 2VR9A 1N6UA 1ZT7B 3CFTA 1N3NA 4LNRB 3THMH 5KSBF 4G1EA 4M5ZH 2JF1A 2BOLA 4EIBA 1GYCA 1VGKB 3RY6A 1C08A 5EOQH 2RH0A 3Q6FB 4W6YB 3QUYD 4GRWB 4N28A 5C09E 4WJ5B 1EGJL 4L29A 3S3BB 5JXED 5JZ7D 1KJ3H 3GLEA 1YY9C 1D5XB 1OTSD 4C4KT 1QEWA 2ZOTA 4HBQA 1IGJB 2ZXDA 3FO9A 3HE7B 5EH1A 4PJIF 2Y5TB 3ABGA 4O9HH 3H6JA 3V0HA 1MI5B 4OZ4B 4YDVB 3KVDD 3CXDH 5D7IA 4PJCF 3Q2CA 5DI8B 3MNWA 3U4AA 3Q6GH 4C83B 1FC1A 1IBDA 2IQ9H 5JHBA 4RAUA 5DD3L 4HAKA 3D9AL 3ZDXE 3KPOB 2D9CA 4Z7NF 2XBTA 1FYTE 3H9HB 4HIJB 1UG9A 1OCOB 5CEXB 2LU7A 3O6FB 4FQJL 4Y16A 4AJVA 3SCMC 1KB3A 4FFVD 1QZ1A 3KCPA 4DVBB 2VLRA 4I48A 3IAPA 3RFZC 3SDAD 1PLCA 3BW9A 1NEUA 4Z7UF 5EU6B 3SDDD 1PFOA 1H8OA 4A7GA 5IOKA 3JTTB 3EBAA 3L3DB 2EO9A 5K93A 2BNQE 3ZHNA 3T6VA 2NY1D 4XNXH 4Y5VC 5J6HA 5FIEA 3QUXA 3D39E 4O2EA 3WGUB 2X38A 4G9FE 3ZKXB 3PIQA 3VXSA 2W60A 1WBXA 4P2YA 1IGTA 5H35A 4OLZH 2BC4A 2ICWJ 4JM2C 1OL0A 1ZGLA 5C0GA 1NPUA 4M8QB 3FTGB 2BSRA 2Y72A 4QKXB 3QH3A 3ZT7A 2OK0L 2E8YA 1OAZL 1P4UA 1DN0A 1GY1A 2X4RA 5IESL 5CU5A 2RAMA 4PRDB 1XIWB 2GSIA 2ZUYA 2F53E 2VJXA 1YEKH 5LDSA 1QNZL 3SYPA 4AGQA 3EOBB 1YMMA 4OZFH 4Z0XB 4Y4KA 3VFRA 4JE0A 4AEFA 3K46A 1MQKL 2CHWA 4DO6A 1G9ML 2AK4A 4HPHA 4TSCL 5I16A 3LPOA 4K3JH 4JO3L 3VI3E 1A1OB 2WYZA 3MNVA 3VFSA 5B7FA 4TRPL 3WN5C 3BSHA 4LL1A 3QXAB 5K59E 3VXOB 1E42A 1WFJA 1V5JA 4UNTA 4PJFE 4QGTA 3LNIA 2VLKB 3QJRB 3KPPB 2PCYA 2GIXA 3VGAB 2VQTA 5C92A 1UZ6F 5D4JA 2YOAA 3HFML 4HFWB 4J1UA 3BYTA 1D9KB 5FYJE 2DM7A 3FTYA 2DQJL 2A9DA 4R0LC 4N6QA 1XGPA 1R5VA 1ZSHA 4L1HA 3NSDA 1QTYT 3RVUC 2CO3A 1X5KA 4YFDB 4AZ8A 5CEZD 1BYOA 2H3NB 2YD4A 3HC0B 3NACH 3KR3H 5I82A 5IB3B 3WTVA 3IGLA 4L1SA 2CKBB 1O5DT 2R0LH 4GRLC 1MLBA 2DLTA 4ZPTB 2CO6A 5HDBE 1G7JB 3MLWL 4NDMB 4N86A 3MN8A 2JH2A 4QOKE 4PJDA 1U8JB 3TN0D 2VN6A 1INQB 