1E6OL

Crystal structure of fab13b5 against hiv-1 capsid protein p24
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
210
structure length
210
Chain Sequence
EIVLTQSPAITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIYEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN HEAVY CHAIN
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
total genus 50
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oL01
1EVUA 3VD7A 2XRAL 4ZUUB 3MBEA 3G5YB 5EUOF 1A02N 3LQZB 4S11A 2XKNB 1XIWA 2VQTA 1F4WH 3RHWF 3MBED 3T3PF 1QR1A 4Y4KC 4HH8A 1QPXA 4QTIL 1XIWD 5T3ZD 5CFHA 3ULVL 4PG9A 4Q6IA 3IJSA 3WFDL 5KJRL 2DN7A 1OARL 1ZA6B 4PJFE 5GRJL 3ARDB 1RK0A 4LLUB 3MREA 2LTQB 4R97B 2X1WL 2QQLH 1YNLL 3BGAA 2DM2A 4WI2A 2VZVA 5E8NB 3SGDI 3NZHL 1DQQA 1A7OH 5BMFH 4MGXA 2FHFA 4UTBH 4BZ2H 4FS0A 1LEKA 3QQNA 2FJHA 3T4YA 3QIBC 3MRGB 1RUAL 3B3IA 5F9WC 1EAJA 4E41A 4HV8B 1MI5A 1PW3A 2R1XA 4DVBA 3GMQA 4TSBL 3HZKB 4U6XA 1D6VL 3FQWA 2VXSL 3KPNB 3HNVH 2Y6SD 5CSZA 1T3FB 2DQIH 3K46A 5I8KL 1FGNL 4KXZH 4OZGB 1YN7A 1PZUB 4JFEB 1NUGA 1I9RL 5EUKB 1RULL 3L7FA 5IWLA 2AK4A 5JHLH 1A5FH 3S35H 4OUUA 4H1LH 2FO4B 5C0FB 2AK4D 1J18A 3MLTA 5TJWK 3BN9D 1Y18B 2YC1A 2R2EB 1CDYA 1NCWH 2HMIC 2A6KB 2ATKA 2NNAA 3BKML 1YPZF 4X5XB 5FM5M 3DV4A 3CVIH 1MFEH 4J3VA 1ZA3B 3X13A 4TRPL 5DD6B 4OCLC 4LLYB 3ZKXC 1HCVA 2C1PB 4HJGB 3SKJH 1BZ9A 4L3ED 4F15B 5KANG 1AKJD 1MJ7H 4KY1H 1A3RH 4PR5B 4JO2H 3KJ6H 4U1KB 5E8PA 5D9SB 3HZMB 2R1WB 2B5IC 4BM7A 5IB4B 2RR3A 1NCTA 4ZUWB 2FX9L 4OCNC 5ESQB 4QRPB 5CJXC 1V7MH 1A4JB 5IFHL 1CICD 5CKAA 1SEQH 2HT4C 1NC4B 5KW9H 2JCCF 3V6ZA 1A1OA 1KIPB 2W65A 3LN9A 3QDGB 4PJ7B 4Z0XA 4Q6YA 1VCAA 4H25A 4PRDB 2VDOH 4ELMA 3ARRA 5CP3A 3BP5A 1WFTA 4J7RA 4P9HC 1T7VA 3DI2B 1JHTA 3WE6B 4XPFL 2P5EA 5LGJA 2MPAH 4J6RH 3TT1H 3IS0X 5TF1L 3EO1B 3CMOH 2I07A 4HPOL 1BJ8A 3DX8A 2P5ED 3SDAC 3OB0K 3N9GH 5C9JA 2XIDA 4I2XB 3ILQD 4ODTL 2JJTC 1CGXA 4KRNA 2V9TA 1DBML 5CBAA 1KT2A 1IAKB 2BDNH 4JQVC 4LP5A 4NNXB 4Q9BA 3QUYC 1FG2B 2OJEB 3K81A 4R0LA 4CVXB 1CIDA 1MFDL 1NFDA 3PE9A 2LV4A 4LVOC 4Y5XA 5EIQA 5CLWA 1FRGL 4ONGH 1KENH 1XGQA 4Y19A 3PP4L 1DQML 4K3DH 4W68A 1PSKL 1FIGH 4Y19D 4OM0L 4L9DA 3V4VH 3FB8A 4YHPB 1KG0B 2FX7L 3GSQB 3X11A 3VXMB 3GKZA 3V52H 1DBKL 2AJ3B 1R3KA 2HVJB 4XAKD 1A6VL 2MCG1 4P57B 3MGOA 1DBAH 3GIZH 1N5YL 3HMXA 3O3BA 3VFGL 2OR7A 3S96A 4HIIA 4OLYH 1ZKAA 3S5LA 3CUPB 1F8TH 1OP3H 1GAFH 2ITCB 4GAJL 5CMAB 4RGOH 4JREC 2VLJB 4JB9L 1XF5A 1QSVA 4MMZC 3BUYA 4WW2A 4LSSH 4M8QA 2LU7A 3LMJH 3W81A 4OZFH 2PO6B 3HI1A 4JM4H 4HAFA 2A77L 3L3KA 3LB6C 3B83A 4GMTL 4Q2ZA 1NSNL 1PKQE 3BEWB 2FEEI 3GEWB 3SDXF 4FA8A 1NAKH 3WUZA 1FFOB 5IB1B 3B5GA 2Z0BA 5F96L 5ALBH 3OXRA 2F19H 2QSQA 3CVHL 3ZKSD 4EUPA 5KG9A 4ODHL 1YEJL 3EYQD 3QAZB 4TUOB 3K7UA 4P2RB 5DQ9B 5IMOA 5CWSA 4WENB 5EBWA 1D9KC 1AIFA 1AGFB 3MRHB 5SWQB 4OLVH 2DD8L 2YPLE 1UCBL 4IJ3B 3UROR 2EXWC 3BPNB 5HI5D 1A7RH 1AGDB 5D8JH 4ZPTB 5TPWL 3S36X 1GC1C 5HYJB 1G0DA 1CDCA 4LSTH 4KTYA 2NY2D 5MEPA 4AK1A 5IV2B 2FYYA 5IBUG 3I75B 5CJOH 1MIEH 2C4FU 4YO0A 1NEZG 5CBEB 1AHWB 3HLAB 3VE0A 4Q9QL 2YZ8A 3JTTA 2YMXL 4WY7L 1HSAA 4OLUH 1HWGB 1N4XH 5T5FH 4PRNB 3D3VB 5KS9B 1PLGH 3VXUA 3OSKA 5LCVH 5DD3H 1KACB 4B53A 4L3EE 1K9TA 1BVLA 4Z6AT 2DQFA 3GMPB 5DGQA 3VG9B 5J1TC 3VXUD 4ODUB 5FYKD 4E5XB 3F5WA 4QLRA 1FV1A 3KXFE 3RWGA 3FB5A 4MJIB 4N0UB 1IM3B 4LCUB 5CIPA 5EZJB 2FECI 2IAMD 5HDBF 3OPZH 1N0XL 1KPUA 5C86A 5D7IE 5C0ND 5IVZB 2Q7YA 1UJ3B 4K9EL 1DQDL 1T22A 3DYPA 3WXVL 2IBBA 4M6OH 2IGFH 3KNBA 5CGMA 1L0YA 1T1ZA 4AH2A 4LLMA 2DQHH 2V2WA 4L8SB 4GQ9H 1S9KC 1KN2H 3OTTA 2P5WA 5J3HC 5FFLA 1CLYL 5HYSB 1G7IA 4ZFFA 1NLDH 3AMLA 4PUBH 4X4ME 1YY8A 4WFGE 3FQXA 3VXPB 2P5WD 1LO5A 3IDMB 3SJVD 3L5XH 5A3IC 1LMKA 2N4IA 5MERB 3D9AL 4H88L 2AP2A 1XCQB 2PXYA 3OKYA 5BVPH 4RFEB 1P4BL 3NCJH 4IIQA 4YJZL 2E7MA 5FA4B 5TFSH 1J1XL 2PXYD 4PJAB 1FNEB 2H26A 5TE4H 4GAGL 4D8PA 2XG5A 4N90D 5T1DH 3E2HC 4TTGA 3FAXA 4X98B 3WNPA 1A9EB 5F3HB 5DJXB 3I2CH 2J3SA 4GW1A 5C0IA 1EMTL 4WTWA 4ZAKB 4OIBA 1KB5H 5D1QA 4PGCA 5LGHL 1GZQB 5LAXA 5GZND 4P2CG 1AXIB 5D96B 5I2IA 4S0SD 2YA0A 1YC8A 1E6JH 3SY0B 4Y19E 2W60A 4ZXBC 4K71C 1I8MB 4G6JH 2A6IB 5J6GB 4XNUH 1I3RA 5MEOB 4XAKE 3WS3B 5CJQH 3NPSC 4KRPB 3KWWB 5EIIA 3VG0H 3DI3B 5FUCC 5CINL 4FRWA 4G7YH 1J10A 5DD0H 1A1NB 4U3HA 3DROA 2GAZA 4FHBD 4MLIA 1S78C 3WIHH 4JZNB 4NQUA 4YDKH 1AXSA 2KBGA 4UV4H 2X70B 3BGFB 3VA2C 4HV8A 3ARGA 1JPFB 3ZDXF 3EO0B 1TVDA 1IGIL 3ARGD 1CTOA 4LCYB 3L5HA 3CH1A 2Y5TA 1H3VA 4HUUA 4RAUA 3QG6A 4NHUA 4U2ZA 4PJEF 2ZUTA 1ADQH 2HKHH 1IMHC 2EYRA 2EXYD 4XX1E 4UT7L 3TH2T 4NGHL 4JY4A 3ARBA 4JFED 4DKFH 2EYSB 4Y4KB 4X5LA 3WFHA 1P2CB 4FG6D 3ARBD 1KYOK 2IFFH 4TTDC 4OCSL 4R3SB 3JV4B 4WUUB 4Z7UA 1IGML 2J88H 5D4QA 4NKMA 1AP2A 1WISA 2AXFB 4JFFB 1ORQA 1VA9A 3G5VA 4LPXA 3GI9H 3OKOB 5DD6A 2FIKA 4XAWH 3RDTA 3U7YL 3IAQA 1RIUL 2AV1B 3H9HA 3WS6A 4OLZL 2VWEE 3RDTD 4KV5E 3P73A 3S37H 1T03L 5CILL 2XKSA 5FCSH 3CU7A 3HPLB 1HEZB 2B4CC 2KDGA 4YDVB 3QIBB 3UZEA 4MDJB 5F9WB 4NZJA 1KN4L 4FQXC 1T6WA 3LCYA 2BXYA 4V1DE 1V5JA 2R69L 3PP3K 4FFYH 4XVJL 3DLQR 3HG1E 1AD0A 1MCOL 4KDTA 5K93A 5I76A 2X9WA 4YFDB 2WNGA 4XVSH 1NC4A 2JJUA 