3GUFA

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Low molecular weight heat shock protein
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 14
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gufA00
3QORB 4JUSA 2WJ7A 3EUDA 4RZKA 1X5MA 4YLCA 1SHSA 1GMEA 2CR0A 2O30A 3GT6A 2JKIS 5DS1A 2BOLA 3Q9PA 4YDZA 3AABA 2XCMC 2K8QA 2RH0A 2WJ5A 2Y1YA 3QORD 4ELDA 2N0KA 2CG9X 2KLRA 3QORA 4FEIA 1WFIA 5LUMA 3L1EA 4I88A 2KMWA 2N3JA 3GLAA 4JUTA 3L1FA 2Y1ZA 3Q9QA 4M5TA 1RL1A 4PCKA 4PBDA 1WH0A 5DS2A 3J07A 4ZJ9A 3VQMA 4YL9A 3IGFA 3L1GA 2Y22A 4M5SA 3GUFA 4YLBA 1EJFA 4YE0A 2MNWA 3VQLA 3QORC 3N3EA 1WGVA 4MJHA 3W1ZA 3AACA
chains in the Genus database with same CATH superfamily
1GPOL 1FVDB 1SGKA 2YEZA 2NPLX 1OLLA 4KMQA 2X70B 4NQVB 2FAUA 4UDUA 1ZLVH 5HXMA 4OZFG 1BEXA 3RA7H 4H8WH 3T9WA 4QJ4B 5I5JA 4I85A 3QEQA 1NCUA 1E43A 4LOUD 3QWRD 4APQC 1U3HB 2CHDA 1ETZB 4AITA 3NAAH 1F6AB 3LS4L 1XH1A 1TTBA 2VN4A 1E5ZA 2A9NH 2AANA 3AMKA 4P9HL 5ERWB 3LVEA 1WPCA 3WIIH 1T5KA 1S7QA 4S0HA 1TZHA 12E8H 3EBGA 2CE6A 2OK0L 1MWAL 1YG9A 4FLHA 3DSNA 3D25A 5EA0H 3JWNE 1N5YH 3QQ4B 5L2KD 4XMKL 1G9EA 1UYWL 4CN4A 4F9PC 3FTWA 4PB0L 5KJRH 3L2NA 2IPKA 4KUCD 4R84A 2WWOA 3L13A 2BHYA 3QORD 3D1MC 2PPDA 4ZXBB 1EEQA 1MPAL 4LZKA 4NFBA 4JFUA 3U0TB 1R75A 2W65A 2GHWB 1BZ9A 2WPGA 2XKUA 4NWUL 3L1FA 4R4FH 4GH7B 3VNYA 1P1ZB 2XUWA 3NEOA 3BKYL 1SLWA 3CXFA 1A22B 1KCVH 2YOCA 4XXWA 1SDYA 2P5EE 4NKQB 2CO3A 1V3MA 2V33A 3QRBA 3U82B 4NRZA 3TF4A 2LW3A 4JDZA 2C1PB 3WENA 2V5RA 5CLWA 2CO2A 1BZOA 3FYEB 4N2EA 2EJ1A 4Y9CA 1A6TA 2JKIS 3QUKA 3S0PA 2W1NA 3BEVA 2WXKA 1WTGT 4ZS7H 4NQCB 3SE9H 5BVPH 1CXLA 3TNNB 3J7HA 1XF5A 5FF6A 5JHDB 4LDOB 5I17A 1JRHI 5HHQA 2CCVA 3KPNA 4YR6A 4PU2A 4AV4A 3BQUC 2WXJA 4AEHH 2B5IC 1KXVC 2R23A 1F0LA 4P5MA 1RIUH 1EX0A 3MRKB 2Z8RA 5DJYB 3BN3B 1L6XA 1Q38A 3IJYB 3Q8AA 4YDNA 3QRLA 4IU3A 2EVJA 2VXSL 2X3BA 5DMJB 4EN3B 4OLVL 5J5EA 5DO2D 3H55A 5AW7B 1O6TA 2IAMA 4CAGA 4NN6B 3OLDA 1UWXH 5FCUL 1MHHB 1GSMA 5CZVL 3KPOB 4LEBA 4P2CG 3IMRA 4LO9A 4AYDC 1OAUH 3VD3A 4TL4A 1KBVA 3NZ8A 4NO2B 1MREL 4Z7QF 1X7QA 4QJ5B 2I60L 1QRNB 2F8OA 5CNHA 5E4OA 3I75A 1H8NA 1A7NH 2BNQB 3ECQA 4POYA 1H3UA 3AS3A 3UGXA 4MNQB 4D7PA 1CD1A 3MQIA 2NSMA 3FQ1A 3SKJH 4Z7OF 3NOIA 2N7SA 4LQFL 2YD7A 3S5LA 5KN5B 3PHSA 4JO2L 2ENSA 3VFOB 3GKWH 2CDEB 2Q76A 5GZND 1MELA 3KM2A 5JLZB 3EFOA 5LQBL 1G6RL 4TXVB 1PZ2A 4XAWH 2HYMA 4I0PA 2JF1A 2GSGA 3ZBMA 4WWKA 4ZNEE 4PGJA 1FG2A 1W8OA 3CZFB 3I9GH 1JK8B 1YMHB 4GKOA 4GUQA 1KV7A 2DEXX 5JDSB 1SYVB 3RGBA 4PY7A 2DIEA 1EXGA 2LE9A 3PAUA 1TEFA 1OAKH 1HOCB 1MRCL 4IMLA 5A6MA 1W15A 5JIDA 1JZJA 6PAZA 3R8BB 3FQNB 3LRGA 3MLXH 4JO1H 2DDQL 5DHMC 5JXEA 5GGTL 3MOAH 3EDEA 3EHBD 2JKTM 2Y25A 1Q0YH 2K9FB 1TJHL 2WY3B 1VFAB 3TH2T 1AIZA 5I1JL 4JB9L 2GG1A 3L9EA 4YHOL 5ENWB 1UQSB 5BRZA 4B7IA 4WW1B 4PS8A 2MJWA 2ZWYA 1P9MA 2XFXA 1D3CA 2ERJB 3L7FB 1JPSH 4BKTC 1SXSA 1RUKH 2GJ6A 3N44B 4JY6A 4URTB 4DEUA 1PIFA 4X6DA 2CRIA 5F2FA 5EWIH 4KK9C 1HQ4A 4PJFA 1N8ZB 5LBSL 5G4NA 4YHNA 1AMYA 4LLUB 2E56A 3T0DA 1REIA 4LDLB 3VTTA 5EEUA 2G5BA 4JPVL 3UABA 5JYMA 1M2VB 3RKPA 2E7LA 3LQZA 3PGCB 4OLYH 4X83A 1X5ZA 1IZJA 2B9BA 2J43A 1UJ3B 5CN1A 5LBVA 4UM8B 3VG9B 3R4RA 2PETA 2X6MA 3MRQA 2V6HA 3A6CL 2EVGA 3OC8A 5KSUA 1LL1A 4KKRA 1C5CH 3IDGB 4R7LA 4X7TB 3ZX1A 4EI6A 3L2LA 5F3FA 4MA7H 3BFWA 1NA8A 3MVSA 5KSVB 2Y9RT 4WJ5A 1JZHA 1BVNT 5HGAB 5EIIB 2VXVH 4JS7A 2F74A 2PF6A 1P4BH 1BG9A 1XGQA 4Z7VB 3T8VA 5A1AA 2NY1C 2W91A 1GVIA 3PWPD 4N85A 1OHQA 4J3XA 1UT9A 5KVEH 1HHKB 2ZXCA 2FR4A 4N6RB 3MCLH 3LOWA 2MWCA 3KJ6H 2AK1H 3TBYA 4RA3A 4MMYA 3JT0A 2BS71 1E9OA 3MA9L 1E8YA 3RE0A 1M7IA 4HUWB 3ZE0E 5F70A 4Z3JA 5J7CC 3EJCA 2EC8A 5ETUB 3M17A 4G8GD 2N0MA 4LNRA 1KJ2L 2NY3D 2QTVA 2X41A 3E1F1 3FT3B 4FP8H 4XNQA 5K39B 4G71B 2K9UA 2XY2A 1RUAL 3KCPB 4AUJA 4NM4L 4GS7B 2EDHA 5F3BB 4JFOB 4P4KC 1R47A 4GBXD 1KB5L 1RIHH 2IGLA 1OM3H 2UWEE 4LPXA 4ZPTA 1OSZB 1XCQA 4M7KL 4A6YL 5HDQL 3RGVD 3GTVA 4Y2OB 5BPPA 1DL7H 4UYPA 5K9KB 3H9HB 1L9OA 4PMEA 1JWUA 3TT1L 3DBXA 2R0WH 4YLQT 3UTQA 5IZ7A 1C1EL 4AZ8B 2D9QB 3N41B 3MOBL 3WN5C 4NZRH 2ZCLL 2ZKMX 5DD6B 2WBWB 2YC1A 3LKNB 4DEPC 2G5UA 1IM9D 3EGDB 7PAZA 2H6PB 2P8LA 3FQXB 3D39E 4O51B 1OGPA 2JKRM 5HI3C 3BE1H 3ALPA 1NCDH 2EADA 5DQJB 3RTQB 3QUYC 5HI5C 2VLLB 3EYOB 5J9PA 2XXCB 2RR3A 3CN1A 2C1OB 3DSFL 3P0VH 1UOLA 3PPSA 3ULUE 1AE6H 1IKNA 1MHPH 2BVOB 3PV6B 2EDDA 1NCCL 3RIKA 3MNZA 4F5CA 2ZOUA 3QEUB 2Q20A 4UOW0 3HB3B 4A2FA 2XV2A 3HMWL 3C09C 4KZDL 4TN9A 4DEPB 1AD9A 1F3RB 4AK2A 1QEWA 4XVUD 4RNRB 3RU8L 1TR7A 2QFRA 2BH0A 2VM4A 1H0DA 4U1LB 4BK5C 2HT4D 1PQZA 5AYQA 3CVHB 4RDQG 4B9IA 3D4ZA 1WWWX 2R8SL 2OMBA 3BP7A 4JHWL 1DQTA 3L8QA 1NLBH 1TPXC 2K6YA 3IDUA 1XXFC 1DO5A 4OV6F 1QWUA 4NJ9H 4HFUH 1JXKA 1A9BB 1ADQH 1I8KA 5HHVH 5SX5K 5FYJE 5J11B 3UMTA 3PGFH 2IBGA 2FJSA 3BSHA 3ZLQC 3NZHH 4GW4B 5DJCB 1GYVA 2E47A 3GXIA 1DQLH 2UXTA 4GSDL 2ARJA 1U2HA 1DANU 4MQTB 3EYSH 4L4VB 3LD8B 3LZOA 4GSXA 2A6IA 4HHGA 5FYLL 4C56B 4G5AA 4OCSH 2WWMD 3AG3B 1SVZA 4I0KA 4RQQB 3R19A 2W0PA 4MYWB 4OZIB 3HNVH 1R9FA 4F2MB 1NGZA 2MQ0A 1MFMA 4WWNA 1JK9B 1IGYA 4RIRB 4BZ1A 2YO3A 1RJYA 1GPOH 