4EUPH 5K9OB 1S7QA 3EJQA 5H4YA 5SWZB 1ZTXE 2R1XB 3J8F7 4MLSA 1TSRA 2FSEA 3IRPX 3LPWA 5TQ0L 1EFXA 2CAKA 4KO9A 1VZIA 1T0PB 1RUAH 2R4SH 4JCWA 5E08L 2MTAA 4PHXA 5CGMA 3WELA 3VXUB 5ECJE 3FSZA 5C9KA 1HL4A 1ZGLM 1P4BL 2PWDA 2R29L 1UHVA 3NA9L 3W11D 1AI1L 3LSOB 4HKXB 2IADA 4B9ZA 4F1SA 1QLEL 2BZDA 2KPNA 4R4FH 1DFBH 4OFYD 3Q8AA 2YC1B 1D5IH 3K6OA 5GRJL 4HC1A 1NZRA 4HH9B 4ZXBD 5HGGS 1QR1B 1JNHA 4E0RA 3UYPA 2AW2A 2WQRA 4N90D 1GGIH 4GKSA 4RFEB 4LLMA 3ROOA 4I85A 3WUWG 4ANKA 3M45A 1P4IH 3O2VL 4JG0H 5HHNB 4Y19B 2ZSWA 4NQED 2R8SL 2ZJSL 3KPSB 4NHUA 1K2DB 3IJYB 3EGDA 3TX4A 1GW6A 5F7LB 35C8L 1FZOA 3AAZB 3FC8A 4XCEA 1TZ8A 3UTPE 4V1DB 5CLXA 4GAAA 3FF8A 3TCTA 2WP3T 4P2RA 2EDEA 7PCYA 1ZWIA 3SYAA 5JHDA 3BVXA 4ZUTB 2Z0BA 5IQLA 4LIQH 4PJGA 4P4RB 2WWKT 3O3AA 1KN2H 4ZPVA 2QPFA 4FQXD 1XF1A 5EN3A 2HX7A 2AGJH 3BZ4A 4PRPA 4EOWL 4HH8A 1JZJA 3GDCA 1YZZA 5DGRA 5BCAA 5EF1A 5AVSB 1NFKA 1VESA 5F0LB 2GVYA 5EU5B 3NCYP 1TETL 4WCYH 5MHSD 4JEGB 1TNNA 3ZDYB 1I8LC 8PAZA 2FX8L 5DVPA 4XOEA 4ODTH 3C6EA 3S8GB 2FH6A 1CI3M 3HLAA 4N0YL 4F7EA 1BDYA 3B37A 4AKPA 1CJYA 4E5XB 5I73B 2A9NL 4EDWL 1HH6B 1GY2A 2X6AA 43C9A 2N7SA 3Q1SH 3BGMB 2VMDA 2WKGA 2AAVA 2RCSL 4EVNB 1JK8B 5IVOA 3X12B 2EC9T 5BW7C 2O1AA 1FIGL 4PG9B 2UX7A 1USZA 5BMFH 1AGCB 1RZJC 1PAMA 1Q9KB 3CX5K 4YZWA 3W2DL 5IVXE 1OO2A 3P40A 3TO4B 4B3VA 1WA0X 1U3ZA 1BQHB 4IJ3B 3VGBA 2YPLB 2KZKA 3MODH 5IW1A 1JWSA 5CR8A 3UJJL 4XNZB 2IEPA 1PVHA 3GBLA 3IJ8A 3TA3C 4FABL 5DGQA 2ZYRA 4JHUA 3WMSA 1RHHA 5I75C 1WAPA 3FMGL 1TU2A 5T1KB 3AY4C 1UXMA 4JFYA 1BVKB 3UX9B 1MHCA 4GXUN 1IGYB 1DEEA 5ABDE 3B3IB 1PTZA 1J11A 3ULVF 1O0VA 3CD4A 1UGNA 4UT6L 5KSBA 3MGTB 3AACA 3O9WD 4MJ2A 3ZDZF 2R2EA 1F4WL 4GG8A 5JXAH 5J11B 2BSDA 1QATA 4GSDH 1QSZA 2X7LB 3VYNA 4K94L 4GG6F 4APXA 3VW3L 3LY6A 