2YUVA

Solution structure of 2nd immunoglobulin domain of slow type myosin-binding protein c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
100
Chain Sequence
GSSGSSGAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Myosin-binding protein C, slow-type
publication title Solution Structure of 2nd Immunoglobulin Domain of Slow Type Myosin-Binding Protein C
rcsb
source organism Homo sapiens
total genus 11
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yuvA00
4KK6C 5D2LB 1BZQK 3I85A 2YBRA 4N8CH 5E8OA 5E2UL 1X9QA 5IQ9B 3N1GC 4M8VA 3T0WA 2R0LH 3WFDH 3NCJH 1T5WA 1RJLA 4ESKA 4DKAA 4KUCF 4HCRH 3GSUA 2FGWL 3ECBA 1T5XB 1NCAH 4Z77A 1DL7L 1IC5H 1P2CA 1TJIH 2AJYH 1Q0YH 5A2KH 3BQUA 1IMHC 4PJ8A 1OSPH 3CFBA 3KPRB 5LCVL 1AGCB 3I6GB 4V1DA 1F3DH 1INDL 4WRLA 3ES6A 5JW3L 5I73B 4OB5L 4XB8A 5KAQF 4MA1B 4RAHA 4MXQC 3WHXA 3W2DH 1HIMH 3WJLC 4PRHB 3I3EA 3W9DA 3CK0H 3BRFA 1F6LL 4NO2B 4YHOL 5KS9F 4OBSA 3RPIA 5D7JB 1DBBH 3UTZA 1MFAL 4QRSB 4MNQA 3U0TB 4YHLH 1ONQA 1NBYA 2H2SC 1UM4L 1MVUB 1QFOA 1UXWB 4GSDL 5DK0B 2BVQA 5D96B 4JM4L 3OKNB 2JIXB 1VFAA 5C0BE 1Z3GL 5C0AB 2EO9A 4TULL 4WO4D 4J3WA 3WHE1 1RZ8B 2F5BL 3PGDB 2HH0H 2Z93B 4NQXA 1XEDA 3HS0B 4NKQB 1Z0NA 2Y36H 4WJ5A 1J05B 2O61A 1BWWA 2X9YA 3BZFA 2HJFB 3V5HB 3C6LC 3TNMA 2DQTH 4LNRA 4M43L 1FIGH 5KANG 1R3LB 1TETH 1BBDH 1MCCA 3T1WA 2GTZA 3CFDA 5I8EB 4YK4B 5ADPH 5ID1B 4PB9L 3MRDA 3UJJH 3UTPD 2YUZA 3F7RA 2X70A 1J12A 3FKUS 3F7VA 1BFOA 1I9IH 3VXNB 4JKWA 1VADA 3SBWC 1AKJD 3QUZD 3DVGB 3HR6A 1EUUA 2DQIL 1MAML 3RWEB 3NH7L 1Z9SA 3QWRD 5DTFA 1ZWIA 5DS8A 5C2BL 2HJKB 1RK1A 2OR8A 4LBEB 3BH9A 3ARGB 3VXOA 3GMLB 2B4CH 4KQ4H 3U1SH 4LLYB 2P8PB 2QQNH 2VDML 1CR9L 2GJ6A 3CX5J 3QJHB 4PJFE 1EFXD 4FTVB 1J1PH 1EO8H 1RUPL 3DGGA 3QUXA 4KDTC 4HPYL 1CZ8H 4KGJA 3VCLA 2ZNWA 2O93L 4KZEH 3HRZB 5IB1B 4KRPB 3GHBL 5DA0B 5E1AA 2X09A 3KPOB 1KCUL 3RIAF 1MHHB 5BZWA 1PEZA 4C54A 4K23L 2MJWA 1YEGL 5J0BA 4WW1A 4NZUL 4ODWA 4KJPD 5E94B 5C09B 4DJMA 3RZCC 3REWA 1FLRL 1JMZA 1IBGH 2DQJH 3SDAB 5CGTA 3FT3B 3ARFB 3OKMA 5IMKB 2YPKA 1WSST 4MJ2A 1U91A 3S98A 4GG6F 4FQXD 4PD4K 3VFRA 4OLEA 5I1JH 1FDLH 2MPAH 3H3BC 4B5EA 3O0RL 5F93C 2X6MA 4NO3A 3LN9A 2YA2A 5GGSY 1XF5B 3TNNA 5GRJL 1ED3B 4DAGL 4M6NH 2EDYA 3D3VA 5FCSH 2HFTA 4ODTL 1W72H 7FABL 3PWVA 4MQSB 2G5BB 3VFUA 2FEEI 4AEEA 1TCRB 5FA3B 4QHUB 4HFUL 3Q3GA 3UTPE 2JF1A 3VG9C 3D0VA 2YBRB 1U42A 5E8OB 5T5FL 3WFHA 5J7CC 1HYRC 1DTUA 5ETUA 3BE1H 5DYOA 1LWRA 3WS3B 4EUPG 2F8OA 3MLWH 4HLZH 4JQXC 3RVVD 1T5WB 1RJLB 3B9AA 1BFVH 3GSUB 3U48A 3ECBB 1LD9A 1YQ2A 3P9LA 4DN4H 1P2CB 1F6FB 4LHUA 2D2OA 4HGKC 5SWQA 3BQUB 1NCWL 5TJWK 1ADQH 4PJ8B 4MB4A 3V95A 3S96A 4G43A 1ZLVK 3WEXB 1J5OL 3CFBB 1Z9MA 3ZTNH 1MHCB 4V1DB 3O6KL 4X7EC 1PG7H 2WUBL 3I3DA 1AJ7L 3WHXB 5CZVL 1P5VA 5JUEL 3IT8D 2DQEH 1B0RA 4QRPA 3W9DB 1TPXB 2DD8H 2Q76B 1WLHA 5IP4A 5GGQH 3NZ8B 3RPIB 5D72H 3HCVA 2X4SB 1JPGA 3FFDA 3UTZB 3L1OL 4LEXL 4MNQB 3EDJA 4R8WH 1P9MC 1ONQB 3BH8A 1NBYB 4A6YH 6CGTA 1FFPA 2EE9A 3FZUD 5D2NE 5AAMA 3L7EB 3RI5K 1VFAB 3RX7A 5DJ6A 5KZCD 4LHQB 2AI0L 3ZE2F 2FEDC 4R97C 1JTPA 1T21B 3HZYA 3OPZL 4W4OA 4OD1H 2DM2A 2B8OT 5D1XD 4DKEH 3D85A 3E8UH 2BVOA 1YEDA 3RL2A 3TZVA 4WJ5B 3CMGA 3V7AE 2O61B 2XY2A 4BK4A 3BZFB 2N7BA 4HX1A 5T1LD 2E9JA 2H8PA 3ARVA 3TNMB 5FUZH 2OR7A 2GTZB 1CDGA 3IJHA 4RZCA 5LXGL 2DQDH 4PJIE 4UINL 4YDIL 3UBXA 5MEOA 3MNZA 3IDMA 5GISL 4APQA 1I1FA 5CJXA 2X70B 5ALBH 3F7VB 1WEJL 4PJBB 1BFOB 2QSCH 2YD3A 3MZTA 2P4AB 3MNWB 1RZKH 1U2CA 4AJ0A 3N85H 1RSFA 2Z4QB 4G6KL 1NL0L 4P5MA 1IGYA 1BD2A 2NY5H 4L8DA 4CMHB 2MHAA 1OD7A 2DTMH 3K4ZA 5DTFB 1ZWIB 4UMGA 1KLUB 1RK1B 1A3LL 5FKAA 3UJTL 2AP2A 5JNYA 1MREL 1JZ2A 3B9DA 3KPRD 3VFOA 4E41B 4ZTPL 5IMLA 4XRCA 4LARL 5E2TH 2GJ6B 3V7MA 4G7YL 1A4JA 4ERSL 1JF5A 1I9RL 4OCSH 4P4KD 4WFHD 4HUVA 3DGGB 3HZVB 1ORQB 3QUXB 1QFPA 4S2SB 5D71L 3NPSB 4NQTA 4PRHD 1UC6A 2OR9H 4O58L 2CKNA 3STZB 3O11A 1E27A 3RVUD 3WXWL 3ULVD 5D7JD 4GRWF 4O2CA 3HLAA 3DSFH 5BZWB 1ULVA 4N8PA 1U8HA 2D7QA 3UYOD 4JVWA 2PW2A 3S34L 3UDWC 3U2SA 2JIXD 4WW1B 2HP4A 4ODWB 2ENYA 4YHIA 2DOCA 2FX9H 3PUCA 3REWB 1FNHA 3LEXA 1SEQL 3QXDA 3ZE1F 5DMGD 1F3JB 1KCRH 5HGGS 4DTGL 4W6YB 3EDDA 3OGOE 3OKMB 4PRNA 2Y5TA 2YPKB 4QEGA 1U91B 4PS4H 3HNVL 5FHBH 1T80A 4MWFA 1UENA 1HH9B 4O4YH 3JWOH 4NO3B 2K3TA 4PJDE 3ULVL 5IESH 4FA8A 1MEXL 1XGYH 1A22B 1IT9L 1KG0A 3WFCL 1LO4H 3D3VB 4XGZA 4QRTB 2BJMH 3K4DA 4L4VE 4Q2ZB 4H20L 3QQ9C 3HB3C 1T0NA 2NY2C 2WK2A 3PWVB 5BQ7B 5K59F 5T33L 3PP3H 1DQDH 2VDNH 3VFUB 1S8DA 2ZUQC 3D6GA 1FZOB 1I3GH 1JNJA 5D2LE 5DD5L 3MOBH 3Q3GB 5FV2A 1OOAA 1OF2A 3D0VB 3DIFB 1F58H 4KK5D 5ALCH 5ETUB 1JFQL 5DYOB 2XV6B 3K74B 3O2WL 4EDWH 5IVXA 1FV1A 5HVHB 4R0LA 4Y88A 2FJFA 3BKCL 4M03A 1LD9B 3P9LB 5I1GL 4FTVD 2ZKHH 1S9KC 3CNKA 4LHUB 2ITCA 1JN6A 2EKSA 3QH3A 5BS0D 5SWQB 2EIEA 3LZFH 1DP0A 1OWRM 2NY6B 1VENA 1UZ6E 3SGEI 3W11C 1S3KH 4O2EA 1R0AL 3S96B 4G43B 1LGVA 4MAUH 3KPRE 3DMMA 3R8BB 2R0KL 4QYOB 2ICEA 4KRMB 4WFHE 4X6BA 2AERT 2N4IA 4JE4B 4NUGH 2DRUA 3KPMA 1NGYB 3ARDA 3KG5A 3G04A 4U31A 4HV8B 4PRHE 5FUOH 5IVZA 3AUVA 1U8MB 1B0RB 1GAFL 3PNWA 5EORL 5C09D 5C0JA 5DT1H 2R1WB 3ALXA 1JPGB 4PJ7B 3FFDB 4PRAA 