2YUVA

Solution structure of 2nd immunoglobulin domain of slow type myosin-binding protein c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
100
Chain Sequence
GSSGSSGAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of 2nd Immunoglobulin Domain of Slow Type Myosin-Binding Protein C
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Myosin-binding protein C, slow-type
total genus 11
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yuvA00
3GGWA 4I8DA 5EWIH 1IM3B 4PJ8D 5EBMB 1ERNA 4L8SB 4KI1A 4FQXD 5EUKA 4Y4KC 4ENEC 3J8F7 2X4QA 1ND0A 3BEWB 4NRXB 5EU4B 3WBDA 2AXJA 1CT8A 3IDJA 4G80B 4KTEH 4XPBH 4UT7L 3ZTJG 5CSZA 4IJ3C 1RURH 2E8YA 1P4BL 2DQDH 2XN9D 3QJHA 2C4FT 4JFFB 3PWJB 2H8PA 3S4SG 2HG5B 1G7LA 4NZRL 5IHUL 4EN3D 5BZWB 1HHJA 1X5LA 3AREA 3UTTE 5CD3A 4I0PD 4OFDA 4RGNC 4P2OB 3NH7H 2W1NA 4GG6A 4PJ7A 4EUPH 4JO2H 1ZA3A 4WTZA 4WO4B 1I7TB 1ONQB 5F9OH 1MFNA 5GGQL 4YWGL 2R4SL 1VHPA 3VFUA 2J12B 3LS4L 1OAZH 2ZCLL 1S7UA 4PV8A 4PBVC 5SWZB 1A1OB 1S8DB 4OCYL 5IB2B 2NMSA 2WSKA 1OLLA 2ZJSH 4LLDB 4UIKL 5A2LH 5SWQA 2QQQA 1A3LH 4CDHA 1M6OB 1HHHB 1OAKH 1X5JA 4GW5B 4TUKL 5IGXH 4PV9A 3SKJL 4P3WA 3BZEA 2I9TA 3MLSL 2A83B 4UNTA 3LSOB 1VDGA 4NDMA 3O9WB 3O8XA 4JZJC 4XP9L 2DLGA 1MVFA 3EDEA 2CK2A 4GSDL 2HJFB 1MHCA 1D9KA 3OXRA 1G9ML 1NLDH 4O58L 3V5DA 5BOZG 4H0IA 1HH9B 1L0XA 3GMMA 2QV2A 4HKJB 1QA9A 2VYRE 4LLVA 4NO0D 1DCLA 2FJGA 4YHKL 3S35H 1IGML 2AGJL 2K9UA 4UT9L 5D7LA 4JZJA 4P2CG 5EZJA 3C5ZC 4LSRL 2R1XB 4OIAA 3TLRA 3RA7L 1XMWA 3LKSB 4G9DA 4LCWE 1QRKA 3MLVH 3TNNB 5E8OB 1M7DA 4HXBL 3LKPA 2IQ9L 4OCXL 4AH2B 3QWRD 1J8HB 5C0RL 1O5DT 3NCBB 5TDNB 1UB5A 3QUXC 2XNAB 2AXFA 2HTKD 5TDNA 4ODHH 3FO0H 3MBXH 3IETB 2DTMH 4ZODA 4LKXB 5I1HH 4DUWA 1BF2A 1FNGA 3QNXB 3QXDB 1TJGH 4DZ8A 2V9QA 4YXHH 1OAXH 2AVGA 3HI1A 4JJHA 2IH1B 3DPBA 4K3EL 4X7DC 1HOCA 3M8OH 4XBPA 3WL9A 4AMKH 4OV5B 2Y06H 4RMTA 4XZUA 5DEGB 4OCNC 1TJHH 3MV7B 4H1LB 4X4ME 4LCCC 4WV1B 4PJCE 4WI4A 5BJTA 4WY7L 1CZ8L 3TT3H 4ZPTA 2RBLA 5F9WB 3QULB 4X4YA 2QHRL 3VFPA 5HSFA 3EO9H 1C5DB 3AC0A 1R3KA 2ICEA 5I19H 3NMEA 1A7RL 2XG5A 1H8NA 2CIKB 3QG6B 3BW9A 1DEEA 5DMGC 1KV3A 3ZT7A 1FIGL 5CBEB 3DV4A 5FYKL 2FYYB 3I02B 4OLYL 3K1KC 2Z4QB 2DWEA 3DX8A 3FN3A 5EWIL 4AIXA 2AJYH 2PYED 2CIIA 1U2CA 4WCYH 5F9AC 4HKZA 4J3UA 5KSUB 2IH3B 5IROA 1BD2A 4JHWH 4YNYB 2NY2B 4U1HB 4JQIL 4Y2DA 3FT2A 1F02I 2QTEA 1F6FB 3AB0B 4OZGF 4KUZH 3OKEA 2ZSVB 4F9PA 5DC0A 2IPTL 5INDA 1YMMB 1QSFA 1IT9H 2A73B 2NYYC 3FMGL 5TGBA 4ZDHA 2YK1L 3ARDC 1A7PL 1INDH 1YY9C 3VXRB 3MRQB 3SO3B 2ZUVA 2XIDA 3U79A 2DL2A 5FV1L 1FG2A 3O2VH 1JF5A 1KJMA 3GSXB 3G5YA 3KPRD 4KRLB 1KCRH 4WVRA 1K6QL 1ZHNB 2B1HH 2HLAA 4FFWD 1OTUD 3B9KC 2ZCLH 2A0LC 5JXED 2A38A 2HLAB 4W6YB 3LVEA 2OTPA 4OCYH 4YJZL 5KANG 3DMMC 4AM0B 1CYGA 4J8RB 3TN0B 4M6MH 1A3LL 2YD7A 2CJUH 1Q9LB 1OF2A 1PZ5A 2ATPB 3D0VB 4PJCB 3B83A 5ESAA 2DQEH 2B2XH 1UKTA 5D2NE 3X12B 3MLSH 3WXVL 1W0VB 3OKKA 4GMSL 1OSPH 4UQ2B 1IM9B 3T77A 3MYJA 4ZUSA 3BIBX 1HCFX 4QLRA 1DQJB 4N8VA 1R3LA 1P6FA 3BYTA 1FV1A 2C3VB 1NLDL 4O58H 3ARFB 4WHYH 2O61A 5E5MA 1MI5B 1U0QA 5DUPH 4ONFL 5E5MB 1H5BA 2JIXA 3V6ZB 3L5XL 1CFTB 3P77B 1CK0H 3QQ9D 4LSRH 3NCFB 4M7LH 4GQ9H 4Z18A 2R0WH 1SY6L 4CVZA 3AU1B 4JG0L 3FTGA 4S1DC 1A6UH 1X5AA 4QGTA 3RU8H 5H37G 3SE3C 4PJXB 5F7EL 1H5BC 4R0LC 2IADB 4DKEL 3U2SA 1HK6A 4HIXH 5IMOA 2R0LL 3RHWK 3U4BH 5SX4I 2WIIB 1D9KB 3OXRB 3HG1B 2APXA 1K8DA 5I1HL 3BHBA 2Y36H 3QEGL 1NL0H 1ZOXA 1JGDB 3MLYL 3MODH 2OS7A 3RWFB 3DHMA 3OAUH 4KJYA 3D39E 3T2OA 1RFDL 1LE9A 3CVHL 3GK8H 5FCUH 1L7TH 4XNQA 3KYAA 1EV2E 3UJTH 3BD4A 4KZEL 2X4QB 2Y06L 1U95B 4M03A 2DN7A 3IDNB 4IOFD 5ADOL 3BP4A 3BEVB 4KMTH 4L4TE 1V7NH 5HPMA 3NBNA 2WBJA 2J8UA 1MLBB 4JLRA 4UTBH 1ZGLA 2QHRH 2I9LA 3WDHA 4OM0H 5E8EB 1RJZA 3ROOA 4IS6B 1KG0B 2EDQA 4LIQE 1YUHB 4QF1A 5CP7B 3QG7H 1A5FH 1KCVH 5JW3L 5BS0A 3LZFL 3CCHA 3OF6D 4N8CL 1ZV5A 3UDWC 3QIWA 4P2OA 3RWJA 2HVJB 5FA4B 3GNML 2BNUB 3PQYA 5DD5H 2NY4C 4OFKA 4PBWD 2GJ6D 3ARDA 2J8UE 1GYAA 5J4MA 4DFHA 5I8OH 2BNRD 3RVVC 3DETD 4ODWB 1KACB 2OJEA 2BVOB 2OJZH 4B7LA 3MRPA 2JJSC 5KSAB 2G2RA 2F54A 5GRVL 5JPNB 5AWNH 3CFJB 3O0RH 4U1KB 3V5KA 2ERJC 1BLNB 2ARWA 3OKNA 1T0MA 3RNKB 5I1LB 4X4YB 1HILB 1PGRB 2DYPB 3C8KA 4I1NB 3GFUA 1QBAA 4MAUL 1HILA 1LO3H 4MB5A 3HC3L 4FTVD 1G9MC 2P8PB 3PQYE 4LLVB 4LNRB 5E6IA 5FAAA 5B8CA 1Q0XH 3VFRB 5F71A 5I30L 1INDL 4TVPH 1UFUA 1I4FA 4NHCL 4YBLB 3ULSB 4FQHB 5E5UB 4Z76A 3SJVD 2PYEE 4JM2F 1Q72H 5LAXA 1GGBH 1AI1H 3WXWH 3DX7A 3MRIA 1J9CT 1IEAB 5D7LE 3B6SA 3FFCB 4PGBB 5EU3A 1U8MA 1XGYH 2MOVA 4M6ML 1HXMB 3WJLA 1OTSC 2CJUL 3T3PE 4PLJC 4QHNA 3QDGD 5C0AD 1T21B 1MJ7H 4P4RA 1WC7A 3DARA 3KPQB 1JPFA 3EOAA 3GKZA 3IFOA 4LRNH 5B39B 5E0QA 1TLKA 4K7PH 3RDTD 3AB0C 1G6RL 3PXJA 1UJ3A 3GMLA 5C2BL 4PGEB 4MD5A 5EU6B 3U9UB 3UC0L 4M6NL 2P24B 4DKAA 1L6XA 5IB5B 5TE4H 3WFBL 1OCWH 2YRZA 1N0XL 3X11A 4EVNA 1D5BB 2AK4E 1WIPA 4ONFH 3UTTD 2VN4A 5JW4R 3ZKXC 5EFIB 5SX5K 5A40E 2YPVL 7FABH 3K1DA 2R1YB 4NM8H 3G6JE 1IM3A 4GQPH 3U46A 3CDGB 2R0WL 2X4NA 4YDIL 1F8TH 4HUXA 4AIZB 3U46B 1KSRA 1EK3A 4JG0H 1MVUB 2E7CA 4I3SH 1A7QL 4G80A 3U82B 1NC2D 3GSXA 1UH2A 5HYJA 4Q2ZB 3QSKB 4AG4L 2NY1B 