4GW5B 4KUCD 4U3SA 4O51B 1ONQB 4ETYA 5G2NA 3JVFC 4OKVA 4PJIA 1A21A 1NLDL 3RJQB 4TUUA 2PMZA 2R4RH 1T22B 1KJ2H 3G6DL 3K8MA 4X80L 4PJCA 4PRNB 5D7JD 5AYTA 2DQIH 4RFOH 4DK5A 3JVGC 1R3IL 3FQTA 5DZJA 4YHLL 2RALA 1AQHA 4OGYH 3ET9F 4D8PB 3BLKA 1E5ZA 1M6UA 2B59A 4ZW8A 2ITCB 4W9KC 4WO4D 3SDXE 2NQCA 1X7QA 4GPVA 4AEHH 5K39A 4RFNC 1QVOA 1E5AA 4BZ2A 3EHBD 3CIQA 2DW5A 3T77B 2PCPA 4OQTA 1XV8A 2YPVL 1NBZB 2F54B 4RZCA 5T3XD 1YUHB 3CQPA 4DTGL 3BIKB 2PN5A 4DEPC 4K5OA 2CNZA 5IB1B 5JPMB 2DIJA 1ZHKA 5D2LB 3FFCB 5DA0B 4JFFD 1DBBH 5IP4A 1JPGB 4ANUA 1E4WL 1I9RH 1BEYL 1ET8A 3X14A 1EXGA 1AGEA 3Q5TA 3U36A 4BFBD 3DV6B 4HP5A 2WVVB 1BBJA 1L9SA 3H3KA 1KLUA 5SX5K 1NEZA 4YSCA 4AENA 1QBML 3X13A 5C6TH 3G6JF 4FAAB 2XWTB 2V3DA 3KXFE 4OLWH 4Q6IB 2C9QA 3TZVA 4DPCX 1NC4A 3NAAL 4JRXD 4WK0B 4AQEB 4I2XB 3M8OL 2HAZA 1NLBL 2C4XA 3DX2A 3AT9A 3B9KA 4C4KO 1J5CA 4MAZA 4PP2B 5D2NB 2BP0A 2VIRB 3QC5X 3K2UH 2XXGA 3CN2A 2VR4A 2I32A 2DI8A 4EN3B 1A0QL 3BT2H 4NO3B 4X42A 4L8SA 3CZFA 3ZUCA 3VQMA 1J10A 3RDTA 1BD2B 5DD6A 1WDAA 1KYOJ 15C8L 3A47A 4UQ9A 2GEQA 5H4ZA 4U33A 3S3SA 3CFDB 4FTVB 4PJXB 2BRRL 2M1KA 1FLRL 3HG1E 3QPKA 2CPUA 1AH1A 3OPZH 4Z76B 5EU7E 3B2XA 5SV4A 1T6VN 4OZHF 1DZ0A 4RGNB 2VABB 1UB6A 3WEOA 3PWJB 1FFOB 4FNPA 4WK4B 3DHPA 3MLSH 1XF4B 1AR1C 4XXCA 3JQOB 4GMSL 2ICCA 5LHDA 4Y1SA 2VERA 1MKFA 1P9MA 1YYLH 2WOYA 4MGXA 2CPCA 1KB9J 3L45A 2GSMB 5T3ZE 3D33A 4NT6A 1XMWA 4OSUL 3B2MA 1SF5A 4HXAH 2WQAA 3NFPA 4Y5YA 5SWSD 4XTRD 1T5XA 2NXZB 2VDOB 2EEXA 1SM3H 2QDVA 3A6OA 4WWKD 4M5TA 1KYFA 4X8JA 5CWSA 4BDVA 1W6LA 4BA8A 2A77L 4AUYA 3DJRA 4FQHA 1RJZA 3K6FA 5SX4I 1FCGA 1UOLA 3QAZC 4CVUA 1KSRA 3BC9A 3MV9B 4N85A 1AE6L 4TF4A 3SY6A 5FM8A 5AFAA 1TF4A 3GSQA 2AABL 1BJ1J 2HRHA 3RX9A 4WVRA 4L4TE 3IMUA 3LKQA 4NN7C 4L8DB 4Z23A 