3QZWA 3FJTA 3KYAA 2VITB 4CN4A 1JF1B 4WI7A 1CDBA 3MROB 5HVGB 3RHWK 1NC4D 1U8JA 3SCMA 1CDIA 5F7LB 1UWGH 4DVRL 5IROA 2VL4A 2H6PB 3QDGD 4EDXA 5IVXA 5ESAB 4OFPA 1S9XA 5FYKE 4M1CD 1M7IB 1F58H 4N5UA 3VFWA 2HTLC 3S3PA 4X9HA 1KJ3L 1ZHNA 4PGZA 3L7EA 2WBWB 4K3EH 3MYJB 4PJHA 5EOCH 3FCTB 4TNVF 2XTJC 4U0RC 4U7SA 1FIEA 1AQDB 1CDHA 1FNLA 4X6CA 4XH2B 4C56A 2DQIL 4H1LG 4MD0B 2YZ1A 4ODSL 1MF2L 1PFCA 1V3MA 1J9CT 3UTOA 4C56D 5EC2B 3IT8D 3ZKXB 2X7LB 4XCCH 4L8DB 3KJ4C 4HC1H 2FH6A 3ZDYE 5H94A 5J9PB 1RUQH 4Y89A 1JVKA 2DI9A 1FO0B 3V8OA 5EPMA 5F3BA 2B5IB 1BQHG 3VXQB 3SJVE 3LKRA 1ZVYA 1I1CA 2PYEE 5E4IA 1IGYA 1KCKA 1WBYA 3CK0L 4JO4L 5J12C 5C0CE 3KPRA 4HFWA 5DJ6A 1Q9OA 5FF6B 5H2BA 2LU3A 5E24E 1YC7A 4X6DE 4S1SH 3KPRD 1H0DB 5EZLA 1KCSH 3MJ8A 5MENE 1RZIA 4XNXH 1EGJA 5DC9B 4QF1B 3JTSB 3JV6B 5JHDB 1KTRL 5TE7L 5EZIL 1LHZA 5C0GA 5L88H 2X9YA 5CEYA 3RNKB 1ZTXH 4WEUD 5CD5D 5IOPB 4OD1L 4APQC 4ELKA 4Z77A 3BMWA 1AJ7L 3ZE1E 2ADIB 1CVRA 3ZHDA 5DQJB 3SDAB 5FECA 4KHTL 4P4RB 3OF6D 1EHAA 3INUL 2X41A 4MNGA 4XPGH 1YN6B 4YHLH 3S9DB 3BEWA 5ITFB 4MXQC 5KW9L 1ROWA 4EEEA 3QUYB 2YD8A 5E5RB 3O6KL 4RZCB 4XP6H 1R0AH 1JN6B 4RMVA 2VN7A 4I3SH 4XC3L 3SDYH 1FFPB 3IAPA 3QHFH 2OR9L 4TULL 2D7OA 3V95A 4S1DD 1EUTA 4XB7A 4PJXB 3PDOB 4ZS6D 3D18B 5D1QC 2VXUH 4P3CH 3HNSH 2Z8RA 3DVNA 2BNQA 2RBLA 1NFIB 4ZD3H 4D0CB 2BHUA 5HYJA 5BW7C 4JFHD 5C3TA 2BNQD 2OX5A 1EUUA 4OZGE 1VEOA 4GLRI 2ICWB 4TPRH 1UJTA 2PCPB 1MHHB 5HYJD 4X6FA 1AY1H 3ELAT 4JFEE 3DJ9A 4YFLI 4JREB 3FT2A 4PRAB 5DMGC 5IEHB 3I75A 1R3HB 4K3DL 1PEZA 3SKOA 5L8KB 4YEEA 1AHWA 3GB7B 3JV0A 4NYLB 3SO3C 3UJIH 4HIXL 5E00A 3C09C 3BD5A 2XPGB 5BJTA 2CKBA 2B2XL 3V52L 3NZ8B 4YX2H 1IQDB 4BSWB 5HHVL 5HGBB 3CCHA 2X4TA 5I8EB 3CSGA 3QI9C 3CU1A 4L4TA 3HRPA 1GGCH 5TGBA 3TA3B 4JO3L 3U2SB 3FN9A 4RGOL 1PD6A 5DS8A 5F21B 1GHFH 2FBOJ 2ZSVB 3I02A 2P4AB 4KQ4L 4PBWD 3TEUA 1NBYA 2GFBA 2QV2A 3O3EA 1NGQH 4OCYL 1D9KB 4LEOA 4MJID 5CJ5A 5F7MC 2DQTL 1OAXH 1MRDH 4Y8AA 1W72A 2Y7QA 3UTTB 1P6FA 3OJDB 1K2DB 2CPCA 3MRDA 4QRPE 3OAUH 4B41A 3MLYH 1JRHH 3ZDZF 1B6DA 3NTCL 5IESL 3VXOB 3T04D 4KZEH 7FABL 3LRSB 2IQAB 3RP1A 5MEQB 3IU3B 4NUGL 3LQAH 4IOFD 4YBLC 3QDGE 3WFBH 4PJ7E 4WU7A 3P4NA 3ZL4H 4D9RE 5JXEA 2H1PL 3BWAA 3M17A 3WS6C 3T0VA 3IJHA 3O8XC 5JXED 4KVCH 2I5YH 3F58H 1CGYA 4OLVL 4JR9H 4RFEA 5C1MB 3ULUL 1BVKA 1BJMA 1FNEA 2CK0H 4I2XE 5E1HB 5HPMB 2HJKA 2EE2A 3CFBA 1F2XK 2QADC 1JZ8A 1DP0A 3IRZA 5KANI 2GITB 5DT1H 5I1GL 4P2QA 1TXKA 1WUNT 1JTPA 3O3DB 5KSBB 2DQDH 5CP3H 4L8CA 4P2QD 4HPYL 4ODXA 5T1MB 4GRLC 3AROA 4GKZA 5F1KC 1CXFA 1XGTB 2EYTA 3FB6B 3BISA 1L7TL 3TM6A 5TDOB 5HYQA 2NTFA 2RGSA 3QEQB 4ISVB 4ZQKB 1HOCB 3SCMC 5CJOL 1SJVA 1L0XA 2PN5A 3MJ9L 3RGVC 1KELH 4CNIA 3PGDA 4DQOL 3B4NA 3TNNB 2MCPH 3F7PC 4OUOA 5HTSA 3VXME 5I8CA 1N4XL 4KRPD 2BK8A 1CFVH 3TZVA 1QP1A 4HGKC 4FXLA 4J3XA 1J87A 4AENB 3FL7A 3VFOB 3ZE0E 3TZVD 1FPTL 5GGVH 1CDJA 1DSFL 4NWUL 2Q87A 1G6RL 3VH8G 8FABB 5DHVH 2VLJE 3U83A 5CCKH 1I3VA 4DWHA 5C7XL 4X4XB 4X4YB 3CLFL 4EN3C 1H3UA 1IKNC 3PV6A 1DLHA 4PLKC 5A16B 1MUJA 3BGMB 1CE1L 1M05B 1WZKA 3E2HB 4ZFOL 2XWTB 1T0MB 1TENA 3QO0B 1P2CA 3WN5C 3ULVC 1JPSL 4KJYB 1MCFA 4PUBL 3IXTB 4R3SA 4Y4KD 1QFHA 3NN8B 1L9MA 4P2RE 1N64H 1Y6KR 3WFCH 2ILLA 3WFEH 2AGJH 4XWOC 5EBLB 1Q0XL 4YR6B 4ZXBB 5BZDA 4K71B 4NM4L 4PJ8C 4YE4H 4S1RL 3NPSB 1UM4H 1OPGH 1T4KB 4JAMB 3U4EB 3EUUA 3KPLB 3PQYB 4KI1A 3T0EB 2IPUK 1BFVL 1VACA 4G8IA 5DFVD 3V5DA 2X5PA 5DO2C 3MLSL 4YDVA 4UQ2A 4MDJA 3LKPA 4XPHL 3L1OH 2VSDA 4JJHA 3RTQC 4WCYH 5I1EH 3WXWH 5DJDB 1S3KH 1J0YA 3GMLA 1E6JL 4UQ3B 3VXRB 3P77B 2WV3A 1SHMA 2O5ZL 2FGZA 1ZHKB 4RDQF 4TVPL 5EORH 4ORZC 5CJQL 3I9GL 5C0DB 1C5DA 4PGJA 2NY1D 3Q6GL 1GPOL 4JFPA 1JZ3A 3IXAB 4PJCA 2D7QA 5DD0L 1CF8H 1OGTB 3D3VE 5ICXB 1KCLA 2HG5A 4MJ5B 5KS9E 5B39B 3AREC 3VW3H 1DQLH 4YDKL 1EAPB 5FO8A 3AS0A 3I3BA 2VXVH 1I7RA 3WD5L 2BCKB 3GRWH 4DN4H 4X8JA 4MJIE 4N0UE 3EOTL 2AABL 5DFTA 1PQZA 3V2AR 4U1NA 1FL3A 5JPMA 1MJ8H 4M7KL 5FKPA 1IC7H 3MRCA 4NRYB 3D2UB 1VERA 5DVOA 1F00I 5GS1A 3OAZK 4K7FA 1G7PA 1DEEB 4KH2A 5FYKH 4D0BA 5D72H 2YHGA 2IH3B 3P0YH 5ITBL 3BRDA 3TC9A 4AEHH 1A3LH 4OQTA 1T1WB 1KIRA 5D93C 4P5KB 5CEZL 5INCB 2K3TA 3TFKC 4OKVA 2I27N 3BDBA 4KQ3H 1G7HB 4UIMB 2C4XA 4JDZA 3O3UN 2EIDA 3FT3A 3Q5TA 1R3LB 2CGRH 5I71C 2LQRA 4NQSB 4X7CC 3MMEB 3MRBB 1F4HA 1MEXL 4PJAE 3S7GA 1MCWM 2VDPH 3LD8C 4BELD 2VISB 2NYYC 4JFOB 1MWAL 2A74B 3JTSA 4F37K 4EXKA 4X99A 3SE3C 5J13B 2GSIB 1OGAA 3P4OA 4MJ2A 4NZRL 3UX9B 3WNOA 1OW0A 3RWEA 3H42L 1OGAD 1N26A 2DDQL 3FO1A 4U1SA 5ID0A 3UPCA 2XTJB 3VWJA 4U0RB 4KI5C 3ARFC 5AZEL 4XVSL 4YGVB 1XGPB 4KKCD 5DVMA 3C6SB 3Q0HA 1S7RB 4UAOC 1V8HA 4EOWH 3VFTB 4ZTPL 2Q8BL 3HUJA 3SOBL 1H5BC 5DURB 4PV9A 3MLRH 1JTOA 3KPOB 4HQQH 3VFNB 5GZOC 4QRTA 2I25N 1OM3L 3M1BB 4Z7VB 2XG4A 5C0RL 2A9ML 4KDWA 1I4FB 3LHPL 3TH3T 2QSCL 1YQVH 3I3DA 5IFJA 2NLJA 2JB6A 4G6KL 3MV9B 5T1KB 4GW4B 4ONOA 32C2B 3IKKA 5FK9B 4J12A 4QHLB 1F6LL 5J12B 2R0LH 5D5MF 3V0WH 2OZ4A 1A7NL 3NACL 4D0CA 3PWUB 4P2OA 5C3LD 1ZVSB 4PREA 3BEVA 4GKSA 4H5SB 4XCCL 3NA4A 4P2OD 4HC1L 3GSNA 3CXHK 4HS8L 4YUEL 3THMH 1MHCA 4N8VG 1WF5A 3SKUD 3O6FC 2YA2A 3WNNA 3LKNA 2MKWA 1MVUB 2FIRT 