3GUFA

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight heat shock protein
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
total genus 14
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gufA00
3GT6A 1EJFA 4MJHA 2JKIS 3Q9QA 3Q9PA 4YLCA 1GMEA 2WJ5A 3GUFA 4FEIA 2O30A 4YLBA 3GLAA 3VQMA 5LUMA 3QORB 2KLRA 4RZKA 3AACA 4YDZA 4YE0A 1WGVA 3AABA 4PCKA 3W1ZA 2RH0A 3N3EA 1SHSA 4PBDA 5DS2A 4M5SA 3EUDA 2WJ7A 1X5MA 3J07A 2BOLA 2Y22A 2KMWA 4JUSA 4YL9A 3VQLA 4M5TA 4JUTA 3L1GA 3QORD 2N3JA 4I88A 1WFIA 1RL1A 3IGFA 3L1FA 3QORC 2CG9X 5DS1A 1WH0A 2MNWA 4ELDA 3QORA 2CR0A 2K8QA 3L1EA 2XCMC 4ZJ9A 2Y1YA 2N0KA 2Y1ZA
chains in the Genus database with same CATH superfamily
1U8MA 4A38A 2DLIA 5F9JA 1JWMA 4J2XA 5I8EB 1VCAA 5F6IB 4MNHB 3TZVC 4JL1A 3QWRA 4DQAA 2LLLA 1JTPA 2H41A 2IFFL 3WUWG 2IPKA 1F58L 1IC1A 1LO2H 1YY9C 1KTKE 2EIZB 4KTYA 2FZ3B 4QHLA 4UUJB 3ZIMA 1R24B 1U8MB 2L7EA 2NY3C 5LGJA 5EV7A 4PJAE 4RQQA 5E8EB 3DWTA 5FM8A 1AGDA 4MNGE 5L0QC 1E8ZA 5HDBB 1MJJB 5AZEH 4B97A 5KYYA 5G4MA 4UQCA 2YKLL 1QUNA 4DP8X 4PJCB 4N2NA 4OGYH 8CGTA 1TQTA 1S3KH 2NXZC 4FABL 3MSPA 4U1LB 1GGIH 3FUMA 3TESA 5KYYB 1T21B 1IGIH 3B2PA 3GO1L 2NY1B 5EO1B 5C09A 4CMHC 1QUNB 2D7OA 3O11A 4ACTA 1TSRA 1S7XB 2P5WA 2X6AA 2BY2A 2EECA 3BHBB 3OC5A 1ZLSL 5AB0A 4DW2L 4APQD 1FGVH 4UOQA 3AY4A 5AVXB 3FQXA 4LHUA 4K73A 1JYVA 1EAQA 1JPST 3WJJA 2X3CA 2F53A 4CSZA 3OKDA 5C09B 4XPHL 3D3VE 3P0YL 3VXPB 2PXYA 3ARDB 3O11B 4WTZA 2P5WB 3FUIA 3FT0A 3HW7A 3KM2A 1RK1A 3KVDD 4KRPC 1ZGLA 1CDUA 3UG5A 3FQXB 1M42A 4CW1B 4IM8A 4PV8B 1DSYA 5LXGH 4M5ZL 1ONQA 1OP4A 5KYXA 3LMJH 1PY0A 4AEHH 3W37A 5IEKA 1OHZA 2NNXA 3UBXB 1SOXA 3HS0C 4DN3H 1SLVA 3E38A 5D7IA 3IJHA 3T5WA 2CM5A 4L0PB 3TYFB 2CG9X 1ZGLB 1PD6A 2ICWA 4PHZA 5A2LH 2QHRH 4AQ1C 4QJ3B 2ZUWA 2DQCL 1NPUA 3QQ4A 3CLFL 5SWQA 4YNYA 1IC7H 5LAPA 1ONQB 3Q5YA 3ASNB 5DK0B 5KYXB 4G2AA 4LCCC 5IEKB 5BV7L 1JWUB 3CMOL 1ORQB 3KXFA 2WLMA 5I19H 3IJHB 3GXDA 2G60H 2XYCA 3FAWA 3ZE1E 5SWQB 1U3JA 2G3ZA 3QQ4B 1SHSA 1KGCD 4H8VA 4HKJB 3RVVD 4MAYA 4F8TA 1OAZH 3QJVB 3ARGC 3KXFB 2CJUL 1CDCA 4JO3L 5F7YC 3SE9L 5LO7A 1HXYA 2EIMB 5B1JC 2XPZA 2DJMA 3UYOD 1EZLA 1S7TB 4IRJA 1G0YR 4DP2X 3OAWA 4B60A 3V0JA 4MTMA 2BVQB 4HXBH 3MDJA 4WFHD 4KJWD 2P9RA 3N06B 1CL7L 1J8HE 2Y7OA 4J4PA 1IM9D 1I7TA 2E7BA 4M00A 3FFOA 2G2NA 5IMMA 4YSRA 1ACZA 3FCUB 4WJKB 4JO4L 2BXYA 1GGUA 1GZQB 1PQZA 3UIZA 5BV7B 4NM4H 3NJLA 2Y23A 4KY1L 3QYMA 4HS8H 4W9KC 3U46A 5J6HB 3E6HB 3N40F 3QS2A 5IF0A 5F8RC 1K8DA 5IMOA 1AHWC 2ZYSA 4RH4A 5IQ9A 1UM4H 3RLSA 4BQ6A 1AZRA 1W8OA 3O6FA 1PQZB 2VQUA 1YLBB 4JB9H 3WTVA 1ULVA 4LSPL 1Y6NR 1F3JA 5E51A 4HAKA 3ZZ1A 1W72L 4WWOA 3T04D 4XNAA 3VXSD 4QHUB 1K8DB 3CVHH 5AZ2H 3QNYA 1EAOA 2IH3B 3OTTA 4XCNB 5HDBE 2OYMA 3T2PA 3D09A 5DUBA 2K6YA 2H7WA 4Y16A 4UNIA 1NC2D 3EOBA 3MYZA 3UIYA 1XBRA 4ZAKB 1JZ7A 3I6KA 4WEBH 3ULVL 2R4SH 1OPOA 3SEPA 1OP9A 4PJXA 3X3GH 4Z1PA 2GVYA 3NEXA 2ZF8A 2BC4B 4H0IA 1W72A 3I6KB 2CO7A 4AMWA 2WHVA 2C26A 5KOVC 4M3JA 1A9BA 3M17B 4X7EC 1YAZA 3NCXA 3QS3A 4TSAH 2XA8L 1MQKH 4R4NC 5C09E 3N1GC 1TXKA 1HNFA 4FRWA 4J28A 5H8DA 2B1HH 1JPSH 1ASQA 2CXGA 2P5WE 2H3XC 1ZTXL 3ZRSA 3KLKA 5C9JA 2A6JB 2F5BL 1YEHL 1AZCA 4JDEA 4UU9A 3VQMA 3EFFA 5BZDB 4EVNA 1UENA 2VXSH 5F7UA 2EIDA 3QUKB 3LXCA 2A9NH 5DUML 2F53E 3X12A 4K94H 4FZ8L 3CCHB 1JRHH 3IDUA 1J8KA 4PB0H 5I1CL 1EJOH 3QNZA 2Y24A 2ADFH 4UT7L 4UIMB 4OLUL 4UU9B 4Y9BA 3DPBB 3ISYA 1OT2A 3QRGL 4Y5XC 2R0WL 1AH1A 1ZV2A 1WT5C 4L3EA 3QEGH 5FV1L 1FV1A 4AYFB 1CQYA 3ETTA 3T2NL 1OT4A 3QNZB 5D7IE 1A6AA 3R1GL 4NJ9L 4YE4L 5I1IH 3BPOC 5B3SB 4WUKH 4NPJA 1DJZA 2BSTA 3E80A 3ZJAA 1ZVSA 3X14A 4PBXA 1AI1H 2WNGA 3EUDA 4ODVL 2PTTB 3EH4B 1QHQA 3KXFE 1QBBA 5A6IA 5IFAL 3P3RA 1JP5A 1MXDA 3BESR 4NAJA 5ABZA 2WNXA 3FSVA 3QARA 4U1IA 3SQBA 4B6ZA 2YWZA 5KANI 3II1A 4MYWB 4M6NL 1KIPA 4PRPD 4FQIH 3FO1B 4WFEE 3HI6L 3R8BB 3X14B 3SJVD 1R0AH 1FFTB 2EUWA 1Y0LA 2VAAA 3O8XD 4C4UA 4JFXB 1GC1L 4U1IB 4XR8C 3SQBB 1YMHA 1BHGA 2C1OB 3KPMB 3VD0A 4QHPA 1XGYL 3F84A 4Y4KD 3MLWH 4MJ2A 3OXRA 1U95A 1SVCP 2VQTA 1T5WA 3QEQD 3LPPA 1IBGL 1MFAL 3BUDA 4PD4K 2J1ZA 2GIYA 3KBHE 4OF6A 3QPXH 4M6AA 1XF5B 3FXIC 4HUUA 3Q13A 4K3DH 4FI6A 3B2UD 1JGEB 3VFWB 3VXQA 2OP4L 1CDGA 1B4TA 1SM3H 3QQ9D 3TA4D 1U95B 3AREB 2ZCKL 2H32A 1UM5L 1Q8MA 3E0GA 3PCYA 3MN8A 1SJHB 1YQVL 3VXQB 2RALA 2X1OA 1LEGA 4ZUWB 4ZMNA 3PAZA 3T2OA 5JUEH 1IM3B 1O6VA 2EIKB 4PMEA 1QASA 4XBPA 3KPQA 5IW1B 5E03A 3CK0H 5TE7L 5J4MA 4B96A 1SLXA 4XP9H 1DBBH 3CZJA 4XO4A 1BZ9A 3VMOA 2OK0L 1BYPA 2W9EH 3MRIB 2D7PA 2O5ZL 3BRFA 4KMTH 2YN5A 1ACYL 4XBPB 3MX0A 4CL7A 5C2BH 4NZJA 4H1LB 1BAWA 5JW4N 2UWEA 2YGVA 3SZ6A 2CXKA 2FAUA 4OLWH 4AJYV 4BDVA 1B6UA 5C0EA 1UVQB 3WLWC 2RFXA 4AX3A 1JI2A 4RFNC 4EMZA 2NQDA 1R3IH 3AB0B 4FXKC 3RL2A 3MRMA 4PJXE 1TJGH 2C9RA 3BMVA 3LS5L 3MX0B 2R83A 4LCYB 3L3OC 4MAUH 3T9WA 1NGXA 1CK0H 2WBJD 1TZGH 2HLFD 2UWEB 3FS9A 4LNRA 4JMXA 1E65A 3SGDI 5DD1L 4E41A 5CINL 4TNVF 4XCEA 2ADGA 3PQYA 3MRMB 1A21A 1IV8A 4KX9A 4TULH 3T6VA 3VI4B 1CFQA 1NGXB 3DX9A 4O58H 2F8OA 4M7LL 1MJUL 4Y4HB 4AE0A 4AT6A 4LNRB 3H9SD 5HJDA 2AXGB 4YSSA 3ULVE 3IU3A 1ES0B 2BVOA 4Y19D 5L8LB 