3TS8A 3ES6A 5I8KH 4JLRB 4CC4C 4P57A 4NAMA 1JF5A 4R8WL 5BVJB 4I0KA 3LXBA 2XZCL 4OCNC 3VI4F 3I6LE 1QQDB 1E5UI 3FFDB 4X4KA 3QJUB 3F7YB 3P11L 1FFQA 2PO6D 4XX1G 4BCXA 5E99L 3PL6A 4NLHA 1A5FH 4WW2B 3AW5A 4E9VA 1W0WA 3QI9C 3BLBA 4OV5A 4NUGL 2DLFH 2R1YA 2H6PA 5EZPA 4HHAB 2W9EL 4FQQB 4LLVB 3WS6A 1T1ZA 3TBSB 1CDJA 1DJXA 3MLXH 3D69B 4EQ2A 1O6SA 3SGJC 1NJ9A 5GPRA 3TBCA 1RZGA 1TMQA 1ZT4A 2FBJH 4HAGA 1JG9A 3EG9A 1KGXA 4GIPD 3IGKA 5CCGE 3Q8EA 5AG8A 2Y2TA 3SE4C 2R56H 3KEDA 4GI6A 2BOCA 2A0LD 3UBFA 3O8XB 4XPFL 3WKPA 2EYRB 1RVFL 1XH2A 1MCBA 2H2PD 2W0FB 4K9EL 2AJSL 3WCYA 1C8PA 1ORQA 1TENA 1QFUH 1N6QL 3F6IA 5CUSL 2H0FA 4BHUA 3I2CH 1T20B 2XNAA 3QFDA 1NCWH 3FQNB 1OCZB 2P80A 2HMIC 4KRPC 4ZMYA 5B39B 3P0YH 5DEJA 1T5WA 4HPOH 4UOW1 2VSCA 1WS8A 2EDHA 2ITEA 3VRIB 1XH3B 3EH5B 1OGPA 2XU9A 2QGEA 2IWKA 3PU7A 2OSLA 4TVPD 3GWJA 3UAAA 2VDNB 1NANI 3SBQA 1XGQB 1EO7A 5F1NA 2Q3XA 3S35L 4CC1A 1OVZA 2R0WH 4OZGF 3GMPA 3GNML 4Y4HC 2EIZB 3A3YB 4XN9A 4BZ1L 4HD5A 1ZGLP 3QDHA 4NM4H 4P3DB 2EZ0C 4KRMB 3QIBD 1JZIA 4NFCA 5DFWH 5H37H 1OM3L 1UA7A 5MENB 1J05B 5CJXA 5C0DA 3UBGA 1S7VA 1YC7A 3L9RB 4KXZI 1TJGH 2ZCHH 3P0VH 3WMQA 3DSNB 5DUBA 1JHTB 1SEQH 2K7QA 3H42H 3FQWB 2OLDA 1SEBA 1OB1A 2XIDA 3IRZA 3MLTB 4KAQH 1RZKC 4ZTPH 2B3IA 1B4JL 5I0VA 3WTUA 3QZLA 2QPEB 3VDBA 3LDBB 2EDXA 4Y2LA 1I9JL 2ISDA 4QD2E 4W9GC 4NAQA 3ZIMA 4LBEB 4MCMA 4YO0B 1CIUA 2OMXA 1U3JA 1USQA 3ME0A 1S9WA 4OM1H 2WP3O 3D25B 5D93B 5TE7H 3C8DA 2GCYB 2OYKA 2YHGA 1RK1A 1FG2A 5HDQL 1E4JA 4EZJA 3EO9H 3Q8FA 5AB1A 2WWKO 4KKLD 4KKBD 2NY7H 4GG6A 4NGHL 1MAMH 3LEYH 1NGZA 1UXSA 3VSVA 1NPNA 4P5MB 5CCKL 1CFTB 1IFRA 4WTWA 1GZPA 4X0KA 4GP8B 3GSNH 2J8UF 1E9QB 2JI2A 3ML8A 4GAGL 5KYYB 4EO5A 3L08A 2NY4B 2P24B 4QRRB 3TO2B 5EC1A 1ZANL 2BSSB 2HLAB 1CDUA 4WV1B 5KZCD 