1UM5H

Catalytic antibody 21h3 with alcohol substrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
VQLQQSGPVLVKPGGSVKMSCKASEYTLTSYLFQWVKQKSGQGLEWIGYIYPYNGGTRYNEKFRGKATLTSDKSSNTAYLELSSLTSEDSAVYYCARSSMSDPGANWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 21H3 L chain
publication title Structural Studies of an Efficient Catalytic Antibody Operating by Ping-Pong and Induced Fit Mechanisms
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H02
1RJLB 1FE8H 1XMWA 3IXAA 4HIJB 1A14L 3JV6A 2X09A 2CK0H 2VN4A 2X2YA 2JB6A 3WIFB 4N5UA 4XBGA 4EN3D 1AKJD 4P48A 1XF4A 1SVZA 4FMKA 3UBXB 4MLSA 4Y19E 3PNWA 4QCIA 1YY8A 2DLGA 4M8QA 3SDCA 3VD9A 4L29A 1HH6B 4BH8B 1PKQA 4U7MA 4Z7NF 4TN9A 4ZXBA 3V7AG 3MTRA 3BZEB 1YNTB 3VRJA 1IAOA 3LS4H 5GS0D 2P5WB 3SKMB 1OAUL 1U2CA 2CDFB 1T2XA 4C56E 1J1XL 3NFNB 2D7MA 2DN7A 4O2CB 4R90L 3W11D 4X4XB 5FCUH 4OGYL 1G7QA 3MRIA 2I24N 3RVVD 1MIEL 4Y5VB 4HUWA 3IGAB 3GHEL 1T1YA 1KEGL 3EHBC 4KVCH 1A8JH 1YEKL 3FAXA 2XA8H 4QXTB 2X89A 2QHRH 3EDFA 4HWBH 2YK1H 3ARBA 3SCMB 3ULSB 5JOFB 3Q1SH 5SWZB 2H41A 2P7TB 5C0JB 2BDNL 1AXIB 1X4YA 5DWUL 4GKNA 4HGKC 4JN2B 2V2TB 4MJ5B 5CD3A 3VFNA 2B4CL 2PTTA 1E6OL 5MEOB 3BKJL 5CJBA 2OYPA 4U6HA 1NUDA 4LSRH 1L0QA 4PYHA 5C0BD 2Z93A 4X8XA 5L8KB 4ZDHB 5FK9B 1F6AA 4BFBD 4NFCA 2P5EE 5I19L 4APQB 4QXGH 4FQIH 3U4BH 1OCWH 1JPFB 1MNUL 1MWAA 1NANH 2WUCH 3WMSA 1OQXA 5DHXB 3VXUD 3ESVF 5D1XD 5J13C 2EIBA 4GOSA 1T2QL 1QKZL 1R3LB 3TVMC 4F7PB 1MCKA 4PJAE 2CRMA 4Z95L 1UJ3B 3KPOB 5C9JA 4NQVA 1N64H 4X98B 4C59B 4B41A 5BRZE 2YA0A 1AGBA 2ICWB 3U0WH 3G04A 1TXKA 4LGRB 3TPKA 3IDXL 3MFGB 3MC0A 2ADGA 5EUOF 5DFVD 1NC2A 3JTSB 1U36A 5KSAA 43C9A 1MFBH 1A7QL 3HG1B 5IJKA 1QO3B 2YD5A 2DDQL 1IZJA 5HYIA 1C08A 3MRBB 4Z7OE 3MCLH 4G9FB 4XPGL 4K7PY 4TNWF 1I7RB 4ZUVA 3L5XH 1RJYB 5GS2D 4X7EC 2VLKB 3MSPA 2HKFL 4K55A 4QWWD 2C26A 3MNZB 5DJ0A 3WXWH 1MCQA 4OZHE 1QBAA 4DK6A 1A9BB 5DGQA 5C0NC 3WIHL 2FR4A 4XP4L 2XWBB 4LAJH 1IGTB 3FKUS 3SDDC 4EOWL 2ZUUA 1X5LA 3OB0K 1E4WH 3IDMB 2VTFA 1FFOB 1MQKL 4K23L 2L4OA 4P3CL 2GSIB 4XVJL 1P4BH 2VLRB 4NWUH 2OTUA 4K94C 1AC0A 3MRRA 1BLNB 1I1CA 3MBXH 1DEEA 2X4PA 1YPZA 5C09B 3MGOB 1S7TB 3MGAA 5I74C 1DDHA 1X5IA 5GZOC 3VD5A 1SJEB 1HOCB 4ZOEA 1NSNL 3WNOA 3QRFM 2J5LB 4G9DA 5B38A 5L0QC 4N8VB 4ONGH 1EBPA 2F19L 2EYRA 2WWMC 3BQUB 4ESKA 1OPGL 2VIRA 2F8XC 4OZFH 3B8YA 1ZLWK 4LLQA 2W65B 1CZ8H 2OX5A 5F9DC 1TJIL 2Q7NA 5I8KH 1T5WA 1IEHA 4WO4D 3QXTA 2X4TA 3TZVA 3LIZL 3BRGC 3DX8B 4QRSA 4RFNC 1YEIH 4FRWA 5BJTB 4PRIB 2NY2B 5IB1B 4HT1L 3FN0H 1B0WA 3IDUA 2V7NA 5I1HL 2F5BH 1HHHA 2D7TH 4U2ZA 4XMLL 4QHKI 2PXYD 3L1OL 5EOCH 2VYRE 5HYSB 3UZVB 4UQ2B 2VZSA 4OM1L 3QO1A 5T1LD 1CDBA 4R7DB 4NN5B 4PJ9A 3RVUD 5HHNA 1MCSA 4OI8A 5INDA 3C5SA 2DYPB 3T65B 3HLAA 4KHTH 2YBRB 4YLQT 2XFXA 3KPQA 2HLFC 2DTML 4MAYC 1WZMA 4TULL 4G42A 2AEWA 2WQ8A 4F7CB 4P5KB 1NFDE 2UZIH 1CL7H 1BIHA 4NKMB 4NN7C 2VDNL 3W9DA 1AO7D 1LK2B 3VCLA 3QCTH 3GSRB 1CTNA 1D9KC 5MP6H 3I6KB 1BZ7A 3QG6B 1P9MC 3FFDB 1MOEA 5F9WB 1DQQB 3V5HB 1UADC 1I1YA 5TGBB 5DD3L 3D48R 2IG2H 4D9QD 1U3HD 5B39B 4J12A 3WDHA 1TTUA 2YXMA 1JYNA 3QQ3B 1VENA 4P2OC 2EIZB 1TVHA 2DQEL 1K3IA 3T8XB 4YXHH 3ETBF 1AHWC 1PSKH 4ODTH 4GFTB 5DMKA 3W0WE 4AY0A 3MRPA 5JZ7D 3DRQB 4CVZA 3GI9H 4IRJA 1PY4A 1W0WB 4XCFH 1T1ZB 2RAMA 4GRMA 1M7IA 1QSEA 1BJMA 3LB6D 4UBDC 5IBTH 5HVWA 3THML 4DN3L 3IS1X 1ZHNA 5F7EL 5EU6E 4DGYH 2YD9A 5E8PA 3ROLA 2ADJA 4L4TB 4UQ3A 1EA9C 4Z7WA 5IHZA 4FQ2L 2NY6C 3MLVL 3OAYK 1T22A 3KLHD 3CVHH 2G60H 4PV8A 1D3CA 2Z31A 1IARB 3QIBB 5TDPB 2EEAA 2CGRH 1NL0L 1FE8L 4P2RE 1P84K 4UUJB 5B3NA 4CDHA 3BPCA 2CK0L 1KLUA 4LCWE 4IMKA 2MHAA 2X10A 4MJ2A 1ORSA 3MUHL 4G9FD 1Z9LA 1JHTB 4MXVF 1QSFB 3VG9C 4N0CC 4JFDE 5IV2A 4H25B 3RGVA 4BELD 4NKOA 3O0RH 4R7NB 3DBXA 3GIVA 5HDQH 4IRZH 5KZCB 3QUXD 3OKKA 4JO4H 4M7ZC 4PJDB 2N1KA 1T04B 3GZKA 3CLFH 3LS4L 3MRJB 4K9EC 1KNOB 5CP7B 1VGKA 3S88H 2Z9TA 2HP4A 4M00A 4M6MH 4XH2A 1NCCH 4IDJH 5FCUL 1PZ5A 3DV4B 4NZDA 1MHHB 1BP3B 4WTWA 4QNPE 1R5IA 1WWAX 4HX1A 1QFUH 2X1XR 3GJEB 3HS0B 2XA8L 5DLML 1G7PA 1FH5H 4L3EA 1HH9B 2QHRL 4HWBL 2YK1L 3C6SB 5FAAA 3FQXA 1RD6A 3Q1SL 5FYLD 5GZND 2FZ3A 4JFQA 4PRBA 1HQRA 1FL6B 1FZJB 1Q9LB 2SEBA 3WL9B 3RBSA 1D5MA 1XR8B 5F89B 2CLRB 4LSRL 2EICA 3RDTB 4EI6B 3MYJB 4GMTH 1CIUA 3QR2A 4EUPG 3DXAB 1I8LC 4P9HH 5DMGC 2WQRA 1BOGB 3ZHDA 2QQKH 3MV01 1IE5A 4QXGL 2GJ6E 4FQIL 3T3ME 3RWGA 2RCSH 3P0YL 3VWJC 1NDGA 4K8RC 1OCWL 3MXWH 3TBVB 4YFDB 2WUCL 4P46A 2IPKB 1SEBA 1VPOH 2GJJA 5AUMB 3PE9A 1GVIA 2B1AH 3BO8A 5T5NF 5A3ID 3QQ9D 3MJ9H 3HZYA 1OAXH 5HGGS 