3MLZL 1SBSH 3KPMB 4ZUSB 4L4VA 4BQ9A 4QT5A 2HN7A 1NLBL 3WYRA 4Z7WF 1OOAA 3ZKMD 1VGEH 4WUUE 3ZMRA 5C2UB 5KN5A 3NFNB 4L4VD 1Y6MR 4LAJH 2F58L 3G08B 4RMRA 3KVQA 4PGBB 3GKWL 4NRZA 4PFEA 5E99H 3NFPB 4JFFE 3ULSA 2XXMB 3VGFA 4EI6B 1P9MA 3RIFK 2AEPL 2ADGA 1E4WH 4NKIL 4XNXL 4M1GH 1A7PL 1U8IB 3DO7A 3D85B 3QUZC 5BO1H 5IHZB 3TA3D 2XV6B 5I75C 1CBVL 4BJLA 5LVEA 5INDB 3WDJA 1QBLH 4OSUH 35C8L 4UMGA 1BFOB 4JN2A 2D9CA 2J6EA 1VESA 2ZZUT 3OKLA 3MZGB 4GBXC 4NPYB 4ORGA 5F1NA 4KVNH 4EI5C 1OAZL 4UDTB 5KTEL 1MOEA 4F3FB 4NT6A 4MA3B 5H8DA 2ATPB 2O61A 4G80B 2OL3B 5EH1A 5EC1B 1EK3A 4U31A 1QOKA 3PIQB 5AG8A 3U0WL 2W9EH 3QNZA 4D94A 5DUBB 4P23A 2YPKB 1ZGLA 5JDSA 5FYJE 1CD1A 3P0GB 1I9IL 3RA7H 4OZIF 1RZFH 3CAFA 2KZ1B 3BESR 2XICA 2R2BA 1Z5LA 3K4AA 1ZT1A 1CE6B 5DD5L 1DEDA 4L3AA 1ZLVH 4BA8A 3SO3B 1CL7H 3C09B 3ARXA 4YWGL 2P42B 4M6MH 1UM6H 2VLLB 4XNQB 3FOMA 3LS5L 3C6LC 4FXGA 3QI9B 4YHIB 4H26A 4LLVB 5A40E 4KROC 1AY1L 1AGEA 5E2TH 3FB6A 4GO6B 2XZQH 2BVQB 3S4SB 1LO3H 3PXHA 1G9MH 2W92A 1QSZA 4XXCA 1ODAA 1HK6A 2VDRH 3QEQD 3RNQB 5ICZB 2AQ3A 4X9IA 3GSWA 2R39A 5T5NG 4GG6A 1TNMA 2GK0B 5DJYB 3L3DA 4IRSC 2F53A 5FO9B 3WIFB 5JIHA 1MAML 2HP4A 5IHLB 5L9DL 2EEBA 2F53D 1U92B 3HE7C 5F9DC 2DMKA 5TDPA 5EU4B 3DUSB 4QCIA 2R0KL 5JUEH 4KXZI 1AI1H 3FQRB 3HI5H 5GGTA 4PB0H 5JHDE 3UAJC 1FH5L 2B1HL 5GS1C 1CLCA 4RMWA 1BZ7A 3O8XB 5DA4A 3PHQA 3RL2B 4DUVA 4PRHA 3RVUD 1WT5A 5EOQH 4R96A 2NQCA 4PJFF 5GIRB 1N6QL 4OGYH 4PRHD 2FHCA 5HGHB 4O58L 3RPIA 5A16A 5D1XA 3H9ZA 4UILH 4EBQL 1AD9B 3C8DA 5E1AA 3EFDH 2QADB 3ME0A 5TE6L 4Q9CA 5D1XD 4A6YL 1KEMH 1WVZA 3RAJL 3MSPA 3NABL 2VOTA 4QTHA 3BP7A 4UTAL 1EEUA 4GRLB 4LPVA 2H2PD 2OYPA 2VXTH 1MAJA 3GNMH 5TDNA 2WM0A 3NCYS 4KVCL 5GXBB 3WL9A 2XXCB 4DTGL 3RGVB 4OM1H 1WGOA 3UTZB 3SKMA 2FWOA 5HYEA 2FJGB 3B9KA 2VZ3A 2OSLB 4PJXE 3U4EA 1LE5A 3PQYA 1HH6A 3T0EA 5C8JA 3B9KD 2OJZL 43CAA 5T3XD 4C59B 5EULV 1UB6B 3QUKA 3PQYD 3T0ED 3JWDC 3CD4A 4MA8H 5ALCH 3E6FB 4U6YA 4MQTB 2ZCKL 2X1QA 2Q86B 1EEZB 4TN9A 4MXWH 1VSCA 1JE6A 5DJDA 2NZ9C 5EO9A 1W0WB 3WIIH 1JNHA 4PGDB 5BRZA 2NW2A 3P0VH 3G04B 1B9ZA 5FA3B 1EFXA 4OF6A 4EN3B 1FFNB 3EOBA 3T77A 5I1JL 2GIYA 3VXRD 3QXUA 4Q0XH 1EFXD 2XTLA 5FCUH 4FMFA 1YYLL 4JHZA 4F2MA 1R5WB 3LSOB 3IXAA 4MSWA 2FJFB 2EH7L 2L7JA 3RIAF 2IG2L 2B20A 3ARSA 5ISZB 4G9DA 4G9FB 4C4KO 4GQPH 2J5LC 2BX5A 3B2VL 1JGDA 1MQKH 3WN5B 1CDGA 4ZSOB 1ZEAL 3CFDB 3FFCA 2VLKA 4YFEA 2ZJSH 5AWNH 5E08H 1OAKH 1F90H 2FGWL 4F57L 2X42A 1JPGB 4NSKB 1RZJL 5FV1L 3CZFA 3FFCD 2VLKD 3S5LG 1VFOA 3GK8H 1IAIM 1G9EA 5A43C 1NKOA 4Z7OE 2BC4B 2ZG1A 1ETZB 1PY4A 3D2UA 1XGYL 3T0WA 3BZFB 3UTTE 4OGZA 5DJCB 4DCQA 3IFPB 5BQ7A 4PJ8B 3JWOH 1NCDL 3ZTJG 3D2UD 4Z7NE 4LLQB 3HE6B 2D2OA 2Q3AA 4ZO9A 5GGRY 2OTUB 5BS0B 5HI3D 4JPIA 2EIEA 1U3HC 5FHAL 2CLZA 4U3CA 2HFFA 4Z5RB 1CQYA 4NN7C 4QXWA 3ZKND 4HJ0C 4WV1C 2HH0H 5KVEH 4OKDA 1K5NB 4P5MA 4L5FL 3WFEL 2AGJL 4I0KA 2Z8SA 3V4PH 3O6ML 3P4MA 2BNUA 4XBEL 3MMEA 1YMHA 5I1LA 1QRKA 5I30L 2XZAL 4XP1H 4QRRB 1KTKE 5FYLD 1N2RB 1IC4H 2CR3A 4GXVH 1B0GB 2EKSB 4I18C 1OAUH 5KSBE 3AREB 1L7IL 3WMSA 5SX4H 5EWIH 1RJZA 3BKYL 5ENWA 4Z76B 3BQUB 4WCYL 2EEAA 3BW9A 1LO2H 3WXWL 3QEQE 2EC9T 3SQOH 6FABH 5F7YC 3CSBA 1U42A 2BVYA 4P23C 2ESVB 5EUOA 3UTQB 5KVGL 1A0QH 1U8KA 1CIUA 3OJVC 4HZLB 4R6UA 4ZFGH 1EA9C 1JZ5A 1MFCL 4KK6C 2Z91B 1RZKH 2PR4L 3TP4A 3KGRA 3O9WA 1EIBA 1CDUA 1MCSA 3MQIA 3O2DL 1S7QA 1FSKC 4HX1B 4WTZA 4NP4L 2H2SC 3O9WD 4OZHB 3OKDA 2Q8AH 3M1BA 3ABZA 5DURD 3VW3L 3OXSA 1I9EA 3GBNL 2VXVL 4UDUB 1I4FA 1XF3A 2ITDA 2BVOB 3QQ3A 3PHOB 2C3XA 5AYUL 3BRFA 4YK4C 4KAQH 3R1GH 5GSVB 5DJ2B 3WLWC 1RJYA 3TYGH 5DWUL 1OAYH 2APBA 2A73B 4MB3A 1I1YB 3AUVA 1MY7A 4QHLA 4OD3L 1QVOB 1T83A 2X6MA 1HINH 2DICA 5JIIA 2CIKA 3KR3L 5HYIA 3MGTB 3MCLH 3WHE0 5J56B 3LD8B 5DRNB 3C9NA 2PTVA 5D72L 5HHPA 1B0RB 5IM7B 3QH3A 4FTVB 3T3ME 1A3LL 3QA3A 4YHZL 4LMQI 4ZUVA 4HXAL 2EIZA 1OTTC 4JKPH 4LSRH 3DMMA 3PG2A 4HUWA 1LDPH 4KRMB 5D71L 1ZS8B 3UYOD 3B5HA 3DMMD 3U9UA 1A9BA 4LNRB 5DJ8B 4QHUA 4F7MA 4R7DB 2CD0A 1K4DA 3BE1H 4LAQH 1ZHLB 2BFVH 3F7VA 2GEEA 4L3CA 1BMGA 3TWCL 3U36A 1ORSB 3HZYB 4UAOB 4Q9RL 4G6ML 5T3XE 1H5BB 5FUCE 1YPZA 3T0EE 2ORBL 5HDQH 4ZNEE 3D85D 4QXTA 2HJLB 2IADA 1E4JA 2VC2L 5FDWB 5F9OL 1S7VB 1T2QH 4KKBC 1YEFL 3T65A 2UY6A 5T5NF 3GI8H 4RAVB 3KYKH 1TJGH 4W6YB 3BZ4B 1EO5A 2Y25A 2WWKT 4XCFL 5HY9A 3VXRE 3N1QC 4MA3A 2V17L 4FQCH 1KFAL 4BH8A 2MHAB 4EOWL 1D5BB 5L8LB 4N68A 1LK3H 2DBLL 5DUBA 1CD9B 3O6LL 2W0FB 4CMMA 4HIHB 1JGLL 4ZTOL 1NAMA 1WITA 3BIKB 5F7NC 2AI0H 3WLBB 1DZBA 3O0RH 3O6FB 3KPQB 5IMMB 3BT2H 2NR6C 2G2RA 2JCCA 4F9PC 5FEBA 5DXWA 2CSPA 2OQJB 5D7IF 3LKSB 3LRGA 4XCYB 4KKLC 4DW2L 2OTWA 4LKCB 3RWCA 3QQ4B 4KUCF 2FCBA 4XHQA 2BRRH 1HQRA 5DEGA 4LSQH 3RVTD 5FYJH 2PW2B 5BCAA 2YSSB 4PLNC 1A47A 2P8LA 1U6AH 3LZFH 1U9KA 4FQ1H 5I75B 4PJGB 3RNQA 4NOBA 1WIUA 1BD2A 4PP2B 4QXUL 1OQOA 5FUOL 3FZUC 1BD2D 2VDKH 3FQTB 4K8RD 1SJEA 5JW4M 3V7AE 2E9WA 4GBXB 2D0GA 2HFGH 2FATL 3SE4A 3K4ZA 4X6EA 3P30H 4HJJH 1MH5A 4POUB 3O2VL 4EI5B 5DJ0B 1MPAH 1R5IA 4R8WH 2NY0B 3GJEB 5F93C 4WFHE 2QHRH 3ZT6A 1FE8H 1MLCA 2IANA 1FO0H 4G5ZL 1TZGH 5DK0B 4ONHA 5JXAL 5I1DB 1XGUA 4NNYB 5HHOB 3HPJA 