3N6YA 4KKCC 3ESPA 1RULL 3NCFB 4JO3H 1NOAA 4O2EB 3GC3A 4WUUD 2FX7L 2W92A 1BX2B 1FIGH 4JVUA 2VL4A 3R1GL 1I1CA 5DF0A 3WTXA 5DQ9A 2OR8A 2Y3AA 3HKZA 5T3ZL 5FXCH 2E4TA 3V5DB 3WJJA 2BY0A 4HCIA 3BWAA 2WM0A 1JPGB 5IBUG 2WN2A 3TEXA 3LS4H 2EE2A 4G8FB 4P3WA 4P9HH 1EIBA 2ESVA 3DC0A 1HDMB 4OZGF 3DXAA 5JXAL 3QIWD 2AAAA 1MWAH 3ARVA 5JR1L 2EVHA 3IDXH 4NUJB 4XMKH 3BZ4A 1VEOA 2FB4L 4PB0H 1LGVA 2HXAA 1RUQL 1M6OB 2XDHA 4Y4FD 5DUML 5CKAA 2N4IA 1IMHC 4X98A 2XJKA 1DVYA 5ANME 5G4OA 3WTTA 1RZPA 4OGXL 1MPAH 2GT9A 3ZHLA 5CU5A 4BGDA 3QQDB 4YDJB 2HKAA 5C08B 5TF1L 4GAFB 1I8IA 4LHUA 4KFMA 3OVUB 3VFWA 1NDGB 2VXQA 3BKYH 3HR5B 4PGBB 2E46A 4XO8A 1LP9B 3HBGA 4Y88A 3EOYG 4TNWF 3O3DB 3QI9C 1UA3A 1E27B 3BO8B 1GC1L 1UB6A 3SDDC 1IT9H 3FO0L 1JF1B 2ZX9A 5E4EC 2C9PA 4YSTA 1R3LB 3SCMD 3OKMA 4A38A 4WU7B 3S35X 4AH2A 2DQTL 1OAQL 5DD1H 2X4NA 5BXFA 2P52A 1KXQA 4M6OH 4Y16A 2AXFB 5CHNB 4OAWB 1BXAA 1JTOA 3L3OA 4R4NC 3IETB 1WEJL 1IAMA 2V37A 4PWIA 3X14A 3D2UA 5C0CD 2A4EA 4S11A 4A2MA 1F4WL 3O4LB 4Z7WF 1KPVA 5AALA 1DEEA 3ZUNC 4Y5XC 3AADB 2BFVL 1HYSC 2V3FA 2OLDA 3HG1B 4R5VA 3L3HA 3RY6A 3RWDA 2NT1A 4I3SL 4AENB 3G6AA 3UFIA 5C71A 4WO4D 3GZOA 3KGTA 1OALA 2VXSH 2VN3A 4JCLA 2Q7NA 4OLVH 4JR9L 2MRYA 2DIAA 3KYNB 3SEPA 1SYSB 1UOVA 4X6FB 3D87B 5IQOA 5CZVH 5FCUH 1ZHNB 2XETA 4QJ3B 5FDWB 2YPVL 5IB3A 4F33A 3SO3B 1QAWA 1ET7A 5A6IA 3PREA 4PJ5B 1A14L 1O6VA 3D34A 3VQLA 3LZPA 2I60H 3D85D 4FFZA 1D7DA 2SEBA 4O2FB 4XPTH 4H26B 2LTQB 5KSAC 1M1SA 2YAOA 3C5JA 1HFUA 2AJYL 1IC0A 3V4PB 2H3NB 1E9QA 2WWNA 1HHJA 1WT5A 2GBAA 4ZFFA 1FAIL 5C3IA 1RP8A 3HC2A 4F7PB 2IF7A 2N7BA 3PJLA 4MXVE 4DN4L 3T8XA 1AQHA 4UIKL 3EDJA 3C60A 3GEWB 3MV8A 1G6RH 4X4YB 4Z7QE 3AWGA 3FT2A 3RWGB 4L1HA 4OGAD 4B95C 4C4UA 3OAYH 4AEFA 3FFOA 5D6DC 1WFNA 2R1YB 3DYMA 3VXQB 5BQ7B 4ZUUB 3F8UB 2MSPA 4Z7OE 2PO6A 4LFHD 3KPMB 2A73B 4L48A 5CSBA 1MRCH 4MAUL 2XSKA 3QYCA 2ENPA 2PP8A 4OVUA 2W0FA 1GMIA 1KPUA 3Q1SL 4CBZA 1SQ2N 4I13B 1TG8A 2CGRH 2K0RA 3GF8A 2DDQH 2NTFB 5GGTH 3IDYC 4UOW1 4DGUA 1TJHH 4FQ1H 2WK2A 1OEZW 3KVDD 2F53A 2FHCA 3N1QC 3QDAA 4YHOH 1TQUA 1CXHA 3FUMA 2VABB 2RHEA 4P99A 5FUOH 2Q10A 3RTLA 1T22B 5DJDB 2EYTA 4L3EE 3NIDF 5CO1A 4P49A 3RUGB 3UADA 1C16B 1YEGL 1M9SA 1PJWA 4PRIB 4H5SB 1U4EA 3Q2CA 4MS8C 3SDXA 5JPNB 5KUMA 1DBBL 3PWJA 4WLCA 5CP3H 1FGVL 4JPVH 2YXMA 4JDTL 4YL4A 3L3IA 4S2SB 1NM9A 3WBDA 1ZT1A 3I85A 2FLRT 4DO4A 1J48A 4R97B 5MHSD 5KS9E 5FR3A 3A6CH 1RXLA 4P46C 2E6PA 1PAZA 1HHIA 2HUEA 1FZMB 2RBLA 3OKOA 4U6XB 1CVSC 3GK8L 1A8JH 1KYFA 4YC2C 1QHPA 3GMLA 5A2JH 4QHNA 3DVFA 4AT6B 1MFCH 4K7FA 5DC4B 3ZHDA 4PJ9B 4M5ZL 2CQVA 1VEMA 2XVKA 3WJMA 4YSSA 4NQDE 4LHQB 1A25A 3TT3L 2JB5H 4H20L 4UT9A 1QBML 5TTRA 1CFVL 3MA9H 2XN9B 5CEYA 5IEKB 3FFDA 2P7TB 3FQRA 2BDNL 5MERA 4MQ7B 3JBG7 5FGRA 1NUDA 2OULB 1KJ2H 3P9WB 3HMXA 5I6NA 2D3JA 1XMWA 1BVNP 2R69L 1RUAH 1UOKA 5FYKU 3HE7A 4AYFB 1AO7E 4LCCC 1X5FA 3T0EA 3KD4A 2IOIA 5FYLD 3BAIA 4BDVA 4LVOC 4RESB 2C3HA 3KS0H 4UB0L 3G5ZA 1ID5I 3HRPA 4IRSC 2DEWX 4A6YH 2F54A 2WXHA 1K4CB 1MEXL 5HDQH 1JXFA 1CDUA 3B43A 5E6ID 1I8MA 3QG6A 5C9JB 2Y6SD 2Z31A 3H9SB 4Z7UF 2DQFA 3DRTB 5EZOL 1AGFB 1C1EH 5A2KH 1ZGLB 3MOBH 1HXMA 3U6RB 2ZCLH 2JCCA 3Q1EA 3PJNA 4FG6D 4HAGA 4OCYL 2W9LA 3KR3L 3L5WA 3I02A 2IADB 3F7VA 5T3ZD 1PD0A 4L4TB 3O45B 1SQMA 2YBRB 4CA4A 2FZ3A 1GOFA 4GRLD 2V2XB 2BCKB 3T3MB 2AXHA 3N1GC 3BMVA 3V0GA 4WGKA 3FO9A 4XPHH 3SBPA 2FT6A 3CUPA 2XBZA 1UADC 3CH1B 3O3EB 1YN7B 1NCCH 2QGEA 4KK6C 4X80L 5EF3A 1B4JL 2VR3A 2YD8A 4ZX6A 2Z93B 1NICA 5L8JB 1IEAB 5BOPA 3HMWH 4U31A 4F1ZA 4KZDH 4FNTA 4E42B 4Q97A 1KBBA 2J5LC 1DJWA 1L0PA 3B9KC 5C9KA 1JGUL 3C2AL 1A3LL 4I87A 4PJIA 1COBA 1ECZA 1WIOA 2GSMB 3CFKB 2HA1A 1YA5A 2BVUA 4N8UA 4JHWH 4ZUVA 2ALAA 1F11B 2Y7QA 4PRBA 1T1WB 2FQFA 1N6UA 2ZKYA 2G75A 3W5NA 4IOFD 1G7LA 5IM7A 3T04D 2OMNA 3MYJB 2R2EB 1TTCA 4LCIL 2APBA 1FNEB 1OAZL 4GSDH 4TNWK 5EBWB 1IAIL 3ZZSA 2A4ZA 3KPSA 1KCBA 4Y4HB 4HK0A 4HA1A 3QR1A 3ARWA 3B9KB 2COVD 3AAZB 2YAFA 4XP5L 3WLBA 1KGWA 4ISVB 5C0FA 4YHML 4IQHA 5GGRB 1T21A 2WXFA 2OW6A 3VRIB 1OP5K 1CLVA 3DI3B 3KPQA 1N59B 3ECVA 4WFFD 2FGZA 1KCSL 1HEZA 3QC6X 3RNKA 4CRPA 3E2HB 1RULH 2ZXQA 4ZQKB 2BHFA 1HHGA 5FOBA 2R7EB 1P5UC 3F6IA 3S5LG 3WFEL 2FEDC 4FKEA 4KAQL 2P24A 3R1GH 4RFNB 4LL4A 3PWUA 4O4YL 5AL8A 3QUZC 2P5EB 2P43B 4KX9A 5I1LB 1KN4L 3ZDWA 4MA1C 2V5MA 2QVKA 4U6VH 4YHIA 5FK9A 4BSJA 3MCKA 2QV4A 4HP5A 3BXNA 4MMZA 4UNTA 3C5SB 2MNWA 3RPIA 4MNGE 4EF3A 5JR1H 5EPMA 2P5WA 1LE5A 2OQJB 4EN2A 4WEUD 1KEMH 1JGVH 2IFGA 3JWDH 1Z1WA 4IBWA 3RWEB 2FB4H 2WCGA 2X4OB 3PV7A 1F4YH 2Z34A 4HZ1A 1S7VA 5DUMH 1JXJA 5IQMA 4NQEA 1P6AB 4M7LL 5KYXA 3VQ1C 4JM2A 5HGBB 5I1EL 4JAMA 4U1IA 3OXRA 2VTFA 1XGYL 2DQJL 4PCTA 4PWJA 5H35A 3LNDA 4PMFA 2GCYA 3KPRD 3ARBB 3E0GA 4QNPF 2HVKB 1Z2KA 4MJ6A 1U3JA 3BVUA 2PYEA 1SM3L 4G43B 1CBVL 4S1SH 3ZE1E 2DQTH 5HDLA 1OAQH 3U0PA 4KK8D 4AYGA 1IBGL 4J8QA 2ESVE 4EIBA 1WEJH 3ARYA 1F45A 2GAZB 2XWCA 3PXJA 3BLPX 1OTUD 2YZ1A 1F4WH 1MCCA 3EH1A 4LP5A 4XBGB 1T83C 4EVNB 1E0OB 2WTRB 4NRYA 1DCLA 3LQAC 3GMRB 2D0GA 1IKFH 2OYMA 1A1OA 1XSOA 2FJHB 1J1PL 2WUCL 2BFVH 3AC0A 2NCEA 2ZOKA 2EAEA 2XTJD 1GCFA 1RPQA 2OJZL 5DEGA 