3WKQA

Copper-containing nitrite reductase from geobacillus thermodenitrificans in complex with formate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
299
structure length
299
Chain Sequence
NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Copper-containing nitrite reductase from Geobacillus thermodenitrificans in complex with formate
rcsb
source organism Geobacillus thermodenitrificans
total genus 102
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wkqA00
2UX7A 4W1TA 1ET7A 1L9QA 3TBBA 1L9SA 3ZDWA 5D4IA 2B08A 1SJMA 2QPDB 3WKQA 1PLBA 3NJJA 2VN3A 2E86A 5TK4A 1BYOA 1J5DA 1SNRA 4UAHA 2EIJB 4P5RA 1L9PA 3UGEA 2HX8A 4YSCA 1AZBA 1J9QA 3EHBB 1FA4A 2JKWA 3OQRA 2BO0A 4G7RB 4GP5B 4L0PB 2AZAA 4PAZA 1RZPA 3FYIB 1ZPUA 9PCYA 3C75A 1L9TA 3FSAA 3X1GA 5AFAA 4G72B 2QDWA 1PLAA 3DIVA 2BZCA 3NJFA 2WO2B 3FPXA 3FU7A 3QJUB 5B1AB 3T71A 2BWDA 3ZIYA 1NIDA 4A2DA 1CYWA 1WS8A 4A2FA 3NJHA 4BXSV 2BZ7A 5EHFA 1IBYA 3RYMA 1XMEB 1OE2A 1BEXA 2VW7A 2FTAA 4HCFA 3KW8A 4JHVA 8PAZA 3N55A 5I26A 3BVDB 1OF0A 2BP8A 3OM3B 2YXWA 2H47C 2VW6A 1RZQA 1A3ZA 4HIPA 1IKOP 1EZLA 1E5ZA 3ZBMA 2DWTA 4DPAX 5I28A 2DY2A 3BQVA 1BAWA 3G5WA 1JZGA 1X9UA 1J9RA 1NIEA 1PNCA 1PF3A 1RKRA 5I6OA 3PAUA 2UXGA 3ASNB 5I6MA 3FSVA 4DP4X 2R7EB 4E9XA 6PCYA 4X4KA 4YSEA 4K9JA 1R1CA 2I7OA 1M56B 5PCYA 3NJIA 3H4FA 5B7FA 2GB2A 1SHXA 2PCYA 3CDZA 4BWTA 3FSZA 3L45A 3PCYA 2XX1A 3QJSB 2PPAA 2J57A 5ANHA 2ZWNA 2GC7C 2HXAA 1JXFA 4A67A 1ZDSA 2TSAA 3IEAA 4GP4B 1RCYA 3D12B 1NIBA 2XX0A 1KBWA 1WS7A 2W8CA 1AZNA 3DKHA 5IY5B 1SHWA 2IAAC 1NIAA 1OE1A 4BWWA 1JZJA 2GI0A 4M3HA 4HCGA 1CYXA 1GS7A 3AG1B 3TA4D 2MRYA 3H4HA 2P80A 5I6NA 3QJVB 1GR7A 3X1FA 2Q9OA 1JZHA 1BXUA 5I6PA 4G70B 4BDVA 3HEIB 3SQRA 7PAZA 3IN0A 4DP9X 3MBWB 3OMNB 2FQEA 3IE9A 4HAKA 1M57B 1XB6A 1BXAA 3SBRA 3X1NA 4PCYA 3X2QB 1BQRA 3AG3B 2JXMA 3FQ2A 1AAJA 2XYBA 1AZUA 7PCYA 1X9RA 3WNJA 2PPCA 1NICA 1OCOB 4A68A 1TU2A 4HCIA 1AZCA 1T5KA 3UADA 3JT2A 3CZUB 4DP5X 2BWIA 1AS6A 2J56A 4N8UA 1FWXA 4FAAB 2FQFA 4GP8B 4DP6X 1OCZB 5I5MA 1V54B 1IC0A 3S3BB 5F7BA 4BWUA 2Q5BA 4DP7X 5E9NA 2GHZA 1ILUA 1NIFA 2RACA 1V10A 3V9CA 1JZFA 1OOWA 2UXFA 3TBCA 2N0MA 3WI9A 1GYCA 5AKRA 1GS8A 2CUAA 4DPBX 1M9WA 2CCWA 1V55B 1J5CA 1ET8A 1OV8A 3AY2A 3EH3B 2BW4A 2XXGA 3OMIB 4E9QA 2CJ3A 4GYBA 5A7EA 1QNIA 2VM4A 4WKXA 3SBQA 1AACA 1AG0A 3ABKB 4YSAA 5B1BB 2AANA 4DPCX 1TEFA 1GY2A 2PPEA 2Y69B 4HZ1A 4M4RB 2PP9A 1SF3A 1WA0X 1KDJA 4N4YB 1JVLA 2IH8A 4KNTA 1ZIAA 3PAVA 3ABLB 2IWKA 3NJGA 1GS6X 2QT6A 3IBOA 1PAZA 1EHKB 5LDUA 2EIMB 2YQBA 3NSFA 1A8ZA 1ASQA 2IDUA 2QPEB 4W9ZA 2J55A 3GXUB 4MFHA 1L9OA 5I5JA 3PLYA 4E9YA 4CSZA 2R7EA 4E9RA 5D4JA 3EH4B 3V9EA 4KO9A 4FA7B 4F2FA 5I6KA 4DP1X 4G71B 4KO5A 3QJQB 1CUOA 1ET5A 2XLLA 1NZRA 4YSPA 2FT6A 3QJTB 1ZV2A 2ZOOA 2HRHA 1BYPA 1JOIA 1IBZA 3PAZA 1ZDQA 1BQ5A 1ASOA 1OCRB 4TXVB 1JERA 4A2HA 1SFHA 3PPSA 2HRGA 1CURA 3GDCA 4HHGA 4KO6A 3NSCA 4BXVA 3UAAA 3S3CB 2OCCB 3SBPA 1QHQA 1PZCA 4G7QB 4ZK8A 3X1BA 2LLNA 2YAEA 2GC4C 1KYAA 2AVFA 2XV2A 5B7MA 1SF5A 1UATA 2EIKB 3NJKA 2UXTA 1AZRA 2H5UA 2GIMA 2YAFA 4KOCA 4CSPA 2HLEB 3KW7A 3WKPA 4F7KA 4E9VA 3FYEB 1XB8A 4UANA 3NYKA 4YVUA 4AKOA 1KBVA 1NDTA 1PY0A 4AX3A 2IWFA 1AG6A 1J9TA 1N70A 2ZONA 1FFTB 1MZZA 1SDDB 3UABA 1ID2A 1SFDA 3ZX1A 1L9RA 1YLBB 2FNWA 1N68A 2BHFA 4KNSA 1HAWA 1NPNA 2PCFA 1E5YA 2AFNA 1HAUA 5I5IA 2YXVA 4Q8BA 1JVOA 3ERXA 1JXGA 1W6LA 1PLCA 5PAZA 2DWSA 3AW5A 2UX6A 2IH9A 3ABGA 5B1KA 3FT0A 2XU9A 4UF7C 2HX9A 2OJ1A 4AKQA 1AIZA 1I53A 1NPJA 3S3DB 1MZYA 3QJRB 2BP0B 1W6WA 4A2GA 2CALA 1OCCB 1ASPA 4KO7A 1ILSA 3H56A 2VSKB 3TU6A 4HHWA 2XVBA 4AKPA 1JXDA 1A4AA 4E9TA 3JTBA 2YAPA 2XWZA 2YAMA 2CAKA 3TASA 1KV7A 4BDVB 2PPFA 3PXLA 4E9WA 3N2JA 4YVNA 2CBPA 3CVCA 1AOZA 4YSUA 4WTQA 3OMAB 2TSBA 1AR1B 2XXFA 2ZXWB 3FPYA 1A4BA 4AI7A 2HX7A 2I7SA 4AZUA 1ETJA 4NAJA 3WIAA 2XV0A 4F2EA 3FQ1A 1JZIA 5B3SB 1GY1A 3CVBA 3DTUB 1DZ0A 1AS8A 3T6VA 4ENZA 2QDVA 4QLWA 2A3TA 2DYSB 1CC3A 3EH5B 5B1JA 1KCWA 1WA1X 3UAEA 1AS7A 3X1EA 1URIA 3AZUA 2J5WA 3NJLA 2P80D 2YAQA 4HALA 3ABMB 2EILB 3MX0B 2WO3B 1A4CA 1NTDA 4Q89A 1NWOA 5B7EA 1TKWA 2DV6A 2MTAA 3OD3A 1NWPA 2PLTA 2WSDA 2B3IA 4DP8X 4YSQA 3U25A 2X88A 2JFCA 3NP3A 4E9SA 3FU8A 2VMJA 3NJMA 4NB7A 2FT7A 2YAOA 3FSWA 4EF3A 3FS9A 2OV0A 1PZBA 1WA2X 4KOBA 5F7AA 1E30A 5B1JC 2IDSA 3FU7B 1SDDA 2DYRB 2VM3A 3NSYA 4GXFA 1MDAA 2YAHA 3NP4A 1NINA 2BW5A 2BP8B 1KCBA 3ASOB 1KDIA 2YARA 3NJNA 1IUZA 1HFUA 3HB3B 3WG7B 1MG2C 1GSKA 5I6LA 3S8GB 1WAEA 1ADWA 1PMYA 3UACA 1W8EA 4G7SB 2XUWA 1PZAA 1E65A 3GYRA 1QLEB 2W88A 4A2EA 4KNUA 4YSDA 3FQYA 1J9SA 2BP0A 3AG2B 3WNIA 3CG8A 4YSSA 3AG4B 1OE3A 2PP8A 2FT8A 2PP7A 4JHUA 1AQ8A 3T6XA 1F56A 2AZUA 2EINB 4YSTA 1KGYE 2FQDA 3QPKA 3T6ZA 2Y1AA 2XV3A 1PNDA 3IN2A 1XB3A 3CDZB 1DYZA 1MG3C 2IDFA 5AZUA 3T6WA 4P5SA 2FWLB 4NERA 3EF4A 2HZHA 5TK2A 2IWEA 1JZEA 4DP0X 2IDQA 2VW4A 2VSMB 4A66A 3FU9A 1E67A 4GY4A 4QKTA 1BQKA 2H3XC 3NSDA 3S8FB 1GW0A 2FJSA 4JKNA 1PCSA 2I85A 4RH4A 4YL4A 2UXVA 1B3IA 2NRDA 1BXVA 2PPDA 3NT0A 3QQXA 6PAZA 1TEGA 1AANA 3CVDA 4BK5C 1VLXA 5FC9A 2FQGA 4YSRA 1A65A 2GSMB 5D4HA 2IDTA 4YSOA 4DP2X 1ZIBA 3T9WA 2GBAA 2X87A
chains in the Genus database with same CATH superfamily
