3GUFA

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
b'AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight heat shock protein
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
total genus 14
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gufA00
2Y1ZA 2MNWA 2XCMC 3L1FA 2WJ7A 4PBDA 5DS2A 4MJHA 1SHSA 3QORB 4YL9A 4ZJ9A 3GUFA 3AABA 1GMEA 4ELDA 4YLBA 3GLAA 3VQMA 5DS1A 4JUTA 3J07A 3VQLA 2KLRA 4I88A 2Y22A 4M5SA 1WH0A 2WJ5A 4M5TA 1EJFA 2CG9X 4RZKA 3Q9PA 2O30A 3EUDA 5LUMA 3AACA 2CR0A 3N3EA 3W1ZA 2KMWA 3L1GA 4YE0A 3GT6A 3QORD 2Y1YA 4PCKA 1X5MA 1RL1A 2K8QA 2JKIS 1WFIA 2RH0A 4YDZA 1WGVA 4JUSA 2N0KA 3QORA 3QORC 2N3JA 3L1EA 3IGFA 4FEIA 3Q9QA 4YLCA 2BOLA
chains in the Genus database with same CATH superfamily
1L6PA 1MFBH 2E9GA 1E30A 2Y1ZA 2QJDA 5FOBA 5GRUL 1RPKA 2NYYC 5ALCH 4P5MB 3TTYA 3FQWB 3KJ6H 3TBWB 3K6NA 1P4BH 1CE6B 3I6SA 4FFVC 3FNKA 4FTVA 3VXUB 5TQ2L 4ORGB 4BSWB 2A6IA 1TITA 4OVVA 1NEZA 3VD3A 2VDLB 2ATPB 1JSYA 5C09A 4WUKH 1P7BA 3Q2CA 2Y5TA 4PB9L 1C12A 2NX5D 4ZDHA 3GRWH 1NL0L 5F1KC 5AL0A 2APTA 3FQXA 1XXFC 1HXYB 5HYJA 2W60B 2NY2D 5ALBL 1PG7L 3EHBB 1R5VA 3IFLH 4C83A 3KPOA 4FQ2H 5HDLA 2BZDA 4EIZC 1QHPA 2XDHA 5EF3A 2QLYA 2HFEA 5DFWH 4ZUVA 1D5BB 5EU3A 1JHKH 4ZMTA 1MFAL 4K7PH 4GBXA 4HS3B 3X12A 3HG3A 3M7OA 5C9JB 2VXVL 1YUKB 5A2BA 4LHUA 4G8GA 4Y2DB 3G5XB 1X5KA 3GLDA 2BSTA 3VGDA 1UWYA 3Q5OA 4L3AA 2J21A 3DXAD 4BFEA 2GUYA 5FA3B 1XGTA 3GM0A 5GGTH 1JGLL 1OD7A 2EUVA 3SE8H 4E9XA 5T5NF 3O6KL 3PP4H 4O00A 2QLVB 3QFJD 4R4BB 4PJAA 4A38A 4DGUA 3W81A 1KV3A 3IU3A 1KELH 1J9CT 1FPTL 4YR6B 4KFZC 1MAJA 3Q2LA 4PVMA 2DD8H 3ARFD 5C07B 3W9EA 1A8JH 4PY7A 3NK3A 4G5ZL 4JQIA 4ZPVB 3VWKB 1USQA 2D8KA 5A6LA 1FVEA 3O2DA 3S4SG 5KSUA 3QI9D 3ROOA 3JV5A 2BO0A 3E80A 4YHYC 2WCSA 3JUZA 3L3GB 1K4DB 3QORC 4U1JB 2D7NA 5BUAA 2P8PA 2X89A 1R5WB 2BH0A 2G60L 4P59H 1WWCA 3F7KA 3ML8A 4HMDA 1KIQA 1IGCH 4Y1AB 4J3OF 1INDL 5GRJH 5IMKB 3K7UA 4NPYA 4ZFOB 3TBTA 1M57B 1T1YA 4QHKJ 5AVWB 2UY6A 4P3CL 4Y16C 5D1ZA 1MHCB 1S9XB 3C2AL 4X7SH 5H8DA 2ZOLA 1JZ7A 5FHAL 5CSGA 4LKCA 1IGFH 1HH6B 5E4IA 3H9YA 4Z7WE 1QI3A 2PP9A 4QCIB 1MZZA 4JUSA 1MEXL 3VG9C 3SE6A 2Z8WC 3PIQA 1JPTH 5FFGA 5J11B 1I9RL 2DQGH 2M8XA 1KJ3H 4CW1A 3CFKB 4FA7B 1CFTB 1E28A 1XCWA 1VFMA 2ESVE 1CLYH 5AWNL 1CCZA 1ZV5A 4WO4C 3MRIA 1DR9A 2ZWYA 2MQGA 1XZWA 4LPXA 1RMFH 1LK3H 3C9NA 4UMGA 2DQ6A 3ME0B 4F7EA 4Z7QF 1EUUA 4ICXA 3N06B 4KKLC 1AS8A 4M5YL 5K1VA 1HXKA 5DURB 3RPBA 2O6FA 3INUH 5T3ZD 1IX2A 4YQXL 1Y6KR 5IUCA 3SPVA 2OMYB 3LRHA 2G3NA 3VFUA 4F8QA 2NX5E 1WGOA 2HLAA 1TYEB 1KYOJ 4EZLA 4UQ2A 3ULUL 2AI0H 3PNRB 4G8IB 5L6YH 2EVGA 2EXWC 4Q74A 3EFDL 3MLSH 4PJDA 5CGYD 3MODL 3ZHLA 1JTOA 2I7OA 5KYXB 4NI6A 2Y9RT 2EYTB 3SDCD 3QJUB 2PTTB 4G42B 4GY4A 4XMUA 1HVXA 5E6ZA 4JZJB 3HE7D 3M7FB 3WUWA 1XAKA 1RAMA 4DVRL 3EO9L 3IFOA 3X3GH 2BNQA 1NOAA 2Y5QA 3BRGC 1SGKA 1NSNL 3K8MA 4AQ8C 15C8H 5ACZB 5FF6A 1I3GH 4HK3J 2DM7A 1IBFA 1P4IL 1TZAA 5CLWA 1MCNA 4MCYA 5EZJB 2DL2A 3QYCA 1UB5B 2CK0L 3SY0B 3L3OB 3MA7A 2HG5B 4XMWA 4QPEA 1AYOA 4F7TA 1DP0A 3OKMA 2GTZB 2Y25A 3DV6A 1DE4B 4HCGA 1T03L 4ZT1A 4HOZA 2ZSVA 2IMNA 3QFJE 5E1GA 4HWZB 4TPRL 3IFNH 5EUOA 2NQDA 4MVBD 3ZK0A 3O2VL 1CK0H 1FVCA 4LBAA 3HI6L 2K0RA 5I0XA 1AANA 1DJZA 4MNQA 4GAYB 5TE4H 3ZMEA 3LEYH 5FO9A 5KYYA 3BN9D 3MFGB 3W37A 4S10A 5LNGA 5IB5B 2FYVA 2KKQA 4R5TA 2YAFA 3N0PB 2FWSA 4NHCH 5A6IA 1G0XA 3WBDA 2CG9X 3L4TA 5I73B 4FADA 1DLHA 3K71A 2E8YA 3DVNA 4Z7UE 4XCNB 5T5FA 4HPOL 2J43A 5AVSB 5IKCA 4W9ZA 5CJOH 4NN6C 3VRJA 2A6DA 5JXEA 1UACL 1BQLH 1FI8C 3CLEH 1LTXA 3MLUH 3HPLA 5LN8A 1A1MA 3QC5X 4FQ1L 2VR9A 2V7NB 4KH2A 2BSCA 2OMXB 3NFNB 4XPTL 5DZVA 4G43B 5HI4C 2EVHA 4N26A 3VXOB 2HPTA 5I1KL 1WJ3A 2K6WA 3WIFA 1MCPH 2AK4A 3DOHA 5TDPB 4KTEL 5F6HI 4YDNA 4DZBB 5EO1A 3ULVF 2EIJB 3O3BB 5GGQH 4H0GA 3SY6A 4G59C 1KB3A 3LCYA 3KCPA 3LMJL 4GQQA 4KO7A 4LCWA 4RWYH 5DC0A 2EDRA 4GFXA 4HKBB 2WINA 4DAGL 2FO8A 4MB3A 3KNBA 1NIFA 2VJXA 4M61B 2GJJA 3T6VA 1N6QL 1JXGA 4BH8B 5FYJD 5HD8D 4Z7VB 1RZ7H 4NZRL 3WKNA 1AQ8A 1Z9NA 4K8RC 3QZBA 3K46A 1H8NA 1ORQA 1UT9A 4XWGH 4D3CH 2VDMB 3AW5A 3LNEA 5T3ZE 3DURB 3K6FA 4ESKA 4NSKA 2N1TE 3M45A 4MB5A 5C0GB 3EO1A 3HC0A 2PO6A 1LP9A 2YQ3A 4HEMA 3WE6B 3RIAK 3SDAD 2ZCKH 5D7LD 4ZNEE 1SY6H 1FO0L 4J4PC 5I0DA 1OAUL 4IBQA 4M1CD 1ZVNA 1CFMA 3OPZL 1LNUB 4CC4A 1OAQL 2XNAA 4POUB 4XODA 3AGVA 1YZZA 1CE1H 3IMRA 5CHNB 3ZE0B 3FUHA 1VF5C 1I1FA 4ONFL 4IRZH 5L8LB 4HFUL 1S3KL 1CBJA 3QIUB 4XVSL 3X1BA 4TNFA 4G6FB 1UD5A 2YO3A 2CUAA 2YD7A 4ONGH 3CG8A 4NRXA 2J1WA 2FATL 3G5VB 4KDVA 3QJZA 4D7PA 4NUJB 3EYVA 1YN6A 3WY4A 3IDMA 2WB7A 2DMBA 4JFQB 1FF5A 1RLBA 4PG2A 3GKWH 3QNYA 4YDJB 3QQDB 1PZBA 1N7ML 3CCHB 4ZUWA 4CVWA 1SBBA 2VR3A 1LILA 4PTTB 4PCKA 5BVJB 3I6GA 1ZTXE 2EO1A 3APFA 4NKIH 1RZIA 2TAAA 3DGDA 3LHPH 4HIQA 4OGXL 2YPVL 1YLBB 3HG4A 4HHWA 1N3NB 3V5KA 4AWJC 1MY7A 3PAVA 4HAKA 4RMTA 1YMME 2PP8A 4LSSL 3LB6C 4KQ0A 3GEWB 3LKQB 3KZ8A 1L0PA 2YBGA 4XHQA 3VE0A 1HILA 2P8MA 5JPNA 1FYTB 1Q0EA 4KU1A 3S35H 1AOHA 1S9WB 3BZ4A 2OX5B 3RY5A 4XNZC 2GPZA 5MENA 4OD1L 4XMKL 1DFBL 3MLTB 4YBQC 4WRLA 2NY0D 2R1XA 5JQ6H 3ZTJG 2HFTA 1F45A 5EULV 5ETUB 3RRQA 