2XFGB 5L9DH 1DVSA 1KJ2A 3F7YB 3UGEA 1TENA 4QRSB 2ADGB 5AYUH 1R3KB 2WY3B 5EZOH 4F8LA 2DAVA 3QC6X 3A6CH 4HWZA 3IPBA 3VXUA 4AT6B 4J3WA 3SO5A 5TQ0L 4JQVC 3LEXB 1JFHA 1Z3GH 4HXAL 5JHBA 3G5YA 4FZEL 1JZ5A 3ALXA 2WW8A 4HWZB 4L3EE 5AUMA 4K3EL 2NYKA 3LPWA 4QAMB 3SE8H 2CA3A 3W9EA 5MENA 3QQDA 3I50L 1ZTXE 4XODA 5F1IB 2CO2A 2Z7YA 1M9SA 5D7LD 4X0KA 5BUGA 2LW3A 4MCZA 3W0WA 7PCYA 2X42A 3FOMB 2K8QA 4NZUH 3G5YB 4QRQB 3N43B 3IDIA 2WLHA 2GBAA 3V0HA 3G6JB 3CDGA 5CBAA 4LPYA 1OB1B 4CSTA 3V5HB 4FQ2H 1C7SA 1IC5L 3QQDB 5F3HB 1U8JB 2YAHA 3GMRA 3K2IA 4XMKH 5GS1C 1H0DB 5LGHH 5KS9A 5AVVB 3W0WB 5ESAA 3CHSA 4ADJA 3NA4A 1J87A 4KROC 1PTZA 1GAFL 3ALWA 3L4UA 3VXMD 4PS8A 1MRCH 3CDGB 2R29L 1WJ3A 5HHMD 4Z3JA 4ALAH 4L48A 3UO1H 1G4MA 1HEZA 1ETB1 1A9VA 5DS1A 1S78D 2NY4B 3QIBC 4P5TC 1LHZA 4PTTA 2QLVB 3GSXB 5ESAB 1H19A 1QTSA 3MU3A 4QGYA 1M7DA 2YAOA 1UUNA 4GAJL 1GA2A 2ATAA 5E4IA 4M4RA 2IAND 1EGJH 4LCUB 4LL1A 4U6HA 1QSVA 2VXUL 4URTB 2VE6A 3E9TA 2QQLL 1DFBH 1TQUA 3O6MH 4M8QA 3VGHA 3FT2A 2ZAHA 1NAKL 3MRLA 4D8PA 2BP8A 4Y2NA 1R6VA 3KJ6L 5GGSY 2R29A 4UM9D 5DJ8B 5FHBH 5HI3C 1JNNH 2Y7QA 3CFBA 4U6HB 4S0HA 3EUUA 3MUJA 3GBML 1AD9A 4PJDF 3WNPA 3BGMA 32C2A 4BE6A 1WP6A 3IAQA 3U1SL 4A37A 2P7TA 4U6XB 3C08H 5I0VA 3KDMA 3TJPA 2BP8B 4LCWA 5E9NA 3KGRA 1OAUL 3ARFD 3OSVA 2Y7QB 3CFBB 3FN0L 2WP3O 1XGPA 5L8JB 5DRXB 2IDQA 4OFYD 5ICUA 1ZLWH 3BGMB 4CDGC 3FZUC 1OWRM 1R5IA 2W9DH 1XCXA 2P7TB 4G8FA 4RX4D 4N2BA 3SO3C 2VDMB 4KKBD 4GAGL 2VO5A 3KYOB 5CUSH 4DUXA 3PGCB 3SDAC 5LXVA 1KIUA 3VFVA 1SNRA 4H20H 1U2CA 3LD8C 2UWEE 1OY3B 4Z0BH 3FFCA 2K9FB 3EBHA 4DP4X 4XCYB 1J0KA 2EUXA 2D3JA 2YRBA 4G8FB 2EEBA 5DWUL 4KUZL 4Q9CA 2YLHA 4MSWA 1OAQL 2WZPD 3I2CL 4NCC1 3SD5A 2EDWA 4UQAA 5HHXH 4GW1B 5AVTB 2ZCZA 1UOLA 3FFCB 2G9KA 3NFNA 2OMZA 3P0GB 4YHZL 4IOSA 4NUJB 4FQQA 4H8PA 1NANI 5KSVB 4KXCA 4X9YA 4E41E 4X7TA 4JHVA 3NJJA 3PQYE 1PX4A 1WWCA 4D9QE 1SJVA 4Y8DC 3BISA 6PCYA 2ZOTA 3JV4B 1EVTC 1L0XA 2BFVH 5DJAB 4HIHB 1UT1A 3CXDH 4L23A 2MKWA 5GJSH 4BQ9A 1MCIA 1NBQA 1AHKA 2CGRH 2PPCA 3GSVA 4HWBL 2YZ1A 4U0RC 4NKDB 2XWBA 4MHHG 4YDNA 2VXVL 2BW5A 4Z0XB 2Y2YA 3KNBA 6FABL 3N41B 3VXUE 5L88L 5CAYB 2GTWA 5GRWA 3QNXA 2BRRL 2E7MA 4IIZA 4K23H 1QLFA 4OH2A 4S2SB 4WTWA 4ZQKA 3GSVB 2WNKA 5E6SB 2OXGB 3TFBA 3II2A 1QR1A 2DM4A 1WD9A 2BCKB 2YPVH 1D5XA 2WSKA 4NKIL 5LVEA 3U0PB 5MENE 1FGNH 5I71B 2GTWB 4M1DL 1AQMA 4IS6A 3QNXB 1U4FA 4BH8A 1QLFB 5CGYC 4MS8D 3INUL 4ZQKB 3T0EB 3W0WE 4HWBA 3GRBA 3GKWL 3L48A 1AZBA 1OE2A 4JM4H 1KENL 4LSUL 4RBPK 3QUZA 3PFUA 3B7RL 1HNYA 3VG0H 3PPEA 1U2HA 5GIRB 3PAUA 4P9HL 1I4FA 5E8NA 4I7ZC 2KUTA 3QIWC 4DSYA 4GW5A 2UXVA 5K9QI 1D6EB 3GRWH 4PRID 4YK4C 3T0XA 1FDLH 1LP9F 2E4TA 3CFUA 3FO2A 3IFLH 4ODTH 1UM6H 5DUPH 4OCWL 5E8NB 4GIOA 1I1RA 4ODXA 1H8SA 5AAMC 1NFDA 1F90H 3GB7A 1XVSA 2O6DA 1AIFB 4GLRH 3UBFA 3UZVB 4YC2C 3OMAB 2J43A 3IM1A 2PWEA 3L1OL 4AJVA 4MXQC 5D4IA 4LL4A 4PLJC 3ZTJG 5JA9A 1MELA 1TO4A 2YBRB 2WYZA 2OPCA 3V4UL 1WK0A 2NR6C 4EI5D 4ODXB 2CK0H 5SX4I 1NFDB 3DBSA 5C7XL 1QFUH 4YHIA 4F7TB 2GITA 2YLKA 4P46C 4TUOA 3H6AA 4KI5F 1OCWL 2PCPB 2YGNA 1MCDA 2XACC 2Z3FA 3IDXH 4FNLH 4I0PA 1HHJA 4OCSL 5LHDA 3BKYL 5L4FA 1AJ7L 3GDBA 4M93C 3FCGA 2MCMA 3F58L 4XHJC 3VFTB 4J3TA 4DGIH 1FAIH 1GGBL 4YHIB 1RZJC 2GITB 3IYLW 3PGDB 2QMJA 4Q58C 1UKTA 4HKZA 2AV7A 4XP4H 5FK9A 4YPJA 4JPQA 3GLDA 1AR2A 4HF5L 4LCWE 4J8RB 1IIIA 4MD0B 1KJMA 3FU6A 4I0PB 4MMXC 3EAKA 3WFHA 3E1ZA 4ZJ9A 2BM3A 2ED6A 2Y5TA 5A16A 1YO4A 2XV3A 1EEQA 3QVAA 3VNYA 4OFIA 4HKZB 5FK9B 1PZUB 4PGEA 2BS71 4HUKB 3OAYK 5DQ9A 1ZDSA 3GHBH 3VWKD 3NBNA 1KJMB 4IGBB 1FZKB 5ABDE 1FN4A 2YRLA 3IRCA 4JQXC 1KY7A 3FFCE 4NRXA 4BHUI 4N0RA 1HJCA 4HPOH 3QISA 5A16B 3TH3T 3MO1B 3K2MC 4ZS6D 3SCMB 4K7PH 3K4AA 3G6AB 1QOKA 4K9JA 1KXHA 5IVXF 3KCPA 4GRLD 4NQVA 4XNUL 2ENYA 1ASPA 3MOBH 2C4FT 3EDFA 1NDMA 1XB8A 3PHSA 4XC1H 4NRXB 1JZEA 4HU8A 4Z7WB 1QZNA 4KVNL 4IRSA 5DJ6B 5T5NG 8FABB 4PREA 3B7YA 2VLLA 3LQAC 4RRPM 5I1HH 2G3NA 3DHUA 5GGVY 1IC4H 5E8DH 4JFDA 4IYKA 2J2ZB 3MLYL 4HD5A 2YK1H 4GBXC 2IFFH 3HE6D 3V9EA 5BJTB 4IRSB 3IETB 1VADA 1LM8V 4PREB 2VLLB 4UV4L 3W82A 4WW2C 3IVKB 3A4EA 4LPWA 4YDKL 3VGFA 1AAJA 2GHZA 4JPSA 4WWKC 4Y9EA 4RDQG 3Q8AA 2FNBA 1K8IB 1T0NB 1VADB 3N04A 4XXCC 3UBHA 2HTLC 4DKDC 4Z3EA 2YKLH 4P3WA 1ZANH 2QDWA 4MMYA 1DLFL 2VDKL 3QUXC 43CAB 2JK5B 2WLZA 4FABH 3V4VB 3T0BA 4ZFFA 1A4KB 3GO1H 4WKZA 5CZKA 1A1NA 4W93A 2VH5L 1WO2A 3ISRA 3CFEA 1IKNA 1KB9K 3B7UX 3OB8A 1ZLSH 5FA3B 3I6LE 3JTTA 4DW2H 3MLPA 1JFQH 1MOEA 2JKNA 3RY6C 3VG9C 3KEHA 4UDTB 1OTTC 5EZIL 4XPHH 3P0YH 3GPSA 5AOJA 5HJ3A 3N40P 3BAWA 3CFEB 5EUOA 3D3VD 5J6GB 1E6JL 3JTTB 4HFUH 1L6PA 1IC0A 5CN1A 4H13C 1KXVC 3WCYA 1FIEA 1ECYA 3IWVA 1HCYA 3PHQB 3BCDA 3LDBC 1ZJAA 1YJDL 2NCMA 3SODB 1NFDE 5HJ3B 4XHQA 4MLIA 2HP4A 5EUOB 4JKNA 2F0CA 4NIYE 3ILEA 2VDKB 1LJMA 3C5SA 4YHYC 3ULAB 5AG8A 4FTDA 4DFHA 5D2NA 2Z4QA 3PV6A 5GSRB 3BO8A 3CMOH 4S1DD 4I18A 1P9MA 3BN9D 4LLWA 4ZMAT 4Z7VF 1ESOA 1ZHKB 1R3JA 1UYWH 1DR9A 1D7CA 4IOFC 4B5ZA 2IADA 3CH1B 5DRWB 1SN5A 3GSWB 1H8NA 1J12A 5D2NB 4KX7A 2ZQKA 3PV6B 3EYOA 1GZHC 3BO8B 3QEHB 1QRNA 4I18B 4LLWB 5GRZA 1F8TL 2CJUH 3DX2A 3JWNC 4JO3H 