3QUGA 1MCJA 1PX4A 1UZGA 4L3CA 3VI4E 5F2FA 3GMMA 4U7MA 3M86A 1UA6H 1L9SA 1J1PH 5B38A 5GGUA 3SGEH 4JO2L 2D2OA 3CFCL 1XV8A 4V1DB 5C2UB 4Z7WB 1J5DA 3N0AA 3PP4L 4PV8B 1B6DA 1MCRA 2WLNA 5HYEA 3THML 3BN9C 2BNQD 3OBAA 4JZJB 2H3KA 4WWKB 4LBEB 4QRPD 3IAQA 4Y1AE 4OZHF 1KV3A 4KU1A 3MRBB 3H1ZA 4UQDA 4BH8B 4X6EB 4F92B 1D2PA 2E47A 3MTXA 3MZTA 4G8GB 5DD1H 2IGTA 3BP4B 3L1OL 5AYTA 5IBUB 2JCCF 4R83A 2ED9A 1ZVYA 4LRIC 1BQHG 5FYKE 3LIZH 5C3TA 3RUGE 3L5XL 1F6AA 1D5MB 2NUPA 3FTGB 3HRZC 4KTDL 1ZA3B 1P53A 3U9PL 1TYEB 4TUOA 1U3HA 3MOBL 3P9LB 4OZIE 1UKTA 5KSAA 1HWHB 2RR3A 3RB7A 1FORL 3RJDA 3U4EA 2J25A 3OZ9H 4GKZB 2G60H 4PREA 4Z1PA 4HDIB 4HUUB 1KPVB 2FR4B 1OF0A 3FUDA 2VDQL 3Q2VA 5EO9B 1FAIH 5DJ2A 4OKDA 4AYDC 32C2B 4UOZA 3WHE0 5E2TL 1EZLA 1VDGA 4H8UA 5TF1H 1SY6H 3MNZA 4KUCD 3U0PA 5DEZA 5EIIG 2A4ZA 2DWTA 3ZBMA 5E00B 5KS9A 3KPRE 4XN9A 5TGBA 5IM7A 4OFYA 4HKZA 2BP3A 4HKBB 1IL1B 4RZCB 4JHZA 4UYPA 5D2NC 3VXQA 3EYUH 1OKEA 1KTCA 1RK0B 1OQXA 2LAGB 1CZ8L 1NOFA 3IWVA 3KNBA 3PXHA 1KB5A 3ROOB 1XZ0B 4GIOA 4WV1A 1BFTA 4HBCH 3MV9E 1FYTD 3N43B 3Q6GL 5FW8A 1TETL 5I8CB 1PZDA 5D7JC 1T7WA 3LKQB 3WTUA 3QUXB 2DLHA 4MMXB 5D72H 3NIGE 4ERSH 3OB0H 5AVRB 2FGZA 3O2DA 3MCG1 1JNLL 3CC5B 4GKSB 5AAWC 5CBEB 1QLFA 4HYTB 5TDOB 1URLA 2VQTA 5DFVD 1E2WA 1NAML 4FI8A 3REWA 3OMZA 2XN9D 1V3MA 1TLMA 4LCWB 5BV7H 1YDPB 2HT2C 3GB7A 3RAJH 2AMGA 3D85A 4KQ3L 3L13A 3WLWD 3C8KB 4MS8D 5F7FA 1CXIA 3PP3H 3CLFH 4PRID 1TTFA 4WO4B 1AC0A 1AMXA 1JPFA 4MD4A 3QR1A 2A9AA 1DSFL 5E1QA 2W0FB 1EK3A 1KBPA 3ILPA 4KUZL 4HC1A 3ARBD 2LU4A 1FGVL 3IN0A 4XMWA 3T0DA 1AGFB 3EYVA 4MD0A 2G5BB 4UV7L 3EYFB 3CSTA 3OLIA 1BXAA 2X3BA 3KPSE 4OGQC 2CIIA 3GXMA 4AVIA 5IB4B 3KYAA 5IBLD 2V33A 2XVGA 5GRJL 4QO1B 2YR3A 4GXVL 1AZUA 5T3ZL 4NNYA 1N59B 3H54A 4TSBH 1JCKA 4X4ZA 1JGLL 1TCRB 3Q5TA 1AZCA 4HX1B 3PFQA 4OF6A 3I75A 1BGXH 4BHUA 3BZDA 3HHRB 3WEBA 4OLEA 5F0PB 4BRVA 2FYYB 1FNLA 2D3LA 3QE5A 3EJCA 4M5TA 3JV4A 3DVGB 1JZFA 1U93B 3VMPA 3O9WC 2YPLD 4LGPB 3PF2A 5KOVC 2CCWA 3T8VA 4N86A 1NSNH 3LXCA 3B2VL 2FEDC 4RISH 2DMCA 2VDOB 5L8KB 3CFJA 1MCHA 4E5XB 3SPGA 2WXLA 5A7EA 4ANUA 4HQQL 3RIAK 1AACA 5AVVB 2DI9A 1COBA 2O5NA 1Y07A 4L05A 4DF9A 5ABAA 2I24N 3RWGB 1GY2A 3FO0H 3S88L 1VGEL 4M6MH 5E4IA 3QCTL 2E9GA 1AHWB 3GJFH 1HXMB 2ZWZA 4MAZA 2GTWB 3TO4C 5KBDA 2HMIC 2FJUB 1U95B 4ZMYA 1GS6X 3O3EA 4L1LA 2PW2A 4W9ZA 1U2CA 5C0CA 2AJYH 2NW3A 4HIHA 4P46C 5JHLA 3O6KH 3UFIA 2UZXB 5JQIB 1JTTA 1K2DA 1B0WA 1IJNA 5A40E 4CJ1A 2R4SL 5JZ7D 1MUJB 3MRMB 2Z4TA 5ESAB 3GKWL 1FH5H 4JO3H 5EU5A 3W39B 3MJGX 4ZX6A 1MJUH 4BFBD 2EDDA 3ARFB 4RA3A 5B3JE 1VPOH 3SGEI 2WBJB 1LK3H 1G7IA 1QATA 3G5XB 4NPYB 3D30A 4N25A 5FGBC 2JELL 4LCYA 1A1NA 1JPST 2NY1D 2FVNA 4GRLB 5IEKB 3FO9B 2KL6A 2YSSA 4L48A 2QPUA 4W9EC 2QSQA 2P5WE 4LOEA 5AAMC 5DFAA 1HXYA 1JG9A 2XWRA 4HWUA 2P24B 4S10A 3N9GL 4Y5VB 4BXVA 1RFDH 3ZZSA 1OF2A 4IDJL 4LSVH 1UM4L 4OCRL 4ZK8A 3S3PA 2CJUH 4BD4A 5L6YL 4ONHA 4MNHB 2XV2A 2R0KL 3ML8A 4ODSH 4QRQA 3DMMB 1MCQA 5AVZB 4MJIE 2VMEA 3E6HA 5AW2B 3QZWA 2GIMA 5DUBA 5I1EL 1MLBA 4UOJA 4OLXH 2ORBL 4YOKA 3JZ7A 3KYKH 5E24E 1BIIB 5HI5C 1ONQB 1T5WA 3FYEB 2WCGA 1NGYA 4MJ6B 4UANA 4OJCA 3U2IA 1PBYA 5CN1A 1HH9A 1PY0A 1VFBA 4XMPL 5IFJA 1ED3A 3BUDA 2EXSA 1FPTL 3LIUA 2AEIT 4Y88A 2OZ4H 5I1LB 3KPMA 4TUUA 2HTKD 5DZVA 4FQ2L 3K80A 3MJ7B 4HUKB 5B4MD 1HQRA 1N68A 2PXYB 4V2CB 4UQ2B 4ALAH 5HYJB 4WU5B 4YHZH 4YBLC 3GM8A 4L4VA 1HTYA 3PNWB 5K1JA 4UDTA 2PR4L 4FQHA 3DGCR 1JVOA 3FB7B 3HNVH 2DWSA 2DMKA 3JTTB 5E6ZA 3SYOA 5IJCC 2AXHA 4CNIB 1G7LA 2X4TB 1KCUH 2YPKA 2YRZA 3GNML 4G8EA 5DHYA 5LCVA 2OYMA 4P23A 2NY6C 2WV3A 1I7TB 1E42A 3F64A 4GJTB 2DWEB 1AQKL 2GI7A 1AD9A 2CHWA 1R3IH 3OC8A 6FABH 3LRMA 4K9EH 3G5YB 1BQHA 4M8QA 3WN5A 4IBZA 1TO5A 3LEXB 5AYUH 5KANI 1XF5A 3BH9B 3QORB 2MKWA 5L9DH 2WINA 2PPFA 3AACA 1PIGA 4MWFA 3PXLA 1G43A 4OCWH 4JB9H 4OIIH 3S5LB 1XTMA 43CAB 3F58H 4C83A 1RK1A 1OAKL 1XGUA 4NNXB 1RMFH 4OD1H 4P99A 5E4AA 1K5NA 3GBEA 1BJ8A 3BHBA 2OJZH 3SJVD 4F93B 1H3PL 3NZ8A 2R2HA 5AKVA 1MFCL 2PYEB 4JZNA 2XWEA 4HS8H 4U3XA 5EIIA 3GZKA 2VC2L 4XP6L 1HU8A 2A5UA 1ZA6B 3GT6A 4J39A 5GGRB 1GY1A 2XSKA 1AS8A 3T6VA 3KH3A 4EI6B 1B6UA 4U7SA 3FQWA 2DTMH 4F7CB 3OR7A 3F01A 4MSWA 4U3HA 5T5FL 1RIUL 5DS8A 3L4VA 3QIWC 3Q2WA 3UYOD 2E7HA 1AKJB 3VFGH 3CK0L 4O9HH 1E3XA 4YHNB 3QXVA 1RZFL 2FX9L 4HXAH 3NZHL 4P9ML 1MQKL 2WSDA 3KDPB 2DQIL 5AB2A 2Q7YB 2O5XL 2ZKWA 3VGEA 1DQML 4PJCB 2JFCA 1UXWA 3VFOB 1DL7L 3CH8A 1CBVL 2Q76B 2VDRL 4WW2C 4EF3A 1F4XH 2CIKA 3QUMB 1E30A 1T21A 2WOBA 2OL3A 5CZVL 2VM3A 3NESA 3ZJAA 2EIDA 4HP5A 5JLZA 1I3RA 4E42B 2FLMA 2K9FB 5EA0L 2BIMA 3OXSA 4GEIA 4Q97A 3MGOB 2RJMA 4DN3L 2H26B 5DLML 5K69A 1EO8H 3MLZL 2NUTA 4F8LA 4XNYL 1DJSA 3WUZA 4I18C 1ZRUA 4PRPB 4XXWC 3ET9F 4L8DB 5CHNA 3TZVA 2CPUA 1RPQA 2X6AA 1DQJB 3D25B 1IQDB 1TNMA 3ME0A 5CWSB 1S9KC 4OTXH 3GYRA 4NO0B 4YDKH 4TS6A 1UXLA 1JZ8A 4OJFL 4P06A 2VT0A 3QJFA 3HR5A 3T3PE 3AG4B 1IB5A 2ZYIA 4RGND 1OE3A 1EV2E 3G08B 3HAEB 2HJFA 4AGPA 4G8GE 2FT8A 2GIXA 3O6FD 3FBQA 3KL5A 1MSPA 2Y1ZA 1KGYE 5DD5H 4M48H 4LEOB 4AIOA 3LQZA 5KYYA 3WTYA 3SDDB 2Q8AL 4ZMOA 1IM9A 2VUOA 4M7LL 2HFGH 3F5WA 2V2XB 3M7OA 2XETA 