4GRMB 2Q7YB 4KPHL 5IJVA 3VDAA 1NQBA 2ZWLT 4FQJH 4PJ5D 3L4ZA 3FPXA 4RMBA 3SYCA 3T0EB 3MJ9L 1NBVL 4HGMA 3FTYA 1YVLA 2EVIA 4NYLA 4PJFA 2BK8A 2DTMH 1JPGB 1COBA 1AJ7L 3BFQG 4H44C 4FI8A 1AGFB 1HJBC 5DVKA 2OMZB 5DD1L 1VCBC 3KWVA 4AT6A 3QEHA 5JHLA 3JWDL 2O6PA 1NFIB 4LAQH 3FRPB 3N1GC 3L95B 2VLJB 3NZSA 4TOYH 2J73A 3MBEC 5K9JL 2RALA 4PLJD 2P48B 3B9EA 3UADA 5KAQF 5I1GH 5T1MA 2F8VA 4JO8A 2HKAA 3JWOH 4OFPA 3VWJC 5IVXE 4CDHA 4RZCB 5E56A 5HYSA 2WTPA 1YEKL 2E4TA 4AH2B 4LE8A 4ZUSA 5CEZL 3L3HB 2PTUA 5IWLA 5INDB 4DW2L 4GRLB 1JGUH 2XG5A 5CBAA 1I7TB 5DJDA 2WVVA 5HGDB 1NGQL 4IDJL 3HLKA 4HOXA 4WW1A 4QD2E 5D7LE 1NWOA 4O2FA 3M1BB 5A7EA 3DBSA 1AH1A 1NMAH 4IKNA 1XR9A 3G04A 4GXFA 3QZNA 1T5XA 3L5XH 2D7OA 5KS9B 5CD5C 1K5NB 1G7LB 4TSAH 5KN5A 4KXDA 1R9FA 3EOAA 1ZK9A 5J3HD 4D0CB 1Z2KA 4JPWL 3RPIB 1IKFL 4RDQF 3VFPB 1A47A 5CXPA 3V9CA 4KJWC 5E4EC 3B1TA 1FL6B 4PJCB 4FFWD 1A6UH 2FIKB 2XWBA 1KCUH 4E36A 2YUWA 3ELQA 5EA0L 2AEQL 5M7QA 4WHCA 5J56B 1RPUA 5E4OA 2YQ2A 4NCC1 3FO1B 1JGEB 4G3YL 2DMGA 1J18A 2YEZB 3L1FA 3APDA 5KWYC 4IU2B 2IOMA 2V4LA 1MLCA 4B5ZA 3MCLH 1C5CH 5TFSH 4PS8A 3ARGA 4FQQA 4OIAA 3C5ZA 3V7AE 4MNHA 1MCWM 1O7SA 2HP4A 4G7YL 2VDOH 1KENL 2H0JA 1A7PH 2UV3A 1WZ1H 3PGFH 1MI5D 3ZRSA 3DUHA 2XU9A 4L4JA 1OSPH 4JKMA 2NSMA 2XETA 3LRGA 5I1HL 1IEHA 3D25B 4IU3A 4AC2A 1M7IA 4FABL 1EAJA 5GRXG 4NKDA 3TNMB 1ZCRA 3IXAA 2EE6A 3IFPA 1M6OB 4MXQC 1GZHC 4DP9X 3N1QC 4PJ5E 5CJ5A 2JXMB 4GRWF 3D6GA 1VFUA 3I02B 3DMMA 3O3EB 3N44F 3Q01A 4OF0A 3QNZA 1MFMA 2LU5A 4DP5X 4UT7H 3HG1D 3QQ4B 1DVZA 2WKOA 3KBFA 2KQNA 4MJ5A 4U1IA 4C56B 4IRSD 4NUMA 1TU2B 3AXLB 5KBKA 3O9WB 4GKOA 5GS0C 1XCTB 5HI5C 3WO4C 5MP6L 4XVTH 2LGNA 5CCKH 4WWKA 2O93L 3KPQB 3G6JB 2X1OA 3Q05A 4GPVA 1JPST 3GDCA 5CF3A 4TM9A 1HZKA 1P6FA 4RDBA 2YLHA 1TJGH 5E5LA 1VACA 2NW3A 5C86A 4LZKA 3E6HA 4KI5D 1KXQE 4XMTA 3VM7A 3ARYA 2BY3A 4HDIB 3TCLA 4XMZA 5A2FA 2ZNXA 5JQHC 3F04A 2QPUA 2ZXGA 1VFAB 2AABH 1AGBB 3OB0H 3RL1A 3HI1A 3UZQA 3WN5C 2AQNA 2DQCH 1KJ2B 1BV8A 1UT1A 4LPCA 3UH8A 3FQ2A 3SKJH 1X5FA 3NTCL 4JGUA 2KBGA 5LBSA 4F8PA 3ARBC 1MCLA 2OLDA 3AREB 4Q89A 4H4NA 1BPVA 2N0KA 3N43B 3U0PA 4O4YL 3TVMD 3RVTD 3VFNA 1NBYA 5FDWB 4AUYA 5I76B 3QUXB 4H8WH 3QUMB 2NW2A 2VJ0A 4JRXD 1QNZL 2WXRA 4EI5A 2A1WH 4X0KA 3KPSD 2MQ0A 2NTFA 2FEEL 3D4CA 4XVJL 5GGVL 5ANHA 4LQFH 3ILEA 5ESQB 2C9SA 4JKLA 4MXVE 3SBRA 4X4XA 4I5BA 3IDXH 2F15A 5E6ID 4I1NB 3S4SB 3FRUB 1Q8MA 4QMEA 1RY7B 1T2QL 3HR6A 1Y07A 4YN3A 3O4LA 2X2JA 5A6MA 4P48A 5L7XH 2PYEB 3B2UD 5L0QB 5KVDE 4LEXL 3IWVA 4ES8A 3EH1A 1FORL 1U91A 1JV2B 3BH9B 5TGBB 1NC4D 3MN8A 3QIWB 1MI5E 2W0LA 1NZRA 3MV7D 4M5ZL 1SQ2N 5C0CB 5A2CA 3CVHB 3TT3H 3GJEA 4MWFA 5D1QB 1PLCA 4BRVA 1Y18A 5IFJB 1UCBH 2OKMA 4GFTB 2F53A 3AB0B 4JN2B 1JPFB 3A22A 4GSXA 2CJTA 4UT6A 3M6DA 5A7BA 3WFCH 2NLJB 3X14A 1YMHA 4XCCH 4BDVB 2AQSA 3X2QB 4B9KC 5SWQA 35C8H 1SXSA 1M7UA 2AJYH 1DJWA 3A21A 1MHHA 1LDSA 4AVJA 1PU0A 1E7VA 3HG1E 2ADIA 2FCBA 3KWWB 4G6KH 5INCA 4Y9BA 5ADOH 2VABB 2VMFA 4WEMB 5DLMH 1JZ8A 3I3EA 4D8OA 3SKOB 1NGPL 2YRBA 2BSRA 4QF1A 1JZ6A 2NCMA 4ELKB 4MLIA 3HB3C 5JOPD 4QI3A 5I8EB 3FU7A 2VLKA 5C09D 1GYCA 3V0AC 2FWLB 4L8BB 1FFOA 2FH8A 4Q9CA 3OB0K 4G9FD 3N3EA 4HLZH 3FO0H 3C6LD 3GJFA 3MNWB 3TESA 5C70A 4DOHE 1R3IL 5C6TL 4AQZA 5T1DL 2OSWA 4BZ2H 2HH0L 2V3DA 3B4NA 2MTPA 4IDLA 1M1XB 1OOWA 2GTWB 2XACC 3FB5B 5FM5M 2AV1B 4MQSB 1NA8A 5ESAA 4GBXD 3KM1A 1WLHA 1CYWA 1V8HA 2QSTA 3S88H 4G8GD 1UCTA 3ZTNH 5FLVA 5DC9B 2XN1A 4X7CC 2DL9A 5DJ0A 4XN9A 5LG6A 3TBVB 2RFXB 1S7SA 1TT6A 1CC3A 3TJPA 2EDHA 2EZ0C 3IPEA 3KXFB 4O02L 2NXYD 3CFDB 3A67H 1D6EA 4HJGA 4ZFOL 4ZMXA 2VLLA 4HWUA 4LNRA 3ARUA 2X38A 4YH6A 1FVDB 5CN1A 1AIZA 1SEBA 3IRPX 4UCFA 1QBMH 3CMGA 3RWEA 1MIEL 1ZT7B 4NBYB 3WEOA 4Q9RH 2ZKXA 4IKJA 2NY5C 1PG7X 3E38A 4I8DA 4JRXE 1HK6A 5FK9A 3X17A 1QSED 1DBJL 3P9MB 4L9DA 2O5ZL 1FO0A 3V6ZB 1KB5B 1DVUA 1AKPA 5DQ9B 3BQUA 3RAJH 3DWTA 4HAFA 1BFTA 5CWSB 3KDMB 3VCLB 4PJXB 3WTSA 4HSAC 4NENA 5D1XA 4N2EA 4XH2A 1DVFA 3VGHA 1BVKA 3OKEB 5DDHA 3SKNA 1OT2A 4FNLL 4MBRA 1C16B 5A16A 2ETWA 3GSOA 4ONOA 1YUHB 5D1ZD 3TH4T 4F15B 5DVLA 5KYUB 3GSWB 2EIMB 4CN6A 3LZFL 1AZNA 3MV7E 5J13C 4ZUTB 1LEIB 3RILA 3RUGB 1S9KC 2IQAA 5D4QA 1WG3A 3MA9H 4R4FH 2FVNA 2EDFA 4JDZA 2ORBH 3VI3E 5FECB 3O6LH 4H8HA 4LAJH 5AD0A 1FZKB 4X6CE 5EO9B 4BA0A 3G9AB 1HYSD 4WY7L 3UDWA 3KPLA 4ENED 4WNQA 3AQXA 5DJ8B 1E50A 2KS0A 1XF4B 1PZ5B 3GMRB 1A6VL 3QR0A 32C2A 2CO3A 3L9RA 4U3XA 4QXWA 1M53A 2V9TA 3ZRCC 1ADQL 5IHHA 4P23D 3VXRD 1GTFA 2OYPA 2Q6WB 2J8UF 5E9DB 1SPDA 1P2CB 4KNUA 4N2IA 2IPUG 4R96B 3FO2A 2PPDA 4FLRA 4X8JA 3QO1B 5JOPE 5FUCE 4LFHD 4MMXC 4G11A 5T3ZH 4NQUA 4C55A 2R23A 1RP9A 4G9FE 2JK5A 2CD0A 2LVEA 4Y19B 3SDYH 4ISVA 3H6JA 1ZT1A 4GW4B 1ED3A 3FW6A 5KUKA 1I8IB 3DX6A 1UTDA 2J72A 3FQUA 1ND0B 3N55A 3O11B 3R1GH 3A6BL 3M17A 3MJ9A 1HIML 3DV4B 4DPCX 2YXWA 3S5YA 2C4FU 2ED8A 2BNQD 1U8MA 3NIDF 1E9QA 1E9PA 2JJTA 3NJXA 4CVXB 4HU2A 1S7UA 2W9DL 1ULVA 5E00B 1OAXH 1N0XH 1WFMA 3DHMA 4YDLC 3I9AA 1QWHA 3DIDA 3H7BA 1E4KC 4KKBD 2FT6A 1YN7A 3QK0A 1YJDH 1THAA 4JRFA 1F4YH 2ADFL 3OTTA 4PRHE 4JE0A 3PDOB 3DSNA 2VDPH 4QTHB 4KRNA 1UOWA 2NTSP 4HPYL 1F8TH 