4MD0B 4NUGL 3BFOA 2NZ1A 2RGSA 4POZD 4QRUA 2B59B 1WAEA 5FA3B 3IRCA 1DVFC 4I3SH 4KKLD 4K73A 2DWYA 4IGBA 3GZQA 2D7OA 1ESOA 4ZTPL 1INEL 2IQ9L 1IEBB 1QVOB 4N90D 3FQ4A 4JR9H 1BHGA 4U1GC 1UD8A 1VPOL 1FFOA 5F3HB 4J4PD 5DHEA 1JI1A 5HHME 3OJDA 2XVBA 3UMNA 4D8PB 1UJTA 5I19L 1HL8A 3K8MA 1KXQE 2ZP0T 2YPVH 1N0XL 1KTLB 5AOJA 3FC8A 4HQQL 4QRQA 2OSYA 3QUXB 1O7SA 2RD0A 3ARDC 3GZKA 3I6KB 4YBLB 1EBAA 1PNDA 4Y1AE 1SBSL 2ZUWA 4E9SA 2Y69B 2Q3ZA 3SZKC 1DVFB 1IC7L 1VLXA 3L9RB 4GUOA 1KLFA 4KNTA 3U2JA 1B0RB 2A99A 3VB9A 4WU5B 3A22A 2K1MA 4UYQA 3MXVL 4DN4H 2DMGA 4WRLA 4UIKH 5E8DL 1QFWI 1I1AD 1S7WA 4G59C 1ZWIA 5EO1A 4AIXA 4LEOA 2VWEC 4ZMQA 2EDWA 5C0EA 5IT2H 3G5YB 1NPJA 1YEIL 1CC3A 3QG7L 3L6FB 3G5XB 4F37F 2C9AA 2YMXL 4MAUH 2XX1A 4KVPA 1JMXA 5F7YC 4NNYB 1XF3A 1G7QB 1OV8A 5GPRA 3Q1SH 5EZLB 4MAYB 2RA1A 3D06A 4EIGB 4L8CA 4AM0A 3AQYA 2IO5A 2E86A 3IRZA 3TM6A 2VQ1A 1DR9A 3U2SB 1N10A 3LKRB 2DPKA 2GTWB 3N3EA 4M61A 1NGXA 4IRJB 4ABWA 3MV8E 4KOCA 1SJHB 4XCNA 2VDRB 3IMUA 3VG0L 2BS8A 3CX5J 1A9VA 1AVAA 1YEGH 5DZVA 4EZLA 2MNUA 4MB3A 4NZDA 5LXVA 1XMEB 3OKLA 1FFNA 2XPYA 4JQIA 4NO5A 1C5BL 5E8PA 2H2SC 1QSFA 5FO9A 4IBLT 4D0DA 1OCZB 4OV5A 2PW1A 3MLWL 3ZE0B 1ACXA 4JDTH 4MXQD 5PCYA 5C8JA 5F97E 1ZDQA 2Z4QA 4NT6A 1NJ9A 1EFQA 3ENEA 5D5MA 4A55A 4E9VA 3ESNA 3FOLA 1S6NA 2EIZA 2XC8A 1J87A 4LSQL 4NO3B 3QDMD 4WV1C 1M2OA 1T4WA 4CVWA 5JA9A 3VYOA 5ICYB 1HKFA 3BUPA 3APFA 3KJ4B 4PJEA 2VZSA 4M8QB 2IBZY 4P5TD 2K8QA 2UWEB 5FO7A 2D8KA 1T7VA 4YN3A 1JPFA 2CUAA 1FORH 1T1YB 3HNTL 2IDSA 2YQ3A 2BSSB 1ZEAL 1UURA 3IU3B 3V8CA 4KVCH 2VIRA 3E1ZA 1RUPL 4P23B 2XWDA 1QBMH 3LVTA 3U9UB 2DLHA 1F00I 3IFOB 5DJXA 4Z3EA 2CUHA 5F1NA 5AAWC 5HJ3B 4ZFOA 1DJGA 1JZ8A 2BDNH 3MUZ1 1F56A 3CU7A 4ZUTA 5JNYA 4OT1L 3CD4A 1H3PL 5CD5C 3ROLB 3ARED 1NUGA 4XODA 1XEDA 3C8DA 2R69H 3BIAX 3FULA 4YAQA 2Y5TB 4U7KA 1MLCB 2AEOA 1YYMH 3HPJA 1RURL 3EGSA 4I9XA 1LYQA 3NJNA 1UKQA 2ATPA 2IC2A 4WKXA 1RU9L 5F88A 4XCEA 1PZAA 4UB0H 4NFCA 4IS6B 1E4KC 4PQXA 5BZXA 1TQCB 1MEXH 3SE8H 1D9KC 3ZT6A 1FFRA 1C12A 3EJSA 4JQXA 4OD1L 3LXAA 5DMIH 5DK0A 2XZAH 3DGDA 3HC0A 5EZOH 3DVIA 4NP4L 3MUGA 2XKNB 4PJ8C 1HSBA 3VRLE 4QXUL 4RCAA 3NSFA 1R24B 1CS6A 3WY1A 4KKBD 1OOWA 2JK5A 1OWRM 4X6EB 3KR3H 3DVGA 1T5XB 2JCWA 2WANA 4OBRA 5GSVB 5DHXB 4UV7L 4JY5L 1OARL 4YJZL 4LHUG 1I8AA 2OBGA 2QEJA 3TTSA 1B88A 1XGPA 4XXCA 1XIWA 4Z7UE 1W0WB 4DT2A 2W07B 1IGTB 3F12A 3LKSB 5J89A 1FV1A 5CJQH 3CBRA 3T0EE 4CJ1A 2EXSA 1JDCA 4KI5D 1MH5B 3OLEA 4OM1L 2ICEC 1DANT 5E23A 5FKAA 4A2HA 4PR5A 1N26A 3WAJA 5LVEA 2DIJA 5FFGA 4QRPD 1WFJA 2WZ0A 4KX8A 4FTDA 1I1YB 4PFEA 5EFIB 3EBIA 1AD0B 4Q9CA 2ZWZA 3N1MC 3V4VB 2X1QA 4TF4A 3VSUA 3QDGA 1JGUH 4X5PA 5L2JB 1R34A 4HIXL 4K7PX 4OY9A 5F93C 2W0LA 4DPBX 1Z3GL 4PJCA 4NKMB 1DJIA 3FQ2A 3T0AA 3SN6N 2O93L 1KIUB 1J0KA 2WCPA 3KPLB 3MR9A 1UB5A 3CMGA 2CR0A 4UTBA 1GYWA 4L37A 3L9BA 5AVYB 3SPVA 4BUQA 1T2QL 1H15A 3TVMD 1KULA 4XBPB 4LCIH 2Z7WA 1TSHA 1LK3L 5EUOA 5EU4B 3PU7A 4NPYA 1IAIH 5DFVD 1IQDB 4MB4A 1GXEA 3Q13A 4EUPB 3HAEH 1WD9A 4Z0XB 1S7SA 4FQQA 4X8CA 4XI5C 2BNUA 1TYRA 4XP5H 4EDXB 4YHMH 2K3TA 3K5SA 4PG2A 1VCBC 2R1XB 2ZE0A 4NIKB 2OSXA 2GKIA 2OTWB 1ZVNA 2ZUXA 4UBDD 4PJIE 4Y9EA 3LSOB 5CZRA 1KCSH 2DM7A 5C92A 5ANMB 5I24A 1CXKA 1I85A 3DPBA 4R0LA 4FOMA 2WINA 3AU1A 3K7UA 2I27N 2IGFL 2HT3C 3WFEH 4KAQH 2AQTA 3GRWL 4KUCF 3CHRA 4O4YH 1I53A 3TWCL 4ELKA 3LRSA 2KMWA 4H1LB 4N9GB 2F61A 1IKOP 1RL1A 4HEMA 4KY2A 4LDCA 15C8L 1KN4H 2PCXA 1Z9LA 4HXAL 4XXWC 1MCEA 3IJ9A 5TH2B 3MNVB 1OP9A 2YPLE 3VFPB 1ZLSH 3GHBL 2ZUUA 1TZHB 3FOMA 2EDKA 2KBGA 5FAAA 1XSKA 3DIFB 4HD5A 4XB3A 3FUNA 1ED3A 3U4BL 4YXHL 1MFAL 2XG4B 4Q9BA 2KHAA 4UZUA 2IPKB 3BI9X 1F86A 4AC2A 5I1EH 3P30L 1DDHA 1MZZA 1XGYH 2RACA 2M83A 4ZRGA 2YJQA 3T6WA 1KFAL 4ZK8A 1PNCA 5FA4B 2A1WL 1DVQA 3SPHA 4JPQA 1YNKH 5ISZD 4MGXA 1GZQB 1ZHKB 1QLEL 2VN6A 3EJRA 2Y4SA 4APQD 3B8SA 3DTUB 3RDTC 2VAJA 4BE6A 1CBVH 3UTSA 1MCKA 3PP3H 3GFUA 4RMQA 4OF7A 2FJFB 2ZNXA 4QWWC 1IBGH 1KCUL 2QDVA 4KMTL 1NTDA 2DYPA 4P06A 3UTOA 3A0OA 4LLWB 2Z92B 2J6EL 3BEVB 2IAMC 4PLJC 1CCZA 3A4FA 1JTPA 2V2WA 3HE6B 2AXGA 4V1DE 3IK2A 2YUWA 4IOIA 3NFSL 1CL7I 3NA9L 3TZVB 2BO0A 1MJJA 4ZO7A 4R8WL 1XWVA 3MREA 1NCAL 1CT8A 4JZOA 2WUCH 4F37K 5DFAA 2EXYD 4AUUA 1UD2A 1QFWM 4YR6B 4GYBA 3W0WA 1R4XA 4MYPA 1TFPA 2WW8A 1CJYA 3N04A 1SRDA 4XP1L 4P5MB 1AGBA 1Z66A 5I75C 1Q72L 1QEXA 5I8KL 1SN5A 4IU3B 4ZTPH 4Z7QB 1INEH 3SQRA 4JFQA 3HR6A 4GG8A 4MJ5B 2Q9OA 1VPOH 2QSVA 1FLTX 1F58L 4LSRH 4Z76B 5IB5A 2Z91A 2BP8A 3TEYA 2ORBH 5EOCL 5I19H 4XBEL 5HYJE 1W80A 3P2DA 2CBQA 2VISB 4I0PC 4UZGA 2YA1A 4ZDHA 4CNIA 4HQQH 1LEIA 3ZL2A 1NCBH 3IT8D 4U3SB 4WWKC 2E8ZA 5D9SA 2PPCA 32C2A 5L8KB 4PRDB 3CC1A 2XWZA 3GSNL 3OKNA 3PJSB 3TBVA 3NP4A 4HMCA 3RVTC 1U8OB 3T77A 4LSUL 1VJSA 4FA6A 4XPBL 2VC2H 4NKOB 4OVVA 4YFLI 1IC7H 4DUWA 2E74C 3BQUD 3D50A 1NGYA 2A9BA 2VXTH 5GGQL 3BFQG 5ACMA 1A6ZA 5HY9A 3FB5B 5D1QC 3T4YA 2KT6A 4N1HB 4Z3GA 2LGNA 1WRFA 4FLSA 4OCWL 5JXEC 4BHUA 2NOYA 2AI0L 2Q76B 3D52A 4M03A 3EFOB 2FX9L 3BH9A 5IVXE 2G3ZA 4G80A 5KANI 2AJ3B 3VDBA 4L3EB 3H85A 4I0PB 1P9MC 3L81A 1IAOA 3DPDA 1FG2B 2UZXA 2HTKC 1S9WB 2EZ0C 2ZTBA 4U1SA 