4XZUA 4FTVD 2NXYD 3O3DB 4EXPX 5JW5B 4JANA 1N64L 3EYQC 3L3JA 2CR6A 5DJDA 1Y6KR 4OKVA 4XXDA 1UZ6E 3U0WL 4M1GH 2H32H 2BXYA 4S1RH 4DK3A 2IADB 3MV9A 2LVEA 2NYYD 1XGRA 2LFGA 2WIIB 3LMJH 2OCFD 4O9HH 2CIIA 3UTSE 4K7PH 4JZJB 1MFBL 3O11A 2UV3A 2UYLB 3W11C 3FB8B 4ONHB 4NQXB 1N0LA 4M6OH 1CR9L 3OJMB 3OHXA 3MCLL 1FL3A 1OD9A 5IF0A 3UZQA 2I07B 4XC3H 2IPTH 5IBUB 5TJWK 4LSSH 4XAKD 3WKNA 3WXWL 4V2BA 2DWDB 1QD0A 2AJXL 1IAKA 4L1DA 1UWEH 1FVDA 2A6KB 4X4ZA 5BS0B 5ISZB 2R2CA 4QRRA 3ZYJA 2FBOJ 2Z92A 3NCYP 1QSZA 5LQBH 4Y1AA 5EUOB 3RFZC 2Q8BH 1ADQA 5I1GH 1HSBA 2H3NB 3ZE2E 3KLDA 1P4BL 3T04D 3IF1B 1YEFH 3MBXL 4JN1H 4HK3N 4WRLA 3VXTB 3SJVE 4FS0A 4WV1A 5D1XC 4LLDB 2ZKHH 1D5ZA 5EB9A 5D7IF 5DRXA 3IXTB 3L3IA 4G43A 1N59A 3DECA 1LO5A 3FB5B 4ONGL 4OFYD 3ULVD 1XIWA 3AXLA 4HIXH 5JPMA 1CU4H 1CZ8L 2VUYA 2ZZUT 5TF1H 2H9GA 1B0RA 3RUGA 3WDJA 3QIWA 5I8KL 4C57C 1RZ8B 1WEJH 2P44B 2IALB 2JCCB 1YEIL 1U8KA 3D85D 4PJEA 3QDMA 2HG5A 2Y1VA 2A83B 3QDGE 4DGVH 3D39D 3E6FA 2F5BL 2D7TL 1T89A 2YUXA 3ILPA 3MRKB 1X5XA 5EBGA 4XWOD 1DBBL 1KTKE 1KCLA 1KT2B 2VLJA 5IG7B 4KQ3H 5D5MF 4QWWC 3RTQB 5F70A 4KKBC 1H5BA 1CFSA 1CN4A 4RFEA 3FOLB 5J1TC 2HJFB 1MCNA 1U8OB 1OP9A 2YD6A 2IFFH 3RWFB 1R3JB 5IR1B 4KPHH 3V0WL 4LF3B 4WUUB 2M26A 2P45B 4KHTL 4Z8FH 3MRLA 2Z4QA 3B3IA 3DSNA 4OI7A 3L5IA 1ACYH 3PWPB 4N9GA 5GGUB 4JJ5B 4P23C 1GH7A 2JJVA 2UZIL 1CL7L 2I26N 5T3XH 4Q6IC 4NT6B 2C4FT 1GAFL 5F3HA 4YHKH 2VR9A 5EO9B 4YDKH 1S9XA 4JG0L 3S36X 3O2DA 3QCTL 1UQSB 5MP6L 4F37K 3V6OE 4EQ2A 1FYTE 2GT9A 2JJSC 3MGTA 3FT4A 2NX5B 2R69H 4HXAH 4D9LH 3VFRA 2IG2L 4P49A 2V2XA 1EFQA 5D1ZC 1N6QH 3ZTJH 3DX6A 1XCTB 3BFOA 4OF5A 4PLKD 4KAQH 3ZKMC 4ODTL 3HC4H 3QPXH 1K8DA 1Y0LB 3GI9L 4UU9A 5JOPD 4WO4C 1IC5H 4XCFL 4U05A 2K1MA 2PF6A 5IBTL 3NGBC 3JWNC 5FF6B 3L3HA 2VZVA 1H8NA 4DGYL 4XPAH 5AAMA 3BGMB 1S7WB 2BOCA 4HUXA 2PXYC 2BP3A 4HAFA 1X6NA 5E1AB 3VGGA 1J05A 4F7TA 4I0PD 3CVHL 3HRZA 2G60L 3CSBA 4JFXA 4C4KO 2GSGA 2EXWD 5KJRH 5ID0B 3PL6D 5C0DB 1IAIH 3DMMB 4HV8B 3IJSA 3Q48A 2CGRL 4JY4A 2F9BT 5ICXA 5TQ0H 1HHJA 3VI3F 3N1GC 4I5BB 3L3KA 4F7MB 3WXVH 2P5EA 2D7PA 4ZUWB 3ME0A 4Y5VC 2X4NB 3LQMA 4RRPG 1O0VA 3QUKA 4NSKA 1YNLH 2FHCA 4TUJB 2NZ9D 5FHAH 2F53D 4WNQA 4PJAA 3O0RL 2EE6A 5IB4A 1AGDA 3N06B 2FSEB 5EU7C 3F58H 4DZBA 5HDQL 4NO5A 1AGEA 4H1LH 4IRZL 2GITA 4JO4L 4U1GB 5KVGH 3FO9A 1WUNT 5C86A 5BRZA 3CLFL 1WISA 4XCEB 2A6JB 4YHYC 2AJUH 3MLRH 4M7LH 4LPCA 1B4JH 3S88L 3CPLB 1OL0A 3U48A 1J0IA 4L8CB 4M6ML 4ISVA 2YSSA 1KGCE 3D0LA 1CFVH 4IDJL 5E8OB 1H3WM 4APQC 2C3VB 4DAGH 3C2AH 3SDXA 5IB2A 2NMSA 1NLDH 5HGBB 4LPXA 1NMCB 4DOHB 2CKNA 4RISH 1FH5L 1Z0NA 4WU5A 3BH8A 1CD9B 4JGMA 2HT3C 5EIIB 1XR9B 3T0EB 5FUCC 4CMHC 2HRLA 1CLCA 5AG8A 2HT2D 4RMWA 1N5YH 4X6CB 1PEZA 1UJ3C 3QXDA 1NGYB 1WVZA 3LN5B 4JFPA 4OZHA 3ARQA 3EJJX 2NW3A 3IKCA 4GMTL 4KK9D 4Y16B 5F1SA 3HZKB 5C2UB 4YR6A 1KJMA 3B9KD 1SMOA 4P9HL 2QQKL 4Q2ZA 1CT8B 1KXTB 3F7VB 4G8GA 1I3RA 4L3CB 2VR4A 2NZIA 1KLFA 2RCSL 4GG8B 4OZGA 3SGJA 4FQXA 5HHVH 3MXWL 2EDTA 4Z7VA 4U1JB 4ZG1A 1SEQH 5DURD 1EEQA 3QG7H 5DA4A 4NO3B 5SV4A 2VISA 3P77A 1VPOL 5DMIL 3BKCL 3GMNB 1OGAD 4XCNB 2B1AL 3AREB 3DX9B 3UPAA 4JFOA 3PWNA 4NKDB 1OAXL 3EYFA 4RBPK 5I76A 3HUJB 4FQQA 2B5IB 5CLTA 1BBDL 4DFIA 1KCUH 3GSNH 4M1GL 4ZFOA 4S1RL 1BBJA 2XPGA 1U3JA 3L9RA 4HK0A 4PGCA 4X4YA 3NIGE 4O9HL 3LMJL 1UKSA 1FFNB 4K7PL 4LCCA 4UB0H 4YX2H 1HWGB 3TO2B 5C70A 1HILA 5C6WH 3I3DA 2FX7H 1KPUA 1TNMA 4WHTA 1YEHH 4XC3L 3S35H 2IPTL 1UB5A 4OKDA 1LEGA 2IH1B 3PDOB 4LSSL 2MFNA 3UTTB 3BP4A 4N0FB 5EU4B 1DSFH 2BK8A 5F3BB 3H3KA 1UWEL 4GBXD 3CC5B 4YBLC 1EAPB 1R5WA 3RRQA 1SBSH 5FDWB 3CK0H 2AV1B 4QOKA 5SV3A 4GKZA 3O9WB 2F54B 3WEXB 3TFKD 1NEZG 2Q8BL 1F4YH 3O4LD 1YEFL 3SDAB 1R0AL 2XZCH 2YD8A 4JN1L 5I8CB 1TETH 2X70B 2EYTB 2XZQH 2JELH 4X0KA 4OUUB 5CJQH 4NJAH 2XN9E 3JSSA 3WN5A 5JHDE 1FVCB 5F6HJ 2XQYG 2DMKA 3DROA 3K0WA 5GSVB 3HR5B 1Q9OA 5T1MA 4HIXL 5HHXH 4O02H 4HMDA 1CU4L 4LDLB 2Y23A 5TF1L 5I1IL 5MHSE 3QPQD 4Y4FD 1F3RB 2P49B 3REVB 5C0IA 1XGUA 4W6XB 4KDVA 1WEJL 4BM7A 2W0KA 2HJKA 2NYYC 4I2XB 5FCSH 2Q76A 2I9TB 5D7LE 3W0WA 3VFPA 4DGVL 2PO6D 3H0TB 5FGSA 5BW7A 3TBYB 1H3PH 1JF1B 3S7GA 5I73B 5L7XH 4NQSA 1HHKA 3MRGB 1CYGA 4KQ3L 2MMXA 2F15A 4UNUA 1WBXA 2VLLA 4LFHG 1J11A 5GRXG 1A6TB 4UIMA 2BJMH 4W70A 2ARWA 5DUBA 5EC1B 4QGTA 1KPRA 5F9WC 1UJTA 3BIBX 4ODUB 3U2SB 5DD5H 4K71B 4ZYKB 1IQWH 1RHHA 2IFFL 1MRFH 4LLUA 5J6GA 3GM0A 2WNGA 5EUKB 1C5DA 4Z8FL 1A6AA 4P2CG 5DD6B 1ROWA 5LJYH 1ACYL 2XY2A 2BNRE 4NCDA 4P2RA 4QHNB 2XWTA 1PZUB 5T3XL 4G7VH 3KXFD 1WLHA 3MV8A 1YC8A 5JO5A 1JGVH 3CFBB 