3GUFA

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
molecule keywords Low molecular weight heat shock protein
total genus 14
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gufA00
4I88A 2KLRA 2Y1YA 4YDZA 3L1FA 3QORA 3GUFA 4FEIA 4YLCA 1X5MA 3Q9QA 2WJ7A 4ZJ9A 3QORB 5LUMA 1WH0A 3L1GA 3L1EA 2N3JA 2Y22A 3IGFA 3QORC 4RZKA 4YE0A 4ELDA 1GMEA 1RL1A 4M5SA 5DS1A 2KMWA 2RH0A 2O30A 3AACA 2Y1ZA 3W1ZA 3VQLA 2K8QA 1EJFA 2JKIS 3AABA 4MJHA 1SHSA 1WGVA 2BOLA 2WJ5A 2CG9X 2N0KA 2XCMC 4PCKA 3GLAA 3GT6A 4JUTA 4YLBA 5DS2A 3QORD 3N3EA 1WFIA 4PBDA 4YL9A 3J07A 3Q9PA 2CR0A 2MNWA 4JUSA 4M5TA 3VQMA 3EUDA
chains in the Genus database with same CATH superfamily
3Q6GL 3EIFA 1NM4A 4H1LB 4Q9CA 5C0FA 1ACXA 5KYWA 3U1SL 2WKGA 3RAJL 3HI5H 3X12B 3EJSA 4NEHB 4G7SB 1AS6A 4NC1C 5JIDA 2ZXWB 3T4AC 3ZRCC 2E86A 3ALPA 3U9PL 4OH2A 4PJ6A 5LGKA 1P4IH 2EE0A 5IB3B 1EGJL 1F90L 1TTRA 2RACA 4XNDA 1J1PH 5ESQB 4BK5A 4GFTB 1JMXA 3MX0A 2V5SA 4P23A 4N20A 1A6VH 5I23A 3Q01A 2D7MA 1PYWB 4XP4L 5CEZD 5GS0L 3D39E 4LVEA 1S7UA 2X2YA 3SYCA 2GBTA 5DK2A 2W81C 1JGUL 5BPPA 2JQAA 2FATL 4FMVA 2GK0B 5LGJA 4E41D 1WBYB 1H3GA 1JERA 2DD8L 4RX4D 4X4MA 5E4EC 5I66A 5HY9A 1QOKA 3QHFH 5BW7C 2AK1H 5C6TL 7TAAA 1IUZA 5C0BB 3FRUA 2TAAA 5D4HA 4NNYA 3CFCH 5TDOB 1MPAL 3HE6A 4LEEA 4ENED 1F8TH 5GGTH 1G5AA 4LASH 3IRPX 2VLKE 3HRZB 5DHXB 3UABA 4TPRH 2ZX8A 3WFCH 2X4SA 1PLCA 3ILQC 3E6FA 5AL0A 1JNHA 2X4QB 4JFHD 1HQ4A 2QHLA 1JXGA 2TSAA 2WAQA 3DYOA 5JW5B 4GQZA 2YN5A 1WFJA 1JZ4A 4Z7WE 3RUGA 2YAPA 4WNQB 5DD0H 3QWOA 1JPFB 4F7EB 2CHDA 4I0PD 3D69A 3ZE0B 4ODUA 1D3CA 1MCPL 4PTUA 3PAZA 1E0OB 2BOCA 2PTVA 3TPUB 3FB7B 4PVLA 4JQIH 4H5SB 1XIWD 4P5RA 1R19A 2CPUA 3HB3B 3OLEA 3RZCC 3SDDB 2WMPA 1IBGL 4HA1A 2CLZA 4GUPB 5DZVA 1E4XH 3MV11 4QXUH 4YDMA 4XP1H 1MY5A 2FD6H 4TSCL 5DRZB 1FFOA 2DTMH 5I6XC 3QHZL 1S9VA 4AEIL 4F8TA 4GBXB 3R7RA 2Y9RT 4NUMA 4XMWA 2HJFA 2VDML 3ZE0F 3DX7A 3MMEB 1CTMA 3WN5B 3QZWA 1AACA 3N41B 5ACMA 2W1NA 4BFKA 4HKXB 4NNPL 1KTBA 4RFNB 3VDAA 2GJ6D 1I7ZB 1KLGA 2DQTL 3MFFB 5F89B 2E4FA 3F84A 1UATA 3TV3H 2NY6B 1P4LA 1DLHB 1ZEAH 4OFKA 5A6IA 4YSRA 3INUH 4KK6D 5GJTH 1G87A 3C6LD 4TM9A 3ARBB 1FBIL 3FCSB 5HHNA 1YECL 4U1LA 4L0YA 4HF5L 3FH7A 2IEPA 3WY1A 3QEHB 4FQHA 5L88H 4FQ2H 4FMKA 2ZUYA 5LGHL 2ENPA 2P5ED 1WIUA 1OL0A 4GQPH 7FABL 2JE8A 4FNPA 2IWGA 3LNIA 3GJEA 3FFCE 3FZUC 3WYRA 4ALAC 1CI5A 3RU8L 1KJMB 2NY1D 3LB6D 5IVXB 3D07A 3U9WA 3KYOB 5DVKA 4U7SA 2GFBB 3UBXB 4BH7B 1G94A 2NUTB 4HH9A 2X2IA 2EKJA 3LKRB 1DDTA 4Z7VF 1OP5H 4WWKC 1BECA 2Y7OA 1IGYA 3DYMA 1LDPL 3DV4A 3B7TA 1LTXA 1PAMA 2BDNH 4M5ZH 4PV8B 3ARFB 3SE9L 3KDMA 4JN2A 5EOCJ 4E9VA 1EWHA 5GS0C 1ZANL 3PWLA 3C6EA 1XGQA 4P9MH 3QDMA 2GVYA 4ZUUA 5GGUA 1XF5B 1SOQA 4JRYB 1TJHL 4PV8A 4YR6A 4OGYH 3OHMB 3KH4A 2JVUA 2R29H 3DX9B 1ZAGA 3H7LA 2FX9H 1A5FL 2CE6A 2I9TA 3MZGB 1J9CT 1XZWA 1BXVA 2OJEB 5D7SL 4W9LC 1INQA 4CSTA 1Z9LA 3MRQA 5GZND 1P84J 2KZ1B 4Y5XA 4PPTA 5DJAB 4EI5D 3QAZB 5AD0A 3ME0B 5KSUA 5I1IL 4PP2A 5K93A 4BKLA 1HINH 1VFBA 2J88H 2IBZX 2CXKA 2L0DA 4K8RC 4HBQA 4OD1H 4TNWF 4XNZC 1KXQA 2APXA 4BRVA 1B6DA 1VEMA 5B4MD 3B3IA 2F74B 4V2CB 1QNIA 2NY7L 4KK6C 4NQVB 4ETYA 5IVZB 2PO6A 4KI5C 4WTZA 5I1LA 1KEGH 4OZHA 4FQXD 4LDOB 4P2OA 4QRBA 5DRWA 2WBJD 1R5IA 3MV9E 2VUKA 5DHYB 4GSRA 3BWAB 5TE4H 1U8HA 2CDGB 3VH8B 1BFOB 1H0DA 4OAWA 4HUWB 4DP2X 2R1YB 4I4WB 3FPXA 3ARDC 1EA9C 2DWDB 2OA9A 4P2OB 5DRWB 2MCG1 1FHNA 4UUJB 3BDYH 4MRBA 1T89C 4PGBB 3LN9A 3Q48A 1XF4B 2F54D 2YQBA 4AYEC 1DVFC 1P4UA 1C7SA 1G9NH 1PGRB 5D7KD 2KBGA 4NB7A 2VDQB 1FAIH 1G9HA 1UA6L 2H0JA 2OAAA 1E4KC 2X6CA 3CMGA 3QQ3B 4Q9QL 4K3JH 3LEVH 4R7NA 3UCRA 1P7QB 2N7BA 4QRUB 4YGAB 2XTJC 4WV1A 1T04A 2ZP9A 2P8LA 2IH9A 3NJGA 4OZGE 1ECYA 5F9WC 4RGMC 4WDIB 4OKVA 4YZFE 3UBXI 3V0FA 2X05A 1WD9A 2ZUVA 2W94A 1V8HA 2H2SD 3CN4A 3O3BA 1CE6A 1YNTB 3K0WA 1NLBL 4JFVA 5GIRA 3CZNA 1BQHA 5BJTB 3NESA 1AXTH 4JFDD 5ANHA 3LIUA 4WKZA 2VDOH 2NY2D 5KVDL 3GZQA 4AQ1A 5I18L 1AZNA 4YPJA 4JY5L 2FX8H 4WI9A 3K1DA 3U6XS 4XMTA 3TCXA 3GSWB 4BCZA 1R5IB 3DOHA 4AXWA 1H8SA 3FT2A 1U95B 5KANG 3UPCA 3C09C 1AHWC 4NN7C 4A38A 4DZBA 3UJTH 3EO1A 4O02H 4AE1A 2ICWJ 1I3GL 4L37B 2WTOA 4I4WA 4N0FB 3V4LA 3QO1A 1Q1JL 4KJQD 5DFVD 3FCTB 4OCSH 2ZKXA 1NMCB 3LQAH 4EIZC 5AW6B 1W0VB 2DMKA 3VB9A 1BQHG 4DP8X 4L5FE 3CFCL 2C9SA 3QUXD 2ATPA 3OG6B 1CFSA 1G7LB 1TEGA 3OAYK 1MCCA 1RQ5A 1E42A 2PPEA 4S1SL 1EJFA 4JHUA 4OCMC 2HN7B 3FQNB 3NZ8A 2BFVH 4JDZB 4IRZL 2FEEL 4RMUA 2ODIA 5CFHA 1IAII 1TCMA 5G4NA 5FM4A 1S7RB 1FF5A 5T33L 2ZX6A 4U1SA 3V52L 1NFDE 1UUNA 4FFYH 5EEVA 4UV4L 3TH2T 2F9BT 4JO1H 1EO5A 32C2B 4BZYA 1MY7A 2LTQC 3IFNL 1RP8A 3STBA 4RESB 3WNPA 1I1AB 3FSOA 4P23B 2WAHA 1LK2B 3BP6B 4W9CC 1U95A 1MJ8H 3RKPA 1CLYH 4UQCA 3I02B 4JG1L 1MH5B 1R46A 1DQTA 1KYOJ 2QPFA 4A63A 5F6HJ 1VADA 2R23B 4OZIB 3FOMB 1XTLA 2AHIA 2YMXH 3WN5A 4PRPD 3EJZC 2A6JB 4UIKL 3QUYB 2FZ3A 2OTPA 3I02A 2IVFC 2MHAA 5SWZD 2I7OA 3FRUB 4JDEB 5MEQA 2VR6A 3KL5A 4YC2C 4Y1AD 2X3CA 5BMFL 4NQCE 5E6IB 5HHOD 5T8IA 3NG5A 1AFVH 3RL2B 4D9LL 4GQ9L 3FHQA 1QKZL 4MQ7B 5BO1L 5LBSH 4EKXA 5LNDA 1IM9D 1J48A 4FQQB 3HVNA 4GRWH 2WWNA 1C8PA 2IMNA 4YSDA 2BNRD 