3SE9H 5BRPA 1R3JB 1S9YA 3IS1X 3LN4A 1LVEA 1W15A 3QK0A 2X89D 3LKNB 3AJ7A 1WGVA 4J5VA 4MJ4A 1QRNB 5DS8A 1O7VA 3ZO0A 5J13B 1AOHA 5DK2A 3BN3B 1UB6B 4O2FA 1CL7H 2LU5A 5I5RA 3FKUS 3NCYS 3VGBA 1XQ4A 4X9GA 3UGUA 1BOGA 1G7IA 1XIWA 2I07B 1NMBL 3VD7A 4JO4H 3EFOA 2IXQB 2QR0B 2UVFA 2D4FA 3VU2A 1KG0A 4KY1H 3E6FA 1RUPL 4WW1A 4PGJA 1BLIA 1LE5B 3U0WL 3BQVA 4A7SA 1WZMA 3DX0A 1NBZB 1G7JA 4Z76A 3BLPX 5F6IC 3P3SA 3FOLB 4MA7H 3E6FB 2WQAA 4WW1B 1W72H 4J7RA 3RJQB 5L4JA 2AAVA 4OZIA 4YEEA 4BV1A 1DQQA 1BQ5A 4RGNB 4K2UL 4PCYA 4JFDE 5DHYB 2NY7L 3QZWG 2CHWA 5KANG 3FB8B 1Y7VA 3H9HA 1E6OL 4Z76B 4LEBA 3VD1A 1JGIA 2XZAL 3P0VL 3QWRD 2ZUVA 2VDRL 4Y9GA 4U33A 4JFOB 3HUJB 4NBXB 4OZIB 4HJ1A 1G6RB 3HAEG 1GGTA 1DQQB 1MH5B 3UPCA 5EBMB 1TJIH 2IOIA 3S96A 3MOAL 4JANA 2R59A 5HDQL 1CB4A 5D93B 3IJSA 3FYEB 1G0DA 2VLRA 4JPIA 4CGUB 1RD6A 2UZIH 5J5EA 4JPWL 2XQBL 3EDDA 2IG2H 4P5KA 1RIUL 4YXHL 2NY1C 3B5TA 3S37X 2X6VA 1N7ML 3GXUB 3OM3B 3IJSB 3UL4A 1PKQA 2IWEA 2E3VA 2VLRB 4LASL 1OAXL 3H2WA 1EXUA 4PVLA 1KULA 3ABMB 2WQRA 2HRHA 1QSFD 5C09D 2PR9A 3EJYD 43C9B 4KJQC 1NIBA 3TJHD 3TBWA 2NQCA 1XFPA 2CKBH 1ORSA 2P5WD 2XZZA 2F5BH 3CFDA 1YEHH 2C3HA 1QTYT 2Y5QA 1GW6A 1XD1A 3ARDC 3CHRA 4UT6H 3WJLC 3WMPA 4LHUD 5C70A 5DDHB 1IARB 3L1FA 2F53D 2HKFL 2OQJA 3E3QC 3VSVA 4UAHA 5EUOE 2VW7A 2PXYD 4UT7H 1ORSB 1T22B 2P8PA 4OLUH 3CFDB 3QYNA 3U9PL 3M1BA 4M1CD 4AQAA 5JHLH 5KYNA 1WCQA 1F1GA 2E46A 1M3JA 4PGCB 1N3NA 2OQJB 3T2NH 2XN9B 3VXNB 4M7ZC 4NI6A 4NJ9H 2P8PB 4ZX4A 5E1QA 5J1SC 3M1BB 1XX9C 4AQAB 4LMQI 3GD1C 2BP3A 2DI8A 5D2NE 4IKKA 4MJIA 3W56A 1I7RA 1NGZB 4I4WA 1I82A 1SHMA 4EN3A 1JL8A 4ODVH 1LK3L 2R9HC 5IFAH 2ITEA 4FE9A 4AJ0A 1DVQA 4TQIA 3FU9A 1ZPUA 4XOBA 4Z7UF 4L4TA 1DSWA 1XBDA 4W9FC 4QRUA 2AJZA 1TVDA 3V7AG 3HI6H 5KYWB 4EN3B 1MIEL 2VDPB 2H32H 2HVKB 4E0RB 5IBUG 4WFED 3SDYL 1QRNE 4ODSL 4MAYD 4KJPD 2GBTA 1GC1H 3D08A 2R7EB 1C16B 3ARPA 4XWGL 2Z31D 4AM0Q 1QSEB 2BOBA 2OMYA 4L4TB 4L2YA 3J27A 1XGYH 4PJBF 2EQDA 4ELMF 3RUGF 2VB5A 4IRJD 4JFTA 3N91A 1CZ8L 3DYPA 5CLWA 1IBGH 2PTVA 3QZOA 1EJFA 1ZSHA 1NOLA 3UO8B 3JTSA 4F37K 3BD3A 2CUAA 2R2HB 4J4PD 2IFGA 4J2QA 5E9DA 1S5HA 3F6LA 2ATKA 3FNKA 3WN6A 5HYJB 2ZCKH 2PWHA 4PWJA 1UM5H 1EO7A 4IJTA 4QCIA 3MZGB 4NZTH 3JTSB 5ID0A 1TZOA 4R97C 4XVSL 1KGIA 1YQVH 2PYFB 4RGNE 4YHLL 1LMKA 1S5HB 3JVGC 5E4AA 2ATKB 1JPEA 4LB8A 5I16A 2B08A 4MJHA 4OZGA 5IBLC 2Q8BL 5C2UB 2AQTA 3O6FD 4QCIB 1PCSA 3RE0A 1IEAA 5TE7H 4HT1L 1B6DA 3J8F7 4C55A 3ZL4L 4ZUSA 4OZIE 3IMUA 5ID0B 4AWJC 1PSKL 2FO8A 2P8MA 2OK0H 4UOW1 1TEYA 2O5ZH 3WEMA 4ZAKC 1U6AL 1ACYH 1VJSA 4YQXL 1J8RA 2AQ3A 4DIXA 1G9HA 4F2FA 4GG8A 4YGVA 2BX5A 2QJDA 4Y16D 4ZUSB 5J9PA 2ED8A 1X9QA 4PW9A 5DD3L 1RZKL 2BY3A 3PL6B 4XMPL 4AM0A 3U4KA 2ZSWA 1KJ2H 3TPKA 5FO8A 5K9OB 4U6YB 1E27B 3X3FL 5AW8B 2ZYHA 2VLRE 1XF3A 5SWZA 2FJFB 1WBXA 1RVFL 3LS5H 4JVWA 1CBVL 2I32A 3U6RB 4I1NB 3QJTB 2NUPA 2DM2A 3W11C 5FFLA 4PRHB 1G9MH 1EFXB 2ZSWB 5CINH 3TBTA 3O3AA 1X5AA 3KLLA 1W91A 4JKWA 1PKQE 3BP6B 5AW1B 5SWZB 1WBXB 4F2ME 4X80L 5IROA 2D0HA 4M7LH 1S7SA 2CR3A 2NUPB 4PJHF 3QUYA 2PW1B 1TQCB 1D5BA 1SUJA 3ROOB 4F1SA 4L8DA 3WUZA 2WUCL 3ULVC 1P4LB 3LZQA 1P2CB 2VR8A 4P2CG 4WSJA 4N8VB 1C08B 1KDJA 1JRHI 2QPEB 5AOKA 4GSQA 3F6JA 1WV7T 1RURH 1MFVA 2P3YA 4WNQB 4HXAH 4XN1A 1P6WA 3HI5H 3M07A 2KMWA 2A1WL 4G3YL 5EU5B 1A02N 2IALA 1RJLA 2IDTA 3X1BA 3ATAA 2ZUQB 1QI4A 4K3EH 4DGUA 5I5IA 3RI5K 1UEMA 4L3ED 5C97A 3WJMB 4GXUN 3I50H 5D72L 3GUTA 5BVPL 5LG1A 3RWFA 1IEBA 3CGTA 4FQHA 3HNSL 12E8L 1FL6A 1S7QA 5KSBB 5DJXB 2BHYA 1AFVL 3C8KA 4NDMA 2X4QA 1O6TA 4MJIE 2NZIA 1RJLB 4HD9A 3WY3A 4IKIA 1I8LA 3C5ZA 3ZMRA 3NA9L 1IC5H 3VWJA 5L2KA 5ANMA 3TBVB 3F5WA 5GPRA 3MJWA 5CLYA 1FL3A 1IEBB 4Z7NF 5C0AA 1W2KT 2JJUA 5IB2B 1FL6B 1YEEL 4L4TE 5DK3A 4OCYL 5F1NA 5I8EA 5J6SA 3JT2A 1GAFH 4W9CC 4GKSB 2R29H 4K5LA 1X5GA 1X5HA 3C8HA 5L2KB 2F1EA 2E75C 5L4MA 5BO0D 1FL3B 1KNOB 3BGFB 5C0AB 4NRYB 3UZEA 5B4MC 1MCPL 2IAMC 5T8IA 2BMKA 3PJSA 1BVLB 4GAJH 4S11A 3WNLA 2BHUA 1ET5A 4KKQA 3V52H 5HXMA 2A2QT 1Z9LA 4PBDA 1ZHBA 4X4ZA 1XF1A 1NCDL 3AREC 1JDAA 2UZPA 4WHCA 3TVMD 1RK0A 2QQLH 5EN2A 3P4MA 5E9DE 2TAAA 1A7NL 1RZIA 3UTTB 3VGAC 2BMKB 5I1KL 1NAKH 5G4NA 4JGMA 3KJ6H 3WD5L 4XN9A 4P2RA 2EKSA 5JXAH 1ZHBB 2FR4A 2AW2A 5EZJA 2G5BA 1V8HA 1RK0B 1L9TA 5EN2B 1A25A 3U1SH 2YEZA 3SGEH 1FZJB 2FLMA 2JQAA 5FXCH 5IM7B 2ICCA 2YEQA 3IPEA 4GINA 4FHJA 4OZGE 2X4SA 3ESVF 4P2RB 2F18A 2Q7YB 3U1QA 4DVBA 2FR4B 2CQVA 3L1GA 5C0BB 1P6AB 2B59A 2H3KA 3C6LA 3E8UH 1URLA 1NQBA 3MAWA 4HBQA 5DMGC 2YEZB 4GAGH 4Z7IA 3UG4A 5J7CC 2XJLA 1EANA 5DJDB 3V6BR 5K9QG 3UPAA 4DVBB 1KN4L 2X4SB 1YNTB 4PPTA 4FFWD 3K4DA 1ZGLM 4C47A 2B59B 4MA1B 2XWDA 3G5ZA 3BUYB 4BKTC 1CG9A 1OK0A 2R4RH 2VJ8A 4UB0L 4Y1TA 2IDSA 4F1ZA 5E08L 4YSPA 5DWUH 5SWZE 1OAQH 1E9OA 3I2CH 4TL5A 5HVHC 3L2NA 3TBBA 2XTJE 3U9WA 4RWYH 4CVZB 1SQ2N 3DX8B 4ZX6A 1UUSA 4H8WL 4Y4HC 2GEQA 1L7TH 1Q9WA 2E0PA 4Q97A 4E41D 1HDMB 3ETBF 3Q9PA 1E9OB 3PQYD 4UIKL 4DZ8B 4AENB 2DM7A 3TNNA 4MWFB 5CHNB 3SBWA 3WIHL 3OR6B 2APWA 4FJZA 5F1KC 1FCGA 1BFOB 2ZZUT 2OTUA 4EUPG 3HZVB 4HWBH 2HJLB 5BZZA 1M53A 3WTTA 3K0WA 2VXVH 1SOKA 1Z9SA 3L4ZA 4NQXA 