3V0IA 1LEGA 3VI3E 1FRGH 1QFPA 1UKSA 1RK7A 4RMWA 4PY7B 2LLGA 2YMXH 4HIIA 4IMLB 4WKZA 3R7QA 3UDWA 1MVFA 3FMGL 1N3NA 3S8GB 1YPZA 2AV1B 4B7LA 5KS9B 2E7LC 5HGGS 5GISL 5CFAA 4ZX3A 1FHGA 4M5SA 2FO4B 4K23H 4NGHH 4G6FB 1UOWA 5F9JA 1YEKH 4AMWA 2GFBA 4JMXA 2V0AA 4NNXA 4FLRA 4MDJB 5CFHA 2WTPA 5DRWA 3STZA 3VG0H 4JY6B 5T1LB 1KB9J 2WZPA 3FF8A 3IDIA 2ZUTA 3V0HA 2EUXA 3TIEA 4NQDB 3CFDA 1EEZA 1HQ4B 3KEHA 5BOZG 2Y7SA 4HJJL 1ADQA 5DJZB 1P4LA 3I3EA 2JJWA 1WCQA 3MJ6A 2G3NA 4XPFL 3ECUA 3U46A 4CVZB 1QWNA 4LSQH 3BAEL 4JUSA 5B21A 2MOQA 1AO7B 4RWYL 3D8MA 3PRZA 5AEAA 1FE8H 1V8HA 2H0FA 4BJLA 3NQIA 4B9GA 2OTUB 2Y1YA 3K3QA 4L9LA 1A66A 2EDJA 3QBTB 1QW9A 2FQGA 3HNTH 1FSKC 3B4NA 3ZR5A 1P84K 1S5HB 1ZEAH 4KK9D 2FR4B 3OZLA 1MQ8A 1E42A 3GGWA 5FM8A 1JXDA 2K6ZA 3LEYL 1E9OB 3MODH 1M7IB 1VACB 4JRXE 3ARGA 3KL3A 2X4QA 4M02A 5EF0A 1HCZA 1Q9KA 4HFWA 4YDVA 4EBQL 2NNCA 1H3PH 4MLSA 4R90L 1L9RA 1MN4A 2NY2C 5D5ME 1OTTC 3JUYA 3M8OL 1C7TA 3FQTB 4XGZA 5A7EA 5JA8B 1M42A 1MWAA 4PYHA 1RURH 3LNEA 4KC3B 3MFFB 5L0QB 3WYRA 2YK1L 5F7FA 2EUVA 1RU9H 1F3DJ 4GI8A 4PJEE 4ZW8A 3BH8B 1YNLL 1GS8A 3JT2A 2NXZB 4ZPTB 1XCQB 1AGCB 1MWOA 3LZRA 2P45B 4GRWF 4W9LC 2NY1D 4OD1H 1IKNC 5CJXC 2J8UF 3LNIA 2WYHA 3LEXA 4NP4H 4NN7B 1CDGA 3DBXB 2XPZA 5AYUL 9CGTA 4F9LA 1UWXK 4XB8A 1YY9C 4QGYA 4X9IA 5KEZA 1CBJA 3VMNA 2CSPA 5MEQA 3LIZH 3ZTJG 3NT0A 5I1DA 3SDCA 2DQCL 1MFUA 2F1AA 4UV7H 3ULVC 4JY5H 5BZZA 3OR7A 3GSXB 4QHLB 5F0MB 1UATA 3PUCA 5FWRA 3D05A 3Q8BA 2X53A 1E28A 2YAQA 1PZ5B 5J9PB 2ICES 4P4KD 5ALCL 3REWA 3QZMA 4OM1H 5BW7A 3ETSA 1J8SA 3ZMNA 1MY7A 3MV7D 3ML8A 3K72B 4HUCA 2W5PA 4LCVA 2HFTA 3RPKA 1W9XA 4L3FA 3FBKA 2UUDH 3WFZA 4BZYA 4RH4A 1QSVA 3BCFA 4P2OB 2CWRA 4LGSB 1MCFA 2HN7A 1QEWB 4IKKA 3CIAA 4D0CA 3F65A 4U6YA 1DN2A 5ICZB 2WSDA 2X12A 5CD3B 1LNUA 1I9RH 3SDAC 5IEHA 1NDMB 1Z3GH 3DURA 4FXGB 3U1PA 2XN2A 2Q86B 2E27L 4XHQA 5HI3D 1J5IA 3DMMB 2FT7A 1U2CA 3QUYD 5HI5D 1RSYA 2VO5A 3WFHB 4AUYA 4B3EA 1IM3A 1VGKA 5CBAB 2ODHA 1DSFL 3BKCH 5KZCD 1T2QH 5ICXB 1BPLB 2VO8A 1QP1A 1LK3H 1A1MB 2AJXL 3BZDA 4CMMA 3IKCA 3CLEH 3CVBA 2ARJB 2YFOA 1OWWA 2N3JA 3UIYA 4JKPL 4PG9B 1BJ1J 2WVSA 4PRPA 3RL1A 4ZO9A 1RHHB 1W91A 2AVFA 5C09E 4BE5A 4F20A 1LHZA 4QKTA 5EU6D 5J12B 5JQ6L 4YVUA 1F2XK 2WKOF 1G6RA 1HWWA 3T1FB 4N8PA 3FU0A 1S5IH 2XI9A 3TFBA 4W70A 3A21A 4GB9A 2DMHA 2VDML 2UY6B 3GRWH 3PAZA 3SCMA 5DQ9B 3QWOA 3B37A 15C8H 1XR8B 1PTZA 4HXAH 1JAEA 3CCHB 2D3VA 1IBDA 2XA3A 2CDFA 3ZE1B 3QZBA 1T20A 2R27A 3DARA 3ETBJ 2OTPA 2ESVB 5GGTA 5L2KE 3ZQXA 1OF2A 3UC0H 5GGVL 2XVGA 3QEGL 2RFXB 3K0YA 5I6KA 1E3FA 1CPUA 2OL3A 5CIPH 3BPCA 4YXHH 3BUIA 4ADGA 4Y16C 4CSTA 5D4QA 5C2BL 4WSGA 4JFDD 4KKCD 5MEPA 1E4JA 3P30H 1L0XA 2EKSB 1OP3H 5F71A 4DAGH 2X4RA 4ZZKA 1HNGA 1KFAH 4NHUB 4QLWA 1BLIA 3FKUS 3VFWB 2A1WH 2VDLB 4KGJA 3MXWL 1FIEA 3GTNA 5CP3A 3V9EA 3RY6C 5FLVA 2FBRA 1OPGL 4UUJA 2BWDA 2R29L 5FX3A 5KVGL 1Y18A 3OKMB 3GSRB 5FGCE 4TL5A 1X7SA 1ZCRA 3O8XA 4AH2B 4KUZH 4KWUA 2X6CA 3G08A 5JUEH 5T3XH 1KCUH 4NQXA 3WEXA 5HHMB 5BXFB 2C9VA 5DGRA 1KSRA 2J6EH 3L3OB 3NIFF 1GY2A 3QIBB 4BHUI 3I6GB 1RZ7L 3CV5A 3FAWA 3IF1A 5E70A 3NFSH 2X9WA 5EEWA 4G9FD 3KNBA 2AKRA 1L9SA 4R8WH 4Y1AB 3CQPA 1ORSB 3Q43A 4HKBA 1M7XA 4GQ9L 3FB8A 3MZGB 3EUUA 3QEHA 4K94C 4MD5B 5HHXH 2XV0A 5D7LA 4WGVB 4CN6A 4XP1H 1QO3A 4HETA 4BCXA 5H94B 1Q72H 4I18B 4XO5A 3QI9D 5I26A 1WT5C 1NIAA 3SDDD 5EF2A 2AQRA 4ZW5A 1EPFA 2ILLA 4QOKD 3P4NA 2ZJSL 4X6CE 1E6OH 4B9CA 1F58H 1OVZA 4HX1A 2NUPB 2BXYA 3C60C 5D7SL 4YZFE 3UBXB 4A7GF 1KGUA 5EOCH 2VLKD 3TIDA 4R4ND 2WLKA 5CCHE 4CUCA 5GSRB 1R17A 3BAXA 3GINA 3OPZL 1TMCB 1TYJA 2PO6C 2V9RA 3QJVB 1QHQA 4JKWA 4LAQL 2SEBB 3BYTA 1HI6B 3V6FB 2DQEH 3QNYB 2YXWA 1I1FA 2VLRA 1HYSD 5F89B 3PHQB 4ZW6A 1RV6X 3GMPA 5KVEE 3VB8A 1HHJB 2VM3A 1RK1B 1YMMD 4ZFFB 5KG9A 2G5RA 3DGCR 3MRDB 4HLJA 1BOGB 3KL0A 4PN6A 1C08B 1FYTA 3EJYC 1USZA 4IIQA 4OCWH 1IFRA 1MRDL 3K80A 1RMFL 3T8XB 2FX9H 4UNIA 4QR7A 3MV8B 3FT2B 1U8NA 4UNVA 1U92A 3IFLL 4HBCH 4Y5YB 3SGKA 2IMNA 2KKQA 3B5TA 4QHUA 4JBSA 3SY0B 4PJ7A 3RFZB 4HHAA 4OQTA 3KH3A 4RMVA 4BRJA 2R2BB 2VRQA 1NMCB 2X4UA 1WAAF 4DP7X 5KSAD 4GKNA 5E1GA 1CIUA 1Q4NX 1DN0A 2BSEA 4KZCA 5AKRA 3RWHB 2JKJA 4PV9B 4XP4L 4NWTL 1URLA 5D96C 4UQIM 1YZZA 3N43B 5DVLA 1T1ZB 1NMBL 3B6SA 3IVKA 4J8RA 5I8EB 1WWAX 2GABA 2ZCKL 3QJOA 2F53B 1Q94A 1R3KB 1YNTF 2VDPB 3BPLC 1OOAA 1P7QD 2AXJA 3ZRFC 3KW7A 2GK2A 5T5FL 1LJMA 3L4ZA 1BBDL 5JOFA 3P73A 1GH7A 4OFIA 3WNIA 5FYJU 1L0YA 2WB1A 4WNQB 1QKZL 5F7EL 4ZPVB 1FPTL 4LF3A 3X3GL 2EP6A 4CMHB 4FEIA 2B77A 3V6ZB 3SDXB 4RGMC 3H8NA 2WUBL 3SJVA 5JW4Q 2BJMH 3P9MA 4DHLA 4G6AC 3U36B 4UQEA 1ACCA 1CIDA 4O02A 2CZNA 4U1HB 3F58L 4XPFH 2CBPA 5IFHL 3ZMEA 4DP5X 4MJHA 3DOIA 3VXUD 3BAEH 4ES9A 2JI1A 4FL4B 3L5XL 3LQAL 4P8QA 1GAFL 1DBAL 3OXSB 1JV5B 3PWVB 1GGYA 4FQCL 3LAFA 3HE7C 1I7RB 3RGHA 5IESL 3PWPE 3FRPA 4D7BA 2Q87A 4HUUB 1ZT7B 5ESAA 1WF5A 3U6XA 5JO5B 5B1CA 4NC1C 4F93B 2AERT 3PNWB 1ULVA 1EFXA 3OR6B 3UYPB 3WSQH 1UWGL 5KVDE 3UYRH 4MS8D 1XCTA 2X1OA 3EJPA 4OZFH 4EXKA 3UZEC 2Z31C 2VAAA 4FEMA 3QULA 3JWOC 4Z7WA 4G8GE 1EHAA 4B9ZA 4HOXA 3FFDB 4GRLA 5DJ2A 5I5IA 3FQRB 5DWUL 2XN9D 3K2UL 1YAZA 