1OGAB 4XNQA 4L1DA 4UDUA 5GSVA 3TP4A 3IDYC 3TURA 3R8QA 2W9DH 2ENYA 9PCYA 2O5YL 5IT2L 1L5GA 3GIVA 5DJ6B 2PPCA 4LAQH 5C0BE 4I13B 3O6FA 4S1RL 2Z64C 3S34H 3QQ9D 5T3ZE 4JPQA 1OTSD 3GM0A 4KJWC 1ORQB 4HMEA 2FQFA 3U6RB 1KIUA 2ZUUA 5FYLE 4TUKH 3VRJB 1LEKB 5LBGA 2A38A 4ADJA 4UQIM 4AEEA 5IGXH 2IH8A 1U36A 1Q9OB 3VE0B 4ABWA 2FECL 2ZWZA 5ACLA 5D1XE 2ARJQ 2LHAA 3QC5X 4FS0A 2X88A 3HRZA 1DLFL 1JFQL 2KQNA 2VMDA 1PS3A 4Q9RL 2EC9T 2PABA 3FF7A 4EN3D 1BZDA 1KPVB 2X1WL 4K3HA 4GAJH 4XXCC 3A0OA 2VJ0A 3QJFA 4YHPA 5IWLA 5I0WA 1XGPB 4U6VH 1K2DA 5DQDL 3TYFB 4AJWA 8FABB 3VNZA 3F5WB 4YXHL 2IG2L 1NKGA 3L9BA 2IQAB 1CDHA 2I07B 5AAMC 3L81A 1E6OL 3WFHB 1JZJA 2FQGA 4PJ9D 3DX1A 5FPIA 2HLFD 3PWPB 4KXBA 4MXVE 5D1QB 2W07A 5DQJB 1S7WB 1T6WA 2XJKA 5C3LD 1BA9A 2R83A 3CVHA 3S35L 3OAUH 5K33A 4U1NA 1X5GA 3MV8E 5ALCL 4IDJL 3CDCA 1UQSA 4OIAA 4GW1A 3CZFA 3WXVH 3CNKA 1Q90A 4PJDE 4GW5B 4J3VA 1DUYA 1FRGH 3O4LB 1ORSA 3D0AA 1WBXB 3WO3B 1UWFA 3PGFH 4H2AA 3LKSA 2WNWA 5KSVA 4PLOB 5I5RA 2RH0A 3C5JA 4OFVA 4X5LA 5E9DE 1XD1A 4BUHA 1UCTA 4WEEA 5C92A 2ZSWA 3NJFA 5I1DA 2GG1A 2P8MB 4PJIF 2DBLL 5FA4B 1BBJA 1XMWA 4PB9L 2P48B 5F7HA 1GCYA 3K2KA 1R3KA 4XR8C 5KSVB 4N1EA 1IJ9A 1ZIBA 2W80C 4OLVH 1XEDA 2DLFL 3SPHA 4K15A 3JYBA 5AW1B 1QLRA 1RI8A 1KCWA 2PO6D 1G9MH 4APQC 3NBNA 3KEDA 2WLNA 4XMKL 4ZQKB 5F1KC 4LMQE 3QDJB 5LBSL 2E7BA 2VN7A 5JPNA 4ZPTA 5FECA 3DTDA 4J27A 5JW4N 2HYMA 1F18A 1KF9B 4FQXC 4EF3A 1LNUB 1EZVX 3T0EE 2Z4TA 5IBLD 2N7AA 5F0MB 1BIIA 3BSGA 4UM9A 4HJJH 5BUAA 3WJJC 4XB8A 4FP8L 4HUCA 1J8HD 4JRFA 3CN1A 5CLXA 1XF5A 4X5WB 3TBYA 4ZYKA 3RX5A 1JV2A 1SXNA 2OMYB 3X11A 3MRGB 5D70L 2DM4A 3PDOA 4FLOA 1D7FA 2VLJE 1IC1A 1NANH 2ZT9C 4FQ1L 4O9HH 2E56A 5DHMC 5EU6A 4QXGL 5E70A 5I1IH 1GGCL 2ZCKH 3ALWA 3NQIA 2DI7A 3KW8A 5FYJU 2VXQH 3CLWA 2A9BA 4FXTA 5JIKA 2ZKWA 1NBVH 1SOSA 2NUTA 4PI0A 4ZFFA 1M2OA 1P1ZB 1EANA 4HK0B 5ECJE 5IUSA 5JYMA 5D7JD 1U3HA 3DV4B 1MJ7H 3ABKB 4HS8H 1F00I 3PV6B 4FCHA 3HAEH 1TJHH 4Y19A 5G4MA 2DQDH 3IMWA 2UZXB 1U3JA 1AIFA 1HHGB 1MIEH 2DYPD 3M88A 1UOKA 5C9JB 1AR1C 1PZSA 2JIXA 4S0HA 4DP4X 1FCGA 5I76B 2X0VA 3RWIB 5K9KB 4ERSL 1PCSA 1U58A 3OR7B 2WLJA 5KVEH 2NNAA 3BGFB 2OV0A 3GSQA 5EUOE 3K6FA 1PMYA 4HV8B 2Z4QA 2E9GA 2VR9A 2X4PA 1LQBC 5GJSH 5F7UA 2ADJA 3AXIA 2QQNH 1RJZA 1WFOA 3ESPA 4QRRD 3GZOA 2OCCB 4Q6IB 4YSTA 4HDIA 3QEQB 2Y7NA 5K39A 3D50A 3W0WB 4ZO6A 1WZAA 3S3DB 2YC1A 2CRYA 2JCCF 1J87A 3CQQA 2HT3C 4TQEH 1SJMA 3AY4A 1FVDB 3IF1A 5C9JA 4PJCB 1UTDA 4Y1AE 1AD9A 2YD8A 3TF4A 3SPIA 1KXQE 4F20A 5D2NB 1SNRA 1UM6L 3VRIA 1Z7JA 4HJGA 1DSWA 1WISA 2LW3A 3SCMB 2AV7B 4PJIB 3MYJA 1U3HB 5JXAL 2EE2A 3P9MA 4UT7H 4NKDB 3TFKD 4Q9BA 3WLBA 4KU1A 2B4CL 1J5CA 2ZX9A 4KXCA 5GJTL 3G6DL 1XGYL 3D4CA 2FL5B 4YK4C 1U8IA 4MJIE 4NZRH 4PWEA 3X1BA 2XSKA 4CC0A 3G6JE 1GGIH 4Y0GA 4P46C 4QO1A 1U93A 2GSIA 4PS7A 1QRNB 4MX7B 1RZ7H 4HOZA 5K9OB 4CSZA 2IAMD 4ONFH 2EEFA 5BOZG 2ZWKA 2PWFA 1UB5B 3KYNA 5FYLL 5A2IH 1KGJA 2VDMH 1MCWW 2VIRB 1UM5L 5CEZE 3DV6B 2J8UF 3U4BH 3QIBD 2Z65C 4S11A 5F96H 3MLUH 1KZYA 4OLXL 3ECVA 5EU5B 1EVUA 2AABH 4X9BA 1EEYB 3T0WA 1SF3A 1DBML 1XGYH 3D3VE 5D8JL 4LEOB 1IU1A 1M2VA 3ECUA 4JL1A 4OZFH 1KTCA 1G0DA 3HNTH 5ITBH 3QIWD 3SGKA 1KIQB 5IROC 2IGFL 4O02B 3SE6A 3A23A 1A66A 5JR1L 3FYEB 1K6QH 4G7QB 5FWQA 4XCFH 4L37A 3VE0A 1UXLA 3GS4A 4R9HA 4UT6L 1NGQL 2J4WL 3ULAB 1YEGL 1OPGL 2R0WL 3MRBA 4PJAA 5EOQH 5KUMA 1N59A 2FX7H 3AITA 1DCLA 1EEZA 4HU2A 4OGAC 4AM0B 2AXFB 5ETUA 3A4AA 5A2FA 1L9QA 4PFEA 4W4OC 5EDSA 4WFGD 2CM5A 2YR3A 1F58L 3QDGB 5EOCH 1KXVA 3ATEA 1KELL 2YK1L 2JB6A 4NZTH 5IFAH 3SJVE 4U1GB 4PJXE 1N5YL 3E1F1 2FJSA 5BQ7B 2O1AA 4PLJD 3IMTA 4BFOA 2HN7A 1FHGA 5CKAA 1NAKL 1YEWA 4N2FA 3LB6C 3ZDYF 3RIKA 4FF9A 3N0PB 4H20L 1KB9J 3WHE1 3D85A 4YFEA 5LG6A 4YEFA 4FERA 3DJ9A 1SHXA 3ZKXB 4R4BB 2YGVA 4OB5L 1CE1H 1CF8H 5K9QG 3DYPA 2AI0L 4ONGH 1E5CA 4RQQA 5ANMA 3NGBC 5D1XC 4BELD 2BSCA 1JD9A 1O0VA 1IILE 3O45B 2K8QA 1J10A 4I3SL 4B3EA 2IH3A 3WY2A 4HIEB 1FDLH 1NOLA 1IFGA 2V2WA 4TULL 1KELH 2EEAA 1N5YH 4XN2A 1KTLB 4XNAA 4PJEF 2QQQA 2ZSWB 2NXZB 4HETA 3APFA 5EORH 4Z7WB 2A6JA 5FO7A 3TJHD 1E5AA 2BWDA 1AFVL 2VQ4A 2XNAA 4LU5L 5HYSG 4EAEA 3CTTA 1PY0A 2BWIA 4OZFG 4XCEB 3U0TA 2EVGA 2IWFA 5EF1A 7PAZA 4MD5A 2I25N 4OJDH 4S2SB 1CF1A 1X4YA 5C08A 3EHBD 4TSAL 4N0UB 4RLDA 3UJIH 1FAKT 5LJYH 2XFXA 1IB5A 4PHXA 3PAUA 2ITEA 2H7WA 1SM3H 3H0TB 5I6NA 4G5ZL 5MI0C 1DVXA 1XGPA 2XVGA 1NJ9A 5INDB 4Z3IA 3ARED 2EXWC 1TLMA 3ISRA 1A3LL 3V0WH 4PJGF 3O3DB 4YSPA 5E51A 3GXPA 1EFQA 2IDCA 1TENA 3PY9A 3ZO9A 3BRGC 2VRAA 3AM8A 5IG7B 1KJVA 3RWJA 1TO5A 4OLEA 3OKEB 3SDYH 2OI9B 4PJHF 3ULVF 3AT9A 4K3EL 4M5SA 5BRZA 2IXQB 3US1A 3SKNA 2NZ9D 1IRAY 1J9RA 2XWTB 1ZDQA 4X7DC 2YJLA 2CO6B 3PQYB 3IWVA 4K3EH 3ZL4H 4HPYL 1TSHA 4LDCA 3GSUB 5DVOA 2EQDA 1E4XL 1QSZA 4PRPE 2COVD 2YD1A 1R3JA 2R1WB 2CA4A 1FRGL 1P6WA 2ZG2A 1HL4A 3GPEA 4MDJA 5D2LE 1KB5H 2EIJB 4CVZB 2DQCL 4KZ0A 1A6TA 1ZT4B 4LLVB 4NZRL 3DDFA 1GMEA 3BEVB 3HG1D 2RAMA 4LSUL 1EVTC 3F01A 1JE6A 1BLIA 3RVTC 4ACPA 5CBAA 3MV8B 4NN5C 1AGDB 4I18B 1TZIB 2PWDA 3HZ3A 1HKFA 1Q0XH 3SGJC 3PWPA 5D1QA 1T20B 1NKRA 1NJ9B 4DUVA 2AJYL 4HIIB 4F1SA 3SOBL 