4JFDB 2Q1EA 4TOYL 3EDDA 5FV2A 3MNWB 3ULUC 4Z0BL 3O8XD 3MFGB 1LD9B 1LILA 1P84J 2IMNA 5GIRA 3RWDA 3TBWA 5GISH 1IC5L 4OCMC 2K7PA 1U3YA 3LY6A 2XTJE 3FB7B 3OX8B 5D2NA 5C6TH 4S2SA 2GSGB 3MRFB 3BP6A 1EEYA 2E9IA 2YBRA 5KVDL 3ZZ1A 2QADD 3C6LB 4K3JL 3EOAB 1FAKT 4NQDA 3QO1B 4KROB 4P9HH 1JUFA 3QZWG 4NM8L 1T7YA 4NQDD 4NIKB 4Z7VE 2EICA 4ZDHB 3RA7L 5FYKU 3SDXA 4JQIH 1J05A 2BOBB 4F80A 1KXTB 4QHKI 5IB5B 3MV9E 5CSBA 4HEME 1Q72L 5T1LB 4BQCA 3GSRB 4P59L 4IRSB 4HGWB 4M48H 4YBHA 1XT5A 1PZ5B 2ICEB 2BY2A 4NHCH 3RX8A 2C3GA 3AS2A 4LARL 3HE7B 5GGRB 1C08A 3E6FA 2QQQA 1S7TB 3OB0H 5E2TL 4GG8B 5IJKC 3GM8A 1I7UB 5C2BL 3DHMA 4YAQB 3PWNA 3C8KA 1CFQA 4XBPB 1D5IH 4J8RB 3VRJA 1BBJA 4XI5D 1PAMA 2R56L 2V2TA 1UA6L 1BOGB 3O45B 2OZ4H 3OR7B 5JR1H 3FO0H 4OGAD 2QQNL 3VFVA 4DZ8B 1KPVB 4KV5F 3D0VB 1CGVA 3WJLC 3WDIA 4HUXA 5JUEL 5B3JE 5AD0B 4JHWL 5ISZD 5F89B 4M02A 4ZPVA 1AXTH 2W9LA 4HWZA 1YEKL 4QHMB 3CZJA 1SEBB 1U3JA 7CGTA 4XWOD 4M1DL 1E27A 3IFPA 4PLJD 3EDEA 1KOAA 1QSFB 1J7VR 5IHUL 2AJSH 3EFDL 3MLVL 3HE6A 3FO2A 4DKEL 2NY4B 1WEJH 1FQ9C 3QIWC 5I1CH 2Y5EA 3EBAA 3S36H 1IEAA 1H3PH 1QZ1A 1RIHH 1DCLA 1GOGA 1MCWW 4OGXH 1OP9A 3HE6D 4XVTH 1BLNA 2VR4A 4ONFL 4WWKA 1HHIA 1FVEA 1IKFL 4XPTL 4WWKD 4CJ0A 1FYTB 4UBDD 4OBRA 1IGFH 3MFFA 4WEBH 4G42A 3EJYC 4NN5C 4MWFA 1HNFA 1OB1B 5FM8A 4IOIA 2J6EH 2CDGA 3V5KA 1A4KA 1GC1H 2VJXA 4I5BB 1UEYA 1T04A 4WFEE 2W1NA 4UU9A 5CHNB 4QRRD 1YQ2A 2X1XR 5C08A 1UZ8B 5EN2A 2VLRB 1LP9B 3ZDYF 1HHKB 2J5LB 5C08D 5B4MC 1HXYA 2AEWA 1UXWA 1N8ZA 3C5ZA 3RWIB 3BQUA 3PWJB 2GUOA 2GT9A 3GHBH 3Q6FA 2IH1B 2VDMH 5EO0A 3BQUD 4ENED 1S9WA 1RMFH 2WP3O 3GGWA 5I16B 1IZKA 1JHKH 3L9RB 2Z35B 5JIKA 5JW4N 1TPXC 2FL5A 4X6DF 3TJEL 3E8UL 1FNSL 5MP6L 4NDMB 2ZKHL 1FZJA 3T8XB 2DJUA 1FGVH 5HD8D 4OZHA 3MRLA 3MV7A 5EA0L 2H41A 3RY6C 1TQCC 3MA7B 1U3HB 2YKLH 5I1AA 3OHXB 4JHBA 1INDH 3C2AH 3TFKD 3HC3H 4WV1B 4PGEA 3ZE1F 4QRSB 2C3WA 5K9JH 1JGUL 4TVSa 3VFRB 2E27H 4NQXA 1Q9LB 4HLJA 4ZOBA 3A0OA 1JF6A 2G75B 2UVEA 5F88A 3RIAK 1QLFB 4XXDA 4X7DC 2VH5L 4OLXH 3AXLA 4JQXA 3SHSA 4W4OA 1AQKH 1BZQK 2HTKD 2YPVL 1I7TA 4OCXH 4I18B 9CGTA 1XZ0B 4FTVD 1LNUA 4X80H 3CXDH 3QUMA 4G3YH 1HHJB 5HYSG 2UZXB 4M7LT 1QG3A 3P9MA 3S34L 2X4OA 4Z8FH 2RQ8A 1C12B 1KJMA 3BPLC 3O81A 1RZ7L 3LIZH 1JGEB 4I48A 2ID5A 5J1AB 2CIIB 3OGCA 4HZAA 4OZGF 3HC4L 1FSKB 1OHQA 1JRHI 5IBTH 2DTSA 4GXVL 2BVEA 3MCKA 2PETA 4UOW1 1PBYA 4Y2OA 1K8IA 2WQ8A 3MRQB 1MCIA 3SGJC 2IALA 1IAOA 2BSSB 3NAAH 4TNWF 1LO2L 3VDBA 6FABL 3LN4B 4CJ1A 1I1FA 2VNCA 2G5RA 5EOTA 3QJHA 4HF5L 5T3XH 1EZVX 4HH9A 3UJJH 1IRAY 3L3HB 1X7QA 4PRIA 2PYFA 4YHOL 1D5BA 2CH8A 4H20L 4LLDA 4PRID 1VFBA 5GHWH 3MJ7A 1SY6L 2AKRB 1P4IH 1UM5L 5BXFB 3GSXA 1P4LA 2RB8A 4KJQD 3A67L 3WLBA 1WWWX 5IMMA 5ISZE 4G9FE 4U6VH 5KOMC 2EC8A 4PP1D 5GRVL 3PDGA 4ZSOE 3ULVE 4WDIB 4KAQL 2Q20A 5E95B 1NH6A 3R8QA 3SGKA 4WI6A 5IMLA 3QQ9C 5D7SL 5TQ0H 1VDGA 4PRBA 1I8IA 3ARPA 3LAFA 4NQVA 4M5YL 5I1IH 3U46B 3IDJA 1EHNA 3EDKA 4M00A 3CFJB 1RHHA 3CVHA 3OZ9H 3AS3A 4TQEH 2PTUA 4G8FA 2VRAA 2YSSA 3RWHA 3TYFA 1HILB 1ACYL 3JWNC 4PJ7F 4M6NH 1A6WH 5BS0E 3UDWA 5JNYA 2A6JA 2WWMC 4K23H 2AS5M 3LV3A 5K9OA 2WBKA 1UC6A 3C5SB 4JDTL 4I3GA 4Y4FC 1KCVL 1LO0H 2FD6H 1TTUA 3BE1L 5IIEB 5IGXH 4LLWB 3I6KA 5ERWA 5JLZA 2NXZD 5ACZB 4GBXD 4EDWH 5DEFB 4EI5D 4EZMA 4K2UL 4CW1B 4W6XB 5HVWA 1BX2B 4HS6A 3X3GL 4QRRE 2NY0D 4WTXA 5FOJA 2YR3A 3EYOB 4KZDH 2B4CH 3BPCA 3QFJB 1ZLUK 5EU5A 1RURL 3WNKA 4AMKH 4JN1L 4OD2A 1M71A 2AJZB 5JOEA 4GAFB 4HWBL 2ESVE 4N0FA 4YC2C 4ALAL 4WUKH 1CFTB 1F13A 4FABL 3WKML 3MUZ1 4FQCL 1T5XB 4P4KC 4RISH 3VMOA 3LEYL 3UP1A 2EKJA 5LWYL 3B5TA 3GUTA 2ED9A 3MV01 4UUJA 4MCYB 1YECL 3W0WB 3G5XA 1NGWB 4M93C 3ZE0F 2V5SA 3BAEL 4M61B 4OZHE 4RIRB 4WWID 4XNYH 4JM2B 3ILPA 5F1IA 4CMHC 4GW5B 3ESUF 3DSNA 4RRPA 2C3VA 2IPTL 5LKNA 2OI9C 3ET9F 5FM5O 1FNHA 4YDLC 2R29H 5CD3A 3OKKA 3OKMA 4OFIA 2OR8A 4QRQB 2GJ6B 4HUVB 4RNRB 3MO1B 3C5ZC 1QNZL 4AM0B 5HI4C 2AJUL 5T1LD 4UINL 1ND0B 4ODWA 3MNZB 4RA0C 4U1JB 4LSQL 2DLFH 1ZT7A 5FYJL 4O02H 4JE4B 4JHAH 4FTVE 4XPAH 1GGYA 4FMKA 3WHXB 2KL6A 1NCCH 3N1GC 3V6OC 4UT9L 15C8L 1JGVH 3GM0A 4LF3A 4F9LC 1G0XA 3RFZC 3B9EA 4LCWB 3MRMA 3SE8L 2EDQA 3H3PH 4ZS7L 4E9LA 1I1AC 3VI4E 5KSUB 3MV11 1JZ2A 4KI5E 3VJ6B 3PWVA 4G8GA 4E0RA 4J3OC 5SWSB 4RWYL 1KPVA 1BHGA 1JK8A 3HCVB 2EDHA 4G8GD 2QHRL 2GQHA 4PD4K 3L3JB 2NW3B 1FO0L 5E6ZA 4RCAA 3DV6A 5DHYB 2DQJH 5LBSH 4U1HA 1FCCA 3PL6A 1JNLL 1TETH 1KIQA 4GSDH 1YDPA 3V5HA 4QHMA 4UT6H 1TNNA 1J11A 1X3DA 4P5TA 4ZUTB 3E6HA 4F33B 3GHEL 1U8PB 1SYVA 3AY4A 5I0ZA 5I19H 3PWLA 4P5TD 3SN6N 4TUKH 1ZXQA 4KTEH 1D6EB 4HWUA 4FOMA 1UWXK 3REWA 2QKIA 2NY4D 3UBXI 3UC0H 4RGMC 5D2LB 4F7TA 5KS9F 4P9HL 2HWZL 3P9LB 5TQ2L 4XVUD 1G6RB 4MD4A 1RIVH 2R2HB 5K33A 3I6GB 5HHNB 4H8WL 1C1EH 3QP3A 5C07B 5F44A 1R6VA 2VAAA 1FYTD 2VZTA 2WWKO 4F7CB 3IVKB 2HRPH 3U6RA 3IDNB 2VDLL 3W11D 1C16A 2OL3H 3OJMB 4JFQB 2X4QB 1ED3A 5DJAB 3CFCL 1A6TA 3FHQA 1FVDB 3MLXL 4AIZB 4ZFOB 2WBJA 1D5ZA 1HN1A 1Q38A 2LVCA 4HCRL 5CHNA 1NMCC 4N8CH 5F7EH 4S10A 2WBJD 1N5AA 1Q9WA 4PV8A 3QXDA 1LGVA 5IKCA 1RZJC 1MFNA 4DKAA 4QNPE 5KSVA 3IGAA 4QRUA 2CUHA 2VIRA 4PJGE 2EC9U 4JKWA 1INEL 5DEZA 2JJSA 2X4SB 4JJ5A 