3LIUA 1QHPA 3L9EA 1KBGH 3MYJA 1HWWA 3TNNB 1MWAH 2P42B 3FFDB 5TFSL 5L88H 1CLZL 4FG4A 3VXUD 1B4JL 2BRRH 3LKQB 3M6DA 4PY8I 2Z93A 3P30L 1ZVNA 2JKIS 4AQ8A 5KSBE 1BVKA 1D9KA 2VMCA 4WVRA 5A1AA 1DJYA 3TZVD 3FB7A 3KYKL 4U1SA 1AS7A 5DGRA 3EJCA 3G08B 2H6PB 1EEYB 4NKIH 4HHGA 1SJXA 2IC2A 2XC8A 1GSMA 5TDPA 2DWDA 4LRIC 3GI9L 3FUKA 3LNGA 4M1DH 5F7FA 2AP2A 5MEND 1LO3L 3FF8A 4CVXA 2DWEA 3GKWH 1BVKB 1D9KB 2A4EA 2YGPA 3UEQA 2FSDA 4UTBL 1KENH 4LSUH 2AKRA 4U1SB 3RYMA 4WV1B 3WE6B 5K5YA 4GI6A 4PRNB 2RHEA 1DJXA 4KDWA 2DKSA 3L5XL 4OI9A 4P9HH 2VM3A 3FJTA 4R6UA 5I5MA 5L2KE 3JYCA 1PLGL 1WE5A 3CSGA 5C0AE 4KV5E 2YD3A 5F71A 5ILTH 4YBQD 4HUWA 3AGVA 2DQEH 2NY4C 2DQIL 3Q8EA 2WMPB 5FM5M 5I1AB 4LL9A 3SSGA 1MCSA 4N0UA 4HK3N 1GJUA 1SFHA 2EYTB 4YHNA 3RNQB 5EEYA 4OCWH 3NVQA 5GHWL 4P59L 2EXSA 4IU2B 4HUWB 4TSCL 4F8QA 4LLQA 4UTBA 4G6KL 5T5FL 1MCKA 1HQRA 4FMKA 1NGPL 4HEMA 4JY4B 1KV3A 4UCFA 4B9PA 3B9KC 5IHUH 2APTA 1UD6A 3I84A 3P69A 5KVDL 4YHNB 2D3LA 5MEPB 5AVRB 3MLTA 3BD5A 2NNAB 1FNGA 2ZONA 3DI3B 3EH1A 3QDJB 4A7UA 4YLBA 3SPHA 3U7WL 3SKNA 3WU1A 1R9FA 1OCWH 2WSDA 2ITFA 5CLZA 1RV6X 4DK6A 1PG7H 4P2RE 1FG2A 1RJYB 4OCSH 3MNMA 5T1MA 1CVRA 5IWLC 1AJ7H 2JIXA 3F58H 4UQ3A 5I82A 1KTJA 5I30L 1RL1A 1GGBH 3MNZA 4AYDC 3SKNB 3TPUB 5T5FA 4NBZB 2E7LC 2WLKA 4PJGA 1UXWA 1ND0B 1LL1A 1BM3L 5T1MB 5JZ7C 4LCWD 1ZLUH 3GK8L 2JIXB 4UQ3B 3CZSA 1D7FA 1EHKB 3QH3B 3S48A 4E9VA 1E2WA 3K6NA 4ZD3H 2X3AA 1U3HB 1OP5K 9PCYA 3CFCL 4IRZL 3TXAA 3QUGA 1ZK5A 3AG1B 5AOMA 3CV5A 4J6IA 1EHLL 2BH0A 3DO4A 1E3ZA 1QFWL 4M8VA 4J3OC 5DLML 3ATEA 3OX8A 4NKOA 1SRDA 3AXIA 3F64A 4N2MA 4XO3A 2AF2A 2HCZX 1JOIA 3LPGA 3FFCD 2VMJA 4NOBA 3EO0B 5EUKA 3G5XA 1DCLA 2XN1A 1G7MB 1N6QL 4J27A 4L1LA 3WGVB 3PP4L 4Y5YC 1IL1A 4KDVA 4U1KB 4XNUH 2GJZB 1BXUA 4XOEA 3R0NA 3PNWA 3GWJA 3IRZA 5HI5D 3TF7C 4A7QA 4NO3B 2R1WA 3R4RA 4IRZA 4IOSD 4FNTA 4M61A 1U9KA 1KFGA 4CC1A 5INDA 3OXSA 4XN7A 1IL1B 3QI9C 4XP5L 3RGVB 1S3RA 3DTUB 5AVUB 2DY2A 4IEFB 1INQB 2AK4A 3MLYH 4LSDA 1IZKA 1MFDL 4HG4J 1S9XB 1LD9B 3PNWB 1KPUA 2Q7NA 1KB5L 4XPTL 3MV8A 3KBEA 4UV4H 3FQ1A 4LHQB 4M61B 2ZPKH 4XP6H 4YDKH 5INDB 4MQTB 5J1AB 3AXHA 4JZOA 1ACCA 4ZYKB 2AXWA 2EEXA 2PPAA 4YVNA 3GXMA 4FFTA 5F7WC 2VDOL 3BUQA 4JFSA 5I71C 2YZ8A 1P7QB 1DLFH 4KKCD 3T0EC 1U8IA 2QKIA 4RNRB 4HSAC 4Y5VA 4ANUA 1Z32X 3EHBC 4N8VG 4ZXBC 5AB2A 4N5ED 4JRYA 2EDXA 1DZ0A 3T1FA 1KB5A 2VDLL 1DN0B 2PR4L 4X8JA 3WTSA 1JWSA 1TU2A 1VEOA 2BSCA 3F12A 2VH5H 3VI3A 1N0XH 2JVUA 1AQHA 4DJMA 1E9PA 5D55A 2EDNA 4NHCL 4ZFOL 1LE9A 1A3LL 2AXFA 3GLAA 2Y6SC 4Y5VB 3QUZD 1IT9H 1I8KA 3WO4B 4N0FB 5EZIH 4AKPA 2P52A 3F12B 2XXGA 2NX5B 4GSDH 4HPYL 4LP5A 2LLGA 1E6JH 3NSFA 3P77A 3POHA 3OZLA 3DV4B 1Z9PA 3PHAA 4N0UE 4WU5A 4ZUUA 1HOCA 1I8KB 3HMWL 3UDWA 2YD6A 3EYQC 5C3IA 4KAQL 3MRQA 4LLYA 3ZU8A 1RZ7H 4WI4A 3TA3C 4X6EB 3P77B 4GLRI 1TKWA 4HEME 2VITA 4ZFOA 5FS5A 2E5EA 5FECB 4ZUUB 2OZNA 3SPVA 4IBSA 1XXFC 1T03L 5F70A 3H9YA 3Q2LA 1IX2A 4BFOA 3MRQB 3WFBL 1PNCA 3L5WA 2VN3A 2V9UA 3P02A 4XB8A 4GXUM 2EVHA 1CT8A 4XVJL 4GQPH 4A6YL 1TKWB 2Z9TA 5IB3B 3JUYA 2W91A 4QDGA 3RDTA 2D8KA 1KBVA 4E9XA 4GRWF 4MAZA 1IE5A 2DJSA 3AQZA 2BP0A 1OAJA 4I0PD 3GZOA 3L5WB 4LSVL 5HDLA 4IBQA 3SE4C 1F41A 3L95B 1IBZA 1NMCB 1F8TH 3S97C 1BMWA 3T08A 2VWEC 4PP2B 5FUCE 1N59A 4TTDD 4Z7QE 1MDAA 2EUVA 4PJGE 2Q2LA 3QIUB 1T83A 4A55A 5I6LA 4Y1SA 3OLDA 5C07B 1UCBL 2BP0B 5KVDE 5EOCL 3DURA 3CSTA 5CIPB 1OTSC 2VR3A 2WKOA 1AP2A 4IGBC 1IVLA 2GJJA 4L9LB 4A6YA 2XCMC 3ZZLA 3SDCA 3PDDA 5EO0A 3K6IA 3GHEH 1JPGA 1NMBH 4KRMB 3Q6FA 1OSEA 2MJWA 1E67A 3DURB 3SCMC 3PUUA 1OM3L 1RQ5A 4AQEA 3RJOA 4KPHL 4ZTPL 2E8ZA 5E1AA 4OFQA 1RUPH 1NIAA 3SDCB 2K6ZA 5EO0B 3CFQA 3VFRB 2WO3B 4TNVK 4KFZC 4TVPL 2V7HB 2YQBA 2XICA 3DMMC 2JKLA 5PCYA 4AQEB 1NA8A 5E1AB 1NCAH 3HEIB 5DURB 3A4DA 5IEHB 2FRGP 5AYQA 3GEFA 4KZEL 4FEMA 2DKUA 3GMMA 1CXHA 4HUMB 4K2UH 1AC6A 2JV6A 1NINA 3CX2A 1PLBA 3EO1B 1DL7L 2AK4E 2EIJB 4LQFL 4MNQA 4OR1A 4XWOC 4JFDD 1DQTA 2C9PA 3EGSB 2XZAH 3P0VH 5HYSA 2VDRH 2VDQB 4Z8FL 1A66A 5EF0A 3GBDA 1P6FA 4LLMB 5D2LA 1KJ3L 2XOTA 1ETZB 4NZRL 4Q2ZA 3T3MB 1MCCA 3B6SA 3GMMB 2RB8A 3LZNA 5HDQH 4Y89A 4F7PB 5E94B 1A1MA 3FULA 4MMZC 1U8CB 3UC2A 5IOKA 5G2NA 4POZD 5FUOL 1R4XA 2XQBH 4JPWH 1S9KC 2AQSA 3KM1A 5D2LB 2J3SA 3B6SB 2NZ1A 4YXHH 5BRZB 5AOIA 2VL5A 4LCVA 3O3BA 1N7MH 2X6BA 5E5MB 1A1MB 5D1QA 4JRYE 1QKZL 1OAXH 3RB5A 1LTXA 3DUSB 4ZMLA 5LN8A 4TMPA 1UD5A 3UTZA 3VI3E 2HMIC 4D94A 3IMWA 2NX5E 1NBYA 3BT2L 3FUDA 4ACPA 3E2HB 3ORJA 5FM4A 4OJAA 4E5XG 3OVUB 1FVDB 2ICWI 3NPSB 4ZW8A 3A6OA 3ZO9A 2CLVA 3LJ3A 4ZMPA 4LU5H 5DI8B 1EZSA 3DVGB 5FDWA 4F3FA 4YH6A 4BFNA 5D5MF 3U83A 1ZRUA 2HKFH 1EH9A 1NBYB 3BT0A 3NK4A 5D7SH 5EOTA 5I74B 2X44D 4CUCA 2IDUA 3U9PH 1BZ8A 1UGNA 2E6PA 2DZEA 2Z0BA 1VRSA 3HHSB 5C08D 3RFZA 4HFWB 4PJ7A 5FDWB 4CGTA 1G87A 4DFIA 4F3FB 3ZL1A 1M2OA 5E6IA 3HR6A 4PJ8B 3IDJB 4KZDH 2NQ3A 1CFSA 1FPTL 1BZEA 3IDNA 3LHPL 3S35X 3RFZB 2OMWA 4P57A 3LHAA 3Q44A 2IGTA 4PJ7B 5IJKC 4C56A 3K71A 4RAUA 3RY5A 2WLJA 3KWUA 4G6JH 1LK3H 3N1QC 5JIQA 4H2CA 4CDHA 1YN7A 3WHXA 1G6VK 5D7JC 1CUOA 4JFYA 4N6RB 1UXMA 1CFSB 1C5BL 4NX0A 5LG6A 3UAFA 5JPNA 1CE1L 2D9CA 2FSEA 