4MWFA 3E6HA 4R90H 1L9MA 1FNSL 3V6OA 1GZPA 4P46D 4D3CL 3MNWB 2IPTL 4Z7UB 3M8OH 3TYGL 3GHEL 3T0EB 4YHPB 2YK1H 2NY5C 1BFTA 4LL1A 5DUPL 1JGIA 4WFHD 4YNYB 1G7IA 2CXKA 3EF4A 5B38G 3G5ZB 1YNLH 3UYOD 1MZYA 5F6HI 3LYRA 2XQBL 3FONA 2YQ2A 2DI8A 4N8VA 3U7YH 2E9IA 4E9WA 2FVNA 3IJ7A 5DI8B 4JFFA 5AYUH 3IS0X 5CZXC 5D1XA 1TVHA 4TSAL 1R3HB 3VUAA 2B16A 4DN3L 4EMZA 3ZKQD 3L95B 3AGVA 1M05A 3H3PL 3L5WB 3I02B 3L08A 3QNZA 1BYOA 1KENH 2DQCH 4NENA 3MHZA 4MSWB 3EO1B 3PL6B 3M6DA 2X0VA 2FZ3B 4L4TD 1TZ8A 5K93A 4DIXA 1M57B 2ZZUT 3KYMB 5E6RB 5C0DA 2FNWA 5ALCH 3QAZC 3QO0B 3W2DL 1U3YA 5EZJB 5DRZB 4EQ2A 4IRSD 2WSKA 1V54B 4MMXA 4L23A 5FKPA 3KVQA 3S88L 4YO0B 2V4LA 2QT6A 2J2ZB 4NO0B 4B9JA 4IEFB 4LPYA 5T1KD 1WAPA 4F7KA 2P80A 3N1FC 3QFDB 4TS6A 1BDYA 3D69B 1UVQA 4M7JH 1TNNA 3JSSA 3HUJF 2GSIA 2B9AA 4PJXE 1W72H 2R9HC 4X50A 4Y2DA 1A1NA 2ITDA 4PJIB 4JPSA 3R4DA 1DE4B 2E27H 2EE0A 2HG5A 5IJBC 1PIGA 1GSKA 3SBWA 3X12B 3ECBB 5EU3A 3OPUA 3CFJA 5FWQA 5INDA 5LBGA 1CLOL 2YPVA 1DSFH 3MLTA 5KYNA 4KNSA 1OGTA 3B8YA 2DKSA 2Z8WC 3B2DC 3TCXA 4F8LA 1OIOA 1XZWA 4HKXB 4KK6D 2WXRA 2X2YA 3QJUB 4JKPH 3VQMA 1ZHBB 4PV1C 4U1NA 2I9TB 1G43A 4JJOA 5IOKA 4UIMA 3KPSB 3VD4A 2H6UA 2YPLB 4B41A 1ZLUH 5CBEB 3EJZD 3F85A 4MMZC 1T21B 1VESA 3B9KD 3KXFA 3N2JA 2D7QA 3KWTA 3JV0A 3WO4B 4GP8B 3F64A 4NQTA 4WUUE 1XV8A 1HWHB 3JVFC 5EBLB 3RNKB 1DBKL 4KHXH 5I1HL 5IJVA 1XH3B 1EDYA 2YGVA 3APNA 4JM2C 5FOBB 4YPGA 5CCGE 4UILH 5LUMA 2VDMH 4PY8I 3PWUB 3WMSA 2VW7A 1J5DA 3DX2A 4PBVC 5JIKA 3KWUA 1AP2B 4ZSOA 4ZUWB 2QQNL 4Z3FA 2VDOH 1NAMH 3KGSA 3MRCA 1KWGA 1Q0XH 3MCKB 4PRPE 3DROB 3BXNB 2L0DA 3HS0B 5E6SB 1CMOA 2DZEA 5GGVH 3PABA 3KYAA 2BNRD 4XVJL 1LE5B 4V1DB 4HAFA 4E5XB 3UJTL 5LG1A 4NCC1 1XTMA 4HGWB 1WLHA 5TK2A 2ARJQ 5KYXB 4NQEB 4WHTB 5JW5A 3VM5A 2HJLA 5L4FA 1X9LA 2XWJB 3IJSA 4KO6A 4OGQC 2J20A 2D03L 5KYWA 2R56H 4DGVL 3FTGB 2FEDD 1T5WA 2QSCL 3PE9A 4OJEH 3MXWH 4LEXL 3QUZD 2X4TA 1KLUA 3QZWA 3FUEA 4I2XE 1T3FA 4MJ6B 2FEEI 5I73B 5KVGH 2YXVA 2AZUA 4IGBC 1X5GA 3IBEA 1EO7A 3GDCA 3QNXB 4RBPH 1L9TA 2Z8SA 3U0PB 4M7ZC 5C0CE 5TE7L 3TFKC 4G6JL 3BJLA 5HYJB 5JORA 3DX9B 4WCYL 4JN2A 3RY5A 1BVLA 1L7TH 4FULA 5DYOA 5SWQB 1FZJB 2P46B 3RURA 4NRYB 4OZHF 2BMKA 1FC1A 2KZBA 3APMA 1HXKA 2X42A 3ZKSD 5IHZA 4HIEB 4HJEA 1SLUA 4Z3TA 3QDHA 1O6SA 2YMOA 3NFPA 5FHAH 4CADA 4PM1A 4LBAA 2ZPKH 1TQVA 1J9TA 2F58L 3RILA 2AHIA 3Q9PA 3PXLA 2Z6FA 3TC9A 5IVXB 4GAYB 3JV6B 5E0QA 4DNLA 1F8TL 5C7XH 4P2QA 1U4FA 1ZK5A 2JWYA 2VUOA 2V3EA 4H0HB 2R69A 4JPKH 4Y2NA 5D7SH 5IREA 3UPRB 5F0LB 1DZ0A 2AGJH 3VXMA 2BP0B 3VI3B 1JHTA 5I1CH 2TSAA 3OPZH 3LN9A 2VDQH 5K33A 4JKLA 1FCGA 1DSYA 3DO7A 2E7BA 2KL6A 3X1BA 3K2IA 2B39A 4KTDL 4WI0B 1GYCA 3WOVA 3UEZA 4ILDA 2AK4A 3S2AA 4M3KB 4HH9A 1CFQA 1O7DC 2NY4C 5INCA 4QY8B 4U1JA 1A4BA 3HHRB 2DLIA 5AWNL 4DF9A 4YHLL 1DVFD 1KLFB 4JHAL 3TYFB 1AMXA 2OA9A 1WH0A 2VLJD 1RMFH 3BUYA 2OMWB 1KNOB 4OJCA 4PD4K 2F18A 3MV9A 2FUTA 1S7TA 4LEOB 1UCBH 2R4SL 5IBTL 9PCYA 3ELAT 3IFLH 2CALA 3ARPA 2XY1A 3LKPA 4HZLB 5I0ZA 4V2CB 2BRRL 3SKMB 3ARDD 1E3ZA 1IGCL 5C0GB 3K6FA 1C5DA 3VACA 1RQ5A 3W39A 5I16A 1QYGL 2NY7L 2XTSA 4I7ZC 3J07A 4NWTH 2VXUL 4XP4H 4V2BA 3WHXB 4JEGB 3TO4B 4AYSA 4MAYD 3L3JA 4YIQA 2E9GA 2ZCKH 5KBPA 1CFSA 1D5XB 2VQ1B 3MACH 4XCYA 4F24A 1JN6A 2QLVB 3TESA 2ZSWA 4LLYA 5SWSA 4PJBF 3LH2H 3ERXA 4I5BA 4D9QD 4YXLL 4R5TA 5T5FH 1BBDH 1S9VB 1WAAE 5DS8B 4XCNB 4ODXB 1LO4H 1M3IA 2Z35B 1UZGA 4QXWA 4A7SA 5FUZL 5F7EH 2I24N 2NY6C 3SYPA 4ZMXA 4Z77A 4U3XA 1J1OL 2AJZB 3U4KA 4NO5B 5I6PA 4PJ7E 4LPCA 2WUBH 1Y07A 5ABZA 1LEKA 5FO9B 4H8WC 4D0DB 3VI4E 5MHSE 4GW1A 2FSDA 4JRXB 1J8HA 1NMAL 1HZLA 2JLLA 1UCTA 3F58H 2ZSVB 1WDAA 4NQSB 5D5MB 1LQSR 2EICA 4UM9D 1CUOA 3FOLB 3L5XH 4LLMB 3LQAH 3AJ7A 5IFJB 1GAFH 1DBAH 2IG2L 4K7PL 3MJ7A 4RAUA 5E99L 5EC2B 2EUZA 1CGYA 3GSOB 3K0WA 3IMBA 1CF1A 4PJEB 4U05A 5IESH 1MJ8L 3S34L 3CSYA 5F21B 5DJ6A 1ZT4A 4KO9A 1SZNA 3ZTNL 1RJZB 4QIRA 3TN0A 4BSWA 1Z9SA 1USQA 4RGOH 1NFDA 1J0YA 4NZFA 2D0HA 4WGWB 4UOQA 4JQXC 5KYUA 3RX9A 3MUY1 1V7ML 2P42B 2PXYA 4LGRB 4ELME 1KACB 1QUPA 1NC4A 3O3AA 4P23D 4M9PA 1HU8A 4GQPH 4ZFOB 3VFSA 3L17A 3K2UH 3GDBA 2APSA 3I6SA 2J12B 1J0JA 3C6LB 4J3OD 2Z65C 4D3CH 5D8JL 3HNSH 1RD6A 1JOIA 3BZ5A 2IPTH 4N2IA 5FYLE 1WSST 4GKSB 1VIWA 3GHEH 3OF6D 3H9ZA 4GG6E 4DTGH 4XXCC 1XIWC 5DUPH 2BSTA 5F1KC 3F3HA 4KPHH 5D72L 2ENQA 5I66A 3HCVB 1H3TA 4KZEL 2XQBH 2RIKA 2ZWKA 5FPIA 4C47A 4KI5F 2O6DA 3Q05A 3EADA 3BIBX 5L88L 3INOA 4QRFA 5F7NC 1B2WL 2VR4A 4TSAH 3GWJA 5T3ZE 3OB0H 4DN3H 3H4HA 2FHFA 3R18A 4XX1G 2AMGA 3H3PH 3ATFA 3KBFA 1AKPA 4AQ1A 2OXHB 4UF7C 1F1GA 1IC4L 1Z9NA 2MQCA 1WE5A 5K9OA 4KRPB 2AQNA 1W0VB 5CN2A 3O3BA 2WD0A 4P05A 2RALA 3F12B 4L1DA 5D1ZB 5G55A 1MCOL 3W2DH 4I3RL 3GXMA 3P11L 4JHZA 5FKAB 1RZKH 3O0LA 3T09A 1U8PB 1D9KD 4WF7A 4HDIA 4YDZA 4WY7L 3L1OL 1WK0A 1KT2A 4DGIL 4MTMA 3NCEB 4PJ8D 4LLDA 5TDNB 1LWRA 2H7WA 4JUTA 2OYKA 2PTUA 5D1XE 1JWSA 4LNVA 4PJGA 4PRNA 3IJ8A 3VVWA 2C3VB 4X8GA 4DVBA 4PG2C 2C7UB 5I30L 4JREC 2VH5L 2MEJB 1Z5LB 1N64L 5IQ9B 1YEDA 3LB6D 4PP2B 3BDBA 1NCIA 2FT8A 4PWKA 1JZEA 4Y9FA 3D4CA 1I85C 5ELIA 3MR9B 2CK0L 3QA3B 1TITA 1L5GB 3JZYA 3GSVA 