3CVHB 1LYQA 4M48H 5FA3B 3U9UB 3V2AR 1FH2A 2K4WA 2EIMB 5F1NA 3PL6A 4X7TA 3V8CA 4NBZB 3KPOA 3T1FA 2ATAA 4YHYB 1NIEA 2XXFA 4WY7H 2VDOL 4G8EB 3JTTA 4M4RB 2C9AA 3D30A 4UBDD 4M7LT 3WAKA 1W8OA 1I9JL 4H8HA 1MAML 1U92B 3GMMA 5ITBL 3IXTA 2P7TB 1A6ZA 2C26A 3RGVC 1IEBB 25C8H 2JXMB 3SE8H 1TQWA 3VI4F 5E6RB 3S3CB 4PEEA 3VTMA 3HZMA 2AABL 4WI8A 3SDAA 3VRIB 1JD7A 2HX8A 1X6NA 5T1LD 5I73C 2VN3A 3N0AA 1UG9A 2KI6A 2WQXA 1MHEB 1JP5A 3PJSA 3M1BA 3MGOB 4XCCL 3ZHLA 5J12B 4YNYB 5C08D 1I1YB 1M1XB 1B2YA 2BW4A 3N9GL 5HPMA 3HR6A 1Y6NR 4ZXBA 2UXFA 1KGWA 1F3JA 4X8JB 1A21A 1N4XL 4HZ1A 3VQLA 4DPBX 3CPLB 3OX8A 3HBQA 4QOKB 1OT4A 1JXJA 3KWWA 1DBJL 2ETWA 3TEXA 4CBZA 4ZS6D 5ICZA 2OR9L 5I0DA 1B9ZA 4F8LA 1JNJA 2EC9U 5T3XD 1FJ1B 4YOKA 3S36L 4ZFQA 1HAUA 3Q05A 2XV0A 1BBDL 2ZXDA 2XU9A 2BCMA 2E9IA 5IB3A 2WXOA 1O9WA 4N25A 1JK8A 2PCXA 3QAZC 4MNQB 4WI2A 4PRAB 1KEMH 4JJHA 5E5MA 3QA3A 5DZ9A 5KSBB 4HV8A 4X0KB 2XWDA 3D4ZA 3KJ4B 4NC1E 2EDTA 5DMIH 5DGQA 3BSZH 1UXWA 3GMPB 4FG6D 3CWGA 2HVJB 4ODBD 4X5XB 4ZD3L 2P8PA 1SEBA 2ZNXA 3EG9B 3EFFB 2EDQA 3FQ4A 4LKXA 1H6FA 4I89A 3C60A 2IDQA 4ZUTB 5IMKB 4PLKC 1WEJH 2P5EA 2VLRA 2YPLD 4YEEA 1U8QB 3BPNB 4YXKL 2PP9A 3N9GH 1RULH 3FULA 5CU5A 2J44A 1G6RA 3B2UD 3WMPA 5D2NA 2EXSA 4ZW5A 5CGMA 5JA8B 3QS2A 1AQMA 2V7HA 1F45A 3ARGA 1PQZB 3NSCA 3RTQC 1R24A 3P54A 1U0QA 2UYLB 4JFEA 4HJEA 3HRPA 4XGZA 4X6FA 4P5SA 3SBWA 3QFJD 3VXSE 1DSFH 2HTLD 3VWJB 3I3DA 4NNXB 3CFDB 2A9MH 4YPGB 2HKAA 3VG0H 2ADIB 2EH8L 1S3KL 2J25A 2IC2A 4R2GD 3ISWA 4JMXA 2IAND 2UWEF 5B7EA 5CSBA 3ISYA 3DO7B 4A7GF 2D3NA 1UB5A 1QAWA 2WD0A 1E30A 3FPYA 1RUQH 1UC6A 3FU7B 5GGVL 3VA6A 4Y4FB 3RWDA 3BYYA 1C5CL 4XWGL 5FYKL 5DF0A 3FBKA 4LQ1A 5EC2B 3P0YL 3TZVA 4U7KA 1TNNA 3N42F 4F8NA 1NAML 3BH8B 4JEGB 4R8WH 1WICA 2BSRB 4OLYL 4FLHA 1E6OH 3JV4B 3RWDB 5C07D 5AFAA 3VI4B 5LGHH 2IH3B 4AMWA 5BO0D 5EBLB 3QEQD 1DVYA 2HJFB 4O51A 1XGRA 2Z31A 3CFJB 4JS7A 2EVIA 3ZYIA 4J3XA 1MW3A 2BNQB 2W38A 1OAUL 3K1KC 5A7BA 1PCXA 3BCFA 2OSLA 2PYEB 2F7PA 2GUOA 1JDCA 3KLDA 4NZUL 4UYPA 4F2MA 5HJ3B 1YEHL 2PTTA 1HOEA 3ATDA 1SHSA 1QFWH 4KROC 3RWFA 1OD7A 1BYOA 4BFIA 2G5BB 5BS0E 2EIDA 3QUYC 4P49A 3BGFC 1J1XL 1OQXA 5I8EA 4YGVA 5IB5A 1HL9A 3K6SB 3JWDH 2Y07H 4HCRL 1KCSL 2BCKB 3B7SA 2DQFB 2MNJB 4F5CE 1MRFH 2B20A 4Z7VE 3AU1B 5FO9A 3WTXA 2WO3B 3T6WA 4NI6A 4XPTH 5JHLL 3BKJH 1NC4A 3GXUB 3OKDB 4ZAKB 3OWRA 2WNXA 2XDHA 1DL7L 1R9FA 1GKEA 1M7DA 1DTUA 2Y3NA 4EOWH 4ESKA 1SMAA 4L18A 4EO5A 2LTQB 4JVWA 3TNNA 4FHKA 4N1HB 2H32B 3ETBF 4MJ5B 1MRCL 1O75A 3H4HA 3VACA 4KFMA 3DVIA 4L8DB 2QGBA 3UAFA 1CL7L 1NBZB 5CCKL 4P5KB 5C0IA 4OT1H 5C71A 1BJMA 2HG5A 3BKYL 1XCXA 5GRUH 4QT5B 5DC2A 1GC1L 3WEBA 4FKHA 5GGRY 4AVKA 3KLAB 3ETBJ 1J12A 2VC2L 5F8RC 5GGSA 1UUSA 2DLEA 3EOAA 3EH2A 1FYTA 4MVBC 2HLAB 2PXYA 5HDBB 1A9VA 2Q0ZX 3F7YA 4PJXA 2H3NA 1T2JA 2J2ZA 3MOAL 5FHAH 4Z7OE 4X50A 2V5TA 3FO9B 2IGLA 1HS6A 3UTTE 3ILQD 4A7UA 3OM3B 1R75A 5GPRA 2CUMA 3NABH 4OGYL 3M7OA 1E3FA 3DIFA 1Y0LB 3MJ8B 3VFOB 5KVEL 2K7PA 3ARBA 3FCSA 4DT2A 5JZ7D 4N28A 1KN4L 3V0VB 3OMNB 4QYOA 5SWSD 5IIEB 3CC5B 1DANU 2MJWA 3OD3A 4OLWL 4QHNB 4Y8DC 4ONOA 3T1WA 5LCVH 3AZUA 3RB5A 2Q6WB 5I16A 3UYPB 3ZIYA 3F85A 4JKKA 4NHUB 5B8CB 3IK2A 1IEBA 5L2JA 3EGDA 2NXZC 2ODHA 4JY6B 4R4NC 1N64H 4NO0A 2WZ0A 4OCXL 1ED3A 4R0LB 1PY4A 5GRYA 3VXMD 4E0RB 3BP4B 4G6JH 4U33A 4DESA 5DUPL 4R90L 1D6EA 4N3TA 4N24A 3K4DA 1J8HE 2NTSP 2CDEA 3QS3A 4J28A 1DJHA 3L3DB 5JOPD 1AC6A 4X4YB 1I4FA 2TRYA 3HI6L 2O26U 3RWHA 3QYNA 2MTPA 1FG2A 1N10A 2PXYD 2BERA 2NQ3A 4JFDB 3LIZH 5AVVB 4UT9H 5SWQB 2XVBA 4FADA 3S8WA 4PG9B 3IMUA 1ADQL 4Y4KB 5DZOA 4GRLC 4J4PD 5IQ9A 3U4BL 4NAJA 4APXB 1XF3B 4OR1A 5G2NA 5HPOA 3M6DA 3W57A 3A6CH 3DBXA 1X5JA 2BVEA 2L7UA 5GRXG 3UYPA 2UY7A 5C0RL 4FNLL 2BNRE 2DEYX 2DQGL 4ISVB 5AG9A 5I9QC 1V05A 4IHOA 3GSUA 4AV4A 1HNGA 4OQTL 3O4LE 4M4RA 2D0HA 4F9PC 3BAEH 2BRRL 5EBMA 3AREB 2F53B 4JFHE 5KS9B 2N0MA 4BQCA 2DKUA 1HHKB 4XAKD 1HU8A 2O5XH 3MVSA 5I28A 5CINL 4BSWA 3FQWA 1CQKA 4ZW6A 1RZ7L 3VD1A 3QK0A 3NRPA 5F0PB 2R0ZL 3ZDXF 2WXMA 3PWVB 5DZLA 3MBEA 1B4TA 1LEIA 1MF2H 4GFXA 1CFMA 4NQUA 4K7PY 4JHVA 4IJTA 3G08B 4XMLL 1KTDB 4AYGA 4BCXA 4PGJA 1OF0A 3MLTA 4JJ5A 1Q1JH 1WDAA 3GBLA 3LEXB 2W0FB 4PRNB 3T2QA 3TWCH 1V7NL 4W9ZA 1C08B 5HP5A 1BPVA 3O6MH 2BOBA 1KLUA 2EZ0C 3AM8C 4GI8A 1ETZA 2IALB 4KC3B 4OIFA 3E2HC 3QQ4B 5JHMA 3A6BH 3FFOA 3RP1A 1ZVSA 5IHUH 2GK0A 4X0KA 3BHBA 5D5MA 5J6GA 2V33A 3OZKA 4ONGL 2QPEB 3KXFB 4XN1A 1LO2L 2BH0A 2Y69B 4LCCA 5HI5C 2B1OA 3VI3B 2FSDA 3PLYA 1MIEL 4ADGA 1OALA 1IMHC 3SCMC 4NKMA 4XNZB 3DUUB 3S34L 4YDIH 4E9YA 2DH2A 4M56A 4AGPA 2YOCA 1HK6A 4MSWB 3L2LA 5BCAA 1J5OL 1LEIB 1T83C 4FTVE 3HBGA 3IMSA 3CDZB 2RIKA 2PTTB 1HEZA 4F37K 3RWFB 1VJSA 5DZAA 1CGWA 4NQEE 1G7JA 4DIXA 1NCTA 4E9XA 5DVNA 1IZKA 2Z3FA 4NQQA 1IGTB 3BWUF 1NBVL 1UB6A 1F4XH 4FA8A 4ELDA 2XVLA 4FULA 4PWIA 1NANI 1R1CA 2TRHA 5KW9H 1ITBB 2IQ9H 4JPIB 5KBMA 1VFMA 1S7TB 3WNIA 3JZ7A 4NQED 2K6YA 2ZXBA 3V95A 2BHFA 3HTLX 4KAQH 4M7LL 1M7DB 1U4EA 2A0LC 2G2RB 3WG7B 5EU3B 1E67A 5DEFB 2KPWA 1N3NA 1O6SB 5LBSA 3MRJB 4WGKA 5IW1A 5IFJB 4NDMB 2X89A 4X9FA 5DRZA 5SWSE 3GDBA 2ORBH 1OP3K 1Q9OA 3HS9A 