5DTFA 4YDKL 4KK5C 5C0AE 2P1YA 2AW2A 4JFDA 2R0LH 32C2A 2WUBH 4JHWH 4JRYB 5FFLA 4PBXA 5E4IA 2MCPH 1FIGH 5CP3A 5IM7A 5D5MB 1JUFA 2R69L 4HXAL 4PY7B 1KACB 2W0FB 3PJSA 4WWKD 3ULVC 4Z7WF 1N6QL 2CLZA 3P9LB 3BZFB 5EFIB 1K2DA 4QRPB 4KAQL 1OP3H 3QIBC 4KZDH 1UB6A 1IGMH 1ZHKA 3WE6B 3HC4L 3QPXL 4KJPC 4NRYB 3VGDA 4TTDD 3QRGH 3BWAA 4AEHH 1MJJA 2D31A 2P24A 2XY1A 3HZMB 4P5TD 3PWLB 4XPAL 3PWVB 1T83A 3KPNB 2EDXA 4WDIB 3G5ZB 2AJSH 1U8NA 3L5HA 4JE4B 5E6IA 3VXMD 1NDMB 3P73B 1Q72L 2EDKA 2UVEA 3BWUC 3RHWF 4TOYH 2DLHA 2OR7A 3C09B 3K4AA 5FV2A 1ZHBB 4WWID 5KJRL 3KGRA 1IAIL 3V7AE 1LE5A 4AENA 3LSOB 3U4EB 4H0HB 1T7XA 3WXVL 4LLVB 5HYJD 3C8KB 4OZIB 3H9SB 1BJ8A 2GJ6A 3GSXB 3VGFA 5A2KH 4LMQE 3N9GL 5J1AB 3QXAB 1UA6H 3VFWB 3PUCA 3GRWL 5FEBA 1TVBB 4NHUA 3BIKA 3IU3B 2BSRB 3G5VB 3PXJA 4LPYA 1F8TH 1YNLL 5FHAL 1BQLH 3VDCA 2PCPB 2IPUK 3RKPA 1FNEB 1WBZA 5C0BE 5IKCB 3F58L 2CR3A 1ORQA 3FQWA 2Y9RT 4U1MB 4U0RC 1KYOK 3MPCA 1OTTD 2NY5C 5KVGL 2ESVB 4M6AA 3U7WH 4Q9RH 1II4E 2AJUL 3CDGA 4G8EB 5M95B 3MLRL 2UWEF 4Y2DA 1B4JL 2FWOB 4MZ2A 5IW1B 1J0YA 4PJFE 3VXUE 1QRNB 3NOIA 1CFVL 1QA9B 1ZOXA 3UTSA 2AKRA 3QIUB 3QUYD 4EI5D 1ZTXH 1LE9B 4DAGL 3C2AL 3GMOA 1NLDL 2EDRA 4B5EA 4LSUH 4NKQB 3MLXH 4PJ5B 1JZ5A 3VFSB 5CKAA 4LHUB 5CEYA 5DYOA 1W0VA 3G5XB 2LU7A 4HBQA 4JPVH 3ZT7A 1N5YL 5FECA 5HXMA 5EZLB 2MKLC 2ED9A 3I3BA 4XNMA 3C5ZA 5HJ3B 3LZFH 3WNNA 2JB5H 1UZ8A 1LD9A 2LU4A 1CLOH 3BP5B 3TJEH 4ZUUB 5IEHA 4L5FH 2V9RA 3CFCH 5FM5M 1U92A 3NN8B 1M4KA 3PL6C 2LAAA 3QEQB 3ZZ1A 4NNXA 4BZYA 5HHVL 2GQHA 4F3FA 3QG7L 4Y4HA 2VC2H 3NIDF 1H15B 2VL5A 4NM4H 3N1PC 1VACB 4OV6F 4PGBA 1B9ZA 1G1YA 1OT1A 1PYWB 2ATPA 4FMFA 3SJVA 1XCQA 3S37H 3QEHB 3FQRA 2DKSA 3FHQA 4LHQB 3WJJA 2NZ9C 2W92A 4WW2A 3BMVA 3GRWA 5T3ZD 4V1DB 1KCUL 3GSNL 1VDGA 1AGCA 2KZWA 2VDKH 2VXUL 5C71A 5EBMA 2DLFH 1BQHG 2UY7A 2APFA 3BPLB 4UT7H 1GGBH 3CX5K 1FNFA 2IBGA 3BE1L 3FOMA 4YQXH 2W60B 3DV6A 4GQ9H 4UB0L 2BVOB 4LU5H 3ZKQD 5GS0H 5LGJB 4KKAD 3BHBA 2FX7L 1ZT1A 1YEGL 5SWSA 1U93B 4ZSOE 2C1PA 5GIRA 5IEKB 1YEHL 5F7WC 3S35L 1ZA3B 5FO8A 2MTPA 4ODWB 5HGAA 3WHE0 1X9QA 4MD5A 4N8CH 3H8NA 4X9GA 1LNUB 35C8H 5EU3B 4KRNA 4HKBB 1DSFL 1JFQH 3ZHLA 4D2NA 3QFDA 1SBSL 3LRSA 4P5MA 4FP8H 1I75A 5CBAB 4IJ3B 5JDSB 3HC3L 1SVCP 1OB1A 5F72S 1GPOH 3B9KC 3SY0B 3QEUB 4NRXA 3ZKSD 3HCVB 2GK2A 4PGDA 4F9PA 2DM2A 3IJHB 2JK5A 2N56A 2XZQL 4HS3A 5EZIH 5CWSB 2LVCA 3RY6C 1G7JA 1VKXA 2ICCA 5CJQL 4NJAL 4C55A 2NXZD 4IRSD 2QTEA 3FQTB 2E8ZA 3TBTB 1JK8B 3TT3H 2X6MA 5KANG 1BFTA 2EH8H 3V6OA 3TIDA 1BQSA 2R1YA 5HHXL 1FYTA 4O02L 3OR7B 4NPYB 2R39A 3C08H 1EXUA 1AXSB 4KRPB 5E7FA 1YMHA 5DS8B 1DVFB 3U46A 5C08B 4GAYB 3VD4A 3IAQA 1U8JB 1INEH 3WCYA 3TVMA 4PJCE 3GO1H 3P4OB 1AO7E 3O4OB 3C60B 3PWUB 5IQ9B 3GSNA 4U1SB 1H3PL 3JV4B 3CZFA 4NKIH 3FFCA 1GGTA 5L7XL 1J12A 5EOQH 1Q0XH 4XC1H 4NO0A 4YO0B 1NGPL 2XIDA 4OF0A 3D25A 4D9QE 5GGSA 4AZ8A 4QHLA 2BJML 4WI6A 4DCQB 1FYHB 2QADB 3HMXA 1QFOA 1IQWL 5GS2H 1OSPH 1MRFL 4GUPA 2DWEA 4WHYG 4ZXBD 4LNRB 4NWTH 4GBXC 4PRNA 4RIRB 1NFKA 4PJ8B 3DLQR 4R4NC 2Q8AH 5FUCE 2VKWA 2Z91A 2K7QA 4X6EA 3TFKC 4U1NB 5JW3H 4G7VL 5HYFA 4IHOA 1JGVL 1YY9C 5K59F 1RAMA 1A7NH 4HIHB 5CEZD 4JFEA 1IC7H 1A47A 1OTUD 3FQNB 2R0LL 4FG6D 4JHWL 2WUBL 4UDTB 2MCPL 1FIGL 1T0NA 3QYCA 1A3LH 5FO9B 3SDDA 3WNLA 3IDIA 5JPNB 1IL1A 2Z35B 3H3BC 1WSST 5C0GA 1WTLA 2V9TA 1K5NB 5DT1H 3G5YA 5D6DC 4QRUB 3RL1B 2DM3A 1DLHA 3HPLB 4QLRA 4G7YH 4KZDL 4OQ1A 4P4KD 1IGML 2EDNA 3DMMC 4Y4FC 4G9FE 3WLBB 4H5SB 3VRIA 3IFNH 2J88H 3EDEA 2BVQB 3QRGL 4R2GD 1H3XA 1HI6A 4AEHL 3MV7B 1G9MH 3VU2A 2ZCLL 5E4EB 3I50H 2P8LA 4R8WH 3NH7H 5IMLB 2WBKA 1XGPB 3ES6A 5E00B 1H3UA 1RIVL 1KLGA 5FA3B 1KIRA 4MXQD 4G8IB 5H2BA 3S5LA 3EYOA 5F7FA 4GQPH 3VMOA 1DCLA 3PP3K 4TOYL 2CKBL 4MQTB 4U1GC 1FVEA 4PJXE 1G0YR 4FFYH 1UM4H 2WBJD 1J5OL 4JKKA 4H20H 3ZYZA 4I3RH 3L7FB 4HXBH 4FOMA 1KB5H 3MNVB 4UILH 1RZIA 3DUUA 1EH9A 5F6HI 5JORA 1NC2D 5EPMB 5FUZH 5FYLE 4GRWF 1UA6L 4JO3H 5KSAD 5KANI 5HHPB 4JZNB 4RAVA 3A6OA 3SDXF 1F8TL 3LKSB 1RZKC 1BQLL 5F93C 1PDKA 3K3QA 1IVLA 3BH9A 3BPOB 5IW3A 5JA9A 4HG4K 4CADA 2JJWA 1YJDC 3FONA 3WS6C 5HHMB 3S34L 1MFEH 3U7WL 3EJZC 1EGJA 4DZ8A 1OM3H 1FFRA 4NDMB 2ENYA 4GW4B 4MQ7A 1X4ZA 4QEGA 4WTZA 3QFJD 4WWKC 3O45A 2G9HA 1S7QA 1MHEB 4M61A 4ODXB 3GBMH 1D9KA 2OQJB 3PP4H 1L0YA 1P9MA 4P57B 4LSUL 5B38G 3MLXL 3VFTB 2HKHH 4JFFB 1KIQB 4FTVE 4Z7VF 1I8KB 1JV5A 4JDVB 4X6DB 2CIKB 4R3SA 2HFEA 4JPVL 4M6NH 1FORH 5KTEH 4P2OA 1OHQA 5I0DA 3IS0X 1AHWA 1GZQB 3LZFL 1TENA 4K3GA 2MWCA 1XF5A 2JB5L 2BHZA 2B5IC 3AVEA 5JUEH 2HTLD 5C08D 3S36H 1LQSR 5DK2B 