4MJ5A 2NNFA 4EIGB 1KN2L 3K71B 4JBSA 2OXHA 4HUXB 3VFGH 4D9RE 1MIEH 3BW9A 5DA0B 3SDYH 1YN7B 3WHXB 1MJ8L 1H3PL 1FG9C 2WWMD 4JFYB 4JFWA 5E7FA 4U6VL 4XC3L 4KJYB 2K3HA 4GUQA 4F9LC 2Y06L 4XWGH 2JCCA 2O5NA 4OTXL 5DU7A 2FSEB 5JPNB 1FA4A 3GMLB 1F3DJ 2OXHB 3OHMB 4WWPA 1ZVHA 3D05A 3MV9A 1BQHA 3NRFA 4YIQB 3BW9B 1DJIA 1CZ8H 1A64A 3FRUA 3GBLA 2FH6A 4IBVA 4RRPG 2GBVA 5DO2D 3KGSA 2JCCB 3CIAA 4N2DA 1JI1A 4M7JL 2XZQL 3OKMB 1CL7I 3ABKB 4X6DB 1XIWD 3PDGA 3TFKC 1AXSA 4DP7X 1JV5B 4B3VA 3ZTEA 3QO0B 2QELA 2F19L 2DH3A 4GS7C 4XP1L 1ZV5A 5ALCL 5T1DL 1VSCA 2IPTL 4QHKJ 1NCBL 3TS8A 4XVSH 3QDMB 4YHLH 2JKJA 1KTDA 5FO2A 4P2AA 2J5LB 3VSTA 4RGNC 2WUBH 2XDHA 2ZXAA 4PGBB 1TTCA 4W6XB 5AEAA 1Z9MA 2Q8BH 5I1DA 5IESH 4HT1H 3ZL4H 1KCUL 3PJLA 1TFHA 1PSKH 3NZUA 4MXWL 3VRJA 3GKZA 3O3EA 5DGQA 3ARSA 4MNQE 4Z5RA 4YSOA 4HIEB 4G6FD 3S3BB 5CCGE 5F7KC 1DTUA 4OD3L 1BQKA 4N85A 4WHYG 3APMA 5I1DB 3C75A 5D93C 5D2LE 5DZJA 3UJTL 2ZUTA 1BGXL 1BPLB 4AG4L 4ORGA 5DD3H 4B95C 5BRZE 3FB5B 1SF5A 2J72A 2LLNA 4UILL 3STBA 4FOMA 5ESQA 1MLBA 3O3EB 4AH2B 1OAKL 5GRVL 4FL4B 4TVPE 3T0WA 1Z66A 1RVFH 1I85A 1Q1JL 3UMTA 1CBVH 1KXQA 4RLDA 1HYSC 2VLRD 4P3CH 3KMDA 1HL9A 2DEWX 4PB9L 1X5KA 3FZUD 3SPCA 5I5JA 2QVMA 3B1TA 3BMWA 1ASOA 2Q20A 2XIIA 1S4IA 2GUOA 1W6WA 1Q0EA 1QQDA 3SDDD 3ZDXF 1OSPL 3ZKMD 5D1QE 2YQGA 1X6NA 1GZPB 2CDEA 1JZ4A 3FHEA 2AJXL 1YN6B 3IJ7A 2GAZA 1YCSA 4F7MB 3W5MA 5BOPA 3VD2A 5I6XC 4LQ1A 1TMCB 2WUCH 5LGYA 1RZFH 3GXNA 3S34H 2WYHA 5F7EL 4JY5L 4XNZB 3RNKA 2QL1A 4DESA 1D7BA 4QXWA 1AS6A 5JIMA 1OF2A 4UV7L 2Z35B 2V8LA 2A1WH 4PJ7E 4F33A 4MVBC 4NO0A 1WFJA 3WG7B 2WTOA 3HPLA 4ZO8A 4QY8A 2AANA 1N8OE 5I1GL 1AE6L 1QPXA 3GSRA 3B9AA 5D72H 4ADGA 3CZKA 3MRHB 5BVPH 4UBDC 1IGYA 1L3NA 4QWWD 3ARQA 2ENJA 12E8H 4GFTB 1Z0MA 1TZAA 3CHPA 5HHNB 1U42A 1AFVH 3NCJL 4C56E 4F33B 2IQ9H 3F62A 3C60B 1GS7A 4DNLA 2ITDB 4MJID 3RVWC 1CDBA 2P24A 3NJFA 3STLB 3NA9H 3ECVA 3O6LL 4EN3D 3MJ8A 2OJZL 4NFDA 3WTWA 3QUML 3B8YA 1IGYB 3HNVH 5EIIA 4X6CA 3US1A 3MRPB 1P5UB 1YEEH 2VAJA 4OCYH 2DQTL 3NIFF 5HYIA 3V6ZB 3W38A 1RJCA 3CWGA 4GSRA 4GUCA 2OYKA 4BJLA 3FONA 4MKTA 4P49A 2H0FA 1N19A 2HFEA 2HTKC 1N5AB 3MJ8B 3MRJA 4A67A 3MUUA 2JCCE 2RA1A 3L5JA 5DFVD 4X6CB 5EIIB 5BRQA 4JG0L 4IMLB 4OT1L 3PWPA 2IPUK 4L29B 1H15B 5J89A 4DPCX 1YDPA 4JX0A 1HX0A 4LESA 1XB3A 4ONFL 2G9HA 2I5YH 2FQEA 3ZOAA 2HFEB 5CO1A 5EZPA 4FNRA 5HGHA 1WF5A 2H2PD 3QUMA 4LIQL 1MF2L 2AJVL 4PJAF 2JB5L 3G5WA 4R96B 5IB5A 4ZT1A 2B77A 2N1TE 3PWPB 3QGVA 4XX1E 4YZFE 4ISVB 5I1KH 3O6KL 5E9DD 1S9VB 3CQQA 3WD5H 1YDPB 2FECL 1WIPA 4J1UA 1XF4A 3MUZ1 2A83A 4YSTA 3T3PF 4CJ0A 4BE5A 5K93A 5HGHB 1NICA 2CZNA 4R84A 5IB5B 3US9A 3AW5A 4GKZA 4HCGA 5HGDB 4P5MA 4AEFA 4Q0XL 3CC5B 3OZ9L 3PP3H 3UOAB 4N25A 3BWUC 4L1DA 5AWNH 1FE8L 3QORA 4AW4A 1XF4B 3HIZA 1BBDL 2A83B 2WZ6A 5I15H 3CN1A 4ZMXA 1YECL 3EGXA 3ZYIA 1JUFB 1IBDA 2MHAA 3VD3A 4GKZB 1A6UL 1U8NB 3DTXA 4KKAD 4UQBA 1HL5A 3PL6C 4YGAB 3S3SA 5F7BA 3TCLB 1KN4H 4FJYA 1BEXA 5JDSB 4XBGA 3BVDB 2ZWLT 3D33A 2DLHA 2HH0L 3EGXB 4HSCX 4IHOA 4N0YH 1HIMH 3QPQD 1KGJA 1FRGL 1TJHL 5E08H 2D3VA 1J5HA 2VR6A 1KXQE 4XVOA 3T4AB 7FABL 5KBDA 4FD0A 4WZ9A 4IHOB 3MFFB 1WS7A 5EU3A 1J0IA 2DLTA 2OULB 5HJBA 2XTJD 4XTRC 2JLLA 1A6ZA 4H8WH 4LP4A 5E6UB 2SEBA 2G2RA 2V2XA 4H8UA 4QRPA 1AO7A 1OP3H 1AC0A 4UIKH 1WZ1L 5HBBA 5GGUB 3F01A 2VZTA 2FUQA 3BGAA 3V0DA 5IROD 3THMH 4M48L 2ZKXA 5F7LB 5IOPA 1IGJA 3HNTL 4X5LA 5FF6A 3QUYD 3ZE1F 4EIUA 4AYBA 3BP7B 1SHXA 3NCFB 3HN5A 5FKPB 1FC1A 2VNCA 4XNYL 3O9WC 5CEZL 3LB6D 3GT6A 4FQJH 2H8PB 3RPKA 5TFSH 4UOJA 1F4XL 1CLZH 1T1ZB 4A7GA 5IOPB 1ILUA 3QWNA 3P30H 4NQCA 5CR1A 2QSCL 2FJGA 4PP1D 2VN7A 1OGAA 1K5WA 1KFAL 3V55A 2IVFC 2VSDA 1KTLA 3MGOB 4N0CC 3HAEB 4H0GA 4P4KD 1LO3H 2PWFA 1MVUB 1A6VL 4RMRA 3V0IA 4OGQC 1I9JL 2M2DA 4XCFL 4UTBH 2UY6A 4PJ5A 2WKLA 1V3MA 2HFFB 5EFIB 3AU1A 1M6OA 1KTLB 2V9QA 3C5ZD 1PLGH 3DUUB 4JZJB 3VWJD 5L2KD 4G9DA 1NSNL 4X6CE 2HKHL 5CS7A 5J12C 3O4LD 4XNMA 2AXJA 5C0AD 2UY6B 4WGVB 2DQIH 3MNDA 3OF6D 4Y7OC 4QOKA 4JVUA 4DP0X 3UYRL 4G1MA 4XO8A 4ZG1A 2HPOA 1E4XL 1WTGT 2R8SL 1KCLA 2ARJB 2LTQB 3GI8L 4P59H 4TNWF 3UCQA 2XRAH 1U8QA 4FG6C 4J3BA 4TSCH 3PWPE 4XNMB 2J1XA 4G6KH 5T5FH 2EE0A 2GUYA 4Z7VB 2WXIA 4QOKB 5TPWL 3Q1EA 5HDBF 2C4XA 4PV9B 4ZFGH 3AAZB 5FFGA 2Y1AA 1FVEA 1EBPA 1I1AB 5D1XA 1MN4A 3D6GA 4PJCF 3WSQH 1U8QB 1J05A 1COBA 3U7WH 1BDYA 4GT0A 2BNQB 1VFBB 4HA1A 1EX0A 3VVWA 3FTXA 4DF9A 2FQDA 3Q48A 2PP8A 4YSAA 1AQ8A 4IKNA 2FX8L 5A3ID 2YRPA 5I30H 1QX1A 4GP4B 1URZA 1GPOH 3OZKA 4KHXH 4IBYA 5HHOB 3BUTA 1A47A 3LOWA 1JZ2A 2DQUL 3SGEI 1S9WA 2X3BA 3D1MC 4YDIL 3VH8A 1BSIA 3GK8H 2AJSH 2IWKA 3FSOA 4LIQE 3TTYA 3C6LD 4IRZH 3VDAA 3C5XA 3RRQA 4BZ2L 5KTEL 1H8OA 4BFBD 2HX9A 5K1JA 1EHLH 4ZPVA 5IBUB 5G55A 2OJ1A 3FCBA 1QFWH 3VH8B 2GIXA 5DLMH 3ATDA 4LAQH 3V0AC 2OMVB 5J3HC 3VFSA 2UYLA 2YOCA 2HUEA 3U30C 4Z3HA 2GG1A 3QAZB 2RCSL 5GZOA 1ITCA 5F7HA 3HG1A 4EI0A 3HTLX 2YD2A 4DGYL 3GSUA 3U2IA 4PRDA 4ZPVB 5JORB 1OGPA 4UOW0 5E2UL 1E40A 2W92A 4XB7A 1NWPA 3W1ZA 1DANT 1QBMH 3GJEB 5D7IF 3PWVB 3V0EA 1ZA6A 4DVRL 4Y0GA 4BZ2A 3HG1B 3CUPB 2Y9RT 2F74B 4LDOB 2P48B 4QRPE 5H94A 3GSUB 3RKDD 1AO7E 4PRDB 