4TUOA 3SDAD 5IHUH 5TQ0L 5CZKA 1ZHLA 5DJ8A 2IGFH 3BH8B 4U1IA 2VH5L 1FFPB 3WS6C 2H6PA 3TT1H 4AL8L 5DJ6B 1KJ2A 4MMXC 1HQRB 4G80A 5HHXH 4AENA 3RTQC 5F7DA 3SY0A 5F88A 3MCKA 3BT2H 3TLRA 3BJ91 3DV6B 3K8LA 3D85B 5LQBH 4KY1L 1S9XA 1YEDB 3RL2B 4JCLA 3RHWF 2YPLD 5FO7B 4CVUA 4HX1B 4X7TA 1N7ML 2H8PB 1HHIA 3F5WA 4PJ9A 3QDAA 1NCTA 3SKNA 3ESUF 1GH7A 4LVNC 3IJHB 4RZCB 1OAKH 4FP8L 1DFBL 3OTTA 4CL7A 5HPMB 1GJIA 5MEOB 3MNZB 4BZ2L 4APQB 5AZEH 3FMGL 3GBMH 4TTGA 5E03A 4BK5A 4F7CA 4P9HL 2I9LA 4X4ZA 1IGCL 1QLEL 1XR9A 3DX7B 4KRLB 4QCIA 5KBNC 4P5MB 3HMWL 4X7CC 1BD2B 4L8DB 2CMRH 2MHAB 5DUMH 5E6IA 1TJGL 4PJHF 3BQUD 1DSFL 5CZXD 4UB0L 1L4IA 4WDIA 5FKAB 4PJ8D 4D0BA 3DUSA 5JNYB 4HUXA 5D93B 3WDHA 3VFOB 5IMLB 4XRCB 3QXUA 4YXHH 4FTVE 1Q9WA 4JFQA 4V1DD 5IQ7L 1A4JB 5KVDL 3SQOH 5C0NC 1C1EL 1T1ZA 2AV1A 3QFDA 4HUVB 5BS0E 1TDQA 3M07A 5E7BA 2AKRB 1ZTXL 3UXFA 4MGXA 1F4YL 2I60L 3BJLA 4J2XA 1KLFA 1S7VA 3O11B 3L5WA 2R69L 5BO1H 5BMFL 4O2CB 5HHQA 4MNQD 5E2WL 1P4BH 5GZOC 4HIEA 5ECJE 1RZJC 1U8HB 4MXVF 3GRWA 5A2JH 4JFPB 3CSYA 4JHAL 3U2SB 1OTTD 1KN4L 1WTLA 3AMKA 3C60A 5C09E 1NKOA 2A9ML 3LD8B 4YHIB 4TQEL 1FBIH 1QFWI 3ZKMD 2GAZA 3LEXB 3QEQA 2CGRH 2R2CA 3QXDB 2HT4C 4JO2H 3HG1A 5KJRH 3VFPB 1MRDH 3UYRL 4OD3H 2DWEB 3BYYA 4GBXC 4H1LB 3P9WB 1FH5H 2AEQH 1IVLA 3QPQD 5D6DA 1UZ8A 4MCYA 4EUPH 4Z7OE 1SBBA 4MWFB 4UNUA 1J10A 4HT1H 2DQCL 1NEUA 5IFAL 5JHLL 4OCRL 2DQGL 4KGLA 3KYOA 2XZCL 3QO0A 3IS1X 5ERWA 3QPXL 5K93A 1KG0B 3PL6C 1CFVH 4AEHH 1BZ7A 3G5VA 3O4LB 1S7SB 2YPLE 3LIZL 1X4YA 3M8OL 1KB5H 3O3DA 1NCUA 2K7PA 2XZZA 3TBSB 1S8DB 2ZNXA 1DUYA 4Z7WA 3T3MF 3QUYB 1TIUA 4ETQA 1L7IL 4I0PB 1D6VH 3N0PB 4KVNH 4K8RD 5FA4A 3QFJB 1YY8A 3MJ8A 4HXAH 4GAGH 5ESAA 1FV1B 4R0LB 1HE7A 3MXVL 5GGRA 2AGJH 4OLVH 2Z9TA 2GJ6D 2NY1C 3TVMA 1NSNL 1YJDL 4YWGH 2W9EH 2BY0A 1JN6B 3QH3B 5FIEA 3QUXD 3O2VH 2EZ0D 1II4E 2JCCA 4JFYB 3HUJA 1G7IA 3RVTD 2H3NA 1E6JH 1AO7B 3DMMB 5F1NA 5DD3L 4V1DE 2ICEB 2EDBA 4LCCC 2AJVH 4WUUA 4X6BB 1F2XK 3VRJA 4K8RL 5MEPA 3KPMB 3ARDB 2X1WL 3T09A 4F58H 2VDOH 3G04B 5IVZB 1MCDA 4RAUA 2X7LA 2D31B 3KNBB 3PNWB 3EJJX 4A2LA 4CW1B 4ZFGL 1W8OA 1WZ1H 1TLKA 4LPXA 4MNQE 1Z5LA 1SJEB 4M6OH 2LV4A 4PRAB 4Y2DC 1ZHLB 5DJ8B 5HHMB 4U1IB 1EXUA 4I0CC 3VG0H 2OI9B 5T5NF 4EBQH 3LQMA 3VXSA 5F72S 2VXSL 4PY8J 1JK8A 1J87A 1FGNH 2ED8A 1KJ2B 2OL3A 2XACC 5DJZA 5GIRA 5I1DA 3ULUC 2IBGA 1PEWA 4AENB 2VRAA 5F7DB 1H5BC 3SY0B 4GRMA 1QSFD 5F88B 3MCKB 5I1KH 1WIUA 5D1ZA 2FHBA 4WI9A 1S9XB 3KVQA 1MHEA 2APVA 3FB5A 1X44A 1AI1L 5DJ2A 4X7TB 1RUKH 4NJAH 1M4KA 4PJ9B 5FM5M 3VFVA 3SKNB 2X4PA 1UJTA 3D5OF 3P30H 3H42H 4RFNB 3LN5A 2XKSA 5DZNA 3QZWB 4UT9H 1IM9D 1GPOH 5DJXA 4F7CB 1ES0A 2Y72A 2R8SH 1XR9B 1KJVA 4QCIB 4Y5YC 3MBEB 4QHLB 1OAXH 5F1IA 4LAQL 4LHUD 3O8XB 4IOIA 2Y7QA 4R2GC 4WDIB 4P2YA 43CAA 2JJSC 3WFZA 3DUSB 4NPYA 2NR6D 4HUXB 4NIKB 3EOYG 4HWBH 2GJ6E 3IXAB 2WBJA 5B39A 2CLVA 1DBAH 4G8IA 4JFQB 4M7JL 2E7HA 3IDIB 5B22A 2AV1B 3QFDB 1A64A 4WCYL 3EJZC 4QRPD 1AXIB 4CGTA 5I8CA 1NGPL 5EG6C 1NAMA 4LSUH 3L5WB 4MB5A 5IGXL 4XMLL 1XMWA 3BIKA 4HK0A 1KJMA 3OAZK 4HIEB 3G5XA 1EV2E 1I1AC 4PRIA 3V6BR 1C5DA 3RI5F 4F80A 1HEZB 1JZ5A 1HHJA 5I66A 2GAZB 5E8DH 3QEQB 5DURB 1S7TA 3O3UN 2J6EL 3GSWB 4Y89A 4TOYL 2O26U 2QTEA 4AT6A 3NFSL 5AWNH 5J9PA 3TZVD 2BHZA 4ZFOB 2APWA 3FOLA 2FR4A 4MCYB 5CD3A 3PGCA 4IOSD 3X12A 4YXKL 1OAUH 1OP3H 3PHOA 4JHWL 5KSUA 2D7TH 3CFIC 3D3VE 2PO6C 1QG3A 3CXDL 1GZPA 3VH8A 4APQD 4M7LL 1SM3L 2B20A 1DDHA 4KKNA 1J88A 4UU9A 4Z9KB 3O3DB 4LKXA 4H0GA 4ENED 1CFQA 4UT6L 1B0GA 1A2YA 2JB6A 3KYAA 3BKMH 4JQIL 1BD2D 5C6TH 5DLMH 4KFZC 1F00I 1XFPA 1LP9F 2DB8A 2XZAH 5FA4B 3MPCA 3L5XH 2GSGB 2X42A 3MJ8B 4GMSH 4NGHL 5ESAB 3VWJB 4JY5L 2CQVA 3TVMB 4MMZC 4YGAB 1C7TA 1NUDA 5TFSH 3C6LA 4DUVA 2R2HA 3MRNB 1D5ZA 5TPWH 1OAQH 3FTGA 1ZOXA 3HUJB 1G7IB 5IB2B 4POUB 4JZNA 1QNZH 5F1NB 3HE7A 3VJ6A 4XVTH 4UQ2A 1QFUH 5CJ5A 3VRJB 3MFGB 1SMOA 3IRPX 1X5HA 4DK6A 2BMKB 4OQTA 2YD4A 4QRPE 3BEVA 2X7LB 12E8H 4TVPD 1LO5A 1YZZA 4KJYA 6FABL 3BWUC 4F8TA 3U83A 1Z5LB 1NPUA 4PRPA 4YC2C 1ZHKA 3AS0A 1EXUB 3WNNA 4PG2A 3L3DA 1Q1JL 1JK8B 2OL3B 5DJZB 3EYSH 5GIRB 4OZFG 1OPGL 1WWBX 4IRZL 4QRQA 5LAXA 2EDTA 4DEPC 4XCNA 4Y4HC 4ELMF 5D1ZB 4JKLA 1MELA 1ZS8A 1MHEB 4K71C 1KCVL 3KLSA 4C83A 5IVNA 2H1PL 4Y16C 4TVPL 5DJ2B 3D1MC 5B21A 3C8HA 2A9NH 1BQHA 3DETC 2IPKA 4KMQA 2X4PB 3O81A 3T4AA 4KV5F 3S37L 2PUQT 1CGWA 1C5CH 1EEZA 5DJXB 1ES0B 4YGVA 1TQCB 5HYSG 3DRQA 1KJVB 5IW1B 1JGVH 3O9WA 2CLRA 4RGMC 1BD2E 2OS7A 1N26A 1CK0H 5F1IB 4XAKD 2X1XR 3C5ZC 2Y7QB 3ZDZE 3SGDI 43CAB 3VXMB 4HCRA 1A7RL 1T1WA 4NPYB 4EI5C 3DMMD 5SX4I 2WBJB 3V6OC 5B39B 2CLVB 4RX4A 4O9HH 4FFVC 1LEIA 4G8IB 3ZLQC 4XNUH 2ZCKL 4ONFH 1WAAA 2J1KA 3ARDD 4GOSA 5EC2A 5BZDB 4EDXA 4NNYB 4L9LB 3TV3L 5I8CB 1NAMB 2M26A 3JV4A 2DMCA 4MVBD 4JLRA 5J12C 1CI5A 3F7QA 3JWDL 1CDCA 2OK0L 1AGEA 5EU7C 1MFEL 1MH5A 1LEGB 1T04A 2CK2A 3BIKB 4HK0B 3BW9A 1KJMB 5HHMD 3G5XB 2FH8A 1REIA 5HVGB 4WHYH 1RUAL 4PRIB 4PUBH 5D1QC 1C5DB 5SV4A 1KIQA 4TPRH 2X1PA 1T0MA 4XHQA 1UXSA 2PKDA 1HHJB 3OKEA 1F4XH 3BISA 1RURH 2D0GA 4RDQF 1P69B 1BX2A 1S7TB 5I17B 4XCFL 1ZAGA 5FGRA 2NY0C 4LVOC 4PBVC 4AT6B 3A0OA 4J8RB 5J9PB 5HHPB 3FOLB 4P46A 