5CMAA 1ND0A 3TJEL 4Z7UE 2UWEB 4L5FL 1A4JB 2X1WL 3DWTA 2PTUA 3CFCL 4WEBH 4PJHF 1A1MA 4LBEB 5BVPH 3OR6A 1T3FA 3MLTA 4FXGA 3MLPA 3DIFA 2YD7A 3MO1B 2CKBA 1UXWA 2VC2L 4I48B 4U1HA 4NM4L 3HNVH 4XAKE 1LEKA 3U7YH 4I4WB 2EDOA 4P2YA 1RZ7H 4CW1B 3S37L 2DBLH 2H26A 5IHUH 4LLWA 5D7JA 4KMQA 3FO0L 3LEXB 4KKCC 3Q2CA 15C8H 2FEEI 4WTXA 3EAKA 3PGCB 1L9MA 4PJ9D 1F4HA 2VDKL 1OTTC 2DLFL 3X14A 1INQB 2R0ZH 3GJFA 5E2TH 4UT7L 4CMMA 1FG2B 4QT5A 4R4BA 5IB3A 3H9YA 3O9WC 4YQXL 4GXUM 5SX4H 4GQ9L 1E4KA 4LU5L 3UDWC 1Q1JH 5GS0L 2GEEA 3TYFA 2FDBP 4EI5C 4GG6F 1JF5A 2UY6A 5J89A 1JTTA 1MLBA 3IDGB 3VJ6A 4FABH 4U7KA 1B0GB 3ULVE 5IROC 2YUZA 4N8CL 4LCUA 3STZA 3OKEA 3L3GB 4FA8A 35C8L 4MX7A 4D0DB 5DUMH 1KCRH 1FL5A 3V2AR 4CU8A 4YJZL 1BFOB 1HHIA 4RGND 4YDIH 4FP8L 4Q9QH 5DJ2B 5EZJB 3B9EA 3D39E 3DURA 3MROB 2NCMA 1GPOL 4M5YH 3CFKA 3NTCH 1I1AD 3O8XB 1SJVA 2ADFH 1MHPL 2BNRA 3RI5F 3U30C 3GKZA 1D6VH 2WV3A 2XKSA 4Y2OA 1O7VA 4PJGF 5ESAB 5EZIL 3VFMB 3VGBA 2VQ1B 5I73C 3GB7B 4LIQE 1R5VB 3MOBH 3TT3L 3T0BA 5EOCJ 1S9WA 5DUPL 2EH8L 4XHJC 4TSBH 2AS5M 4EUPH 3MUZ1 1YN6A 2VAAA 3FB7A 3C08L 4A6YB 1Q0YH 1DUZA 1IKFL 3J8F7 3V6BR 3JBG7 4WHCA 4NRZA 5JHLH 3DX7B 1N3NA 3WUWB 2ZG3A 1VERA 2Z31D 1INEL 3GO1L 4M9PA 3LHPH 1OSZB 3LQAH 3P11H 4HDIB 1AKJA 3KWWA 2B7DT 3GSOB 1JVKA 3CSYA 2X1QA 3TBSB 4LRIC 4MA7H 1X6LA 4NKIL 3BN3B 3B5HA 4Z7NE 5ANMB 5EOQL 1Q0XL 2FATL 4XC1L 1UCTA 1AP2A 4JHZA 5CHNA 1U95B 4EKXA 3X13A 2BHYA 3L95B 4KC3B 3RGVD 2OZ4A 1YMMB 5F1NB 3Q0HA 2KKQA 3I02B 2AEPH 2EDWA 5D9SA 3TGXA 5DHVH 3TH3T 4KXZI 4BUGA 4NWTL 5JOPE 3PQYB 4O4YH 2IANB 3ARGB 3D18B 4UTBH 2CD0A 3BZ4A 2EE3A 3OJDA 2Q8AL 3X3GH 1MI5D 1J0KA 4PJ7F 5I8EA 5JW3L 4MS8D 1NAKH 5GSRB 2WINA 5FKAA 1S5HA 4LQFH 5AZEH 3TCLB 1ZT4B 5HI4C 3GGWA 3I6GA 4D0BA 1IC7L 3SBWC 3D87B 3OJ2C 4F58H 5GGTA 4E5XA 1AD9A 4OZ4A 5C0BA 2ZUQB 3DGCR 2VUOA 3JWOH 1C7SA 3MA7A 3DVNB 2V5RA 5DT1L 3FMGH 3C09C 5J0BA 5EOTB 4G7YL 4KTDH 4ODVH 1A7OH 2ILLA 1MVUA 4ZS6D 4PJFA 5ESQA 4F8TA 1DN2A 3VXUA 5D1XA 4DGIH 1KYOJ 3IFNL 1NGWA 2J88L 4NC1E 3AM8C 4OLEA 2HN7B 1JN6B 5DJYA 4JFYA 2F53E 1FBIH 1G9ML 4L4VB 1RJCA 2ICWJ 1LP9F 4AK1A 4AH2A 3O2WH 1IM3A 3I50L 2PR4H 5JW4M 4R8WL 3NH7L 3MREA 1AH1A 4PV9A 1WITA 1BPVA 3EGSA 4KI5F 2OTWA 1A6ZB 2CPCA 5KSBB 3MJ8B 2R29H 3WYRA 1JYXA 1Q38A 4FFYL 5MERA 3GK8H 1UM4L 4KV5F 5L2JB 4H20L 1JNLH 4I3RL 1G7LB 2R4RL 4HXBL 2YC1A 5E0QA 1KB5L 4UILL 1DN0B 4YDVB 4LIQH 2XTJB 1WZKA 3KPRD 3QIUC 3KPMA 1U3YA 5FUZL 4JO3L 5C3TA 1ZXQA 1U58B 5CLWA 2QHLA 3HTLX 1H3TA 4F7EA 3DRTA 3UPRA 1MCLA 4JG1H 5BVJA 4QGYA 5EH1A 4NZRH 2VSCA 1X7QB 1S3KL 5I16B 4NQEA 3UAJD 3DARA 4I18B 4E9LA 3D2UB 5E5UB 5HGDB 4J3XA 1MFEL 1F2XK 1HK6A 1T7ZA 3FT3A 5BQ7A 5TDOB 3MNWA 4R6UA 1U8QA 1OM3L 1AIFA 1GGIH 3R0MA 3WKMH 1F4AA 3W81A 1UEYA 1PEWA 4Q6IA 4AQOA 4DEPB 3GMQB 1IGFL 4XBPB 2BNQD 2E9JA 2VB5A 3RL2B 3VXPA 1OGAE 5GXBB 1A02N 3GBML 1G6VK 3PP4L 4Y1AD 1IT9L 4PB9L 1MVFA 4YFLI 2C4FU 2HKHL 4WW1A 5ITFB 4R2GC 2R2BB 2JJSA 4MWFB 3KLSA 3DVGA 2LQRA 3CX5J 4LL9A 1FNGB 3GMMA 4FHBD 1MHCA 4ZSOA 1I7UB 3ARSA 1PX3A 5D1ZA 1JMZA 3QDJD 4MDIB 1FORL 5KVDH 5IGXH 4LSPH 4BZ1H 1NEZB 5KTEL 5J4MA 2W9DH 5CZKA 3V6FA 1VADB 2NY0B 4W6YB 3F8UB 4E41B 3MZGB 1ZHLA 4HBCH 1W2KT 1RJLA 5JUEL 4WO4A 4WW2F 3S36L 3EJYD 3WFZA 1KELH 4LASH 3RWEB 3VWKB 2ZSWA 4WEBL 4MMZC 5CINH 1CLZH 2WBJC 2A1WH 3BPLC 5BVPL 3AC0A 3O6FD 3CH8A 4A6YH 3VDBA 2D03H 3UBXA 2PXYA 5IT2H 1Y18B 5IFJB 4KROD 3HNVL 2DQFB 1PG7X 3B83A 3U7YL 4BH8A 5T1LA 1RZ7L 1VEMA 3EOTL 5F9JA 4N0UB 2DBLL 3ZE1F 1AC6A 1KB5A 1YNTA 1CE1L 2QSTA 2ZPKL 1RUMH 3JUZA 5IHUL 5DK0A 3QEGH 2P5WA 3A67H 3CNKA 3KHQA 1NGXA 2CDFA 1A6PA 5FHBH 3ARRA 4D94A 4CJ1A 15C8L 3LD8B 2LV4A 1AGFA 1A2YB 4X4XA 3HE7B 2E7LC 1KTDB 4Y5VA 5E2TL 5E2UH 1FFPB 4M62L 4IJ3C 3O4LE 2CO7B 1TFHA 5IW6B 1J0HA 1NGZB 4PJCA 1Q1JL 3WFBH 2HWZH 1AO7A 3MFFA 5SWZA 4ELME 4FABL 3NPSB 3T0XA 4BSVA 4X5WA 3QHZH 4R97B 5HVHB 3F5WB 4JKPH 1YYLH 1F45A 1T21A 5C07D 2FJHB 4GMSL 4ZFFA 1CBVH 4FZEH 5DUML 5ID1A 1KCRL 3MRHB 1WFOA 1MCPH 3HPJB 4WJ5B 4N1CA 1N2RB 4NBZB 4YDJB 4UOW0 2APVA 4APQA 4YDIL 4Q9QL 2AK4D 1HDMB 1XGTB 4M9OA 2A6IA 4Y88A 1YQVH 3MJ7B 2FEDD 4KRPC 1DVFC 4PRDB 2HTLC 2YEZB 3IDNB 1BZ9A 1L4IA 2RBLA 4JPKH 4M5YL 3VFUB 3NTCL 4BH7B 3LKPB 1R3LA 1WCBA 4F7PA 3G6AB 3JTTB 4Z6AT 3T0DA 2KUTA 1P5VA 3VXQA 3C6LB 2AJ3B 5GS1B 3MBED 4KKLC 4X99B 4LSVH 4EXKA 4X98A 3H42H 3A6CH 2XRAH 3QJHA 3MOBL 4OLXH 4AMKH 4DFHA 1JGUH 5EO0B 3RWCA 4TSBL 3VDAA 1XF2B 4PP2B 2IQAA 3WFCH 1TMCB 2OTPA 5TQ2H 1Q0YL 2O5YH 1A4KB 3ULUH 4ZTPH 4HQQL 3HG1A 5JHLL 3U1SH 5TE6H 4S2SA 5DD0H 4WHDA 2W9EH 3KXFE 1ES0B 