2HWZL 4ELMF 2VQ1A 5JIHA 3SBPA 1XF2A 2LU3A 3VFMB 3P9LA 2GJ6B 2YD4A 3OL2A 5CLYA 5CNHA 1GHFL 1NGXA 3O2DL 4H8VA 4TVSa 3OKMB 1JPTH 3S5ZA 4MSWA 3QXDA 1BYNA 3VFGL 4AQAB 3LTVA 4PP1D 4EI5A 2GJ6A 2NTFA 4BWTA 4LOUD 5TQ2H 1K4CB 1QFUL 2Y2YA 2IAMB 3U79A 2WZ6A 1QFWI 1GVIA 1HFUA 5F3FA 1DVFD 1ZVYA 2H3XC 3QUZD 3L16A 4HQQL 3QHZH 4M3JA 4XMUA 5HHNB 3DHJA 5CCJA 1BMGA 2QQLL 4YFDB 5ERWB 1B0GA 3IKCB 3DK2A 1ZLEA 5KJ7E 2G5BA 2IFFH 4B9IA 1YYML 1Z2KA 1KTRL 5FGRA 4P2QA 4I85A 2WBJC 2YPVL 2AKRB 5GZNA 4HOXA 4HJ0C 4PLKD 1MOEA 5H2BB 5JW3L 4Y4KC 1D5ZA 3FTXA 1OTUD 1FFNA 2FBJL 4FNRA 2YXVA 2HMID 2BJMH 4QAWA 5HI3C 5IFJA 2EILB 1OGTB 1CQYA 3W82A 4N5EC 4UCFA 4CSPA 5BV7L 4U1MB 3X14A 2CHXA 1H9DA 3CVHH 4B41A 3MJ6A 1A7PH 1XCTB 5CWSB 4AYBA 5I6XB 4ZTOL 4FQ2L 4PY7A 4POUB 4U6VL 5DQDH 5BS0A 2YOAA 3MSPA 5AW7B 3K2IA 4X6EB 4AK1A 2NTFB 4RAVA 3U2JA 2YGPA 1XXFC 2BS71 3WSQH 3EOTH 5IQLA 3VVVA 4XODA 4IBSA 2ZWSA 5EZJA 3F7QA 1MFCL 3ARGD 4QTIH 2OXHA 3LV3A 2IANE 4KNTA 3VDBA 2AJUL 5L2KD 1ZXKA 4Z78B 3QAQA 3AS3A 1WWCA 5HTSA 4DPCX 4YE4L 3ARPA 2YEQA 3PL6C 2HT2C 2CGRL 1ZSDB 3FBQA 2G3XA 3IDXL 4EUPB 4XP4H 5GS0H 4MCZB 3B56A 2CBMA 3OHXA 4K7FA 5AB0A 3VD9A 2JKTM 1E8YA 4MKTA 1PKQB 3VB8A 4OJFH 3PWLB 5GS2H 1U8KB 4FDWA 3KYKL 1UQSB 1OLZA 4ZSOA 1F4YH 2PETA 5I9QB 3OHXC 3JUYA 1NOFA 5F7FA 4ZX5A 3KYAA 1OW0C 4JGJA 5CD3A 1IARB 2ZYSA 1JXFA 1WFUA 1QA9B 3MOAH 4MS8D 4OF0A 4HCRA 1GC1H 2XN9A 1XB3A 2B8OT 3FAWA 1CDJA 1MVFA 4LRNH 1CGXA 4U6HA 5FGCE 3UBXA 4BH7A 4C83B 2XZZA 5DJAA 2DM7A 5IQ7H 2PXYB 4CGUB 2VDLH 4BE6A 3CLEH 4LLMB 4K55A 1DANT 4YZFF 5I0VA 3V79C 3MBWA 1KJ2B 3PFQA 1MRCH 3NN8A 3CCHA 4F7PB 3FO9A 2BVQA 1XZ0B 4D2NA 2QQLH 1WD8A 1MCQA 2RCSH 1WWAX 3IAQA 2X1QA 3BP4A 2X4PB 3MBWB 3U36B 3T4AB 4NZ8A 4ZNEA 1Y18A 2KMWA 2AJXH 1W0VA 3WXWH 2MCAA 4ZMWA 4TUUA 5E2VH 1WA0X 4NCC2 2W5PA 3ARFC 1MCSA 3RWGB 2HPOA 2J3SA 2X89D 3CC5A 4LSTH 5DMJB 3O9WA 3X12A 3KXFE 2K4AA 5ICUA 3WIHH 2WWKT 1O5PA 4JG9A 4K8RD 4D8PA 1YEFL 1G4RA 4FLQA 3HB3D 1JWUA 4IRJC 3PGFL 4DOHE 1OTUC 3KPRD 2ORBL 1ES0A 3W11D 1A7OL 1CWVA 1IGJB 1PDKA 1WZMA 2NY3D 3UBHA 1IT9H 2VXTH 1S7VB 2EACA 4IKIA 4KRPB 4R5XA 3T6VA 1CTOA 2BOLA 1AQ8A 3JWDC 1I1AC 4AH2A 2CJSA 2VERA 3J07A 4TS6A 3DETC 2GJZA 1WWBX 4C56B 5HYEA 4M8QA 1AR2A 2IAAC 4MB5A 3DTXA 2DIJA 1GIGL 3AGVA 4IHBA 4G1EA 2Y72A 3VD3A 3BAIA 1OF2B 2CJ3A 5G5DA 5FUCC 1CFQB 1SXAA 4BKTC 3BMVA 4KO7A 5DWUH 5IESH 2QQNL 3OGOE 5T3XH 5CN1A 2VMFA 3MJGX 1DQDL 4QJ3B 2ZXEB 1ZCRA 4GQQA 1Y6KR 1JFHA 3FQUB 3W11C 4GP8B 1QSFB 2X4NA 3KCPA 3GSNA 4HQQH 3UTZA 3RGVB 3FAXA 4M5TA 5HD8C 2ZOOA 1N0XL 4KVPA 2PF6A 4CW1B 1W6WA 3HZKA 5DEFA 4I3RH 5I1GH 2F53D 3PWUA 3UTQA 5IJVB 4LEBA 1YEDA 2QADC 3DXAB 1J8RA 5DJ6A 2J72A 2OLDA 2ICEB 1OHZA 2BXZA 3UMNA 4GEIA 1P7BA 3QULB 2CJUL 3V4UL 3X3GL 1OW0A 2HT4D 4ORGB 3ZKSD 5E9AA 3L5XH 4X4KA 4I0PA 1A64A 3SDYL 1HZHL 4NO2A 4X6BA 4JY4A 5E5RB 4G6FD 4JBSA 4Z3JA 1G0YR 4IOFD 5DEGA 3IRCA 1DSYA 4DKTA 3BUYA 3UJJH 3ELQA 2X4UB 3JWOC 4KV5E 4F3FB 1ETA1 4NKMB 4NO2B 4W6YB 4A7TA 4RBPK 4JB9L 5C2BL 1SHWA 4KTEH 1M56B 2PTUA 4Y9CA 5HGBA 5EULV 3GMLA 4UIMA 1LJMA 4Q0XL 3N40P 2BNQD 2VN6A 1DVUA 1F4XL 5DRXB 3BSZL 3RRQA 1VAHA 3S36H 3QUYA 1U33A 4K9EH 5K1VA 4RGNE 4AEHL 4JHWL 5EORL 4BQ8A 3MRNA 1CGUA 5IHHA 4R7LA 2OTUB 5E8NB 3RQ3A 2WINB 5KVEE 4OV5A 4OCXH 3SYAA 2XN9D 3Q3GA 4MZIA 4PJBA 2ZICA 4XBEL 1JV5B 5L8KB 1XSIA 2ZE0A 4FX5A 2DQHL 4FFYL 32C2A 2LE9A 1X5KA 3EW3B 1DBBL 4H88L 4IKJA 3FUFA 3T2PA 5HHMD 3DX3A 1EBPA 2XOTA 1BXUA 2H4EA 3T2LA 3V6OA 1MNUL 2DWYA 2J55A 4Z7NB 3K80A 3VW3H 1MQKL 3W39A 3VVWA 1J9QA 2BDNL 3GBNL 1G7MA 2F15A 4JO5A 3PPEA 4LLAA 2LV4A 1TZHB 4JZJB 3E6FB 5LGYA 3ZYZA 5DZNA 4EQ3A 1ERNA 3V5DA 4IIQC 4PW4A 3KL3A 4YXLH 5EF2A 4RIRA 5HBBA 4K5OA 1MIMH 2VDLB 3BCDA 1TFHA 1HEHC 3VXRA 3QZWG 1OARL 2XLLA 3FB8B 2WB7A 4P4RA 3U46B 4IKLA 4QHMA 1I85A 2WINA 4ZMOA 4OV5B 4FJZA 3NFNB 4ZQTA 4I5BA 5IEHB 4GSDL 3RIFF 3KPNB 2E0PA 2V3EA 3SY0A 3U0PB 5EZLA 3MA9H 1FL5B 3QYMA 1IKOP 4UINL 3BQUB 3JWNG 4F9LA 4HUNB 1JGVL 3DPBA 5CJOL 1ZGLA 3JSSA 5ISZD 2P8MA 3WELA 2B39A 4OCRL 5A6LA 3Q6FB 1TT6A 4JRYE 4UV7H 3MJ7A 5FXCH 4BH8B 4GQRA 3UBGA 3D34A 1KV3A 3FUNA 5C7XL 4FI8A 4L3EA 5TJWK 3W39B 1UACH 3ESVF 3HCVA 1CBVH 4GW5A 3CX5J 2G9HB 1CXLA 2C1PA 4Z7WA 3MJ7B 1EK3A 2W0PA 4MJ2A 2AEPH 2LR4A 4WWID 1KCSH 5FLVA 5C0CB 2Q3AA 3ZL1A 4L2LA 3LDBB 1LMKA 2BNUA 4LL1A 4PAZA 5E4OA 2V3DA 1MUJB 3LKRA 3X1FA 5BZXA 1AKJA 5IJCC 2M1KA 2AAAA 2OYMA 1EZSA 5IOPB 2WBJB 2X4RB 5MP6L 2H32H 2G75B 1T21B 2RALA 3ZE1B 2EDNA 3QPQC 5FUZH 3DGCR 4LIQH 5IEHA 1UT9A 1LEGB 1T1XA 5J57B 3L9YA 1BQSA 4GB9A 4M1CC 4FFZL 4HDIB 2IPTL 4HK3J 2F74A 3MGTB 2YSSB 4K2UL 2W95A 4X9HA 1B90A 1C1EL 5GIRB 3ATAA 2FH6A 2OMTB 4N8CL 1E8XA 5E1GA 4ZAKC 3E0GA 4H8WH 4YHYC 3P0YH 1BBDH 2JELL 3HNSL 3LNFA 3NSXA 3QJQB 4MXWH 4XO9A 4XMPL 4KQ3L 2ICES 2FAUA 2JIXB 2WLMA 4KJPC 4HOMA 2NY4D 2O6PA 4BD4A 4P5TA 1WT5C 4I3GA 1T0NB 3JV6A 4JQVA 4AJVA 4WQOA 4X4ME 4J1UA 1MCJA 2FYYB 3OR7A 5T3ZH 4ODTL 5J3HD 1NDMB 4PIRF 5TPWH 2R8SL 3ZTCC 2XWRA 1U8JB 4YDJB 5FYLD 3ZYOA 2Z4QB 1MI5B 1E5YA 4N2AA 3QDMB 2XBDA 4M5ZL 1ADWA 3GSXA 1ZSDA 4OAWB 3D39D 4QXTB 2ZIDA 1RIHL 2CKBB 3N44B 5I1KL 4YUEH 1OT1A 