3SPVB 1JFQH 3KBEA 4KKQA 3KYOA 5AW1B 1FBIH 4UQ3A 5A2CA 4HULB 2WVVA 4S10A 2EIDA 1FLRL 3ARQA 2EEFA 4HJGA 4NPYB 3VXRA 1NGPL 2IH3A 1IBFA 3CMOL 4JCMA 3CXDL 3KWWA 1PY0A 5IIEA 5L2KB 3TV3L 4DUXA 2PPEA 1ZLEA 4QT5A 4WFFE 3CVIL 5TGBB 4Q9RL 3P9LB 1U8HA 3BP4A 3T4AA 1KJ3L 3QORB 4M1CC 2Y2TA 1SVBA 3TBCA 4I77L 4LU5L 1DBKH 5IHHA 5I1HH 2AV7B 1EERB 4U3HA 2J21A 4R0LB 1BVKA 3DV4B 5EV7A 5EDSA 4ZFGH 2HUHA 3UZQB 5KOVC 5K9JH 1RUML 2UVFA 1XR9A 1QNIA 4JZJB 4GINA 5F44A 5IV2A 2JIXA 1R33A 3L4XA 2QQNH 3BVXA 3QEQD 5FGCB 5B39B 1KXTB 1U8KA 4IIZA 4X7FC 4RMSA 1Y6KR 2CBTA 5J3HC 2A6DA 2MHAB 4XI5D 2P9RA 4B60A 3QJZA 5AD0A 1DQDL 1UM6L 4APXA 3FOMB 4LOFA 4OJDH 1HILB 3QB7C 5ECGA 5BMFH 2BP5M 2HSIA 3DHUA 4JKNA 5HHNB 4CKQA 2FIRT 1L0QA 5E1QA 4NAJA 1RJCA 5DQDL 5CGBA 4KVNL 1NUFA 2D03H 2C34A 1DDHB 3NYKA 2QVTA 1HEJC 3WUWA 1NCTA 2HT3D 3KPRE 3QH3A 2YPKB 1RIVL 4BFBD 4UQBA 2AJVL 3N0AA 4LEXH 3ZDYF 1N70A 3ZYJA 5C0JA 5CGMA 3ULVL 2BZCA 1G7PB 3SD5A 1QBAA 1JZGA 3FCSB 4X6CB 3UTSB 4JG1L 4M43H 1ZXKA 3LHAA 2FGWL 1K5WA 4LBEA 2EH8L 2X5PA 2XNAB 4G6JH 3SB3A 4I88A 4P07A 1JZIA 3M1BA 1ZDSA 4WCYH 1NCGA 2CCWA 3AS1A 4F91B 3B2XA 5B1KA 2N7AA 3C5ZA 4IOIB 2DKUA 2H9GA 4JPIA 4Y19A 2XTJE 4I9WD 4LPUA 1OLZA 4L8SA 4UT7L 4B9PA 1FVCB 4AWJC 1AI1L 3MLVL 4HS8H 2CIKA 4KITB 1ET5A 4I48B 4GXUM 2CLZA 1MXGA 3UO1L 2F58H 3B5GA 1UD4A 3V0JA 1T2XA 2IBZX 1U8IA 1WFTA 3FRPG 3N40F 4N90E 1UXMA 3NJKA 2HPOA 2NY0C 4CSPA 3AG1B 1YQVH 1FO0B 4OZHE 1PG7W 3BH4A 4H8HA 2R1WB 2YLKA 3AB0C 4N0YL 5I2IA 4QWWD 4JN1L 2Y22A 4URKA 4R4BB 4PLJD 2IAMD 1WIPA 2NDGA 1MSPA 4IHOA 3UAFA 4CNIB 4FQHA 5K1JA 1I9IL 1BEYH 1KGCD 3VFVA 4L5FH 5D9SB 4PTUB 32C2B 3O11A 1E90A 2P48B 3L5JA 3AUVA 3OKNB 4Y4KA 3PY9A 3TBVB 5ADOH 1YEFL 1E7VA 5DA4A 1BFSA 1KLGB 4HPOL 1VADA 1F4XH 1A6ZB 5AWNH 4QRRA 4JHAH 3V7AE 4LXFA 3BGFC 1H9DA 3AFLA 3GB7A 1N4XH 3AB0B 3B9EA 2UYLA 3LIZA 1YYCA 5LN4A 1INDL 3MA7B 5BJTB 1IAII 3BH9B 4X4KA 3H53A 2IH1B 1ID2A 4N8VG 5IBTH 3GLEA 5I6XC 5JDJA 3IDNB 1E9PA 3VO0A 1A3RL 1YHPA 1X4XA 3IMWA 3RZCA 1HS6A 3VGFA 1S2EA 1SHSA 2VXQL 2VDLL 3IPFA 4I0PD 2W60A 2BRRH 1M3JA 1YCSA 4WWKD 4HIJB 1IGCH 5B3SB 1ZLDA 1I1RA 2Q2LA 4KJWC 1NKRA 3RVTD 2YKLH 3E3QC 1UXWA 3N44F 1QYGH 4WKZB 4X99B 2NY7H 1N3NB 1MIEL 2VXUH 5E5RB 4Q6IA 1CGSL 3UGUA 3WDJA 4B9KC 1KB3A 2C3WA 3GJFK 5BO1L 3KWXA 2H5UA 2WMPB 3I2CH 4AQ8A 1S9XB 3SPIA 3FS9A 5AVXB 2VQTA 5DZJA 5BZWA 5JXED 3DUUA 1RK0B 3VH8B 2GFBB 2QBWA 4LLQB 3PWPB 1J9SA 4NNXB 4TPRL 1HC1A 3LZNA 1WGOA 3VVVA 5BRZD 4YFEA 1UXSB 1UA7A 1X4YA 3BD5A 5DRWB 3STZB 4TUKL 5FUZH 2V7HA 5HYEA 4L9LC 3VMPA 4QHMB 1I3UA 2HTKD 3IDIB 2EZ0D 2GJ6D 6PCYA 4FRWA 4X6BB 1J1OH 5I71C 5IVNA 4LPWA 1ZVHA 5HYIA 2LOEA 4RFEA 1X9UA 3CFQA 4G8GB 1P4LB 4FA8A 4JG5A 1DVUA 2YD5A 3AGWA 2NLJB 3ARGC 3QDME 4N2NA 4K3DL 4MFHA 1HN1A 4HXBH 1QNZH 1TZOA 4GBXB 4X0NA 3X11B 2IG2H 3CFEA 5E99H 2WBJA 3RGVB 4MASA 3Q8CA 4W9FC 3FPXA 4K94L 1MJ8H 4XN4A 5SWSE 4FFZL 4M48L 3S34H 3P0GB 3EDKA 4D2NA 3CN4A 2A77H 1XT5A 4L9LB 1I7TA 4PGDB 3ZTNH 5AUMA 4OB5L 4ZMOA 3KHQA 3GKZA 3PFUA 5MI0C 7FABL 5LXGL 4W4OA 5LCVH 4JFWA 1V7MH 1ZLVK 4AKOA 1IM9B 3GRWA 3GGWB 5TQ0H 1QTPA 4HJSA 1Z32X 4XMLH 4Q7DA 2DMCA 4F9LC 2I5YL 3EH2A 3FUHA 1TZIB 3UZVB 3QYNA 1KJVA 1WBYA 1WA2X 1Q9WA 5D8JH 2VZ1A 3WY3A 3SDCC 4AVKA 4X2UA 3B83A 1WZMA 3S4SG 3N41F 2C3GA 4FI6A 4XGZB 5J0BA 1AZUA 1MWAB 3VJ6B 3IRPX 3NFNB 5SWZA 3NSJA 4DP8X 5CIPA 1FNFA 3B3IB 4G3YL 4OFVA 5E9NA 3VSVA 3NJXA 1N12A 5D72H 4GFTB 4FZ8H 4XE0A 1M56B 2XFGB 4QO1B 1A02N 5KBDA 4G6ML 4KZEH 4OFQA 1IAKA 4OCLC 3U7WL 5IF0B 3LPGA 4MX7A 1NFDE 1BIIA 2B1AL 1B2WH 1RZGA 3T6QC 1R3JA 1SXBA 1ZS8B 3V5HA 1U58A 4F3FA 2YEQA 5FECA 4PJXB 1I4FA 3ZTEA 4YH6A 1AOHA 4TV3A 3V0AC 3GSUA 3T3PE 2C7FA 1CGWA 1IC4H 3OWRA 5GRVL 1TEYA 2NY2D 1A7QL 1PLBA 3M7OA 1GJIA 2XWTA 4DJMA 3K6OA 1D5BA 4KI5E 3ASOB 4ZMAT 3QZWG 3ZL4L 1E28B 1V55B 1S7XB 3HC3L 4FQXA 4JGUA 5I23A 2CAKA 3VW3H 3DETD 1UT1A 4RSVA 4X9BA 3P11H 4QRPE 5I74B 5BVJB 4MA8L 1E8ZA 3D08A 2XICA 3CN0A 4GO6B 4E41A 1QFWL 3S48A 1IRAY 3VM7A 4WY7H 1IGFL 2A4CA 4DGIH 2GPZA 2YD3A 4QI3A 2Z4TA 4XNAA 3BT2L 5J1AA 3X13A 1RZ8A 2AJSL 3HKFA 1YY9D 4G8AC 5GGSY 1JD7A 4ANWA 4PJAE 5J57B 2A9ML 1ORQB 4JFXA 1MCIA 1BFVL 1FWXA 4WUUB 5I30H 1PKQA 2YRBA 5CGYC 2GK0B 3GMOB 4PGCA 1T1XA 3UCQA 1N64H 3ULVD 3FRUA 1AGEB 1BXUA 3NJVA 1SNRA 4TVUA 3OTTA 3VX1A 4DP1X 5SX4H 4OZIF 1KZQA 3DRQA 2QDWA 2F5AH 5KVMC 1G7MA 1XHHA 2V17H 5E4IA 4DP0X 5EEVA 5AL0A 5KOMC 1X5AA 5E94A 4YXKL 1X5YA 3HMXL 1NGPH 3GXFA 3CMOH 5F1OB 4PRPB 4FJZA 3CFTA 1GR7A 4OI8A 4ZTOL 4NOFA 1HNFA 4U6HA 4Y4FB 3CVIH 1FNGB 4QXVA 2DOCA 4L1TA 4LVNC 4EI5A 1M7DA 3RWFA 4PJGE 1KJ3H 1XDTT 1VFOA 3KPTA 3P4MA 4OKVB 4P2RA 1HIML 3SDAD 4ZBJA 1G6RB 1VZIA 4H4NA 2ITCB 2AQ1A 4JDEB 4LU5H 3ZKND 1K2DB 5H37G 5BS0A 1F6FB 5CILL 3VWKC 3QHTC 1MW3A 1NOFA 1OO2A 1QSEA 3PHOA 3JWOL 3MRHA 3O4OC 2R4RL 5ID1B 1FG9C 3SCMB 3R7RA 3SBRA 1PGRB 4DGWC 4I2XB 1FL3B 4GRMA 3BEWA 4U49A 4BZ2L 1H8LA 2FH8A 2XRAL 5H2BB 5KSBA 5A16A 1P7KA 4K9JA 2H0EA 3DX6A 5F9OL 2NY5L 4HPHA 2Q7YB 5PAZA 5C0CB 2NNAA 3O2DH 3O8XC 1LP9F 2EH7L 2MOVA 1DQDH 1UM6H 1CFTB 2WLIB 2WNKA 4BFKA 4DCQB 2ESVD 2YD2A 3O6FA 1LXMA 3DXAD 1G84A 3BPCB 5DU7A 3BZFA 