2VZ3A 4WIQA 4XOCA 3V9EA 1IILE 1UM4L 1A6TA 1Z3GL 2IV9A 3OG4B 1ZTXH 4PJBE 4RAUB 1MZYA 3O3DB 1JRHI 5KJ7E 2W81C 3MFFA 4U6XB 2BIMA 3V6BR 4M7JL 2B1HL 3X1GA 4UAOB 4DKEL 4DTGL 2XZQL 3W38A 2RGSA 2PXYD 3IAGC 4F2MB 4XNQA 3STLB 4YZFF 5BRQA 5EBWB 4GG8A 4BHUI 1QSEE 1ZXQA 3QJFB 4BFBD 4OR1A 1EMTL 2C7UA 5SX5H 3CE1A 1UH2A 1SM3H 2F5BL 3QDMD 4E9SA 4X6DB 2D3VA 5FUZL 3V4UH 2L7EA 3L3DA 1VGEL 3MRBA 4MDIA 1GMEA 3U4AA 5D9SA 4EN2A 3PNWA 2CIIA 3TWCH 1DUYA 3VXTB 1WWAX 1I7ZA 2F58H 4YDKH 1F5WA 5JXED 4JHZA 1WIOA 5J6HB 5JA8B 2VXSL 4N8CH 1MVUA 2WXIA 5J1AA 4FYSA 4LB8A 1BD2A 1JOIA 1NBCA 1E27A 1P7KA 2VDML 5EEUA 4AEFA 2XN9B 5I8OH 4JM2B 5D7SL 1OO2A 3EUUA 1CF8L 1KBWA 4N0CC 2O5XL 5CSZB 5BQDA 5E8NB 3D4GA 5EOCH 2IH3A 4NQEE 1H19A 1DVQA 4DPAX 3SBPA 3T2OA 1E6JL 4LCWD 4A7SA 2DI8A 1N5YL 4HCRH 1F3DH 1HI6B 2WXKA 12E8L 5FKPA 5EU6B 2VN5A 3T1FB 1ET8A 2I24N 1Q4NX 5GRVK 3VXRE 1S7VB 4EOWL 1Q0YH 1DEDA 1SJHA 1F90H 4OQTH 5LBGA 2A83B 3MRHA 5F7AA 4LEBA 5D1ZI 1E2WA 2KZ1B 1F4XH 2PO6D 3AG1B 4LDLB 5TF1H 3GD1C 3U36B 6PCYA 3IRCA 4ZMOA 3CV5A 3HPJB 4QYOA 3Q8BA 4XAKD 1FC2D 3MAWA 3OC5A 1CYXA 3WIIL 4J7RA 4LPVA 4L29B 4M6OH 5FYKE 2WKLA 2NQCA 5BV7B 2CBTA 1P4LA 2ZKHL 4ILDA 4QY8A 2DQMA 3T8MA 4HKXB 5DJCA 5IQMA 2WNGA 4YLQT 2CQVA 4IHOB 2E9WA 3EYFB 1ETJA 2BNQE 1NDTA 4PJ6A 4QLWA 5I8KH 4U1MA 4QR7A 3FTZA 3R0MA 1E5BA 2Y7SA 4G2AA 4IBVA 2YPKB 1F6LL 3GRBA 3QEGH 1HHHB 3K6SB 1J9RA 4X42A 5DVNA 3KLHD 5MI0B 3AADB 2Y6TE 3BVTA 4M1DL 3RTQC 1MSPA 3GMNA 3TIEA 2PF6A 5D96B 5JDSB 5FFLA 1OF2B 4LLQB 3DGGB 3V79C 1JF1B 1WFNA 1TENA 5C3LD 4WCYL 1OEZW 3U1SL 2IOOA 4GUPA 3HNTL 43CAB 1CTOA 4GP5B 4KWUA 3U25A 3SDDC 1DSWA 1N0LA 4LNVA 2N7SA 4FLSA 4L2YA 4CU8A 2BSEA 3A3YB 3QDME 2TSBA 1Y0LB 4C4BA 2K9FB 2BXYA 4U1LA 5CSBA 4JNXA 4EN3B 3NJLA 1ZVYA 2FWUA 1TTGA 5D7JD 3GMQA 3CLFH 4OZHA 1U8OA 1G9NH 2VDRH 3MRDB 4ODVL 1VIWA 2NYZA 3D2UB 5B4MC 5IFAL 2FL5A 2A6JB 4OV5B 1ES0A 4N86A 2H26A 4U1NB 3RFZC 5TF0A 3Q06A 2JCCE 1AR2A 2NY7L 1IC0A 2Z91A 2WJ7A 4KRPB 3ZE1F 1YY9D 3UO1L 1YECL 1T04B 3F7VA 4Z7OB 3VU1A 4AV5A 2VXUH 2FNBA 3BW9A 3TS8A 1MJ8H 2IJ0C 4KKRA 5C6WH 3IWUA 3CVIL 4HV8B 3LHAA 3T4AB 5C8JB 4MD4B 1AS6A 1TOXA 3QDGE 1QA9B 1RUPH 4J3VA 3ZE2E 1HHGB 1N4XL 4FC3E 4PP1C 2AXHA 4P5MA 5KTEH 1ZDQA 4RAHA 3FQWA 3TBWA 2ZUSA 1CE6A 4E9VA 2NY3B 4ORGA 4BSWA 3OQ3B 2BP3A 5T33H 5FAAA 4BKTC 1PZSA 5IM7A 3UAEA 2ATPA 2OJZH 3Q6GL 3SO3C 2BWIA 3KMDA 4LU5H 4CU7A 3VXMB 1GOHA 5CEXB 2FWOB 1QAWA 1HXYA 4X83A 2W60A 3OB8A 4H8QA 1WFIA 3LH2H 3VYNA 5C0DB 3QCVH 4OCRH 5EMYA 1IFHH 2R83A 2ZXCA 3WEAA 5C71A 2BJMH 1J48A 3BC9A 3D48R 1ZSHA 3BGAA 5K33A 1PG7W 3D8MA 4AXWA 1JK8A 4EZJA 4H40A 3SE9L 5I1DB 5C9JA 1G9HA 5DZ9A 4KTDL 2JB6B 4YK4C 3S34H 4WWID 4Y2DA 3G5XA 3RVUD 3GXMA 4N8PA 3FSVA 2EXYD 2YPLD 2D9QB 1UC6A 4J8QA 5FA3A 2Q1EA 5I19H 2HJKB 1JN6B 1RK1B 3F2LA 2ENQA 4U31A 4QT5B 1KPVB 3VUAA 1HAUA 4R4BA 2NY1D 1AQKL 1EFXB 5FCUH 2R9HD 4CKQA 3P11L 4YR6A 4OGZA 1G5AA 3C5ZD 5IJKA 4XCFL 5C07A 4A04A 3PDGA 4ZPVA 1KZYA 3NA9H 3VWKA 5F9WC 2VW7A 1BZ9B 4WTZA 1HESA 2BXZA 5ESVB 4N2KA 2R56L 4LCUB 2Y7OA 1XH3B 2FDBP 3DC0A 5E2WH 4ENZA 5TE7L 4OUOA 5KVDH 2GHZA 3L3GA 4BWWA 4U1JA 1SVBA 4N6QA 5BS0B 2X7LA 1R5WA 1YEEL 3NAAL 3BD3A 3RE0A 2VQUA 4DQAA 4PV1C 3T6ZA 2X3BA 5IMKA 4UIMB 4ZFOA 2ATKB 3GQFA 1TJIH 1ZHKB 4FN0A 1WAAA 4YHYB 3QORB 3MQIA 4XHJC 4XN5A 1MHCA 1S9XA 3L1OH 3K0WA 4OH2A 3T4YB 3V0VB 2PPAA 4PJEF 3Q0HA 1LDPH 2F0CA 2VJ8A 4FA6A 1HH6A 1YC8A 3MV11 4UIKH 1F4WH 2E7MA 3TJEH 1F6AA 2F54B 1KCVH 4ZW8A 2BMKB 4YDIH 4QCIA 3WFZA 1J88A 3LRSB 2VIRB 4Y16B 3MMEB 3CFKA 3VAEA 1CFTA 1SFDA 3Q5YA 1L9RA 3HTLX 2KL6A 3PHOB 2J25A 4L4TD 3DRQB 3PP3H 5F9DC 3ZT5A 4M8QB 2ICWJ 1N64L 2WCPA 3VG9B 5A3ID 4D0BB 1CICC 3ME0A 3LKRB 2CKBL 5KSAC 2E7LA 3QHFL 4BK8A 1OT1A 1KB9K 2XV6B 4QRSB 5HYFA 5DYOB 3GHEL 4WO4B 1MW3A 5LUMA 4X4MA 1JYVA 1XGYH 4PP2B 3UTTD 4ZW5A 3MOBL 1WZMA 1NCAL 2OMNA 5AVRB 5G5DB 3W11D 1F58H 2OMYA 3QUML 3FQ4A 4QRAA 1DN0B 3NEXA 3SDXE 1N68A 2GCYB 3BAWA 2V5YA 4XNXL 2W9EL 4D7BA 2WOBA 5D71L 4ORZC 5IW1B 5KYXA 4TSBL 5IOPB 2PTTA 4G42A 2WXNA 2GEQA 5BZWB 3D05A 4JZJA 1NJ9A 4GAJL 1WISA 3WHXB 1ADQA 1WFUA 3V0WH 5A2LH 2CXGA 3MUZ1 4G72B 1QR4A 5ACZA 1JDDA 2EVFA 2V37A 4QUOA 3F58L 3HUJF 4TUKL 1PIGA 3IF1B 5EZJA 2W92A 4BKSC 3BVUA 1UB5A 4XX1E 3QQ9C 2MCAA 5FUOH 3SY0A 4EI5D 2PWEA 2HG5A 2V5TA 2COQA 3PDDA 4V11A 1AR1C 2YPLE 1Z5LB 3VG0H 2OMTB 3DX7B 1WITA 1DE4A 2H9GB 4L0ZA 4GG6E 43C9B 2V9UA 4JBSA 2YHGA 4W6YB 4CVUA 1QATA 1QBAA 4OLYL 5MEOB 3L9YA 5FXCH 3G6DH 2Z7WA 1J5OH 2WIIB 3Q2WA 4EXKA 4YPJA 4JHAL 4PV8A 4MDJB 3QCUH 4FZ8H 3D69A 1DQJB 1K3ZA 5I1IL 1YNKL 4UV7L 2WLIB 3NSDA 5MENB 1U8KB 2AC0A 3B56A 3RB5A 4UQBA 4JDEA 3D3VB 3FU3A 5IB5A 3N50A 2YGPA 4ZFGH 4EAEA 2F53D 3ZDXF 5EOQL 1E40A 2HT3C 4P46A 4XCNA 2DYPB 3JYCA 1B3JA 3BVDB 2P1YA 2HZHA 1DQQB 4DHLA 1I8UA 3AY2A 4B50A 2OK0L 3TONA 1IGYA 3FFDB 3LQZB 4QXUH 4OT1H 3PP3K 4HBCL 5TK2A 4QHLB 1RZFH 2OMXA 3NFNA 5HI3D 2HWZL 2UXFA 4G43A 4N0FB 5M95B 3CC5B 5EWIL 3VXOA 4E9TA 3NJKA 4ODWB 5EO0A 4NN6B 3C60D 4ZSOB 5TDPA 4U7SA 4DZBA 5I5MA 2LFEA 4BFKA 3O3BA 1XVSA 1ZPUA 1RU9L 3FFOA 4L4TE 1UWEL 1NPNA 1BZOA 1W8NA 4K3EL 5GZOA 4RSVA 4QWWD 3ESPA 4HKBA 1A3RH 3C09C 