3FFDB 4Y19E 4PY7B 4AT6B 3KNBA 4ZO9A 4WGWB 3CFKB 4P3DA 1ADQA 1IEBB 4OZHE 2A77H 4X6DA 5FYJL 5E9DE 5GS1C 5E9DB 1QP1A 4FMKA 3GRWA 1GC1C 3CX5K 4Z95H 1H3WM 4CU7A 4U05A 5DRXA 1J0HA 1L7TL 5IBTH 4HIJA 4EIZC 2A74A 1QBML 1MWAH 4RFNB 4YHNB 2HWZH 3MFGB 1N8ZB 1JK8A 4R96B 5FYLE 3EOBA 2GY5A 1JMZA 2BNQE 4X5XB 1XT5A 3W2DL 4OSUL 2FZ3B 1V7NL 1CICB 3P30L 5F1IA 4P9HH 1B0RA 1CICC 1XIWC 5CWSA 1KN2H 5JW3H 1U3HB 2DI7A 5J12C 4D9LH 5GRWA 2WLYA 1WBXA 3DYOA 2DWDB 4F7CA 3FT4A 2VABA 3OJ2C 1CU4H 3ISWA 4N0UB 2MFNA 2BCKB 5CP3A 4YGVA 4J8RA 2ZPKH 2FX7L 1OGAE 4CMMB 4JFEA 5EBWA 3HZVB 1JZ6A 1NFDB 5IT2H 5M95B 4PJDA 4WFFE 4X4MA 5JDSA 2ZG3A 5D7SH 4LDOB 4H5SA 1NCCH 4JFDA 4KVCH 5L6YL 5A2KH 1KUMA 1OTTD 2BX5A 2NZIA 4WI6A 3JVGA 4LP5A 3O0RL 5CBAB 1GGIL 4AQOA 4OLXL 1DTUA 3Q5TA 1G0XA 2Y5EA 3SDCC 3TT1H 4BKLB 4FQ2H 5F1SA 3LRSA 5FOBB 3SPVA 1FYTD 3T2NL 4M8QB 4ZO8A 2D4DA 5E24E 4TTGA 4PLKD 3PDGA 3VWKD 1BIIA 1OW0A 4NO5A 3N0PB 2XNAA 1UZ8B 1P53A 4MJ5A 4Z77A 4NO5B 2FX9L 1DVFA 1J8HA 4M1CC 1BX2A 4WEMB 2VQUA 2F53E 2G75A 1T04A 1R5WA 3D69B 5E4EB 5DEZA 2ZUTA 4YPGB 4P2RD 1KGCD 3ZL4H 3BVNA 4PP1D 3NZ8B 3BKYH 1DQDH 4GBXC 4MXVE 2W65B 3PWUB 2OX5A 1JTTA 3IFPA 4Z77B 4WO4C 5EOCL 2A9ML 2W60A 5CJXC 5J3HD 1HNGA 5L88L 3QQ4B 3RTQD 2WWMD 4NSKB 2YMXH 4PRHA 4P4KB 1L4IA 1OWRM 4V1DD 1CD0A 4HULB 1T1WB 2KBGA 3HZVA 1MH5B 3AREC 3PG2A 3OV6A 4C55A 2P47B 3RX7A 5H94B 1FZOB 1S7VA 2E5EA 4I13B 5KSBA 3O9WA 1A22B 1IARB 3LKQA 2P43B 4HH9A 2QJDA 4OGYH 3PP3K 1D6VH 3DROA 4HD9A 1IGCL 3ZYJA 5BO1H 1ACZA 1Y18A 1SMAA 2QQLL 4JY6B 4C4KT 3WEXA 2JJVA 3DX6A 3Q48A 2QSCL 3I3EA 5T1LA 2JB6A 3MV8D 4TUJA 3KPLA 1J12A 5DVNA 4JVWA 4YAQB 3ZHKA 2EH8L 2P8MA 4U0RB 4RMQA 1JHTA 3M17A 1DVFB 4KJQD 3ZE0F 1S7QB 4GAGL 1J0ZA 1MF2L 3BGMA 4LSPL 3KR3L 2P5EA 3B2UC 2NPLX 4N0FB 5E2VH 1M1SA 5IVOA 1UEYA 1BEYH 1AC6A 3IGAB 4Z95L 2H2SD 1DQML 4NQEE 2UZIL 1BMGA 3OGOE 4OAWA 3MJ9H 2OL3L 1RUMH 5F70A 2YA1A 3QXAB 4D8PB 1FL5B 5F21B 4K8RH 4F58H 5E4IA 5IBLC 4PJHE 15C8H 4DOHE 5KSBF 3NIFF 3O6MH 5D7KD 3VWJC 3CNKA 4HS3A 3RRQA 3TBTB 4ZS6C 3O6FB 4IMKA 2XI9A 1CXLA 3ECBA 4LGRB 4NFDA 4P3DB 1J86A 4ONGH 1IBGL 4YHZH 1KN2L 1L6ZA 1BJ1J 3JXAA 3PXHA 5C2UB 1LEIA 3MR9B 1WSST 4P2RA 3DVFA 3UJIH 4KGJA 5B8CB 2EDKA 4OD2A 4PB9H 3P4OA 4C56B 2ESVE 4LFHG 5F3HB 1PKQE 3TZVD 1MVUA 1JZ5A 5EZOL 1MOEA 3S36H 1T7VA 2R39A 3IJYA 3TH3T 4QXTB 4UDTB 5C6TL 1BOGA 4NUGL 5TE6L 1XF1A 2XZQH 1V7ML 3RY4A 1F2XK 5IHZA 1BFSA 1CE6B 1XR9A 3L3HA 3HFMH 4TNVK 1FYTB 1CGYA 3EOBB 3JV6A 1NCCL 2DM3A 4LSUH 3B5HA 5JMOC 1E27A 1RJLB 4LVOC 3ARGA 4PRBA 1I1AA 1HXMA 3KPSB 3P9LB 3X3FH 2V7NA 4YNYA 5CMAB 2PW2A 1UJ3B 3ULVF 1UC6A 3EYQD 1NUNB 2DF3A 4OLXH 1FHGA 4MNQD 3VD9A 4Q74A 4NZUH 2OP4H 1TTGA 5FGCE 4GAJH 4H0HB 4RCAA 4PRBB 2CKNA 5E1AA 4PRNB 2NY6C 5DZLA 3S4SA 4FTVA 3BWUC 3UBXA 4KROB 4NYLA 3MLTA 1U8IA 3TH4T 1T7ZA 5EOTA 2ED7A 2BY1A 3LPGA 4OTXH 3E1F1 3KLHD 4ZG1A 5FB8A 3NFNA 3SY0A 4Y2OA 1QYGH 3RWFA 3UZQA 1AD9A 3G04A 1RV6X 5ANME 3BHBB 1P9MC 2J4WH 1KYOK 3PWPE 2FEEL 3ZKMD 4DCQA 5I16B 4APQC 1ZVSB 3UBXB 1KIPB 3WNOA 5L88H 5I2IB 4U2ZA 2ZG2A 2FWOA 4ZUVB 1T5XA 4OF7A 2RB8A 2YD6A 2Z8VC 1X3DA 3ZSSA 2MPAH 4YFLI 3EIFA 3UPRA 1VFBB 2X9YA 1B88A 3ARSA 2PW1B 1AXTL 4X0KB 2G75B 3D69A 2HLFD 4J3TA 4FQJH 4UILH 4WO4A 4KI5E 4TSCH 1YN6B 3ARWA 2E27H 4UV7L 5CUSH 2IF7A 1CG9B 3LB6D 1IGCH 1QBBA 4FQLL 4M1DL 4PJAF 4CMHC 5C08D 4XVJH 1F58H 3FZUC 3GSNA 4K2UL 3V0AC 5T1MB 3Q1SL 1HHJB 4FQQA 3CFIC 4JB9L 1MQKH 4WI2A 2HVKB 4UNUA 1MJUH 2G60H 4ZOCA 4N8VG 1OLZA 1OOAA 1HHIA 4HFUH 4KK9D 3SKOB 4XP5L 2RHEA 1DUYB 1YYLH 5HHXH 5JA8B 3WFCL 3VA2C 4CMHB 3KR3H 5CJQH 2P8PA 1NGZB 2PXYA 5FDWB 4OZFG 1TJIH 3LRHA 1A7OL 5EH1A 3QULA 1NBVH 3V5HA 3VG9C 1K8DB 5I1LA 3O8XB 1Y18B 4WI5A 8FABB 4LAJH 1E4JA 2WM0A 2HJLA 4JPWL 5KVFL 3OB0H 1QNZL 5TQ2H 1YEJH 1CL7I 2FJFB 2WINA 5HGHA 4F58L 5DHVH 4K9EL 4BK4A 5LGHL 1Y0LB 1AHWC 3KXFE 3CZJA 1A9BB 1U58A 1R0AH 3OAYH 4YBHA 4S11A 2J6EL 3H7BB 1CIDA 4ONGL 3O6KL 3GI9H 1F11A 3U7WH 1ZAGA 4YDVB 3SDXF 1WITA 5I73C 3MRFB 3MRGA 5EOCJ 1DBJL 4LCCB 3UJIL 3JUYA 3ARBB 1NMBL 5TQ0H 4DVBB 5I6XB 4Y89A 3S36L 3ARUA 1FG9C 4RIRB 4AEHH 4UAOB 5DGQA 1WIUA 4DN4H 3KLAA 2BNUA 5EORH 3IFOB 3FB6B 4W4NA 3TVMC 5E9DD 2AK1H 2ZWLT 3WUWG 5TDOA 4L5FH 1KTDB 3GI8L 3QI9D 1T7YA 4XBGB 5CHNB 2H1PL 4YHIA 5HHME 4ALAL 5FM8A 2CRMA 2W9LA 2CLVA 3QFDB 4HWUA 1R3KB 2NY5H 4KDWA 1ZWIA 4KFZC 2D7MA 4PJIE 1Q1JH 3P11L 1MH5A 3D2UA 5CEZD 3RJDA 2Q8AL 5IVZB 3UTTB 5T5FH 3DTXA 5K9OB 1T89A 1RJCA 2NZ9C 1QLEH 5ID0A 1N7MH 3HNVL 3MACL 4PR5A 3OMZA 2PO6C 5ECJE 5K93A 4YE4L 5EU6D 3O4LD 1PX3A 3QIUD 2YPLD 2BSRB 3ZYZA 2BMKB 3T4AB 4UOJA 4U7KA 5BCAA 3CFEA 2J4WL 5I18H 2NY3B 3ZO0A 5CEXB 2YD4A 3AAZB 2HT2D 2WIMA 1FZKA 1H3VA 2YWZA 5ISZD 2YS4A 4LEOB 2Q7NA 1TFHA 1CIUA 1M05A 3QIUB 4R3SA 3U30B 2VL5B 1XF3A 3L7EA 5E6YA 2FLRT 2PYFB 1I8IB 1MCFA 4OJFL 4H25A 1J1PH 1RZ8B 3JUZA 4YHLL 1ULVA 1I1FA 4NIKB 5JW4M 3P9MB 3SKMA 1S7TA 3KHOA 3UTSE 4X4XB 1FCGA 2H6PB 4LCUA 4OZFA 1FZMB 1NQBA 4MHHI 4TTDD 3W0WB 3WUWB 4FP8H 1SHMA 2WAHA 3S5LG 1KEMH 3WO4C 3TO4A 1MJUL 1XGTB 5DC9B 5H8DA 4XP4L 1YEEH 5HDLA 1TDQA 5EC2A 4CN4A 5AD0A 3BGAA 1LNUA 4QRSB 3HC4L 2EDTA 5JOPE 4PJIA 4NM4H 5HYSA 4AM0A 3BQUC 4DN3L 