1X9LA 3RL1A 3DDGA 2YOAA 4TSBH 5ACZA 2D7NA 1OAYL 4XP5H 5FR3A 5AALA 4I9XA 3FF7A 1MFDH 4V1DA 4QTHA 4JFPA 4X7FC 1KB5H 3MBXL 5ETUB 5KW9L 3STZA 3T77A 3DGDA 2OLDA 4HX1A 2FIRT 4L3AA 3VVVA 1TYRA 3AWFA 3HE7A 4WWID 4ZQTA 4V1DB 1SXNA 5IFHL 1I1CA 3LIZL 3S5LA 1RZPA 4AMXA 3STZB 3T77B 4NQCE 3WEBA 3VFOA 2VDOH 4D7PA 2GABA 1A3RL 3HE7B 3RHWF 3VMPA 4UZSA 1VGEL 1D9KD 1OGAE 4UNUA 1PJWA 4CILA 3NTCL 3AROA 4K7FA 3ZT5A 2KPWA 3I02A 2VDLH 3S5LB 2PR4H 4WV1C 4K8RL 5DTFB 3UTPE 2BLFA 4AL8L 3FN3A 4PJ5E 5JYLA 3EBIA 1PEZA 4NHCH 5CEZE 3AM8C 4K7FB 5GQBA 4PV1C 5CLXA 3BH8A 3I02B 4DQOL 6CGTA 2GTZA 1MY5A 4QRRB 2ALAA 4NN6B 5DHXB 3WKMH 1NL0L 2C9SA 4FQXA 4HPYH 2FEEL 3IMTA 2ENSA 4Y2DB 4ELKA 1DQVA 3TONA 2O61B 4QOKE 1ZTMA 5JDJA 1UZ8A 1X5IA 2GB2A 3IN0A 5FV2A 1OZUA 2GTZB 1QNZL 4KAQH 1BYNA 2J25A 2G4EA 5KWYC 4FQXB 2IAAC 4B27A 4HCRH 2ZOUA 4ELKB 3AWEA 2NXYB 3K6SB 5EU6A 3LRSB 5B8CB 2N59A 4R2GD 5F9WB 2UZXB 3MPCA 4Z7UB 4NC1C 5F72S 1NAML 1AZVA 1AG0A 4R7LA 1D2OA 3H42H 3IDYB 4LHUG 3EFDL 5D1XE 1XB6A 4EKJA 4XVJH 2FHBA 4A6YH 1M57B 4BZ1L 3HS8A 5AW2B 4KZ0A 1DVFA 1J5CA 3UBXG 4WTZG 4YDMA 4PJXF 3NT0A 1XDTT 1U3YA 2ADJA 4X5RA 5E8OA 4LSVH 5GS0L 2IEPA 4FGMA 3X17A 2V7NA 1M4KA 4G80B 1PD0A 4JRLA 1U3HC 5FIEA 1FNAA 1U3ZA 1UCBH 2HVJA 2WPGA 2Y36L 3B1UA 5EOCH 3WOVA 1OV8A 1XR9B 1XGUA 4NNXA 1TZHA 2XU9A 2Z6FA 5F7DA 2DBLH 4YLQT 3ULVF 2ZNWA 3GMPB 4FNSA 4BZ1A 3IJ8A 1U93A 3DKHA 1DDHA 3SY6A 2VXTL 3ZDZB 4G9FA 2FX7L 2VIRA 4CADA 2VZVA 1NAMB 1XGRA 4BH7B 3LV3A 3QWOA 1XGUB 2DLFH 2VERA 1TZHB 1TTRA 3ZT7A 4KPHH 4LDLB 4ZTPH 1QEWA 4YL9A 4RGOL 3L9RA 4NYLA 1U93B 3HG1E 3FT4B 4GXVL 4F2MA 1UKSA 4ZMTA 1LK2A 3BH9A 4CADB 4TVPH 3H0TB 4Q14A 1NC4A 4Q6IA 1B0GB 1QTPA 3RGVC 4IOIB 3DIFB 3QZBA 4NYLB 2Y7LA 3BVVA 5JORA 4F2MB 5DJ0A 2W95A 1KELL 4KZEH 1LK2B 3AGWA 3BH9B 4MD5B 5DRNB 3T6WA 3ZKSD 4R90L 1DL7H 3CPLB 2HUHA 4V1DE 2I9TB 2QPSA 2AK4D 4TL4A 3TOPA 1YHPA 4AQZA 3H8NA 3QJFA 4Y4FA 2QVTA 5HGAB 1KJ3H 3EYVA 3RPIA 3MV8D 1IAIL 1KC5L 4NZRH 4TS6A 5DJ0B 4AYMC 1IKOP 2R2EA 2AJYL 3QFJA 4N2KA 3D4GA 3VRIB 3FBQA 4KXZH 3NP3A 4PJEB 3DVNB 3GSOB 3ARYA 4D0BA 3AZUA 3KZ8A 3H54A 3OJ2C 5FUOH 3VX1A 3QJFB 1FH5L 3RPIB 1J5DA 1L9RA 3KW7A 2R2EB 1WEJH 2HA1A 3QFJB 1PYWB 4IBLT 5AVZB 4EI6A 3LZRA 2COQA 3UZQB 5CWSB 3NZ8A 4XXWC 1TPXB 3VFMA 2ZX8A 1J0ZA 1QKZH 3R8QA 1BZDA 2V33A 4GAYB 4QIRA 3DYOA 3O2DL 4FLQA 4JRYD 4N90E 2DYSB 1DVUA 3WO4C 3B37A 3BT2H 2XXCB 4NUMA 3S3CB 4EI6B 4PY8J 1Q9OA 4MCYA 3S36L 1UJ3A 5HSFA 4JZNA 3VFMB 1A6TA 1FYTA 4XXDA 2MQGA 4ODWA 2BVPB 3W11D 1EK3A 2R1XB 4O4YL 3KYAA 1MCOL 1TZIA 2A6IB 2Y4SA 5CU9A 3PWLB 2B0SL 4HH9A 4Z23A 2CBPA 1JD7A 1Q9OB 3EJRA 5T1KA 1T03H 2ZP9A 4OLXL 4XMLH 3QUHA 4X4YA 4ENZA 3TO4B 1SDYA 5DD5L 2E27L 4NFCA 4X7CC 3O2DA 3MBEA 5JPMB 5C0IA 4F7EB 3SQRA 1TZIB 4GQRA 3MACL 2R23B 4FQ1L 3SGJA 4TLTA 5I0WA 5EU6E 1AXTL 2AI0L 5CMAA 4Z7NB 5C0CA 5HI4C 4WY7H 5F9AC 3NZHH 2L7UA 2QFPA 2WWNA 3WMQA 3Q6GL 4KOCA 3ULUC 2UWEF 5TK4A 2PP7A 1RI8A 5C0IB 5CEXB 3ML9A 3AT0A 3CDYA 2BSRB 3IWUA 4U1JA 4ZOBA 3OR7A 1C5BH 3HVNA 2CD0A 2ZXQA 1BJ1H 1NMCC 2JELL 3RDTD 4IBWA 2WCSA 1KN2H 3QCTH 4MDRA 3VI4F 3QHZL 1AGCA 3H3PL 5IB1A 3QIUC 4H4NA 1MJ8H 1H3PH 2NNRA 3OWEA 1SXBA 3BLBA 1F0LA 3LXBA 3OR7B 4N1CA 2VSMB 2Y06H 4GQ9L 4XC3H 3S6CA 3UH8A 4OTXH 5GRJL 4L9LC 4U7SA 4FAAB 1KLFB 2K6WA 5IB1B 3HZYA 3OAZK 1NEUA 2UY7B 4NPYA 1JAEA 1HWGB 4A66A 1WBYB 4R4BA 3O2VL 3SDCD 2ZF9A 4FDWA 2C3VB 5AKVA 2XX0A 3NMEA 2V5TA 1HILA 2AEQL 2X9YA 4P2OC 3HZYB 4ONHB 1Q9LA 1Y6MR 5JW5A 2F19H 4F58L 4NPYB 3HHMA 5ECJE 2B2XL 2BS9A 4XP1H 4AC4A 5ALCH 1KB3A 2IPTH 1AACA 1BM7A 2FB4L 2FJUB 2I27N 4R4BB 2XETA 3N43F 5DURD 3RVXD 5EULV 3AXLB 4I0KA 1UFUA 2CK2A 1CYXA 3S2CA 1HILB 4PI2A 4TQEH 4MD4A 3BQUA 4Q9RL 3HKZA 2AXHA 1Q9LB 2DMBA 2XX1A 2FWSA 1NOAA 4FQPA 4GKNA 4KO9A 4M43H 5BZWA 5KVFL 1TQBB 1KCUH 2OMXB 4IIQA 2HN7A 3WELA 1MDTA 3TL5A 1KCKA 4J3OH 2WM0A 3BQUB 2KZKA 4G42A 2N56A 4MNQD 1ODUA 3KPLA 4LARL 3S3PA 1LGVA 4GKNB 5LQBL 2AEPL 1RFDH 1BGXH 2XPYA 4IIQB 1QLRB 4AG4H 4R3SA 5KOMC 3IF1B 1P4BL 3QFJE 4UILH 2Z64C 5CGMA 4HYTB 1QATA 1I9IL 1YC7A 1ZSDA 4I8DA 1Q1JH 4TVPD 3KPLB 5TDNA 1HT6A 3I6GA 3V0VA 4M1GL 2H0PA 1J18A 2ZXWB 4MA8H 2CR0A 1T1YB 3EKCA 3KPOA 2LOEA 2YBGA 4JPKL 2ICEA 1OSPH 2DMGA 5IHZA 1ZSDB 5EBWA 3E2HC 5F7MC 4PWHA 3HFMH 1L0QA 2BSSA 4P9ML 4LVOB 5D1QD 3I6GB 3JWOL 1C9SA 3CBJB 2AJ3A 2AJXH 4HPHA 3QA3A 1LLAA 2XKNA 3V4PB 2OR9L 3H4FA 1EPFA 1ZKAA 1PF3A 3WEXA 2ICEB 3Q01A 4DKFL 1SGKA 2GEEA 2Z92B 1FYTE 5I74C 3TWCL 3KVQA 5H37A 3QFDA 5FKAA 2AJ3B 1IKFL 4G59C 4JY5H 5F7EH 3QA3B 2X0WA 4MYPA 2WYTA 1IM9B 2GI0A 3GSNH 5ANHA 1S6NA 4PJ8C 4UV7H 5FEBA 1BW8A 3UYPA 1YEJL 3CIQA 5FCUL 4LEOA 4V2CB 3RFZC 4PI0A 2JWYA 1CXIA 2NT1A 2P26A 5I1GH 5JTWA 1AE6H 5E6ID 4FKEA 2R0ZL 2Y2WA 4X0NA 3JWDC 5C0CE 1HH9B 1FVCA 3O41B 4FLHA 3NCJH 4LEOB 4C56D 2VZUA 2EE6A 4TUJB 3QULB 3RIAF 3O6LH 4PJIB 1RUKL 3F7QA 5I1EH 5FW7A 2OJZH 3QUMH 3UTQA 3VXSB 2APVA 2ZUYA 2VDNL 4K3GA 3SPJA 3T2LA 4ABVA 5JYMA 3OKLA 1FVCB 3TN0A 2F7OA 4QI3A 2YRZA 3FT1A 1LQSR 3L3IA 1AR1C 4AIXA 4RBPH 3CZLA 2AQ2A 2UVEA 2DYPA 1JHTB 1T0MA 1O0VA 2BIHA 1NC2B 3FH5A 1VACB 3KLAB 4HLZH 4OAWA 2NY5C 3UTQB 2X2UA 3D25A 4JG0H 4OT1H 