4KVNH 3LHPL 1CXFA 1BIIA 2G5BB 1C1EL 3T1FB 2I9LB 4G9FA 3LQAL 3P11L 1I7RA 1DZBA 4MXVE 1RJYA 2AJZB 4XMKH 5CJXA 5FO7A 2FYYB 2BVYA 3SPVB 3UYRH 3GMLB 3I9GH 4I1NB 3SN6N 1GCFA 1JPSH 4KJYB 5I1LA 2XWBA 2ARJQ 1IGTA 3UROR 4O2FA 1ED3B 2VQTA 2X4SB 3FZUD 2AEPL 5T1KB 5TPWH 3MZTA 3IDMA 3FT2A 1IRAY 1FFOA 1ZWIA 4YGAB 5MEND 4AEEA 2GSIA 4O4YL 4UTBL 2VLRA 1J8HB 1BLNA 1HZHH 4XP9H 3X3GL 5C09A 3MGOA 3DUSA 1T2JA 4HWEH 5EWIH 1A7RH 1HOCA 1NAKL 5D2NE 1I1AC 5E2JA 5TH2A 4QF1A 1OF2B 1QFWH 5AZEL 4X7TA 4N8VA 1IEAA 4U1LB 3VXME 4FXKA 1KCVH 4F58L 4S1DD 3P4LA 1TTGA 3ARDB 3TN0B 5C0EB 5CSZB 3VXSB 2OXHA 5D6CB 5IVXB 4ZFZB 3GSVB 4LRNH 5H94B 1ODAA 3JWOL 4TTGA 3OKLB 4Y5XC 2FIKB 4JLRB 2OJEB 5HYJE 3FMGL 2J6EH 2IPUG 1E6JH 3SE8L 4HG4J 2Q86A 4KTDL 4PRIA 4ODVL 1A7OL 3TPUB 1JCKA 4HF5L 1NC4B 2YN5A 5ICYA 4R96B 4DGIL 4K3DH 5I71C 4KTYA 3BEVA 4G8GD 4Y4KD 5E2WH 1GZPA 1SYVB 5HYSA 1FBIL 2KDGA 1TNNA 3E6HB 3O2WL 2PR4L 3ZKXC 5DR5H 4N0YH 5IP4A 4JY6A 5JLZB 1O7SA 5CZVH 1AFVL 3W9EB 1KIPA 4GH7B 3KYNA 3AS3A 4GSDH 1R24B 4X8JB 3NFSH 2DOCA 4PG9B 4OCXH 4H8WC 2YBRA 1HEZA 1HSAA 2NY1D 2FJFB 2R29L 2VXVH 1P1ZB 25C8H 2YUWA 1KJ3L 4ZUSB 5EORH 4TSAH 4Q9BA 1N8ZB 1JNLL 4Z7UA 4OFIA 4FQJL 4L9LC 4LIQL 1LK2A 3SE3C 5DJAB 1P7QB 1UH4A 4YZFE 4Z78B 3IFOA 3UCRA 1FO0A 4GXUN 1CDGA 5DHVA 3LQZA 1Q9KB 2AXJA 3FFDA 3HZVB 4MS8C 3SKOA 4UTAH 1BQHB 4JG1L 4NZRL 1U42A 5EBWB 4LKCB 4WVRA 3WV0A 4YDLB 5FGCB 5B39A 3S9DB 2J3SA 2WW8A 4P2QD 1LHZA 3OPZL 2DI9A 1JNHA 2E6PA 4GW5B 1IQDA 3T8XA 3LKOB 1AR1D 1GGIL 2W91A 3WKML 3QULB 1C12B 5F88A 3UTQA 1CL7I 1T1ZA 2FGWH 4XVSH 2C7UA 2N4IA 4QOKD 4PTTA 4ACPA 1E27B 5ETUB 4Q0XH 4ZS6C 3TNNB 5K9OA 1S9KC 2CLVA 2HVKB 4G80A 5D7IE 4EDWH 1MCRA 3QAZB 5BOZG 5F7UA 4F37F 3OSKA 5DRNA 4OFPA 1E28A 4L4TA 5JA8B 3U36A 4OFYA 4U6XA 2ZOKA 3DPBA 3Q6FA 5KVDL 5T3ZE 3FL7A 5IGXL 4LSPL 1SY6A 4PLOB 4BZ1L 2W9DL 3QIBA 4UZGA 1RFDH 5DJCA 2PYEB 4HBCL 4RFOH 2UZXB 2X4RB 3FO1A 4UUJA 1OGTA 1KELL 3CDFA 3D85A 4GAJH 5CINL 2HRPH 1CLZL 5ALCH 2A1WL 3D39A 5ERWB 5DQ9B 2XKNB 4YBQD 4A6YL 1QSFA 3OAUH 3RWJA 2D03L 5IT2L 5FB8B 4M7JH 1PQZA 1HKLH 1OAZH 4R7NA 3JV6B 1JGDA 4JDZA 1IGIH 2VDPH 1EUUA 3VFOA 4AT6A 1X5GA 5D1QD 2JB6B 1KENH 4PJDA 1FAKT 1RUML 3EFDH 1XF4B 3QCUL 1Q8MA 1KNOA 3QEGL 5LAXB 1U6AH 3ROOB 5FHBL 3PNWB 5JNYB 2DQGL 3QUMH 4OQTL 4QCIB 1DQMH 1YY8B 4M8QB 3SDCB 4JM2F 4L29B 1I8MB 4O58H 1PKQB 4WY7H 1J8HD 5E2UL 4MJID 2RFXB 3VRJB 3D3VD 4OF8A 3NVQA 3GJEA 3K8KA 2DQCH 3WSQH 1HH9A 3WFBL 2HWZL 3C6SA 1CFNB 3O8XC 5ALBL 3G6JF 4MA3B 2DQDH 3CLEH 1S7SA 4RMQA 1P4LA 4MDJA 1FSKC 3L6FA 1G7QB 1FZJA 4HUWB 3QHZL 3WL9A 1T1YB 3BEWB 2DI8A 3MV8D 4JKPL 1YYLL 4POZC 2VZ1A 5F89A 4EI6A 2EKSB 1HXYA 1CBVL 4FZEL 3RNKA 3TWCL 1MCPL 3ARFD 4JQXC 4LVNB 2G75A 1NUNB 3OF6A 5CD3B 3VFNB 1WZLA 4XGZA 2PTTB 3RX7A 3TBVA 1YQVL 4PRHD 2Z93B 4JPKL 1I9IH 1UWGH 3BOVA 5D96B 4S0TD 2EECA 5JR1H 4X7DC 2E5EA 1MCCA 2JIXB 3KYMB 3O3BB 1MWAB 3S96A 4KROC 2F5AH 3AY4C 5F97E 3H42L 3A6CL 4I8DA 2XRAL 4BYHA 4DKDC 1VFBB 4OLXL 1GRWA 2OMBA 4I0PA 4AMKL 1JGUL 5EA0L 2IADA 1L7TH 4I9WD 3W5NA 5B3JF 3PL6A 2I60H 4GRLB 5E6ID 2WIIA 2P8MA 3RKDD 1EAJA 5TQ2L 2O5YL 4NQVB 5C9JB 1T20A 3ULUL 1IM9D 4ZTPL 2NY7H 3HAEA 1EHXA 2XT1B 5KS9F 5KOMC 4OTXL 3IDJB 4XVTH 5TE6L 1AGBB 2KBGA 5DD0L 2W9EL 3G04B 4KVNL 4NZJA 4FNLL 5T3ZH 1JMXA 2ADGB 2K7PA 4EDXA 3EOAA 5CEZE 4JY5H 4XMKL 1F90H 4OQTA 3UYRL 4N1EA 43C9B 3VH8A 3I9GL 4XAWH 3LDBC 2VABB 3P9WB 2I27N 1C08B 4G8FB 5L9DH 2RR3A 5ISZA 2DS4A 1DQLL 2UUDK 3VXRB 5E08H 1G9NH 4KI5D 2C1OA 5CD5D 5TPWL 5DJ0B 5EUOA 3L3DB 2XXMB 4D9RD 3UTOA 5KW9L 2H3NA 3E3QE 1ZLWH 4KTEH 4LVEA 1DR9A 1Z9OA 3ZTJG 1HZHL 3M8OH 5DVOA 4XP9L 3EO1A 2A77L 3VXTA 4RMUA 4XVUD 4HWEL 5DEFA 1A7RL 1U91B 4PJBF 4JKLA 1EEYA 1QFWL 1T7VA 1KCVL 4PR5A 2OTUB 3MRRB 1BHGA 1DEEB 2X4PB 5I75B 1YPZB 1UC6A 4JR9H 1EHLL 2XYCA 3QISA 4LRNL 3DYOA 4G9DB 3B9KA 1I85C 2Y5TA 3X11A 2EYRB 2J6EL 3LN4B 3MOAH 5EZOH 2DLEA 4LLQB 4EEEA 3VRLF 3RY6A 4K3DL 3NIFF 5E2WL 1T5WB 1OGAA 5GGRY 3WJLC 2XTJC 2X4TB 3TZVB 5IG7A 5DQJB 2J8UF 5IJVA 4F2MA 4N0YL 4Y4HD 4P3DB 2YWZA 2V7NB 2NY3D 5CZVL 4GSDL 3RWFA 3NFSL 4NHCH 5HDOA 4OCXL 3QFJE 4I18C 3GSUB 1JWUA 4JQVC 2VXVL 3QO1B 25C8L 4RGOH 2GUOA 3BRDA 3FZUC 5EORL 3H6JA 4TSAL 1G7IA 3ARWA 3SDYH 2EE2A 2Y7QA 3PV6A 3LEVH 3VGHA 5KVFH 5HHNB 2WLZA 5MEPB 3G08B 3C5SB 3HN3A 1F3JB 4CAGA 3OKNA 5F9OH 4GS7C 4DEPC 3UC0L 3HLAB 5EO9A 1ITCA 3KPQB 2NW2A 3VMNA 1CG9A 2VXTL 4G42B 1U41A 3BKMH 3TBWB 3OKDA 5FYKD 4P99A 4X80H 1FCGA 5SWSD 5E5RB 1BMGA 3VI4F 3W9DB 1UACH 4GBXA 5C0CD 1YEJH 3VCLB 4G6JL 3ARXA 3OWEA 2AAVA 5A2IH 3LKQA 4Y8AA 5DEGA 1M71A 