4P57B 4W9JC 5DFVD 1JRHH 4M61A 3UOAB 4BH8A 2PN5A 1JZ5A 3WLWC 4Z7VA 1IJ9A 3MXVH 4FG6C 4I77H 4N0YH 1PLGH 4E0RB 1USZA 3UTTE 5IROD 3ARQA 3DURA 5AG9A 5C0GA 5HGBA 3JV6B 2BDNL 4NDMB 5GJTH 4ICWA 1A65A 4OCWH 3F83A 4W68A 3VYOA 1XGQA 3WE6A 1L7IL 4MNGB 2HFFB 5LN4A 1WBYB 4O51B 1KB5L 1OP9A 4Y89A 2B16A 3VQLA 3DTUB 3AJ7A 1LNUA 1XT5A 2ED6A 4DQOH 5LGJB 3R18A 4ZO7A 5TJWK 3FOLB 4ODHL 5CHNA 4CN4A 5CP7A 4CVZA 1QHOA 2YFNA 1EZSA 4YAQB 4EBQL 3QIUA 3RVWD 1FC1A 1MDAA 3WTXA 1X9QA 3BWAB 3SB3A 1QABA 3LQAH 3OHMB 3G5VA 3L2NA 3MV9E 4HETA 3BP4B 3BFOA 1IBGL 4M7ZC 4NUJA 1NIEA 2HFGH 1QSVA 1ZK5A 4JG5A 1NUGA 1QSFD 2APFA 3DHJA 4ZS7L 4BUHA 4E9QA 5BNXD 1A9EB 4JFQA 3KPPA 4G7VL 5DD6B 4YDJA 3QQDA 3CCHA 3Q3GB 3FL7A 4PTTA 5I1JL 5BVJA 1Q9OB 3K91A 4TVUA 4C4KT 4LP8A 5AB1A 4JDTH 4XT1C 3WS3B 4M9PA 2QVIA 4OZGE 4GQ9L 4JG1L 4BUQA 5DEZA 4PJIF 1BG9A 1UATA 1U58B 1AO7B 1N3NA 1KGJA 2CUMA 3K2IA 1MCBA 2LAGB 3L81A 2FEJA 2IV8A 2HXAA 1QASA 2Y1AA 2WP3T 4J6RH 4UBDC 4IRJC 3LKQA 4OF6A 1WO2A 1CLZL 3M1CA 2HG0A 1E8YA 1TPXC 4MQXD 5CLZA 5K9OB 4YHOL 3ZKSD 1FYTA 5E1IA 3WNIA 4WF7A 4DUXA 4KI5F 4KV5F 1S9WA 2OX5A 3L3JB 1ZLSL 2Z1KA 3W0WD 1QFWL 3QUGA 3MLTA 4F37F 5DD5L 2F53E 4KKCD 5I6XC 3N42B 1Y6NR 2QADC 5ETUA 1CGYA 4GRMA 3RL2B 2O5YL 5LDUA 4Q4IA 4PJ9B 4ATWA 4X7EC 1BEYH 4NX0A 1ZY9A 3CHQA 1I8AA 2OTPA 1N10A 1FFQA 1VZIA 4OM0L 4XNZB 5KVGL 1IKNA 3VSTA 3M8OL 2R0LH 1KIPB 4YUEL 5A2KH 3QH3B 3V2AR 2A4ZA 5FO8B 4FG0A 1JPGA 3RKDD 2P7TB 1AGFA 1BFSA 2B0SL 3VDBA 2OMZA 1HXMB 3VXNB 3NIGB 4L5FL 3I2CL 1MVFA 2EICA 3ISWA 3EYQC 3RVXC 1NFIA 1WHPA 1TETL 2WJ5A 3V4VB 1DBAL 4NUGH 3L95A 2BHFA 2VLJA 1RUQL 3AQYA 3PXLA 1TQWA 3WY1A 4N68A 5E0FA 2CAKA 4Q97A 2DQUL 2Y6SC 1VEPA 3GXUB 1A1NB 3S8FB 2GBAA 1WEJL 1L6ZA 1XF3B 3VXSB 4U6TA 2IPKB 4RZCA 3SCMC 3EH5B 3IJHB 3UROR 3V6OA 4F9PA 4AH2A 5FYKH 1I1YB 3MBEB 4M8RA 3KWTA 5F8RC 5INDA 3R4RA 4I3RL 4GRLA 1J5IA 2ZAIA 2Q3ZA 1DBKL 3ISRA 4FS0A 4PBXA 5HGDA 1GGCH 2J4WH 3PS6A 3AM8C 4LSVL 4JHWH 5CP3A 2TRYA 1GY1A 4L4VA 2X0UA 3H56A 2EC9U 3IMWA 1NDGB 3M1BA 2ZAGA 3BGFC 4OJFH 2AEPL 1PZ3A 1KGUA 2DQDH 2ZX5A 5ABDE 3C6EA 3A5VA 5KS9A 1CDBA 1K5NA 1G7LA 1NCHA 3FAWA 3GM8A 2VDNL 5AZ2H 2WTRB 1NCTA 5IVZB 2MQ3A 2WQWA 4HUVB 4D0CA 5CEZD 5D7IA 1OGPA 3RPIA 3VFPA 3EYSH 4NQVB 1WQVT 2BRRH 3L2LA 1BM7A 1IBZA 2YN5A 1QSFE 1FL6A 1LEGB 3KPRB 4PJCA 2FIKA 4HG4K 2CO6B 5B7EA 4LF3B 4OZFA 4QHKI 1O6SB 5J1TC 4H0HB 3B2XA 3JXAA 4CC4C 2B4CL 5KYNA 3FO1A 1AQMA 1JGEA 1N70A 1WBXB 3CXHJ 4Q4EA 3T09A 4AL8C 5AYUL 4IU2A 3W5NA 4MJ4A 4XAWH 4P49A 4Q14A 4PWIA 3UAAA 2F1EA 2BZ7A 1QQDB 3AY4C 3BDYL 1A7RH 4M8UA 3BKMH 4KHTL 3FB8B 4YIQA 2GC7C 1CMOA 2YOCA 3PXHA 3NABH 5AW9B 2JTYA 3OMZA 3RU8L 3HR5B 4F33A 1XB3A 3VI4B 2ARWA 2YEQA 2FJHB 4OD3L 1GC1L 4HZAA 5IVOA 3HAEB 4R7XA 4AMKH 3O2WH 1VHPA 4OCSH 4GKSB 3QPKA 3BESR 3W0WE 4DN3H 4GSRA 4YSEA 3D25A 2QPFA 1RZQA 3ZSTA 5LBVA 2IH8A 3TNMA 3ML9A 2E6QA 3L3KA 5DA0B 1M6OA 2XKSA 3F6LA 2FEDD 2OJEB 3HHSB 2JXMA 3T08A 4JFHD 4KUZH 5LVEA 3BVWA 1QTYT 5HHMD 5AW5B 2ICEC 3OM3B 5D2LB 3QQ4A 1XB8A 5GIRB 4W4NA 2NXZC 4C56A 1K8DB 1V05A 3QXAA 1A7OL 4OM1L 1TU2A 2ZCHH 3AXLA 3O9WA 4X9IA 5DT1L 2HT4C 1XCTA 4R97C 4BCZA 2AJUL 4U1SB 4PJAF 5J9PB 3KPQA 5ACLA 3AUVA 4XBPB 3J2PA 4UM8B 4P06A 4Z3IA 1CQKA 3DVFA 3LZQA 3ZMNA 4LHQB 4OIIL 1C5DB 1J8RA 5I82A 3HNSH 4UNTA 2RB8A 4YHNB 3OGOE 4M6ML 4DGVH 1EHNA 3D39B 4IBZA 5D55A 2BERA 4OCYL 3WO4B 3U48A 5C0EA 1BJ8A 2OL3B 3SGEH 1ECYA 2WUCL 2XBTA 4JANB 2AJVH 4HDIA 4PVNA 3T04D 2W38A 3E6FB 3F05A 4HQQL 3IPBA 3TBBA 3ZDYB 3MLRH 3OMNB 1J12A 1MWOA 1AGBA 1S5HB 1XD0A 3S8WA 1KNOB 3KG5A 4PTUB 5IHUH 2VM4A 4HUMB 4DZ8B 2RACA 4NC0B 1KJ2A 1AY1L 4I13B 4XO8A 4Y4KC 1M3IA 2CKNA 3G5ZB 1V54B 3DK0A 5TQ0L 3BT2H 1KTLB 4X98A 4B9FA 2CIKB 2VC2H 3CVCA 1PZAA 3EJTA 3PJLA 4HFWB 4LSRL 1OAYH 3WN5B 5DA4A 3CSBA 2BRQA 1WH0A 4KK8D 4PAZA 1CZ8H 1O7VA 2V17L 3AREA 5CEZE 3BRFA 2EDMA 1WD8A 5FDWA 1XFPA 4ZX3A 4NGHL 4RFOL 3NOIA 1TYJA 2XV0A 1X5IA 3CFJB 3QUXA 4MHHG 3QUMA 3RNQB 5I76A 1P7QB 4LOEA 3ARBB 4NO3B 1YEIL 3UAJA 4BE6A 3FUKA 3QRBA 4Q2ZB 1Z5HA 4BRJA 4JPIB 4J3OG 5ESQA 1S5IL 3KGTA 2NZIA 3S4SA 4O9HL 3FRUA 5DQDL 1OM3H 5FYKU 2HLFC 3QZOA 3F7RA 5B7MA 3ZKMC 2VH5L 3B37A 2Y07L 1MFUA 2PYEA 2EUZA 1H6FA 2R0WH 3B9KC 1IQDB 4UTCA 3UC0H 4RGND 4S2SB 4TULH 1DQDL 5TGBA 1JV2A 3BH9A 3QIWA 2DAVA 1E8WA 4LVEA 5C0CA 2WOYA 4PJDF 3QUHA 3A24A 2C9PA 4A2EA 2C4FT 5D1QA 4PWEA 5EHFA 5C6PB 2PKDA 4OVUA 3WYRA 5IFJA 3NEEA 1WCBB 2B39A 4JN2A 1JPFA 2OSXA 1G1CA 3VD9A 4FP8L 5J89A 1BLIA 1AZZC 4W6WB 5E2UL 1UHVA 1GGIL 2NLJA 2VSCA 4MAUL 4AEIH 1BZQK 4BDVA 3NJGA 4JFHE 2LU7A 1BAFH 1F42A 1HE8A 2LHAA 4M6NH 5HHME 3HJ0A 3CFEB 2ALWA 3KWWA 3IMVA 2P5WD 3ZQXA 2GAZA 2WGXA 4LCVA 2VABA 4AY0A 2ZXAA 3K4ZA 3SKOA 3LRMA 1CDJA 4I9XA 1J0JA 4ELKA 3H42L 4NM8H 2Y36H 5F6IC 5I8EA 1G7HB 5EUOF 4L8BA 4LEEA 2OR9H 1RFDL 2VR4A 3O0LA 3DMMC 3MNWA 3VD2A 4WSGA 3WFHB 3EOTL 3US1A 2D31B 3T8XB 4OLUH 4YHKH 1JTPA 3CFCL 3WIHL 3ZQ9A 4GP4B 4R0LC 4I89A 1K6QH 4JB9L 4IBYA 5HDWA 1GSKA 5I6OA 1F2QA 1M1XA 3FB5A 1ZTMA 5GRUH 3T71A 2FSDA 3LNDA 5IW3A 1KJVB 5DLLA 4WWKC 1CU4H 4MASA 2WHVA 1T22B 1TYRA 1X7SA 4XN4A 4BZ1L 5ITBL 1A02N 5AL8A 2BS71 1TIUA 2AXJA 4B0MB 4XB3A 