5JO5B 3ARVA 2WY3B 4KGLA 1KCUL 4KKQA 3UYRH 1KENH 3FQUA 3UGUA 2FT8A 4KTGA 1NAKH 4QNPF 3MUUA 3HZYB 5HYFA 2BIIA 5LQBH 2H26A 3FDWA 1QEWB 2EVHA 1B4LA 1JGEB 2DMCA 3GI8H 2YK1H 3OC8A 2XY1A 4IRJD 5KYUA 4B3VA 5B3NA 3TT3L 4H8WL 1DVSA 3PABA 1W0WA 3GSRA 1MCKA 4MGXA 4MQXD 4OKVB 4N0CD 3E8UL 3OGCA 2CD0A 4XOEA 2E9JA 4XO5A 1RJCA 3K6IA 5JDSB 4M61A 4H25B 5DO8A 4KUZL 1PD6A 4WJ5A 3TM6A 4A2HA 3GSRB 3DOSB 5J6HB 1BP3B 1HYSC 5CCKH 1NLDH 1X5MA 1CR9H 1S7VA 4JANA 4DPRA 2FK9A 3LXUX 1A0QH 1PSKL 4L4TA 1M6UA 2OR9H 4BFJA 1I82A 4LSDA 5DURB 4G42A 1C12A 1VESA 4CVXB 1BFVL 1TKWA 1FGVH 3IDUA 1QSFE 2OJZL 2QGCA 4M29A 4JDEA 1I1CA 5MEQB 4MMZA 4Y19D 2J8OA 2OULB 1JYWA 3W56A 4PW9A 4ZRGA 4GMTH 2JJTA 5CEXA 4UOJA 2A9CA 1SQMA 3RNKB 2XWCA 4PRAA 5E2TH 5DD1H 5CJQL 2CQVA 4AEIH 1G43A 4Y1SA 1SDDB 3DECA 2VZSA 2WLZA 4HJUA 2BY1A 1PJ9A 1T03L 1YEHH 1PJWA 5LN4A 5T1LB 4WTZG 1FVEB 1WJ3A 4AL8H 2X3BA 4N8VG 5F2FA 4C56E 5D1QC 4UBDC 1KV7A 3NZSA 4TV3A 2C1OA 2N7SA 4NENB 3K91A 3O9WC 3K6NA 4JW3A 3C5ZA 3NH7L 4FTVD 4M61B 4EJ1C 4IK7A 1LP9F 4L1LA 5T1LA 2PUQT 4AYSA 3MI6A 3LIZL 3MA9L 4DEUA 2JQMA 1ROCA 4PJGE 5FAAA 2C1OB 1QLFB 2FBOJ 3OQ3B 2HT2D 3QUXA 5FW7A 4G80B 1A14L 3T3PB 3V0DA 3GLZA 1A9EB 1AGEB 1GIGH 1DE4B 4QO1B 4X6FB 4Z7AA 2B0SL 2JJTC 4RAUA 5CMAA 4XO4A 5KBLA 2EABA 4CNIB 1TQUA 2XIIA 1BOYA 3OC5A 5EPMA 1HH6A 4NFDA 3U0TB 1E27B 3IMRA 5KVFL 1D7BA 3CZUB 5FF6A 4CN4A 3M86A 4XVJL 3F3HA 4MZ2A 5GISH 1E5ZA 2GHZA 1URIA 4B0MM 1A4BA 2VZ3A 4PB0H 3CSTA 2NYZA 1Y1DA 4HUUB 1FIGH 1VFAB 3SQBA 3TNNB 4KMQA 1XX9C 2VDNH 3UG3A 2H9GB 3GTTA 4I7ZC 4HGWB 4GKSB 5J7CC 3O45A 2XVKA 3IDNB 4PR5A 3BFQG 4ZMZA 3TZVB 3NFPB 4U31A 1KN2L 3LZRA 4XOCA 4GEJA 1I7TA 3SDXB 5I19L 1QWHA 1DJGA 1KN4H 3SE4A 3PQYD 1YY8B 4KOCA 4XVTH 5AVUB 3V9FA 5IQOA 1CN4A 3QIBB 4ZMVA 3NFPA 5KVDE 3QNZB 3AWEA 4PMFA 3ZQWA 4WEMB 5HHOA 1AHWA 5F70A 1CT8B 3ZW3A 2G4EA 5F7KC 3V0HA 3O6ML 1VGKA 4Y5VA 2A6DB 4S2SA 1R3JB 1ZK9A 4FG2A 3ZTNL 3GPSA 3OJDB 4FQ1H 5ABDE 4ZXBC 2F54A 1XMEB 3BFWA 4FNSA 2JELH 3HNSH 4MXWL 1TVBB 3LN5B 3QRGL 4P4KB 4GXVH 4DGIL 5H37H 5DSCA 1O9VA 4MDIA 4LLWB 1KYUA 1WFIA 2WQSA 2FYVA 3MUHL 4POYA 4JAMB 1WAPA 3EJYD 2R0KL 4PREA 2E75C 2DM2A 3QEGL 2GB2A 1B4JH 3MRNB 4KDTA 3LZNA 4OT1L 1EV2E 5F88A 5LAXA 4LNRB 2JF1A 4ZAKA 1QQDA 3SKMA 1FORL 1L0PA 4DKDC 2P5WE 5JHDE 5I16B 5KVGE 3SD5A 3UH8A 1B2WL 4F92B 3D2UD 3V4VH 3ZE0E 3BMWA 1FDLL 4NCDA 3L4YA 2GEQA 3QFDB 5KANI 3IFNH 3MUJA 5DD6A 1WA2X 2MCMA 1JDDA 3PDOB 1MRDH 1UVQA 1Q9LB 4PI2A 4ZUSB 1YAZA 5K9QI 2WLLA 2OXGA 3E6HB 2YSSA 4B5ZA 2A74A 4I77L 4FEMA 1RZIA 3O2VH 4PB9H 1AO7A 3L4XA 3WU1A 1TIUA 5BVPL 3NPZB 1NOAA 4M8UA 1SJVA 3GMNA 1A6TB 1ZT4A 2XXCB 3WCYA 1MFCH 1M71A 4PJ5E 5F9JB 4ZQKA 3O41B 5GGVY 1QFWL 5JZ7C 3MNVA 1OP4A 5I1DB 5IHBA 1SM3L 4E9WA 4D0BB 4XN4A 2V6HA 2WZ5A 1FUNA 1IGML 4F7CA 4MAUL 2ENJA 2ATKA 1MCPH 3FQRB 4ZXBB 3QFGA 1WC7B 2VW6A 3TU6A 5SX5K 4RGOH 1J5HA 1Z3RA 3QZPA 1WYJA 3CMOL 4JFXB 2WLIA 2NY5H 5DK0B 3ARWA 3ROLA 4AT6B 1AZZC 4G71B 2KS0A 3GSOA 3IPBA 1ZJAA 1OTSC 1FE8L 4O00A 5D9SA 3NCJL 3IJYB 1A6ZB 1ZT7B 4TVPE 4DN4H 4GW1B 1BJ1J 2IH1B 3NACL 4UM9B 2J8HA 2X6AA 1C5CH 4L3EE 3ASNB 4KH2A 1VDGA 2WLLB 1ASPA 3THMH 3WUWG 1M57B 2ALWA 1YPZE 5EWIL 4XO8A 1M3IA 3WMQA 4B97A 5F1NB 2HVKA 3I2CL 4TUOA 2R7EA 4R2GC 3RDTB 1T0MB 4YIQB 1AQDB 4MZRA 5SX5H 1RPKA 3HR5A 4Y5YA 2FATH 2H8PB 4M6NH 4AQOA 2WGXA 3I3EA 1LWRA 5CLTA 5CCHE 1IM3B 5D7LD 1YVLA 3EO9H 1ID2A 2Q3XA 1GW6A 1ZRUA 1U58B 4QY8A 1HSBA 5HDQL 1YN7B 1U8OB 3ZLQC 2PO6B 1R3HA 5AYUL 1ET7A 3GKWH 3QDGE 4WSJA 4LVHB 1NEPA 1X7QA 1FGVL 3DSNB 2WBJA 2HPTA 3WOVA 4WFFD 5JNYB 3KBFA 5E8PA 4HBCL 3V5HB 4AT6A 2VLJD 4XBEH 2UWEB 4LHUB 4PJIE 1CGYA 1TZGL 2ZCLL 3ZN6A 3WE1A 4LSRL 2QZQA 5F7BA 1M7UA 1OTTD 4M1GH 4N8CH 5TDNB 4I87A 2Y1AA 3PL6B 5IQ9B 4UDTA 3F7LA 3O4LD 3NUKA 4U1KA 3Q06A 3H1ZA 3NQKA 2ICWA 4JPVH 3WKYA 1MCOH 1OAZL 4Z0XB 1U3HD 2P24B 4Y4FA 1RZFL 4EI5C 2JK5A 2DJ4A 2NW3A 2XUWA 3B7YA 3QEQA 2OQJA 3RZWA 3QXWA 4KKAC 3S48A 1N26A 4G1MA 4FQCH 4RMWA 1QEWA 2ICWB 1A6AA 5IF0A 5FUZL 2YEZA 4JRLA 5D96B 4B95C 4BZ1L 4PRIB 1QWUA 1T4KB 2GI7A 1R24B 2WYHA 5L4JA 3X13B 4FXKA 3VA2C 4L0PB 2HLEB 2UY6B 1AANA 1CLYL 1QRNA 1UKSA 4UV4H 1E65A 4OV6F 4NPJA 4ZTPH 1YQVH 4JO3H 3MLPA 2AVGA 3GSWA 5T5NF 4ZO7A 1MCEA 5IMMA 3MROA 4UTBH 1X7QB 2WV3A 4AW7A 4YWGH 4XCNB 1HHHA 4YHLH 3BFOA 5AWNH 4M3KB 3EO1B 4IRZH 1MSPA 2YD3A 1HH6B 1BHGA 3OKNB 4I88A 1J1XH 1AD0A 3L7FB 4JM2D 3PAVA 3VXUB 2G5RA 1P1VA 3UTSB 5DQ9B 4HHAB 1FFPB 3QFJA 3RA7H 1G1CA 2CUAA 1KY7A 5K39B 3KWUA 1QHPA 4HUVB 3MHZA 1ZTXH 3B8YA 2BSEA 3P4NB 5AKSA 4PJ7B 4GRLB 5B38G 3GRWH 1CFSB 3KL0A 3VFNB 1HCFX 2V9TA 5F6IB 1IO4C 3OLGA 3A5VA 4WV1C 4HUVA 4HUMB 1BZ9B 3FB6A 4PJAE 3SE3A 3QT2A 3BLBA 3DVFA 4H25A 3L3OC 2EXYC 3OKMA 2EKSB 5CP3A 1T1YA 3MLSL 2FTAA 3FKUS 2FX8L 4L1TA 1NBZA 1IKNC 1NDTA 1ZMYA 4FG6C 4YXHH 5HD8D 1EEZB 4BSVA 4XMVA 4GAGH 4AJYV 2IGFH 4N8VA 4PGDB 1NCWH 4YMPA 2V7HB 5IBLC 5E8EA 2WTRA 2ADGA 2OZNA 3QI9B 5IMMB 1AY1L 3FFDB 5DTFB 1UGNA 1MFBH 5SWZB 3H6JA 4KMTH 2WBKA 2I69A 3D39B 4UM8A 2F0CA 3SSGA 3LS4L 3VUAA 1TKWB 4P8QA 3FHEA 5D5ME 1VF5C 4HK3N 4XP6L 4PJ9A 1M05A 1MI5D 2F1EA 3MLWH 1L0QA 3EJJX 1A3QA 5IREA 1KGXA 1DN0A 