3Q9QA 3T6WA 1FGNH 3QZPA 5JTWA 1K9TA 1OAQH 4OGAC 3TV3L 3B9KD 4L5FE 2NYYD 4UDUB 3GSXA 1BBDH 1TQCB 2VW4A 3HS0B 4X8JB 3BN3B 1SDAB 3V55A 2MQCA 5HD8D 1NUDA 1Q94B 1E67A 4BGDA 5FGRA 3WCYA 3D1MC 1CR9L 1BMGA 1UWGL 1Z9SB 2QADD 3DSFL 4HU8A 1OWWA 1PDKB 1XX9C 1JF6A 1A3RH 3I6KA 4OGXL 1D5IL 1SOSA 3HNSL 4B53A 1WTGT 1K6QH 1XCXA 4N2FA 1TEYA 2IFGA 2ZX7A 4U6HB 4KXZH 1I85C 4WCYL 1W8NA 4AC4A 4DEUA 5HDBB 4ATWA 1BEYH 3ZDZB 2NTSP 1SM3H 5IGXL 2ZAHA 1AMYA 1QWUA 4TUKL 1NFKA 2AK4B 2R29H 1JFHA 1SBSL 5IHWA 4L3AA 2L7QA 1NCWL 5IV2B 1TVDA 3ECBA 1BVNP 4LASL 1C9SA 5JNYB 3WKQA 3QJHB 4ZS7L 4OLUH 3T2NH 3NJJA 4QRRA 3D0VB 4HJ0C 1VSCA 1KT2B 4FQIL 2XFGB 1Z9NA 1N5AB 4K15A 4G80B 5DC9B 2QR0A 3OWRA 1FA4A 4GO9A 2F15A 3G6JF 2VAAA 1KIRA 5H2BA 3SODB 3SYAA 3STZA 3SDAC 2PO6C 5C71A 5IHHA 4PAZA 2WZAA 1ZPUA 5K9KB 4KKCD 4PHXA 4YPJA 4EZKA 5DVPA 5IB1A 1CE1L 5D1ZA 4M1CC 4X7SL 4LEXL 4BIKA 4AW7A 1G94A 1HSBA 1MCOL 4OT1H 2VN6A 5DK0B 3VD7A 4XOCA 3PWPD 3MNDA 3DTXB 3Q3GA 1GGTA 4Y19E 4HIEA 4ZO6A 3VFSB 3W57A 5EOQL 5GGTH 1KGWA 2WUCH 4L4TD 5HYSB 4CU6A 5LDSA 2VW7A 2XICA 3TXAA 4L4JA 4XTRD 5SWSD 3WNOA 3PHQB 3KW8A 2YGPA 1ZS8A 3FCTA 2B4CC 2FSEB 1QWHA 3RQ3A 1CLOL 3FUJA 5F7LB 1ORQB 4ELMB 3L7EB 2DQGL 2XJKA 4OZFH 1S7VB 1X3DA 1BYNA 4DK6A 4N6RA 2WQWA 5ITFB 1YAIA 2XA8L 3WHXA 1OAXL 2NY2B 3CZSA 3ZXAC 1J9RA 4Y8AA 3BSGA 1LO3H 1XD1A 4ZO7A 4K5MA 3VGAB 2NZ1A 3BZEA 3AXHA 4KXBA 1N3NB 4OZHA 4Y5XA 3KLHC 1UZ8A 4AENA 4WFED 5CN3A 1SN0A 2X40A 3DX0A 3QDHA 5DT1H 1TSHA 1QX1A 1NMCC 2JCCA 5GPRA 4OQTH 4LLWB 3MJ9H 3QZNA 5DK2A 4BWTA 3FSZA 5D1XB 2I60L 1XCTA 3OKDB 3DC0A 3O45B 1M7IA 1PG7X 1H0DB 4PJ9B 5I0XA 1X5GA 4YFDB 2E4FA 4FFTA 2G2NA 3OZLA 3QUYA 2W07B 4WUUE 4R2GB 1DE4B 1UCBH 4TUJB 1TTAA 2CBTA 4UZGA 4WI2A 5IUSA 5DWPA 4IRJA 3C5SA 3S34H 3TT1H 3MA9H 4M8VA 2W8CA 2RQ8A 5CR1A 2VITB 1ZT1A 1ROCA 5BZZA 2R0WH 4PCKA 4YGVA 3JWNC 1G7JA 1OO2A 1RJLB 5DRXA 4P2OA 3WKNA 1I7ZA 1VKXB 4CVZA 1K4DB 3QJVB 4Y16C 5ICYA 4HCRH 1R34A 2ZOKB 1BXUA 1QACA 1FE8H 4G70B 4PJIF 4XPTH 3I3BA 4ZFFA 3PQYA 4X98A 3ZDXF 3QULA 1ZMYA 3Q0HA 1U33A 4DVRH 2J2ZA 2R1WA 4KK6C 3VWJA 4WJ5A 1MNUL 2QTVA 4PCYA 1FFNB 4MAYA 2FJGB 4PLJD 3UTTD 1HHJB 4HWBL 2BJML 3GMLB 3I85A 3IETB 4NPKA 4OLWH 4R26L 4WFHE 2XG5A 1R5IB 1MPAH 2NDFA 3FBKA 1E7VA 4Z7UF 3LDBC 2WK2A 1TMQA 4XP1H 3CZUB 5KVEE 4LSDA 1BV8A 2CGRL 5DUPL 2J8UF 1A0QH 5FKPB 4XP9L 1VJSA 5F7BA 2A1WH 1CLZH 2Q5BA 1Q90A 4QF1A 4PJHA 4YHYC 2GHZA 2R69A 4CGUB 3BPCB 1HIMH 3K72B 5DO8A 1WBXB 4DW2L 3PGCB 4PG2A 2RA1A 4Z78A 1AGDA 2E9BA 2VLJA 3IFLL 4DNLA 3BAIA 1NCDL 2GEEA 2WB7A 4OVVA 3IDJB 3ABZA 1CFVL 5FM5M 1S7SB 4ES9A 2CZNA 5SWQB 2QQLH 3BVNB 5FA4A 5CFHA 4JZJC 2IH3B 4WWKC 1A1MA 2EZ0C 3CQQA 1V7MH 2V4LA 2WM0A 4BSJA 3QQ4B 3LRSA 2VJ8A 1H8OA 2SEBA 1FIGL 1F3RB 3QPQD 4OLZH 2IH8A 3F3HA 1T3FA 4YBQC 1ZIAA 4NP4H 4PBVC 4CILA 1GYVA 2G3ZA 5LDUA 5EBLB 1BMWA 2X6CA 1X4YA 3NEEA 1QSFB 4GPVA 5HYJE 1YN7B 5CP3H 3EO9L 4KJQC 5L2JA 4A7GF 2R7EA 4KXZI 2AQSA 5C1MB 4BRJA 3FT9A 1KMGA 2YPVA 3G6DH 4F33A 4KO5A 1IAIH 3TBYA 4XX5A 3V5DB 4ZFGL 3PV6B 4PJBF 4UQ3B 4GRWF 4N0YL 4B9YA 2ODIA 1C12B 4ODTL 1FZJB 5IKCA 1YMMA 1ZV2A 2OBGA 3T0BA 4KMTH 4U7KA 1A2YB 3TPUA 2XQBL 4CN4A 4MA1B 5C6PB 4CA4A 3WFCL 1E4JA 1IC7H 5HYQB 3VACA 2DM3A 2F53A 3PAYA 2NSXA 3UZQB 9CGTA 4FQQA 1KTDA 1HHKB 4HBQA 1EAOA 3WFEL 3WJJC 1PZCA 1YPZB 2X3CA 1Z66A 4PJXE 5E6IA 2ZXGA 1TKWB 4L5FL 5A2FA 1ACCA 4ZTPH 1D7DA 4X5WA 3TNNB 3QUXC 1RQ5A 4MMXC 4WTWA 4H26B 5HDWA 4O02B 5F0LB 5EPMA 4E68A 2AEWA 3MRQA 1CFBA 3FFDB 4JRXB 1T0NA 4MXWH 2HKFH 4PGBA 4X0KB 1QI4A 4H0LC 4FADA 5LXVA 1OY3B 2PYEE 4U1JB 1NDTA 5H35A 5L2KD 5I66A 4AX3A 3ULVC 3I9GH 3OAZH 4RMTA 1DBBL 5C6TL 2A99A 2BNRB 1KACB 3IJSB 4JPVL 3BIKB 5F1NB 5J3HC 5KVDL 4BQ9A 1BOYA 1E7UA 1IBGH 5EZOH 2CKBA 5E95B 3HC3L 1E9QA 4L18A 1J87A 4MZRA 3BFWA 1UTDA 4G42A 4ZOAA 4I3RL 1O6SA 3IKKA 1N8OE 4F5CE 4WO4C 4JK0D 1IGJB 1L5GA 2FWOB 4LSTH 3LPOA 5GZNC 4G6KH 4TOYH 3HOGA 1LM8V 2AEOA 3QRBA 3T4YA 4Y2NA 5SX5K 1IU1A 1DBMH 4ZTEA 4JFDE 1QLEL 5B1KA 1N18A 5HHXH 1ESOA 1XZWA 2EYRB 5F93C 4O00A 4WI3A 2NW2A 5DYFA 4WW2F 2G75B 4G6JH 4HWEH 5L0QB 2J43A 4F37F 1NMBH 1P4IH 3K46A 2DBLH 5GRUL 1A6ZA 4PJ5B 2ZT9C 1EPFA 4A39A 2JIXD 4EDWL 2EDOA 4FKKA 1JXDA 3FQXA 2CNZA 3BGMA 1MAJA 4R84A 5JXEC 1QR4A 3PJNA 1JN6A 1HINH 1MFAH 2OTWB 4AW4A 2YKLL 1JNJA 2BOBA 2J44A 2VR9A 4JM2A 1EGJA 2OX5A 2ICCA 3QUZC 4P57A 4O51B 3ARGD 3HI5L 1ZJBA 1RXLA 1A9VA 2IBZY 1SLWA 1T6WA 4WHYG 2RALA 5A2JH 5CJQL 4JHAH 4PRNA 4YLQT 1CDBA 5MP6L 2DQEL 2OMTB 4JFHD 4PRHA 1T4KA 4LLQA 5FA3B 5TPWL 1DBJH 1SJHB 2MEJB 2NY0B 3LN9A 4JR9L 3CXDH 4JQIA 2Z65C 1DJYA 4F2EA 3KCPA 4FZEH 2VXUH 4HKXA 1EVTC 4FYTA 2BHUA 5DD3L 3N42F 3CVBA 5DZ9A 1D9KD 1DZ0A 4I0PB 3C08H 2VXQL 1AHWC 1S78D 2BVPB 3KHOA 2WZ6A 4U0RB 4JAMB 1OP4A 2W65B 3EG9A 4NQVA 4PRAA 5E6UB 4JANB 4NC2B 5FEBA 3SDCB 1SYVB 4CN6A 1M42A 4L9LB 2OXGA 5F6HI 1IM3A 4XNQB 2UYLB 3IU3B 2W9LA 1MXDA 4ZMPA 3LS4L 5IWLC 3HLAB 4WGVB 3DOHA 2WQ8A 3JV0A 3HZMB 3QXAB 5D9SB 2ZCHH 4B60A 3CHQA 2AQNA 3SZ6A 4K55A 5AENA 3FAXA 3P0VH 5JUEH 4UINH 5CNHA 3N0PB 4LSUL 2ZX6A 2P3YA 4X7EC 3CHPA 2VLRE 3WUWB 2AJUH 3ARFC 2X88A 2WXQA 1F1GA 3NP3A 3QO0A 1AD0A 2WBJC 2ZIDA 1EO5A 1SYSA 3VB9A 1Y18A 4H8PA 