1CQKA 3FUDA 2E9JA 2Q8BL 4LIQL 5E5UB 5DQDH 3GXDA 4KVNH 1B0GB 2PWEA 4N4YB 4PSRA 4OSUL 3WELA 1FF5A 3V79C 4ABQA 3GS4A 5CR8A 5ISZE 1RIVH 4WO4B 4HW6A 1FN4A 3HC4L 4QOKA 1IU1A 4LHUD 3ZYZA 2YD1A 5CF3A 4J12A 4PVBA 3RNQA 4ODSL 3REVB 3QS3A 3EYQC 1NAKH 3CDZA 4J39A 1CFNB 1I9JL 2FGWH 2ROYA 2J8UA 5DMKA 1G7JB 2K7PA 1QRKA 1CDBA 1I7ZA 1HINL 1H5BB 3ZDYE 3IF1B 4Y16D 3BLBA 2HTLC 1EHKB 3B1TA 3GD1C 1NBCA 3HG4A 2AKRB 3D2UD 2WIIA 4UT7H 4P5KB 4HKBB 1LO2L 3MLVH 3LN4A 3HFML 5BUPA 5JOPD 3NRPA 4OLWL 1YC7A 4DZBA 5J13C 5D7LB 3UO1H 1ILSA 5D70L 3AT9A 1FZKA 3HJEA 3UJJL 3F7YB 4ORGA 3ZU8A 4KH2A 2CK2A 3C6SA 2RTTA 1CFMA 1P1VA 1DQQB 2EE3A 3ML9A 4XMXA 3QUML 3KG5A 3H0TA 2FIKA 4IIQC 3EXJA 1TJIH 4N2LA 3JTTB 1KJ2B 4ZNCD 4L8BA 3BPNC 2ZWLT 2HWZL 4W6WB 1F4HA 1U95B 1YYLL 3D09A 3TIDB 4L0PB 3HRZB 2Z7UA 3L3KA 2LHAA 1T04A 3WY2A 1FQ9C 5J06A 4N2CA 2DH3A 1KB5B 1LO5A 3U1SL 2QR0B 1NPUA 5IVZB 5IKCB 2O5YL 1BG1A 4A6YB 2WYIA 1YEFH 2AEWA 2BOBB 1D6EA 4PS4L 2EVFA 1NKGA 2IPUK 3GMPB 1Q9LA 1PG7H 1S3RA 2GJZA 3GBML 1X5HA 5DSCA 1EXUA 2DL2A 2P49B 3HLAA 3ARFC 2ZKXA 4M29A 5HPMB 1UASA 1INDH 2CMRL 3BSZL 2K7QA 3B2MA 1R5IA 4F7MA 3C60D 1Z0MA 1U92B 3ABZA 4MDRA 1A3RH 4U4BA 1MCJA 4BQ8A 3VU1A 1JGDA 5DTFB 4F1SA 4KOBA 2AEPL 2VXQH 4W1TA 2VT0A 5KYYB 3VAEA 3VD0A 2DAVA 4PREA 3L4TA 4PJ7B 4JJ5A 4XZUB 1BZ7B 2PO6D 3VI4B 2XWBA 1UKTA 4WAFA 1BMGA 4Q9QL 2X4UB 1KTBA 2FJGB 4GKNB 3RUGF 2PR4L 4L1BA 2VQUA 1MIEH 1Z9PA 4HS6A 2WC7A 4FZEL 1RZIA 1KFGA 2A38A 2OMXA 2PCFA 1RPUA 1IJ9A 3IVKB 1TUPA 4J8RB 2VMJA 1OSPH 3I9PA 3CPLA 5B4MC 3EJYD 5DXWA 1W72A 1YO4A 3QISA 3QP3A 2F53D 3BVNA 1YUHA 4O9HL 5JOFB 5IVOA 3VFUB 4TUKH 4RFOL 3IGAA 4XC1L 2DEYX 1WBZA 3ZTCC 4AMKL 3ZDXE 4ELMB 4PJDE 3IXAA 3UACA 4DKFH 5BV7C 2IANA 4I89A 2A83A 3W11C 3GXUB 1INQB 1B90A 4D9LL 3B56A 3S97C 2FSEA 4I8DA 3BISA 1J0HA 1KCRH 2J55A 2NYKA 1KG0B 2P47B 4F15C 5AFAA 5JZ7C 4GKLA 4IKIA 2ATAA 3V6OC 4GG6B 3FCTA 2V9UA 1Q1JH 1JCVA 1TVDA 1KMGA 3PUUA 5E6IB 4M48H 4LKXA 4LSVL 1S3KL 3U30B 3H7LA 3JWDC 2VJ8A 2Q0ZX 4YHYB 2VERN 4OB5H 4P59L 1PDKB 3VGAC 5LXGH 1EFXB 1CU4H 1O9ZA 2VGLM 1TDQA 4XPGL 1KUMA 4R7NA 4ZX4A 3AY2A 1XCTB 4RLDA 1JDDA 1PLAA 4JGMA 1MVUA 4DQAA 2VAAB 3ETTA 3VCLA 4AV0A 4G6AD 4LVHB 1CL7L 3HBPA 1U36A 1UWEL 2ADGA 3MLZL 4GRLB 2I5YH 5D1XC 4AG4L 1NAMA 4BINA 3D18B 2GQHA 5HI4C 1P5VB 4V33A 4L2YA 2YOAA 5I1IH 1HWGB 1JMZA 4XRCB 1H3XA 1NSNH 5F9WB 5C0BA 1LO0L 3HE7D 4G3YH 3O81A 5EOQH 5HD8C 2UXGA 3T0ED 4TOYL 3UEQA 4JFVA 1J88A 4TM9A 3T3MF 3VFRB 3ZKXB 5I1AA 4MMXC 1KOAA 2F54D 3CC5A 3EUDA 4WHDA 5GIRA 3RP1A 3U7WH 4A7GA 4DETA 4WI7A 3SGJA 3CFMA 2B0SH 5DK2A 5TE4L 1P7HL 2YD0A 2Z31D 2NDFA 2FWSA 5D1XB 1L9QA 1EA9C 2GTQA 1ZXQA 3IDMB 3ILQC 4QRTA 2C8NA 4MKMA 2KQNA 2P8PB 5C6WH 3ME0B 3T08A 2WWKO 3K81A 3WUWG 2TRHA 2WYTA 5C0AA 3CSBA 1A7QH 1CE1H 3QZPA 4J3TA 2Z3FA 3DHMA 3UBHA 3ZL4H 4X4XB 2QLYA 3HC3H 1JWMA 3MV7E 3OZ9L 4JQIL 4ONFL 5J6GB 2H1LM 3MRMA 3QS2A 4G83A 3DNKA 5E8OA 3SHSA 1RY7B 4UQAA 2CLRB 4UAHA 2FCBA 5T1MA 4HJ0D 4NX0A 2AP2A 2RJMA 4X5WA 2XIIA 3WNKA 3VFNB 3ZDZE 1VENA 3BT2H 4X8JA 2IQAB 2AJSH 2HX8A 1AYOA 1CGTA 1KTDA 2H8PA 4TUJB 2BC4B 3GNMH 2A9MH 4H25A 5GRUH 3BESR 4GLRH 1BFVH 5LNGA 5EH1A 3ZT5A 4Y2DB 4MD4B 1BLNA 2ZOLA 4G8IA 4O58H 5F6HJ 2EYRA 3P3RA 4PVNA 3KLAA 5LAXB 3KBPA 3Q3GA 2NSXA 1JERA 3CFJB 4H8WL 4A66A 1OAYH 5KAQF 1HSAA 3VD9A 1R1CA 2EABA 5D7IE 3MLTB 2CO7B 1TQWA 3MNMA 1JV2B 1YNTA 2OX5A 3QK0A 3LV3B 1EGJA 4M5TA 4AW7A 5IW6A 3WS3A 1ZTXL 5EU5A 4YXKH 1QA9A 3NAAL 1VB9A 4JL1A 1FNAA 3UXFA 3HMXH 2QKSA 3OC5A 3V5KA 4U1NB 5T1JA 1B0WA 1BMZA 1JS4A 4UIMB 3WIIL 1CE6A 3FU7B 3L4CA 4UU9B 5EU6E 1X7TA 1IC5L 1PD1A 1MAML 2WTOA 3KPSD 3QQ3B 5B7MA 4F2ME 5AVZB 4WW2B 3WTYA 1N5YL 1TU2A 2PWDA 4OLZL 5JW3L 1AC0A 3MJ8A 1Q1PA 2AABL 4JGNA 2R9HD 3KWVA 1HIMH 1ES0B 3SKOA 5KJRL 2OPCA 4YDIL 1F1DA 5D7JA 1P5UA 2HFFA 5HJBA 1AS7A 4PPTA 5DJ0B 2QQLL 4JRFA 5CILH 2J3SA 2LV4A 4TNFA 3QUZA 4ZFQA 4R4FL 3D0VA 3KPRB 3MMEA 4YPGB 5HHOA 1DLFL 2BSDA 3RI5F 1QLFB 3TP4A 2JKSA 2P28B 5DZAA 3DGGA 2D31A 1GW0A 4WSKA 4BZ2H 1I3GH 3BVDB 1Z9OA 7PCYA 1ZPLA 2XRAH 4P4RB 1A6AB 4Q6YA 2J57A 3APCA 3BVWA 5DC9B 2EKJA 4R6UA 4YK4C 3F5WB 4RA0C 1I8UA 1TTUA 1XX9C 2O61B 3PABB 1IBBA 3GM8A 1HXYB 4XCFH 4XO4A 4JFDE 3MFGB 1DBJH 1A6WH 3MO1A 1WUZA 5A7BA 1KJMA 2IEPA 2P5WD 4P2RE 1FZOA 5AVRB 4L1LA 4LIQH 2Q8BH 1R3IH 3VD2A 2JTDA 1AXSB 5FLUA 4NSKA 3RX5A 1HAUA 3IJSB 4HWNA 4JFPB 4NQED 3O2WH 4JM2D 5DRNA 5KYWB 4JLRB 4AEHL 4YDLC 3LRLA 1RIUL 1BCIA 5E5MA 3MROA 5J6HB 4PRAB 3IMSA 4F8NA 2GEQA 4LPTA 2J1KA 3SIKA 2GC4C 4WEMB 4ODSH 4OZHB 1A7PL 3NIGF 1IVLA 2X89A 4GSRA 2PYED 1CD8A 5AB9A 2G2RB 3WMPA 2YSTA 2GTZA 3QARA 4G9FE 1HINH 4AIZB 5JORB 5F1IA 1OAUL 2HAZA 1BVLB 3QPXL 4JN2B 4UTBL 3O41A 4PY8J 3IXTB 3MRRB 3WKNA 3QYMA 5CS7A 2GW5A 1G0XA 4IBTA 1WV7T 2CPUA 1LO2H 4ZUSB 5I8CA 4HUXA 4JDVB 4OD2A 2W0KA 4AVIA 1U8MB 3CX5K 1QBLH 2OP4L 3FQUA 3MGTA 4E9RA 1SHXA 3MLSL 3EGXA 1UFGA 4QOKE 4EKXA 3S5YA 1I1AB 3UAAA 4BGLA 1NC2A 4G1EA 1FFPA 1OT1A 3A67L 4FMVA 4KV5F 3QUMH 4IGBD 2VLKE 4N1CA 1BFOA 2EC9U 5IKCA 1BJMA 3LZFL 3TFKD 2EUWA 4G70B 4MNHB 1U93B 1YY8A 3VGEA 4GKZB 4OGZA 3ZHKA 1HOEA 2E6QA 1XF4A 3KS0J 3U1SH 3VFMA 2O5YH 3G9AB 