4Q2ZA 1LEIB 2IC2A 3QPXL 2NY7H 1T2JA 3FRUA 3AXLA 4XPTL 3DX9A 2FRGP 3TF7C 1TVBA 1MEXL 2FL5B 3HPLA 4XNUL 4RFEB 5HDBE 5DZOA 3HPJB 1QR4A 1S9VB 1DANU 4QRRE 2BVPA 4AEFA 4DGIL 2CK0H 4RMSA 1QNZH 4P4KC 3U7AA 2R56H 1SEQH 4YEFA 3ZTJH 4K9EH 5LGHH 3MUHL 5T3ZD 1R0AL 1I7TA 3P77A 3L1OL 1JZ8A 3KVQA 3MCLH 2CDGA 4HEPG 1AE6L 2BOCB 3GI9L 3MQIA 5AEAA 3L9RB 2DICA 4WTXA 3BI9X 3FFCE 1FVEA 2R2HA 2KDGA 5IQ9A 4ZNEE 4RDQF 4Y5YB 3V5DB 3KPTA 2Y7QA 4YHML 4N8PA 4K7PY 1LE9B 2VC2L 4U1MB 1F4XH 3FO9A 5EORL 5AG9A 2A6JB 5EBMA 3NAAL 5BV7L 3LSOA 4NN5B 3S8WA 5D1ZA 3Q2CA 4NRXA 3WNNA 1FVDB 1J11A 5IVXE 4B7IA 1F97A 4K94H 2FD6H 1T3FA 3LD8C 2FBJL 2ZSWB 1XR8A 1SJHA 2NY5L 5L9DH 3S36X 4ZOBA 2YPKA 2L0DA 1MRDH 2NY2D 4UBDD 3GM0A 1U8QA 5GRVK 2FJFA 3IU3A 2Q8AH 4DGYL 4Z0BL 1JYXA 3ESUF 4FFYH 3MV9A 5DQ9B 2PYEB 2LVCA 3MLWL 1F4WH 3DI3B 4QHNB 1H0DA 5IESL 2W0FA 1IAKA 1QFWI 4WRLA 1BIIB 3EZ8A 4R4ND 4Z7QE 5CD5D 1UVQA 4LQ1A 3ILQC 5D2LA 4N90D 3KLAB 3NZ8A 3JWDH 4IIQC 4X7FC 2GAZA 4G8GE 3PQYB 4HK3J 1OVZA 1A4KB 1KFAH 1GRWA 4MB4A 3TVMB 3R06B 3LN4B 2NY0B 4M00A 4X8XA 1NANI 4JZOB 3VFWA 1Q9WA 3HE6D 3ARRA 4CL7A 4PJ9A 5HDOA 4XHJD 3RGVA 2JF1A 1J8KA 1TETH 3CK0H 5C9KA 1JNHB 2VITA 4HS6B 3FONB 1BQLH 4YDLC 3T4YB 3BZFA 5F3BA 1VKXB 2Y6SC 3IU4L 3BH9B 3QUZB 4JR9H 2JK5A 2RFXA 1NC2A 3HB3C 3SDXE 2X1OA 3V5KB 1QFHA 4L8DB 1O0VA 1U92B 1HH9A 5TF1L 2AS5M 3FFDA 1HINL 3KJ6H 3IDYC 4KUCD 3D2UB 3C6LC 1U3ZA 2DM2A 3FQUB 1JPSH 3RL2A 3S97C 1KF9B 4NWTL 1QFWL 3BN9C 2ADIA 1IGTA 5DO2D 5IKCB 4FABH 4Y19D 3VWJA 5F8RC 4XCYA 4XP4H 3O8XC 2DQTH 2HKHL 1DBKH 2AI0H 5I75C 2QADD 3QUML 4DN3H 2A6IB 1KTRL 5TGBB 5F89A 3IAGC 4OCMC 5HI5D 1I8IA 4L4VE 4Z9KB 4LSVL 1JPFB 4N0FA 3P0YL 4TPRH 2HTLD 4JQXA 3TWCL 1T21A 3VXTA 4W70A 4CVXB 4MQSB 4L8CB 2ZP0T 3BP5A 3EO1B 2ENSA 4M6AA 4YK4B 4GMTL 5BVJB 3DV6B 1SM3L 5FGCB 4KJPD 3TYFA 5DD1H 1OHQA 4P46A 3UTSA 5FYLL 5D7JB 1CLOH 1UKQA 4LPXA 5JW4N 5KN5A 1S3KL 3R0MA 3VCLA 4K8RD 3MV7D 4PJIF 1BFTA 2YRPA 1EVTC 3NCCB 4KRPD 1NGPL 4K3GA 2ZOKA 2VOTA 3DYMA 3WS3B 1I1CA 1WCQA 5B3JF 1QD0A 5GGRB 4N0YH 4R97B 1OL0A 3VXRE 3JTTA 2EIZB 3VH8B 4EOWL 4OZIA 4C56E 1U8PB 2P48B 1TCRB 5IB3A 3BJ91 2CLRB 4LQFH 1CFSB 2VH5H 4MJ5B 3GB7A 1ZSDA 4HKXA 4FQCL 1IZKA 3KYKH 3RJQB 3NPSB 3BPLC 4PG2A 5TPWL 2XOTA 3MUZ1 3QDMB 4MJ6B 3ZTNL 4QHUB 5T3ZE 5B38B 5CEZH 3NZHH 2QSVA 1T2QH 4GRLA 4OF3A 4PJ5E 5KTEH 5L9DL 4WW2B 4BQ8A 4LPVA 3BVNB 2XQBL 3A0OA 1LHZA 5GHWL 5KS9B 2BC4A 4H8WH 1JHLL 1CFQA 1MCRA 5BW7A 4QNPF 3MTRA 4HUUB 4OF5A 3KXFD 4A6YH 5JXAH 4PJ8B 1F4WL 4O4YL 3CDCA 5SWSB 4NQEB 4TVPE 4MDIB 1P4IL 2OL3B 3WLWC 5T33H 3WJJA 1QKZH 3ETBF 3QUYD 4X83A 1U93B 5M94B 5HI4C 2H9GA 4JFEB 2VR4A 5EBWB 1JBJA 5ILTL 1A2YB 3ET9F 4XTRC 4W68A 2F19H 1CT8B 3IDJB 1F4HA 2X4PA 4RMWA 5IFAL 3MRDA 4JFZL 2X1QA 2CXGA 5E8PB 3HS0B 3IFNL 3IT8D 3P9WB 2VXQH 4R6UA 1C08B 1UXWB 1IJ9A 1KCUL 3H9HA 4BFEA 2E9IA 2GFBB 4TSAH 4NKOA 5IHUH 4XVUD 3D18B 1U36A 2N7AA 4KTDH 4ODSH 5CZKA 3P73B 3K2UL 2VISB 1KBGH 3HS0A 1JNNH 2VZVA 1RIHH 4LK4A 3QH3B 5TF1H 1D5MA 4JFXB 4ZS7H 4ZTOH 2CMRL 5H35B 4M48L 4TN9A 1IGJB 3TIEA 1IKNA 1LEKB 3TZVB 7CGTA 3VH8G 4HUVB 2LU7A 3F62A 3OPZH 1XIWA 4MD4B 4G8GD 4OFVA 1U3JA 3K8KA 3JTSA 1MRFH 3F7RA 4ZAKA 4JFED 4YZFF 2R15A 4KY1L 5DJYA 5DA4A 2AJZB 5DJYB 4Y4HD 4Y16A 1AFVH 5BRZB 2I07B 1BQUA 3G5VB 3W9EB 1M4KA 1JHKL 1U8NB 3JTSB 3SGKA 1B0GB 1AQDA 1OGTA 4RA0C 4MWFB 1A6ZA 1JGDA 1RUPL 5J0BA 4LSVH 1U3HD 4JREC 5DJCB 5GS0H 1AGFA 1II4E 2R1YA 4PTTA 2VERN 1U2HA 1ORQA 3ULVD 3RUGA 4IRJD 3S34H 3QAZB 5HYJB 1M7IB 4P46C 1U91B 3NFPA 1DVFD 4QXTA 4UDTA 4KKAC 4G8IA 1QTYT 1FFPA 2YZ1A 5I0ZA 4I0KA 3G9VA 4BUGA 1JVKA 3S96B 4LSQH 1BREA 1FL3B 4JEGB 3UMTA 3VRLE 3RUGB 2VDNH 3V4VH 3K3QA 1IE5A 4P23C 2NW2B 3OF6A 2DB8A 4NZDA 3CX2A 4K23L 4XVSH 3PP4L 4MXWL 5D4QA 3L7FB 2FNBA 3V6OA 3ARDB 4KAQL 1T4KA 1TJGL 1S7XB 1N3NB 1ACYH 5DRWB 5MEOB 2JJTC 3RWGA 4U6YB 1JYWA 1YY8B 4LQFL 2Q20A 3WN5C 5GZNC 2J6EA 3NACH 4AMKL 1I7RA 1T1XB 5D1QB 4FQCH 1QRNB 2ZG1A 3KYKL 2HH0H 3PL6C 5E4EC 4ZPVB 5C0ND 4M62H 3DO7A 1LEGA 4GUPA 5FXCH 2X41A 3ZTNH 3EO0A 3TESA 3CDYA 4U6HB 4HPOL 3JV4B 4JRXE 5GRUL 3ZKND 3C60A 1OP5H 2XQBH 1MJ8H 1ZTXL 1B2WL 3RVWC 1EHXA 3QRGL 4NC2B 5I19L 3QNYA 4L29B 3NIFE 4P2RB 4W4OA 4HWZB 4L8DA 4ONHA 5LVEA 4O4YH 3JTTB 1J7VR 4F7EB 4OLYH 1YPZF 1TENA 2QADB 1QKZL 3SCMB 1ZT1B 4H8WC 2QQNH 4IMLB 1JZ7A 1Z9SA 4WIQA 4MNHA 3VWKB 2AJYL 3SCMA 2MCG1 1S5IH 1N5YH 1IEBA 5ILTH 2GJ6A 4HDIB 1Q94B 4LBEB 1MFAH 5F9WC 1UH3A 3ARZA 4Y19B 5DEFA 3HLAA 4ZAKD 3L6FB 5AZEH 4RWYL 3PGDA 1XGRB 1ZHKB 4ZO6A 5HVFB 1TZIA 3RAJL 4D0CA 1JPGA 1CFQB 5CD3B 1QFOA 3I6LE 5GJTL 2AEPL 4TSAL 5JO5B 4GXUN 4OZGA 1U8LB 5J12B 3HMXL 1C5BL 5ERWB 1KBGL 4U3XA 5I17A 1VFAA 4M48H 2AJSH 3W11C 2A6KA 1QHPA 4D2NA 4S2SB 5J1AA 1KCRL 1MHHB 4O2CA 4IRJA 2PXYD 2F58H 3OR7A 4KGLA 2HMIC 4ZYKA 3U0WH 1MRFL 1TPXB 4J7RA 4CUCA 1SQ2N 2UVFA 4J3WA 2NCMA 3O6LH 1J0YA 4KY1H 3UTPD 2V5RA 5SX5H 1C16B 5MENE 1YEIL 4XB8A 3KHQA 3O41B 3KPOA 1EEUA 3FAWA 1KIPA 4RGOH 1BHGA 1NGQH 2DQEL 5FOBA 5CKAA 4DCQB 3GO1H 2GJ6E 2HJKA 4GMSH 4JRYE 2DDQL 4X99A 1S7SA 1DL7H 1S7WA 5ACLA 3FN0H 2YPKB 4KKBD 4OLVH 5KJRH 1S7SB 1IL1B 1QPXA 1UM4H 3WMSA 1RUPH 3WIHA 1W0WA 3VE0B 1NCAH 5HHMB 