2C3VB 3EHBD 4HISA 2L7JA 4FQXA 5BJTA 5KN5A 3HMXH 2OSXA 2I07B 5AVYB 1QOKA 1D5RA 1M2VA 2Y6TE 5LB1A 1RL1A 2DYRB 2XZAH 1BZ9B 4HJ1A 4NQXA 4MNQD 1NLDH 2AK1H 3NACH 2FO1A 3DUSA 3QRGL 5FOBB 3GHEH 4FMFA 2XRAL 2WQSA 3B83A 3DMMC 2Q6WB 4QR7A 3ECWA 3JUZA 4I0KA 1EHLL 5BRZD 5DRWA 1X9QA 3BVUA 3QHTC 5C8JA 4ESKA 1DJZA 3S97C 1EFXB 1PZ2A 4I9XA 5D6CA 4NO3B 5DJZB 2AI0H 4JREB 1ETZB 3L1FA 1HCZA 4JE0A 2H3NB 5F1SA 3GZPA 4JQXC 1MFDH 4G6FD 3LQAC 5LAPA 1U6AH 3F85A 4P9HH 2YEQA 1TT6A 1WZLA 1S9WA 4FXTA 5F96H 4DGYL 5K9JL 3RIFK 1FFPA 1W0VB 4A2EA 1IAII 1Y0LA 1ADQL 3WNIA 4L8BA 4OUUA 2X4SB 2XKSA 4CADB 3ARDB 1OAUH 2DW5A 3SKNB 4B9JA 2PXYC 5DVMA 3RY4A 2ZX9A 3BUTA 1FBIH 3PU7A 5K39A 3AY4C 3W0WE 3ARWA 4NWUH 3T6ZA 3UJTL 1TZGH 3C8DA 1ZGLB 1SJVA 5F21B 3LKRA 3GBML 2OJEB 3GPSA 3Q2CA 4OCSL 4RNRB 3MV01 1UACL 3EBHA 4JG0L 4KNQA 2HZHA 4ODHL 4N8CH 1FVCB 3QDAA 4QHLB 1UVQA 1ZV5A 4LLAA 3L9BA 2WYTA 4A66A 2VKXA 3TA3D 2ALWA 1IE4A 4CBZA 2FX7H 3FQRA 1F4AA 1U3NA 2H3XC 2ZKMX 4ELME 1KEGH 2OTUB 2EEXA 2NSMA 1RIVL 1IT9H 3GD1C 3ZHNA 4YL4A 4Y2DB 1UD8A 1WEJL 2PETA 1RUML 3WEXA 2ZWYA 4YDIH 4XE5B 2BSTA 1CFNA 5FC9A 1ZHNB 5D4HA 5AL8A 1OQOA 1S9XB 5DQDH 4X5LA 3QORC 5E4EB 2Q87A 4FNSA 4H25A 3EFDH 3S36X 4RCAA 1T4WA 3VXUA 4EI5D 2Z34A 3VXSB 4Z7IA 3DGDA 3ISYA 4G59C 4FKEA 4LRIA 4TVSa 4W1TA 4NJAL 4ZOBA 1CFTA 1UB5A 1MXGA 3HRZA 4P2RB 3QH3B 5D4IA 2Y07H 3T1FB 4ZZFA 1XR8A 4ZPTB 5D1XE 3VSQA 3EJZC 4RAVB 3EJTA 1F4YL 1OPOA 4XO8A 4Y1TA 1FL6B 4KJPD 2YMTA 2YWYA 4ZX5A 4MZ3A 3VVWA 5E8EA 3SO3B 2HH0H 1DEEB 1M6OA 4J3SA 3FQUA 2HFEB 4G7RB 5C07D 4ZUUA 4R90L 3DX8A 3S35L 4RRPM 1GGCL 2F5AL 5HI4C 4NQQA 3H9HB 4KKZA 1II4E 4AQAB 3X1GA 2GYSA 3WFHA 5D2NA 2K6YA 3NVQA 3QISA 1IGYA 4K7FB 4R7DB 1KJMA 2RCSH 3HNTL 2BOCA 1KN2L 1LNUA 3A6CL 4KK8C 4QRSB 5FDWA 2RAMA 4ZPVA 3ILQD 5E5MB 4QOKD 4QJ5B 3EIFA 2AV1A 4YH6A 4HUMB 3RYMA 4RDQG 1T0MB 2NNCA 1MW3A 5J11B 2FTAA 4RX4D 2AP2A 5D7JA 3VGFA 3F6JA 1F58H 3FFCD 2H1XA 3DETC 1SJEB 2VW6A 1I7RB 1VFAA 1P7QD 1O9ZA 2ODHA 1JHTA 3SPJA 5AAWA 2DY2A 4QGYA 4FP8H 1INQB 2XG4B 1BAWA 3GSVB 3MBED 3Q6FB 3QFJA 3UJJL 1NCCH 2HG0A 4KKAD 1DUZB 1RKRA 5I6OA 2UXGA 3LNIA 4KROD 4Y4FD 3T77B 1CWVA 4JPSA 5CMAB 6PCYA 4E9XA 4X9FA 2VLLA 4G8AC 3F7VA 5TQ0L 4OF3A 4A2LA 4J1UA 1IKFL 3FT3A 5M95B 1ES0B 4LOUC 4A55A 1MEXL 5ITBH 3A6BH 3BKJH 4XCCH 1NC2D 3SE9H 3IJYA 1MHCA 3CDZA 1Q9WB 3VDAA 4DAGL 4YE4H 2X0UA 3KLLA 2VB5A 3D9AL 1CGVA 3LZOA 2P8PB 3QXDA 3IKCB 2EH7H 1XF1A 2DYPB 1M1XA 1CXEA 5J9PA 1G6RB 3EUUA 3KBEA 3HMWH 3HUJF 3E6FA 4XP5L 1PYWB 3IGAB 2IAAC 1OE1A 5BUAA 1AIFB 4QHMB 1C1EL 4OJAA 3SCMD 3SDDC 1S9YA 2QKIB 1IAKB 4DGVH 3P3TA 2VR3A 4PJFA 5DZPA 4OFKA 1NKOA 3BUYB 3HEIB 3CHSA 4G5ZH 4GLRH 3SQRA 5FCUH 4YHML 3H6JA 5C9JB 1M57B 2GBTA 2KC0A 4XN7A 1TQCC 1X5JA 3ES6B 2Y7QA 4Y4HD 2XYBA 2DB8A 4AE1A 5DHVA 1XXDC 2VABB 7PCYA 4OSUL 2VLME 3ZE2F 2WIIB 1TU2A 4LL4A 3BC9A 5K93A 4PCTA 4NKDB 5GS0H 4F9PC 2XIBA 2BWIA 4LAQL 4QEGA 2G3XA 4JFEE 4F8OA 1XH2A 2ICEB 4PWHA 5I5MA 2VJXA 5E99L 2QSTA 5I73B 3TO4A 3EXLA 1LEKB 3PHSA 2RACA 3L95B 3QEQA 5JO5A 1BMZA 2DEXX 5AKRA 4FNLH 1J5CA 3CVHL 2APXA 5LAXB 4FQCH 4LLMA 4Z95L 3MXWL 2C1PA 5EN2B 4C56B 5A2LH 1JSYA 1OW0C 5CIPH 2EXTA 3UG3A 1Q1PA 3OKLA 3VXRA 3G6JE 4WKXA 5DWUL 1VF5C 2FECI 3IFOA 4JRXE 1GC1C 5IBTH 4Z3EA 43C9B 3INUH 1XIWD 5E0FA 1GZQA 4HZ1A 4DH2A 2IGFH 1JXKA 5IOPA 3FCGA 2BNRE 3BX7C 3MRNB 4ELKB 5H37H 2R2EA 3CVIH 4KNTA 1BF5A 4N87A 5FGBA 1WZAA 1N2RB 1HHHA 2YA0A 1BZQK 1N64L 4K0OA 4J8QA 5AAMA 3BGAA 2GCYB 4PY7B 2LVCA 1DN0B 3O3BA 3GLAA 3VI4A 3V9EA 1L7TH 8CGTA 1QRNB 3Q5OA 5LKNA 5JW5A 4ACTA 3ORJA 3VU2A 1A25A 1AR1D 1RZJC 1SLUA 4WNJA 4LHUB 5CJXC 2XLLA 3HBZA 4JKWA 4RAHA 1PD6A 5C0AA 2A9NH 1GOFA 4JFXB 3U7AA 2NY2C 3STLB 4A2HA 1SFHA 3DGGB 5DYOB 5KYWA 3T2QA 1MAML 1MFVA 2ZG2A 4UTCA 3I9IA 2QHRL 4DOHB 2J5LB 1D6EA 3M1OA 1T03L 2DI8A 3X1BA 2LLNA 4N90D 1MCFA 3G5ZA 3W38A 3RUGA 3D69A 3EJYC 1LE9A 4R7XA 4GG8A 5T1KB 1XEUA 2UXTA 2XPGA 2PWGA 2H5UA 3BH8B 3O3UN 3FTSA 1UUSA 4QCIA 5D1XC 1FG2B 4V2BA 4HIXL 1AJ7L 2Z31C 4E9VA 1Q72L 3F84A 2CLRA 2MKLC 2YD3A 4PJ9C 3VWKA 1Q9KB 2HT3D 4LXFA 1ITCA 1RURL 3NYKA 2E0PA 2H2SC 4FABL 2JKJA 2IWFA 4M61A 4R2GC 3EYOB 2R1YA 3UCQA 3WFDL 1KCRL 3LB6D 1KXQE 5L4MA 1MJ8H 1BVKB 3TN0B 1PG7H 3LTVA 2DMBA 1ULVA 3H9YA 1CLYH 4QTFA 2XNAB 4NYLB 4KNSA 5MEQB 1M05B 3AQXA 2ZOLA 3TIEB 4LE8A 3QG6B 2EICA 4WEBH 4XNDA 1T89C 1H3TA 4PJIE 2MOGA 2UY6A 1I8AA 4Q8BA 1YEIL 3F00A 4PBDA 5L4JA 4JFOB 1EXUA 2Y3AA 1XGQB 4FXGB 3RFZB 4QRPB 5JIIA 4FFZA 1QBLL 2ED6A 3RP1A 3NCBB 2YD8A 4OM0L 4XPHH 4IMLB 1JV5B 3VRIA 4BFNA 4Z7UE 4DHLA 2F7PA 4ABUA 3PL6B 1RHHA 1I1YA 2J8UE 3PGFH 2F5BL 3H56A 3RVUC 2BSEA 2AF2A 2IBGA 4M4RA 2Y06L 1YEDB 1HQ4B 3RWHB 5FYLD 4JY6A 1AGBB 3DK0A 1G7QB 1R24A 1CU4H 5DRZB 2XWZA 1JDDA 4ZYKB 3P3SA 4IEFA 5IMKB 3GSNA 2F8IA 1F6LL 3HZKA 1OSZA 3QIWA 2RFXA 3HN8A 5E9DB 3HPJA 1TJIL 5I30H 3K6SB 5E2VH 2J12B 1HILA 4BFGA 1XBRA 4MCZB 3OKOB 5JORA 3VXMB 1BLIA 1KELH 4JDZB 2ZAIA 3VQ1C 1GYUA 3KPSA 5MEND 4JY4B 3NRPA 4F37K 1C16B 2DWXA 5DDHA 2V2TA 4GLRI 3LKNB 1JZIA 4YHKL 4W9IC 4OFVA 4JO2H 1FYTB 5M7QA 3DOSB 2W5PA 3CFCH 4K8RC 1HEZB 3PP4H 1FO0L 4G43B 2HVKB 4ONFL 1BVLB 3THMH 5CZXD 3EH5B 1HYSC 2UVFA 1KCLA 2W59A 