2FR4B 1FZJB 4E42A 5CD3B 3PGCB 1MFDL 3HMXL 3QHZH 2AQ3A 1D9KC 3PHOB 4PJ9D 5KSUB 3RDTC 2CXGA 3MV01 2ZUTA 3GSNH 2VZ1A 4KUCD 3O4LE 3HN3A 1Z6JT 3I75A 2P5WD 2K1MA 1MLBA 2FATL 3N1PC 4XMPL 3HAEH 1CGSL 1DDHB 1CTNA 3DXAA 4H8WL 4OIIL 4UU9B 5SV3A 4LKXB 2QQLH 1CFQB 2EYSA 3QDMA 1B0GB 3GEWB 1A2YB 4K3EL 4JVPA 2JB6B 3V7AG 2A0LC 1AHWA 5EO1A 5IROC 3V4PL 5E6ID 1T7YA 5IVXE 4KHXL 3E6HA 2ZPKL 5I71B 3TO4A 2BY2A 4YDLB 2EYRB 2V2WB 4Y4KA 3ZDYF 2CK0L 4XAKE 4GRLC 3OAYH 1KCKA 1QP1A 3V6ZA 2C5DC 5LKNA 4CVZA 2VISA 2R2HB 2QR0A 5L7XH 1DBJL 3FTGB 3KAAA 5DHVB 5C9KA 3IDJA 2VLRA 2ZP0T 1XF1A 3B9KD 5TDNA 3W5NA 3HE7B 1I8IB 1QFHA 3VJ6B 1CLOL 4UQ2B 4EXKA 4YEEA 3HKFA 4WU7A 4HF5L 1A6PA 2NXYB 1JYWA 9CGTA 4U1GC 4U2ZA 1MQKH 4OM0L 2Z8VC 3MRJA 1RQ5A 3BEVB 3C60D 3T0AA 4LF3B 4XPGL 1LO5B 3PG2A 3QEQD 4HWNA 5DURD 1MCRA 4XI5D 3PWJA 5IM7A 2NY7H 1OTSD 1B90A 3HG1D 4PRPB 1ZHKB 5HHME 3BGFB 1DBKL 1Q9KA 1JBJA 2JJUA 1QBLH 5F70A 5F44A 1JJUA 3L3DB 3FRPA 3L3IA 5CEZH 3T3PE 1X6NA 1OW0C 2BCKA 1NDMB 5DQJA 4XCNB 3EFFA 4MAYC 3C08L 1EEYA 5GHWL 5TH2A 2YEZA 3GRWL 5BV7L 1T0PB 4C83B 4JCMA 1TVBA 1UA6H 1ZGLM 5DHYB 1KPUB 2PXYC 5HI3C 1BQHB 4JM2A 1JHKL 3HE6B 2ADJA 4UBDD 4N5EC 1CVRA 3T4AB 5D7IA 4KKAD 3W0WA 1NGQH 4JO1H 1W72A 3TEUA 1Q0XL 4M48H 1GHFL 5A2LH 1EEZB 4RA0C 2IAMC 2VSCA 4M62L 2B1AH 4YGVB 5DD1L 3DRQB 1IGTA 1WIPA 2AEPH 3O9WB 2CLRB 1J0HA 4JN2B 2HFFA 1TTFA 5J3HC 3GMQA 4N0FA 4YLQT 4KMLB 4NN7B 3HI6H 4LQ1A 4B7IA 3MV8A 3SDDC 3ZL4L 2HT2D 4Z5RB 4F3FB 3OF6A 1C7SA 1CXHA 3IKKA 3LKQA 3BAEL 1KYOK 1FNGB 4HGWB 3PJSA 4WUUD 5GS1A 3KWWA 5TE7L 1ZLUH 5K9JH 1ADQA 2J8OA 1BWMA 4KDWA 5EC2B 2WMPA 3D0LB 3GZKA 4JVUA 2FX8H 3X3FL 4J4PC 3JV4B 4U1JA 4Q6YA 4HFWB 4HBQA 4JLRB 1JZ3A 4HKXA 1ZEAL 1NAKL 3BPLB 5GRXG 5D8JH 5C7XL 3EW3B 3P4OA 5EIIA 2UWEF 1OTUC 4H26A 1A6TA 5TF0A 4ZSOB 5T3XH 3B2UD 3QNYA 4LVHB 3LDBB 4KKBD 3VXSD 2D7PA 1UXSB 3C8KB 3QEQE 3TBVB 1BX2B 4RMVA 5B3JF 3MZGB 1JYXA 1GC1L 5D1ZD 5GS0L 4OLZH 1CGTA 3MMEA 2R9HD 5DFVD 1ZA3A 1TNNA 4P46B 3KPSA 4BZ1L 4E42B 4F57L 5C0RL 4OT1H 1KBGL 4JEGB 4LRNH 3K2MC 5FKPA 2V2XA 5FM8A 1KCSH 4F15B 1CFNB 3VGFA 4R4FH 4EJ1C 3I75B 3P0YL 4KK9C 1VPOH 1MWAL 2P46B 1MLBB 2R1YA 3GIVA 2OL3L 3PP4L 3DXAB 1TQBB 4K7PL 4HC1H 4YX2L 1N64H 4Z7WE 3EFDH 4OCNC 2RFXA 3QDMB 1LEKA 1VHPA 3H7BA 3U30C 4U05A 1MCBA 4NO0A 4YDVA 4GAJL 1AHWB 3RGVC 5KSBF 3CLEL 1KTDB 1QYGH 1JF1A 4B50A 2L7UA 2WWMC 5I19H 4ALAL 1KIPB 1IQDA 3B2VL 1MF2H 2XNAA 2HN7B 5SX5H 1BEYH 4L4TA 3RWJA 1IC7L 5IBLD 1T03L 5DRXA 5HSFA 3E6HB 3BX7C 1QPXA 3TO4B 4WW2F 3LCYA 2WBJD 1WITA 3NA9L 4R9HA 4BFIA 5ADOL 2V17H 3HUJE 2QR0B 3WNKA 2P8MA 2QLVB 5IF0A 3IDJB 2VLRB 4OLXH 5I1IL 3B4NA 4OZFH 2I9TA 2AABH 5TDNB 3GO1L 5JHDA 2DKUA 4WUUE 5IBTH 1P7HL 1CDJA 3WE6A 2GITB 1NCDH 4WU7B 3B9VA 4KAQH 3EDKA 4LOUC 3TCLA 3ET9F 4M6MH 4PRID 5T1DH 3LH2H 3MRJB 4QRUB 2I24N 3MJ9H 4HAGA 4NC1E 1JTOA 3PWJB 1HWHB 1X7QA 1NEZB 4WY7H 3O45A 3TJHD 5JW4R 3VXSE 2AXHA 3RFZC 4PJGF 4Z7NE 4GKZB 3L3IB 3EYUH 1JWSB 3U9PL 1I1RA 4JFZH 4LNVA 1A0QL 2BCKB 4XBGB 1FNSL 4JPVL 5DQJB 4MJ6A 1GVIA 4MXQD 5M95B 1EEYB 4Q58C 1JIBA 2YEZB 2AK1H 1TVBB 4LSRL 4XBEL 2RHEA 1LP9A 1MIMH 5EPMA 3TH2T 2HTLC 4NCC2 4IRJA 4JM2B 4PRBB 1A14H 4OGYL 3KPQA 2ADJB 4NHUA 3BZ4A 3T0EA 3LS4L 4F7EA 4GW5B 4K9EL 5D7IB 3W0WB 5F7WC 3D18B 1W72B 2OLDA 1NCCL 4MXWH 3TWCH 2QJDA 3BOVA 4M61B 4K3JH 3U7WH 3WXVH 4WI3A 1JWMA 3QUMH 3ZO0A 3RGHA 5CCKH 1IGTB 3LB6D 4K7FA 3CUPA 1GGIH 4UIMA 4YPGA 1A1MA 2GY5A 2CKBH 4GBXA 4NNXA 3GMQB 3FCTB 4N0FB 4LU5L 4X4YA 3ROLB 4HWEH 3C6LD 1EK3A 2Q87A 5ESVB 1XGUB 4JY4A 3MV8B 5EZOL 5FM5O 1B88A 4U1HA 2VITA 3H2WA 2VZTA 4PG9A 1MI5A 5KSVA 2UZIH 1SYVB 4KTEL 3HE7D 3WD5H 1OCWH 4U3XA 4ISVA 2DBLH 3KR3L 5GS1B 3KWWB 4ZXBC 5JOEA 1MLCA 1XIWA 1CE1H 4OZIF 2P43B 5F7HA 4DKFL 2DYPA 4HPOL 4YDJA 2H2PD 2N7AA 2R56L 2CDFA 3DUUA 3MUHL 5TF1L 1S78C 1QRNB 4YUEL 1K6QH 4D3CH 4U1SB 4U2YA 3CZJA 4U1JB 1WT5C 2NY4C 1NC4A 5TDPB 3QDHA 1IAIH 4LIQH 3ZE2E 4YBQD 1N3NA 2QHRL 4PRPD 3B6SA 4FNLL 3RIFK 5E08H 5JXEC 2W92A 5EIIB 4H26B 1A6TB 4PRIE 3TM6A 5EU6A 2IANA 2VTFA 4S1SH 5EZJA 3X3GH 1WWCA 1HSAB 1LVEA 3MLTA 4M1GH 1W0WA 3VW3H 4A6YB 3FN0H 4NM8H 3RBGA 1CBVH 3DBXA 4OQTL 4MNHA 3MMEB 1U8PA 3VDBA 3ZKXC 3KPSB 3MLSL 3QCUL 4FQLL 3WUZA 5AAWA 5LVEA 2D0HA 2MMXA 5FKPB 1G7MA 2V2XB 3RWHA 4KJQD 5EFIB 4AMKH 4WU5A 4OLUL 1IQWL 2KL6A 2PR4L 5ICXB 5MEQB 5FB8A 1PZ5A 1YNKH 5F7LB 5A2FA 2F5AL 3HC4L 4BQBA 2R1YB 3GIVB 3IYLW 4Y2OA 4U7KA 2RFXB 4TNWK 1LEKB 5DQDL 4F7MA 1AY1L 3H7BB 1KTRL 3O9WD 1IGFL 4YDVB 4NO0B 1N6QL 1X5ZA 3RZWA 1JF1B 4JREB 4L8SA 4QOKA 2NMSA 1IQDB 1OGTA 2XFXA 1M7XA 2XNAB 3RWJB 2G75A 1PSKH 4I77L 4P2RB 1Z0MA 5DRXB 4ODUB 1DANT 4I2XA 5I1CH 3T0VA 5IFJA 4RX4D 1I1CA 5KSAC 3MLZL 4FFZH 5HYIA 1DQMH 3LMJL 2D7MA 5EH1A 4KZDH 1HYSD 3FO0L 1A3RH 3HPJA 4BFIB 1X5JA 1T2QH 3UO1L 3S3PA 3TP4A 5IF0B 4OF3A 2I9TB 4N8CL 1D5BA 5KW9H 5EO9A 3FAWA 5F71A 3W9EB 5JHDB 5DFWH 4FABH 3ZE1E 1YNLH 3IFOA 2QADB 2E6PA 1FORH 5HDLA 5IUSA 3WFDL 2J5LC 3WE6B 3E2HB 3RY6C 4NQDA 4U0QB 3TCLB 2CIIA 4Y5YA 3JV0A 2NPLX 1T66D 4WHDA 4Y19B 3D69A 3VA2C 2AJYL 5FDWA 4WTZG 4PRPE 3QUZC 1X7QB 4M7KL 4OF5A 1OSPL 1G7QA 2JJSA 3O45B 1XF4A 2D4DA 2J8UA 4P46D 2UUDH 3O3BA 1G9NH 4HS6A 