2QKIB 3NN8A 3O3BA 3WS6C 1YNKL 1FNSH 4Y5XC 4UU9B 3WFEH 2FEDC 2ICCA 1ED3A 2OZ4L 1CVRA 1B4RA 1WAAE 3QNXA 3QXDA 2NY1D 2FZ3A 3TH2T 4I5BA 1G7QA 3JWOL 4AK1A 4I2XA 1UVQB 1MQ8A 1Q9WB 2I07A 2ZUSA 1JZ4A 2ITCB 4HF5H 2C3WA 1UWEH 1VFAB 4NKIH 1JGUL 1FDLL 3FQTB 5DJXB 3HNTL 2BOCA 3E6HB 1NUDA 3SDDB 1KTKE 5IFJA 3VGFA 2R0LH 2IFFL 2C1OA 3QDJA 5IV2B 1GJIA 1K8IA 4MXWH 3QEGH 3HTLX 1R24B 3CMOL 1FFRA 5C71A 1KXTB 1AH1A 4YO0A 5T3XE 3C08L 3SGEH 4KJWC 2WINB 2YA2A 3F8UB 4M5ZL 5FV2A 3TJEH 1HZHL 5HGHB 4ZNCD 3RNQA 3H2WA 3UJTL 3V4UH 2B5IB 2KZWA 2DBLH 3RVXD 1NAMB 1EFXA 4X7EC 5D1ZB 4S0TD 2DAVA 3DGCR 4EZMA 4XAKE 4KMTL 4F2MA 2X89D 3TCLB 4MSWA 3RL2B 2NY0D 4H26B 1GVIA 3SDAC 1FC2D 3EYSL 1A5FL 1KCVL 2YKLH 3QG7L 4HJGA 3BAEL 1IAMA 1KCSH 3KYNA 2YPLE 1WBYB 3LZFH 4N8CH 1FRGL 1HDMA 3HI1B 3OJDB 2X1XR 3MZGB 3QUKB 3SJVA 2VTFA 3OKEB 1ADQH 5DJ6B 5ALBH 1MCNA 1N5YL 3E3QC 2P49B 4S1RL 2P5WE 4HZLB 1K85A 4NP4H 2KQNA 1MIEH 1JFQL 2DQIH 3WIIL 3QO1A 3W0WD 5I71C 1T1ZB 2C3XA 2NY4B 2VLLA 1WF5A 1F3JB 1FN4A 2ICEB 5ENWB 4EXPX 3QUYA 1RY7B 4JZNA 5K9QG 4IOSD 4NO3A 5I9QC 1V8HA 2Z0BA 2HT3C 1WUNT 4PJAA 3S88H 1E4XI 1PZ5B 4CNIA 4TVPL 1EFXB 1L9NA 3HE7D 5ID0B 5MP6H 2AJSL 2WWKT 4F33B 3BEWA 4Y1AB 3UTTA 4NQCA 1MCBA 1M71B 5T3XD 5CJOH 4MSWB 3IJYB 4PLNC 2HT4D 5GJSL 4F37K 4BZ1L 1U91A 3IDGB 1X5HA 1MPAL 1NBYA 2NY3D 4GRLD 1BFVH 1BVKB 1S9XA 5IFHL 4NFBA 5D2NA 3FB7B 2NXZB 3QIBB 3OKDA 3O4LB 1XZ0B 4HUWA 1KPUB 4DQOL 1MJ7L 4KV5E 3I6LD 3MJ8B 1JV5A 1QSFB 5FK9A 2XY2A 2XTJE 1YEDA 3ZE2E 1DL7L 5ISZE 1R5VA 4HEME 4LIQH 3BFOA 3OX8B 5KJRL 4Y5VB 4K7PL 4R2GC 4JHBA 4B0MM 3L7FA 1LO0H 3CSYA 4XCFL 4L3EE 4FQQB 3VDCA 2MQ0A 2ADFH 2XTJB 4PBXA 5JOEA 1C1EL 4FS0A 3VGAC 4RAVA 1AGEB 5C0FB 4KK8C 4UAOC 3VXTB 1GZQB 2XRAH 2YPVH 7FABL 4NM8L 5DHYA 1LP9B 1EBAA 2BRRH 4H1LH 4NKMB 3FB8A 4I3SL 4NQVA 4OD1L 5EB9A 5JW4Q 1A7QH 2EXYC 3UTZB 2B4CH 1RI8A 1UWEL 4YBQD 1JGUH 5TDPB 4WUUD 5BVPH 2GI7A 5EC2B 2IFFH 43C9B 3HPJA 5E2WL 5IW6A 1DN0A 2E7HA 1NFDA 5C6WH 1XR8B 1NDGA 1INQB 3U0TB 12E8H 2GTZB 2IANA 2O5YH 3FRUB 3RZCA 5J6HB 1J1OH 1HKFA 1D5ZB 2KZ1B 1JZ2A 1RZ7L 4LAQH 3FKUS 1RZJC 5GS0D 2XT1B 4QRQA 4QY8B 4M5ZH 1KIQA 2AABL 3C5SB 2AJXL 3IDIB 5EPMB 5DTFB 2EC9U 3MGTA 2VLRD 3QISA 5FUOH 5ERWA 4TQEL 2OCFD 5K59E 1YNTB 1G7LB 3MUY1 2PR4L 2H41A 4LKXA 5DT1L 3VFUB 4Y8AA 2FDBP 1CFVL 2IADA 3QHZL 4WI9A 3GBML 5IFJB 2YKLL 3Q3GA 1BVLA 1BQHG 3BAEH 1WK0A 3B4NA 1J5OH 3LEYL 4J2XA 1MY5A 2YC1B 3MCKA 5GS2D 2F8VA 3GSOA 4MGXA 3PDDA 1IAIH 2E7BA 3GRWL 2F54E 1RVFH 1IRAY 1ADQL 3QDHA 2Y07H 5C0DA 4U1NB 1WBZB 5IOPA 4X4ZA 4CADA 4MA3A 5IEKA 1MIEL 2IBZX 3GMMB 1FFNA 1F00I 5ACZB 1T2XA 3VD5A 4WWKC 1KB5H 3BKCH 4XAKD 4OCRH 2FGZA 2YSSB 4HWEH 8FABA 3BO8A 4TNVF 4Q0XL 4B5EA 5EIQA 4G8IB 3M45A 4EBQL 5ICZB 1GGTA 4XGZA 2V5SA 4KKCD 4HPYL 1GGYA 3QEQA 5EN2B 4IOIB 3S88L 3BWAB 4KKNA 1P5UA 2RAMA 2NLJA 3SE9L 1EERB 3K2MC 5DQDL 1JGEA 3PNWB 5ICZA 4KROC 5DRWA 4ZFOL 2IAMC 1U42A 5HD8C 3RVTD 3SE4A 5DURD 2VDLL 1MPAH 2X7LA 1DQDL 3EJZD 5F88B 2QL1A 3ULUE 1R5WB 1NANH 4JZOA 3BISA 2VXVL 2MHAA 3ARPA 1XGQA 1AJ7H 1A21A 2AXFB 1I7RB 1T1XA 3QDJE 4TOYH 1PZUB 5I74B 1FSKB 5L2KB 2YMXL 4PJBE 5D1ZD 4EQ2A 5DRNB 3ARBC 3H9YA 3IGAA 2ADJA 2X7LB 4DVRH 5CIPA 3MRBB 4LIQL 4Z7NF 1PW3A 4QT5B 4X5WB 1R5IA 3HMWH 4RZCA 3N06B 2XZAL 3SDCA 4OZHA 3HRZA 4QRPA 1BIHA 4RX4D 2NX5A 5FUCC 3TFKC 3DVGA 4GRWE 4OUOA 3P4OB 4J4PD 3CFEB 4A2LA 1UEMA 2QQLH 2VLJE 3K80A 5K9OA 1EGJA 1QBLL 2DWEB 2DM7A 2C5DC 2ADIB 3I02A 4XVTL 1JGVL 1T5WB 4N0UE 2ZUYA 1HDMB 5DK2B 5HVHC 2VDRL 4WDIB 4RMVA 4WFED 3RGVC 2D0FA 4K3JH 5BVPL 3T0VA 5GRYA 1CXIA 4NQDB 1PG7H 2F9BT 2LQRA 2X40A 3TPUB 4AEIH 4C56D 3EYFA 5E2WH 5D70H 5E2VL 1UQSB 1YMHB 5KVGH 1A1NB 4MB3A 5MENA 1W8OA 1W8NA 4OZGB 4PYHA 2E7LA 1RULL 1WCBA 3TGXA 1DQQB 2EDHA 3MJ9L 1MREL 3KPQA 3KPRA 3MA9L 1FL5A 4RAVB 4HWBA 3OG6B 1NMAH 3P9MA 2CUHA 3RWGB 2CXKA 2DMBA 2F8OA 1JGLL 4EI6A 3CSYB 3VRJA 5CEZE 1CCZA 4E0RB 4YFLF 4TQEH 4GJTB 3VXUD 5INCA 3THMH 4R8WH 4P2OC 3WIFA 1EHLL 3OHXA 1OT1A 1N2RB 5GGTL 1N59A 4OZGE 3WS6A 4NWUH 4O2FA 2VZOA 2OR7A 3T3MF 5C08A 4X6CE 1Z6JT 4N68A 5EU4A 3UJJL 2UZYB 1ZVSA 2DMCA 4FQXA 1CDGA 1WZ1H 4PJAE 5EUOF 3MLUH 4JO4H 4WI7A 4K07A 4DUXA 3T77B 1T5WA 3VWKA 5TE6H 2BSRA 4NKOB 2XZQL 5EG6C 3VA6A 4X6EA 2BVEA 1JJUA 4UT6H 3KPMB 3BMWA 4G6ML 1ZLWK 3U48A 4OGXL 5F9JB 4IDJH 1KB5L 4FQXC 2W07A 2DQCL 2CDFB 1TMCB 3IXTB 1EIBA 3MO1B 1VEOA 3MMEB 1I9JL 3IJSA 3OXSB 5F7FA 5IB2A 5C1MB 2HKFL 3PDOA 2NY6B 3X3GL 1BZ9B 4OLUH 1FFQA 4XPAH 3EDKA 3KWWA 2GYSA 1EJOL 2IMMA 4NZUL 1A4JA 2BSTB 5TE7H 2EC9T 4X6FB 4D9RD 1ZA3B 5I8KL 3TYGH 2KL6A 2X4RA 4XNXL 3VRIB 2AJZA 4EN3C 3SCMD 6FABH 5MEPB 3VRIA 3OKLA 3T8XA 1W72L 1BM3H 4I3RH 2Z31B 4RGND 1MLCA 3KS0H 4KZDL 1K4DB 2BC4B 3VXUB 4LVOB 2OTWB 4LMQI 4JKWA 2YEZB 4EUPG 4QKXB 3CFDB 3B3IB 4S2SA 2EYRA 1G7PB 3TV3L 3TA3D 3X13A 5D1XD 1MWAA 1NH6A 1VPOH 2NXZC 5C09A 3QHTC 2OQJB 5C09D 3OAZH 1AJ7L 2EXWC 5CGTA 1CD1A 2GITB 5EUOB 4XWOC 3R8BB 1R6VA 3NA9L 4OZIF 3HNSL 4TUJB 4AYFA 5HPMB 3T0EC 5E6IC 1MCOH 4LVHC 2ORBH 3KXFB 3E2HC 4X99B 4EKXA 3QIWD 6CGTA 1ORSA 2EO9A 4UILL 2B0SH 5F7WC 1NEZG 4G8GA 4M43H 1JYVA 1JUFA 5BRZE 3PWLB 4FQLH 2NTFA 5EZLB 2XWTB 3BXNB 5MERA 4K2UH 3GJEB 