2QSVA 4Z0XB 2ITCB 3X1EA 2B5IC 4AEEA 4PGDA 4NWTL 3BGFB 3L1OH 1J8HE 4KXDA 5CZRA 2ZWSA 4IYKA 1OGTA 1NWPA 3L5XH 3IF1B 2AXWA 4KTDH 2Y7OA 4Z3TA 2ROYA 4PMEA 3U9PH 4A7UA 4I18A 2VE6B 3MOBH 5DMGD 3BUQA 1FORH 4AYGA 4OCYL 3SEPA 2DI7A 5CJOL 1VADB 5EO0B 4MA1C 4PRIB 3RKDD 2VDQH 5IFJB 4QNPF 3FU7B 2QV2A 3D0LB 2CWRA 1FG9C 5E2TH 2XIDA 1TMCB 2XVKA 1MDAA 3K6FA 3DUHA 2YD5A 3OKNB 5EIVA 1HNFA 4ODWA 3WEMA 4G9FE 4QWWC 5ISZA 4RMVA 4MXQC 3CFEA 4NO5B 2UZYB 3WENA 4PJ7E 2M26A 3QXTA 5JOFA 4P2RE 2F18A 3GRGA 2WWOA 2A6JA 1Q38A 2YGNA 3VH8G 3Q6GH 1DQVA 3IMSA 3TJHD 3BZ4B 2DM7A 1E0OB 2HUHA 1S7UB 2WAHA 1G0DA 3OLEA 1AGEB 4OZGB 3WMSA 1A3LL 4B0MB 5KYUA 1J9SA 2X42A 3WTVA 1GAFL 3SYCA 1A02N 1X4XA 3H3PH 1JNLH 4H1LH 2YUVA 2IAND 3L1EA 1HESA 5I17B 1I4FA 5ALBL 3VSUA 4GT7A 1I85A 4OFDA 1NAMH 3L8QA 4LDEB 4NENB 1EHAA 1XB3A 1Z3RA 5F3HA 1HCVA 3KBPA 2BIIA 2GK0A 1LTXA 1ZWIA 1ZLSL 4MJIA 3TWCH 3WXVL 4OLVH 5AZEL 1BJ1H 1MCEA 2TRHA 5GISL 4LT7A 1BLNA 2EO9A 4P2QA 2Z0BA 1SXZA 3II2A 3MROA 1GGYA 4ZDHB 4BK4A 2VDKL 3PYCA 4FNUA 5L0QC 3BIBX 2G5RA 3TH4T 4AK1A 1J5IA 5EN3A 1KF9B 3QDMB 2V9RA 3GJFB 4UV7H 1UB6A 3V95A 1M9SA 1YNTB 2YFOA 3O4LA 2X4NB 3QWOB 3SDAA 5C0BE 5G4MA 2X4QB 2FQGA 5GRJH 3QCVL 4JDTL 4GXVH 1QR1A 4YJZL 5T3ZH 3BVXA 4J3OF 2GITB 2FK9A 1CQYA 2VGLM 3RILA 1VACB 1JGLH 4PH8A 4AG4L 1CLCA 2K6WA 4PJEB 3B2DC 4ORGB 1A21A 1RZKH 5C0GA 1A64A 5FDYA 2G4EA 1JVKA 4JDEA 2APBA 1B4RA 3ZDWA 5T3ZD 2CJTA 5JR1L 3TEWA 5EEVA 3BD3A 2D7TL 2H1PL 1XT5A 1W72H 1XF4B 2DLGA 4G8IA 4J8RA 4LVHB 5EV7A 2DS4A 2NY1B 2XFXB 2PTTA 1D5ZA 1H3WM 1ZT7B 3BE1H 3BP7B 1MDTA 4HW6A 4HJJL 1AXTL 5C09E 4KC3B 4E5XG 3B2VH 2WCSA 3OJVC 5D71L 1DSYA 3NCJL 4MJ2A 4I0PC 4U0RC 5EZJB 3SBWA 3AQDA 5IG7A 4HQQH 3MUJA 1USZA 3UO8B 3BVTA 1S7QA 3CFMA 4L9LC 4YDNA 3VI3B 3DIVA 3GF8A 1NDGB 4M8RA 1VGEH 1KGJA 1CYWA 3BWAB 4NQED 3R8QA 4A2FA 4U3SA 2ZE0A 3QCTH 5C0DB 2BZ7A 3QRLA 4RMWA 5I6XB 1U91B 4WHYH 1XMEB 2DTSA 2Z1KA 3NMEA 1QSEA 1RUQL 2FSDA 3W56A 2YD2A 5JPMB 3H9SD 5E08L 3PHOB 1MWAH 5C0IB 1BOGA 4HS6A 4YR6B 4QUOA 2VLKD 1NC4A 3QWNA 5IVXE 3DXAD 1XSOA 3RWEA 3L3IB 1I8LC 1MRDH 4H0GA 4BQCA 3GKWH 1VEPA 1X9UA 1XD0A 5DRNA 1GZHA 3W9DA 4F7PA 2X1PA 3EBGA 3T2OA 1ROWA 2XXCB 1UZ6F 3A21A 4U2YA 5HJGA 3ZYOA 3FTZA 3CUPA 3PUUA 2JELH 2ADJB 1ORSB 5PCYA 3NJIA 1UFUA 3HLKA 1IILE 4P4RA 3SYPA 1RZIA 1KIQA 1X5FA 4Y16A 2X4UA 5GZOD 4XRCB 2ATKA 3N9GH 3O3DA 4C56E 3KCWA 4IDJH 4OCRH 1UM4H 3OKYA 4XBMA 5L6YH 4U4IA 4JREC 2N0KA 1PD1A 2R0KH 3BAJA 5HHVL 3D05A 3FN3A 2Y36L 1JWUA 4EOWL 2ENQA 2WXMA 2I26N 3IVKB 5FCSH 3ARDC 1J1OL 1RP8A 4XBPB 2YKKA 2MCPL 3RWFB 4XMPH 1FPTH 1I3VA 1HXKA 2Z7ZA 3FO1A 4FQ2H 5I6NA 1JZHA 2VDLL 1WFJA 3PGDB 2P44B 2VWEE 3AITA 4HH9B 5I5RA 4PWIA 3C6LB 3MBWB 4QGTA 5IOKA 3HHSB 4AMKH 3SKOB 1KCVH 3S8WA 4V1DA 3CGTA 2BVYA 2EE9A 2ZAGA 4Z7WA 2PR4H 4C55A 4PV8A 1EZVX 3BYYA 1MREL 5F7EH 3WY1A 3R06B 4Y2DC 2EH8L 4JZJA 4ZFOL 1KLUB 4MX7B 4WWKA 4LBEA 3GNMH 1MELA 1XGTB 1U8PB 4HJIA 1SXSA 2IIJA 1C7SA 3MRBA 1V54B 4BH8A 4X6EA 4I3SL 5E4EC 4G8GA 1AQKH 3BP4A 1X5KA 4DOHE 5JHDD 1B88A 5BS0D 5K59E 1H15B 4MBOA 3MPCA 4X8GA 4DPBX 2PR9A 1D5MA 2BS9A 2P5PA 1NDMB 3FTGA 3OVUB 1ZA3A 4PPTA 1EX0A 1QVOB 3ALXA 3P9LA 4ODVL 5A3ID 2ITDB 1Z2KA 3IM1A 5AB9A 4PUBL 1A9EB 2A9ML 4ORZC 2QGBA 4PJ8B 4GKZA 3K1DA 1IX2A 1C5BL 1K3ZA 4PS4L 4HDIA 4HUUA 1KPVA 3GXTA 4Q4EA 4Z76B 3FULA 2FR4A 2Q3ZA 5EO9A 3SO3C 1WGVA 3B7UX 5T1JA 2PPEA 32C2A 1O6VA 4NM4H 3NDYE 3V4VL 1KCSL 1ZEAL 5E00A 3S35X 1MFCH 4HKBA 4RZCA 1IL1A 5GGVL 4HA1A 1RK0A 1EHKB 3WO4B 2RB8A 2V0AA 2VC2H 4XP6H 3SQBB 2BSRB 2J55A 3ROOA 1XZ0A 1BWMA 2YJQA 5IEHB 3WJJA 4ZMLA 2H6OA 3UDWC 4KVCL 3UO1L 2EKSB 3BQUD 1WE5A 4NZ8A 3UG4A 5J11C 3MGAA 2BNQE 4FA8A 1TFHA 5I8CA 4IRZL 3DHPA 1JIBA 3QC6X 4DFIA 4QRPE 1RIUH 3LKQA 2OYPA 3SZKC 4GQRA 3KLSA 3QUXA 3JWOL 4MMXA 4RGNB 3MLXL 5JHMA 1H6TA 4ATTA 4BSVB 3RVTD 1RZFH 2JKXA 2V5MA 3CC5A 4GKSA 5G55A 5CBEA 5TDOA 3NZHH 4P9MH 4OIBA 1OCRB 1MQKH 3MNMA 2DQIH 1QA9B 3KJ6L 4LSPL 3VD2A 1MJJB 4Q9QL 3AGVA 4XN4A 1FNAA 2O5XH 1X6LA 3MFFB 1DL7H 4KO6A 1P5UB 3FTUA 3HZ3A 4LCWA 1CBVH 1YDPA 5FM4A 2VDRH 3SPIA 2A0LD 3LRLA 1OM3L 4H8WC 2E8ZA 1SF5A 1UATA 3C8KA 1GJIA 5CZVH 4WO4A 2QADB 2WN2A 1P4LB 5C0EB 4F7KA 4N1EA 5BNXD 2W0FA 2X2YA 5GZNA 4MQXD 4S1DC 5EA0H 2BY3A 2J1XA 1AQDB 1AGFA 3V6OE 3T5WA 2G5BA 2OP4H 3EYFA 3BOVA 5IB4A 1INDL 4DN3H 4W9FC 1JL8A 4AEFA 3IRPX 3CHOA 4KJYB 5DLMH 3PXJA 4QO1A 1HHIB 3MLZH 4QXGL 4XNYH 4N2AA 3D4CA 1FYTE 1N59A 4WWOA 4KITB 1XGRB 4WZ9A 1TCRA 2CMRL 3BCFA 4HX1A 3KEHA 4KHTH 3CPLB 3N1PC 3QO1B 3RZCC 2QMJA 3PY9A 4G6ML 4AK2A 1PTZA 5JXEA 4OJFH 1BWWA 2FYYA 2YWZA 2QKIC 5GSVB 2AAAA 4X5QA 5DS2A 2X0WA 2QGCA 3DVGA 1U93A 1U3HD 4IHBA 3NJVA 5KSAD 1WUNT 1LLAA 5ESVB 4MJ4A 3SE6A 1IV8A 4ZQTA 4KJWD 3MVSA 3EOBB 4E5XA 5CGBA 3ZE2E 2XN9E 4FLQA 1AIZA 2ZD0A 3HB3D 3X12B 2VUYA 3IMBA 4NQDD 1NPJA 3OQ3B 4I4WB 1KB5H 2A9CA 1FDLL 4OFYD 1AO7B 3RWGA 4YZFF 1TTUA 1EANA 1MHEB 3PWPB 1MCNA 1RVFL 4PRIE 1A4AA 3FH7A 2ICEC 3G7TA 4L4TB 3GSRB 1AHWA 4KH2A 5I73C 5SWSB 2GTWA 1CR9H 1UQSB 1UWGH 4XNZB 1U95A 2ERJB 1NQBA 5DEFB 3LN5B 1EDHA 2RQEA 4OGXH 5D7IE 1D5IH 3HNSH 3UG5A 4R5TA 2OMYB 3D34A 1OP3K 1WAAE 4BZ1L 5D8JL 2CBOA 4TL4A 4WCYH 4X99B 1A14L 5IWLA 