2DLTA 2FWOA 2I9LA 3E6FB 2Q6WA 1YMME 3V0VA 1QI4A 2ZG1A 1T2JA 3GBMH 3NDYE 1Q0YL 3OG6B 3F05A 2IALA 5A43C 3NH7L 2UXFA 3TEWA 4HS3B 5DZLA 4L4JA 1M1XA 5DT1L 1TVBA 4BFRA 1EHNA 3BUYB 2CMRH 3D4GA 3M1CA 5DD5H 3TU6A 3BSZH 5AZ2H 2EXWC 3ZTJH 1JPSL 3IJHA 3HHSB 5C0RL 1RUKL 1OB1A 4K2UL 1S7TB 1J11A 2WZ5A 4HKZA 4UAOC 1TCRA 5EWIL 1RI8A 3LKPB 3KCWA 5GS1A 5LWYL 3DTXA 5LGJA 4ETQB 5G5DA 4Q9QH 4R7DB 1RZQA 4OLYL 4P57A 4XHJC 4YBHA 4NM8L 4JZNB 4UM9A 2PR4H 3MRFA 3QDMB 2NY4D 3STBA 2VR7A 2I26N 3ILDA 4E0RB 4RZCA 4YIQB 1ND0B 4QGTA 1QLRA 5T33L 1T66C 4F8OA 3IAPA 1JN6B 3QZNA 2BOCA 3QCTL 2VXVL 3QSKB 4X5XA 1TQBC 5SWSB 4HUVA 2WBXA 4AGQA 4DP9X 2WLZA 3TBTA 1MJ7L 2PP7A 3ES6B 3TJHC 4AK1A 4RFOH 3U6XS 1DUYB 5K69A 4XC1H 4HH8A 1O5DT 3MCLL 1LWJA 5FOJA 5E8EA 3KJ6L 2AK1L 4A2GA 4AMKH 3ZIYA 3FH7A 1DUZB 4PD4J 2UWEF 2X2UA 2IXQA 3AREB 4AQAA 2PXYC 1J8HB 1QSFD 4JFYA 3VA2C 3FCBA 2C3XA 3VXUE 5TDOB 2DM2A 4U1MB 3FJTA 3HAEB 3GUTA 4PHXA 3FTYA 1E3XA 2O30A 2WSPA 4U3CA 5DYFA 5HJGA 4BWWA 1CGVA 4LCWA 1PLCA 1TQBB 3MYZA 4IJTA 4RAUB 2OMZA 1UEYA 4TQ8A 1RIHL 2G2NA 4J3OF 1KDIA 1G7HB 5I9QB 5LNEA 4LSVH 4NC2B 1S3KH 3CSYB 4P59H 4LP8A 5IQNA 3FCGA 4YQXL 2YSSB 1TZAA 3DO3A 3GJFB 5MEOB 3TN0B 2NY6D 4RBPK 3DOSA 1NFDB 1VGEH 2QHRL 4AGOA 5JPMA 4AJWA 4ES8A 1HHHB 3ULUF 1GGTA 4M8VA 1QUNA 4FMKA 4XZ4A 2RB8A 3S5ZA 2XN9E 3PQYA 1AQKH 2BIQA 2IANE 3EG9A 4Z5RB 2CKBL 1UWEH 3VFSB 2Y2YA 1FFTB 2VCOA 1NDTA 1ML0A 4J3WA 2R0KL 3T3PB 1ZLWH 2JXMB 3K91A 4XTRC 3WE6A 5JW4R 4MAZA 4AQ1C 4FYTA 4WFHE 2DD8L 4LQ1A 2DQIH 1QI3A 1D9KA 3E9UA 1LO0H 2HVBA 3L3GA 4I4WA 2NX5A 2BSTB 2CH8A 4TOYH 4QRPB 3MCG1 3ZYOA 1D7BA 3K2KA 1UH2A 5IHUH 3CK0H 3P77B 5I66B 4OKDA 5C07A 4F27A 4M4RB 5ESQA 3GSQA 1D7CA 2IH9A 2VSCA 2VW4A 2BY1A 3TEUA 1TSRA 5L4MA 2XCMC 3JWNH 4RMUA 4KJYA 4PJAB 2CRZA 4K55A 2KI6A 2COQA 5DS2A 2XQYK 4LSSH 3HS8A 5F1SA 5KBLA 1HE8A 1NLBL 1ZHLA 2GHZA 2XU9A 4HF5L 5DZNA 2YEVB 4OZ4A 3OZ9H 3TVMB 4ONFH 4HFUL 4YWGL 2P5PA 2HVJB 1BD2A 1XIWD 5C0BE 1XGRA 3HZMA 5CJ5A 2DICA 1EEYA 1YEJL 4GAGH 4QXTB 2VKXA 3NZHL 3RVUC 1K5NA 2JB6A 5KW9H 3D33A 1MJUH 2LAGB 2M8XA 3EYSL 3IS1X 1CICA 1QZ1A 5DZ9A 1UZ8B 4XCCH 5HVHC 4OCSL 4EDWH 1Z0NA 1WC7A 1KT2B 1B0IA 2E3VA 3HNVL 1MLBB 1J12A 1JWSB 4PJGB 1OXYA 2WXGA 1PPIA 3ZOAA 1IBZA 2IIJA 5CEXA 2VLMD 2A9DA 5KVGE 3KLHC 3QDGD 5IJDC 3T4AC 4JO3L 3K2MC 1SLVA 4P5SA 5DJ8A 1NBVL 1AGDA 1FIGL 3N1PC 4BKLB 4Z1PA 4PJHA 5IMMA 1GGCH 4ECNA 2XHNA 2J8HA 4GIOA 4N0FB 2KDGA 4R2GC 3TPKA 3GSVB 4PJBA 1EO8H 3TTYA 1ZTXH 3IDJB 4PV8A 4IBUA 4HJGB 3L3DA 1SJEA 3MUJA 3RWCB 2E7MA 2JSFA 3UGEA 1T7ZA 4BQ9A 1IC5H 1U2YA 1MAMH 3IDXL 3RJQB 1U8JA 5JW3H 3MRIA 4OLZH 4RMBA 1DYZA 2AABH 2W9EH 3G6JA 3BP4B 3FO2B 1AR2A 2I07B 4NI3A 4YDIH 3VXNB 4N0CC 4GUCA 3CBJB 4UANA 4HSQA 1G1OA 2QQLH 4LSTL 1HK6A 3ETBF 1XF1A 1A8ZA 1L6ZA 1BVKB 3DK0A 4FTVA 4JJHA 1DLFH 4ZMVA 4FHKA 1XSJA 5ISZB 2ZX8A 5FUCC 4DZ8A 2YKKA 4PH8A 3BJ91 4APQB 3R06B 4KK5C 5HYQA 4IHBA 5D2LE 1S8DA 4OTXL 1IT9L 4JY4A 2M26A 3H56A 5IV2B 5IB2B 2JIXB 1MY5A 1SPDA 3NCYS 2YMTA 6TAAA 1U8KB 2IFFH 4XNYH 5DD1L 2VZTA 5CSZA 2BNRE 1A4JA 3MBXH 1AQ8A 1QQDB 4M6OL 1NBZB 4AYEC 4EI0A 3O9WC 1KXHA 4GQQA 4A1RA 3PLYA 4HT1H 3ZDYB 4M1CD 3TOPA 1QW8A 1AS6A 3WXWL 4A37A 2AITA 4JRYA 3C5ZC 3EYVA 1FA4A 1ZSDA 3I84A 5A2LH 1BGXL 1MI5A 4L8SC 2PCYA 2XPGB 3A4EA 2DWTA 3FT1A 3MDJA 3QH3B 4K71C 4MA3B 3D0LA 4MJIA 3RDTA 8FABA 2GUOA 2C9SA 4O2CB 3SKNA 4ZT1A 2X0WA 3FT0A 4NPKA 1A7PH 3ILPA 5IFAH 5IMOA 5EO0A 4AL8C 3B2UD 5J3HD 3CFCL 3DUHA 2FK9A 43C9A 2ZAHA 3UTSD 3RWJA 2F6AA 1LD9B 3MTRA 2P26A 4UDTA 2WGXA 4L0YA 2V9QA 2DYPD 2FEJA 2ZOTA 3HN5A 3QPXH 3GQFA 4UTBH 4Z7NF 4MXVF 1U8QA 4L3CA 4K3JL 2VE6A 2A9AA 2UZYA 1IV8A 2YAHA 3OB0K 4MRBA 1DFXA 4XPTL 4XNZC 5LGKA 3BQUB 4HCRH 4NRXB 2BWIA 4L8SB 2B5IB 2X9XA 3NIGE 4ZAKC 3SKUD 2OMYB 4G42A 3WFDL 3PFQA 2B20A 4Y4KC 5LCVA 2ENJA 3VWJA 1CR9H 2OP4H 1WUNT 1MF2L 1KB9K 3G04A 3MLSH 3CJJA 3WFBH 3W0WD 2YGPA 3TO2A 3A67H 3D3VA 5F72S 2HMID 3GI9H 4QRSB 2E76C 3KE0A 1KIRA 2VDRH 2VDKH 2MCMA 1N2RA 3BWUF 1IGJB 1FC2D 3IGLA 2HKHH 3LZFH 5JHMA 3D7PA 1TEGA 3NMEA 4DESA 3NCYP 3QIUA 1EWHA 3CGTA 1R0AH 3JTSA 5AZEL 4FQHB 3IJEB 2DM4A 4XNZB 3RZCC 3MX0B 5IMLA 3VFVB 1QASA 4JANB 1JPEA 4LOUC 4BFIA 4OBSA 1SDDA 5I0XA 3ABMB 4NCC2 5B8CA 4KV5E 4OCXL 2PABA 5AB0A 5D1QA 4EZJA 2CGRL 3X1FA 3GIVA 3LS5H 2VLJE 2QJDA 3TA3A 4FQ1L 1VADB 3SQBA 2GITA 2XXFA 3MRGA 2OL3L 3NH7H 4Q6IC 3JYBA 4K5NA 1J05A 2VJXA 3GB7B 2NY0D 4GMSL 5DT1H 2X7LA 1D5RA 2UYLB 3CH8A 5FUOL 4AQ8C 1F3JA 1FVDA 3FXIC 4XAKD 1MCHA 5C0RH 4J3SA 5KS9F 3WD5L 4K2UH 3L7EB 2X70A 4NQVA 1HKLH 1FFQA 2WWKT 2X3CA 1WCBB 3BRDA 4XMZA 4N2FA 2EE9A 3ZDXB 5LWYH 3K6DA 4PJDB 2UY7A 1ETZA 1A6PA 4OF8A 2W81C 4NM8H 1UXWB 3VXPB 1HNYA 1TF4A 2NT0A 3CHOA 3L1GA 4C54A 4BA0A 1DBMH 5ERWA 3QJQB 4X6DF 2Y07L 1I7UB 1UA6L 1XF2B 3GMQB 2X4SA 4D9QE 3QQ4A 5T33H 3ULUH 3K6SA 1KIPB 1A6VH 2CJ3A 2VWEE 1BIHA 3QCTH 1ZA3B 5CM1A 1CF8L 2ZX6A 4ZXBA 3GYRA 2WBJC 4OIBA 3WNMA 1MJ7H 4XXDA 3JV4B 4MJ4A 5EIVA 3FN0H 3U0TA 1VFUA 2RAMA 2WGNB 1MFCL 5L6YL 3LH8A 1P1ZA 3UOAB 4F2EA 3B7YA 2JB5L 3PDOB 4H88L 3CFUA 1F4AA 4QDGA 4W4OC 2WZPD 3ATBA 2Y36L 1UD6A 4KJWD 4WO0A 5IW1A 5E1HB 2C1PA 4PWGA 3QHFL