1THCA 2CBMA 4OGYL 2WLIA 3CVCA 2PKDA 4DGVH 3L3IB 1BQLH 3MR9A 1X44A 3L4XA 1WIOA 4P5RA 1TDQA 3FU5A 3ULSB 3MV9D 4ONFH 5E2TL 1E28B 5D4QA 4OAWB 2V5MA 1IGIL 1HZLA 2ICES 4HHAB 4LIQH 3D25B 2AJVH 3V6OA 2JB5H 1LEIB 3PXLA 2FBJH 1NCWL 4K3JL 1SYSA 2VLME 3O6KH 2IWGA 4KQ0A 1LEKA 1T1WA 2JI1A 4LSQL 5CSBA 3VGDA 1JS4A 1I3GL 2J5LC 2CO1A 1NZRA 2JKXA 2BJML 3K74B 5IK3A 1E9QA 4FLRA 4NO2A 3B9KD 2Z65C 4Q0XH 1MIML 2BY1A 3OZ9H 3ZTNL 2UXFA 3MGAA 1NCTA 1CQKA 1FE8H 5LXGL 1LEKB 2B4CL 4M6ML 4PS3A 5DVKA 1RAMA 4JR9H 1FP5A 4P8QA 1YECH 2MEJB 3PREA 3UPRA 1P84J 2VTFA 2DKMA 4RISL 1E9QB 5IK3B 4K9EL 1CF1A 1GW0A 3UTSA 3KWWA 4F7CA 4NCDA 4M5SA 1W80A 1E0OB 2QHRL 3LKRA 3OBAA 1T5XB 3NFPA 4FL4C 2HH0H 4OSUH 4BK8A 1TTUA 2BNUA 4FP8L 5I8CB 1MG3C 3UTSB 4EDWH 2WXOA 2O6CA 1FRGH 1TJHH 3KWWB 5A7EA 2M1KA 1KGCE 1GMEA 7FABH 1D5ZB 3OAYH 2NPLX 3NFPB 4V2BA 1KLUA 1NFDF 5KVFE 5LUMA 2Q76A 5K9KA 1OAZL 3LNIA 1NJ9A 3LEVH 1V3KA 3KS0H 5IR1A 1KUMA 4QXTA 5LAXB 4PRPB 4BKLA 2XFXA 4Y4KA 1QNIA 2RGSA 4BCYA 3FPYA 3DXAA 3SJVB 2X4NA 3QZNA 3ZUCA 4WNSA 4ZTOL 4NT6A 2Q76B 4M48H 4RVBA 5K9KB 4PBWD 1U8KA 2D4DA 1INEL 4QXTB 4Y4KB 1HL4A 3BAEL 2X4NB 4PW4A 2YD5A 4K5MA 3KCWA 3QEQB 3EDEA 4PJ6A 2Y7NA 5BVJB 2DWXA 4ENED 5I0YA 1T7YA 4P4RB 4WI7A 2Y7SA 2QSCH 2DB8A 2DQJH 3NG5A 4PS7A 3GS0A 4KXDA 2DH2A 5DEGA 3OLGA 4HIIA 2J12B 1UM4L 4NO0D 5I8OH 2NTSP 1M2VB 1CD9B 2ICWJ 4JHBA 3C60C 2EYSA 4Z3FA 5IZ7A 3VXSE 1A6VH 1DQLH 4XCFH 2G3XA 3P3UA 4LGSB 1WICA 2YC1A 1BQSA 3KBFA 5DEGB 4JJHA 3CVHL 4HIIB 1P5UC 5AZ2L 4Z7WF 2J1KA 2YS4A 5CEYA 1CURA 2O6PA 4B9YA 4MA3B 2C3GA 4OLEA 1ZGLP 1VKXB 2O4EA 4MB5A 1Z6JT 1NSNH 3LZOA 2YA1A 2YD0A 5DSCA 1RSFA 3D2UD 1M7UA 1WH0A 3VSQA 3RAJL 3EHBD 4FKKA 1BQRA 5ELIA 2FO4A 4JFZL 3UYRH 1RKRA 3G9AB 1E4XH 4DUVA 2R8SH 3BWAA 5CN2A 3X3GL 3G04B 3GI8H 4KI5C 4E5XB 1VERA 4DEUA 5DSCB 2HJKA 2JKTM 4GI9A 4QR7A 2BW4A 3ZR5A 5EPMB 1I3RA 5TPWH 5KYUB 3VE0A 2FO4B 4QXGL 3KH3A 1Q90A 4TSAL 1MQKL 2WBJB 5F7AA 3CZUB 3H9SA 1NLDH 1IBYA 3KYNA 3V6OE 2FX9H 1JPSL 1JYWA 5FLUA 1F4HA 1YVLA 4GEIA 5BO1L 3IKKA 5EC2A 3SYQA 3CVHB 4CA4A 1RJZA 1RHHB 3PLYA 2R69L 4BK5A 3TA3D 4K94L 2GY7B 3H9SB 1LWHA 1JRHL 4KK6C 2CHNA 2X4PA 1QVOB 3ARXA 3HLAA 2NY2D 4Y19B 5J8OA 2BNRD 1VFUA 4FYTA 1HHHB 4NZ8A 4GO8A 1N0LB 3PWJB 5EC2B 5B1KA 3SY0B 2DQUH 4JQIL 2P46B 1CLOH 1GGYA 1GOGA 5AFAA 5G5DA 3QORD 2NRDA 2H26B 1KYOK 1IGMH 1EAPA 2X2HA 2WIIA 3ILPA 4W68A 5EDSA 1NKGA 4HGKC 3UTSE 1JDCA 2DN7A 5KTEH 3IGAB 4LGRB 3B2VL 5CZRA 3AUVA 5I1IL 1K4CA 2OKMA 3FK3A 5E95B 2LR4A 3W5NA 4Q9BA 2R69A 3V5DB 4HMDA 4N6QA 5D9SA 2XWJB 1EAPB 3FBKA 5EUOF 4TYUA 2HJFA 4OY9A 5D7LB 3T4AC 2DQ6A 2RCSH 3K5SA 3BIAX 1HSAA 5E2WL 3TT3L 2BIMA 1C12A 4XMZA 4DGYH 2KLTA 5JNYB 5FCSH 4HC1H 4JQIA 3P73A 5B39A 1OTSD 5E2UH 3P4NA 3HI1A 3MRDA 4H25A 5I1JL 2FT8A 5D9SB 3WENA 2VMEA 5H2BA 2C3XA 4JVPA 2HVBA 4BINA 4LLDA 3U9UB 3VA6A 1C12B 1YPZA 1GIGL 4GQZA 4CJ1A 4IDJL 3R4DA 4AVJA 4QRPD 1OAYH 3DXAE 5B1CA 3VXMB 2FT6A 1AO7D 5HHMB 3CHQA 3SGKA 3P4NB 2OR7A 3NCCB 3QJSB 1HE7A 3MRDB 4H25B 5IREA 1W6LA 4JM0A 4IK6A 1EZUA 5KW9H 4G82A 4E9WA 4LLDB 1YPZB 4MBRA 4NRZB 4OD1L 3QPXL 4KWUA 4NP4H 1N6UA 4K3DL 1EEUA 3JVFC 3QRFM 5F0MB 2RR3A 2E59A 2MRYA 1NUFA 2I9LA 3CDZA 1SM3L 3L2MA 2W07A 2IANB 5DUJA 5IFHH 3H55A 4J8QA 3ZDWA 4GAAA 2OYPA 3ML8A 4ZX5A 1DJSA 2QGEA 1IGCH 4X4KA 5I76A 1ZT7A 1A3RH 4NQSA 1QWHA 4NQCD 3L13A 1VGEH 1A4JB 3T6XA 1OW0C 4XWOD 3EYUL 2I9LB 1OGAD 3CDZB 3QO1A 1I1FA 3OQRA 5JUEL 4P5SA 1XO8A 1HJBC 4JMNA 1UH2A 3GS7A 4LBAA 4K8RH 4JJOA 3CK0L 1WWAX 5I76B 4AL8H 3UTPD 3RWHA 4JZJC 1DBBL 2YSTA 3AFLA 3V0WH 1YEIL 2F9BT 1X7SA 4PJ5D 2QTEA 3U7AA 2XG4B 4NO5B 4KMTL 4YMPA 3BCFA 4AV5A 3Q8BA 2X1PA 3ARFB 4LHJB 1WPCA 2FK9A 3CVIH 4DQOH 3MJ6A 1NL0H 1THAA 2KDGA 4YAQA 3ZUNC 1JK9A 1TSHA 4OLWL 1FSKB 1T2XA 4K71B 4OGXH 2LTQC 2Y69B 2WVTA 3HRZB 1R3IL 3QAQA 3QP3A 5FGBA 4QOKD 5CP7A 1ZMYA 4OVVA 3LSOA 1FO0L 4OZIF 2C1PA 2DL9A 2W81C 2X4OB 2X09A 2XIBA 1K5NA 2CHDA 2CJ3A 4QT5A 1I1AC 2ZAGA 1UATA 2YKKA 3REWA 4PG9B 1K3IA 1TVHB 1NUGA 2NZ9C 4XI5D 3Q9QA 2JJTA 3UCRA 2QHLA 4CBPA 1ETJA 3H9SE 2EH7H 3EFDH 1S7WB 2R1YA 2QV4A 1AOZA 1XSOA 3IGKA 5D1XD 3U82B 3CBRA 2ATPA 1T66C 4PBVC 2X2IA 4JFQA 2Q5BA 2PABA 1HL8A 4BM7A 1NCGA 3J07A 3A6CL 5GS0H 2ZXBA 1FO0A 1KCRL 2I60L 2MNWA 4QRTA 4OJEH 5L2JA 4WI9A 1DJGA 3GJFK 3HC3H 4JFQB 4LDCA 4WQOA 2NLJA 3T0VA 3ZX1A 3L7EA 2Y36H 3B56A 4U3SB 3VJ6B 3OLIA 4DZBA 4EOWH 4F8OA 5HGBA 3X13A 1PZ2A 4DPBX 2AABL 5D7JD 1QPKA 5TGBB 1DBML 2EDLA 3DBXA 5EO9A 5L2JB 3T6ZA 1U8OA 5MEOA 4N9GA 4JDTL 2VXTH 3WI9A 4XPGL 3EJZD 3D0VB 2MTAA 5I17A 2EDRA 3CFJA 4DCQA 1ODAA 5HGBB 3X13B 1QFWI 4A2HA 1X5YA 4QPEA 3LPOA 3S4SA 3ETSA 2SODB 4JO2L 4RGOH 4XMKL 5FM5O 3MRNA 5MEOB 4GXVH 1E5YA 4N9GB 5DFAA 5GZOD 3V2AR 4QLWA 3HG1D 3H53A 1NCNA 1CLVA 4PRIA 3UAJC 2YIHA 3CFJB 5C9KA 1JCVA 4GAFB 3SKMA 5LDSA 1P0SE 4Q6KA 4X42A 3S4SB 4MDJB 2Q87A 3MRNB 1YPZE 1DE4A 4MQ7A 1ZA3A 1KELH 3BXNA 3S7GA 1E4HA 2JTDA 1LWRA 4PRIB 5GZNC 4R90H 3SKMB 4YFEA 4L37B 5B21A 2IANE 2ALWA 2OMUA 2ERJB 4C57C 1PJ9A 3RX5A 4V1DD 5CNHA 4XAWH 5EH1A 4JE4B 1OCZB 4WCYH 3PG2A 5IVZB 2VR5A 3S8GB 4WI6A 1QFOA 3FRPA 1KC5H 4MQ7B 1ZA3B 3N6YA 2HT3C 3BXNB 2AJYH 1WRFA 