2M8XA 2UZXA 3QVAA 5AD0B 2ZXWB 5EWIL 5IGXH 1A4BA 5A6IA 1MUJA 3MRMA 1KYOJ 4TUKH 5ESAA 5AB0A 1SBSH 1Q1JL 1UH2A 3W39A 3AT0A 3D09A 1NCWH 3IGLA 1AXIB 1G9ML 3ARFA 4LASH 4ZS7H 2WBJA 4R5VA 4UQEA 2PF6A 3G5XA 4NPYA 2YC1B 5T3XD 2YPLE 4PR5B 5I8EB 5KTEL 3ESVF 4A7SA 1WIOA 4GRLA 5IEKA 4UTBA 3FO9A 3AJ7A 3D85D 3LKOB 1KCWA 3HIZA 3B4NA 4Y5VA 3VXPB 2P24A 2HLFD 2J5WA 4R7VA 3J27A 5I1JL 3MLRL 1XL6A 3QQ3B 4MNHA 1CE1H 1BG9A 3DMMA 4KRNA 2W94A 4N0CD 4X7SH 4BSWB 5IROC 1DQKA 4GW1B 2CDEB 1MCOH 2CNYA 3QHFH 2NY4D 1BIIA 1NGPL 1U9KA 1ONQA 3RA7L 3DARA 4S11A 4AMWA 4PSRA 4MJ6A 3Q8CA 4NB7A 3DYPA 1DBKL 4F58L 1KIUB 1J0YA 4GS7B 3QQNA 5F7AA 3RY5A 3ULUH 2N7SA 1CLOH 3BMVA 5I1LA 4HFWB 1UWXK 2DQGH 2WVVB 2NXYD 1BAFL 2CLZB 2J5LC 3MJ7A 1KGCD 1NFDF 3FRUB 3TLRA 3VGBA 1LP9B 5SWZD 5IJKC 3F7QA 2PXYA 1G0XA 3U4AA 3ULUD 1Z9OA 4UQ2A 5CEZL 1OAXH 5HYJA 1JNHB 3AY4A 2MJWA 1SN5A 2B59B 3POHA 4PJEE 2WTPA 3CTTA 4WU5A 1W9XA 3PNWA 5HGHB 2DQDL 3AQZA 1BREA 3FT4B 4XNXL 3FB7A 2F54B 3QEGH 3TVMC 3JTTA 5CLXA 5EUOE 3H2QA 3UTZB 1U8LB 1CDYA 4CNIA 3OAYH 2X4TA 2J8HA 3WTTA 2BFVL 4PRBB 3J2PA 2WXIA 1I7TA 3O8XB 2I60H 1R3LB 4ZD3L 3KHQA 3TN0C 2LLGA 2DWEA 4YSDA 1WC7B 3VFPB 3FOLB 4W6YB 1B9KA 2Z93B 3HE7D 4Y4KB 1A5FH 4IBVA 5IQLA 2GJ6D 4HWZB 2CHDA 3GK8L 5EC1B 3G5YA 4EUPG 3WN6A 5I1KL 1AQ8A 1UGNA 2WLJA 5DLLA 5DEJA 1GPOL 3RJQB 4HS3B 2CUHA 4XN5A 3LEXA 3BH9A 1EO7A 3QORA 4N0FB 2W95A 2BVOB 2E9JA 3UP6A 2BCMA 4FXGC 3S5LA 43CAA 4ZX3A 4NNXA 5FHAL 4BEIA 2BMKB 3W11D 2IDQA 2Y7LA 1HEJC 4L1BA 5DJAB 3PL6C 2PYEA 1TQVA 3BAEL 3AS0A 2VDML 3O11B 3OJ2C 5DU7A 1ZA6A 4FQLH 1MNUH 5GGRA 5F70A 1OGSA 1HZHH 4EI6A 1ZHKB 1XF3B 2BJMH 4HWBH 4R26H 5F9JB 4YSOA 2EUZA 4F7CA 4PV1C 1WGOA 4YXLH 3IT8D 1A4JB 3LZRA 3KD4A 3H7LA 5TDPB 3RGHA 4F5CA 2CGRH 2EYSB 1AKJA 3GBNL 5IR1B 4MKMA 4J4PD 1ANUA 2WBKA 4YHNA 2L4OA 1NAKL 3FC8A 3T0VA 4R3SB 5TK4A 2X4OB 3M7FB 3QYMA 2HX8A 2NY5H 4QLRA 3CFDB 2EVFA 2WXRA 4BK8A 2Q7YA 2JKWA 2W81C 1AYOA 2KPWA 2OTPA 4PJCA 3VFOA 1L0XA 2PW1B 3ATBA 1NCDH 3JXAA 3CDYA 3HI1B 1CFVH 3DPBB 2Q76A 4F1SA 2P42B 5GJTL 2QDWA 3QUMA 3A67H 3FZUD 2R59A 4KKBD 1AE6L 2BWDA 3SJVE 2XA3A 4IS6B 4L4VD 4UNTA 1FIGH 3BGFC 4E42A 2J1WA 5L2KB 3HZVB 3MGOA 1U8HB 2VXVL 3EBIA 3VTAA 2H26A 4PP1D 2E74C 5JW4M 3UPAA 5DJDB 3KXFD 1SY6L 3OM3B 4FJYA 3EO9H 3L48A 1BXXA 3JQOB 4PRPA 4MHHG 3M45A 4P23D 1JK8B 5HXMA 4L8DA 3L4UA 4CC4C 1QZ1A 3NIFE 2EXWD 3WLWC 1DQJA 2AJ3B 3D25A 3K74B 1IQDA 5CWSA 3CLWA 5EBWB 3P69A 4NO0A 4OD2B 5BUGA 4ZFGH 4N0YH 3PAUA 4PN6A 1NFAA 4I9WD 3U46B 2IQAB 3U7YH 2CXKA 3G08A 3HAEA 3FSVA 3ZL4H 5D7LB 2L0DA 4KPHH 2MCMA 3RGVC 2XQBH 1V5JA 4P4KD 3TESA 3ZMRA 3FOMB 4LEOA 3D39D 3SDDA 1DJIA 2E27L 2GB2A 2KH2B 4FL4B 1ERNA 2XBTA 3HVDA 5IQOA 5I1HL 1T66D 2O5YH 2V2XA 4J12A 3MYZA 3WFEH 2BIOA 5ADOL 2JIXB 3W2DL 4Y9FA 2PWFA 1CS6A 2MOQA 3ETTA 1YUHB 2IEPA 2LR4A 1BM3L 3FU3A 4XODA 3ARZA 4UDUA 4L5FH 3HS0A 4X8JA 4EO5A 4BUGA 2L8AA 1ZDSA 4YX2H 1E3ZA 1Q94A 5FUOL 5EIQA 5BV7L 1Z9SA 1OTTD 3IMVA 1BAGA 3ARGB 1PDKA 1DLHB 4BHUI 3B7YA 1X5XA 4F9PA 4UILH 4X50A 4HG4K 3NPZB 2IOIA 2N1TE 4HJUA 1DBBH 4U6HA 3SPHA 4HCGA 4FG2A 1FLTX 2WUBH 1T2JA 3E9TA 4JPVH 3DDFA 5KVDH 3S0PA 1WP6A 4TNGA 3PG2A 3V79C 2AK4A 4JPKL 4PTUB 3RURA 4X6FB 5IV2A 2HKHL 1J8SA 5KBNC 4BZ2L 5JNYA 3QJHA 4B3EA 1OW0A 2RTTA 3D0VA 4RGNE 1QUNB 3BVVA 4L1HA 3P11H 1KT2A 2EDLA 4KRPB 3RPKA 4FFYA 4WEMB 1N5AA 3TCLB 3U30C 5C3LD 2GJZB 4G80A 4YDLB 2AEPL 1CFQB 3VMNA 4F9LC 1QLEH 4ZFQA 1CD8A 1QD0A 1UC6A 4CUCA 4WHTB 1T0PB 5K9KA 3WYRA 5LBVA 1SBBA 5JZ7C 3D5OF 1ILUA 2B15A 2RGSA 1OOWA 5DHXB 2QVTA 1M7UA 4AJVA 3EUDA 1YYLH 1AZVA 1M9WA 5DK0A 1RK7A 4FGMA 2X38A 2HT4D 3L3KB 4NKIH 3DV6B 4P07A 3W37A 3DTXA 1T7ZA 5HTSA 3VFSA 3IPBA 2YKLH 1DVFD 1JPTL 4D9LL 5HYSA 1MY5A 2ZYRA 2NY1C 2QLVB 4GAYB 3PHQA 4LFHD 2I5YL 2X12A 2FSEA 3HI5H 4M6ML 4YEEA 4P5MB 2AMUA 1ORQA 2FZ3B 4ELMA 3L7EA 4M5ZL 2KT6A 5MP6H 3W1ZA 1M3JA 1FVDB 1S7VA 5B39G 5TPWH 2APFA 2YLKA 4N4YB 4PIBA 4G1EB 2W9EH 2WLMA 3FTWA 5ITFA 1F1AA 4JR9H 3HFMH 1ZHBB 2AV7B 2AJYL 1I8KB 2XWJB 4BJLA 3NSFA 1A8ZA 3O6KL 1JYNA 5DD3H 4F8PA 4XI5C 1CBJA 2CK2A 1MH5B 1N3NA 2VXQH 2N56A 4R7NB 4LHJB 1IM9D 1U8QB 3OKMB 5I6XC 5J4MA 4KWUA 2FL5B 4F2FA 5JPMC 2GUYA 4G2AA 4LLWA 5D1XA 4FEIA 5KZCB 3LS4H 3F2LA 3OKDA 4QHUB 3RHWF 4UT6A 5F89B 3O45A 5I24A 1DBAL 1H0DA 4PJ9A 4FKHA 4XO3A 1NBZB 3V7AE 1BYPA 2GJPA 3J07A 4LLVB 2XWDA 2DQHL 2W07A 4PP2B 4LSUH 1DE4A 4TUJA 3B1TA 3PWPE 4LSVL 4OI8A 1CURA 1FRGH 4L4TE 4XHQA 1VRSA 1MF2H 2VITA 3BDXA 5SWSE 3EFFB 2IADB 3GRWL 2FH6A 3BZFB 5IHBA 3TA3B 1RJLA 1HK6A 1VKXA 3KYKL 1T89A 1F18A 1K4DA 2FJFB 4CSPA 4M29A 3KW7A 1T1ZB 1CIDA 2ZOKA 2R27A 4FMKA 5F6IB 3QRGH 3MUUA 4XPFH 1FAKT 3VXNB 3KEDA 5BRPA 3PABB 4U1NB 3EADA 2B77A 1F45A 4L1TA 2OZ4L 1EHLH 2IVFC 1FFNA 4BFJA 2FJGA 1HHJA 3SGDH 3IETA 3GMLA 3LN4B 4I89A 4NAMA 4EI5B 4F20A 2ZOTA 1FL5B 1P5VB 3MV8D 4WFEE 1R5IA 4QXTB 2R8SL 4ALAL 1ZLVK 1WIPA 4YHZL 2FNWA 3BXNB 1HAWA 2ADGB 5D1ZD 4DGYH 3BSZA 3BRGC 5K9JH 2I9LB 5FKPA 5AVWB 5EEWA 2NYKA 4L3FA 3V8CA 1MRCH 3ERXA 1W6LA 3BPCA 3DBXB 1OAJA 2Q3AA 1WBXA 3K72A 4DGUA 3C6LC 2CSPA 3PGCA 4IBQA 1H3XA 5C0ND 1KYUA 3UJTH 1HWGB 4UT9A 3RWCB 4YIQB 2BZDA 4G5AA 4AKQA 3IDJA 4OCSH 1S7SA 2D9CA 2QSCH 