2K6ZA 2AJ3B 1J1OL 3TBVA 2RFXA 2NDGA 1MWAB 3B2MA 5EC1B 3TM6A 3F12B 5J1SC 4PB9H 2DBJA 1FCCA 3CFDA 5MEPB 3BP5B 1XBRA 2KMWA 4QRBA 1TSRA 1D7DA 3JSSA 4GT7A 4UQDA 5F89B 5ALBH 1PG7H 4XNYL 2WD0A 2Z31C 1FVDA 1X3DA 4WI0B 5CU5A 1PFCA 2HTLC 1KWGA 1ZT7A 1HL8A 1SYSA 5FGSA 1A3LL 3HMWL 5B3SB 3FBQA 3ZE2F 4N0RA 3C8KB 1MFAH 1UWXK 3VQ1C 4Z0XB 2E56A 3V6ZA 2VXVH 1KB5A 2OP4L 5DQ9A 2BP0B 4QKXB 4K3GA 4R3SB 5DU7A 1U95A 5JW4M 4OU3A 4FA8A 1VERA 1JWMB 4PJXA 4X0NA 3WS6A 5CZXD 3FK3A 3OKEA 4P2CG 2CH8A 1C16A 1TJXA 2WKGA 1ZD6A 1T6WA 1LP9F 1YUHA 2Q8BH 4CDGC 2EO9A 2YFOA 4RGNE 5KYUA 3GSWA 1T80A 4JFFB 2CBQA 1FPTH 4XO5A 3WN6A 3S9DB 3H53A 4ZUTA 1LEIA 3RUGA 1JF5A 1M2VB 2WXFA 3ZMRA 1SOXA 4G5ZH 4PJHA 1NDMB 2X05A 3WU1A 1OP4A 2CR6A 2VMDA 4LRNL 1S78D 1BXUA 3KAAA 5FECA 1CGVA 1A9VA 1FZKA 5EO9A 1PKQB 4HX1B 1AGCB 5KW9L 1PGRB 5J13B 2CPUA 1ZVHA 1BDYA 2FJFB 5DJ8A 4Y5YC 2G60H 1PZ5A 3T5WA 3GMRA 3S2AA 3U1PA 4M03A 1INDH 1PX4A 4NT6A 2P5WE 2G9KA 1I82A 2GFBB 2D2CC 1HEJC 3KLDA 2Q6WA 1V3JA 3C2AH 4I0KA 3NP4A 1P2CA 2IO5A 5DURD 1EAOA 4GKLA 5E9DA 5FHAH 2QMJA 4R96A 5DSCB 5FKAB 3QO1A 3RDTC 1XGZA 4NJAL 2HMIC 5C2BL 3EDEA 4HU8A 1TO5A 5DHYB 1T1ZB 4Y19A 1DANT 1WWWX 4GW4A 1F11B 1UJ3B 2FEEI 1I8IA 1WPCA 3LPFA 1ND0A 2BIOA 3O11A 5AWNH 3DV4A 1AC6A 4WNSA 4NZUL 3KD4A 3JBG7 4OV6F 4ZPTB 1NKGA 4EJ1C 1U2CA 4C4KO 3K72A 1UD8A 4CVXA 2GQHA 3IDNA 5E00A 4M5YH 2DZEA 1ACCA 3P2TA 2K7QA 3PYCA 5IQLA 1ZHLB 3ABLB 1SDDB 5BJTB 4YQXH 5AOMA 2I9LB 2FB4L 3PDOA 4E5XG 3WUZA 4QTHA 1KN4L 3FT3B 3I85A 3QXVA 4XP4H 4PJFF 1KBGL 3G9VA 2MIZA 1SMOA 3EFDH 3LPGA 2X1QA 4RAUA 3MODH 1PDKB 3O3DA 3O6FC 4U6XA 1CFSB 4HXAL 1YPZE 2EDTA 4F2MA 3CN0A 4J3UA 3STLA 4DVRH 3EO9H 3LJ3A 4BM7A 5HHNB 2EEXA 1NSNH 1B0WA 3U6RB 3FU0A 1P4IH 4OLWL 4GLRI 4X6DA 1G9ML 2NY6D 2CK0H 3TXAA 1T3FB 1BIIA 4L1HA 3L1EA 3D9AH 3ZYJA 3CDZB 5DEJA 1S7WB 1QYGH 1AHWA 1NM4A 4P46D 5DVMA 4BINA 2Y3AA 1T03H 5LAXB 4U7KA 2JIXB 4HHGA 4KROB 5D5ME 1OSEA 4TPRH 3MXWL 5G55A 3V0JA 5J6HA 3O2VH 4U0QB 1A2YB 1NPUA 1I4FB 1NLDL 5ISZD 3CX5K 4L9LC 4JM2A 2FGWL 2QV4A 5AZUA 2VLRB 5CSZA 2E59A 2WYIA 2MOVA 1X6LA 1PKOA 1QRNE 3ARFC 1U8JB 4KJPC 4WFGD 2VWEE 5E8NA 5BZDB 5EDSA 5GZNC 5D1XC 4K8RL 1YEHL 3QI9C 4HIPA 2VQTA 4AYEC 2LAAA 2K78A 4X8XA 4RX4A 1HI6A 4L0YA 1M4KA 5EU6A 3ARXA 5TE6H 5HXMA 5CKGA 5M94B 3N41B 3GJFH 3LD8C 2E27L 1NUDA 4RFEB 1GGBL 1S7VA 4F58L 4F1ZA 2FRGP 1UACH 5F1OB 2A83A 3BEVB 4YSAA 3OJDB 4YFLI 4XNMB 3LSOB 2DEYX 4FQ1H 4ES9A 3FSAA 4XPTH 5HHPA 3TZVA 1HJCA 5I1KH 1P4UA 1OXYA 3SEPA 3U36A 3HPJA 2APXA 4N22A 5F9JB 4KTEH 1QUPA 5T1LB 1MHPL 3D0LB 3NIFB 4L29A 1ACYL 2CO7B 5HYQB 3DHUA 3KLAA 1GJIA 2WN3A 3LMJH 2NY4C 1HNFA 3WFEL 5K59E 4UNIA 1R0AL 4HKXA 4XXCC 4HULB 3WLBB 4DAGH 1U2HA 3EYFA 4TV3A 1TTFA 1U8PB 1K2DB 3QIUD 4M3JA 2IQ9L 1N6QH 4R90L 1V55B 1BFVH 1HH9B 1ROCA 4NZRH 2P5PA 1QEWA 1U9KA 4IMLB 3RIFF 1AC0A 3U9WA 5F3HB 3REWB 4DP4X 4F24A 4MXWL 5HDBF 2HRPL 3BAKA 4QO1B 4LLYB 4NFBA 4B41A 1O6TA 1AS7A 2DLHA 3OG6B 1FO0H 3KPMB 2WKOF 2C3WA 4ZTEA 1OAUH 2YA2A 5B1JC 5JDSA 1YC7A 3DGGA 1JF1A 2BY1A 3OPZH 4X7TB 5HHOD 2JJTC 5DQJA 4NHUB 2EIBA 4OFDA 2EUXA 1QKZH 3X1EA 5E5MB 1CD0A 4S1QL 3QWNA 3RTQB 4HZ1A 4ONFH 5C92A 43CAA 2AMGA 2MKWA 1I9JL 2LQRA 1S3KH 3QDJB 4HFUH 4XVSH 5C0BB 2ED7A 3HE7C 1IEBB 3QZPA 4RVBA 1ODUA 3CX2A 5K1NA 2FATH 1Q9WB 4WK2B 1Y0LA 3QJVB 3G5YB 4EN3A 5JXAH 5A43C 4W9HC 2FX9L 3WI9A 3MRDA 5FA4B 4QNPF 1L9NA 1XXDC 2A6JA 3OLDA 4OV5A 1A0QH 4U1NA 2WBJD 5ANME 1BBDH 1CF1A 2IANB 4OGXH 4OGAC 2YPVH 3BAJA 5ISZE 3QULB 1RULL 3L6FB 4FQXD 3FO9B 2GSGB 1KCWA 2ZXDA 1EO5A 4LP4A 2WXMA 1XIWC 2R4SL 3GJFK 1F97A 4LSSH 1JG9A 3HZKB 4ATTA 4CSPA 1FRGL 1NAMB 4D9LL 1OTUD 1NH6A 2BHUA 2BOCB 5GSVB 3T0VA 1PLAA 3WTVA 4HV8A 1RSYA 4LLAA 4MAZA 2PPEA 1G7JB 3O8XB 4MD4A 3T4AA 5F0MB 4HJ0C 2CGYA 3ILPB 3CSTA 3RFRA 4OD1H 1HHGA 3QG7L 4Z77B 2IOIA 1DFBH 2FHFA 3NCJL 5AB2A 3VFOB 4EKXA 2J2ZB 3BUQA 4KPHH 2WXLA 1YG9A 1IGIL 2J8OA 3ULUF 2C1PB 1KCLA 3MJ9H 4QGTA 5K69A 4AVIA 1H8OA 1PSKL 3CMOL 1KEML 1OP3H 4BCYA 3GC3A 1I8LA 1OK8A 2UWEA 4TNEA 4BFNA 5I23A 3PWVB 4N0UB 1AJ7H 4L4VD 5AVTB 1BP3B 1IE5A 3VXMA 4BV1A 3OAWA 2FWOA 3PUUA 5DD1H 5CEXA 2Y22A 4FOMA 1XAUA 3JWDH 4HBQA 4J8RB 4MA8L 3K6OA 2AHIA 3NJJA 2E47A 5C0DA 5JHDD 2P5EB 3FZUD 3SO3B 5K9JH 3IDYC 3JTSB 1AP2B 2A77L 3AGWA 4KK6D 2I60L 2G0LA 2JJWA 3GPSA 1SQMA 4FF9A 2OSLB 4MJID 3UTZB 4Z7NB 1IC7H 3HRZC 2P49B 1D9KB 1JHLL 4AJ0A 5I1DA 4Z0BH 2MNWA 1I1AC 5IB1B 1JUFB 1YEKH 2WV3A 1KYOK 2QSCL 1RJZB 5CEZH 4DW2H 1BAGA 1E9OA 1LVEA 3HMXL 3NCEB 3OXRB 3JWNE 3Q6FB 4WGWB 4KDWA 4HUNB 1NGQH 3DX1A 4YOKA 2ZYSA 5F7LB 4IDJH 2HJKA 3QCTH 1JN6A 1RK1A 1RUKL 3ZHFA 3MRFB 1B0RB 1D5IL 2XQYK 4QT5A 1KPVA 4UI2A 4V1DB 2Y0SA 1EFXA 4YK4B 3I3BA 3WIHA 2EJ1A 5CIPB 3QXUA 3AFLA 4YVNA 3SDAC 3DOSB 5HHOE 3CQPA 2COVD 1HCYA 1II4E 4M1CC 2YD0A 2PW2B 3GINA 5F6HJ 3WHE0 3MRCB 1BZ9A 5DUBB 3KWXA 2XX0A 5ESVA 1XH3A 5AW6B 4BZ1A 4HT1L 4JPWH 1DDHB 1IKFH 1UASA 4TF4A 4JDVB 1FFNB 3EBAA 4LSTL 1TQUA 2CLVB 1AVAA 4QRUB 4KX8A 4NZ8A 2BVYA 3AROA 5EA0H 5F9WB 2AEQH 3CIQA 3VB9A 4UIMA 3VSUA 4DKFH 1WRFA 1ZHKA 4G3YH 5GS0L 3QORA 2VAAB 3T4YA 3V0VA 1BOGB 1HOEA 2ARJB 1F18A 2VDQB 4KNSA 4QHMB 3QVAA 5DK0B 4WTWA 