2NX5D 2Z93B 3P0VH 3Q1SH 2EKSA 3NIDF 3BRDA 1A6VL 4J3VA 2YWYA 4PREB 5I71B 2CGRH 4NSKA 1XIWB 3C5ZD 3B5TA 3O81A 5CHNA 3BP7A 1WISA 3T8XB 4RSVA 5DJDA 1F45A 1HNFA 5HJ3B 1AKJD 1KB9K 1X5GA 2VMFA 4F9PC 2KQMA 4AEIL 5DDHB 1IGFH 3QUXD 5KVGL 4J3OC 3EAKA 1N5AA 3U4EB 3PWNB 5IVXA 2Q76A 1AIFA 2C1OB 2DJSA 5DJ2A 2Z92B 3U83A 1EVUA 4BH8A 1H3GA 1INEH 1JNLL 1MREH 3VJ6B 4R97C 1CD9B 2IANE 3MA9H 5D7JD 1IQDB 4N5EC 3MLRH 3L95B 5EOQH 3HAEH 5B39G 1RIUH 2YHGA 1EGJH 4N9OB 5IB4A 1DN2A 3D39B 2GSGA 5GS1B 4WENB 3DXAE 5DUBA 5LAXB 5J8OA 3KXFA 3RTQB 4ZUWA 3HG1E 1F13A 4MZ2A 5F3HA 3MRMA 3FQUA 4XCNA 3O6KH 4ERSH 1FZJA 3E3QE 4L3EB 4PR5B 2CLZA 3VFMA 1DBJH 4FQ1L 4S1QL 4M9PA 1T1YA 1FL3A 2YD9A 4KQ3H 4ONOA 2WLZA 1K9TA 1DLHB 4POZD 4LCYA 5KANI 3LKNB 5KOVC 3RX5A 4BFBD 4YK4C 5JOFA 3WLBB 3ROLB 4UIMA 4PJ5A 2D7QA 4QCIA 1H3PL 4RMUA 4DN4L 3FT3B 4MCZB 5B39A 4HCRH 4MJ6A 4UT6L 4L5FL 2IPKA 3TBVA 1AGEA 1CQYA 2R69L 3LDBC 4ZDHB 2O93L 5DD0L 4ZD3H 2FCBA 3LMJH 3PWNA 2HKFH 4MCZA 1OAUH 3OGCA 1QSEE 1EJOH 3V6BR 4JY4B 3GJFK 3OKOB 3WS3A 5I8KH 4LOUD 2EIDA 2Y23A 4ZXBA 4X6CF 3MOAH 1OF2B 1E4KA 2BFVH 2NYYD 2ZUQC 3MRCB 4NC0B 3GHBL 1CQKA 4X9HA 4XC3H 1YY9D 5DK2A 2XG4A 2IG2L 1U8HB 3TPKA 1FBIH 3TV3H 1ZGLM 4LEXL 1NEZA 5I2IA 5I18L 3LOWA 1OTUC 3B9KD 5HYSB 1T1YB 3WNPA 3ES6A 3HLAB 3AUVA 2ESVB 5T3XH 1BD2D 2RIKA 1EEYA 2ENYA 3GMPA 4HDIA 4TUOB 5DYOB 5CJ8A 1I3GH 1FC1A 4RNRB 3V7MA 4W81A 1AP2B 2APTA 5DFWH 3MLXL 1S7UB 4I77L 3TEUA 4D9RE 4X5XA 3V9FA 4FTVB 2P7TA 3QUMB 4EI6B 3MV11 4KXZI 2A6KB 4X4XA 2JIXB 3V6ZA 2XFXB 2NY5C 1WBXB 4M43L 5GXBB 1PEWA 4UT7H 1BVLB 4OI9A 3OHXB 1P4BH 1OP3H 3OGCB 1CICA 1PEZA 4QO1A 5FKAB 3I6GB 5IJKC 5BOPA 4E42A 4M4RA 2LAAA 5BQ7B 4FZ8H 1YEEL 3H9SA 5I0DA 3QQ9C 4L4VA 1LO4L 4XP1H 3ULVH 1G6RB 1QFWM 5C8JB 4P5MB 4Y16D 4WNQA 4JO2L 3QNZB 3LD8B 5B38G 4ZUTA 1A7NL 4JFDB 3TBSB 3P73A 5F9OL 2XA8H 1Z3GH 5KSVB 3QEHA 2IANB 1MCQA 5C0AE 2C4FU 3RPKA 2GFBA 3D0LB 3E6FB 4I0CC 2LABA 1DN0B 2BXYA 1HI6B 4F57L 4PJGA 5F7DA 3MLRL 3PWLA 3R8QA 2ICES 1KIUA 1RAMA 5IB3B 3OJVC 3IXAB 3KPMA 5ETUA 5IGXL 3EDFA 4XP6H 2D31B 2LTQB 3DVNA 5A3IC 5J6GA 3QDGB 3MROB 2PTTA 2GEEA 4U6XB 4NNXB 3L1OH 1NGYB 5CJXA 2G2RB 2Z31A 1R3IL 5T1MA 3CH1B 4LLQB 3HE7B 4Z7VF 1WAAA 4FQ1H 3FQTA 2YC1A 3MCKB 4S1QH 4WHTA 2OJEB 4JGUA 2A1WH 4I9WD 4M9OA 2CDGB 2Z92A 1IGMH 4KQ4H 4WEBH 4UT9H 4NNPL 1N5AB 4WFEE 5ENWA 4MD0A 1H3PH 4LHQB 1RZGB 3IYLW 5D9SA 3FL7A 3VXUA 1KJVB 4JHAL 3G5VA 1MCEA 3P4NA 5DRZB 3ARFC 2NY4D 3KPPA 4BH7A 2P45B 1WWWX 5KG9A 1FJ1A 2WNGA 3QR2A 4L3CB 4M7KL 1RIVL 3VD7A 3TNMB 4EI5A 3DETC 1Q8MA 4FXKA 4I4WA 2CIKA 2HP4A 3QEQE 3QRFM 3VFRA 3FO0L 3U9PL 4XNQB 5J1TC 1AQKH 4P3CL 2I60H 4PGCB 4Y2DD 2LVEA 3QO0A 4F7TB 3UZEA 4YXHL 4F7TA 4LLYB 3WFHB 2VN7A 4N5UA 1OT2A 4AEEA 5BV7C 3LS5L 4DGYH 3WO4B 2ESVD 1DSFL 2BFVL 3HHRB 2BXZA 5E7BA 2GJ6B 1OM3H 1QSFD 4LHUB 5F7HA 3VFGH 3DSFL 4HIHB 4I0PA 1UWGH 3QIBD 5ICYA 1CZ8H 3GMLB 5D7IE 5C07A 5C0AA 2V2WB 5I1AB 5BXFA 5EU5A 3WDJA 1GXEA 4MVBD 4FFVD 3BMVA 1PQZA 3F12B 3QXTA 1KFAL 1D5BA 1T1ZA 4KK6C 1HOCB 2NTSP 2DI8A 3GDBA 5EU6A 4L8CA 3KPRB 3GIZL 3MFFA 3V52L 1XGQB 1FIGH 2OMBA 1OTSD 2UYLB 3WIFB 4YUEH 5J7CC 3T4YA 5IBUB 4M7LT 3VXRD 1EFXD 1CDCA 3MLXH 2R1WA 5B21A 4Z7WB 5DI8B 2F53A 2BNQB 4ESKA 2V9TA 4NQXB 1TVHA 4RDQG 3VW3H 1CF8L 4JQIH 3RDTC 2NR6D 4GG6F 4OD2B 1V3MA 3QWOB 4HIIB 1RZJH 3MRLB 3ESVF 4LLUA 5DMKA 4F7PB 3MR9A 1XCTB 4PPTA 3Q6FA 4HC1L 3KLSA 1C5DA 4NWTH 2EEDA 3UCRA 3VMPA 4X8JA 1RSFA 3P4MB 4LSTL 1YJDH 1RJYB 1NDGB 4LL9A 2IPTH 3HN3A 1S78D 3QIBA 4ELMF 4GXUM 4UOW0 4RQQA 4NQCB 5F9JA 4XP1L 3ULVL 4FG6C 2HKHH 1G7JB 2J8HA 1R3HA 4HK0B 1YEKL 1QSZA 3T1FA 1A7NH 4WEUD 1LDPH 1K6QH 1T0PB 4PRIE 3UTOA 5D7IB 1ZA6B 4QEGA 3VFSB 1JWSA 4R7NB 4HUKB 4OCSL 1ITCA 1CVSC 2VABB 3L7EB 3GMOB 2R0KL 1FVEB 2R2HB 1U3HA 2D03H 2YXFA 1HHIB 1NBZA 4JY4A 2ZSVA 1RZ8A 4Q9RH 3BKMH 1AO7E 3CLFL 5I1GL 3NCJL 1VGKB 1A1MB 4HHAA 5GGUB 4GKZB 1MIMH 4Z7WF 2X2YA 3S7GA 1EHNA 3DV6A 3HZMB 3IKKA 1Q38A 4Y5YA 2NX5E 4PJEB 2EIEA 2VL4A 4NKQB 25C8H 2FIKB 4LLWA 1VSCA 5HHOA 1IFHL 1XGUA 4HJ0C 3C5ZB 3TBWB 2A1WL 1XIWD 2VLMD 4D9QE 1CL7H 3UPAA 4JKLA 4JFFA 4NNPH 4QYOB 1MHCB 5DMIL 4X7CC 4GRWB 4XNYL 5HHVL 3O3DB 3GZKA 4N0YL 5EZJB 3C8DA 2GTZA 1SY6H 5CSZB 1U8HA 5C07D 2NTFB 3IAPA 3UYOD 1BAFL 1YECH 2VXUH 1SYVA 3MGOB 2M2DA 3TBWA 1ORSB 5F7EH 4H88H 4DKEH 3EHBD 3TBYA 1GHFL 1HI6A 4XI5C 3NCYS 4FMFA 1RHHB 2MKWA 2I60L 3FOLA 4MAYB 3PWUA 2W65A 1CN4A 1OTTC 2Y36L 1ZHBA 1HQRA 2GUOB 5HGAB 2MSPA 4H8WL 4RIRA 1GPOH 4MXQC 5I66B 5F96L 2V6HA 4DKDC 3GSOB 1CLYH 3R1GL 5MEPA 1UGNA 1IC7H 3CFCL 1FNFA 1OM3L 2BVOA 5F93C 4O02H 4PLKC 3T1WA 2DLTA 3VFGL 5HYSG 4KI5F 1FNGB 2O5XH 1A1OA 2QSQA 2CO7B 2I5YL 4BQCA 2HFGL 5DMJB 4M1CD 1MLCB 1S9YB 1T20B 4PJEF 4C57C 3QT2A 3P3YA 1XF4A 2FO4B 4P49A 2B8OT 2P5WA 2F19L 4PJ7F 1DLFH 1G7HB 1CGVA 3LKOA 3HUJB 3H3PH 3LHPH 1VACA 3VGEA 4WO4D 4YUEL 5HDQL 3RIFF 5J3HC 3LPWA 2FH8A 2YD8A 4G9FD 2JB6B 3V5HB 3CXHK 5E70A 4F2MB 1A3RL 1MCWW 2COQA 1HH6A 2R8SL 4ODSL 4OI7A 1C08A 1UXWA 4HKJA 2OJZL 1J0KA 4ZNEA 2I26N 4LRIA 3I9GH 4WDIA 3GSNH 2CMRH 3V0WL 5DF0A 5CGMA 4WV1C 2FB4H 1AGDB 3MLZL 3OAYK 3F58L 2ARJA 4GAFB 5FYKU 4JM2D 1MUJB 3DSNA 1EUTA 3CZFA 3T65A 4JFQB 