4QRTA 3TBBA 2R27A 5I2IA 2YA1A 3CFIC 3GZPA 3PDDA 1YNLL 2G5UA 2YN3A 3ROOB 4KRNA 3WIIH 2AQPA 4XVUD 1RD6A 4HIXH 5AKVA 3P4NA 3D52A 3V10A 3HG5A 2DQHH 1JVKA 3QIWC 3O2DH 1R47A 4HUKB 4XWOC 3QWNA 5H35B 4J3TA 4EZKA 5GZNC 3QG6B 5LKNA 3K8KA 3B2XA 4XXDA 3HKFA 3VFRB 2ZXAA 3C5ZB 3QIUC 5EU7E 1N0LB 4AZ8A 1KNOA 5C3TA 3GJFK 1YN6B 4N0UE 1ZD6A 3S37L 5EBWB 4GO9A 4JPSA 3ARBC 1L3WA 3G5XA 2X70A 2XNAB 2HLAA 1IIKA 2J1ZA 3T6QC 1ZLSH 3AT0A 3L3OB 3RX9A 4HUXB 3CU1A 3MRRA 4PJ9C 5KBDA 3I6KB 3DUSA 4QJ4B 3MRBB 1JF5A 2JJSA 2NY7H 4FP8H 4KI1A 2FEEI 2H6PA 3NJHA 4NJAL 3ARFA 2P47B 3O41A 4F15B 1XR9A 3N5AA 2P4AB 4Y19E 4PJ9B 1SLVA 2WUBH 2M2DA 3NTCH 2NZ1A 5AZEL 3T8XB 2YA0A 4GINA 4NZDA 3MLVH 3WFEH 3FU8A 3CHRA 2YRLA 2OR8A 4XPBH 4HW6A 1ONQB 1OSPL 5EO1B 5INDA 4GI9A 1OSYA 3LJ3A 3UZQB 1D5MB 4HALA 4RWYH 3WNOA 3F04A 5IIEA 4P4KC 4P9ML 4LF3A 4GAYA 1T2QL 4KY1H 3RLSA 3T71A 2NY1C 1NC2D 2YGOA 2Y6TE 3MBXL 4FA7B 4IYKA 4HC1H 2E8ZA 1ZJBA 3L5IA 4Q52A 4PRPA 4Z3HA 1KCUH 3EH3B 2XX0A 5T33H 4MS8C 4WJG3 2YA2A 3QJOA 1QQDB 3FTGA 5DQJA 1MXDA 4ZMXA 3O3DA 4I0KA 1JHTB 4WW2B 2V9UA 1BF2A 3SJVB 5A16A 2QSTA 4JG0L 3ZHFA 1A2YB 2WQVA 2JKJA 4Z95L 5KTEL 5E1AA 5IB2B 3TS8A 1I9JH 2EVJA 3ABMB 2RR3A 4AUJA 2R2EA 4TOYH 2YZ8A 4LLVA 3KLAA 2F8OA 4IMKC 2Z0UA 1B88A 4QYAA 1EHLH 3WNNA 2F54B 3ZGHA 4ZMQA 4KX8A 5JHLA 3HS0C 3PXJA 5JQHC 3AG1B 4HX1B 3WGVB 1VB9A 2DWDA 1UZ6F 4M5YL 1AZVA 1IM9B 2XN1A 4Z77B 1PZ3A 1S5IL 1TETL 1HIML 2HRHA 4OF3A 2OXHB 3ARDB 5EG6C 5FA3A 2QR0B 3BIKB 2W9EL 1IM9A 4Z77A 4QRAA 3GB7A 2Q7YB 1AS8A 2IO5A 1U2HA 4KXZH 2A4ZA 4JZNB 3RILA 3BPCB 4WV1B 5C7ZA 2ED8A 4Q14A 3SKJH 3C75A 3BVTA 4P2RB 2FSEB 1AGDA 2JKWA 2XG5A 1DFBL 4AMKL 4X4YA 3DX0A 2EUWA 2VL4A 4PY8I 3QARA 1JAEA 3FQXB 4NIKB 1BQHB 3KPMA 4KDVA 4PRHD 2ZUQC 3TVMB 3VFVB 3FUHA 4N5ED 4QHLB 5KZCD 4UQ9A 1M6OB 4Q9QH 1IC7H 4UQAA 4TYUA 4CJ1A 1ZSHA 4K94H 1KIPB 3LNGA 3C60B 5FYLH 4TLTA 1E7VA 5BVJB 2BX5A 1OCWH 1D6VH 1F3JB 1JZFA 1LWHA 2AV1A 3BVNA 1IC7L 2W9DL 4NQDA 5IEKB 5HGDA 1GPOH 1MCDA 5EU4B 3HOGA 5I1HL 2Y7QB 1URZA 3F2LA 4G6KH 2EDMA 4UZGA 3H9YA 3WJMB 1I1FB 4K3GA 3FUEA 5TGBB 1U4FA 4Z7QB 3S3JA 4XP1L 4A7QA 3LS4H 1YDPB 1VCAA 4LRIA 1Z6JT 4NRYA 1JCKA 5AAWC 3SPVB 4F80A 5DJ8B 2G60H 1E9OB 2YMOA 2XT1B 4MNQA 1HSBB 1TEYA 1S6NA 1AOHA 3K4ZA 1LXMA 3B9EA 3ZX1A 5DJDB 5J4MA 1J8SA 3D3VB 2GYSA 2ZPKH 5JMOC 4OF8A 4RRPM 3MRCB 1KIRA 4GG6A 3KPRE 2BZCA 1PZUB 2NY1B 3NCFB 4Q8BA 2BP3A 5DJDA 3G5YA 3GBDA 5EN3A 2HFGL 4WAFA 2NCEA 5L4FA 1ZVNA 1LO5B 2C3HA 5KVDH 5KYWB 1SLUA 1WLHA 4O2CB 3WLWC 5FW6A 4RGOL 1Z5YD 2BOCB 5L9DL 2ZUSA 2X9ZA 2NY2B 3KNBB 1DUZB 4FZEL 4PUBH 4X6BB 1NLBH 1XCQB 3PAYA 4MLSA 5EZIL 4WEBH 1BQKA 2YBRB 1HKLH 5C0DB 1P4BL 4M7JL 5DC9B 3SPCA 5AKRA 3UPRA 3S36X 3FOMA 5AAWA 1QSFD 2EDKA 4R26H 1YN7A 5DGRA 5TGBA 4NO5B 3UTSD 5HPMB 3KVPA 4GXUN 1AR1D 3HG3A 4HC1A 8PAZA 3KLQA 4UTBL 1QFUH 1I7RA 4D3CH 3G08A 4MYPA 2WQ8A 4GLRH 5C97A 1KPUB 3W38A 1F41A 5A2CA 1RZKH 5I66B 2AQSA 3J27A 5G4OA 2M8XA 4G82A 3IM1A 3LEXA 3HI5L 4QF1A 3ZMRA 1BQRA 3W9EB 2MNUA 3W1ZA 1RK1A 3MR9B 2XWBA 5C0AB 3RPKA 1A02N 2NOYA 1CS6A 2WOBA 1A9BB 4Q0XH 1J0IA 3R06A 1N6VA 1AMXA 1QSED 2AQNA 4QF1B 5IQ7L 2FH8A 1Q72H 2DM3A 2VIRA 4FYSA 4PJEE 1DQJB 3MR9A 2OL3A 3TBWB 3KM2A 1D9KC 3LCYA 3C8KA 3SDDC 3HJ0A 1OD9A 3DROB 1YEDB 4HWBA 2ZYHA 1RZGB 1JRHH 1JWSA 1ZT1A 1V3JA 3S37H 1EJOL 2IQ9L 2QVKA 2QPSA 2NXYD 1ILSA 3VFNA 4U4IA 4LSRH 4HJ0D 3G5VB 3SN6N 2CBPA 3DX7B 4BGDA 3JV0A 2DLHA 3ETSA 5GRJL 4V1DD 3RTLA 4PJ8A 4W9GC 4P3CL 3CDYA 3JV4A 5B7FA 5TF0A 3VQMA 3C2AH 1FN4B 5IBTL 5LBVA 3LRHA 1CYWA 3HPJB 4HT1H 5I6PA 3P77B 4RSYA 1NEZB 3WY4A 2J7LA 4JRYD 4MD4B 4NNXA 3ZDZF 4B60A 1R0AH 4QTIL 3FH5A 4L05A 1JPTL 3PHQB 4YDKL 3V5KA 3VWKA 2VZ1A 3AS1A 4S1DC 3A6CL 1YNLH 4F27A 3BI9X 4PIBA 4YO0B 4XXCA 3IJSA 3CK0L 4FQLH 4RDQG 3I2CH 4ZMAT 3RBSA 1S78D 4J23A 4AX3A 1NKOA 4AMKH 3F58H 4JZOB 3SZ6A 1FIGL 2BCKA 4X80L 1G7PA 1GYVA 3DMMB 5CS7A 3GD1C 2J20A 3BIAX 3FMGH 1PL3A 3JXAA 5B1BB 3WAJA 1F86A 3LS5H 2Q6WA 4CKQA 4M48L 2NYYD 4LHJB 3AU0A 4LPCA 3FTUA 3S5LG 5FA4A 1V10A 5LWYL 3FMGL 1XGRB 2Z31B 3CFJA 5FKAA 3VU1A 3PU7A 4NUJB 4WI4A 5IUCA 3WFDH 1MVYA 1NCDH 4G8GB 4QDGA 3WO4B 2JKXA 3DMMD 4PLJC 4G8FB 2RB8A 3MMEA 3OKLB 4TPRL 2NY5C 4AVHA 4TTDD 3P77A 5IVZA 2B5IB 3BVVA 4J3UA 4L3AA 1PBYA 2IFFL 4U1JB 1DLFH 4DNLA 2EH8H 4NQEA 3BWAA 2DQTH 1PFOA 5EA0H 4P9HC 4J7RA 3QC6X 1EDQA 3MTXA 2CDEB 5MEND 2WIIA 4JX0A 4N0YH 3RWCA 3ZSTA 4UQDA 4UB0L 1FAIL 4WK2B 1F3RB 2H3KA 1DDHA 2A83B 2VDPH 2KYIA 4NYLB 4NZJA 1VKXA 3UX9B 1OT2A 4UQ3A 1JV2B 2OMYA 1WHPA 3X11B 1EFXB 4HC1L 4S1RH 1JTTA 1H3UA 1B0RA 1I75A 1S46A 2DTML 1W8NA 1DO5A 3HLAB 3KPNA 3BKCH 3MRFB 4GY4A 5AVTB 5AD0B 1ZA3B 4N2CA 4YAQB 5JIPA 4AZ8B 1EEQA 1QA9A 1GJUA 4JDTH 3PREA 1CIUA 4PRHB 4WDIA 3U7WL 1QI3A 4TUJB 1WUZA 2KL6A 4R0LA 1YEKL 4DVRH 3EOBB 4X99B 1BCIA 4QXGH 5BRQA 3GUTA 1P1ZA 3MV9D 4JDVA 1OSZB 2NSMA 2VDRH 3WFEL 1NBCA 4WO4B 3BZEA 2CK0H 2X4OA 5I8OH 3AXLB 3X1GA 2GITA 3KH3A 4PRHA 1K4DA 3HFFA 2XPYA 4Z7UF 1YMMD 3QE5A 3KHQA 2K70A 4ZZFA 4LVNC 3QJVB 3BP5A 4OTXL 2W60A 1FL3B 5GS0D 4XZUB 4JB9H 2V4LA 2YPVA 4UUJA 3DO4A 3Q1EA 3PCYA 5KSBF 3ARDD 1HTYA 3ZSSA 3GC3A 4ZJ9A 3B3IB 3VXNB 