3FB7B 2YUXA 2F54A 4C58B 2BMKA 4G7YH 4NQDD 3TEXA 4P99A 5GJSL 4ERSL 3LRSA 2VIRA 3N5AA 3O9WD 3RX8A 4Y16A 3MMEA 2J8HA 4ZZKA 1X7QB 2A0LC 3QP3A 2P80A 5DHVH 1OP3K 3DRQA 4KC3B 4D9QE 5J57B 3NCYP 4TL5A 4D0BA 5H4ZA 4H88L 3LKRA 4M62H 1G9NC 2BOLA 2NY0C 4TQIA 1R3HB 3ZR5A 9CGTA 4QRSA 5DXWA 1OANA 4G7QB 5DYOA 4WO4A 1CGXA 2WAHA 5IF0B 4DK5A 4PP2A 3FU6A 5DZPA 3OC8A 5B8CC 3ZDZF 3QNXB 1BQ5A 3L4YA 1DQVA 1CICB 1CLOL 1JZ2A 4JPQA 5G5DA 3QISA 5I8CB 5KSAB 1BQHB 3POHA 5CGBA 1DN0A 3RGVD 4L4VE 2BSDA 2WXQA 2GCYA 1U8QA 3HFML 3MZTA 3PL6D 4N1CA 4PS4L 3FHAA 2DQHL 5IW1A 3MUHL 5PCYA 4XI5D 3NJMA 5JHDE 2WSPA 1UD3A 2FZ3A 3TJHD 1A4AA 2ICES 4PREB 5BZWA 4XP6L 3WHXA 1URZA 5D4IA 2SEBB 1CGUA 2V2XB 4MJIE 4EUPH 1OTSD 1E43A 2EC8A 4LARL 3OLGA 3PF2A 4QXVA 3I74A 5D7IE 1NCWL 3TO4D 1Z32X 3LIZL 5CEYB 4IOFD 3IF1A 2GSMB 1H9VA 4KGLA 1NFDB 4WWOA 3SQBB 4FYQA 3KYAA 3FB6B 2PCPB 2OMTA 3WO3B 4NPKA 4AQ8A 2H9GA 5C97A 2Q9OA 43C9A 1GGYA 2NYKA 4Z8FH 4YXHH 3VH8G 1JNLH 4IKKA 1HHKB 2VQ1B 2X28A 4YHPB 5F1IB 5MEOA 5IQ9B 4FMKA 5ABAA 3IKKA 3BPNB 5L88H 1AR1B 4G80B 3HI5L 1KG0B 5HPMB 2WIIA 1BG1A 3BE1H 5I9QB 3O41B 1CDGA 3MJ7B 4Y2DC 5LAPA 3IDJB 4MDJA 1NC2D 3D51A 4ABVA 2WLIA 1LYQA 1IO4C 1QUNB 5C0CD 1PQZA 4O4YH 3PWUB 4QTIL 3KYKL 3T6WA 2GJ6D 5D7EA 1PEWA 5IESL 2N59A 1QNZH 1R17A 5GQBA 2EDYA 4U6VL 4TL4A 4XVJH 4HS6B 1IMHC 3EGSB 3U0WL 2FQFA 5GGVH 4J2QA 4GUOA 2DYPA 2EC9T 1J5HA 1BQRA 5LNEA 1DQQA 4JN1L 2PR4L 3VWKC 2IIJA 4PB0L 4JO2L 3FFDA 3LQZA 4KHXL 1KLUA 4KMLB 1A22B 4AJVA 1T2QH 4XO3A 2FHBA 4QHLA 3NH7L 4N0FA 7FABL 4NQDE 3CC5A 3CVDA 3OX8B 5G4NA 1OZUA 3IJSB 4ODWA 1A7QH 3ZO0A 4B3EA 4LEXH 1B4RA 3MNVB 1CB4A 1NTDA 4G9DA 4QXTB 4ZSOA 4B9GA 1RQ5A 1MW1A 3EJZC 4ALAC 4M5ZH 1LO0L 1PX3A 3BXNA 3FN9A 3QARA 5L8JB 2WGNB 2NNCA 3IAPA 2HKFH 3KPNA 4FI7A 4P57A 2HJLB 2ZOOA 3NQIA 2CRIA 1E5ZA 1S2EA 3NN8A 2B5IC 3REVB 3EFFB 4MJJA 5L2KE 4N9GB 1SJMA 4WFFD 5TH2B 2APVA 1OGAB 1IAIL 4E0RA 2DI7A 4RAVB 1ZHNB 2PWFA 4PJ7B 1JPSL 1CDHA 1MHEB 1PD1A 3BP6B 3SE3C 4OTXL 3C09B 3ATEA 3SYPA 3JV6A 4NDMA 3F7QA 2A9BA 2UXTA 3RA7H 4GLRH 1HL5A 4MNGA 1NGPH 1SVZA 2HFFA 1JFHA 1WBYA 4U7MA 2Y69B 4O51A 4NZDA 4NIKB 5CBEB 1FLTX 4PCYA 5LGJA 2VOTA 2WVSA 3T3MF 4N28A 3FOLA 2NY5L 2ZJSL 4N2BA 3X1NA 1RURL 1JYXA 3R4DA 3SPGA 1R19A 4RESB 5C0RL 3KDPB 3OKOA 4J4PA 3TEZA 1OB1B 3OHXC 5CZVL 4FFZL 3BWAA 3WEBA 4E5XB 5T1DH 3BP4A 2DB8A 2MFNA 2JVUA 1RI8A 3CFUA 1A9EA 3BYTA 3QGVA 1ERNA 1IT9L 1IVLA 4U6YA 3Q3GA 4CC0A 3J7HA 5I16B 2HX9A 3N1MC 4JZJC 2N7BA 4TKWA 4HWEL 5IQ7H 2HVJB 2VZ1A 3AZUA 1H6UA 3GSRA 4HLZG 1D3CA 3MREB 4WEUD 5BZZA 1U58A 1AO7A 3FQRB 3GI9L 4TQEL 4O02H 2AQTA 3KLLA 1OAJA 2Q10A 4BXVA 4R84A 1CO1A 3HC4L 4PSPA 4WNJA 3FUJA 3L3OC 4LOUD 3SOBH 5K9OA 3GZOA 2H2PD 5AW0B 3OGCB 4BE5A 5I1CL 1HS6A 2GJ6E 3CSGA 3L3JA 4NERA 4YBHA 3SZKC 5ENWB 2YK1L 1ILUA 5IT2H 3GMOB 3TVMC 3P9WB 2H3XC 1DBJH 1ZVSB 3VB8A 3KBHE 3ZSSA 4PG9B 5C0AD 4R7LA 2ALAA 2WXGA 4X9YA 2QBWA 4P2QA 4TLKA 1D7BA 4MCZA 2V6HA 4LOFA 3TFBA 4EDXB 5KVMC 3IJYB 3ROLB 4KTGA 5LXVA 4XN2A 1FNFA 5KSBB 1KIPA 4OZIE 5I6XB 1TJHL 3DPBB 4FG4A 5FO8A 2EEBA 1GKEA 2QADB 2YA0A 2JQZA 1N8ZB 4Y4HC 2P7TA 1JXDA 5E9DD 2F8OA 1C8QA 1HXMA 3VXNA 5FWQA 3MVSA 3WGUB 3LZFH 1SEQL 3UTSD 2N01B 1BF2A 1RD6A 5HVGB 4PBWD 4S1DC 5H37A 5B1CA 1RCYA 1UVQB 3QUKB 4P4KD 1BWWA 1A1NA 1XF3A 3VXSA 4WY7H 1YDPA 2IPKA 3TT1L 1GOFA 4HOMA 3IJHA 1HFUA 1HKLL 1Z66A 4WFFE 1B4JL 4F8LA 1I1YA 3MBEA 1A6VH 3NCMA 1I7RB 1KLFB 2ZUUA 3HW7A 5AALA 3BEWB 3PGDA 1IM3B 3KL3A 5AOZA 4B53A 4ZO9A 2YAEA 1K4CB 4XBMA 3SQOL 2X1XR 1O9ZA 1ADQH 4OZHF 2GUOB 4DT2A 2J5WA 3OKNB 5I1LB 4PRDB 4KQ3L 3SCMB 2V0AA 4BSJA 3QEQE 4YNYB 4EEEA 1NDGA 5GZOC 4WUUB 3ZIMA 1ZHBB 3F7YB 5AVQB 4WU7A 2Q76B 1LD9B 4PS7A 5I1EL 3H2WA 3N9GL 3FT9A 1AKJB 2JKRM 1PIFA 4N9OB 4UTBL 5FUCC 1GHFL 2WTRA 2X53A 3DDFA 2QHLA 1N5AB 4L18A 1GZPB 4K7FA 1VADB 5IVZA 2J6EL 3MACL 3BGFB 4HUVA 1XSOA 3A6BH 1HIMH 5FR3A 4D8PB 1JVLA 1LO3L 5LXGL 3BAXA 2W94A 1LEGA 3KPRA 3WDIA 4U2ZA 4MAYD 2CO6A 4LF3A 5ITFB 1O6SA 1SOSA 2W9DH 1TXKA 4KKAC 1GH7A 1WBXA 1FUNA 3N1PC 5L4FA 2H0EA 4HUXB 1E2VA 5BRZB 2X0VA 2CJSA 5DD0L 2HKHH 4F7KA 2KPWA 2ADFH 3GZKA 3OVUB 1QQDA 4G8FB 1VDGA 5EZOL 4HPYH 4JFVA 4L3ED 1KYDA 4ELMB 5DR5H 3L5JA 2JLPA 2EEFA 2C3HA 2QGBA 1A1OB 2KQMA 3HR5A 5E9AA 5ABZA 2XIIA 4CKVX 2X2IA 3ASNB 3VI4A 4G1EB 2CGRL 2EEAA 1NICA 2B1HH 2FJHA 3N44B 4M7JH 4DKEH 1H3XA 1GZQB 4DTGH 1GPOL 2XZQH 3HAEA 3LZNA 1GCFA 3FH7A 2V7HB 1T7YA 2MCMA 5D72H 3TBSB 1MQKL 1IL1A 3MGOB 1P5UC 2LVCA 3FFCA 4PJHE 4QJ4B 1LO5B 3K5RA 2XQ0A 5FW8A 1L9TA 5DRXB 5C0AE 3DETD 5GSRB 4Z1PA 2B2XH 5FUZH 4XP9L 2WQXA 2OJEA 3HHSA 1TQCB 3LNFA 1GOGA 2IBZX 2YGOA 3BLKA 4PGBA 3SJVA 1BYNA 4RX4D 3HC3L 5EU6D 5C2UB 4NLAA 4XVUC 1VKXB 4QOKA 3LH8A 1TZIB 5D2LA 5GIRA 4J27A 1K8DA 5B39B 2DM4A 2DICA 1GZHA 1OALA 2IGLA 3GS4A 5FIEA 3WY3A 1HHIB 1KPRB 2VXSH 4BFRA 3MV8B 1A4BA 4Q0XL 5D70L 3UTSE 3MRKB 4U1SA 5J9PA 2H6PB 4XBPA 2JE8A 2NT1A 4N85A 4UM8A 4MQ7B 3TZVD 1QFUL 2ICEB 3H2PA 1J86A 1ORSB 3WSQH 4Z3GA 5D7SH 2R2EB 1CF8H 1C5DA 2O5XH 2XV2A 3GIZL 4FZEH 2FX7H 4YHNA 3T0EC 1WT5C 1AXSB 3D39A 2VERA 1U8IB 2X4TA 3K5SA 1E6JH 3PHQB 4IMKC 4DO5A 3AT8A 1MNUL 5KVGE 4JANA 2Q7AA 4XXWC 