4Q4EA 3KG5A 1XZ0A 4GKZA 3ZKXC 3L8QA 4AK1A 5I1IL 4OI9A 2DL2A 4AGPA 3D0AA 2LLGA 1ZVSA 5CEZE 5GRYA 3QUYC 2XKNB 3BOVA 5JZ7C 4F3FA 4FC3E 3AFLA 1X5IA 1WK0A 2H8PB 1YEJL 4M7ZC 4JHWH 2B4CC 1OTSC 1S7SA 3KPSE 1QX1A 1EO5A 1JPFB 1RERA 4NC2B 3TBYB 4EN2A 2OTUA 4QTHA 2RBLA 1WVZA 1QP1A 1CTNA 2FAUA 4O5LH 1HH9B 5FXCH 4DZBA 5JUEL 4YC2C 5IKCA 1WAEA 5FYJH 3HCVB 3LZFH 2F74A 4G6FD 5EUKB 1G1KA 1GPOL 4IEFB 2XV6B 4ZJ9A 1VPOL 2WWOA 3L4YA 4KHXH 5HJ3B 5HHOA 3SOBL 1LXMA 3UO8B 5CD3B 1TKWA 2OI9C 5C08A 1RZJH 3X1EA 5E95B 3U1SL 3ZK0A 4NRXB 1YN7A 1I7RB 4FFVC 4JJ5B 1P69B 4NQVA 4AVJA 1A6PA 3ZE0B 3SDAC 2FQFA 3D09A 2BNRD 3SDDC 5GSRB 4M7LH 1CFSB 1WE5A 2QZ5A 5E8DH 4Z78A 3OKDB 4MCYB 5I24A 4WHTA 4UT6A 3ZDYE 5GIRA 4ORGA 3G6JA 1NGWA 2WV3A 1N5YH 1ZTXH 3WEXB 1ZS8B 5KBNC 1QO3A 3IGAA 3H1ZA 5EU3A 1SJHB 4WFFE 1UYWL 3BAIA 3TEXA 3Q9QA 2CBQA 1D9KC 3LEVL 4LOUD 1SXCA 3NK3A 5E6IA 4AYMC 3ZE2B 2XKSA 3GIVB 2N56A 2HJLA 2DQUH 4DP7X 4D0CA 2W65A 1KTDA 3K6IA 3LN4A 1TEYA 4YHMH 2A6DA 3UAJC 4ATTA 5LVEA 4G1EB 7PAZA 4JO5A 1KWGA 2WUCH 1C08B 3ULUD 4JDZA 1G7QA 4KXCA 5CCHE 3BFQG 2X9XA 1ROWA 1T0MB 2PCFA 3FTZA 2E7LA 4OZHA 3CX2A 1THAA 2JWYA 3SKOA 2FHCA 3UTTA 1QEWB 4ZMWA 3FO9B 1CGTA 3H7LA 3P4OA 1HNYA 3CVHH 5D7IB 5IK3A 4JFED 1KEGH 3MNWB 5MHSE 1E2ZA 3MFFA 1LTXA 5KJ4A 4XPGL 4OGAC 2E9IA 1OLLA 2GK2A 1BAWA 4RAUB 3INUH 1E90A 3HPJA 2BNUA 3U0PB 2HJKB 5DDHA 5BO1L 1QPPA 5EEXA 1LO4L 3F7PC 2HFGL 3GF8A 2OXHB 4P2OB 3OZLA 3KCWA 4I3RL 3EOAA 2GI7A 2R69A 3CSPA 1WH0A 1KELL 4Y16B 1E4XH 3MRNB 2KBGA 2Z7ZA 3KCPB 2VLRB 4I48B 3BW9B 4AMXA 5FOJA 1SOXA 3LH9A 5FW6A 2ZWSA 5M94B 3LQZA 1VCBC 4HOMA 3VNYA 1KBGH 3TJEH 2ARJA 2AZUA 4R26L 5J6HB 2M8XA 3QUXB 4O2EB 1KXVC 2HPOA 4RGOL 3S5YA 2RACA 3ELQA 2CJTA 3PIQB 3Q5OA 2EDBA 2OULB 2W60B 4TXVB 1JDCA 2H0PA 3GK8L 3VXSB 