3OAYH 1ONQA 1E4JA 4HD9A 2FGWL 1C7TA 4XVSL 4FQ1H 3O4LA 1ZGLA 4Q0XL 3RWIA 4YGVB 1TVHB 1OAKH 3GUTB 4EDWL 1S7WA 1JI1A 5DMKB 4HIIA 3MRPB 1RPQA 4Y4KC 1UM6H 4CVZB 1E4XI 1QOKA 2BY2A 4GRMB 1M7IB 1QSEB 2X05A 1Z9SA 1J0JA 5D6DA 1PLGL 5IFAH 3SO3B 5E70A 1ZHNB 4NQCD 5ID0A 2E7CA 3IRPX 3SO5A 5C0DA 3N50A 5E8PB 1RFDL 4Y4FA 1MWAH 2A74A 2ADJB 3QH3B 3NCBB 4RFOL 4JAMA 4I5BA 4UQ3B 2IQ9H 5IHZB 1TCRA 2Y4SA 1T22B 3HE7C 4GAJL 3IVKB 2HRPL 5ALCL 4PV8B 5E03A 2X4NA 3ZT6A 3V0AC 1QQDA 3OAUL 1YDPB 2N7BA 4YIQA 3TVMD 1NFIB 1BD2B 4M7JL 1HKLL 1OAZL 2FSEA 3BPCB 1IGIL 2VDPL 5IMOA 4MNGE 3V4VH 1KLUB 2V5TA 2MHAB 3NPSC 5M7QA 2BC4A 4PJIB 3VGAB 1MCFA 4R97C 4YHOH 3FFCD 3EFDL 3AAZB 4RGNE 3VMPA 5KAQG 5HTSA 4Y5YC 1IAII 4HZAA 1MCOH 5JQ6H 3QUML 1ZANH 3DBXB 4JJHA 3GIVB 1DQML 1MAKA 1OAUH 4O58L 4WY7L 3TF7C 3OKKB 2VDOH 1XH3A 1PGRB 2FECL 3KXFA 2DQCL 4OGYH 4U4BA 1KULA 5IWLA 1RSFA 3ALPA 1XR9A 3K1DA 2DQDL 3CLEL 1RIHH 4NOFA 4NZUL 4XX1G 1YEKH 1R5IB 2AV7B 1VEPA 3V0VB 4Q6YA 5GS1C 3E2HB 2ID5A 3QCVH 4L3EB 4Z7WE 4JFED 3HZKA 4J3WA 4WWKA 4M7LT 3HNTH 2GFBA 3F7RA 4PRBB 1HQRB 1SJHA 2SEBB 4GG8A 3RBGA 5CJOH 1D5MB 4H26A 4JM2B 4U1JA 2FX8H 1UWGL 2ITCA 3QZWA 3OXRA 1AI1H 4OD2A 4XCNA 5L2KD 1MNUH 3DX9A 2N7AA 2DIBA 2L7JA 5JR1L 4MNQD 4YBQC 5GZOD 3L3OA 5HSFA 3RWGB 1CFTB 3S5LG 1NDGB 3WO4C 5I30H 1ZLVH 3MRMA 3OGCA 3CVIH 4P46B 2F5AL 4HWZA 1JWSB 2WWMD 5FYKU 5DRZB 3H9ZA 3KPSB 3OX8B 5IB5A 4OFKA 4MSWA 4TNWK 4DVRH 4YPJA 5D1QC 3BO8B 3WUZA 1LWRA 3HZYB 2I60L 4J6RH 4XZUB 4L4JA 2CXKA 3U7AA 4Z0BH 4NCC2 4JANB 1L9NA 2CJUH 3L3JB 2ED8A 1MI5E 4HW6A 4XVTL 3TO2A 1J9CT 4U1KB 5I6XB 4OKVB 4XXDB 4NQDB 5K9JL 5DA0B 4KXZH 4ZUTA 5T3ZL 3MV9B 1FZMB 4JY5L 1XGRB 1F90L 4LCYA 2CIIB 3RX8A 3IETB 3O11B 3PDOA 5F1IB 2AABH 3DVIA 4XAWL 3UTTA 4HUVA 5D7KD 4N0FA 5EU4A 4X9HA 5F3BA 4OF6A 1FL3B 3Q3GB 4IMLB 5L9DL 5IF0B 1D5XB 5FDWA 2UWEE 4WTZG 4FZ8H 5E08L 3BW9A 2QEJA 3ARDC 4LGSB 3TN0C 3P4MB 3IJYA 3O9WA 4XP4H 3UDWA 1PG7H 1PD6A 3O3EB 4S10A 5GRVL 4MAYD 5GGQH 4UI2A 1BX2A 1IAKB 3NABH 4KTEL 4EI5A 2VDML 5CGYD 1FVDB 4EOWH 1WWCA 5CUSL 5I1JH 3M8OL 5D2LF 2HT4C 4IIQA 4QRRB 3ALXA 3DI2B 2FBJL 4P3CH 5IROA 4KZEH 1T5XB 3BXNB 2D0GA 3OXSB 4PREA 1RZJL 4OUUA 1RMFH 2DM7A 3TNMA 2BNUA 1HSBB 3KPLA 1D9KD 5HY9A 4OCNC 3MMEA 1WFNA 3H3PH 3HR5A 1EO5A 3QUZB 4JR9L 1H9VA 1EIBA 2EEDA 1MCEA 4WV1B 1C5CH 2BOBA 4UNTA 3REVA 1D5ZB 2B20A 5DRXB 1OAYH 4G43B 1N59B 5K9QI 1LO5B 1XIWB 2VQUA 5EZOL 3MOAL 3TEUA 5I17A 3KPRE 5JPMB 2X44D 3QWOA 3LV3B 3H0TA 3NIDE 5DVMA 3TBYA 2H9GB 3RUGB 1XZ0B 3QIWB 4UBDD 1BD2D 1WIUA 1MJUH 1YN7A 3DO7A 3W82A 3MRGA 4J3UA 4LOUC 3QWQB 4PJEB 1U8KB 4XMLH 5D7IA 3QDMB 1KC5H 2HG5B 4PJBB 3O6LH 4QRTB 5ELIA 5ILTH 1KTLA 4HH8A 2F58H 1BF8A 5EC1A 1G9NC 1CE6B 3CFIC 4ZYKA 2NY6D 3ILPB 3FO2A 3EOBA 4JVWA 4NHCL 4YDLC 2VLJB 2EXYD 1S7VB 5J9PA 5TDNB 1VFMA 4RGOL 1MFDH 1OLLA 2BNQE 2LE9A 2QJDA 3D0VA 2VSDA 3SDYL 1H5BB 1CFSB 5CD5C 4RFEB 3GSWB 1F4XL 2DQIL 3LEVL 4LLMA 4Y1AE 4LRIA 1WC7A 3U9UB 2VRAA 1DEDA 5F9OL 4X6BB 1MAJA 1NCWH 3MRLB 1VEOA 5B4MC 3B3IB 3PGDA 3QDJE 3UYPA 4N0CD 3BKML 4XVUC 4FFVC 4LSQL 3EZJB 2FH6A 3QAZC 3V4UH 3ORJA 5I1KL 3U79A 4K3EH 5D5MA 3KNBA 4X80L 5F7DA 4C83B 3FCTB 1C5BH 2Z0BA 5F3HB 1UACL 2C3GA 1S9XB 1YEJL 2HVJA 4ELKA 4G3YL 2HFTA 3P9LA 3BZFA 2D7OA 5BZWA 3TO4B 4Y19B 1NUGA 4C58B 2COQA 2OL3A 3MGTB 3FT4B 2P46B 2EDEA 2I25N 4XBEH 3VFRB 1EZVY 2V2XB 4FQ1L 5EC2B 3SBWA 3KYOA 3RGHA 2WAHA 1OAKL 3LKRB 4LHJB 4C56B 3EFFA 3VFVA 1VA9A 1CGWA 1DE4A 2D3VA 3G5ZA 2L0DA 1K8DB 1UM6L 4HKZA 4UU9B 4DN3H 1OARL 1I1FB 1NDMA 3FAWA 5CBEB 2EDQA 3P73A 8FABA 5IFAL 5C6TH 5A2FA 3VXNA 1RVFH 3L3HB 3WNPA 3PF2A 4PJDF 4HWNA 4FQ2H 3MLVH 2XACC 4HUXB 1INDH 2Q3AA 1GIGH 1T4KB 5DMGD 5A16A 1DL7H 3AM8A 2IQ9L 3U4EA 4LLVA 3C8KA 3SDCC 3GSXA 1YZZA 4F7TB 3VWJD 1NL0H 3S35X 4JFXB 1UZ6F 1LK3H 4A2LA 2YD2A 1TVBA 1CI5A 1CFQA 3Q5OA 4JPIA 3IU3A 2V7HB 1GGCL 3IJSB 1HQ4A 2BFVH 1HHJB 3C87A 2PCPA 4ALAL 2IMMA 5HHOD 2P5EB 5C07E 3TIEB 3V4VL 3V52H 4ONFH 5MEQA 4OGXH 1T80A 4YHOL 3EYQD 4RWYH 1JE6A 4I0KA 1WBYA 4NBXB 3BYTA 4G8EA 2QSCH 2AK4E 7CGTA 2BCKB 3QUKB 5I0ZA 1X5KA 1MCOL 5IW1A 1VB9A 5IB4B 4PJAB 1BEYL 5JQ6L 4EBQH 3FHAA 1AGDB 1ZANL 4TQEH 4LVNC 3R0NA 5E8EB 2OLDA 3QIUA 2ZNWA 2A6DA 5TF0A 2VDOL 4AEIH 3FO9B 1RURH 2P4AB 5BRZB 5DF0A 3ZDZE 4LHUA 5K59E 1RJZB 4ISVB 5KG9A 4HUNB 3G5XA 4X83A 3D0LB 1RIHL 3F7QA 5D96C 5DLMH 1K9TA 1T0PB 43CAA 5IB2B 4UV4H 3KR3L 3QCVL 4WU5B 4RSVA 1ADQH 3BH8B 4ZUUA 4PRPD 4XWGH 3HNTL 1YC7A 3OZ9L 4RBPH 4P4KA 4MCYA 4GRLC 3OKMA 1CTOA 2EDHA 2VXQL 2IH3A 3B2UC 5CJOL 3BD3A 3QXDB 2VWEC 1H0DA 2FX8L 4JFPB 4OZHB 