3QCVL 3RI5F 3FQUB 3AM8C 3NIDE 3REVB 4LPCA 3LVEA 1P7HL 25C8H 5D70H 3BHBA 4HIJA 4PJAF 2DIJA 3T8XA 3QIWB 3D69A 5ANMB 5DZLA 2CDFA 5DMJB 2ZOKB 1KSRA 5FUZH 2Q6WA 1KEGL 1I85C 5CGYC 1JPTL 1XR9A 3MBXL 4PJ5A 3RVVD 1FVCB 1BAFL 3SE9H 1TVHA 1F3DH 1U3HD 1CXLA 5HHOE 2ADFL 3G5ZA 2LFGA 4JFDE 1PG7L 4MNHA 3FONA 5L7XH 4NN5B 1DVFA 1LK2B 4LCCA 3FQNB 4V2CB 1XF1A 4PLOB 3Q2CA 1FZMA 2A9NH 4J1UB 2WIIB 5FAAA 1I7ZB 4M4PA 1K6QH 5JORB 2A6DB 2DQCH 3SDDA 3HC0B 1RIHL 3KYMB 3PF2A 4U6HA 4XVTL 2UZYB 5DD1L 4LP4A 3AAZA 1PGRB 2YD3A 1B4RA 5FOBB 3RZWA 4HFUH 1HHGA 3EYVA 3VXSA 4U7MA 1JBJA 5T3ZL 5FYJU 5GRYA 5DSCB 1UACH 3MUHL 4JRYB 1WIPA 1MREL 1E28A 2RHEA 3WUWB 3SDCA 1RI8A 1ZANH 5LXGL 4NWTL 1TPXB 5JQ6H 4LQFH 1BPVA 1HI6B 1QFWL 1X5IA 2UUDH 5TH2B 1QA9A 3C08H 4C57C 5GRUL 3GSUA 1W0YT 1TQCB 1RZ8B 3TPUB 3LN5A 3QDJB 4FQLH 2BSSA 4LASH 3H9YA 3CFEB 1RU9H 5DRWA 1BM3H 4WNQB 4Y2DC 4KJPD 3RY5A 4HKBA 4YHMH 3QEGL 4I0PA 5FO7B 3MXVH 3QXAA 4IRJC 5IEKB 4JY6A 3L3IA 3LKQA 4E42B 4NBZB 4IEFB 3F8UB 4I0PD 5DHXB 4OB5H 2I9TB 2YK1L 1MWAB 3HZVA 3KPSA 3MRJB 4H0HB 5HHQB 1CL7I 1S5HB 2R4SL 3KPSD 1U93B 4J4PA 4TSCH 1YEEH 1A6UL 3F7YB 1H3GA 2V7HB 2ED7A 4D9LL 4DN3H 3QFDB 1IGJA 4J4PD 2UWEB 4PJDB 2P8PA 1P7QB 2XA3A 5J7CC 3UTSA 4JZJA 3QRGH 3UTSD 5BOZG 1MIMH 2XRAH 4HBCL 1G1YA 1WTGT 1EXUA 1YY9C 5IQ9A 5IQ7L 2D7PA 2M26A 1S8DB 1QSFE 1JYWA 3O2WL 3X12B 1TZIB 4QTIH 4D3CL 5CEXA 3ULVH 3IU4H 3DURA 1M6OA 2H9GA 4HHAB 5CLTA 1NDMA 4YIQB 5KJRH 3F12A 5E94B 3BSZL 1OARH 4JLRB 3X14B 5GRJH 4XPBL 3U0PA 5EZOL 3ZSTA 5F8RC 1EVTC 3LEXA 4K7PL 3WJJC 1IL1B 5DC0A 5DK2B 2BVUA 4R2GC 1FYTE 1YNLH 1RVFL 4G6AC 4U1MA 5AZ2L 1KCRL 3NZHH 3ZHKA 4GKNB 1FNFA 1IGCL 4LVHC 5D1ZC 4PTTB 3TBYB 1U8MA 4PY7B 1TTGA 2YRPA 3QB7C 2WIMA 1BX2A 5DRZB 2XN9B 4OV6F 5IBTL 1RUAH 3O4LA 4LRNL 1S7UA 3QNYA 2VLRE 1AGCA 1LP9E 3ZTNL 1QR4A 4LKXB 3O4LD 4TSBH 3ARYA 3VGDA 2X4RA 5E6IA 5EU3B 2QTEA 3STLB 1HQ4B 2DIAA 4AL8L 3HB3C 4IRZL 2AJZA 4XZUA 5ACMA 1FGNH 3RUGB 1QO3B 3MNVB 3EZJB 4YPGA 1MCQA 3RBSA 1CS6A 1RULH 3MUGB 4KKLD 1P7KA 1XR8B 3IDXL 1T5WB 1FJ1B 3W0WD 4P2YA 4TNWK 3FRUB 1MCLA 2QSTA 2IPKB 4JM2D 4D0DB 4OZFA 4LBEA 4LOUD 3TO4C 1HXMA 4BYHA 4X5WA 5JPNB 1AO7A 4HS3B 4TRPH 1F6AB 2BMKB 1RY7B 4Y4FB 3NCCB 2O5YH 3EGSA 3FZUD 3TCLB 2DS4A 2P49B 1T66C 1AO7D 5D7LA 1ND0A 4BKLB 1J5OH 3S98A 4QYOA 1RK1A 3MXWL 2Y36L 3KYOA 3B8SA 1YJDL 5D7LD 5FKAB 3F7RA 2A83A 3NVQA 4WU5B 3V6FB 4RQQB 3PGCB 4HIEB 3EYFA 4RMUA 2DWEB 4M7LL 3DRTA 5C0JA 3HMXL 5I66B 2XQYK 2F54B 1QLRB 4UIKL 1IGTA 5IFHH 4JPWH 1S7WA 1BF2A 1NUFA 2R9HC 2GJZB 1N3NB 3OAZH 3ULUD 1QBML 1LEIA 5DYOB 5KAQG 1H3XA 3RWFB 3DX7B 4LCWD 1MJJA 4F7PA 4YC2B 3LH2L 4PJXF 4XP4L 1NC2A 4P4KB 2JK5B 5SWSD 5GPRA 5K9KA 4WW1A 4XPFH 4Z7WA 5DHYA 5C09A 1OSZB 3V0VA 4ODVL 5FB8B 5TF1H 1DDHA 4YNYA 1I8LA 2YPLB 2B4CL 4M93B 4CMHB 4YXHL 3HI6L 4JRXA 4IHOB 4ODTH 3SDDC 5GS2H 3VFUB 4QXGL 1DBMH 4JRXD 2OI9B 5B8CA 5D6CB 4BK4A 4YDLB 2Q3ZA 5C0EA 2WK2A 1UKSA 2AAVA 3PV7A 4KU1A 5B22A 4WJ5A 3G6JB 1MFDH 3IAGC 1IFHL 1NUNB 4MA1B 5DI8A 3QSKB 1FRGH 4MNQB 1TZHA 3QUXC 2HFEB 1RZGA 1KTDB 4NRXA 4O2EA 4WI3A 3PP4H 1XF4B 1DQMH 1PSKH 3SBWA 2D3VA 4OM0H 3R06A 3MRKA 4PRPA 1T20A 4WTZG 1QSEA 2FX7H 3RZCA 2FZ3B 1FL6A 5C07A 1DE4A 4JANA 4LK4A 1DBKH 5E8EA 2VQ1B 3DVGB 5SX4I 1A6VH 1D7FA 1QSED 1JTTA 2DQEL 4J2XA 2JIXB 5C07D 3ROOB 3IDNA 4NO2A 3KYNA 3QEHB 4Z7OF 3VFGH 5I6XC 5KSAC 1I1AB 1UH4A 2X4QA 4JCLA 1UH2A 1FVDA 4GJTB 5KOVC 4ZFOA 4MMXC 4A6YB 1U58B 1RFDL 4Z7NF 3FN0L 4GAJH 4OZIA 1JMXA 1G1CA 1U91A 4O02L 3BD4A 4JB9H 4ZYKA 4PB9L 5IB2B 1NPUA 3GSVB 5HGDA 4C83B 4WO4A 4X7EC 2FX8L 2E8ZA 2W59A 2G9HA 2AK1L 2BNRA 4JFZL 4FQQB 1U8OA 3K2UL 4WO4D 2A77H 1CT8B 3S3JA 1JYVA 3ZO0A 1JGVL 4GFTB 3I85A 2BNRD 4GMTH 2BSRB 1RJLB 2X4SA 5I74C 1NSNH 3TIEA 5I17A 2OM5A 3NOIA 1BIIA 3CDGA 5D7JC 1XH3B 4AQ1B 3IKCA 5JW5A 1XF2B 3U7AA 5F96H 1DQJB 4QOKA 5AAMA 1R24B 3KHOA 1QACA 4ODHH 1NGZA 1YEJH 1JWSB 4EIGB 2MQ3A 4HLZG 3VI3E 2GY5A 5E2VH 3UYRL 3QIWD 3C60A 3QEUB 2A0LC 5KSBF 1HH9B 2DQJL 1G7QA 4M5ZL 5MHSD 3C60D 1MCDA 4MQXC 2DD8H 1WV7T 1UCBH 3DXAB 3QFJE 4GSDL 3QPXL 1FZOA 2QJDA 2X4UB 4PIRF 1S7SB 1A6AB 2EDFA 3J8F7 5TPWH 1B4JL 4NO0B 3DVFA 2X4PB 3JBG7 2Y06L 3V0AC 1UGNA 2D7MA 3B9VA 2F5BL 4HUMB 3VRIA 4TVPD 5IR1A 1AGBB 4FP8L 2A6DA 5E0QA 3TT3L 2P43B 5L6YL 3WIHA 3KYMA 1BECA 1VFAA 4YZFE 1DLFH 1NMCB 2FB4L 3UC0L 1V3KA 4PJFA 1FDLL 4HKJB 5GGSY 3TBSB 3U0TA 3W0WE 2UV3A 3OMZA 4YHNA 2YUWA 3VMNA 2YXMA 4Q9QH 4HXBL 1C1EL 2YMXH 4WY7H 2E7LC 5I18L 2X4NA 3I3EA 4MD5B 4JRYD 1ADQA 2F5AH 4AEFA 2GJ6E 1JMZA 2OL3L 5E6IC 4CVZB 2R1YB 3H0TB 4N9OB 3DNKA 1ES0B 1R5VA 1KB9J 4NO3B 3TVMC 1A7QH 4LSVL 5T33L 5IF0A 1WZLA 5F7EL 5CP7B 5ESVA 3T3MF 3ECBB 1MFAL 2JELL 3T1FB 2BZDA 3HAEB 3FOLB 2PTTB 3IF1A 4PJ9C 1DQDH 5SWZE 1UXSB 1CTNA 3WXVH 1TCMA 3ULUE 3VFMA 4LCWE 4P9ML 1A7BA 1X5LA 4PBVC 1HYRC 4Y4HA 4WHTB 1B2WL 2H8PA 1KJVB 5SWSE 1KLUA 2AJXL 4J23A 4DGVL 12E8L 4Y4HD 3W9DB 3GMNB 2Q76B 3KPPA 3D9AH 4H88H 2OXGA 1NMBL 5ETUB 1F3JB 3MA9L 1P4BH 4Y5YC 5DQDL 1YEHL 3RI5K 4MDIB 3N06B 4QHKJ 1I8KA 1XGRB 3Q1SL 4JFXB 3PABB 3WSQH 4GAGH 1E4XL 2A9NL 2C9AA 2X1OA 3PWPB 5GGUA 5J6HB 1A21A 2NY5L 1GXEA 4R4FL 5HJ3B 2IC2A 4XRCA 1EMTH 3SEPA 4NKDB 