1MCIA 2FHCA 1LO3L 4GFTB 5HHPA 5EIIB 1M7XA 5GIRA 1YEGL 3ZDXE 4EUPB 1F3JA 1FN4B 3BGMB 5IF0B 1MFCL 3BT2H 4PJCF 4XBGA 2UWEA 2W59A 3NGBB 5HJ3A 5JPMB 4JKPH 4Y5VC 1Z2KA 5SWSE 3U9UA 2W0PA 4Y0GA 1A4KA 3MGAA 5C7XL 5IP4A 1T20A 4OFPA 3QDJD 4OCSH 2ATKB 2BDNL 1DR9A 3R4DA 3B2UD 1N4XL 3FQNB 4WI3A 5BRZD 2R0KH 3IF1A 4X98B 5H2BA 5GGTA 2UWEF 4G8EB 4OGAD 4C83A 3SN6N 1FORH 1WQVT 1Z9LA 3AY4C 5DS8A 1UACH 3O3AA 5GSRA 3E2HB 5D1QD 4RBPH 1EX0A 4LRNL 2DLEA 4PP2A 4MA8H 5B8CC 3CLFH 2P42B 2V7HA 1G9EA 1Z9OA 4GS7C 3AY4A 4NQDD 5EIVA 3UC0H 3NPZB 2ZOKB 3QG6A 5ESAB 2VDNL 4QWWD 5L2JA 4G6KH 4HMEA 4S1SH 5GISL 3SGJC 5TE4L 4PGJA 1IFHH 4ZS6D 3B8YA 2KKQA 5ISZA 1BVKA 4PRID 4UI2A 3UTQA 5HGGS 4NNYB 4XH2A 3BSZL 4Y5YC 4QTIL 1T6WA 1F8TL 3O3EA 5ICXA 3O2DL 3QPQD 2HFEB 3TO2A 4EN3A 2KUTA 4D9QD 1YECL 3L3IA 4HIEB 4G5ZH 3WIHH 2X42A 3MC0A 1A3QA 3FB8B 1UG9A 4HV8A 2J7LA 2HH0L 4K7FB 1BBJA 1FYTE 4PJEA 1VFUA 4EEEA 5L0QC 1U8LA 1MNUH 3QUYB 4O2CB 4C54A 1MJ8L 3EYQC 4G43B 3SE4C 2WBJC 5EO9A 3QHFL 1HHGA 3QRGH 1B6UA 1OSZB 2A9NH 2JTDA 3OG4B 1QBMH 4DK6A 3R1GH 4DTGH 5D6DA 2FO1A 1AD0B 1LWRA 2FJHA 2N56A 2QR0B 5IJVA 1CGUA 2AJVH 5E6ZA 2O5XL 3W2DH 2I5YH 4J1UB 5J13C 3ZT5A 2VZSA 5KSVA 3EYOA 5F7UA 2ATPA 3D0VA 4HG4J 3RIAK 3DVIA 4L8SC 5C0GB 1WICA 3QWQB 5HYEA 4D9LL 4GRMA 1A6PA 1DLFL 3DUUA 4G8GB 1A47A 1X5KA 3GHEL 1S9WA 5MEQB 4GRMB 4KTEL 2L7UA 4ETQB 1LE5A 2EIZA 2HYMA 1DBAH 3ZKMC 3MOBH 5B22A 5SWQB 3B43A 1ZHBB 4Q9QH 4HQQL 1MFDL 4ZXBD 3VFVB 3SDDC 1A3RH 1WLHA 3V8OA 2YR3A 2XWJA 3DLQR 4XMPH 3HMXH 4Z7UA 4HMDA 4MDIA 1S5HA 3ILPA 1FQ9C 2FHFA 4YR6A 1C5CH 5D2LE 3IJHB 5BRZA 3SEPA 5DJDB 3OJMB 4HUUA 5IOPB 2V5TA 3BGFB 1AXSB 2EECA 1KENH 1UENA 1MAKA 1G7PA 1B0RB 5I1EH 1G7QB 2VLJD 3LB6C 2GT9A 3U4EA 5IVXB 3K4ZA 3FZUD 4ETYA 2F53D 4TNWF 3T2NH 3GBNL 4LRIC 2P46B 3EJYC 5DJXA 3QCUL 1YEIH 2BHUA 3OBAA 3IDNA 2G5RA 5DJ0B 1OAKL 1NGQL 1X7QA 4IDLA 2OTUB 1J05B 1EMTL 1AGBB 3PHQB 3UBXG 5CFHA 3Q5OA 3S5LA 3TNNA 4ORGA 2GT9B 1U58B 4P5TA 1A0QL 3H0TB 4Y4FC 3ZL4L 5DJZB 1INQA 3U0TA 4DW2L 4QRTB 5FUZL 2EDBA 4N0CC 4XPFH 3TJHC 3ARGD 1M7IA 3DO3A 4X6DF 4FNLH 3C8HA 5ACMA 2A9MH 3FB5B 1FL6B 4RRPA 4QRQB 2VDMH 4R90H 4YHYB 2VISA 1JUFB 3DI2B 1FL6A 2VSDA 4I18C 3D18A 4YHKH 3G5XB 3S35L 5E1HB 1K5NB 3S96A 2AGJH 5FECB 4G9FA 1D5XB 3FQXB 5HHQB 2X4TA 2Y5TA 2YD1A 1AGDA 4KMQA 1LQSR 3QQ3A 3NGBC 2IQ9H 4OCXH 3W9EA 3IETA 3C6SA 5BW7C 1BX2B 2R4RH 2Q6WA 1OAQL 3L3DB 4X9IA 2MTPA 4MQXD 3VG0L 3D1MC 2NNAB 4L4TA 3QUZD 5CZVL 3HR5A 2K7PA 2MHAB 1CE1H 1NAKL 1QZ1A 3BSZH 1X6LA 1YQVL 2FATH 1KCKA 1RZGA 2Y72A 1P5VA 4QTIH 5D9SB 5IQ7H 5SWZE 1LP9F 5JOFB 3O2DH 3VRJB 4TRPH 2EH8H 4K3EH 3QO1B 3TJEL 4G5ZL 4KHXL 3ARTA 2WBKA 2VAAB 5JUEL 4GAGH 3LEXB 4V1DB 3PWPA 5I76A 5EBLA 4GG8B 2BOBB 3PQYD 5CJ5A 1D6EB 3TN0A 1T66D 4WY7H 5ANMA 1P1ZA 3MRMB 3MRIB 1SVCP 1BEYL 1NBYB 3PWVB 1A7BA 4G3YH 4KHTL 5DUBB 4Z76B 1M05B 4OD3L 3EYSH 2OL3H 3KNBB 2GSGB 1JL8A 5GS1A 4P5KB 2DKUA 4KRNA 1R3HB 1U3YA 1FRGH 4P5KA 2BVYA 4K8RL 4RQQB 5FYJU 4L3EA 3ZKXB 3CU1A 1CDBA 1XEDA 2NZ9D 4HMCA 15C8L 2PO6D 3B2VH 4LKCA 5DXWA 1JWUB 3RKDC 5GZOC 4WCYL 3NVQA 1V3KA 1Q0YH 2ZCHH 2VDOH 4PJDE 4JDVA 4QGYA 3I6KA 1IBGH 4NP4L 3VFTB 4LCUB 3C60D 2GCYA 4J23A 4ZFFB 4ZQKB 1LO5A 3AMLA 3DBXA 5FM4A 3WIIH 3QXAA 2E9BA 4CVXA 2FLBT 1R3JA 3C09C 3MOBL 2JCCA 4YH6A 3N85L 5MEOA 1KJ2H 4JCMA 5CIPB 3ARYA 2EE9A 1V7MH 4LPWA 3MLTB 2VLLB 2XICA 3MRCA 1BBJB 1A7PH 1QVOB 1PKQA 5IVNA 4QTHA 3QEUB 2CKBL 2X44D 2DLFH 3CFKA 4GG6E 4QOKB 1QVOA 2V5MA 4G7YL 2DYPD 4Y4HA 3X14A 4OUUA 1TTFA 2VDPL 1Q94A 4LBEA 2B1HL 5CJOL 1PD6A 4MJIA 3V4PL 3RZCB 1QLRB 4BZ1H 5DLMH 4CU8A 5AG8A 3AMKA 1UM6H 4AY0A 3G6JB 5F7MC 3DX9B 4JPKL 3X12A 2ICWI 3GKWH 5IFHH 4C56A 3O2DA 3TBYB 4P5TC 5DYOA 4JRXB 2VNCA 3V7AG 4UU9A 4CRPA 1MAJA 1CGSL 3V6OE 2IALA 1DDHA 1EMTH 4X6DE 2Z9TA 2EH7H 5FO8B 5E95B 3WXVH 3WKML 3HZKB 1OSPL 1EFQA 1NEZB 4OTXL 2AJ3B 4Y4KD 4BFIA 4ENED 4LU5H 4JCLA 4A2MA 4JVPA 5D7IF 2AJ3A 1I7UA 2LAGB 3P4LA 4RWHA 4ETQA 4XPFL 1K4DA 3FT4B 1ZLWH 3PUCA 1C1EH 3UTPE 2XTJC 1OQXA 1T0NA 2JJSA 4ODWA 5GGVL 2X4RB 1I3RA 5F1NB 5F1IB 4I0PC 3SO5A 4M7LL 4UDUB 3RUGE 4GQ9L 2W0LA 1S9YA 5F6IC 5JIIA 1HQ4A 1U8NA 4YXLL 4UDUA 1N6VA 3SDDA 3PGCB 1AD0A 2FJHB 5LGKA 1AGBA 3PHQA 2B4CL 3TO4D 2L7JA 4CN6A 4F7CB 3PJSB 2R4RL 1ZE3C 5EBGA 2A6DB 1DJSA 1KNOB 2KPNA 3MRKA 4TSBH 4PFEA 1QA9B 3SJVE 2BNQD 1KB9J 4LF3A 3I6GA 3U4BL 4MDJA 1CE1L 5IEHB 4MS8C 5D96B 1NL0L 1MELA 4U6TA 5IQ7L 2HJFA 3MLYH 12E8L 3DWTA 4GS7B 1Y0LA 5T1LB 3BP4B 2H2PD 2G60L 4DFIA 1J1OL 4Y4FA 4ZFOB 4M93B 3GJFA 1RZ7H 1HYSD 4NFCA 2ARJB 1OP3K 1JRHI 1D5MB 2YSSA 1DDHB 1UADC 3O6FC 3NN8B 3IXAA 4MMXC 1D5ZA 4NO0A 3H9ZA 4PJBF 4R0LB 5E00A 4IEFB 3GMQA 5I9QB 1A14H 1TJIL 1UH4A 3ORJA 1FVCA 3S35X 4OM0L 1D7FA 1CFVH 3QHZH 4NPYB 3LQAH 3GBMH 4OIIH 5J11C 1Q9OB 4I48A 2D9QB 4N9GB 1RPQA 1G9NL 3WL9B 4UBDC 4LCIH 5TQ2L 1IM9D 5HGBA 4Q97A 3S37H 1E4WH 3L9RA 4POUB 1KTDA 3F7PC 3WV0A 4LSDA 3EFDH 1AQDB 1PY9A 3BPLB 3RI5F 3MUGB 1HEZB 3B2VL 3FONA 2OTWA 5D5ME 3QDJB 4S0SD 5ALCH 4V2CB 3SBWA 2VDOL 3PWPB 1LD9A 5CD5C 2EDNA 3HR5B 5CKGA 4NQSA 5I76B 3BDBA 3U7WL 4HJJH 5D72H 1QSVA 2FX8L 1QFUH 5BV7B 4LGPB 3MPCA 3KPPB 4BH7B 4JN2A 1T83A 3CVHB 4OCWH 3HUJF 5AWNL 