3MUJA 2NW3B 2ITDA 5E9DD 2W1NA 4AJ0A 3P0YH 1KJMB 1VACA 3TH2T 4BQBA 1AI1L 4Q2ZB 4MAUH 4RX4D 3QEHA 4FQXB 5I30L 1NBZA 5FYJD 1FCCA 3CVIL 3CVHB 1G7MB 5GGVY 1FLTX 1I1RA 2CRZA 3WFHB 2VISB 3QI9D 3P77B 4V1DA 4DVRL 3MRQA 5MENE 4XP5H 1GOFA 4JFOB 3PWNB 2WBJA 4J6RL 2AJYH 4Z0BL 5I76B 2W60A 2OJZH 1MFNA 2CJUL 4FQQB 3VA2C 2YPLD 4GRWE 3GSQB 5F7KC 2A9NH 2ORBH 5KSUA 1KPVA 2ERJB 1U93A 3OMZA 3JWDH 3SDXE 4L8BA 5IEKA 3L9RB 3BD4A 4HK0B 4PGCB 4X4YB 1AJ7H 1MCDA 1CR9H 1NCBH 2AABL 1N0XH 3LPFA 4OM0H 4M1CC 4UINH 2B4CC 3FJTA 4X5LA 1HILB 4KKBD 1KPUB 1DQDL 2GW5A 3C8HA 4WHTB 5I75C 2ZP0T 4FZ8L 2AJXH 4R26H 1LEGB 4Y19D 4KH2A 4NQED 1QP1A 1RZGA 3QFJA 4BUHA 1PG7L 3SY0A 3QEUA 4FFWC 4RQQA 2ENSA 4EIGB 5GGQL 4G8GE 1QVOA 3NABL 3ABZA 3HCVA 3O2DH 1MREH 4JRXD 1KEMH 1R3IH 1R5WB 2JCCF 2VOTA 4P23D 4OZGE 5I1JL 2NR6C 4Z7VE 5BV7H 3NCCB 4KZEL 1A7PH 1B88A 2BSTB 1RMFL 3TBTA 1JK8A 2IAMD 4WI9A 3H3PL 1F58L 3K1KC 1NFDB 4ETYA 3QSKB 2IFGA 5CGMA 5DVNA 4LMQI 1ITBB 2HMID 1AXSA 1C5CL 1OT2A 2CDGA 1EDQA 2R1XA 5D1ZD 1DVFA 5GRVK 5C08A 3AROA 2BZDA 1OAYL 3WN5B 4PJHE 1CGTA 4F57H 2NPLX 3A0OA 3ZKMD 3UBXG 4MJ4A 1CF8H 4HH9A 3PWUA 4OCLC 4HHAA 5IQ9A 3M07A 5D2LB 5C0IB 4BSWA 3HA0A 1MJUL 4O2EB 4JGJA 4YO0A 4AM0A 4YK4C 1KC5L 3O6LL 3W0WB 3VFPB 5ILTL 4P2QE 1DBBH 2AI0L 2F58L 4RWHA 3NBNA 2H32B 4J3VA 4AL8H 1K4CA 4LNRA 1HHKB 1VGEH 4RIRA 5EU6B 2X4UB 4POYA 4HZLA 4KMLB 2P5WD 1WBXB 2VLLB 3B9AA 3CFJB 2AK1H 1MFDL 2OP4H 4QOKE 3B2VH 4UIMB 3V0WH 4RA0C 5DUBB 3GBNL 3V4PH 4J3SA 2YRPA 1RHHB 4GG6E 4LLUB 4ONOA 5J6GB 2AGJH 4RAUA 4EQ3A 2APXA 1NCWL 1OWWA 5CGYC 1A6AB 3RIFF 4XCYA 1P7KA 1J1PL 2D4FA 2XZZA 3TYGH 1EO8L 1BVLB 3FQNA 3L7EA 2J8OA 4OLZH 4E42B 1FV1A 1GAFH 3SCMD 4PIRF 4P2RB 3V4UL 4BA8A 4JG0H 5SWZD 2WK2A 4K3EL 4MNGA 5FM8A 4LSDA 4F8QA 4LCWB 2Z35A 1H8SA 5FYJU 1C5BL 1IGYB 1K5NA 4IDLA 4JO1L 5DTFB 4GRWH 4QRUA 2YRLA 3SO3C 1V7NH 4JFDB 2R2HA 32C2B 1KJ2A 5I2IA 4KK6D 4M3JA 3WLBA 7FABH 5KOVC 3T09A 2BVQA 1JUFB 1YEDB 3KJ4B 1I1AA 1ZSDB 4JM4H 4XBEL 4APQD 3PJSB 4RAHA 3S37X 1DQJA 2CLZB 1U8HA 4PJGE 4YC2B 5DJ8B 4ZQKA 3AFLA 4X6FA 1CGYA 1CDHA 1UB6B 1XGPA 3GHBH 3FB6B 3BJ91 2HT3D 4ZO8A 3LPGA 3GDBA 2XA3A 5HHQB 1ZE3C 5FA3A 4G8IA 3BWAB 5GGRA 3VE0B 4Y5XA 1MJJB 4IMKC 2P24B 5C6TL 2YOCA 3MLZH 5HGHA 1RVFL 1U8MA 5E95B 2EDBA 1FGNH 2ZOLA 2ZCKH 1J8HE 4MJIE 1UEMA 1INDL 1GIGL 1U8NB 5LXGH 1VCAA 1DUYA 2XI9A 3D3VE 3MNVA 1DL7L 3EDJA 2EXYC 4OIAA 3CU7A 2ZUTA 5EPMA 3T1WA 4ZAKB 1LK3L 1F6FB 3HG1D 5HHPA 3SKNA 1MJ8H 4F15B 4JZNA 1I9RH 4PS4H 3LKSA 2BFVL 3MV8E 1S8DA 1X4XA 4NNYB 4AENB 5ABDE 4LVHB 1BVKA 5E99L 2GJ6B 1U2HA 2VLKD 3V52L 1J18A 4ONFL 1X3DA 3I85A 4OGXL 4Z9KB 4X6CF 2YKLH 4PB0H 4RWYL 3BIKB 4HUKB 4MQXD 2QSCL 1GC1H 4NDMA 5E94A 2A9MH 5SWQB 3DVFA 4IBLT 1TZHA 1W72H 2DLIA 1A5FH 4TUOA 4EBQL 4PRHE 4XHQA 4L9LA 1XAUA 1FNSH 4TQEL 3SE3A 4U31A 3WIIH 2YN3A 1BAFH 3KDMA 3QHFH 3FQWB 4YHIA 4AG4H 5BCAA 2J12B 4ODXA 3S3SA 3BAEH 2OQJA 4MNHA 4PJ7E 5H8DA 4AEIL 1RURL 4JM2C 1MI5A 3BP7B 4WI2A 3CDGB 4JFFA 5ACZB 4N8VG 4BZ2H 4M93C 2X4QB 4Y2DB 4JDVA 3RVWC 1SM3H 2VLRD 2CIKA 3AS2A 4W68A 2VE6A 4ZPVA 5C09D 3UTSB 2AKRB 2JTDA 1UVQA 3INUH 3GMOB 4I9WE 4UV4L 1BFSA 2MOVA 4L8SC 3BQUD 5CEYB 5DYOB 1W0VB 1ADQL 3HUJF 2O61A 2UWEA 4J1UA 1G7HA 3I84A 4XWGL 2HFFA 4D8PB 4G6FB 3P0VH 4KUCF 1RUKH 3GBLA 2VLMD 4XNMB 3C5ZB 5HYSG 3SE4C 4RA3A 3TCXA 3LAFA 4WI7A 1ZVSB 1G0DA 4K7FA 5J57B 4OCYH 1LD9B 1LP9E 2PNDA 4P9MH 5I6XC 4PRID 2NY2D 3PABB 5A2JH 4LCIL 5IEHB 4MAUL 5GGVH 4CW1A 1U92B 1B6DA 5I1EL 3HHRB 5DMIH 1IC1A 3BKCH 5KSVA 5CKGA 2R8SH 4KI5E 1EFXB 4NCC1 1TZGH 5EO1A 3BRFA 2VL5B 5MI0B 3GIZH 2M8XA 4D9RE 5I1AA 4PGBB 2ATPB 4XP5L 4KV5E 4Q9CA 3SJVB 2OSLB 4CRPA 1TQCB 3FQRB 2DYPD 1BBDH 2WP3T 1KF9B 2AJYL 5FGBC 2KL6A 4N90D 2FNBA 1C16B 2OJZL 4LGPB 1RUQH 5E8NA 1TJHH 5F1KC 3WS3A 3KPRA 1AGCB 4PBVC 3DHMA 3IDGA 1U3ZA 2A9NL 2ORBL 5EBMB 3JWDL 3KLAA 5IOPA 1ZLVK 1AJ7L 2CRIA 3FOMB 5J6HA 5B39G 4H1LB 1IKNC 1NCBL 4JHAH 3FN3A 1N0XL 5IQ7H 4OM0L 5FM5O 5GGSY 4UINL 5IMKA 1LVEA 1WTGT 2EE9A 2H1PH 3QDGB 2DMBA 1ZT1B 1I3GH 1BFOA 3QUZC 1JF6A 5GIRB 2WZPD 5JXEC 5FO8B 1H3GA 4R26L 1OAQH 5HGAB 4YFEA 5SX4I 2R56H 3O8XA 1EEZA 2BNQA 3O2DL 2EDYA 5JIHA 4ZD3H 1MREL 1XIWC 2DJSA 1KEML 1R3IL 4MA1C 4P5MB 5ESAA 3VFMA 5BV7L 2CH8A 4NN6C 2EIEA 2VQ1A 3GI8H 1A7PL 1OB1B 5CP3H 3I75A 4KK5D 1YUHB 3IB4A 4WCYH 2MCG1 1R0AH 1R3HB 4NRXB 3QDJA 4NFBA 2ARJA 1DP0A 3RU8H 2JK5B 3P3YA 4L4TD 1F3DH 2D9CA 1T89C 5DSCB 1G7JB 1NPUA 1VKXB 3QI9C 3DX7A 5ACLA 3T2PA 3WUWA 3L5JA 3DGGA 4G6MH 3QIBD 5I1IH 4F57L 1OSZA 2FRGP 1X5AA 4KJPD 2DKMA 3SKJH 3O6FA 3TIDB 4TVSa 1FYTB 1H5BC 