4GAFB 1TZIB 5SWQA 2WHVA 3BVNA 1UACH 2BP0B 3FT2B 4JG0H 4WRLA 1BD2B 1F90L 2IH3A 4JGUA 4ODHH 3QQ4A 2IPTL 3QDJB 3ZQ9A 1KBKA 1ZV9A 3B6SB 4BFEA 1SXCA 1W80A 1P4BL 1KV7A 3Q2NA 5CLTA 3NFNB 1RIVH 4MA7L 4X8CA 1LP9E 2IF7A 1QBAA 3N2JA 4FTDA 5EBLA 3VU1A 4LSRH 1QSFA 1RUMH 2OJZL 3UTTE 1P7QB 1YN7A 4WQOA 4CSTA 4M5YL 3LS5L 4HIJB 1Z1WA 3GXFA 5HDRA 5E8PB 1J9CT 2E7CA 4PJ8C 4AI7A 5DUMH 3OSVA 4H8QA 3X3FL 1I1AB 3R0NA 3PUCA 4F7EB 2YQ2A 3B1UA 3IXTB 2F0CA 3V5DA 1UEYA 5AG9A 3L9RB 4QPEA 3PV6A 4UQ3A 5J6GA 1CGUA 1C12A 2DTML 5JQ6L 3NPSB 1B0RB 3KMDA 3DTUB 2CHXA 1FZJA 3ENEA 4HIIB 2XKNB 1KYOK 1VEMA 4ICWA 5E70A 3RNQB 4H13C 3SDXF 4QLWA 3ZE1F 1A2YA 4LKCB 5DC0A 2Z64C 3K7UA 3WO4C 1DANT 2X9YA 3C5ZB 5HYQA 3UZQA 3E3QC 3FF8A 1WDAA 1HHKA 2Y5TB 4MB4A 1YPZA 1ZE3C 4HALA 4LGSB 4HXAL 3NCMA 3RI5F 4IBWA 1LDSA 1U4FA 4OCNC 3HNTH 3PQYD 2VSCA 1TKWA 1KN2H 5DJ8B 4GG6B 1HT6A 4PIRF 3TNNA 1PFCA 1ITBB 3VWJD 1F1DA 1AVAA 4H26A 1FCGA 4RGNC 4X4ME 4O02A 4MAYD 3DUUB 2HRPL 4K94C 1GYWA 3FFDA 1JDAA 4JRXA 4X0KA 4X6DB 4E9SA 5HHMB 5IHUH 4G1MB 1B3JA 4U1JA 2YAOA 2WWMC 1WA2X 4JL2A 2BNRA 3B9EA 3IJSA 2XTJD 5F1NA 3BIKA 1U21A 4JPQA 4AH2B 1P5UC 3FONB 4M62L 3L4ZA 4FX5A 2NR6C 3NCFB 1CJYA 2FO8A 1YJDL 4HOZA 4AWJC 1U0QA 3BLBA 5I0WA 2EDHA 3UJJH 4X6CB 4B7IA 4KI5C 1D6VL 1IGJA 2E56A 3P02A 2QADC 3BDBA 4PFEA 3RTLA 2FWOA 1P4UA 1MCPL 3MYJB 2VLJD 1YMHB 2WJ7A 2ZUUA 1TLKA 3D3VD 4RMBA 3KM2A 3EW3B 5TQ0H 1TO4A 1IKFH 2P46B 4OTXL 3NSXA 1MEXH 2E7MA 3O41B 2EXYD 5BO0D 3VFUB 5HI3C 2EYRA 2M83A 3ZW3A 4KZ0A 4UB0H 5FUCC 4JGJA 5C0FB 3VCLB 2W88A 4DAGH 2G75A 1RU9L 5EU3B 3FQYA 2LGNA 3D9AH 2AABL 1IAMA 4JRFA 1LHZA 2OW6A 3KL3A 4PJ5A 5DD5L 3WIHL 5E2WL 2OZNA 3Q2LA 3T0ED 2H0FA 3QPKA 3SSGA 2XV3A 2V3FA 2OTWA 2YPVH 4JFFD 4Z9KB 5I8OH 5MEOB 1E90A 4DGIL 4XP5H 4P5SA 2CQVA 4O51A 5L2KE 4YC2C 5TK2A 1U3JA 1IEHA 5LQBL 4FD0A 1C1EH 4KKCC 5FO2A 3FNKA 4MZIA 3RL1B 2OMTA 4JFVA 3E0GA 5E5LA 1P2CB 5FA3A 2EE6A 3V9FA 1SJHA 4FFVC 1FF5A 2HPTA 1P7KB 3OGCB 1N4XL 4YHMH 3CX5J 5F9WB 4ZUVB 2M2DA 3CJJA 2BK8A 3IFNL 5LN8A 5FXCH 3GXPA 4PJGE 4EVNB 1IIIA 1N0XH 5C9KA 4I0PA 2BVPA 3FUNA 5D1ZI 4JAMA 2W65A 3SGDI 2F53D 4XNZC 4JANA 2ERJC 2NTFB 3RL2B 1SYVA 4OSUH 3SDCA 2R1XB 1CYGA 4L9LA 1UH3A 2AQ1A 3T9WA 4XNQA 2UYLA 3IU3A 4H5SB 2EDXA 4BDVB 5EOTB 4LAQH 5E6ID 2IPUG 3SKUD 1NL0L 4H20H 4F3FB 2Y2TA 4EI0A 3GC3A 3HLAA 5E99H 1U4EA 3T8XB 2X2JA 5EOCL 3HZMA 3QXAA 5D9SA 3LH2H 3Q8EA 4EBQH 4IKIA 1IBDA 1KSRA 4CBPA 3EJRA 1B2YA 4APXB 1KJ2L 3WUWA 3MXWH 1GYAA 2E4TA 5I8KH 1Q0YL 2AZAA 2CO4A 1RZPA 4YXHL 3DVNB 2J6EA 1I8LA 3FW6A 3DNKA 4B41A 4LCIL 2C3VA 5DWUH 2R0LL 4J5VA 4HAFA 4AQZA 2I07A 2KZWA 5J7CC 5B1AB 3WNPA 4JFHE 1BZ9A 1NIDA 2B3RA 5CSZB 4ELDA 2ARJB 5FOBA 3OPUA 2CR3A 3M8OL 1Q8MA 3PDDA 2Q6WA 1BEXA 4HIQA 4JHVA 1HH6B 1N64H 1SJXA 1GGIL 2D4DA 3ECVA 3N55A 3P3YA 5SX5H 1IFGA 4FLSA 2H47C 4C57C 4C54A 1EFXA 1MIEL 5JHAA 4U1IB 4NO3A 5DJZA 2UWEF 2WQVA 1YNTF 3IDGB 1ETZA 1H19A 2H3NA 3BKML 4DPAX 3OGOE 4HUWB 3BQVA 4HEME 4GS7C 3C8HA 2YJLA 4LHUG 1NFDE 1UXMA 1W2KT 2BRRH 1W0VA 5IP4A 1PF3A 1YC8A 3ASNB 2VOTA 2X4SA 3HC2A 3ARDA 4M93C 4CADA 3K0YA 5DT1L 3O0LA 2YSTA 5GGSB 3SKNA 4DP4X 4JM2D 2F74B 1UWFA 2Z6FA 3KJ4B 4PLJC 4X7TB 2R0ZL 2O26U 1T7VA 3RX5A 1ZGLA 1MAMH 1G6VK 1IGTB 4TTGA 2OJEA 3EDEA 1G1YA 5GGQL 4PRHD 1ML0A 2CO7B 2ZKYA 3MDJA 4RNRA 1T03H 4K5LA 1Y6NR 3QW9A 3UH8A 1FVCA 3GXDA 5H8DA 4QHLA 1DJGA 1FL3B 2PWDA 2VUKA 1L0PA 2YGVA 4MNQE 2BRQA 2YMXL 3O8XC 1Z9MA 1AJ7H 4HIXH 3INOA 1Q72H 4M9PA 5HY9B 2OTUA 2XX0A 1KTLB 4Z7OB 4Y4KC 4Y2DA 1RURH 4HPOL 3UTSB 1X7SA 4FABH 5BRZE 3MRGB 1DQIA 1IM3D 4WW1B 3QS3A 2G9HB 2I25N 4I8DA 3TNMB 1ZHNA 3WFDH 1KCRH 2D31B 3C6EA 2DQ6A 4IRSB 3VD0A 1S9XA 2P80A 2FBOJ 4XPTL 4KKNA 5E8DL 3U9WA 5MENB 3Q7JA 1J0IA 2Q9OA 4A6YB 3VXSA 1SPDA 5KSBF 1KULA 4P2RA 1EEQA 5KVFL 3QPQC 5LWYL 2NXZD 2F61A 3QH3A 3X1NA 1OARL 3T1FA 4TPRH 1G9EA 4ZPTA 3FB8B 2N59A 2AJZB 5CKGA 1A6TB 1YEIH 4RAVA 1JGDB 5LXGL 1FL6A 1JMZA 2NX5B 1GW6A 1A0QL 1QBLH 2E6QA 1ETB1 1DEEA 3ZKNC 3S4SG 2HFEA 1XAUA 4E0RB 1ZT4B 3A4AA 3H9HA 4W70A 4ZBJA 4AQAA 4PGCB 1P9MA 2Y2YA 1JBJA 2KS0A 2ITEA 4EE2A 2F5BH 4X7DC 4K7FA 4R7DA 4LOVA 4A7QA 5ID0B 1GYCA 1CG9B 2ZG3A 4QRSA 1I1RA 2YD1A 4XPGL 2B14A 3DHJA 2ZG1A 1D5BB 5E5MA 3TTSA 3AQYA 2XXGA 2WPGA 3OMIB 2NQ3A 3UDWA 3REVB 1PVHA 2VRKA 3IMUA 3UAJC 4EIUA 1T0MA 2P26A 2J20A 1WFTA 1C5CL 3SBQA 3VFRB 4PJAF 1C5DB 1V7ML 2H7WA 4MCYB 4YSAA 3UROR 4C47A 3CN2A 1SJEA 1I7RA 2PCXA 3JWDC 5GS2D 1TJIH 2IH1B 2UUDH 3U1QA 2Z7WA 4ZW8A 2GIYA 4KK9D 1E4KA 2VDQB 1T1WB 5FW7A 2ZYSA 3ZTDC 1INQA 2XG4A 3PAVA 4NIYE 3GSVA 3Q6FA 4CVWA 4WTZG 4MA8L 4B95C 2JQMA 2XWTB 4GUCA 1DUZA 2OKMA 3CZNA 3WN5C 3FUIA 4YHKH 5J13B 2Q10A 4E9YA 3GQFA 3T77A 2ZCLL 3R19A 5CMAA 5F3BB 1FO0H 4TL5A 1IBHA 4ONFH 2VQ4A 1ES0A 1N8ZB 2K6ZA 3EH2A 3HG2A 4FA7B 3ZYZA 5D2LB 1S7WB 4W9LC 1DP0A 5C07E 2ISDA 1Q9WA 3W82A 1F42A 4NWTH 3C60B 1MHPL 2PNDA 4KMTL 1OGPA 2X4RB 4YSPA 2QL1A 3ILDA 3KGRA 3QJTB 3ZRSA 2P8PA 3ISRA 3IKCA 4M6OL 5I1IL 5HGBB 1IC7L 1INEH 3BN9D 2QHLA 5ACZB 4CSSA 2DYPA 4QOKE 2C4XA 4ZOEA 4EQ3A 1G6RA 1CGWA 1RH8A 3O0RL 3GI8H 2KLSA 1OPGL 5KANG 4TQEL 1WTLA 1NAMB 1PYWA 2EYTB 3VXUD 1PEZA 3IGAA 4OCYH 4KTYA 2D7NA 1AIFA 5CJOH 4YN3A 