4YHPA 3N85H 1KOAA 2E9JA 5J56B 4PB0L 2VXTH 3VDBA 4AEHL 1NGWB 4EBQH 4XHJC 4MAUH 3BEVA 2ZSWA 3GIVB 4GKSA 4IMLA 5ESVB 2BP3A 1U6AH 5DR5L 2K1MA 1Q0XL 3EZJB 4K94C 1PYWB 3R0NA 3RUGF 2CLZB 2Y6SD 4G7YH 3VFMB 3RVUC 2ICWJ 5HY9B 5DQDH 4XRCB 5ICXB 1LILA 2YUZA 3V4PH 1GGBL 4JO3H 3PE9A 4G9FB 4XXCC 4AJ0A 3P11H 1UM6L 4R26H 3CUPA 3WFDL 3B9KA 1XGYL 1A6WH 1WZMA 4ISVB 1DBML 3VXRA 4WJ5A 3UEZA 4YEEA 1N7ML 3BJLA 1LK2A 3BP5B 3EO1A 4TOYL 2X89A 4PRNA 5FYJD 5IB5A 5C92A 5CGYC 3O8XD 2XN9E 4L8BB 2MMXA 1I1FB 4MD5B 1I75A 3RWCB 3F6IA 2D7NA 4LU5L 1QR1A 1F3DJ 4ZUUB 1BLNA 3OKNB 4JO1H 1EHAA 3DO7B 4ZUUA 5B4MD 5DRNA 4J6RL 2XWBB 4D8PA 3GMRB 5C0EA 1T80A 3OKYA 2BNRE 1OCWL 3W39B 1HHGB 1YNLL 1D9KD 2HTLC 1J88A 3C9NB 1WTGT 1YZZA 2R1WB 4Z7UF 1SYSB 1S9XB 4JJ5A 4BA8A 3ARDD 4OZIB 3UTSD 3D85B 1BQSA 2H45A 1UCBL 3ABZA 2X05A 5E08H 2NW3A 4YDIH 4OJFH 4YXLH 3E8UH 3MJ8A 1LE5B 2D9CA 2OYPA 4X0KA 2BVPB 3U7YL 1U8PA 5JXEC 4LFHD 1BF8A 4K8RC 2FGWH 3T4AA 1IGIH 4FP8L 4MNHB 1T22B 4KRPC 2BSSA 1IZJA 2D7OA 4YLQT 1YDPA 1J8HD 5T1DH 3LV3B 3RPIB 1DUZB 3KS0J 3M1BA 2B1AL 1ONQA 4PJXA 4DOHB 8CGTA 5FO9A 1M6OA 3SKMB 3RKPA 4IIQB 5I17B 4NJAH 5T5NF 3B3IA 3CMGA 1JYNA 3P30H 4KMLB 4ZTPL 2GW5A 4RGMB 4GKZA 5D93C 3THML 1VB9A 2VZUA 4NYLB 4U1JB 4OUUB 5GGTH 4OIIL 4NZJA 4YHYC 1KJ3L 1JPTH 3CXDH 1WFTA 1G7HA 1OB1A 4RAUA 1F6AB 3I3DA 5JXEA 1CU4L 1WZ1L 2PNDA 2R56L 3O9WD 1E4WL 3PGCA 5E2UL 1AY1H 2ID5A 5EUKB 2D7TL 3MV9D 4MNQB 1MAML 2R1XA 3L5IA 2AQ3A 3T0EB 5ALCL 3T2QA 5D6DC 3H9HB 1DANT 3KLDA 3OTTA 4PJFA 2GSIB 4NKDA 1F11B 4IDJL 3OL2A 5MEQA 4F80A 1KIQB 2CUIA 4XTRD 4NQCD 4HJGB 4MZ3A 4XBEL 4CAGA 5F7DB 1TIUA 1CGXA 1KXVC 4PB0H 2DQJL 5F1KC 1ZANL 3VI4E 2X4TB 3TT1L 3PL6A 4FQ2L 3BGFC 1X6NA 32C2A 3CFBA 3NAAH 5DR5H 3BZ4A 4PS4L 1ZHLA 4JFFD 4P2QB 4FN0A 3VI3F 2FX9H 5JW5A 1IC5H 4I3RL 4LPCA 3FQRB 1J8HE 1WBZA 3MX0A 4OAWB 5FCSH 4G6AD 2VQ1B 3FB6A 4ELME 4PV8B 3K4DA 4I5BB 2MQCA 4MD0B 4Z6AT 5IV2A 1VPOL 4BJLA 1DUYA 4Z0BH 5EOCH 3WNMA 1DBBL 5JW5B 1NFDE 5H2BB 3V2AR 3LN5A 3FQWB 4MA3B 2WZPD 4PD4J 1ETZB 4KK5D 4P57B 3RVVD 3QB7C 4FZEL 3C5JA 1GL4B 2Q76B 3NA9H 5FA3A 3HNSH 3AS0A 2ZNXA 2JKXA 5JR1H 1FFPB 3ARQA 3V7AE 2C3GA 3NFPB 5I15L 3IDXH 3DX6B 4ZOAA 2FJGB 1D6VL 2B0SL 1T3FB 3AAZA 3N9GH 5HY9A 5DMYA 5KSUA 5MEND 3BWAA 1PQZB 3F12A 4N1HB 1LK3L 1PSKH 3FB5A 3IVKB 4E5XB 1TETL 3CK0L 1A9BA 4P9ML 3T0WA 3FQXA 1F3DH 3MSPA 1UCBH 5ICYB 2H26B 5E08L 4OI8A 2CGRL 1ZGLP 3GMQB 4ODVL 3ZSTA 4HZAA 1MUJA 3MJ9A 5KSAC 4PRIB 3MNVB 4YDKH 3SDYH 4TULH 4KUCF 4KKAD 4QHLB 1CFNB 1GZPA 4Z0XA 4DJMA 4ELMA 1VGEH 1MF2H 1FNAA 3ELAT 2FGWL 1W2KT 1LD9B 2A73A 2K7QA 5JLZA 2OLDA 3LH2L 4JKMA 1SMOA 3IDUA 5JIPA 5DSCA 3T0BA 4P59H 4WUUE 5EFIA 4M6OH 4JFFE 1H9VA 4PLJD 1DQMH 1HEZA 2UYLA 2BK8A 4ZSOE 3LEVH 1DBKL 2AI0L 1EGJL 2IBZY 4NQXA 4DK3A 1BFOA 3STLA 4NJAL 1ND0B 3TA3B 2X10A 1UXSA 3U36B 3MYJB 2NQCA 2CRIA 1PLGH 4JM2A 1EBPA 5C0NC 1KN4L 5AZ2L 1ZT1A 4KI5D 2VWEC 3NA4A 4ZUVA 4OF0A 3ZKNC 1JPTL 3MYZA 4TUOA 2O61B 4AT6A 1DLHA 2M26A 3BW9B 2CLRA 3RY6A 3RVWD 3ES6B 3MXVH 5J06A 4JDTL 1WZKA 2VE6B 3LN9A 2BSED 1RUKL 1FZJB 1AY1L 1OP5K 3O3EB 4QCIB 1KLGA 5DD1L 5C6TH 2VR9A 1UKSA 4JAMA 2OXHA 1UM5L 2J5LB 5JIKA 3D2UD 3MO1A 2PTUA 4JY5L 1S3KH 2PN5A 5I74C 3HCVA 3HI6H 2D0HA 4LSUL 4E41A 3HR6A 2JELL 4PJ9C 5C0JB 5E1AB 5FYKD 3X3FL 1LVEA 1YY8A 1KPVA 3EOYG 3ZDYF 4PGEA 3AU1A 2XWBA 1ZANH 2YPLA 2BJMH 2OP4L 5F44A 3G5YB 5DGRA 3EJJX 4L1DA 2I9TB 1QR1B 1JRHH 4FQXB 3HE6B 1JPST 4PS4H 5IQ9B 4K7FA 2AEWA 3GBLA 5C0FA 2ZUWA 3SDXA 1JF1A 2JIXD 2QHLA 4U1JA 1PG7W 3DGGB 1TNNA 5FKAA 5L8JB 2XV6B 1CICD 1P7QD 1QYGL 3SKNA 3K4AA 4UQ2A 5C0CA 5D7LB 1S7WB 3F5WB 4PGDB 1TVDA 4JN1H 3MREB 4OLEA 1L7IL 2LFGA 4A6YL 2PW1A 1P6AB 2IALB 1G7JA 3JV6B 4IOIA 4IRSD 4EI5C 3ULUF 1CDUA 2C9AA 4RFEA 5HGDA 1FAKT 3VFVA 5D7IA 1NFDF 5JR1L 4I77H 4P2RE 3NCEB 4MCYA 5EZIH 4KKBC 1YYML 3PABB 3C5SA 4X9BA 4ZSOA 2DI9A 3SQOH 5KBNC 2VZ1A 4M1DH 4LASL 1VEMA 1LO2L 5FHAL 5LBSL 5TDOB 4WUUA 1QRNE 4KVNL 3P4NB 4WW1A 4HS6A 2P5EE 1A1MA 5GGUA 3DECA 1KYOJ 3JBG7 4KTDL 2AXHA 4FZ8L 4YDKL 3E6HA 3TNMA 4EI5B 3VFWB 5CINH 4P5MA 1RIHL 3LN5B 4NN6C 1N26A 4XCEB 1YYLL 2CO6B 3WFCH 5BQ7A 1VGEL 4ODUA 5GRJH 3G6DH 3VGHA 1HHKB 2VLKD 1RK1A 1Z3GL 2HTKC 1P4LA 2WANA 3WSQL 1A7OH 3G6AB 4HAGA 4Q9BA 4M6OL 1HCVA 5FGSA 5IKCA 1I8KB 3RTQC 4XHQA 2X1WL 5I1IL 1WBYA 4OQTH 1AFVL 5K9QI 3GEWB 2IPUK 5HHPB 3Q6GH 4L3ED 4D3CH 32C2B 3MROA 4PJ5B 4LKCB 4DEPB 1JGEB 2IQAB 1SBSL 4NNYA 1I8LA 1MCDA 4CJ1A 5GS0L 3BIKB 4E5XA 3FJTA 5J9PB 2E7MA 4PJ9B 2NY0C 1XGPB 3PIQB 2GKIA 2OI9B 4XXDA 5I1CH 3F6LA 4BFGA 2P24A 3MRPB 4OIBA 3MZTA 4U6YA 4L1HA 4GH7B 5DMGD 2Q8BL 4GKNB 1H15A 4Z7WA 3QFDA 2RR3A 2ADJB 5GSRB 1LEGB 4GUPB 2DBJA 2EDEA 5I1KL 5DDHA 5JHLL 1DQTA 3EUUA 4V1DA 4FXKB 4M7KH 3A6BH 4G6FD 3NCMA 1OGAD 4ALAH 5IMLB 4OT1L 1SVZA 1AQKL 3HKFA 4P3CH 5CEXA 2BNRB 1XCQB 1KELH 1NGWA 1KIRA 3GM8A 3KYOB 3SDAA 2VSCA 2F54D 4OB5L 2Z91A 4TNWK 2EZ0C 4XX1G 1ACYL 3QIUA 1HKLH 2VRAA 3D25A 2X1PA 4HFWB 5I1DB 3ULSA 3WEXB 1E6OL 1FH5H 1IC4L 3Q5YA 3T0XA 2AP2A 1QLEL 4Z7VE 2Q3ZA 3HNVH 3MACH 4PTUA 2HT3D 4DUVA 5D71H 1FYTA 1AR1C 5D2NB 1OAYL 3DSFH 3N1FC 4XCNB 5C0AB 4HPOH 5GRUH 4WWID 2BY2A 3ULUC 5J1SC 4O9HL 1I9IH 1KTLA 