1IGTB 5F7DA 1G9NC 2JB6A 1ZSDA 5FWQA 3REWA 5H35B 1L6ZA 4LPUA 1NL0L 3G3LA 4ZRGA 3VI4A 3WY1A 1ZGLB 2KI6A 4FHJA 2IDFA 5IROD 5B4MD 4AQ8C 4U2YA 1PD0A 3C09B 3I9PA 1OARL 3QH3B 4K07A 4NC1E 2JKXA 5DR5H 4ABVA 3IRCA 2IAAC 5J5EA 2X4PB 4X5LA 4CN4A 2X4RB 4HCFA 2GSIB 3MOBL 4DP1X 4N0FA 2DM3A 4Q58C 1CGUA 3IE9A 2QV4A 1YMMB 3T2OA 5LNDA 1JD7A 4NIYE 5F88A 1CF8L 3VFRB 2NY2C 5LGHL 4ELME 2AK4B 3S9DB 2XTJB 3EADA 4Y5XA 5I16B 2B2XL 1NUDA 3B2VH 4HUXA 4JDEB 3MV7B 3N6YA 4KKCD 5DJXA 3ZT6A 5J0BA 5KVFL 5HJDA 4PAZA 3VFSB 2AEPH 5F8QC 1VHPA 5I73C 2WLKA 2ICEA 5IVZB 2VITA 4K2UL 4LAQH 1FO0H 2NZ9D 5HHVL 3HR6A 1CQYA 2RB8A 5TDNA 3RLSA 4FMVA 3RWJA 4XZUA 4DHLA 5CFHA 4PGEA 3JYBA 4IOSD 5DD1L 2K45A 1T4KA 1JDDA 2UZXA 1XX9C 3ALWA 1VEMA 1Z3GH 4KZDH 3GXPA 4J1UB 1Z9LA 5E2VH 2VN7A 4LHUA 3TO4C 2NYKA 2JVUA 3T1FA 3NBNA 1HCVA 1UQSA 1XGPB 3CV5A 1ZV2A 1R5VB 3VSQA 5MEQA 2X5PA 4KOCA 4XNZC 4AZ8B 4XNYL 3TNNA 3RUGF 4GFXA 5T3XE 3TEZA 2NY3B 5FCSH 3BVDB 2CO6B 4PJXE 4OZGA 5T5NF 1UCBL 5D7EA 5FDWA 4PJDB 2NNXA 1KJVA 3QJFB 1S7QB 1M2OA 4PWGA 5EOCJ 3BD5A 3HE6D 3D48R 5LG1A 1EFXB 3IJHA 4UIKL 1X9RA 3L4WA 4JX0A 3L4UA 3RX7A 3QNYA 2O93L 3C60D 4XVJH 3VWKA 1JGEA 5KBMA 1MFEL 4MDJA 3UYRL 5L6YL 3D4CA 4J3WA 3T2QA 4JN1H 3DX7A 3CGTA 3DETC 2J21A 1MIML 3GS0A 1HQ4A 3FQXA 1JZFA 2IADB 2KLSA 2VLJA 3HG3A 4PM1A 2NUTA 4QR7A 4XMTA 2Y2WA 1JYXA 4L18A 1ZVNA 4NFBA 2NY5C 5ANME 4V2BA 5E5RB 2XY2A 2ZAGA 1EHAA 1JNHB 4YDIH 4M6ML 4TSBL 3ZMEA 4L37A 5GS1C 5KJRL 3MOAL 5C1MB 5DK3A 4FOMA 4GKSB 4LLMB 3ROOB 2VMCA 2DQEL 1U2HA 3DHUA 1HS6A 1MW3A 2ZSWB 4YDJA 4F27A 5TE4H 1DR9A 4JQVA 5I6XC 4WNJA 4N22A 2EIBA 2JJUA 2J8UA 4NC1C 3EGDB 2FB4L 4UQIM 3UACA 4FQCH 1WP6A 4ODVH 5GGRB 1FZOB 1HE8A 1YMHA 3PGFL 3O9WC 4P2RB 4EI5D 5JPMC 3RAJL 1FBIL 3B9AA 1ZWIB 5JHDB 3TWCH 4PJGB 3S3JA 