3FT3A 1DFBL 1JGVL 3O6ML 3GGWA 1VPOL 3NABL 4YFLI 2VT0A 2BZ7A 3HE7C 1QLEL 2OMUB 4NQDA 2CIIA 2K70A 3ZDXB 4AW7A 4UYPA 3L54A 4EI5B 3DETD 3MOQA 2LAAA 3BRDA 5H4ZA 2GYSA 1FH5H 3RG1C 1HKFA 2FGWH 5I6MA 2R2CA 1ZE3C 5T1LD 5C0FA 3DHMA 2VERN 3AUWB 3NDZE 4HZLB 5DO8A 2ZSVA 3BOVA 3C08L 4U2YA 1NGQL 4NQDB 3T09A 1Y1UA 3ZBMA 1WAEA 2GT9A 2OI9C 3MREA 3O2DH 3T6QC 4KNSA 2ARWA 3Q1SH 3KLSA 4H8HA 1HINL 4N90D 4NN6C 1F1DA 1I75A 2E6QA 1A9EB 1E30A 3S8WA 2ZSVB 3S36H 2EACA 3H2QA 5C8JA 1J0HA 4Y2DC 1HAWA 3MREB 1ZLEA 2FL5A 4MJ6A 1MCOH 1F11B 2JMRA 4MB3A 4XOAA 5BOZG 4OLXH 2NXYD 1YUHA 2DICA 3EJTA 4OZGF 1HXMA 2ORBL 5C8JB 4GRLA 4X8CA 2E27H 1S8DA 1PAMA 4RZCA 5B8CC 3FO9A 3Q2NA 4M03A 5CLTA 4CMMB 4K8RD 4MJ6B 2P80A 1MWOA 5KAQG 4DO6A 3MACH 2AC0A 4YJZL 4OJCA 3U2SA 1AQDA 2HRGA 4FMVA 2AI0H 2HLAA 3IJEA 2H0JA 4GRLB 4LF3A 5EU6D 2ZUSA 3CG8A 4XPAL 3Q6GH 1S8DB 1E5UI 3FO9B 3HE6A 1ZT4B 4G6AC 4KK8D 2Q7AA 4ODBD 3A23A 4FFVD 5AKTA 2KT6A 2OSLA 2GFBA 1JVLA 2JELH 3FB6A 5JQIB 4MVBD 3IJEB 3O4OB 5AZUA 1DVFD 1QR4A 3F3HA 4FLOA 5GRXG 3JZ7A 3QHZH 3GMNB 3H3PH 2GJPA 3HE6B 3KE0A 2GI7A 3M88A 5C0ND 1DYZA 4GQ9H 1MCFA 4LPXA 4W9DC 2OSLB 2GFBB 4LFHD 4BK4A 3FB6B 3BEVB 5GRJH 3T2QA 3WKYA 4PJAB 4LBEA 1BJMA 2MOQA 2A74B 3MNVA 2G5RA 3Q2WA 4I88A 2ZP8A 3B9VA 1FGNL 1O9ZA 2X70A 3Q3GA 1B0WA 4OUUB 3IBOA 5I26A 1A8JH 5D7KD 3RWGB 3JBG7 2RBLA 3N42B 2QV2A 1ZLVK 1AGEA 2CMRL 1PEWA 3O2VH 3REVB 1P4UA 2L0DA 2O1AA 2DWTA 4FXGC 4LBEB 3ZSSA 1SZNA 4OKVA 4G9FD 3MXVL 3IAPA 2DM3A 4Z77B 3WS6C 2X70B 3Q3GB 1QG3A 4P99A 4F58H 5GS0D 3DHJA 3SIKA 3RWJA 4JG1H 2FB4H 3LZPA 4ZUVA 5KSBF 1T20A 1AGEB 4HWNA 4HOMA 5KSAA 4M6OL 3BDBA 3C6SB 4PRIE 1I1YA 2F68X 4JUTA 1XZWA 1NKRA 4Q9RH 1FL5A 2EXYD 2EC9U 4LEEA 4NKMB 2ZTBA 1QWUA 5EA0L 4XRCA 2O6EA 4HKXA 3F00A 1NC4D 1UM6L 3RVTC 5DUPL 1CD1A 1P1ZA 4CNIA 4R7NB 2NDGA 4HETA 4ZUVB 3K2KA 1T20B 3D3VB 1F90L 2WINB 3L3HA 5JMRA 1I1YB 1TCMA 3ZK0A 3GMQA 1FL5B 2L7QA 4C4KT 4YR6A 4XRCB 4CU6A 4HKXB 4CKQA 4LARH 3WXVL 2IH1B 5ICZA 5IV2A 1CD1B 1P1ZB 2AEPH 3C09C 4HMCA 4CNIB 1SMAA 2L4OA 4Y4FD 1QW8A 1P4BH 1GYCA 3ESNA 3RDJA 4DOHE 3CN0A 3GMQB 1KGWA 4KDTA 3HS9A 3NCMA 4KXZI 4NQDE 1JV2A 1KBWA 3ARWA 4XMTA 1AZNA 4TV3A 1SDDA 2R39A 4I77L 5H37H 5IVXA 4HUNB 1TPXC 3IS0X 3C9NA 1EEZA 1PZAA 3OKOB 2MPAL 4WNJA 4D0DB 5KUKA 1T2QL 1DBAL 3HR5A 3LCYA 4FMFA 5F3BB 5KBNC 2DF3A 4JPKH 2EDDA 5KBLA 4KZCA 2VZ1A 2FE0A 4QKXB 1KYAA 2VR7A 1XCWA 2YGOA 4Z3TA 3WIFB 4P9MH 5IP4A 3KLHD 1E4KC 3C9NB 3O3DB 2OR9H 1MRDL 4GSXA 1QBLL 3R7RA 3BEWB 4NI3A 2IJ0C 2ZWNA 4NZFA 3WXWH 1OF0A 2GIMA 1V54B 4OQ1A 4DKFH 1SOSA 4R7VA 2BS8A 3TWCH 3ARBC 3M7OA 1C5CL 1EXHA 1U8PA 1AKJA 1FYTD 2BZDA 4U3CA 1IKFH 3SB3A 1AGFA 1XAUA 4O02L 1O7DC 3TO4C 3NCEB 4AI7A 2R0LL 5AW3B 4HPOL 5I6OA 2YPLA 4TNWK 3WN5A 5JPMC 2DDQL 1JXJA 3QHTC 2OS7A 1YAIA 2NY6B 1MG2C 4K7PL 5T1KD 1YEJH 1YNTF 5FCUH 3DX6A 5E1IA 3U7YL 4HIQA 3MOBL 1IGTA 4HGWB 5D70L 3MBED 1BBJB 3QXTA 4LOUD 4WJ5B 1E4WH 4HIJB 3RTQA 3O9WD 4F91B 3APNA 2AEWA 3NK3A 5AVSB 5ADPL 5C0CD 4TLSA 2GY5A 1IC4L 1WSST 2JXMA 3DX6B 5E8DL 4YHKL 1IGTB 2Y1VA 2YK1L 1GR7A 1RUKH 3EDKA 1TVBA 4O02A 5AW5B 3W9DB 1TR7A 2BINA 2EKJA 3TYGL 3RTQB 4KRNA 4O51B 2VDNH 1FORL 1TETH 5FGCE 3NEEA 5F9JB 1JWMB 2DQFA 4ESKA 1DVZA 2JXMB 4FN0A 4G7YH 4ORZC 4U4BA 2E9WA 1ROWA 1KLGA 1TVBB 2IPKB 1T7WA 3MJ7A 2X6MA 4ZMVA 3A5VA 4QHLB 1ZANL 4W9HC 4JG9A 5LGJB 2DQFB 4H26A 1SLWA 4RQQB 3BIKA 4FJ6A 1AGDB 1RXLA 3MA7A 2CHXA 5E2TH 1KLGB 1SMOA 1EDHA 5EG6C 3IKCA 3QQNA 3VXOA 1QSFA 3MJ7B 2YAFA 2EC9T 1NCWH 4H26B 4K3JH 4NNPL 4PJ9A 3MFGB 4HV8A 1JFQL 1VZHA 4EJ1C 1K4DA 5JIIA 3TIEA 2VLMD 4APQC 5BPPA 3P9LA 4LSQH 3IKCB 1QSFB 1I3GH 3K1KC 2ZX5A 3ABLB 2BJMH 1QYGL 4JFFA 4YX2H 1RMFH 5CFAA 1L9SA 4Q8BA 4G7QB 4HFUL 4URKA 1MIMH 3SHSA 3ZTNH 1K4DB 4LHUB 3TIEB 3K46A 4G8GA 4Q7DA 4F24A 1QWNA 1T4KA 3BQUD 2B4CH 4M6MH 1FLRL 2F53B 3OKDB 1ZVYA 3OSKA 2ZXCA 3TNMA 3P1VA 3SZKC 5CFHA 3SBPA 2PXYB 4RISH 1E5ZA 5GGRA 4K9EH 1OGSA 3H9ZA 1RK1B 3TIDA 3AQXA 1MW1A 1HESA 1MNUL 4G8GB 4MQSB 1T4KB 1CYWA 2WXPA 3U4BL 2LU3A 2QSVA 4Z7OB 4WU7A 2A9BA 5LB1A 3TU6A 3HG2A 4FP8H 2LU4A 5GGRB 3H7LA 2E47A 4OBSA 5D7IB 3TIDB 4R0LA 4ABQA 4N1HB 3RHWK 1HEHC 1UYWL 1OANA 1OP5H 1OCOB 2ICWB 2Y07H 3PABA 4LO9A 4YNYB 4FCHA 4G70B 3A21A 4WU7B 5DJYA 1P1VA 3PGFH 1N2RA 3FSWA 4U1MA 3RVVC 2Z31A 2EDTA 4BCZA 5BW7A 1GHFL 4F15B 3KL3A 5DJYB 4ZTOH 4MAYB 4WHTA 4D0CA 3DIVA 5GSVA 2Z31B 5JXEA 3DROA 1HXYB 4FYQA 4DP9X 1IQWL 1INEH 1CFTA 4DETA 1B4LA 2LABA 2C7UA 1MRFL 3BAEH 2MNJB 1UFGA 4IRJB 3HJ0A 1FFPA 2XSKA 3SKJL 3KW8A 3HC2A 4HOZA 4M56A 2YPLE 4Y1AA 5GSVB 3DROB 4PJGF 3NCYP 1I7TB 1OWWA 4LLUA 4BUQA 5IMMB 4OB5L 3KJ4B 2KI6A 5KSUA 5EF1A 4CU8A 4P04A 4WLCA 3ROLA 1FFPB 1S2EA 2EDFA 5MHSE 4LAJH 2DQGL 4MXVE 4OZ4A 4MA7L 3RWIA 3UACA 4PRAA 3EZ8A 3U46B 4LLUB 2FQFA 5IF0B 5ISZA 1KTCA 5IMOB 2GSIA 4E9YA 5KSUB 4KGLA 5IQ9B 5F88A 3OGOE 4W9IC 3ROLB 3RU8L 3O6FB 4FCAA 1G7LA 1F3JB 4O2CA 1EDQA 3BX7C 4HK0A 4FTVA 3MGTA 3POCA 3TN0D 3RAJH 2HX8A 1Q9KA 1TJIL 1PX8A 1S7VA 2W80C 2X2JA 3L3GA 3L16A 3QNYB 4JFZH 4WSGA 4BQ8A 1N67A 2QSTA 3MLVL 2K0RA 3L2LA 3OD3A 2DYPD 4U1HA 4A68A 2UZIL 5DUBB 4Y16B 5DJCA 4O2CB 3EOBB 2F1AA 4DEPB 1A5FL 2I