4GSDL 3E1F1 3E6FA 4IW4C 5LNDA 1HYSC 4LLVA 12E8H 2HJFB 4M7KL 3Q1EA 5TK4A 1J9SA 4Y2LA 4WWPA 1AZCA 1CWVA 4FFYL 1S5HA 2RCSL 4PTUA 3MYJB 4EOWH 2FGZA 3FUFA 3QSKB 4DZ8A 4P23C 1WAAF 1KYAA 4KXZH 3G5ZA 4YFLF 4OJEH 4JFTA 1KTLA 3DX4A 2CIKA 4JW3A 5I24A 4HCFA 1GGUA 3SO5A 3TPUB 3V6OC 3JWNH 3MUGB 2WLYA 4HFWA 1P9MC 4F9PC 1QFWI 1AZBA 4HSQA 3WN5A 3WIIH 1A8ZA 5JR1L 5DWUL 4K23L 4Y4KB 4JKPH 2BCKB 3JVGC 5DRZB 4ODUB 2NR6D 3VFGL 2ZKHH 5GS3A 4RGOL 4JFZL 2JWYA 3TN0B 2E86A 2H6UA 4OLZH 4P5TD 3RNQA 4A2HA 3CFJA 3DA0A 3RX7A 5D7HA 4JPSA 5DO2D 1P7QA 1FZMB 3ARBA 4NO3A 4FXTA 5IMOB 1IU1A 2Z3FA 4Q2ZA 4YWGL 3WG7B 4JPIA 1NAML 1DQML 1NCOA 3T9WA 3H9SB 4RFNC 4X6DE 4Q9QH 3ILDA 4CMMB 4JCMA 1UM6L 2NZ9C 3MRLB 4RIRA 4Z3FA 2PUQT 5C7XL 3GSNL 2R29L 4H5SB 4NUPA 4F5CE 1KTJA 4M1DH 4L3FA 4L3EE 3VQMA 3QZWG 3CHPA 5LQBL 4RLDA 5JYLA 1IQDA 4X7DC 4YPGB 3KCWA 4S2SA 1CYGA 1Z6JT 1W0YT 3RX9A 4JG9A 3U1SH 2QGDA 4NWTL 4WGKA 4TTDD 2WYTA 3HNTH 1EGJA 3HIZA 2R59A 3B9KB 5K59F 1WCBA 2VMJA 2PXYC 1A6WL 1BXAA 4FNPA 4TQPA 3CDGB 4Z7QE 4XPBL 3CDFA 2BM3A 1MCOL 2QGEA 2B1AH 2WXOA 3GK8L 3FCGA 1QX1A 5K93A 5EU6E 1HL4A 1ZE3H 2IMMA 3CFEA 1X44A 4ODVH 1MF2H 2JNZA 4F9LC 5IFAH 2B08A 2LTQB 4NNPL 5CCHE 1JE6A 3B3IB 4IEFB 4AYBA 3BIKB 2HN7B 5DFAA 3V7AG 4FCAA 4N2CA 4PRIB 2NYYD 2GT9B 1G7HA 1YECH 3QQXA 4KFMA 3UO1H 3D1MC 5FHBL 2CO4A 3B9DA 3GI8L 4FFVD 5EU5B 1DVSA 4R7NB 3CN1A 4NEHB 2D31A 3WFHA 2J7LA 3CVIH 4P4RB 3T8XA 1ZLVH 5FPIA 4PWGA 5F9OL 2D9CA 5F6IB 1NIBA 3V4LA 1E4HA 1N4XH 4GYBA 3D12B 1MAML 4ZS6C 5FV1L 2I27N 3GBML 1EEYB 4U3SB 1KJVA 2MHAB 4Q6YA 1Y6MR 3BQVA 1FV1B 4Q6IC 3T2NL 3NZ8B 1AZUA 1T22A 3T0AA 3GO1L 2C9XA 1OGSA 4R0LB 4PRPD 2AJ3A 2WLKA 5JORB 3Q6GH 1MWAA 2KZWA 5EC1A 2ZAHA 3F12A 4OZFH 4JJ5B 5MEPA 1FNGB 5AVYB 4AGPA 1EFXD 1BA9A 5F89A 1EVUA 4W9KC 4HJJL 4WI0A 2DLIA 3VDCA 1L6XA 1T0OA 4FG2A 2VO5A 4TRPL 4LDCA 4TUJB 1G0YR 2ZYRA 3KM2A 3MOAL 5FDYA 5LCVL 5JA9A 1X5LA 3F5WB 1H3TA 4UMSA 3UABA 2J12B 3C8KA 1YEDB 5AOJA 1J1XH 2RAMA 3SE9H 2IDCA 2Z31B 4GXVL 2BP0A 4KTDH 1LLAA 4LBEB 1E4XL 4Z7VF 2BNRD 2XY1A 4JPKL 1PZDA 2XN2A 1JWMA 1RP8A 3PQYE 3JT0A 4ZAKD 2DQEL 3WTYA 3Q8FA 4OLXH 4KK9C 2Y72A 3QORD 4FFZA 1XF1A 5IZ7A 1DUZB 1CFVL 1KY6A 3P11H 4JX0A 3UAJC 3E8VA 3DX3A 5CJXC 4Z5RB 3ULVE 2DMCA 1XBDA 4XCFH 2F54D 1M2VA 4M43L 3Q1SL 2OQJA 3NACL 4TVSa 4Y16D 2DKSA 2R56H 3EZJB 3U4EB 3ZE0F 4ELDA 5TE7H 2P80D 4KZDL 5E7BA 4QRPD 4F7PB 2YKLL 1WHOA 4HX1A 2CHWA 1AGCA 1EHAA 1NUFA 3G08A 3C75A 2FJFA 4HXBH 1O9VA 2O6EA 1W80A 1YEEH 3NAAH 1S3RA 2PNDA 3P0YH 4X5XB 5JYMA 2E6PA 4QKTA 2P43B 3BDBA 4DEUA 5IP4A 5D7JC 1CL7L 2GFBA 5K9QI 1ZA6B 1OWRM 2FX8L 1ZLVK 1AE6H 3HE6D 5DSCA 3K8LA 1BAWA 4QRFA 3ZKXB 4Y5YB 3I75B 5FKAA 5IUSA 4CSZA 3QUZC 1ZLUH 4OSUL 2UWEE 3W2DL 3QJTB 2XQBL 1MVYA 4NNYB 1MFBL 3H3KA 2WWMD 4MX7A 5DHYA 1T1ZA 2X5PA 3BWUF 1EDQA 1F11A 3QJOA 2XBDA 2YR3A 1UJ3A 4WHYH 1H3WM 5J8OA 1NOLA 2X6AA 2CJ3A 2XWRA 3RDTB 2ZX6A 1OCRB 1SJEB 1N64H 4ZPTA 4K5PA 4Z7WB 5C0JB 2WZPD 3EJCA 2CKBH 3PRZA 4K3JL 4EVNA 2EXWD 5IEHB 3GRWL 1T7VA 3GHEH 3DBXB 1ZHLA 5EU7C 4NM4L 5AVUB 3ZUNC 2GSIB 4WAFA 2NQ3A 5B7FA 1SDDA 3QR2A 4PRPE 2ESVB 5BJTA 4O5LL 3MOBH 2I9LA 5DJ2B 1NCAH 3HHRB 5I74C 3FT3A 3KVQA 2X0WA 4JFWA 2ITFA 4XNXH 3ESUF 5D71H 1E4KA 3FU5A 1WS8A 3PPEA 1PDKA 5T3XL 2E5EA 3I3DA 3BAYA 2XPGA 1ZS8B 4TSBH 3A23A 3FYEB 1Z7JA 4GAJH 4BCXA 3ATAA 2AEWA 2DW5A 4AVKA 1WA1X 3BVXA 4OAWB 5HHNA 2NX5B 5EBMA 5IY5B 2ZX9A 5ID1B 3BMWA 3SE8L 4TUKH 3O2DL 2BNRE 5BW7C 4LLDB 3V0HA 1T3FA 1CT8B 1WA2X 4RISL 4J1UB 3CDZA 3F84A 1S7WA 3CHXA 1BGXL 3FJTA 4KJQD 4K5NA 3MRMB 2GBVA 5LAXA 3SBQA 3SD2A 4ZW6A 2JIXA 4XNDA 3HHMA 4HS8L 2DKMA 4LLMB 3M07A 4MJHA 4OLYH 4I9WE 5EZLB 1A2YA 1I4FA 4BK4A 5JLZB 5DS1A 3EJYC 4L48A 4P59L 2FO4A 4JHAH 1J05B 2VLRA 4A39A 5KS9F 1NLBH 4PCSA 5I1IH 1U8JA 1YNKH 4XX5A 4UV7H 5BZDA 3Q8EA 4QRPE 2V2TB 5E6SB 3QFJB 3CZLA 1ZLUK 4FNTA 5HI4D 4JFDE 1F41A 1XH1A 4L9LB 1IGFL 2WK2A 5AOIA 1FYHB 2VDKL 3A0OA 4KX9A 5DJZB 1OCZB 5EOQH 3ARFB 4PJCF 4HALA 3JV0A 1W0VB 4GJTB 4RFEA 4GQPH 5AW4B 3QI9B 4FQHB 2OK0H 1KJ3L 4Z76B 3BEVA 1HWWA 2XPYA 2E74C 3OJDA 1WTGT 3LSOA 4F1SA 4MS6A 3X1FA 2NSXA 2HWZH 3PY9A 1UGNA 4WJG3 2G4EA 1G6RL 1KN2L 2XTJE 3O0RL 3CH1B 4Z7UB 5F9JA 5T1LA 3D0LA 3P0VL 4H26B 1GJUA 2CO7A 5HYQA 1BM3L 5HYEA 2DWSA 1RU9H 1FN4B 1ONQA 3H6AA 3QJXA 3MKGA 4K3EH 5DMGD 1J8KA 2B3IA 2Z9TA 3TV8A 4YGVB 4BGLA 5F97E 4BWTA 1U8PA 4J4PD 1K2DA 4U1GC 1H15B 3TYFB 2CDGA 2A2QT 1CFQB 3JVFC 5C3IA 3NFPA 1HH9A 5CILL 4IMLA 5F3HA 2NY4B 1P69B 3REWA 4S1SL 2XVGA 1ZLDA 2F61A 4L1TA 4QO1A 4L8CB 4LLYA 1EXHA 5BXFB 5IW6B 3T6XA 1SBSH 2QTEA 3MLVH 1L7IH 3LXUX 1NEZG 1KB5H 4RBPH 2YWYA 2YD5A 1I3GL 1FL5B 4X7TA 1AO7D 2FD6L 1TVHA 4BFIB 1F00I 4J28A 2YN3A 5E5MA 2LE9A 5DUML 2B1OA 4GIOA 2EIKB 3RTQA 1IIKA 3QDJA 3ZZ1A 5C0BA 4UT9L 3NK4A 7PCYA 1IEBA 5JW4Q 3D4ZA 2ZOWA 3D08A 5GHWL 3OKLB 3NCYS 2AAVA 2VZUA 1KF9B 3ZTDC 3CTTA 1NCCL 4GRWE 4ZS7H 3G5YA 3AS2A 3ISYA 3IGFA 4UB0L 2VZVA 3LB6D 3SDCB 1I8MB 4FKHA 3HE7B 3R06B 5FA4A 4NAMA 1BYPA 5I1JH 4UAOC 3BRDA 4A63A 3I6KB 4P2QD 2HSIA 1ZSDB 4GKZB 3RLSA 4JG1H 3HG5A 4HIXL 5EEWA 2IANA 4CU6A 5DC2A 3KEDA 1ZEAL 3QULA 1IAKB 3L6FA 3O3UN 3FO9A 2GSGA 1ZA3B 2VDPB 