5DMJB 1HYRC 2VW7A 1H3VA 3O3AB 4CADB 1Y6MR 1ZLDA 4L8BA 4ZPVB 3SIKA 3D12B 4OCXH 1NBCA 4X5WA 4B9FA 4UMGA 4D3CH 1HZKA 3BZ4B 4ZG1A 1R46A 1AZRA 1U33A 4BZ1A 2I7OA 2EUWA 4WSGA 4Q8BA 2WXKA 1PW3A 2WVSA 3V4VH 5D7JC 2Z92A 4MAYA 2P8MA 5B21A 1FQ9C 4MVBD 4Q6IC 2SEBA 3ARDA 5AL8A 4K7PY 3HLAB 1FVEA 2LLLA 3WDIA 4F7EB 4HK3N 1CLOL 2YBRA 5E8EA 4WKZA 4GBXA 43C9B 4OV6F 3W37A 2VL5A 3KM1A 3EGXA 2XTSA 1JK9A 5J12C 3MLZH 5T1LA 1F0LA 3SYQA 3AG3B 4O4YH 3RIAF 2P5ED 3BVUA 1MNUH 3E80A 1OLZA 5T3ZH 2Q8BH 1HINL 4HLEA 1IVLA 5B8CB 1AZUA 4Y1AD 1RZKH 4G7QB 1WAAE 1JWSB 3K72A 1I1AA 3NH7L 2V9TA 1L3WA 3JWNG 4X6CE 4ERSH 1JXGA 1NCHA 1KZQA 2X2IA 3UTSA 1T0OA 1RHHB 3HI6H 5IBLD 1TU2B 4NM8L 3IB4A 4TKWA 3CAFA 4KJPD 4G43A 1MHCB 2E76C 1DEEB 1EMTL 4JFPA 5D6CA 4FA7B 2CR0A 2DJSA 1JHKH 1ZHNA 4NJ9L 2H3XC 1R4XA 1A7QH 5MENE 4PJBE 1PKQA 5FM4A 1U2YA 5KSBB 4NQTA 4N2MA 4F5CE 2R2EB 1P4LA 2VQ1A 4YFEA 1RK7A 4LCWB 4XOAA 1BWMA 3OB8A 1L7TH 3D6GA 3PUUA 2AMGA 4APXB 5GZNC 4EMZA 5B3JF 4HF5H 4U3SB 2NXZC 3CE1A 3TIEB 2EE6A 5C7XH 4U7MA 4OKVB 1MOEA 3IDNA 4PJIB 3OC5A 5E1HB 3T71A 2QZQA 4PJCB 4M61B 1F11A 1WFMA 1B90A 3ARGD 3DIVA 3LRHA 4PMFA 3R7QA 3T65A 4X83A 2WZ6A 3FQTB 9CGTA 2DPKA 3GRBA 1IAKA 2B4CH 2E7CA 4WDIA 2B15A 4TVPE 3ESNA 4I3GA 4IBLT 2B59B 5C0EB 4YK4B 2PYEB 3GXIA 5GGVL 1KIPA 2N01B 4HJUA 2G2PA 1X7QB 2DY2A 5K39B 2ADGB 4MXVF 2J57A 3QIWD 5FUZL 4HSAC 1QVOB 4KU1A 4AVHA 4HJ0C 2WZPD 1RU9L 4YSSA 2MCAA 3FT9A 2PCPB 3WD5L 2YZ8A 4KPHH 2WXNA 4MNGE 1F58L 4RZCB 4LVOC 4PCYA 3BCDA 2WBKA 3PWLA 4JE4B 4PRHD 3UJIH 4H88H 4PG2C 2XV2A 1KTRL 1BAFH 1GCYA 1NAML 1ZHKB 4W70A 4WJG3 2GITA 1AANA 4A7VA 3IDMA 3DX8B 2ZYSA 5BZWA 4CJ0A 1CD1A 4A2DA 2ARWA 3X14B 1AS6A 1AGEB 2E3VA 3LS5L 3HI1A 1DBJH 3O8XC 1DJWA 5B1BB 3U36B 1CGSL 3IDIA 4XX5A 1BBJB 2ITFA 3W39A 3QEQA 