4D9LH 1JI1A 2VR4A 1T7VA 4K3DH 4C56D 5GGVL 1SHMA 1TZHB 2WLYA 3M17A 3T2NH 3W2DL 1HIML 2QBWA 4FFWC 4MDJA 1WFUA 5BW7A 4EUPA 4LFHD 3M1BA 3VGEA 1E4XH 1LP9B 5EPMB 3CXHJ 5IJVA 3H3PH 3SGKA 1YN7A 1JWUA 4K55A 4IRJB 4YHLL 4XX1E 2H41A 3RVWD 3KPQB 4LCWA 5AZ2H 4NHUB 3BZ4B 2FSEB 3T0EB 5IB5A 4OI8A 4F7EB 4K2UH 5T1KD 3BD5A 5L0QB 1WCBA 4MA7L 4NN5C 5HVFB 3QQ3B 1N0XH 1KB5A 1XCQB 3OHXA 4Z7UA 3SE9L 2H32B 4ZS7L 5DJDA 3ARXA 1V05A 3AAZA 2FEDD 1J8HA 3ARTA 2FJGB 4K7FB 3CUPB 2FB4H 3TO4D 5D2NC 2E8ZA 4UIMB 4Y4KD 1NMCB 5DRNA 1U8LA 4NNXB 2G5RA 2C3HA 2BVPB 3FT2A 4KJPC 4X4YB 2GIYA 1TETL 3OGCA 1BBDL 4DW2H 4JY4B 4ODVL 5CGMA 1IZJA 3F58H 1XR8A 1MUJA 4G8GB 2VLRD 4U1HB 5E5UB 4PG9B 1MI5B 3GSRB 2PO6A 1W0YT 3UTOA 4ZNCD 3GK8H 1I9IL 2Y5EA 1MLCB 1WAAE 4XCCH 1XIWB 3IB4A 4CN4A 2DYPB 2ICWJ 3GSQA 3QIWA 2CDFB 3VGAC 4LPYA 5FGCB 2YK1H 3BIAX 4FQJL 2E3VA 3WO4C 2BRRH 3SPVA 3O4OB 1N3NB 3SQBA 5JQHC 3JTSA 4JRYB 1J7VR 2CR3A 3B6SB 2B4CL 4KQ4L 3MOQA 4ELMB 3V4VH 1EGJH 3EOTH 3AB0B 5EU6B 4XPHL 2MSPA 2IANB 5EZJB 4NQVB 5FK9A 1W0WB 1GL4B 1Q38A 2VB5A 4I18A 3RVVC 1OAYL 4JZJA 3RWFA 3DBXB 4EZMA 1FE8H 4LGPB 4MNHB 3K2UH 4JRWA 2FL5A 3LKRA 4OSUL 3RWHB 1D6EA 1G7MB 4JM2D 4QNPE 2ITDA 2J88L 4KC3B 4RISH 3CMOL 4WU5B 3W0WD 1QRKA 1IJ9A 5CP3H 1RIHL 2FYYA 1PAMA 4NYLB 2Y6SC 3DXAE 4Z95H 4BQ8A 5GGSA 2DQJL 3DV4B 4LPCA 2CUIA 5SWZB 3QDME 1DBML 4KKCD 1JZ6A 5JW5A 4F7MB 1WK0A 3MRRA 5EOQH 5DQ9A 5I74B 4XXCC 2JK5A 4ZUSA 3WLWC 3MACL 3DNKA 4L8SB 4QOKB 3RAJH 5M7QA 2DLHA 1OGTB 4CVWA 2XFXB 5J06A 3GKZA 1P7QB 2XQBH 5DK3A 3AREB 4M6NL 5DGQA 2GCYA 5DHXB 2GFBA 4J6RL 3OF6D 3FZUC 4I2XB 5C71A 5IFJB 5I8OH 1W72L 3KPPB 1CU4H 3QQ9D 3HB3D 1FL6A 2I07B 2VE6B 4Y16A 3S36X 3HPJB 1W8NA 3MLYH 5I16A 5L8KB 1YY9D 1HN1A 4MJ4A 2VLRE 5D1XC 4PP1C 3BSZH 5HDBF 5ICZA 3NOIA 1U92A 1S9WA 3V0WH 1D5BB 1ND0A 3BE1L 4XPTH 4ZUUA 1NLDL 4KROB 2A6DA 1DZBA 3IFOB 4P3DA 1HKLH 5BXFB 3PHSA 4FZEH 1CD9B 3G08A 1BFVL 1MCOH 4Y4FA 2CIIB 2VN4A 3AU1A 1IGIH 3FQXB 3D69B 5J13B 4JRXB 1VGKA 2VYRE 4HIXL 4L4JA 4TSBH 1H3UA 2EIBA 4G9FA 3NCEB 3DTXA 3NCMA 3W11D 3ZTNL 1HH6B 1XF4B 1VACA 1KC5L 3KPSD 3GHEL 2YUWA 4M5YL 5KG9A 3O3BB 5HHVH 3V6OA 1PG7L 4HS6B 2C4XA 5JZ7D 1YDPA 3M17B 4MDJB 1KJ3H 5GXBB 3BZEA 3KLHC 4EUPB 2DQEL 2DD8L 3U0PB 3M1BB 2X1OA 5I73C 5IJVB 3ESVF 4MA1C 1YN7B 1JWUB 5CJ8A 4H1LG 4LGSB 4LCWB 5D7IE 2EC9T 4L29A 4NO0D 5IB5B 3W0WE 1WZLA 1J9CT 4LSSL 1WCBB 3CCHB 5JW4Q 5C92A 4KI1A 3RVUC 1KB5B 2YRZA 3OHXB 3CFJA 5D7JC 5JPNB 3BGMB 2B39A 5DJDB 4ZOAA 4OKVA 4L4TD 4ZG1A 4OD1L 3RTQD 3JTTA 4LSVL 1J8HB 1N4XH 5DWUL 3KPLB 5D96C 4D9RD 2MWCA 1DLFL 5DRNB 1U8LB 1Q9OA 1RMFL 3QXWA 4N0UB 3FT2B 4HS3B 5FUZL 1MSPA 3MV8E 5DJCA 3L6FA 3RDTA 1MHPH 2DQDL 4Y5VA 1MUJB 4HIHA 2ILLA 5JHDD 1CL7L 2QSCL 2QADD 3FB6A 3L7FA 1BVLA 3ZE0F 3V9FA 4YK4C 2APXA 1OP5K 1QRNE 3GSQB 3QIWB 5MI0B 3UCRA 4BSVA 2NY5L 4PJGA 4P59L 4S1DD 4HHAA 2DTML 4Z78A 3P11H 3QCVL 3SPVB 4WENB 2E9BA 3LSOA 1AXSB 3JTSB 4CVXA 5FGBA 4JJHA 5DD0L 1GGUA 1G7JA 1F3RB 2F58H 3QHFH 4OCSL 1N2RA 5C0ND 2BFVL 5IOPB 4GRLA 5FK9B 4LPUA 3V2AR 2LABA 3LQAC 3S37X 3EO0A 4I18B 4XAWL 1UQSB 3L3KA 4JZJB 5FM4A 4L8CB 5EBLB 3RWFB 4HJ0D 3DVFA 3ZYZA 2E7LC 3KPSE 4NN6B 3VXUA 3WJJC 3IFPB 1H0DA 5ICYB 1PG7W 2FL5B 3DSFL 2APTA 5L2KB 4IRJD 4YO0A 3I2CH 4I0KA 2ITDB 2Z8WC 5E5MA 4YHKH 3SE3C 1F5WA 4KH2A 1IGML 1XGRA 1CDIA 1I7ZB 1JMXA 2FYYB 1B3JA 4G42A 3S88H 1HDMA 3V79C 4JKPH 1MCHA 2KZ1B 5GGSB 3EO9H 1H8OA 2HT4D 1ZMYA 3M45A 4UV4H 3BKJH 3MRRB 4M4RA 4GBXD 5DQ9B 2DLTA 3SE4A 2JK5B 5I1LB 3U0WL 2VLLB 4ZUSB 2B5IB 4LQFH 2NLJA 4X5XB 1SJXA 3JWOL 35C8L 2DDQL 5IESL 1P4LA 4L4TE 3SDAC 1XGYL 5D4QA 4HKZA 3ARFC 4PRDA 4JN1L 4PBXA 3QZWG 2GCYB 2GFBB 3IKCB 4D9RE 2Z31A 1MI5D 1RZJL 2BJML 3IGAB 1RZFL 2ZUUA 4ZFZA 1NBVH 4WI4A 4QHMA 1OY3B 1FL6B 1XIWD 2DLGA 1DQDL 3VFMB 3MRKA 5I16B 1RFDH 2DYPD 2JJTA 4OF6A 1T1XB 5ICZB 1S9WB 4LPTA 5JHDE 1E6OH 2C3WA 2XICA 5KAQG 1NC4D 1ND0B 2C3XA 5ALCL 15C8H 4ZUUB 2A6DB 4P3DB 4NSKA 2HVKB 5IWLC 3FFCA 2C26A 4CU7A 3RIFF 1C08A 1YYML 3LHPH 3CU7A 3HNTL 2YN3A 4Y4FB 3RJQB 5EU6D 2IAND 4X4XA 2ZKHL 1VGKB 1A6VH 1CXIA 5JO5A 1VERA 2FRGP 1Y0LA 4OJFH 4JR9H 4G9FB 5CILH 2EE3A 3X17A 5B4MD 5FYLH 5ILTH 3DTXB 4HIIB 4MAUL 2EDJA 3FN3A 1R24A 3E3QE 4JG0L 1VACB 2DF3A 2YZ8A 1G0YR 4Z7VA 4X6CA 5KG9B 3SDXA 3L3HA 4J3UA 1DANU 2WWKO 4FQCH 3TFKD 3BQUC 5CZXC 1J1OL 4BM7A 4PJ8C 4NJ9L 2F15A 3BZEB 3DOSA 1QLFA 5KSBB 3A67L 4HG4K 4UQ3A 1FO0L 1LP9E 4F8QA 5DT1L 2EDDA 3EYOB 4HH8A 1EO7A 1R3IH 5D6CB 3GSNA 3VXPA 1MPAL 3T0EE 4TNWF 3NTCH 4L29B 3TT1L 1LK2A 1TPXC 3DX6A 2HRPL 1GGYA 4QOKD 1U3HA 2BSRA 2D3VA 3CFJB 3OB0H 3ULUD 4NRZA 3WIHL 1KEGH 1V8HA 4NKIL 3JTTB 4HJGA 4JPIA 5I15L 5LQBL 1QKZL 1V3JA 5J11B 4YEFA 2VDPH 3RX5A 1KENH 1OTTC 3U79A 1DN0A 5BJTB 1Q9OB 2F8VA 2VO5A 3FN9A 3N1FC 3RBSA 3SDYL 3PWUA 3C2SA 4Q0XH 2DIJA 2IFFL 5DJCB 3RKPA 1OAKL 4Y5VB 3U46A 1MI5E 4P99A 2F54A 3QPQC 4LSDA 4FMFA 5AZEL 3GBML 4KROD 3FB6B 3L7FB 3MRQA 1FVEA 4TRPL 1BVLB 4X8XA 3QEGH 3ULUL 2VSDA 2QQQA 4XP6L 4NQDD 5FGCE 1T3FA 4HQQH 4BSVB 4PJGB 5L88H 4HHAB 4Z78B 1AQKH 2DKMA 5ISZA 1YN6B 3LSOB 2WINB 2OTWB 2Z0BA 5E0QA 1D5XA 3V4UH 4R2GD 1MNUH 2MNUA 1NC2A 4PY8I 5EU6E 5A3ID 4PJAA 2IANE 4CMHC 1G7JB 5DRWA 