5LGHH 3QULA 4RGNC 5F7UA 4KK9C 4GUPA 5E94A 1U95B 3IDIB 5D2LE 4OAWB 5IBUB 4ZOAA 4NKOA 4HFUL 1FHGA 5GRVK 4U1IA 1NEZB 4P46C 2YD4A 4R4BB 5E8OB 2APVA 4Y2DB 4Y1AB 3QIUA 4O2FB 1ZT4B 3MODH 4MS8D 2XWJB 1UADC 4IRJB 4KJWC 3TN0A 4K3GA 5CINH 5EOCJ 1XCTB 3PJSB 3QIUD 3I50L 3ZHLA 4Q58C 4HC1A 4LQFL 5BVJA 1X5ZA 2AJVL 3RJQB 3PHSA 1HDMB 1JWMB 3JWDH 3VXNB 1Q9KA 1A6PA 3EHBC 4BFIB 4L8BA 1L9NA 2XN9D 1BBDL 3VXTB 1VADB 1W0VB 1IGIH 2ERJC 3IDUA 5D6DA 2WINA 5B3NA 1LEGA 1BM3L 4N9GA 5KAQF 2ZCHL 1JNJA 1DN2A 2R23A 3NA9L 5C70A 2JB5L 2NY6C 4Z78A 1DBJL 2DM4A 3QWOB 4OB5L 4UT7H 4JDVB 4LDOB 3DETD 4NGHH 1ULVA 2GCYA 1KGCD 5L8JB 2FDBP 1YMMB 1GZPA 3JZ7A 1PYWB 1EV2E 5ANME 2RCSL 1TVBB 5MHSE 3WNLA 4NQTA 1IGMH 4ETQB 4TUJA 1YZZA 2DYPA 3CX5J 5GJSL 1M7DB 2X1PA 3QJFA 4JVWA 1K8DB 2DYPD 3Q5OA 3U7YH 4R2GB 1RIUH 5MENB 1N7ML 4OLZH 3W9EB 4BKLA 2EE6A 1BEYL 2D03L 2R0WL 4BFGA 4LVHB 1FC2D 4TVPE 1T03H 5D1ZB 5CILH 1F2QA 3FT4B 4WU5A 4K3HA 4JCMA 3IU4L 1KN4H 2ICWI 2NY3C 2XZZA 4NZUH 4FQIL 5GS0L 2R69H 3DBXB 4XVJH 1B6UA 4JY5L 4Z7VF 5EU6B 1EGJL 1MCOH 3MRIA 1PKQA 1KLFA 3VWKC 5BV7C 1OP5K 4DEPC 4FFWC 5C0AB 4JRYE 3WKNA 5H35B 4DVRH 4JFYA 5C71A 1EO7A 3AU1A 1M7XA 1E4KA 3IB4A 4OV5B 1CFNA 4XGZB 3S88L 2CLVB 1MCKA 2YPLA 3DRQA 1IT9L 2IPUG 2I60H 5JZ7D 3JVGA 1KJ3H 2BERA 5CEZE 2YPLD 2YN3A 3STZA 3WDHA 1S9YB 5K9QI 1DUZB 1UB5B 3GMRB 1WCBB 3IS1X 3MRPA 3QDJE 3TO4B 4KKNA 2ADJA 5KZCD 4KUZL 4ODSH 4RX4A 1A8JH 5D6CA 4X6BA 1MF2H 5IFAL 2HLFC 1ZOXA 4RX4D 3RKDD 4QWWD 2W91A 4OI8A 1EEQA 1SM3L 4PPTA 3I6LE 2B0SL 2YUXA 1U8HB 1ZSDA 1JV5B 4LPWA 1NANH 4M7JL 4OF5A 1IEBA 4RAHA 1G7LB 5DJZA 4AT6B 1WC7A 1XF4A 5B3JF 2V2XA 1OSPH 1J1OL 2J8HA 5GSRA 3RX5A 5D7KE 3CK0H 4JO4H 2UWEE 4PJDE 1FZKB 1VGKB 1S7XB 2PW1B 2VQ1A 2Z31C 5F7DA 5DVKA 1O7SA 3MRRB 5HGAA 2O5YL 4L3EA 4DZBB 1AKJA 5HHMB 1KJ2L 4MQSB 2XWBB 4XTRD 2JIXD 1DN0A 5AUMA 3KXFA 1J5OL 4WFFE 4JG0L 2E8YA 5TE7H 3A6CL 3K8MA 3KXFD 5EZIH 4JRWA 4U1LB 2CKBL 2UYLA 3KLAB 4OD1H 5D7IA 3VCLA 1Q94A 1AJ7H 4IMLA 1LE9B 5BZWA 1AR2A 3B2UC 5GGSB 4YHKL 1CICA 3DX9A 3NCBB 4KHTH 5E03A 3INUH 1CT8A 2GY7B 2EDYA 4JPWL 3T4AB 4O4YL 2PNDA 1AE6L 4I4WB 3QR2A 1WBXA 4KUCD 4MAYC 1HYSC 2CLRB 3QDMB 5F71A 5E2UL 5E5MA 1QRNB 4X4MA 3O6KH 1JWSA 1W72L 1OVZA 1T1YA 2EE3A 4PTUB 4WFGD 4XC3H 3QUXB 3OKNA 1FLTX 1AR1C 1HH9A 2XN9E 3DTXB 1DBBL 2OR9H 4TULH 4H8WC 4PD4J 2YUZA 4NO5B 2XFXB 5DRXA 3G9AB 2V7NB 3KHQA 3O11B 1NBZA 1MFBH 3DXAD 4ODBD 1MLBA 3RUGE 4NO0D 3TNMB 5I6XB 4CUCA 3IFNL 5KSAB 4PJIB 1FFQA 3SPVA 3JUYA 2G60L 1KGCE 1O0VA 3CC5B 1JNNL 3EIFA 4OF3A 1GOFA 3TO2A 3TN0C 3G6AB 3EKCA 1BQHB 5DHVA 2UZIL 5IK3A 3L95B 4HWEL 4HIXH 3L3GA 1U8QA 4L9LB 3VFPA 2I9LB 2B2XH 4LHUA 4Y5VC 3IFLL 1INQA 4FQHA 5HHVH 5I74B 4FQJL 4YBQC 5D7JB 4LHUD 1FL5A 3L6FB 2VDQL 1UQSA 3BH9A 4JO3H 1A3QA 3VDCA 1ZVHA 5FGBA 4PJBB 4KQ4H 2KZWA 3IETB 4OCYH 2DLHA 4RSVA 1RAMA 4MVBC 1KNOA 2KPNA 2IBZY 2DQTH 1MRFH 3UEZA 1MCPL 1UXSA 1JWUA 2F54E 1M4KA 5F9JA 1Q0YL 2ZUUA 2H3NB 4LSPL 4BZ1L 1ZGLP 1H15A 3NTCH 5IESH 2CDEA 1OLZA 2P7TA 1HHHB 7FABH 4MAUH 4NUGH 4WHTA 1YUHB 3BZEA 3BXNA 1P1ZB 2H1PH 1D5XB 2X10A 5E2VL 1PG7X 4ERSL 2VERN 3MBEC 3SKNB 1RUML 3T1WA 1G7MA 3DGCR 1XIWC 3EW3B 5KVFL 3ULUH 1JPST 4ZFZA 1ZHBB 1ZLSL 2Z8WC 2HVKB 1F11B 1F5WA 1XGRA 4Q6IC 1SVCP 4XNMB 1KTLB 2OP4L 2BSTB 5DMYA 5I1GH 4G43B 1IILE 4X7TA 4Z9KB 4HK3J 2W9DL 4HKZA 4HPYH 4KMLB 5HJ3A 3G6JE 1QQDA 1DLFL 4V1DA 1L7TH 3NIFE 5IMKB 3L5IA 4JGUA 3GRWA 4MNQE 3HG1A 3O41B 4V1DD 1NDGB 1T1XB 1QTYT 2ENSA 4OQ1A 2GTZB 3HG1D 3LPWA 3MJ9H 3ULVF 4DQOH 3GJFK 1KCUH 3OGOE 4PJ9B 3V6OE 2MFNA 5L2JA 4XMKL 2L7UA 1EJOL 2Y6SC 1MELA 3KDMB 1U2CA 3BMVA 2DM3A 2F5AL 4RRPG 3O3AA 2Y4SA 1TDQA 3HRZB 3OR6B 5I15L 4XCNA 2VL5A 5ICYB 2Z92A 2J7LA 1FPTH 4GMSL 4MA7L 1A7QL 2IAMA 1DSFH 2P8MA 4NWUH 4GRMB 5H37H 1G6RH 1N59B 1YEDB 4O9HL 5IVOA 5JOFA 3BVNA 3GIVA 1WZ1L 5C7XH 1FLRL 5IWLC 3CLFH 2BOCA 2DWDB 3BP4A 3BN9C 4Y5YB 2ARJQ 1KLGA 2CJUL 4FQPA 4L29A 4Y16B 3HR5A 1CG9B 3UBXA 4P3DB 1CE1H 3OKEB 5EFIB 3CSYA 5D5MB 3BO8A 3U79A 1RJCA 3FTGB 1WSST 4F7EA 4FQ2L 1WLHA 2ARJA 4IS6B 3SJVA 1NGXA 1JPSH 1NGYB 3IDYC 4WI9A 1QFWM 2PYEA 4AYFA 4XBGA 3STBA 4OF7A 2AW2A 4RGNB 3RWJB 1S9VA 2PYED 5C0CA 4IOSD 3LQAC 1Q0XH 4X6DA 5C0CD 1AC6A 2DLIA 4NCC1 4P46B 1CZ8L 3DXAE 4OQTL 3C8HA 1KXQE 4NM4H 5MENA 2B7DT 4S1RH 3WSQL 3DIFB 5DTFB 4ZUUA 5JOPD 1GYAA 1TFHA 4R90L 3G5YA 5IW1B 1CICC 2R0ZL 3LQZA 5MEND 2Y72A 2XKNA 1BFVH 4B50A 1FN4B 1BVZA 1P5UA 5ELIA 1URLA 3MLSH 4XPHH 4K7PX 5SV3A 1ZA6A 1L0QA 4OZHF 1IAIL 2ERJB 4KK5D 3ARDA 4XP5L 4LLUA 4QO1A 1KBGL 4J3TA 2O5ZH 2ED8A 3ARDD 3MLWH 1T89A 4TVPH 4OZ4B 1JP5A 43C9B 2J8UB 5E8NA 3I9GH 5DVNA 3MODL 3Q48A 3Q6GH 4NFCA 5IB3B 1GPOH 1DL7L 3L3OB 2NY6B 1WBZB 1KC5L 4JVUA 5EO1B 3ZT5A 3JWDL 1RSFA 3MRGA 3WD5H 1BJ1H 3ROLB 1I1RA 1WZMA 3EOTH 2AABH 4LLAA 3HZKA 4R0LC 3KLHD 3KPNA 2C1OB 1T3FA 4Y5XC 4WI5A 4M7KH 4GOSA 1OF2B 3BKJH 4N5ED 4OZGA 1QEWB 4M6AA 2SEBB 2JE8A 4Q7DA 3DGGB 3EOYG 4JFEA 3VI4F 5ITBH 5EUKA 1YJDC 4MQ7B 2YEZB 4POYA 1MQ8A 3P11L 4KI5F 3T2OA 1M1SA 5CEZH 1A1MB 4FFVD 1H8OA 4F37F 2FO4A 5C0FA 2OCFD 1Y18A 1NCAL 2R2EA 2HKFL 2A6KA 1X5XA 3V4UL 4X5XA 1OAQL 4J3WA 3VFSB 4NBYB 4QHNB 3GSNL 3UTPD 5JA9A 1ZA3A 3DOSA 