1RUMH 4Y5XB 1R0AH 3EOTL 3WG7B 1KLUB 2BVUA 1NEZB 1QASA 3I02A 4MD5A 5DS1A 3P30L 3W1ZA 4AENB 5T5FA 3X3FH 1P6FA 4PLJD 1MAJA 4NQCD 5AOJA 1MCOL 4KTDH 1S3KL 1NUFA 3TZVB 1NC4B 1BAGA 1UWFA 4X2UA 3PWVA 5DHVB 3C5ZD 5KVEL 4ALAL 1SMAA 1O7SA 1HSBA 2XICA 3ERXA 4S1RL 4TLUA 3B9KB 4W9EC 1OSPH 1JGLL 2BP0B 1FLTX 3Q05A 2NNAA 5D5MF 3LH8A 3W57A 1T89A 1QBLL 4NNPH 3BWSA 3VA2C 3VTAA 4BGDA 2NT1A 3CZFB 4H2CA 4NP4L 3RDTB 3FUIA 4NZDA 5DD6B 3DO7A 3AMKA 2OR9L 3BPCA 5CEYA 4TM9A 3BVVA 3SBPA 3SDCA 5B3NA 3MV8A 4YXLH 2X4OA 3TTYA 2HLFD 3FW6A 5DQJA 3VQLA 4B50A 5FCUH 3TCLA 2XWRA 4N2HA 5IFJA 2V5RA 2YWYA 3MCYA 4XPHL 1JGVL 2NCMA 4W9LC 5ADPL 5JHLH 1E40A 1RJYA 5AVRB 4QNPF 3DHMA 1GMIA 1N4XL 2JELH 1JFQH 1UUSA 1UB6B 5FUOH 4P05A 2N0MA 4YEEA 4BXVA 4UDUA 1II4E 3NPSC 3SE8H 3EYVA 5E23A 1JHLH 3RUGA 5IWLA 2CJ3A 1OPGL 1VACA 4LSVH 4J28A 4K23L 5J1AA 3LDBC 1B9ZA 1CDCA 1OW0A 1TJHL 2HWZH 1VGEH 1KTBA 1WICA 2PR4L 3RIKA 1N6VA 5L0QB 4NT6B 1QLFA 4G5ZL 4OJEH 4WUKL 5CEZH 4OFKA 2NR6C 1YG9A 2OCJA 3QCUL 1A1NA 3NFPB 3UGXA 5KWYC 4NPKA 4Y5YB 4K3EL 2MNWA 4Z9KB 1T5XB 1NCGA 2BNRE 4OIIH 5C86A 4WQOA 4J3OF 4WI2A 4BA0A 2JFCA 3RJDA 1WA2X 1OAKH 4X8JB 4UTBH 1HNFA 5CWSB 4BDVB 2Q86A 1DFXA 4HEPA 4PVNA 1MJUL 1JYNA 4FQHB 1RJZB 1TXKA 1YQVH 5EO0A 3R7RA 1R9FA 1R5WA 3BISA 4QWWC 5AZ2L 4ODUB 1J8HA 1EO8L 1EHXA 3GSQB 3THML 5DQDH 1P1ZB 2C9UA 3LKQB 4J8QA 2VR6A 2DEXX 2YN5A 3ES6B 4XGZA 1TOXA 5LBGA 3VXMB 4P57B 2NY4C 3QIBC 4LEXH 1M53A 1I1YB 4WV1C 1BIHA 1KJ3L 1URIA 3V0JA 4CGUB 3ZQWA 4O02L 4Q9QH 2JK5A 4G8FB 5EIIG 4UQ2A 5B1CA 3UP6A 4EKJA 3KBHE 1H0DA 1W0WB 1T04A 4O9HL 4OV5B 3MGOA 3KLQA 3D4YA 2R1YB 2H6PB 2RTTA 3CXDL 1UC6A 1T1ZB 1QWNA 3F6LA 1NJ9B 1THCA 5I8OH 3ULUE 1MZZA 1ZT4B 1BLIA 4G8IB 2XPYA 4XAWH 4IRSC 4PGCA 1PIGA 2Y7OA 4UINL 2BOCB 1NIAA 2TSAA 4ACTA