3SQOL 4G6FB 3ARWA 2NNAA 4K8RC 3PDDA 1N2RB 2X40A 2V7NA 5C0GA 4C4KO 2VLKB 3L3KB 4KV5E 1SY6H 1YEHL 4PB0H 3EJZD 4EOWH 1H0DB 4F33B 3CJJA 3QUXC 2FHFA 2P45B 4YO0B 2EZ0C 4Q9BA 5A43C 1CL7I 3RVTC 5E5MB 5H94A 4LCWD 3NPSC 1FRGH 1XGRB 5E9DB 2W1NA 1FBIL 5J56B 2O5XH 2CGRL 3T4YB 5SWZE 5CIPH 2Q8AH 1RVFL 4RWHA 1YQVH 1J8HD 3ZKQD 4OD3L 3P9MB 4DKDC 3X13A 2AEQL 1F97A 5JXAH 3SDCB 5EBMA 1MOEA 1WBYA 4QOKE 4HT1L 4EN3A 2NLJB 2EH8H 2HRLA 1P4LB 4OZIB 5CD5D 3QULA 25C8L 4HS8L 1L6XA 3RWGB 4LSPH 4PRDB 5EUOF 5IEHA 4I2XE 2CLZA 1E28A 1NLBH 2Z31B 1ETZA 1QBAA 2YD1A 3MGTB 4Z8FH 5I30H 4KWUA 2PO6D 2PN5A 3GNMH 4ZFZB 4OF0A 4H0IA 4QHMB 1KB5L 1K3IA 2WBWB 4NQEB 3U4AA 1AFVH 1HKFA 3MRKB 5EU3A 1CLZL 1NMAL 2Y23A 1NFDF 2VXTH 5IW6A 5J1TC 4YZFF 5EULV 1D6VL 4KVNL 1UKSA 1KTLB 4G8EB 4FZ8H 1K85A 5DMJB 5F96H 4OGAD 4HXAL 3WIFA 1NMBL 3FFCB 3KYNA 3QAZB 2D03H 4NQDE 1C08B 1Y6NR 4P5TA 2AGJL 4OLVL 1G84A 4PGDA 4Q74A 4NCC1 4OTXH 4X4XB 4H1LH 3QHTC 2W9EL 4NM4L 2FBJH 1UKQA 3H0TA 5JO5B 1Y0LB 4JGUA 3TIDB 1DEEA 3HC0B 5HVHC 3LKNA 1E6JL 2J8UE 4FQHB 1QO3A 1R24B 4PTTA 4FG6D 4QXUH 4WGWB 3I6LD 3MR9A 4X6CB 3SDXB 3L3HB 4MDIB 1KCLA 1CICB 4ZXBA 3VWKA 5C86A 3QCTL 5EO0B 3UAJD 2NR6C 4O51A 4OI9A 4UQ3B 2ADFL 5ACZB 5E8NB 3IJYA 4Z0XB 3VFGH 3TYFA 3GSNB 4R7NA 4LCWE 3MLRH 5F7MC 3VXPB 4M5ZH 3VG0L 1U93A 1KPRB 1FC2D 2VLJA 3ZDYE 2CO7B 2WNGA 1LK2B 2PW1B 4F7TA 3DX6B 1ACZA 4UTBH 4U7SA 1U3HB 2I27N 3HAEB 4G6AD 4Z7UE 2BSRB 5I1HH 2GEEA 5EU4A 4HC1A 1JV5A 3GI9L 4NRZB 1J8HE 3WKNA 2HVJA 4JPIB 4HJGB 3ZHKA 5BRZA 4LCIH 5C2UB 3GJFK 1GGBH 1DN0B 2VABA 3UTQB 4YDKH 5DDHA 3TO2A 4O2FA 4UNTA 2W0FA 4Y16D 3TA3A 2W60A 4W4OC 4TUKH 2ID5A 2Y07H 1UB6A 3U46B 4G3YH 1JNLH 1EVUA 4JDVA 4UT9L 1KN2L 3FQRA 4NHCH 3QISA 1GPOL 3MRQB 1FVEB 4TTDD 3V0VA 3NPZB 2R8SL 5CJQH 2GJZA 4LLMA 2A77H 4OZFA 4Y4FD 1RULH 1T3FB 4APQC 3N06B 5CJXC 3VGDA 1S5IH 4PLNC 4K94H 2JELH 2FX7L 5FCUL 5JR1H 2HG5A 4NC2B 4G9FD 4CN1A 4ENEC 1D5XB 2CR6A 1OARL 5JMOC 3IAPA 4FFYH 1ZHBB 3LV3A 3MJ9A 4PJAB 1FGVH 5DRWB 1KOAA 2W65B 5KSAA 2NNAB 1OAZH 4FFVD 4Y1AA 4XP9L 2J4WH 3HI1A 5IFHH 2V7NB 3W39A 2E6QA 3HI5H 1QOKA 5D93C 1EAJA 3BGAA 4AIZA 4LSUL 5HYSA 1JGEA 1MCFA 2YD5A 5DD6A 2WWKT 5IEKA 4R6UA 5KTEH 5INCA 3S3SA 1J0IA 4HKBA 4MD0B 4GKNA 2XZQL 3AXLA 3C8DA 5C07A 4PD4J 3LPFA 1DL7H 4PV9A 1F4AA 3Q6FA 3X13B 1H9VA 3BN9C 2R4RL 2OM5A 4X83A 1DQQA 5EBMB 1WBYB 2VAAA 2VOTA 3QUMA 4EN3B 3TPKA 2D7TL 2F74A 43C9A 1D9KD 1UADC 4NP4H 4U0RB 3QULB 3RDTD 5JW3H 4DK3A 4OB5H 5IEHB 1DR9A 2CLZB 1E28B 2CKBA 4JFXB 5T3ZL 2XPGB 2EECA 4WV1B 5EOTB 2EDFA 4U49A 4YHOH 3B43A 3SKUD 5EU3B 3Q0HA 1V3LA 3O3AA 3S97C 3N1MC 1FZKB 5IW6B 1MFAH 3P3YA 4DZBB 1JHLH 1T6VN 3B8SA 5DLML 1CT8A 2A0LD 1UM4H 1N0LA 2XZAL 5GRWA 4OIBA 2ATKB 1AP2A 3J8F7 3TBWA 4PIRF 5B3JE 2DICA 5IW3A 4GMSL 1F42A 1Z3GH 3KYNB 4P2QA 3RX8A 3WO3B 3QUYC 4TULH 4P5TB 4I1NB 1A9EA 2F5BH 2VIRA 4I0PC 2OQJA 5A2IH 1V7ML 3VI3F 2XXCB 5TFSL 3QXAA 3H0TB 4GRLD 1RAMA 4OFKA 4G9FE 2Q86B 1OAQL 5EOCL 1DEEB 3GFUA 2A6IB 3LKNB 4R0LC 1F02I 3U9UA 3OJMB 4M43H 3FO1A 1QO3B 1KGCD 4QXWA 3VXUD 4PTTB 1URLA 1YPZA 4M8QA 3MR9B 3V6OE 3F65A 3T77A 4NOFA 1BECA 4ODXA 3VWKB 3MA7A 3TYGL 4KMTL 4C4KT 2FECI 4OLWH 2O5ZL 4YHZL 3DMMC 5L8LB 1OP9A 5DEZA 4JO4L 3MRBA 4NQCA 3GI8H 1MAMH 3IJYB 3JVGC 3SGJA 2AVGA 3NH7H 3ARDC 3TYFB 4FQQB 4U3HA 1YMMA 4R7NB 4XBPA 5C2BH 2Z35A 2VLJB 4F7TB 3T2PA 5CHNA 1EEQA 4RMRA 4MVBC 1HILB 1MCWW 5EU4B 4ORGB 5C9JA 1JV5B 3BO8A 1RJYA 1ZT4A 2LQRA 1RUPH 1JPFA 1SBSL 4ZUTB 2Z31D 3BKYL 5BRZB 5LGJA 2OI9C 4W81A 4HPYH 3PXJA 2BNQA 5I1EH 2VABB 1WGOA 4RNRA 5DDHB 4OUUA 1EMTL 3TO2B 4AG4H 4O2FB 1FHGA 2DM7A 2W0FB 3OAUL 3TA3B 2A9NL 2W60B 1NCNA 5HI3D 1A47A 2YD6A 4O5LH 5K9OA 2ARJB 3DLQR 3QRFM 1UB6B 1KCUH 4N5ED 4JDVB 3FB8A 5HYJA 1C5CL 3FQRB 2KH2B 4XP5H 3R8QA 3BIBX 4YH6A 2MQ3A 3JV6A 3FHQA 1YC7A 1B2WL 3FO2A 5HXMA 5MP6L 3VGGA 4PJ9C 2FJHB 2GJZB 2GT9A 4LLMB 3FFCD 1A7NL 2IAMD 3NFNA 5C0IB 1JGVL 1FLRH 1CQKA 1FCCA 2AJXL 4RFNC 5FHAL 4PJGE 1T7ZA 5FV1L 1L0QA 1CK0L 3MJ7B 5J3HD 3H9ZA 4NBZB 2HG5B 4PJCA 1I75A 2GTWA 4MA8L 3C87A 3SGEH 3VRLE 2B2XL 4LLUA 1SQ2N 4FQ2L 3ILQD 3MBEC 3LV3B 4YHNA 5GRVK 3MLUL 4O9HL 4PJEF 5GRJH 3V6FB 4XNUL 3NZHL 4KXZI 1HXYA 2XA8H 1G6RH 3O8XC 4Y1AB 3MRGB 3HPLA 4ODTH 1JPST 2PNDA 5HY9A 1MCPH 4X98A 1BZ9B 3W39B 1KT2A 4ODSL 2VLKE 4OGXH 5JTWA 3K1KC 3MUGB 1ZLWK 1F8TH 5C0DA 1KGCE 4AIZB 3VXUE 2XT1B 3CC5A 3UROR 5HYSB 4HFUH 4L4VA 5DD6B 1NEZG 2AK4D 1RY7B 5IEKB 3RUGF 4NT6A 4LDEB 5INCB 3K1DA 5E9DE 5JLZA 1LQSR 4ZNEA 1G9MC 1UKTA 4TPRL 2VUYA 4JDTH 1RURL 4GKNB 3FRUA 3I50H 2NZIA 5C07B 2DQUL 3Q6FB 4HLJA 3QIBA 3L5IA 1NCWH 1DQQB 4FMKA 1T5XA 1CGUA 3QUMB 1J5OH 1I7UB 2F74B 4XI5C 4OZIE 2R23B 43C9B 1OTSC 3STLB 3WNPA 3GSNL 3O6KH 2WUBH 2BSSA 2CKBB 2AJ3A 4BZYA 2F54D 1ZLSH 3Q5OA 2CIKB 5IV2B 1Z9LA 4PLJC 5I1AA 3DYMA 2LU4A 2QQLL 1HNGA 3V0AC 3O3AB 1C12A 1LO3L 2VWEE 4U6VL 3L1OH 1SEBB 4LEXH 1CT8B 5JORA 2BOBA 4HLZG 2WWMD 5ISZD 1AP2B 4YE4H 1V7NH 3DUHA 3FFCE 2RQ8A 4P2QB 4ZUVA 1FSKB 5KVGH 1AGFB 1MVUA 2AI0H 1NC2D 4KKAC 3CD4A 1A9EB 2VIRB 2OQJB 3SEPA 3QXAB 5C0AA 3CH1A 4QO1A 3L3JB 1CXEA 5T5NG 2Q7NA 3PGDA 3VWJC 2Z93A 4XMKL 3U9UB 4ZO8A 3FO1B 2W9DL 4OCWL 3TVMC 5DC9B 4Z7VE 5LXGH 4X6CE 