3VWKB 3Q5YA 4LLYA 5BV7B 3MCG1 1MEXH 2C7UB 2C1PA 4DEPB 4MCZB 4WW2C 2YWYA 1I9JL 4HJGA 1MWAH 1F6FB 5A2JH 5HHMD 5EIVA 1KPRB 4O51B 4PR5A 3ORJA 3PWPE 3FO9B 4U1KA 3FFDB 4NZRH 2DQUL 5D9SA 4U1LA 3HZMA 2R1WA 5IB4A 3H42H 4ZUWA 3MV8B 3R0NA 1G84A 1BQUA 4NZUL 2DDQH 3EYQC 3NGBC 5ESQA 4QRPA 1A4JA 4K7PY 4NQEB 1G9NL 3T4AA 4X7SL 4QRPD 5AZEH 2XNAB 1MJUL 1TJHL 1KIPA 1T0NB 3HS0B 2VABB 1UVQB 4TYUA 5HI5C 3QDGA 4Y1AE 4PJ7A 4ZTPH 2Q8BH 4PRDA 3SOBH 3B6SB 4GAYB 1OM3H 3WE6A 2HFTA 4D9RD 5C0RH 2A9MH 1OTSD 1I3GL 3LHPH 2QSCH 3EO1A 4OLWL 3RL1B 2G5BB 2I60L 4G6KH 1NL0L 2NY2C 3U1SL 1QD0A 4I2XA 1LDSA 2NX5B 4NQCE 5GRXG 4R7NB 4QNPF 5EG6C 5I0DA 1B88A 1IAKA 1A7NH 3NACH 4PJGF 5F7KC 5IBLD 1RUPL 4NNXA 4FXKB 1FG2A 4LDEB 2OJEA 3NIDF 4P0DA 3TJHD 2DQGL 4CVXA 4MB4A 3TV3L 3RIFF 1TCRB 4HS8H 4YUEH 1SJHB 4M62H 2P47B 2BJML 2NXYC 1RV6X 5ADOH 3MLZH 1SYSB 3IFOB 2ZP0T 1YMME 4BQBA 1OSPL 1NLBH 2DLTA 3D0LB 5I8OL 2VDNH 4JZOB 4YHPA 1KG0A 3GSQA 4L9LA 4RFOH 3VXMA 2F58H 2AJ3A 2HVJA 2W07A 2IMMA 3GKWH 2APXA 3B9AA 4P57A 4HK0B 3VXMD 3ZT7A 5C0BB 2AEPH 1MHEB 3LQMA 4MAYB 4RDQG 5JOPE 4NKIH 3CUPA 1A7PH 2V5RA 5DDHB 4HDIB 2ITCA 5CMAA 3IJYB 5DR5L 2VLJA 3RY4A 2FNBA 3X17A 1CBVH 3D39B 3OF6A 2VLJD 1K4CB 4XB8A 2E7CA 3L5JA 2PO6A 3KS0H 4CKVX 35C8H 2P24B 2QL1A 2X05A 1QFUL 4YDJB 2PO6D 5EU6E 1OAZH 1R3JB 5KTEH 4LGPB 1FFOA 3DX6B 5IB1A 2PXYC 4XWGH 1RD6A 4IIQC 5C0AE 4AQOA 3U0WH 4MX7B 2V6HA 4HT1L 3V9FA 1U8NB 4TUOA 5HBBA 4P2RA 5DQ9A 4LVOB 2HJFB 2H45A 1AGFA 3MRHA 3WEXB 1I9IH 4P2RD 5SWQA 3D25B 4KTDL 3V6BR 1ZHBA 5ID1B 5DD5H 4CL7A 3K0WA 2VUYA 1AGDA 1A6ZB 3BH8B 1MFBL 1HKLL 3QYCA 4YWGH 4ZPTA 3ZE2E 4AIXA 4AEEA 5GZNC 2Z4QB 4EKXA 4Y5VB 2IQ9L 1QPPA 2HLAB 3K4DA 3BIAX 3LS5H 2RFXB 2ZCLL 3C5JB 5IJVB 1ZLUH 5C92A 1XMWA 4KK8C 4R97C 5IV2A 4N8VB 4Z18A 2LAGB 2VE6B 3NPZB 1NDGA 5AAWA 1CLOL 5CBEA 4XHJD 3HLAA 4MLSA 4AZ8A 3UTPE 5DUML 1WAAE 3ARQA 2GTWB 3ARGC 2ZUWA 1FAIL 4PRNA 3D3VA 5EBMB 5KS9A 4XCEB 1MAMH 3GSOB 5L9DH 2FR4B 4OZFG 2FEEL 3H9SB 3GMPA 3D3VD 5HHME 2R0KH 4ODUA 4E5XA 4NCDA 1Q1JL 4MJIA 4N0UA 1IM3A 4LCUA 1FH5H 2B1HH 5EZJA 1ACZA 2EXYC 4XT1C 1GOHA 1VKXB 2ZOLB 2ZUXA 3MBEB 3EO9H 2D0FA 4FG6C 1MRFL 3JXAA 3ARBC 1XIWB 5IVZA 1UJ3A 1N6QH 1QR1B 1HZHH 4O58H 4Y16A 4D9QD 2ZSWB 5SX5H 4HULB 4EBQH 4PG9B 4Q6IB 3IJSB 4LVEA 4Y16D 2QQKL 5TE6H 1SBBA 4HG4J 5BOPA 1H9VA 1BOYA 4L8SA 2NY5C 4A6YH 5E2JA 3RAJH 3FTGA 2VLME 3NABH 4MAUL 4B7LA 1RK0B 4UTAH 5HYSA 3QDME 3RDTC 3RVXC 1QRNE 3MREB 2AXJA 4N0YL 3VXPA 3IDMA 5MERA 1XEDA 4U49A 1J1PL 2UUDK 1DQQB 1XCQA 1LP9F 3OV6A 4OIIL 5FA4A 4DTGH 1OLLA 3QDAA 4PJAA 2FJHB 3T4YB 1F4AA 3B3IB 4P46D 3QCTL 4E41B 3RGHA 1MI5B 2R1XB 3BYYA 4DVBB 2OJZH 3GMQB 4X98A 4U6XB 4YDIL 1A9EA 1JL8A 5F3HA 3FQWB 4NNPL 5DJXA 2COQA 4KDTC 5ADPL 5JW3L 2C5DC 4PJIE 2ZCKH 4ZAKA 1J88A 1HIML 1GZQA 1DUYB 1YN7B 4ZAKD 2FECL 3H2WA 3GJFB 3P4LA 4LGSB 5IROC 3SY0A 1X4XA 1UH3A 3L7FB 4G7VL 3UZVB 1I8MA 2AK4B 3PGFL 2A6IA 5J6GA 1KCUL 5I1JH 2WUCL 5MEOA 3WS3A 4OUUB 3KWWA 1UWXH 1YYLH 3MLTB 1G9MC 1KULA 2YC1B 1WBZA 1A1NA 2EH7H 4DGIL 2ATKB 3GO1L 2IG2H 1KIUA 2NY6D 3DV4B 4JZNA 2CRIA 3B2VH 1F42A 4BH7B 5J06A 1ZEAH 2X70A 3X13B 3IDYB 5F70A 3D48R 4F57H 2FGWH 1JPFA 4PJBE 2OMNA 1RZJH 3EO0A 2HT2D 1VEMA 1BZ9B 4LCYA 5GGQL 2L4OA 4KPHH 1JHLL 4C58B 4IDJH 1ZAGA 5E8PB 1XGYH 3H8NA 5M95B 1NCDH 2EDLA 4MQ7A 1J0HA 2EYSA 4Y4KA 3DWTA 5FHAH 1OT1A 1F3RB 5GS0C 3V6ZB 1A1OB 3JV4A 4WUUA 2W65B 3HAEH 2R4RL 2ZG2A 3EYUL 4L5FH 4Z0XB 4XC1L 4H25B 2DJSA 2AXFA 4JFFA 4QHNA 4ELMB 3O6MH 4WUUD 5CD5C 3BP5B 4CDGC 4U1GC 3OKOA 3LOWA 4XBEH 4XMPL 4JFFD 2QLVB 1JHTB 4HWBA 5C9KA 5I30H 3W5NA 2AV1A 2P5EB 5LGJB 2XZAH 4LIQL 3VWKD 2I07B 5JMOC 1BWMA 5C9JB 3H3BC 2DM7A 3QCUL 3ARUA 3HPLA 1HEZA 1L7IH 1C7TA 5CBAB 1EO8H 1LQSR 1KT2B 3QIBA 5IHBA 3BKYH 1CXIA 1NBQA 3QIBD 3NCYP 2V9RA 2JTDA 4R0LB 5KVGH 1NFDB 3UYPA 2LABA 3FRPG 5I1KL 1MFCH 3MLWL 2L0DA 2VITA 1JF1A 1XGQB 2PR4H 4S1DC 3F6LA 3MROA 1Z6JT 3MLPA 4ZS6C 3O2DH 4IJ3C 1OWWA 3QISA 2H6PA 4NP4H 1GIGL 4PYGA 3FB8B 2FSEB 5ESAA 1NGPL 4LEXL 3GBNH 1M7IA 2Y1VA 1R3KB 5E9DB 5FYJD 2G5BA 3MGOB 4I13B 3UJTL 3V8CA 5AYUH 1PY9A 3O3BB 4FZ8H 3MYJA 3ARZA 3FCTA 3S96B 5DWUH 1X5KA 1CCZA 1AQDA 3S5LB 4XH2A 1PJ9A 4OD3H 5E8DL 2HMID 4MD0A 2AXGB 3BKJL 4D9QE 3KR3H 1NAML 3V79C 1XF5B 5EC2A 2X7LA 2ZUSA 3BUYB 4L8DA 4WW2B 4M8QB 1AHWC 2Z8VC 3S6CA 1NJ9B 3HI1B 4Y8DC 5J9PA 5D5ME 4YHZH 1CLZL 1FO0A 3L3KB 4ZG1A 1OWRM 4HXAH 3VI3F 1V7NL 1HNGA 3OL2A 3VXQA 4Q2ZB 1DJSA 5D71H 4FQXB 1GGIL 4OFVA 4RGNE 3NGBB 4XP9H 3OXRB 5DMKB 5KG9B 4EUPB 5FF6A 1TITA 4ZOEA 5IMOB 5CWSB 3DUHA 5EBWB 3TWCH 1AIFB 1H0DA 2B39A 3MRNB 4Q9RH 2HT4D 4G6MH 4QF1A 1EHLL 3JV6A 5JHDA 3NH7L 4K8RL 3LPFA 2ORBH 5ILTL 4RMTA 5JHDD 3RNKA 2VC2H 4YZFF 3KLDA 5IOPA 5K59E 5F9OH 1CK0L 1YEFH 2V5YA 3QHZL 2ADIA 3WCYA 4IOFC 2APWA 5DQJA 4X9GA 3SDAA 3D39D 4P4RA 2NY2B 4AEIL 1YN6A 2JJTA 4JM2F 3SDAD 5I73C 3VU2A 5JXEC 5MEPB 1C5BH 4XCFH 5ITFA 4HD9A 2J4WL 2FYYB 4JQVA 3LRHA 2V17H 5LJYH 1KFAH 3BWUC 4CVUA 3QUYA 4YO0B 5DZOA 1F4YL 2J8UE 4HCRA 2DBLH 3KJ4B 3VE0B 4RZCA 3O6LH 1JN6A 2Y23A 1JGLH 3QUYD 4ZTOH 1QYGL 5DLML 3JTTB 2NXYB 3A6BL 1FFPA 1RZKC 4R26L 2VKXA 3BDYL 2WUBL 3D25A 2MNUA 4U3XA 3BD3A 3VXUB 1BVLB 2DQFB 