5BS0D 4JFDE 1D5IL 1GZPB 4Z0XB 4M61A 4JPIB 4U2YA 2A0LD 4IRSB 1L7IH 3O45B 4PY8J 1FAIH 4DKFH 4JFEE 1WT5C 3MOQA 3DMMD 5CWSB 2DQHH 4MQ7A 3ALPA 3KPSE 3I50H 4CW1B 2VZ3A 1YMMA 2QQNL 4U6HA 3WUWA 1MHHA 1MFAL 4RGNB 5D1QA 1R3JB 5BVJA 5JORB 3QNYB 2A6DA 1F6AA 5SV4A 3SQOL 3SDXB 4E41E 4QOKA 1BZ7A 3BOVA 4F8QA 3GMRA 4LHJB 1ZS8B 5D1XA 5EO9B 1PKQB 3T2PA 2BNQA 3MNWA 3RAJH 5CLTA 3ULVE 1S7RB 3QDME 1MY7A 1QO3B 4HHAB 1BQHA 3D85A 1GC1H 3GJFH 4IJ3B 4S10A 1NMCC 1PVHA 4BKLA 5DK3A 1TVBB 5E9DA 1JF1B 3KGRA 1EO7A 3BQUB 4XNZB 4YQXH 5CEYA 1GIGL 3SOBH 1MI5D 3GSRB 5GRXG 3KLHC 4BQ9A 3L6FA 1FNEA 4PJCA 4S1DD 4Y7MA 4U0QB 4NOFA 4G8FA 5GRJL 2EICA 5C0GA 4XCCH 4YWGH 2R4SH 4PJGB 3RP1A 4XPTH 5HGAA 4MX7B 1KTLB 3WSQH 1FNHA 3DMMA 3FOLB 4MAYA 1W72B 1JV5B 3BPNB 3HZKA 4TVPD 3T1FB 4U7MA 4XC1H 3ZLQC 1I1AD 4UIKH 3BDXA 2GJZA 2Y4SA 4HKBB 1U8KB 4QXWA 1FO0B 3FHAA 4X7TA 2D03L 4GBXB 4DGIH 2W60B 2AV1A 3A67H 2ILLA 4JFYA 4PD4K 1X4ZA 5GS0C 4HH8A 1NC4D 2ED9A 3BUYA 3HAEA 3BKML 3UROR 3D3VA 4XPHL 2DKSA 3REWB 1GGCH 5I1GH 2EE2A 3CFDA 4YFEA 2VZTA 3GSQB 2NXYD 4U1KA 5JQ6L 4XAWL 3S5LB 4IM8A 3B9VA 1AE6H 2MKLC 1NCAL 4Y16B 4Y5XB 4ELKA 1G9NC 2AQ1A 4L4VB 2VAJA 3HG1D 3LPFA 4HAFA 1IAII 3BZDA 4WFGD 3LQAC 4B53A 1REIA 4O51A 4KH2A 4GKOA 5HVHB 4AIOA 1RMFL 1F4XL 4WHDA 1MHEA 3RA7H 4D0DA 1YN7B 5H37H 5TH2B 1MLBA 4HXAH 2VDQH 1UB6A 5LXGL 1E4KC 5BV7H 4CU6A 2EIBA 1BAFH 5DUML 5I1KH 1Y6MR 1T89C 1T5XB 1G0YR 5C0RH 3A6BL 3MRFA 4KDVA 2EEAA 2FECI 3HNTH 4K94L 1FVDA 1NKOA 1S9KC 1WJ3A 4OGZA 4PJGF 4XCYB 4NNXA 4U3HA 1SYVB 3MGOA 3BIKA 1W0WB 5C07B 1KELL 1IAIM 3EFFA 2Z8WC 4GAYA 3QWRA 4YDJA 1NCBH 1SJHB 1NUGA 2ZUUA 1OAXL 3CX5J 3DOSA 3NTCL 4GAYB 3D3VE 4R0LA 3ZZ1A 1GPOL 1KLFA 3MRNB 2AV1B 1XGPA 4FFYL 5BMFH 5ID1B 1CLYL 2X70B 3MRNA 4YIQB 5TFSH 2OI9C 3BH9A 3MV8A 5INDB 3TT3L 1A6ZB 5TJWK 1FE8L 3EO0B 4JZNB 4O9HH 2VDKH 3EO9L 5C70A 4KROD 2P1YA 1Z0NA 4L9LA 2V9RA 1X5YA 4I2XE 2X09A 3EJZC 3LN4A 3VJ6A 3H3PL 3LHPL 3N1GC 3I2CH 1RD6A 2VB5A 2ZCKH 4RX4A 4HT1L 2BY0A 4QOKE 3KYOA 4OLZH 4OBRA 2ATKA 2OK0H 2VUOA 4WI8A 1BQLL 3FO2A 3W0WE 1YQ2A 1FO0L 3QI9C 3CC5B 1BGXH 2YBRB 4GG8A 3IU4H 4PRHD 5KW9L 1IGTB 2R8SH 1YMMD 2FHBA 1JE6A 1JFQH 3WCYA 4FQHA 4HUNB 4LEOA 5T5NG 4P2QD 3I9GL 5HVWA 3QCTL 1HINH 2DJ4A 4M7JH 3H7LA 3KYNB 1I4FB 1CE6A 3V0WH 2FB4L 2OBGA 1E6JH 5EO1A 2QLVB 3ZHLA 4CN1A 1DQJA 1RZKC 5A2FA 3SGEI 4H26A 1UYWH 5EU7C 1TQCC 1BZQK 4KV5F 4FFZH 4XH2B 3KG5A 3LDBB 1YEGH 5C0JA 2YK1H 4M1GH 4GW1B 1L0YA 1Y6NR 1GIGH 1MFCH 3BT2L 4ISVA 3C6SB 4UINL 1N64L 5EO1B 4X6CA 5MP6L 2FBOJ 3O2VL 1BJMA 5D7JA 5KN5B 1UZ6E 4XCCL 5HYQB 3ZT6A 3BPCB 2MNUA 1N2RA 2JE8A 1RHFA 5JNYB 1A6TA 1FG2B 4MAYC 2VLRE 2P5ED 3C9NA 4AL8H 1VERA 2VWEE 2QQKL 5C08E 5SX4H 4OZHB 3G6JA 5C0EB 1SM3H 5DK0B 5E8DL 1B90A 3RI5K 1GGCL 5C0BD 4KPHH 4BSVB 2BNRA 3BN3B 3KJ4B 3DRTA 3I75A 5JQ6H 1GOFA 2HRPH 4QRRB 2VLRB 3IXTA 5GISH 4X6DB 1RU9H 4L9LC 1H8SA 3GMPB 5C0IA 5CLWA 5DFVC 4LVNB 4PY7A 1EAPB 4U49A 5CIPH 5K9JL 4M8QA 5BZWA 1B4JH 4X6EB 4M61B 4N8VB 3WHXA 1CK0L 2ERJB 2FL5A 3HPLB 1RMFH 4JAMB 3VXSD 3ULUL 3GMNB 5DHVB 4PGZA 1TZIB 1YEFL 3BQUD 4UV4H 5DUMH 2Y1VA 3WN5A 5IUSA 3IJHA 1TITA 1S9WB 2XACC 1OD7A 2ESVA 4X6CB 3U2SB 1TZHA 4OZ4B 1NGXB 2BSSB 3IFPB 1EPFA 4JQXC 1NJ9A 4CVZB 5EA0L 4QRPD 2O5YL 3UTSB 3NTCH 4J4PA 2Y7QB 3IFLH 4JPVL 4P4KD 3FOMA 1KJMB 4E0RA 3CVHH 4NQEA 2J8OA 1CLZH 5J1AB 3QHFH 3PHOA 3OQ3B 5C0BA 3LKOB 1X7QB 2AABH 5BMFL 5C8JA 1H8OA 4L4VD 1OB1B 4RAUB 4DTGL 5C09B 3WNLA 3FTGB 4LVHB 4NQSB 3VWKC 1RZKH 4HX1B 5FUOL 5T33L 1HXYB 1KB5B 1EZVX 1P7HL 4GW4A 5IW1A 1FE8H 1KC5L 1SJEA 2GTWA 3VXQB 5HHNB 3VXPA 2P8LA 2R2EB 4APQA 4PP1C 5CBAA 1JI1A 5IFAH 5DQ9A 3UAJC 3BRGC 3TA3C 4GBXD 3MRGB 2NXZD 3IFNH 2Z8SA 2VXQL 3GNMH 4LPYA 2I9LB 4IHOB 2Y5TB 4Q9QL 5D2LB 1MFDH 4OFYD 2WWMC 3E6FA 1I3UA 2Y07L 2YN5A 1FO0H 3SQBA 3PL6B 1BGXL 4I0PB 5KW9H 5HGDB 2RJMA 5E00B 4XMPL 1J18A 4X9GA 5DTFA 3IS1X 4UUJA 2APFA 5IWLC 3MBEC 3O2WH 1JNNL 2X70A 5JPNA 4HKBA 4Z8FL 3LIZH 4L9DA 4MLSA 4OCRL 5AAMA 4NUJA 2RCSL 4HWEL 4PRHE 2IH1A 1HSBB 2DYPA 4Q0XH 5IB1A 5I1EL 4WW2C 3VFOB 1T1WA 1AIFB 2V2TB 3CVIL 1YEHH 3HC3H 2C26A 3GBNH 4M1GL 4FA8A 1NCDH 5DJ0A 3LEXA 4NGHH 1F3RB 4JQVA 1E0OB 4U0RC 4XCEA 3ILQD 5KG9B 3GIVA 4GKSB 2PTVA 2EDWA 3S3JA 4L9LB 4KJQC 5JHDA 2V7HB 4PRPA 4TVSa 1A0QH 1U41A 3SDAB 2EYTA 3BPOC 1EA9C 3KYMA 3WXWL 3WKNA 4PRPB 3RZCC 1LP9E 3KPLB 1Z0MA 1EO8L 4JDZB 3G9AB 1G1CA 3QA3B 4WWKA 5KZCB 2IGFL 5L7XL 3TC9A 1ZT7B 2R0ZL 4JFOA 3TN0C 4JY6A 3C6LA 4R90L 1BD2B 3DJ9A 2YUVA 1XR9B 3L3HB 3B9KB 5HPOA 4HSQA 3FT3A 3DX7B 3PGFL 4G9DB 3S6CA 1UQSA 3ROLA 4KPHL 2Z4QA 3GJEA 3N1PC 1B0WA 1X5ZA 4Z7OF 5FFLA 3EDDA 3QQNA 4EDWH 5FECA 3U0PB 4M6NH 3OKDB 1QQDA 3VXMD 3IVKA 5A16B 1A9EA 5IMKB 4DZBA 3V4VL 3K81A 3HCVB 3VFTA 3WFBH 4JPIA 3EYVA 5DO2C 4DZBB 3VG0H 2Z35B 1JN6A 4LLMA 4ODBD 3W81A 3RWEA 3ZDZF 4K23H 1JWUA 3IDMA 2F15A 1KLUB 3WD5L 1MI5E 1YQVH 2FATL 2SEBA 1UT9A 1ZHNA 2FSEA 4POZC 4QT5A 3JV4A 4TRPL 2YD5A 4ONHB 5EOTB 4NJ9L 3RGVB 5GGSY 1MFEH 4OV5A 4U7SA 5I75B 5HI5C 3NACL 4X98A 2A77L 3TO4B 3RIFK 1TZGL 4PJHB 5EA0H 4PJ7E 1VADA 4K7PX 4FXGB 2DD8H 1ZTXH 1B2WH 5EBLB 4JPVH 4Z5RB 4G3YL 4KHTH 1KULA 1MHPL 2XKNB 2AJUH 2V17H 1W0VA 1QEWA 3OKKB