5DTFA 5EOTB 2CSPA 2JV6A 1MCCA 3V0EA 3HZKA 2F08A 4N2LA 4XRCB 5BOJA 1CLZH 1NAMA 4L3CB 4KH9A 2AMUA 3H3BC 4KRLB 2GG1A 5JW5B 1JFQH 2BOCA 3F6JA 4YHOH 5GSVA 2X6BA 1G7JA 3O8XA 1ZLSH 1BQLL 4IKLA 3N43F 3ILPA 5C0IB 4Z77A 3GSNA 2R29A 3MLUL 4PYHA 5DD5H 3VFOA 4HD9A 5H35B 1KCKA 2OZ4L 1L0YA 3MJWA 2J2ZA 2ZONA 1YMMB 2O5YH 2D73A 2C1PA 5IVNA 1ZRUA 1OTTD 4JM2C 3MBED 4OM0H 2P44B 5KVGH 3M8OH 4YUEH 1FNEB 1FAKT 4RWYL 3PWVA 4N0UA 3VWJD 5CNHA 4ETQB 2B0SH 5AAPA 4CA4A 4XN8A 1Q0XL 2I69A 3I2CH 4AJWA 5JHMA 4J8RA 2AJSL 2CMRL 2ATAA 4YLBA 1DBAH 1OQOA 2P5EA 2QFRA 3C60C 4TVPL 1RUQH 4FYRA 3L5IA 2GY7B 3VJ6A 4KVNL 5JIIA 1AP2A 3OJMB 4N20A 5K5YA 4KX7A 2OSLA 4ZODA 1TSHA 3UTZA 4LSDA 4XGZB 1OW0C 1WEJH 1F56A 1D9KA 5DHEA 2K3HA 3BPOB 4RBPK 4ZI8A 4AL8L 4QRTA 1BSIA 1T1XB 1JUFA 1TTCA 5IB1A 4K94H 4PLKC 3MUY1 8CGTA 1RJZA 3IDYB 2Z1PA 3T3PB 4J3SA 5CD5D 4YSTA 1YY8B 3OXRA 4WI6A 3Q6FA 2YXVA 3HRZB 1S7RA 2BSSA 2HTKC 1CVRA 3V5DB 3GSQB 3MRFA 1B0RA 5IVXB 1PY0A 1RIHL 1B6UA 1UFUA 3PPSA 4LFHG 4QJ3B 2AEPH 1RZGB 5CIPA 3JTTB 3DOSA 5HJBA 1A7BA 1AO7E 4RMVA 5DWPA 3L45A 1JZFA 2PW2A 2XZZA 4LSPL 2GW5A 3NYKA 2AP2A 2R51A 2VDNH 4ZMAT 2XWTB 4AGQA 3Q8CA 5DUBA 3HLAB 3TH3T 1KY7A 1G1YA 1JS4A 3PHSA 4G6JL 5FM8A 1U8NB 1T66C 3SDAB 1DDHA 5D7LB 1UUNA 2BWQA 4JDVA 4NKIL 5EIQA 2GC4C 5GS1C 2P3YA 3QZWB 2CLVA 4BFOA 3W3BA 3FFCD 4QRUA 1I7UB 3VFTB 2WWNA 4WTQA 1BVNT 1FE8L 3ET9F 3P2DA 1NGYB 3DTDA 1PZCA 4B9CA 5IEKB 4P2QE 3A6CL 5E94B 5AYUH 4N2NA 3OWEA 3SJVD 2ZWSA 3ZN6A 2VAAA 1VLXA 3BDYH 3UX9B 3N2JA 2ARJA 4UOQA 2NNXA 5LCVA 4QHMA 4QOKD 5DK0A 4KHTH 1I1RA 5EV7A 2H3NB 4PW9A 3C5JB 4FXKC 5D93C 5IHLB 3RU8H 4MXQD 4W70A 3BPCA 5HYIA 2YEVB 4PR5B 1X7QA 1B2YA 4OD3H 2Y2YA 4Y5VC 3NSXA 3QO0B 5FS5A 5KBMA 3KR3H 4MQXC 3BIAX 1WTLA 4AE0A 5JHLL 4CUCA 4DUWA 1DN2A 4GQZA 4Z7IA 3D39D 2K7PA 1MCKA 1ZIAA 5HI5D 5SV3A 3TIDB 4ADGA 4JFPB 5GS0D 3QYNA 2QPDB 3S3CB 1THCA 3BMVA 2VRKA 4KDTC 1I3UA 1R3HA 1U3HD 4FNUA 3EYOB 4JRYD 3LOWA 1XEUA 3U6XS 3MV01 3QNXA 1CICA 1HQ4B 1ACXA 3T2LA 3RWGB 2VN4A 4PJXF 5KSAA 1BQHA 2DDQL 4MA1C 4IBLT 1A7OH 1KZQA 2NY0B 4OM1H 2CBOA 2H7WA 1KIUB 3LN4B 1MAKA 1A3QA 1VEMA 1WD9A 1URLA 2XG4B 3J27A 5B8CB 4PJ5B 1JWSB 4N2HA 2YSSB 3V5HB 3OD3A 2NY3C 4LPYA 2V2XA 3RUGF 4M6MH 4QDGA 4JL1A 4NQCA 4OCYH 1H0DB 4LDOB 4ZUUB 1I8LC 4N4YB 2WUCH 1ESOA 5CEYA 1T4WA 2UZXB 4HSCX 1NFDA 2ID5A 4RMUA 3ZTCC 4HQQH 3SQBA 3HNVL 3OPUA 7PAZA 3TFKD 1BWMA 3FB6A 2PCPA 3VMNA 3L5XL 3QRGL 1BF8A 1WUZA 1A64A 1Y1DA 5EORL 2IDSA 4JFOB 2DIBA 5EF1A 5JPMB 1IFRA 1HHKA 2VQ1A 2MCPL 5TQ0H 3LKPB 5IGXL 2HX7A 4YHPA 4MBOA 5F1IA 5IQ9A 3WTTA 4GIAA 3QJRB 1TZGH 2QSQA 3MKKA 4G80A 3EJSA 4EQ3A 5IHZA 1KG0A 2QVTA 5HPMA 4LSRH 1NOFA 5AAMC 3QE5A 1L9PA 3DPDA 3LS5L 3MJ7A 2IGTA 3GRWA 3IDJA 4HIJB 3S3JA 4DCQA 3GXDA 1A4KA 2R27A 2V17H 2XZAH 2DIAA 1QUNA 1Z0NA 2EE2A 4IIZA 3PWUA 3ULVH 1MKFA 4NGHH 4RFOH 3FFCE 4R2GD 1T6BX 1ZMYA 5JOFB 4LVNB 4QRRA 4G6AD 2UY7B 1YEIH 4HS6A 4NN5B 3EGSA 3GMMB 1XL6A 2I5YL 4XOAA 1TMQA 3IPFA 2J8UE 3EGXB 4UZGA 3SJVE 4GP8B 4O9HH 5DQDH 2V2WB 1OSPL 4UWQB 4QOKE 3T65B 5L9DH 2BS9A 5GGTA 5I1AB 3OX8A 3IJSA 4NKMB 1MJ7H 1JTTA 2YQBA 4TXVB 3MNVA 4J3TA 4QXTA 1TLKA 2QL1A 1CFBA 2G9HB 3QAQA 5HJ3B 4L37B 3II2A 4PBVC 1CURA 4Y2NA 3NIDE 2HJLA 1J8HA 3EO0B 2W91A 5JIMA 4FP8H 4G1MB 3REVA 3HB3D 1E3XA 3EFFA 1GGIH 1KJMA 5E2UH 3VSQA 2NDFA 3ZX1A 3AABA 3KW7A 4N9GA 5TH2A 2ZD0A 1OGAA 4JRYE 1T4KB 1MI5B 3CIAA 4RAVA 1ZHNA 4PJ7A 5CCKL 1W72B 4URTB 4X6DF 3ZRFC 1MHEA 3BP6A 3NJHA 1WC7B 3E0GA 2C34A 2ZG2A 1BCIA 2B5IB 2P46B 1CXKA 2AITA 4ABQA 2MTAA 4LO9A 5CBEA 5E08L 2ZP9A 4MYWB 2JJUA 1L7TH 3WNOA 5JMOC 1AG0A 1RFDH 1I3VA 1WAPA 4B97A 2AW2A 2HUEA 4HH9B 5CN2A 4YZFE 1IGTA 4YFEA 4JM2F 4D0DB 1V5JA 1CDYA 4IRSB 4WI5A 1JXJA 1B0IA 4E5XA 5D7KD 3WIHH 4XPAL 2DQCL 1DQTA 5LBSL 2AXGB 3U9UB 2BLFA 5H94B 5HHQB 2EZ0D 3RX5A 1G43A 4XOEA 1ETB1 3VFWB 4X2UA 4OB5H 2AGJL 1EBPA 5HYSG 1DVYA 5HY9B 1G6RA 3A4EA 3OHXB 3CXDL 2CLRB 3ECBB 1BJ1J 2MMXA 1QI4A 5I16A 3DOIA 3O3AB 4BZ1H 5I75C 5ITBH 2HVJA 3WTUA 4DOHB 1LQBC 1J1OH 2F5AL 5IQNA 5SWSD 4PW4A 1H3VA 2DQIL 3MREA 2YIHA 3PWJB 3NQKA 1J5CA 2XHNA 2XWZA 4KOCA 3DI3B 3GKZA 3L08A 5I5IA 2HPOA 4OJAA 3US0A 4PJ8C 3UPCA 4PI2A 4XNYH 3K2UH 4LQFL 4OY9A 2F74B 3QT2A 2CNYA 3QRFM 3FH5A 3IDXL 4YDVB 2JKIS 3CXHK 3TYGL 3OGCA 2V8LA 1A3LH 1EZVY 5ENWA 5GISL 2EKJA 3GMOA 1UGKA 4HJIA 4AOFA 1ZVSA 4IRJA 1W6LA 3D33A 2OP4H 3DXAE 2CCLA 1B3IA 4XX1G 3RJOA 3TGXA 1HOCB 3GNML 3WEXB 4EDXA 3ABKB 3IJYA 3ROLA 3G6AB 4UT6L 5JW4N 3GFUA 1ZWIB 3TVMB 3L5WA 5KSBA 3V0DA 3TTSA 3DPBA 3S36L 5F0PB 3IMBA 1WF5A 4JRXB 1N8ZA 4UT9A 5DK2B 1UCBL 4LLUB 1P7HL 4Q56A 3MCYA 3UBXB 1R4XA 4TNGA 4B60A 3WFCL 4F7MB 2D7TL 2F8XC 2H32H 2R2HB 4B5EA 5E6IB 1JK9B 4BBWA 4PWKA 2ITCB 4Y4HB 3K1KC 4LRNH 1X5HA 4P9HH 2W88A 5T8IA 4FLOA 1MDTA 4LIQL 5D2NC 2FJSA 5F7UA 1NC4B 2FBJL 4WV1B 4BH7B 1I7RA 1KLFA 3MV7B 1IM3A 2GBUA 4WFED 4DEWA 4UUJB 2GUOA 2P24B 3TBYB 3OKNA 5I1LA 4PRDA 3SCMA 2A38A 3VI3B 4YNYA 2G3MA 4N25A 2F7QA 3DKHA 1ZHBA 1C1EL 3F7YA 4X6CB 3ZQWA 4HKJB 4P3DB 2IH9A 2Q76A 3BO8B 2QPEB 3ZL4L 4NJAH 1LD9A 4B9PA 3PWPD 2JQMA 3DIVA 4PHXA 3NCCB 1AKJA 2WQSA 2OZ4A 2G2RB 3AM8A 5FOBB 3NPSC 5KSVB 3HBQA 1INQB