2EO9A 3PDOA 4PJXA 4LU5L 3D18A 3F5WB 1FV1B 3RWGB 3FB5B 4DW2H 5CIPB 1NFIA 3ULUF 2ICWA 4OFKA 1KPUB 1PG7W 2PCPA 3T09A 1MHHA 4YBQD 3EYSH 1JZ6A 2Q7YB 4M62L 1T22B 3DSFL 4OT1L 1O5DT 4KRPC 4PRAA 5IEHA 4NBXB 4YQXL 3RRQA 5ADOL 1R3HA 3KNBB 2ICWJ 4APQB 2Z93B 1T1ZB 3TZVC 4AH2B 3GB7A 4LLMB 4NYLA 4QXUH 2V2WB 5FUOH 3F62A 3DYOA 4GKOA 4MVBD 1YYML 2VDNL 2DI7A 1CR9L 4RFOL 2P5WB 2XKUA 1J0ZA 1WFNA 2XPGA 1RUKL 2ZUVA 1G7IB 3NZ8A 4K94L 4ZFFB 2DLEA 2FATH 1IQDA 2CUMA 4BSWA 1YY8B 3FQXB 3O2VH 5HGBA 4LFHD 2CXKA 5I8EA 3LB6D 4EIZC 1AFVL 3UPAA 2XQBL 2PXYB 1U8LB 3TA3A 3U2SA 1X5GA 4BSVB 4G5ZH 1CU4L 1J8HB 2ZSVA 2ZNXA 5JXAH 2BVPB 2H26B 5DC4B 2VR5A 1D9KA 3HNTL 4D8PB 4TOYH 2OLDA 4M43H 4CBPA 1PDKA 2O5XH 4NC0B 5D2LF 4Z0BH 1D9KD 4R9HA 1MHPL 3MV8E 3UTTA 2A1WL 3OJDA 1K2DA 1IC5H 2ZSWA 4GW1B 4NQEE 5C0IB 3UTTD 4DGYL 3NFSL 5D1QB 2EXWD 4PGCB 3HFML 3VXOA 5LAXB 4XWGL 3LRSA 2IQAA 5KVDH 5MEQA 5I2IB 3IU3A 1J8KA 4K3JH 2DBJA 4O5LL 2W60B 3UMTA 3PDDA 4NM8H 1I3RB 4I77L 3N85L 2R8SL 5DFVC 5EIIB 2XACC 5E2WH 3DROB 2GAZB 2DTML 1Q72H 1WCQA 2NX5E 5HPMA 1AXSB 4PS4L 4P59H 2E6QA 3ARGB 4FNLL 2GITA 1NBVL 4E41D 1WFOA 3O3DA 5KSBA 4LARH 1MI5D 3J7HA 5T1MA 3CH1B 2Y5TB 1XGTA 4HUUB 2NY1C 4RAUB 1DUYA 3QG6B 4NHUB 5TDOA 3BRGC 3QEQA 5C2BH 4ISVA 4ZQKA 1HOCA 2MQ0A 1MIML 5LG1A 3GJFA 1T21B 1OL0A 2EYRB 2J8OA 2R56H 4JY4B 3ARBB 1UA6H 1MRCL 3W2DL 3WFHB 3TNNA 2QQNH 4HGMA 1I75A 2RIKA 1DFBL 4Z7UB 5C0BE 2XY2A 4AENA 1TMCB 1EHXA 3VFOA 4NKMB 1AP2B 1ORQB 3G5VB 4BH7A 2VUOA 4YBLB 4JHWH 2J2ZA 2FIKB 3RDTB 3F65A 3KPTA 8FABA 4YGAB 3H9HB 5J3HD 1A14L 3P73B 1NANI 3EO9L 3D39E 4X4XA 1YNKL 4X4YA 5A3ID 1YEKH 3E3QC 1JZ7A 3MC0A 1UG9A 1HZHL 4CN1A 4M1DH 4U4BA 3BGMA 1TIUA 5IHUH 3MLVH 4DKEH 1M05A 3TLRA 4BUGA 2XWTA 4X9BA 4PY8I 4CVWA 1T0MA 3P9WB 5J11C 3AS1A 4YXLL 1AD0B 3QO0A 3K1DA 1UENA 5I76B 1JZ4A 4KJYA 4ONFH 4I3RL 3IXTA 3QZWB 4KHXL 3NN8A 4J3SA 5GRZA 1IKFH 4XPTH 1U8JB 3SCMB 5EBLA 5I9QC 5HHXL 4YR6A 4EDXB 4ZXBA 5IVXB 4BUHA 1S9XB 5GRWA 1OW0C 4ZXBD 4JAMA 1T4KA 3VFWB 3KPLA 1ZHNB 2PF6A 3L7EB 4ZNEA 4PJHB 3QUML 3VWJC 4KKCC 4X6CB 4C56B 1S78D 4KMTL 4UV7L 4GRWB 4NKQB 4LSUL 4UQ3A 4NJAL 3VXRA 3P77A 2H32H 1YEGL 5H94B 2UWEF 4PJDF 1ZHKA 4I9WE 1JFQL 1R3IL 5EPMB 5F3BB 5C0DA 3TJEH 3E8UH 5I1HH 3LKRB 1FNSH 2XA8L 5MP6H 2ZKHH 1OGTA 5ICXA 2FSEA 4MJ5A 1IGYB 5EA0H 5B39A 1WBYB 1NMAL 1EAPA 1X5AA 4LHUG 3H9SE 3KPRB 4FFZH 4HFWB 5DJ6B 5E9DA 1Q9OB 5H2BB 2BCKA 3FMGL 4P2OC 4HBQA 5E9DD 5EZLB 3MJ8B 1RZIB 4TTDD 1JGUH 3U4BL 4KPHL 3T2NL 2C3HA 4QY8B 4S1QH 1F4XL 3PXJA 2AXGA 4IDJL 4U1GB 1FBIL 4NRYA 5C0GB 5T3ZE 5J0BA 5CEYB 3ZKMC 3BIBX 5CUSL 4ELKB 4Z77B 3HAEG 4NZDA 1DEEA 2VH5H 3E1F1 4W4NA 2IH3A 1NCBL 1NJ9A 4LNVA 5FECB 1T1WA 5DVLA 4MJ6B 4MNGB 4P5KA 2YPVH 5INCA 4XX1G 5DUPL 1F02I 1P9MC 1G7HA 4UIMA 3I84A 1XFPA 4FQXA 5KVMC 4AY0A 1G9NC 4X83A 1R3LA 3RTQB 1KYOJ 3TA3C 5DMKA 1CI5A 4FQXD 3CLEL 3R0MA 3S34H 4NQSA 2DKUA 1BQSA 2KUTA 3MRBA 1CXKA 3MRNA 1CGSL 2VISA 2DL9A 4JFOA 1RZ7H 2A74A 4K07A 4F58L 4E41E 3RUGF 3HC4H 3P2TA 4WFHD 1MI5E 4BQ8A 1HSBB 2GSIA 3BJ91 3OQ3B 4S0TD 1EO8L 3DVNB 2BNQB 1E6OL 1WIOA 2GK2A 4JO1L 2HTLD 4X6FB 4JG1L 4ZOCA 4HF5H 4YGVA 5GJTH 1XGPA 2XTJD 3FT2B 1YEIL 2AK4E 1N0LA 3C6SA 1S7RA 1KJ2B 4YHOH 3VFTA 4EVNB 4H20H 3SKOB 2FBJH 2W0PA 2J1KA 1C5CL 3KPOA 3N1MC 1SY6H 3VFNA 1UM5H 3KAAA 5E00B 2VB5A 4Z7VA 3A67H 3MR9B 5D93B 5BJTB 2CKBB 2YS4A 2YD9A 5F8QC 3CCHB 2NXYD 2X4TB 4FZ8L 3MV9A 1Z3GH 5T1KA 4GW4A 32C2A 3V7MA 5FK9A 4L4TB 3MV9D 5D7SH 5T1KD 5TGBB 4YFLF 5I71B 1UFUA 3U7WL 5DS8B 3I02B 4M5YH 3PWUA 1NBYB 2GFBB 3O3EB 1ZVSA 2EH8L 4XXCC 4JEGB 4LEOB 4H5SA 4U33A 4NJ9L 1SVZA 1W72B 2Y7QB 4UI2A 1ACYH 1X44A 4POZC 3MRDB 3UBXG 1OCWL 1MVUA 4APQA 2Z93A 3KPMA 4ZUSA 2VSCA 4APQD 4JDTH 4X0KB 3CFKB 5LQBL 4XP9L 3NFNA 1KCVH 5HXMA 1Z2KA 3G08A 2Y9RT 4PGBA 4YEFA 4WU7B 1TJIL 3NFPA 3ARFB 3P4NB 3PUCA 4ELME 5I73B 3BWAB 3M17B 4EI6A 3RVUC 3IJHB 1ZGLM 2XZCH 3MLUH 4K2UH 2P5EE 1QKZH 1WT5C 4OCRL 5A2LH 1GGUA 1U8LA 1U8IA 3MACL 4MXQD 4RFNC 3X3GH 3D85A 4BSVA 1FORL 1JYNA 1BVKB 3N50A 1J8HA 5IHZA 5F97E 3N1FC 2BVPA 2Z9TA 2XOTA 3K8LA 5D1XC 3G6JF 2HJKB 1J8HD 3CFBB 1RURH 2ICES 3NIFF 4RBPH 5INDA 4HMCA 4P2QB 2H2PC 1BQLL 3OJ2C 4JN1H 1BFOA 4L8CB 1NUDA 2MWCA 3K8KA 1OD9A 4ODXB 4NPYA 4GKZB 5BV7H 4HWBH 4UDTA 3R4DA 1C5BL 1D3CA 2EYTB 4F3FA 1NFDE 5HYQB 1U2HA 4ALAH 2NTFB 4CRPA 3X3FL 3GZKA 2ATPA 2WZPD 4FABH 4G80A 2OL3A 5D1QD 3WKMH 5EC1A 5BW7A 5LWYH 3LEYH 3PIQA 1UZ6E 1YECH 4YHYC 1I3UA 4CNIB 3PGDB 2YPKA 3KG5A 3B9KC 1G6VK 3BAEH 5FHBL 2EDJA 4KK8D 5I8CB 3T0EC 3EZ8A 3DYMA 5FDYA 2IPTH 5E9DE 2D7NA 1IBGL 5DMGD 5AG9A 3TZVB 1OP5H 1CE6A 3BKCL 1QLEL 2VXQL 2DI8A 4QKXB 1UWEL 1QNZH 2AJUH 2EDEA 2FEDC 2VLLA 4XNQA 4UINH 4WFED 4ACPA 3QI9A 4YHIA 2A38A 4LLVA 3EYSL 3VD5A 2JJVA 3E0GA 2ZPKL 3PV6B 3QI9D 3QUZB 1DLHB 3BUTA 5E4EC 2BVQA 3S4SA 4X9FA 1MUJB 1T21A 4UT9H 5ICZA 15C8H 3K74B 2E7HA 4DKDC 3SE8H 4ZS7H 2GK0A 5DJYA 2PKDA 5FO9A 3WFZA 3G6DH 3WIFA 1F3DJ 4DFHA 2NZIA 4RWYH 1U92A 5EU4A 3DUSA 3LS4L 3FQRA 5BZDB 2X9XA 3RJDA 5IVNA 3MJ6A 4KMQA 1JNLH 3O8XA 5HI3C 4DAGH 3LKOB 3RL2A 3RVXD 3GBMH 4M43L 2D0HA 2O5XL 1CYGA 3V5DB 1VACB 4G8IB 1F4WL 3AGVA 4HSQA 3ZKNC 5HGHA 3SO5A 3GHEH 1MNUH