1YPZB 2DIAA 4GLRI 4M8QB 3SDXE 2BNRA 5CEZD 3V5HA 2HJFA 2IQ9L 3B9EA 3T77B 5GISH 3IDYB 4ODXB 1AE6L 3MA7B 5C6WH 2OZ4H 3QO1A 2HT2C 4X6DA 3RY5A 2C4FT 2OMBA 1QBML 1CCZA 3MRBB 4G6KH 4NQCB 3TT3H 1ZSDA 3VXNA 2NY7L 3BPNB 2VZOA 5EUOA 1CLCA 1BJ8A 1YMMB 3WLBB 3DVGA 2Z35B 5IG7B 1MCSA 5CP3A 2MCG1 2MKWA 4N90D 2IALA 1IEAA 3S9DB 1MRFH 5CHNB 2NX5A 1MREH 4EN3D 4NC1C 5CEZL 4ZTPH 2D7OA 2HJKA 4G7YH 1QD0A 5C9JB 2WSKA 1ODAA 1ZT4B 4GRWH 3ARGA 1NGXA 1I9RH 4ERSH 5JA9A 1JPFB 2RB8A 4KKBC 3QWOA 4PTUA 4RNRB 2MKLC 4O58H 3TBTB 3MREB 3WXWH 4WWKA 5D1ZC 5K9OB 4MQ7A 2R9HC 4JO1L 4Z7QF 4U33A 3FB8B 1RUML 4M48L 1WFOA 4PJXA 5HYJB 2WUCH 3JV6B 1AR1D 3FO2B 3HRZA 1QQDB 2GT9B 5EU5A 4G6ML 4O00A 1MHHA 1NDGA 4P5TD 3NIFE 4AEIL 1YEFH 3ZSSA 3HRPA 4HJJH 3IFNH 3KDMA 1GRWA 5ISZE 4Q9RL 1F4WL 4M7LT 4MQXD 3U7YH 4PJCB 2GTWB 1TQCC 4LLWA 3OB8A 3MLPA 3ULVH 2DQFB 1LNUA 4PJAE 1MEXH 4YHNB 5IMMA 3BRGC 3FQUB 4MS8C 3WIIL 5K9JL 4ONHA 3HPLB 3NCBB 4ZXBD 3VWKD 4I8DA 4DUXA 4X98B 1KT2B 1XF5A 1QACA 1FVCB 2WBJC 2BVUA 1S78D 2IPUG 3CC5B 5CEZE 5DD5H 3CSGA 1A7OL 1I85A 3IAQA 5DGRA 1T4KB 5JOFA 1JGLL 1U8JB 2G5BA 5IWLA 3P4MA 4XC1H 1JFQH 4L9LC 5CMAB 2VLJD 5JLZB 4QHUA 3S4SG 2M2DA 4JO3L 1HZHL 2Q7YA 4POZD 1OB1A 2G9HA 3BKCH 3GMNA 1FL3A 3FRUB 1PYWA 1QSVA 4LMQE 5D5MA 3WS3A 2ZG1A 4OLZL 5BRZD 4CDGC 3QIBB 4N90E 4FQ1H 5E8PB 1R0AH 1S7RA 4OFYA 5LGHL 4OT1L 3GMMA 2Q3AA 3RP1A 4LRNL 4W70A 3SCMB 3TA3D 4IEFB 4Z6AT 2IH1B 1KCSL 3OG4B 1QEWA 5GGTL 2R2BB 5GS3A 5DUPH 4R4FL 1C8PA 4K9EC 2BSSB 4PLKC 2AJ3B 3TJHC 3WEXA 2A74B 1VPOL 1A7QH 2Y25A 1MHCA 1KV3A 5I1AB 1GYAA 1GGCH 1GAFH 4HC1L 1VGEL 5KVFH 2MOVA 5EORH 5I0DA 4IRSB 1C12B 5MENA 1U8IA 3FAXA 4UAOB 1H5BB 2E9WA 1G1CA 5JORB 2Q76A 2ZSWA 2BOBB 4BH7A 1LDPH 2VH5H 3NZ8A 5EBWA 2X4SA 3UPRB 1BEYL 1FQ9C 3TH4T 3ISWA 5FFLA 4PYHA 4ZUVB 4M4PA 2NTSP 3L7EA 3RU8L 5BOZG 1AIFB 5KSAD 4Y1AD 2BVEA 5F1OB 4X9IA 1Q94A 2V17L 4V2BA 1W0VA 3CH1B 4XVJH 3H9SB 1T21A 2CUHA 4GXUN 5T3XE 1K9TA 3LB6C 4OLXL 4XNYH 5B3NA 5I71C 1RIVH 4YDLC 2AABL 4GW1A 5IBTL 3V5KA 4FP8H 1DFBH 2BNRB 5F9DC 1T7XA 4H88H 4BZ2H 5HI4D 4KAQL 4Y8AA 3FMGH 4X6DB 3QO1B 3EYQD 3WFBL 1YEJL 1KUMA 4M6ML 4P9HH 3S3JA 1M71B 1X5IA 1QLEH 3HE7C 3MYJA 1FLTX 5JIKA 4LL9A 4NBYB 4L3CA 5GRZA 4LLAA 3HMWH 4PJBA 4DGVH 1ZSDB 4MZ2A 5C07D 3BRDA 1EJ6A 2HTKD 2NXYC 5EUOB 3MNWA 1BM3H 2H2PC 1BF2A 2VLJE 1DSFH 1LMKA 2Z4QA 4QHNA 4UB0H 5CLTA 2IALB 1IEAB 1BJ1J 4JY6A 4ZAKA 3H9YA 2NX5B 3TJEL 4YBQC 5E99L 1KLUA 2BP3A 5IQ7H 1A1NA 1EJOH 3BGFC 1NGXB 1MFBL 1NFDB 5BRZE 5HDBE 5JIIA 4FFWD 1A6UL 3QT2A 3CLFL 4PG2C 1A6WL 3QWOB 1MIML 2E8YA 4E41A 4JDZA 2AEIT 4PTUB 1F4YH 1AR2A 1E4KA 5IJKA 4OCYL 3HZVA 1ORQA 3MRFA 2R69H 1L0XA 4HMDA 4WWKB 2GSIA 4S2SA 4WTZA 2XN9A 4MQ7B 5E2WH 1CFBA 2EE6A 2JLLA 1L6ZA 4PJXB 4MXWL 3STZA 4K3JL 3MJ6A 3HHRB 2GK2A 1T22A 3L95A 2Z91B 2PCPA 4KJQC 5EU5B 3HE6C 4P2QD 4TQEH 1B9ZA 1CDYA 1GGIL 1NDGB 2CH8A 2LE9A 2Z8RA 2KUTA 2CKBL 1AXTL 4BFEA 5ANMA 3UYRH 1Q8MA 4LLQA 1FNLA 4HWEL 3KDMB 2PETA 3R4DA 3G9VA 1JE6A 1BQLL 2Q8BH 1F3JA 4LLWB 1MRCL 4UOJA 4K3HA 5IFAH 2DQGH 4LCUA 3O9WC 2XZCH 2C1PA 1LNUB 1GGTA 3WD5L 4RRPG 2DBLL 4ZQKB 5E2JA 4NN7C 4RDQG 4D8PA 3C5SA 4Y1AE 5IMMB 5F9JA 2NW2A 3GB7A 1HH9A 4ONHB 3GM0A 3IDNA 3LIZH 1JRHL 1PGRB 3QXVA 2EIZA 1EHXA 1AC6A 4N0YL 3WFEL 3E0GA 4FQIH 2YMXL 3NAAL 4QRTA 4R4BB 1IAIL 3ZTJG 4Q2ZA 1L7IH 4LIQL 1XT5A 5AG9A 1ERNA 4XWGL 1HYSC 1GSMA 5IT2H 5JOFB 5BQ7A 4N68A 1YMMD 2GKIA 3P4MB 3MV9A 4X9HA 5E08L 4QXGL 5K9QG 4UOW1 1FZOA 2UY7A 4ZOCA 3G6JA 1KLGA 2VQTA 5DR5L 2Q7YB 3X3GL 1UACL 1OB1B 2G9HB 3BPLC 3DIFA 3GMNB 2KPNA 3WKMH 1FL3B 3HNSL 4M1GL 1PYWB 5D5MB 1YJDH 5C07E 1T1YA 2FWOB 1IAMA 5E56A 2EXYC 4QT5A 4LVHC 4WTXA 3LDBC 1T66C 2BNQD 2PYEA 4JPWH 1S7RB 2VDQH 3GMMB 2XRAH 5DD3H 1XF3B 1QEWB 3ROOA 4J3OC 3MLVL 1YNKL 5DJYB 2EDWA 4P46C 4N0RA 3EJYC 1RZ7L 1YMHB 4QYOA 4PJIF 4TSCL 2Y6SD 4LLDA 3N9GL 3GSXA 2ICWI 3EDFA 4F15C 4ZFGH 1NGYA 4BUHA 5MENB 1U8IB 3IETA 5CKGA 4HV8A 5GRVL 2ZUVA 2AV7A 1U8MA 4PJEA 2ZSWB 2BSED 4BH7B 3WLWD 5DRZA 3L5HA 2R1WA 5EBWB 5DA4A 4ODBD 1TQBC 2R29L 1PSKL 4PJ7A 4P2QE 5CINL 3SGDH 2P24A 5D9SA 3RVWC 1ACYH 2DJUA 1R5WA 3O6FA 2P5EB 5FECA 1AHWC 5SX4H 3RNKA 4FFZL 4LIQE 1DQML 5E2VH 4KZDL 1A7BA 4M1DL 3U7AA 2YN5A 3UJIH 1A3RL 1Q94B 1M05A 1W0VB 1HQRA 1AI1H 3BP5A 1MJJB 4OV6F 3TO4C 1ORSA 3DV6A 4K7PY 3BMWA 1FVDA 4PP1D 4Y4KC 1MFNA 1YPZE 3NGBB 4FABL 1T89C 4GW1B 3V5KB 1X5GA 4L4VD 5FO7A 3WUWG 3D87B 4L5FH 2B4CC 4PY7A 5CBAA 3BP4A 4XPAL 3ZYIA 1FIEA 3C5ZB 5HPMA 1KIRB 1N5YL 1U8QA 3K7UA 3MYJB 4U1LB 4NQCE 1ZLVH 1R5IA 5FO8A 5JMRA 4L3CB 5J89A 2IBZY 1YMME 2E7BA 4LAQH 3EOBA 3DX7A 3QIBD 2LVEA 4QHNB 2DMKA 1CIDA 4JY6B 4ZAKB 5ENWB 3KJ4B 5CIPA 5E24E 4K3DL 4AIXA 4NZJA 3T2NL 1EPFA 3I02B 3IU4L 5J57B 1A1NB 4PJDF 3NIGE 4CN6A 3KLHD 2BNQE 1E4XL 5J1AA 2DL2A 4JDZB 3H3PL 4ZS6C 1NGPH 2ERJC 3MRFB 2AKRA 4WFGD 5FDYA 5AZ2L 5IGXH 2GSIB 4ODHL 1U8OB 2XN9B 4K2UL 2DI9A 5HYJE 4U6HA 2XTJB 1JCKA 4FXKA 1TVHA 1BLNA 5D2LF 1T22B 4NZTH 3ARPA 3AS2A 3L95B 2C4FU 2PCPB 5CP7A 4JM2C 5H35B 4KK8C 3RWIA 1JNNH 4IJ3B 1LO0H 2J6EH 4JFPA 5ANMB 3H3KA 1JGDA 4LLQB 5C0AD 4PJCE 3I9GL 1P6AB 4I3RL 2IFGA 3F58L 1JTTA 2EC8A 3ARBB 3R1GH 4YXKH 4KKCC 4R90H 4JHWH 3VFPA 