3FFCE 4QHMA 5J1SC 1BPVA 1MAKA 1IC5L 4FL4C 4JHWL 1T2QH 1U8CB 2QKIA 1IAKA 1NANH 3GZOA 3VFVB 2BS71 5EZLB 2RD0A 3BUYA 4PBWD 4RLDA 4JO8A 2RBLA 5KBPA 4Y8DC 4C4BA 4JMXA 5C9JA 5IFHL 5HHNB 2OR7A 2XI9A 4HFUL 2GQHA 3ES6A 4K07A 3MUZ1 1IBGL 2JKLA 2VABA 3LVEA 1SDDB 3B34A 3D4GA 4IGBB 1ID2A 1N12A 2WIIA 4NKDA 1MCWM 1YLBB 4LOFA 2BHFA 3VFNB 4JN1L 3D50A 4LNRB 2EEDA 4OLYL 2ICEA 1CFMA 4JRYB 3LKSB 3ZDYF 4G6KL 3NFPB 5AW1B 1LEKA 4Q58C 3WIIH 1DBML 3L95A 4LCUB 4QYAA 2HUEA 3AU1B 3OG4B 3X11B 4F8NA 5ALBH 1BZEA 4W4NA 5LAXA 5D7JD 3JYCA 1L9MA 4JVWA 5EN2A 4C56A 4GG6E 5CU5A 1S5IL 5IJBC 7FABL 2H0EA 4DETA 1X5HA 2OFQA 4BKLB 4TQPA 4KRPC 4GSQA 1ZLSH 4X6DE 3WXVH 4ZOCA 4YDLC 4OZ4B 5AZEH 4KO7A 1S9VB 4A2GA 2FIKB 4NQEB 43C9A 1X5MA 2X9XA 1B4TA 3QFJD 1MFAL 3CHXA 1RJZB 4R8WL 4ZMTA 2VRAA 4E9TA 2Q1EA 3K6DA 2VDKH 3MRNA 3UBHA 4ELKA 2I32A 3TASA 4W9GC 2IO5A 1GZPB 2HT2D 1N2RA 4KI5F 4KKLC 1OP5H 2WO4A 4JFPB 3M1BB 4UOW1 3C2SA 4JHAL 4X9YA 2VLKB 4LHQB 5LNEA 3SGKC 3DXAB 1DTUA 2GCYA 4PY7A 4WTQA 4X6CE 3QCVH 4JDTH 3S3SA 1DN0A 4FULA 4UM9B 1BFVL 3HKZA 2CD0A 2ZOUA 4AG4H 3LJ3A 1QRNA 4IQHA 2I7SA 5K9OB 3QQ9C 5IROA 3L4WA 2QVMA 5C08D 3BP6B 3ZLQC 4LHUA 5L8LB 3BD5A 2EIZB 2H1PH 4MDIB 4Y9BA 4KGLA 4MB5A 4JFXA 5E1AB 5CP7B 2WXNA 5IQ9B 3BEVB 3STLA 1AXTH 5AYQA 1DHKA 3DGGA 5DYOA 3QAZB 4AGQA 2ICWI 1KNOB 1UD4A 3NCJH 3NJLA 2C9SA 1TZAA 5IJKA 4XGZB 5JUEL 1OTSC 1EAQA 3TIDB 3O9WD 1SOXA 3CSPA 2ZUTA 3SPCA 1NGXB 5T1KA 3RNKB 5D1QB 1XWVA 3BH8A 2K9UA 4ZQKB 4W9HC 4KAQH 1R33A 2FEDD 1FG2A 4M5SA 4RDBA 5AW7B 1N9PA 4AITA 5JIKA 1WCBB 5FGSA 3LRGA 4JE4B 1Q9KA 1DJXA 3NJMA 2ZOWA 3GLZA 3QP3A 1RUQH 4N2BA 3FQNB 4TLSA 3EYOA 4BA0A 4N2EA 3ZSSA 4NRYB 1BVKA 2ESVD 3TN0A 3SY6A 4JDVB 2YAHA 2XNAA 2HMID 2YEZB 4NYLA 3QEQD 1X5IA 1XGYH 3GMRB 4FTVB 5DF0A 1M05A 4AIZB 3M46A 5MEQA 3TIEA 3WTXA 3QG6A 2QFRA 2K70A 1ZKAA 4L3ED 4Z7NB 3VD3A 4WUKL 1G9NL 1JS4A 3ARXA 4P46D 3VW3L 2BP8B 3UTQB 2RMNA 2VDNL 4JFOA 5F6IC 4UTAA 1XGQA 4FXGA 3RFZA 4QRPA 3S8GB 4P9HL 3VXRD 1XH1A 5F96L 4UT7L 3U7WL 4OM1L 4DKFL 3MCKB 4IMLA 1JV5A 3H9ZA 1W15A 3V4PL 1AFVL 4Q4IA 2Y6SC 1EDYA 2JKSA 3PL6A 4XMLH 3WY3A 4N90E 3ARQA 4Y1AB 4NWUL 3U6RB 1M7DB 1TZGL 3MAWA 4PWGA 4PI0A 2PP7A 3GSUB 1YEDA 1HQ4A 2Y36H 3RWHA 1PIFA 2WQXA 4KXAA 4YSTA 1AGBA 2FECL 4NNPH 1G7QA 1CFSB 5DRZA 2JTDA 3LIZA 4EOWH 4IDLA 2A6IB 4ZYKA 1GHFL 2G0LA 2WLLB 5IMKA 3CBRA 3S48A 2MCPH 3TBWB 2IWEA 4OZIB 2Y7SA 5E9DA 4L29B 4X4YB 2ZF8A 5DZNA 3K6SA 1PZUB 4KY1L 2P49B 2AC0A 4MCZA 3OKOA 4N2HA 3NCXA 3VXMA 3CDCA 4QHKI 1ZK9A 5HI5D 4JDZA 2VDLH 3MGTB 4Q74A 3V6OA 2OM5A 4JY4A 4ZNEA 1C16A 4PWEA 5C0AD 3ILQC 1TZHB 2XWXA 3LKNA 1DVUA 4PM1A 3RIAF 5TTRA 1FYTA 4MHHI 3DOSA 3F7LA 3KPRB 3KYOB 5DQDL 3EFDL 3DX9B 1HEZA 3N44B 3B9DA 2VC2B 1O7DC 2HVKA 4G43A 1BVLA 1SEBB 4M7LT 3OB0K 4NP9A 2EH8H 3CIQA 4ADIA 4P2OC 4Z0XA 5K9QI 1F3JB 2ITCA 2H32H 2OK0L 1Z0MA 3MV9B 4TTDC 4TULH 3QRFM 5E1IA 2ZUWA 4JO1H 4WNQB 2B08A 2IMNA 4J27A 4I3SH 3OHXB 3MSPA 1J86A 2JXMB 2XKUA 2L7EA 4HK3J 4KKAC 1I1AC 1L9PA 4FG6C 4YSCA 3NIGB 1F3DJ 4YNYB 3AXLB 1P7HL 4JM0A 4GRWH 4NKOB 5FYLE 3IF1A 4EN3D 4WHCA 1IIKA 5KJRL 3OQRA 2FBJH 2H6UA 2VE6A 3NPSC 3QS2A 4ODVH 3ZE1E 5KBKA 1WD9A 2A9MH 2VO8A 4FF9A 3PP3K 4HU2A 4PUBH 4CC4A 1JYWA 4G72B 5B8CB 1C5BH 1VADA 2B9AA 2C8NA 2X09A 4PRIA 4PS4H 5EO0A 3UC0L 1PL3A 4A63A 4ZW5A 4ZAKB 5IVZB 2BZCA 2DQJL 3NJFA 3C5ZC 1NCAL 2VDRB 3FU7A 4GXUN 3D0LA 3RVWC 1RV6X 5F6HJ 5KAQF 2OMWB 4IBLT 3V4VH 1F8TL 3DJRA 1KCSH 3OKNA 4LGRB 3MV7D 3GGWB 3VA2C 5IFAL 1ZEAH 2UV3A 1DN2A 5MENE 3TS8A 2EAEA 1JYVA 5GGVH 2WQAA 1WAAA 2WJ5A 4NT6B 2F08A 7TAAA 4R4NC 4NO5A 2UZYA 5AKTA 5DJYB 1R75A 4ZMVA 3BAXA 2H6PB 4JRLA 1VZHA 3P40A 2YHGA 1CDUA 5L88L 1UD3A 4FP8L 3VGDA 2BDNL 3UO1H 1AOHA 5GHWL 1NCCL 3BZ4A 2KLTA 1S7UA 1NCOA 2CBMA 3N3EA 5LHDA 1MW2A 1AGEA 3B2XA 4P49A 3SY0B 3PWUB 1NIEA 4OZGA 3MLXH 3UZVB 5DTFB 2V7NB 4FXKB 1IVTA 3T2PA 2HVBA 2FCBA 5T1DL 1JZDC 4LAJH 1EEZB 5ITBL 3A6BL 5I18L 5I17A 3US0A 4X4KA 2QBWA 5HPMB 3KJ6H 4LSPH 3FU5A 3FUEA 3H8NA 4FLRA 4Q9QH 4NQDB 3QIWD 4NENA 2PCYA 2WW8A 4P04A 1VFOA 4RWYH 2LQRA 1P1ZB 5AB1A 1RUPH 3L08A 3QJSB 3U48A 3DBSA 3GJFK 2A6KB 4JJOA 4AGOA 5EB9A 1WQVT 2HXAA 4XB3A 4ZDHA 4LESA 3HMWL 5GS0C 1GOGA 5FFGA 1CI5A 2BVQB 3QDMA 5HHOD 2H45A 2FRGP 3MR9B 5KYXB 1OEZW 3GJFA 3NH7L 4W4OA 4F9LA 2OMXB 1YNTA 3QWOA 1I9EA 2B1AL 2X4NA 3D48R 3Q9PA 4GSUA 5F7NC 3ZIMA 2X4QA 3F04A 2G30A 2D3JA 4OF7A 1X44A 1CYXA 4QXGH 3D0AA 1L7IL 2VZ3A 2BC4B 3H4HA 2YN3A 4G5ZL 2GITA 4MTMA 5FCUL 3Q48A 1JZ7A 1VACA 2CMRH 3QI9D 3MN8A 3CFKB 3MRFB 1EEUA 3Q1SL 4ORGA 4PJEA 5F72S 3ZGIA 4Z3IA 3FL7A 1K3IA 1WVZA 4FS0A 4MCNA 4G6MH 4HZLB 2Y0SA 3EJUA 4ZUSB 3X2QB 5JIPA 1XF4A 4XAKD 4P59L 5KW9L 2XFXA 5AVSB 4Z7QB 2ADYA 1ZT7A 2Z35B 1I3GH 3BP7A 2IANE 5F9WC 1EFQA 1F00I 3S2CA 3L1GA 4U05A 3MOAL 4JO5A 1U8MB 1A6UL 2J56A 3V7AG 2AQTA 1TTGA 4I1RA 2Q3XA 5EZJA 5AALA 2Z7YA 4BWUA 1QLRB 4AV4A 4RBPH 1BW8A 3N41F 1QFOA 1FDLH 1UG9A 2P5WB 4MXVF 1BZOA 3VI3A 2N0MA 3MLUL 1NDGA 3UGUA 5ISZD 2CUAA 1RVFH 1OP9A 4U1KB 1BZDA 1V55B 3BWAA 4LQ1A 3BFOA 5C0DA 2BLFA 3Q8AA 3EH3B 3Q06A 3E2HB 1U91A 2BHYA 5DZLA 3HZYB 5FYJU 2LTQB 5JPMA 3D6GA 3NN8B 5E1GA 4QTHB 4ODXB 4OGAD 3PHOA 5C0IA 3ARED 4W93A 4YR6