2BC4A 3VGAC 1QUNA 5CR1A 3LV3B 2O6EA 3F12B 3OMIB 1BM7A 3CDGA 2C5DC 3ZKNC 4M1GL 4G6KL 5DHYA 4N85A 5KSAD 1Y0LA 1NCAH 2F53E 3MJ8A 2R29L 1OCZB 3VFSA 2Z8RA 3CC1A 5ID0B 3HHSB 1QRKA 3H6AA 4P0DA 4IOFC 1A6WH 1A7RL 3FO2A 4OF7A 3UCQA 4CN6A 3S37X 1LILA 2XRAL 1FNSH 3OB0K 5FYJE 1OAJA 1AR1B 4X7EC 7PCYA 3C9NA 4JLRA 1ZHNA 1CE1L 1M7IB 4YUEL 3IGKA 4RMTA 4QRQB 3KBPA 2BVPB 3VD2A 3REWA 5AW0B 2AJUH 2R39A 1WPCA 3RI5K 1A6VL 2AQQA 2E76C 1ECZA 1T2QH 1YEJL 4TNVF 1XDTT 3UTTA 4A67A 3HEIB 2UY7B 1W72A 4Y2DD 4DZBB 1GZQB 1NC2B 1BWWA 4IU3B 1OEZW 3K5SA 4IHOB 2YQGA 5AKTA 5CXPA 2CKNA 1T3FA 4NM8H 4YE0A 4X6CF 2W60B 4F93B 1A4KA 3VXME 5J1SC 4G1EB 5KAQG 1UD5A 2Z1KA 5IBUB 7FABH 1NAMB 3ZYJA 3D2TA 4TVPD 3GNMH 2ZWLT 2YRZA 4AQ1B 5T1DL 3OB0H 2NW2B 5CEYA 4F7TA 3BXNA 1DBAH 4FFYA 3TO4C 2WTPA 4WHCA 1XR8B 4KROD 2NPLX 4WWNA 2CHNA 3MBEB 4M8QB 2LU5A 4J6RL 3SEPA 2Q2EB 1ETB1 2BJML 2IWEA 1QNZH 3BXNB 3D0LB 4HJSA 3P0VH 3CMOH 4AWJC 3SODB 3ZPDA 2XWBB 1QZ1A 5C0AA 4EDWL 4EE2A 1IE5A 2F5BH 5DJXA 4B0MB 2Z93A 3GBML 4Y4FC 2FJGA 1TJIH 5DEZA 4U1SB 3HZYA 3TVMA 3HIZA 1J0ZA 1R33A 1YSOA 4M7ZC 4KX7A 4Q6IC 1J0KA 4NENA 3ZDZE 3X3FH 1OM9A 1O7VA 4H7VA 1Z5LA 1KB5A 2E46A 4O2EB 5INCA 4N0RA 5IW1B 1EO7A 4FNLH 3FRPB 3IU3B 4G3YH 1EBAA 3WXWL 4B9CA 3FQTA 4QHKI 2BSED 4L8BB 4BK4A 2DIEA 3HE6B 3BHBB 5D5MB 1OLLA 5CF3A 5J1AA 2YBRA 4YHKH 4PG2C 1GAFL 1ADQH 3PWJA 1XH3B 3U1SH 1RZJH 4PJFE 1IGTA 4M43H 4APQD 2EYTA 3K7UA 2L4OA 2AXGB 5TFSH 2QV4A 2JB6B 2IDUA 4CSSA 5BMFH 2WIMA 1XEUA 1FSKB 3G6AB 4K07A 3US0A 5I26A 5HY9B 4HS3B 5IJKC 4HJTA 3S5LB 4PJFB 3G9VA 1WBZB 1JYXA 2F8IA 1A3RL 1JGDB 4YBLB 3UL4A 4D7PA 4QRPA 4JG5A 3K81A 5EUOB 3D05A 3VWJA 5AOJA 2ZSVB 1A1NB 2DY2A 1REIA 5I82A 1X5ZA 4AUYA 4L4VE 1T5XB 4HLEA 3WY3A 1LO3L 3CAFA 4FJYA 3WTSA 4PD4K 5BQDA 3RPBA 4C58B 4JO8A 3GRWL 3G6JA 4X6DE 3HMWL 4JO1L 1G7QA 4X83A 3QHFL 2ZD0A 2AC0A 4PTUB 1O6VA 2EVFA 4HAGA 4MTMA 4WUUD 2R9HD 3C8DA 4X6DB 1H8NA 2NYKA 3I50L 4OLWH 4R5VA 4L4JA 4HJIA 2VDQL 4PS3A 1G7QB 3RKDD 3TYGL 1LO2H 4P3WA 3ILDA 4XCCH 1EXGA 2Z8WC 3DI2B 4U1IB 3G5VA 5F1IB 5DEJA 2GFBA 4L4TD 2VRQA 3EYQD 1DE4A 2FWUA 3IMVA 3QDMD 4P2QE 5I73B 4PJHE 4J12A 3ZXAC 5T3ZL 4NLAA 3VWJC 5HGBB 4IK6A 5GISL 5F7NC 1QR1A 3TF7C 5AALA 5I1CH 3WFHA 3MN8A 1BYPA 2PW1B 5K1JA 5EUOA 2PYEE 1WTLA 3QUMA 3RFZB 4NO3A 2B08A 1KBKA 3R06B 2NY4B 1FO0A 1SFHA 1DDHB 1SRDA 2A83A 2CLRB 4ODHH 2RFXA 4Y2NA 3KW7A 1VKXB 4JM4L 2OMWA 3Q7JA 3IXAB 2W0LA 1OGAA 3DX9A 1TFPA 1QR4A 3S2AA 2EDBA 1BIIB 4KJWD 5BV7H 2I60L 1OWRM 4O9HL 3FTWA 2VKWA 4NCC1 2DI9A 2ISDA 4QCIA 1K6QL 1OGPA 5FWRA 2OJEA 1NC4D 4NKQB 1AS7A 3ERXA 3ZKXC 2XACC 3QR2A 2R29A 4Z9KB 4I5BB 5KSBE 2KLTA 4AYMC 3F58L 3HNVL 4AKPA 5KEZA 1PZ5B 4RGNC 3L5HA 5CBEB 5F7DA 3VRJA 3LNEA 5HI4C 3KPSD 3WV0A 3AXLA 1B9KA 3EYSL 4GBXA 4UWQB 3APDA 1A7QH 4Z18A 4YDKH 2BS9A 5E08H 4LQFL 4MRCA 2IAMA 3N85H 1PX3A 4XXWC 1F6AA 1UXSA 4YHZH 1OM3L 3KYOA 2CHZA 1TZHA 4JZJA 3OKOB 3BAEL 1B0WA 1C5DB 1TVHB 4MDIB 1CGSH 2KHAA 3ZL4L 3V5DB 3W0WE 4BZ1A 2HJKA 5EOTB 5JYLA 4KH9A 2WOYA 5IQNA 3TO4D 5LVEA 3DX2A 5F44A 3EJZD 3MLWL 4N2MA 3CXDH 1IAKB 1B3JA 5ILTL 2EDWA 1ZT7A 4XB7A 2QSCL 4K71B 4M62L 3GSQB 1INEH 1S7WA 1AI1L 3IWUA 1PTZA 3QORB 1MNNA 4CMMA 3OPZL 2OCFD 2UXVA 4NAMA 2XBTA 3O9WB 1RJZB 4NM4H 5D72H 5AZUA 3VSVA 1KGCD 4YR6B 3CBRA 4UAHA 4HWZA 2YKLL 1RPQA 3ZTJG 3NJMA 4K7FB 4F9PA 1IBFA 4NP4L 4Q58C 1G7HB 1HWGB 2JCWA 3HZMB 3MCLH 4YBQC 3SDAB 4LMQI 2Y2TA 3UBXG 1RFDL 1UZ6E 1E9QA 4Y4HC 3ECWA 2P49B 5D2NE 1A6UH 3ZUNC 2HFTA 1W72B 1AGBA 4K3DH 2P42B 1MFEL 4TTGA 3SQRA 2C3GA 4KRLB 2P3YA 3EFDL 1CFVL 3ZDXB 5DA0B 3NZHH 1JXDA 3L6FA 3C6LA 3O2WL 5I30L 3LZFL 1WP6A 3QYCA 3UMTA 4P3DA 3ML8A 3VG9B 3H42L 4TRPL 4EUPH 4WRLA 1UD6A 1IAKA 5GQBA 2W88A 3B1TA 3K74B 2XQBL 4W81A 3OR6B 2X1PA 2I9TB 1Z9NA 4N68A 3SGEH 3TZVC 3D1MC 5KYUB 3FTVA 4K4KA 4HCFA 5EFIB 4FZEH 3LXCA 5B1CA 4L23A 4GAFB 1C8QA 4XVOA 3EYFA 3OJVC 3IVKB 4XMPH 5E23A 5JO5A 2H1LM 1PY9A 2VE6A 5AL8A 1EH9A 4PM1A 5HHXL 2H2SC 3QNFA 4RNRB 2NQDA 1C1EH 4B9ZA 1TTUA 4PV9A 2LGNA 3ZQXA 5D1XA 3MODH 4A66A 3IDIB 5HVWA 4K9EL 1J7VR 2BZ7A 5I1EH 2AQ3A 3FQTB 3TPKA 5IHWA 1L0YA 3QISA 4HK0A 3WKNA 1WITA 3L4WA 4XRCB 1LE5A 4HLZH 4OTXH 4PSPA 1HSAA 4JRXE 4Q89A 1WBYA 2YAFA 3C87A 4YX2L 5GRVK 3C09B 4NN7B 3VQ2C 1TUPA 4MAUH 3WBDA 2ITFA 3O6LH 2YD9A 2GBVA 4AH2B 4WJ5B 3FQWB 2VGLM 4X98A 1MWAB 3IFLL 3R0NA 2GJZB 4HKZB 1FC1A 4DZ8B 2FNWA 5EBGA 4HS3A 3GI9H 4FGMA 1BGXL 1EAJA 3OKKB 4XBGB 5DC4B 3FQNA 2FL5A 3MNZB 2Q86A 3EUUA 2IF7A 3AS2A 5E6IA 4OLVL 4W9IC 5KVMC 2QGEA 3BKMH 4MVBD 4JFPA 3KPLB 4R7NB 4M6MH 5IB1A 4Q97A 1BMWA 1V5JA 5DD1L 1DN2A 3VI3F 3SQBB 2ERJC 1QLEH 5IFHL 5JOEA 1CF8L 3QJZA 4JKPH 5D7LB 4AW4A 5F9DC 3IE9A 5C7XH 5B3SB 4CKVX 4Y8AA 4Z7QE 4ECNA 4PV9B 2FIKB 5D1XB 2K3TA 1FP5A 2DN7A 2OJ1A 3KGUA 3RVWD 3QQ4A 4O51B 3ZZSA 1FO0L 1DQKA 1XV8A 2BSTA 2WXQA 5D71H 4G80A 5CJOH 3KCWA 3EXLA 3WFBH 2KLSA 2AJ3A 3WL9A 5IR1A 3X13A 1QEXA 4OFPA 1FFOB 4MNQD 3P11L 1GS6X 5E94A 5CP3H 3V0GA 4X9GA 2YBGA 2XICA 4NSKA 5KAQF 5A2BA 2CGYA 3DKHA 5TDPA 5LGJB 2XN0A 5HYQA 1BLNB 5E6SB 3ES6B 2OMUA 2X1OA 3REVA 5LWYH 1NFDA 3T0EA 2HKFL 1IBBA 1KFAH 4LCYA 4JPKL 3LNDA 4FLSA 2WM0A 3D0LA 