4LCUB 5EA0H 2C1PB 2DWEA 3F6LA 3G6DH 3BI9X 4H1LA 3GK8L 4QF1B 1UZ6F 2BNRD 4D8PB 3C5SB 4OD2B 5F9JB 2NW2B 3CXDH 3GB7B 3IDNB 4M7LH 1D5MB 1SM3H 2EIZB 1XGQA 2MCPL 2YK1L 1OLZA 3VDCA 4N8VG 3O4LA 1S7SA 4HK3J 5GS1C 3C6SA 4N5UA 4E0RA 5DF0A 2H32H 1YY9C 3MV9B 2Z92A 1CE6B 3TBSA 3ULVF 5HGDB 1RHHA 3QUYA 4ZNEE 3G6JB 4NGHH 1KLGB 4I0PA 2NX5D 2DI8A 3TH3T 3BP6B 1H3PL 3CVIH 4ZTOH 3WSQL 3QFJA 5IR1A 3H9HA 3DO7A 4XP1H 1T1YB 3ARGD 1FE8L 4Q9QL 1EEUA 3TF7C 1O5DT 4QT5B 5IBUG 1UYWL 4BQ9A 3JV5A 2XKNA 3T8XA 1CG9A 2PYEB 4HUWA 2ZCLH 2AJZA 2OMNA 1XF2B 3MQIA 4J1UA 3WL9A 3ZYJA 3LPGA 3ROOB 2HYMA 3BMVA 4WWKD 4JFYA 4ACPA 1AO7A 1LO2H 1AD0A 4B0MM 4WI6A 5I9QC 4IBLT 2EDRA 3S35X 3O6MH 2X89D 2HFEA 1LK3L 4KRPD 1N59A 2E5EA 1KPVA 4LLDB 5H37G 3JVGA 3GSXB 1SMAA 5JZ7C 4WFGE 3GMPB 6FABH 2W0LA 3LQAL 1MCEA 3IETB 4DFIA 5HDOA 2H26A 1MCLA 2AV7B 4PJEB 3RAJL 2FO1A 2D31A 3KNBA 2BC4A 5DRZB 4CW1A 4ZFFA 3HA0A 4NUJA 4ZD3L 1DVFA 1SJEA 2P24B 5D9SB 3ARFD 1OPGH 1R5WB 3O6FB 5FECB 5DC0A 3RNKB 5HGBA 4JREC 2BHYA 2FCBA 2ZWLT 1PDKA 5I8OL 4KTYA 5C0AE 3QIUB 2BVYA 4TN9A 1RZKC 3MLYL 3RUGB 1M05B 5ELIA 4TVPH 3BP5B 3BSZL 2NY5C 1ORSB 1FVDB 3CXHK 3DI2B 3TBYB 2ZZUT 2BNRE 4LHJB 1MCJA 1HKLL 2A2QT 1KELL 4FZEL 4PY7B 5CBAB 4X6DE 1QSZA 3BP4B 3O6LH 4RMWA 1I7TA 2WV3A 3V5DA 1JYNA 1IGIL 1U8QB 3MOAL 3OBAA 3QZWA 1R5IB 5FO8B 3BD4A 1FC1A 2QADC 1UB5A 3KPTA 5CWSA 5EUOE 3E2HC 4GH7B 3WN5A 3EOBB 5IKCA 3BPCA 1XH3A 2E27L 4NQUA 4S1DC 1NJ9A 4CU8A 1UWEL 2P48B 1A7RH 2NX5E 3MBEA 1QSEA 4OFYD 4QHLA 3BDBA 5CIPB 3W82A 4Z7OF 3O8XA 4GKOA 4HKJB 3F62A 3BD3A 1KJ3L 5LG1A 3REVA 1P84K 1A1OA 3VD3A 1HCVA 3IJSB 4RGOH 1KEML 3E3QC 4QLRA 3IXAA 4XCEA 5J1AB 4NRXB 5KS9A 5I76B 3TV3H 3IDIA 2G60L 3EZ8A 3VXQA 1IC4L 5J6GB 3JWDH 2OK0H 2ZOKA 1BVKA 1JL8A 1MFEH 3AS1A 4LSQH 4EQ3A 4HJ0C 2FDBP 4PJXE 5JQ6H 4U6HB 1ZHNB 3DI3B 3GSOB 3JWOC 4FXKB 1TVHB 1BLNB 1RUAH 4LLVB 2CDGB 1S7UB 3L9RA 5DZOA 4IRJC 5CP7B 1NUNB 2CRMA 1TZGH 2OTUB 2D9CA 3ZTJH 1MFCL 1MAJA 3RWIB 3T0EC 1FL5A 3BEWA 4XCFH 4NNPH 2BERA 1CN4A 1JGDB 1HEZA 3P4NB 3RKDC 1F45A 2DM4A 2BNUA 4XC3L 2V5TA 5EDXA 3GSWA 3HMXH 1KYOJ 5I8KH 3EAKA 2M1KA 1NMCC 4ZFOA 3AY4A 2V7HB 3B3IB 5DUBB 4WI8A 3UZEA 4PJ5A 5CJOL 2QKIA 2VXVL 4XMPH 3C09B 1K5NA 1XGQB 3IF1A 4H8WH 1RPQA 4RQQA 4DOHB 2YXMA 4JGJA 4K3EH 3P11L 1VSCA 4JFEB 1F6AA 4PP2A 3C6SB 3EO1B 5D70L 4E0RB 1XIWC 3V4PH 1UM6L 4WHYG 3OJDB 1E0OB 2Z92B 1RHHB 1U3ZA 2DM3A 4WO4A 3MXWL 2HMID 4G5ZL 4KHXH 2F58L 4ZAKD 4QTIH 4MYWB 2ZPKH 4OFIA 3DGCR 1JPSL 3O4OC 4HUKB 5D5ME 5D7LA 5IR1B 2UYLA 2GSGA 5DI8B 3H9HB 3DO7B 2CK0H 4HDIA 3VWJA 3AB0C 4P3CH 3TN0A 4E41D 2XKNB 1DBJH 3T8XB 1CG9B 4HUWB 1BOGA 4M3JA 2AJZB 3CSBA 1ZT7A 3OR7B 4J1UB 1ZGLP 3I2CL 3WL9B 3LRGA 1CLOH 4X0KA 3MRNA 4CMMA 5B4MC 3VD9A 2XN9D 5IB2A 2RJMA 3HAEG 4HF5H 4P48A 1AD0B 2W07A 2XTJD 3B5GA 2MQ0A 2FLRT 3C2AL 1OM3H 4DVRL 3IDGA 2HFEB 2J8HA 3TFKC 1N59B 3PGFL 5IB4A 1KPVB 4XPGH 2BMKA 5DVMA 5LWYL 5MENE 4EIGB 2H26B 4GG6A 5EZIL 1LILA 1OL0A 4LQFL 3LKOB 2BC4B 2FBOJ 4KDVA 4WHCA 4ZFFB 1AGDA 3MC0A 4NRYA 4NZRL 4NUJB 1DVFB 4WI2A 2EICA 2ZCHH 4OCMC 2P5EE 2DLIA 3ZT5A 5FGSA 5I74C 5HGBB 2ZSVB 1NBVL 4L8SC 2E7CA 1H8SA 3C08H 4K07A 3FT4A 3K46A 1RFDL 5FYLD 3AREC 4P23A 4U1MA 3RIAK 3INUL 3QQ4A 2OP4L 2HJLA 3D3VD 1E6OL 1JHKH 1K4CB 5E00B 1G6RA 1UJ3A 1R3HB 2ICWB 4ONGL 4X8JA 4XHJC 4W68A 5C0BB 1GHFH 3MV9D 2XIDA 4BH8B 3N50A 5GSRA 1I7TB 2IMNA 3OKYA 4M62H 3V5DB 3GJFB 5DD1H 4GW4B 4KROC 5EWIL 4PJBE 2A6KA 1UB5B 2I26N 5HDQL 5C0FB 2BDNH 5CWSB 4JR9L 2V9TA 4ZO7A 5FYLL 2EDOA 3KXFA 3WN5B 3PWNB 5IW1A 5IKCB 3BPCB 1XH3B 3WBDA 3CU1A 1NJ9B 4ZUWA 2PYED 2Q20A 3DARA 3H8NA 3ZL4H 5J13C 1QSEB 4NFDA 3ZKNC 1K8IA 3S6CA 4PPTA 5FXCH 5F3HB 5LBSH 2NY6D 5IK3B 4RBPK 5TE7H 4F7PB 3REVB 3VXMA 1A1OB 2XTLA 3S35H 1S9YA 2AJUL 5A3IC 4E41E 2DKSA 4XCEB 5KS9B 1U8KA 1UCBH 3X3FH 1EAPA 2FHCA 2XA3A 5AEAA 3VXQB 1ZEAH 2ZOKB 4L1DA 5BW7C 1BJ1H 1BVKB 2XN9E 5BZDA 3O2DH 4NNYA 4RFEB 4L9LA 2XTJE 4UUJB 3GM8A 2QEJA 4DGIH 3V8OA 3SGKC 3L9RB 4KI5F 4NCDA 1LEGA 5L6YL 1BFTA 2VUOA 1WZKA 3O6FD 2HKHL 1FL5B 1D5IL 3HC3L 1KENL 3S36L 3MA9H 3BEWB 5ANME 4OAWA 4RFOH 1GC1H 5GS0H 1ZGLA 3SKOA 4FOMA 4I9WD 4M9OA 2BNUB 5CGYC 2I5YH 4XVSL 4BZ1H 1BIIB 2V9QA 5I17A 5DMIH 5C0RH 1KBGH 5IMOA 2YUVA 3D85D 4NWTL 4J8RA 1ZKAA 5H8DA 5HHPA 1CF8L 1FZJA 2X4NA 2B0SH 4OLYL 1WFTA 3P0YH 5FYLE 4PJ5B 5TGBA 5CD5C 1MWAH 2QKIB 3FONA 4K3GA 1K5NB 4IHOB 1JHTA 3IF1B 4EVNA 4DZ8B 4K7PH 4RQQB 4JKKA 4R3SB 4X6FA 1RIUH 1NH6A 1AQKL 1VEOA 1F6AB 4PP2B 5DVNA 1HINH 1RU9H 3CLEH 1EZVY 2OZ4A 3BYTA 3MV9E 1IKNA 4D0CB 4NO5A 1MNUL 3B2VH 3QI9A 3QIWC 4WO4B 5MI0C 2IPTH 3G6JE 4C59B 5H37H 3D9AH 4QWWC 4N9GA 2AXJA 4UDTA 1G1YA 4JFDA 4R96A 4CUCA 5D7LB 4OGAC 2UYLB 1TJHL 3NA9H 4HDIB 1XGPA 4M9PA 4HEPG 4KQ3L 4LAJH 5ADOH 3OAZH 3TN0B 2PYEE 2EYRA 3MGAA 2V2WA 2VKWA 1PY9A 3ZKSD 1BOGB 3CH8A 3GMRA 4HXBL 3U82B 4XNMB 2MTPA 1ZT7B 3MLXL 4V2CB 3GO1H 4UIKL 4I18C 4JZJC 4X0KB 1O7SA 4CMMB 5DHVA 1AKJB 4NN6C 1F2QA 4FG6C 1M6OA 3NIDE 1I8IA 4JHBA 2ZG3A 1NUFA 3IDGB 2YXFA 2YR3A 3RPKA 4LRIA 1IL1A 1YQVL 5IB4B 2Y4SA 1FP5A 2JE8A 2VR5A 4LP5A 2O5YH 2X2YA 3MO1A 1PVHA 3UAJC 1L9MA 1EHNA 4PJEE 3BN9D 4GG6B 3P4LA 3DVIA 1AGBB 4LF3A 4G6JH 1AGDB 3D25A 