2HJLB 3ZHNA 1GS8A 1TQTA 4I1RA 1IQDA 2D8KA 3MFFA 4JCMA 3UTSA 1AXSA 2IDTA 3FUJA 3I9GL 5DJXB 5C08B 4XWGH 5AVRB 1IGCH 4A68A 4ZXBD 4QRSB 4K5MA 3T2NL 4BUGA 4KRPD 5IW3A 1A7BA 2D31A 5HYJD 3CFTA 3AQYA 5D93C 3RL1B 1HXYB 2LVEA 2ERJB 1QHQA 4FG0A 2ICEA 3B9KD 3LKPA 2PNDA 1IKFH 1PX8A 3S9DB 1IC4L 4K8RH 2MCPL 5AVYB 4YBQD 4QWWD 3UO8B 1UT1A 4MAYA 3KLHD 3T77B 2EE9A 5CR8A 4JFWA 1PG7H 2WXGA 1HXYA 3KLKA 5L2KE 3QWRD 4W9JC 2WJ7A 5CJ5A 2F1AA 5D6CA 2ZG1A 3KR3L 4RQQB 3EBHA 4LBEA 2KKQA 1SN0A 3WS6C 2M83A 1YY8A 3P73A 2AJSL 2ED7A 1EEUA 3A3YB 3PV7A 3BW9A 3ILPA 1S7SA 3FN9A 3QNZA 2XC8A 2IJ0C 1L6XA 4TSAH 5FDWB 2JI2A 1E4XI 5I0ZA 2Q3ZA 2WQRA 4MQTB 1YMHA 3VJ6B 4NQCB 3F6JA 3L4TA 5D2LF 4HUUA 3BPOC 3UYOD 5IB4B 3R1GH 1S9WA 2CGZA 4YDLB 1XSKA 4X7FC 4P05A 1XH2A 4UZUA 2HTKD 1UJTA 2E5EA 4NFCA 1P4LB 1GJWA 5KBKA 3IDNA 4PR5B 3KYKH 1BXXA 3FT0A 43C9A 1KG0B 1U8PB 5ILTH 5LAXB 4HWZB 4LOVA 2D7OA 2C4XA 2IDSA 3QJTB 4RFOL 1MFAL 2Z6FA 3K2MC 1BEXA 1DBJH 1NUGA 5TF1H 1KJ3L 3H2WA 3ZTJH 3GZKA 4KVCL 5ALBH 43C9B 1MRFL 1KTLA 3RDTC 4MXQC 1QW8A 2VLJA 3GHBH 4TUOB 5EU6E 4LL9A 3SKNB 4KZEH 2VL5A 4NRZB 25C8L 3ET9F 3MCYA 5CHNA 3HR5B 4FNUA 2OJZH 4Y5YB 2JTDA 4HLJA 2G4GA 1T83A 2FWLB 4KKCC 2BVOB 2MQCA 4DAGH 1UYWH 1UACL 1YC7A 1T1ZA 5M7QA 4XP6H 2IPUG 1HNFA 1IM3A 3E9UA 4MCYA 3O6KH 3OSVA 5E5LA 3QJUB 4Y7OC 5IFAL 5C70A 5DLLA 1X5HA 1RV6X 2DAVA 2AEQL 1L6PA 1LO0L 1I8LC 1ZWIB 3DHUA 3QXUA 2AXWA 4YLCA 1BPLB 1CDUA 1MFEH 3OKOA 4H0LC 4PVNA 3RWIA 3WDHA 3LRSB 4CVZA 5K9KA 5IVXF 5AVQB 3GINA 2JIXD 2FX7L 1JJUA 1UM6H 1A7NL 1VERA 2EDOA 3B7UX 3DVNB 2MSPA 3TIEB 1HYSD 2GT9A 1HILB 3BGAA 3Q44A 4LOFA 2Y7MA 2K0RA 2V17L 5BZZA 3EYFB 3W37A 3WIFB 2Q10A 3FUMA 4MMYA 2JNZA 5JW4R 1PD1A 4PHZA 1FZMB 1WBXA 3VTAA 2Y6SC 3TV8A 3L3HA 3Q13A 5I6LA 1YNTF 3AW5A 2X2UA 4WNSA 4CC4C 3S8FB 1WFNA 5DYOA 5LUMA 1L9NA 2MH4A 5KWYC 3D18A 4BXVA 4E9SA 3MNDA 4J5VA 4OFYA 5T5FA 1JN6A 3IRZA 2CO2A 3T04D 5IMLB 2R7EB 3MBEC 1YUKB 3MOBL 5E4EB 3AWFA 4HZLB 3O3AA 1OCWL 1CGSL 2LOEA 2DLFH 3T8MA 4HFWA 1ZWIA 4PJ7E 4A55A 3H9SB 3Q2WA 1ZLVH 5CBAB 1YEEH 1FNSL 1E9PA 4HKZA 2XYBA 1FYTD 1WWWX 1ZHKB 4KKBD 4L9LA 4AYDC 2D03L 1JXKA 3CFMA 2ZG3A 2Q8AH 3RIFK 3CV5A 3KYNB 4JFTA 2UUDH 3ZK0A 2NX5B 1U8NA 3CBJB 3IDYB 1K85A 1F0LA 4PCSA 3QQNA 5BO1H 1MW2A 2Y4SA 1RZQA 2VLKB 5EF3A 2D4FA 3EG9A 3F7PC 4NBYB 3ATFA 3DO7A 3RWGA 1NCBH 2O4EA 3L5JA 3X1NA 2IV9A 4AKOA 3B83A 4XNMA 2FWOB 3BQUD 1JK8B 3BT0A 5JUEL 4ZPVA 1KEML 2V2XB 1UWXK 4K23L 4LEOA 4KTEL 4HU8A 3UAJC 3A21A 3EXJA 4LCVA 4LRNL 1LM8V 1DP0A 1AYOA 2WXJA 3I75B 1ULVA 1RZJL 1JHKH 2P8PB 3KWVA 3TO2B 2ZKHH 3AMLA 1RSFA 2YUWA 1CD9B 5B38A 4LOEA 1ACCA 4KBPA 5GGTL 4U6YB 5GHWH 5GJSL 4HIJA 3STZB 1G7JB 4KKPA 5AYUH 5I76A 1J5OH 1IJNA 1AP2A 3HHMA 2ITCB 3V5HA 3ULVL 1QRND 2XKNB 1MQKH 4NKIL 1JPSH 1Q9WB 2HFFB 2Z8SA 3KPSB 2O93L 3T4YB 1TTGA 4G72B 4RZKA 5I1GL 1TTAA 2QADB 4AQEB 1ZTMA 2ADJB 5DO2D 2Z91B 4PRBA 2FJFB 2OX5A 4MS6A 3WUWA 5K9OA 3QH3A 1XFPA 4L2YA 2XCMC 1QO3A 2H26B 3N1PC 1MZZA 2YHGA 4HVBA 2F5BL 3IJEA 3KXFD 5AAMA 5ICYB 1GOFA 3OZ9L 1J1PL 2GC4C 5I75B 4O02A 1W80A 2QFRA 4WUKL 2GTZB 1QSFA 2EKSA 2A4CA 2KZKA 2X4NB 1P7HL 5GHWL 3WS6A 1JWMB 4KPHL 3P30H 3CBKB 3S35H 3PXLA 3RDJA 2OP4H 3D25B 2ZP8A 3WKML 3ULVC 1KFGA 3FZUD 1QLFA 2D3LA 1XCQA 1NCIA 2IPKA 3LQAL 4UT6H 5F93C 3C2SA 4R6UA 1BXAA 2CIKA 4IRSC 1EEYA 5B1AB 1YN6A 4FXKB 4Q2ZA 4XWOD 1K8DA 1L4IA 2E4TA 5FUOH 2GUOB 3FB6B 4A6YH 5EU7C 3MDJA 1E5UI 4BK5C 5AW3B 2J71A 4MNGB 1HHIA 2DKSA 5D1ZA 1JPGB 2DZEA 4ZW7A 2D4DA 2WZAA 3FXIC 5F7MC 1T0OA 2BVYA 4PGCB 5DD5L 4DUWA 3OKKA 4XBGA 1E50A 4N2LA 2DMGA 2N59A 2AERT 3B2PA 2YAMA 1G9ML 5ISZE 5DQ9A 4GKSA 1O7DE 1K2DB 2J12B 4UILH 1V27A 3TYFA 2FZ3B 5FYJH 5K9JL 3ULUE 4G6FB 4HKJA 5DVPA 1P0SE 4HPYH 3CXDL 4I9XA 2X2HA 3UP6A 4EOWL 1FFNB 3WIHL 2DQUH 35C8L 3S3BB 4XI5C 3TEZA 3NIFB 1RURL 2B14A 2XTJB 2ZAIA 2GIYA 1N67A 5AQ0A 3ESOA 2R2HA 4Y2DA 5HHVH 3WJJA 4Q6KA 3LN4A 4Y1AA 2R2BB 5IBTH 4PWKA 3FO0L 2ESVD 2DQIL 4U4BA 5DUML 4R4FH 2XA8L 4L4TE 4B9JA 4D9QE 1P9MA 3J2PA 4EUPG 2WKLA 3W3BA 5E8DL 4URKA 5E08L 2UXTA 3B9VA 5D7IF 5A16B 3BWUC 4OFQA 3SJVA 1AJ7H 4GSUA 5DFTA 5ISZB 3E1ZA 4L8SC 3RGBA 4HISA 4LPVA 4AK2A 1SJHA 1UZ8A 2DL2A 3CFUA 1AO7D 2J8UB 4MD5B 3LRMA 3WE6B 2CIIB 4N90E 2O61B 1BOGB 1IQWH 1VPOH 4YQXH 3IU4L 3BGMA 4IJ3C 2CNZA 4IOSA 4MNGE 5MI0B 4P07A 2ADFL 2W0KA 1S5IH 2BSSA 5I15L 3EH4B 5CD5D 2XIDA 1BM3L 3OJ2C 4JKNA 1TQVA 3RG1C 2IAMC 2CXGA 1MIML 3BEVA 1WG3A 3L1GA 5E6UB 1LLAA 4GBXC 5JIIA 3ARDA 3QR0A 1EXUB 1JG9A 3LEYL 1RU9L 3V0EA 1YMME 4YO0A 1IGFH 3CLFL 5T5FL 5DSCB 4YLQT 3T8XA 3QCVH 3SGJA 2Z35B 2D31B 3OZ9H 1I31A 2K6WA 1RAMA 4WI0A 4HLZG 3BH9A 2CSPA 4HWUA 1EMTL 3HG0A 2VMJA 4JFYB 4WW1B 3IDXH 4IW4C 1MJJB 3DX6B 1JGIA 2KLRA 4JN1L 4LPYA 2BY0A 4PGZA 4YS4A 4QHMB 3LZQA 4YBLC 3VG0L 5ANMB 3BQUC 3NJLA 4WW2F 2R2EB 2I24N 1SJXA 3V7AG 1HQRA 4L29A 2VCOA 2KZWA 4HIEA 1NFKA 2Z1PA 1IE4A 3C5SA 2CR6A 4O5LH 1TJMA 3FTGB 3L3JB 1DUYB 1KJ2A 3QPQD 1JHTA 4KROB 1T6BX 4YSSA 3NCYS 3C6SB 4BSJA 4CVWA 5E1AB 1EO8L 2QTEA 3GMRA 4TL5A 4AGLA 5KVFH 3SDXE 4QRPD 4KFZC 4P5MB 3DUHA 4DEPC 2VL5B 3DBSA 1SYSB 5MENA 4MB4A 2H5UA 2VWEE 3MUGA 3FRPG 2N3JA 3GSOB 1T7YA 2DKMA