3WV0A 4NRYB 4PJ7E 3L3OA 1KXVC 3GBLA 3U9PH 1NLBL 2NY3B 2YD9A 3QA3B 1A0QH 1UWXK 4JPVH 3CDCA 3ZDZF 1ZA6A 1TVDA 2B5IC 2GQHA 4I9WE 4G6AC 2KKQA 7CGTA 4OV5A 1U2HA 2GUOB 1AFVL 3FT4B 4LSRH 4XBEH 4P23B 1NDMA 4U1MB 3H7LA 3WDIA 3KJ6H 3QQ4B 1BJMA 4HBCH 2HJLB 3QDJA 3O4LD 5JDSA 1HSBB 4EXPX 3DURB 1G6RB 1UJ3B 5DHYA 3LS4H 4CBPA 1KPUA 3MRCB 5F96L 4X8JB 4BSWA 1WVZA 4DGYL 4KTDL 3HE6A 1OQOA 3AVEA 5B38G 5E4EB 3TPUB 3QUYD 3T04D 5GSRB 3BP7A 2LAGB 1FG2A 4I0PD 3QUKB 2OJZL 3HR5B 5I18H 2FBJL 1Y6KR 4TTDC 3C9NB 2A6KB 4FQXB 4DN3L 3QFJD 4N1CA 3SO5A 4LU5H 1CXFA 3KXFB 4WEBL 2FGZA 3EOAB 4Y4FC 1K2DB 4CAGA 4JN2A 4ZUWB 2OX5A 4EIZC 1K8IB 1KXTB 3QXTA 1MIEH 1T83A 2APFA 3RA7L 1DLHA 3KR3H 1KULA 1IRAY 1ZE3C 1LHZA 3IXTB 4PLOB 4Z5RA 1S9YB 1P5UA 1AO7D 3OXRB 4F3FA 4BELD 4CDHA 4DKFH 4HPOH 3PV6A 2R56H 4M3KB 1U8KB 3MCLL 1FNGA 2MFNA 4PGCA 4HGWA 1JZ8A 1EAPB 2COQA 4M5ZL 2EDLA 1JI2A 2QHRH 4F9PA 3NABH 3D0LA 1F11A 1MQ8A 1R3JA 4FNLH 4UTBL 4WUKL 1BP3B 5F3BA 5I1HL 4HFWA 5B8CA 1DVFD 4QHKI 1S7QA 1CFSA 3D48R 4LCIL 3S8WA 4ZSOA 3BDYH 4OAWB 5IVXF 1ZGLB 3SKOB 1CGXA 3C8KA 4J12A 2FEEL 3TBVA 4TUKL 2IEPA 3MLSH 3LPWA 4XVUD 1L7TL 3VU2A 4UI2A 5IMOB 2BSTA 2XQYK 4DUWA 4NHCL 3VFWB 1GXEA 5F9OL 2EDQA 2PR4H 5FYJH 2X4NB 5CJQL 4KJWC 5TGBB 3HC4H 5TDOB 3FONB 4Y5VC 2BX5A 1RULL 1JHTB 1CGVA 4EVNB 1CFNA 4I3SH 4DOHE 3Q2CA 1S5IL 4X6FB 5F9AC 3SKMA 4JFEE 2R0ZL 4LSTL 2IG2H 1N6QH 1UM5L 1UT9A 2AW2A 4PJHA 1KJ2L 1G0DA 2DWDA 5KZCB 1EHLH 4NO5B 5GRUH 3QI9B 5EUKA 4FFYL 3JUZA 1FGVL 3MBED 1QSED 2HFGH 1KTDA 3VE0A 3PABA 4N9GB 4UT7H 2J4WL 4UDTB 5IFHL 1KIPA 4JFDB 4R96B 3QFJE 3O8XD 3LS5L 2HN7A 3LMJH 2VQUA 5FGBC 3FO0H 5FYJU 1XGPB 3T3PF 3ALPA 2QHLA 3UO1H 2VDKL 3GMRB 2ORBL 1T89A 2XG4A 3NBNA 4LEOB 4O02H 4YNYB 4GRWB 5KTEL 3G5YB 5LGKA 4OCXL 1RV6X 4JAMB 3MUJA 4R26H 3ARUA 1AO7E 1I9JH 1M6OB 2E6JA 4YXLL 5C8JB 2YPVH 4N9OB 5DO2D 1BGXL 3CSPA 1IL1B 2GITA 2FD6L 3MO1B 2WLZA 1IM3B 4J23A 1WICA 1K3ZA 1QA9B 4M7KH 1HOCA 3RNQA 3BFOA 4QRUA 3D25B 4NP4L 1ZANL 3L3OB 2JB5L 4PYGA 5F6IC 4P4KB 1NEZA 5F7EH 5DVKA 5GGVH 3SDCC 3SE4C 1ZA6B 2YD8A 2X4QA 1G9ML 4OV5B 4GKZA 3A6BL 1G0XA 4PLJD 1JWSA 4PJ5D 2HT3D 4KVCL 3UBXI 3T2QA 4XBGA 1WCQA 4JB9L 1VA9A 4YR6A 2Z31C 4CADB 1JHLL 2J7LA 3QDJB 2WZPD 5JDSB 1VEPA 2GW5A 4JJ5A 4BSWB 2DLFH 4MA7H 3ZT6A 2JJTC 3SE9H 4PRBA 4ZS7H 3SOBL 2VWEC 1G7HB 2J3SA 3BP7B 5GZNC 4RSVA 1KB9K 4GW5A 1FG2B 4ZFOL 3D18A 1FNAA 3HFML 4M61A 5D7LD 1X5LA 3QAZC 4KHTH 2CPCA 4YFLF 3VWJD 1CLYL 1RUQH 5CEXA 3TN0D 2WW8A 3RL1A 4ODVH 1H3VA 1QSEE 2EEBA 3TVMD 3UYPA 1X5XA 3FCTA 3HZKA 3ROLA 1QLRA 1DQTA 4LCYB 4X80L 1DLHB 5ESVA 1XGUA 4OLWL 3HTLX 1Q9LB 3ILQC 5KS9E 1SYVA 3PV6B 2ARWA 3GI8L 3ZT7A 3QNXA 4PGCB 5ESQA 1CICC 4FQJH 1IILE 3CZFA 1X5YA 1B4JL 2QV2A 3PHQA 1LE9A 3MROB 1F11B 1R3JB 4HD9A 1QRNA 2Q1EA 4U1SA 1C5BL 4Z7WF 5F3BB 1U3YA 2HLAA 4QGTA 3SE8H 4PV8A 4N0CD 5FUCE 5TDPA 1UEMA 3RVXD 4XPHH 5B8CB 4S1QH 3LQZA 4MX7B 4ORZC 1S7QB 3QJFA 1CFSB 2NY3D 3CFCH 3FQTB 4GMTL 5BS0B 3GBNH 1FNEA 2D0FA 1FYHB 4MJIA 3BHBA 5I1EL 2P8LA 1OAYH 1PLGL 1U3HC 4J3VA 4AG4L 1U0QA 3IDUA 1HSAA 4P23D 3LEVH 4O5LL 4A6YA 4OSUH 2BSTB 4D0DB 2J88H 4XP5L 2JCCF 5AUMB 3HUJF 4BKLA 3GSVA 3CMOH 4XWOC 5IVOA 3T0DA 1MCQA 1T2XA 1UEYA 2HWZL 4PJ5E 1RIHH 5A40E 5EFIA 3P0VL 3TIEA 1J0YA 2DQHH 2EH7L 5ICXA 1DBMH 1R5VA 5MEQA 3SKMB 4UTAL 5HVWA 4HWZA 5AYUH 5F6HJ 4PJHB 2DWDB 3CFEA 3MACH 3KXFD 4IMKC 1GIGL 5EUKB 1A9BB 4NWUL 1QSFA 2YOCA 1A4KA 3OZ9L 2YZ1A 3VE0B 4J6RH 2A6JA 3CVHH 2XA8L 1G6RL 3PABB 4NQSB 1CDHA 5D7LE 1MCPL 4MS8D 4OGXL 2YPLB 4Z7NF 1FPTL 4ZYKA 3VXMD 2VMFA 1F8TL 4P2RA 1J86A 4ODUA 2GHWB 4NKMB 4JFOA 3R0NA 5EOCJ 5BOPA 3MV7A 5K9QI 2EXWC 1IM9A 1NLDH 1UWGL 1Q72L 2YWZA 4IIQA 5H2BA 3W5MA 4JDTL 4JG1L 3W9EA 5DMKA 3I50L 2X4UA 3KPNA 3UPCA 3P0GB 4Z77B 4TSAH 4NKDA 4HIXH 4GG6E 1HOCB 3RNQB 4Y19A 1VEMA 4YBLB 3NFPA 1NUGA 1KC5H 3QG7L 4I13B 4WHTA 3GHEH 4M5YH 3ES6B 2OYPA 1RK0A 2J6EA 4M1CD 2F19H 3VI4F 1ZLSL 4PLKD 2X4QB 3K80A 4EN3C 1NAML 3S4SA 1KFAH 2Q3ZA 2ZJSH 4U0RC 3QNZA 3ETBF 4YR6B 1TZHA 4U6XA 4WV1C 3DYOA 2BVQB 1TFHA 4QXTA 4YE4L 1V7NL 4MLIA 4LSSH 3SJVA 4JJ5B 5KVGL 3QI9D 4XPBH 2WANA 3R06A 2FSEA 2IBBA 4LSVH 3MRPA 4ZODA 4NQXB 5DWUH 1UGNA 1KF9B 2VDLL 4AEFA 4JFDD 3QQ3A 1AR1C 1XCQA 1DLFH 4X7SH 2H32A 5D7SL 1RMFH 2IPUK 3KXFE 2DL9A 4LNRB 4P5TC 2FJGA 4RMQA 5CEXB 4P49A 1TNMA 3CFDB 5DVOA 3RL1B 3A6OA 1HK6A 5JPMA 3MRDB 2BVPA 2EDHA 3HZKB 4MQXC 1QLRB 4QGYA 5F9WB 1CL7H 2OZ4L 4HG4J 2IJ0C 3VXME 4MNGA 1VADB 4G8GA 1WBXA 2EEAA 1BAFH 1JGUH 3GSRA 4GJTB 1QFWL 3TT3L 3QNXB 2ENSA 4U1KA 1CS6A 4P59H 5ESQB 3VWKC 3QCVH 2V5SA 5DS8B 3CZFB 2NXYD 3BH9B 3PHQB 1LE9B 5TQ2H 3VXOB 2CRIA 1MRFL 4YFLI 2HLAB 5E5RB 4PV8B 5DD0H 5J6HA 4ZOEA 2VC2L 3LQZB 2KQNA 4JRYA 3NACH 3PP3K 3QJFB 2WAHA 2BFVH 2PYFA 4ELMA 1M7IA 1FNEB 5CEYA 4MJIB 3BHBB 4XAWH 2P8LB 4POZC 4XP4L 3VCLB 4IDJL 3I6KA 2PTVA 4G7VL 4NQVA 1YEKH 5CSZA 3PDGA 5J4MA 2CO6B 5E1AB 2WQ8A 3QDJD 2VDRL 4BKLB 3GSVB 2WUCL 2WM0A 1IGMH 1F90H 2X9WA 3TA3C 1CXLA 3HE6D 2EKJA 3TIEB 4GFTB 1KSRA 1YEFL 3K8MA 1R5VB 1TMCB 5IHZA 4HJJL 3IFNL 4X9FA 1UG9A 4HWZB 1QTYT 3WCYA 1X5FA 4KKLC 2NXZB 3U7YL 4NYLA 3VFRB 4OUOA 3U0WH 3DV4A 3CFEB 5SWZA 35C8H 2DDQH 4OM1L 3OKOA 1QSFB 3TNN<