1CF8L 5I9QB 2AEIT 2H6PA 2APWA 5FYKE 1G9EA 5HBBA 3U46B 3AY4A 5J13B 4DVBB 2D9QB 5INCA 4OBRA 3IT8D 5SWSE 1ZS8A 3IFLH 3ZE1E 1QSFD 5C0CE 3ALWA 1JRHL 4EZMA 2PUQT 1YMMA 3RVXC 1HYRC 4HKJA 1G6RA 3CFDA 3GSNB 3MRCA 3U6RA 3CZFB 5KZCD 4AL8L 2DQJH 1ZV5A 1VGEL 2X40A 3PQYA 4NO0B 4YXLH 3D18A 4OD1L 3D25B 4WUKH 2AK1L 3WD5H 3TO4C 2OP4L 3B2VL 1D6EA 5T3XD 2DL9A 3V4PL 1T0MB 3NZHL 1H3VA 4O51B 4G6KH 1OTSD 4GUPB 1T1WA 2AGJL 2DWEB 3TCLA 4YHPB 3UJTH 3TYGL 2M2DA 4KJWC 5I66A 6CGTA 4OLZL 3JXAA 2Z91B 4CGTA 3ILQC 4NQCE 5C07A 4X6EB 1DBAH 1DTUA 2IAMC 3T4AB 4ZOCA 3DVNA 1VFAA 4IHOB 4N8PA 5H37G 1E4XH 1K8IA 4FQHB 5DMYA 3AGVA 1S7UB 2AK4A 3RDTD 2HMIC 1V7NL 3R06B 4KDTC 3MRFA 3P4NA 1NAMA 1T0NB 7FABL 3DXAD 1I7TA 3SDDB 3IDIB 1IL1B 2F74A 2HN7A 3PP3H 4JM4L 2H2PC 3OF6D 5C0GB 1MJ7L 4M48L 4OZIF 1MH5A 2DD8H 4HJGA 2X7LA 3G5YB 5HD8C 3EBAA 2E9WA 2W0PA 3GHBL 3MBEA 2A2QT 5I74B 5C0FA 3FFCE 3VRIB 5DDHA 1SBBA 1HI6B 1I85A 2DL2A 5I1DA 5KSBA 2DJ4A 2DQUH 3PV7A 1M05B 3V95A 3MLZL 3HAEG 1FGNL 2AERT 4F80A 5L2JA 2ZCKL 3TA3B 2BVTA 4ORZC 1Q72H 1QACA 4RDQF 3ES6B 2D4DA 5LXGL 1KLGB 1KIRB 5H2BB 1MCJA 3S5LB 3BN9D 4WFED 1N6VA 3LEYH 3EYOB 3VXOA 3WJLA 1TPXB 3QDAA 5F1OB 2AXFB 4RFNB 3VH8G 1FVEB 1U58A 3CSGA 1MFCH 1MJ8L 4MMXC 2DB8A 1HXMA 1I9RL 1QLEH 4PS4L 3S3PA 3D69A 1AQKH 3N9GH 2H8PA 4M7KH 4DUWA 3GRWH 2NNAB 4PG2C 4ZFOL 1RZIB 3DUUB 4JFEE 5JORB 1E0OB 2Q6WB 4NBYB 1BJ1H 4JQVA 4LAQH 3SCMC 2YUVA 2YKLL 3H9HB 1L6ZA 4PB0L 4XX1E 3T3PF 3OG6B 4RAVB 4OJFH 1GC1L 3KJ6H 3M17A 2A9ML 1W72L 5FYKH 4AQ1B 1A5FL 3BH9B 4G6AC 5MENA 4HCRA 5BS0D 5F7HA 5ISZD 1FNSL 2EIDA 1CDUA 4UT9H 3WIIL 1BAFL 1DJSA 3QHFL 4AG4L 5L2KE 5CJ5A 1WFTA 3BAEL 4KK6C 1EX0A 4DZ8B 4MNQE 3HE6B 3RIAF 4BZ2L 5ITFA 3ZE0F 4MWFA 1FZOB 4MQ7B 3OJVC 1SM3L 2P8PA 1S7QB 1I8IB 2MSPA 4MDIA 3CH1A 3IRZA 3RWHA 4M61B 3QQ4A 3INUL 5IHLB 2R0KH 1VADA 3LS5H 4YNYA 5IIEA 2ADIA 5HI3C 3RWEA 4NQUA 5DRWA 3P0VL 4HKXA 4P2OB 5DFTA 1RUKL 3AU1B 3T4YA 1AHWB 4XPFL 1JZ3A 3CFEA 1XF5B 4Y4KA 5IK3A 4N9OB 1B4RA 4OCYL 4BKLB 5CCKH 2QR0A 3P9MA 1N5AA 4P9ML 4ETQA 5CMAB 1ND0B 2DQFA 4PD4K 5D7KE 5GGVL 1PKOA 5JIPA 4M02A 4N0UA 4Z7QF 1PY9A 3G9VA 2VDLH 2E27L 1T3FB 3MLTB 5C92A 2R8SL 1TZGL 3DIFB 2CKBB 2VZ3A 4U1HB 2ATKB 3RTQD 3BP6B 3GIZL 3MRDB 3HE7A 5FXCH 2H26B 3KYKH 4MQXC 3CU1A 2XN9B 4WUUD 5D7JB 4W4NA 4PJHA 4PGEA 5JHDB 2VXUH 1RUQL 2MQ3A 5CIPA 2Z8SA 1TJHL 5E5MB 3U0TA 2DRUA 4YUEH 4KDWA 3PWPD 4Y89A 1T6WA 1TIUA 3BE1H 2EZ0C 3ZDXF 4ODSL 5TFSH 3X14B 3GJFB 1W72A 4WU7A 3HMXH 4CMMB 4QT5B 3F5WA 5K93A 3WNMA 3V7MA 3V5DB 8CGTA 5J06A 2OMNA 4JHAL 3RZCB 1YEGH 2FJHA 3EO9H 4Y5YA 1CICB 5IQ7L 4LKXA 3ARUA 5HVGB 1QPPA 5D7LB 3TYFB 3MRHA 4P2QA 3HPJA 2H1PL 3VJ6B 1MLBB 4W6WB 1I3GL 1N2RA 1CS6A 1NGQH 3IFPB 2J5LC 4M7ZB 1D5BA 2NX5D 1HDMA 4BQ9A 1I7ZA 4HMEA 3BQUC 4P9HC 1OAQL 4X5XB 3MJ7A 4YHNA 4PRDA 3UTZA 1JPGB 3BPNB 4M4RA 2R56L 3WN5C 4NNPH 3LKPA 4R4ND 4YWGH 1A6UH 2QKIA 3HC3H 4HFWA 1BD2E 1ZLUH 5DJ6B 4ZD3L 3SGEI 3JTTA 2Y06H 1HHIB 5DHYB 2NQCA 4GG6A 4IOIA 3WHXA 4UOJA 5GS1A 3K2UH 3GI8L 1YY9D 4IOFC 4WCYL 4QXUH 4NOBA 2NY2C 1K6QH 1I4FA 3CFKB 1T1XA 5CS7A 4JHBA 4UV7H 5BZDB 1C8PA 2BNRB 1G1CA 2R15A 4LQ1A 4K94H 2FO4A 2D7QA 3BYYA 4PP2A 3H7BA 3RU8L 1ZKAA 4J23A 2Y6SC 3HMWH 4ZNEA 5JQHC 2OS7A 1S78D 4JPWH 5C0AB 4NN5C 4G6ML 3WNKA 4KRLB 2AQ3A 1S9WB 5I15H 2G5BA 3DMMD 2WSKA 3T1FA 3SKJL 5BMFH 5HYEA 2NY4B 2AJZA 4PPTA 1YN6B 1R3KA 2VAAB 3FB7B 4PJXF 2ZUXA 3SPVA 1DUZB 4NRZB 2VAJA 4PJGA 4JQIH 1JWMB 1N3NB 2ICES 5BXFB 1HWHB 3IFLL 5D1QA 5F8QC 4EN3B 1AKJB 4YAQA 3KWWB 4PFEA 1BGXH 1EEUA 1DANU 1ED3A 1NGPH 4ZODA 2DQJL 3B5TA 4QYOA 4UNVA 4YXLL 3LRHA 4WUKL 1J8HA 3X13B 4MJIA 1QR4A 4NO2A 3G6DH 3WD5L 2CSPA 3D3VA 1DQTA 2Y5EA 2QBWA 3HKFA 2M1KA 4ZPTB 3RWDB 5AYUH 4JVUA 3G6JE 3KJ4C 5D9SB 4G6KL 2PW2B 3REWB 4Q7DA 1LO3H 3UJTL 2O93L 4XI5D 3BZ4B 1JPST 4JKWA 1CK0H 1EGJH 3VG0H 2V2WA 3ECBB 4JCMA 3ARDA 1Q94A 2ICEA 5D6CA 5IVXA 3TLRA 3T0ED 5I8EB 3PWJB 3GSVA 5C3LD 1P84J 1DBAL 1S9YB 2WINB 3EDDA 3ARFA 5F8RC 4Z77B 4MYWB 1E4XL 2OJEA 3GGWB 3EJZD 3I6GB 4D0BB 3V8CA 4BQ6A 4B50A 4E5XB 1AD9B 4OZ4B 2JE8A 4Y16D 3WFEH 4PRHA 5C0BB 4R96A 4YHZH 3QZWG 4M8VA 4TNVF 5F6IB 3MA7B 5L6YL 2DD8L 2JJTC 4PJ7A 4MCZA 4XNUH 1QFWI 4ZAKC 5HHOE 4QHUA 3PDGA 1OY3B 4F15C 3U83A 2VZUA 4PJFB 4HIEA 2OK0H 4QTHA 4YHMH 3VXUB 5D1XB 1ZT7B 2ZCLH 3ARED 1FN4B 5DJYB 4JFYB 1UGNA 2CDEA 1N4XH 3FTGA 3O81A 5AYQA 4Z76A 2DQUL 5B3JE 4XTRC 4AEFA 1RIVH 1IM3B 1OW0C 5KS9E 1IM9A 2G2RA 1N8ZA 2DBJA 2CKBH 5F7LB 3EGSB 2W0LA 2DM4A 4KUCD 2OTWB 3LEYL 4JGUA 1J5OH 1P7QA 5ENWA 2GAZA 5T5NG 4PBWD 3UZEA 4JZOA 5MERB 1MFCL 1Q9KA 1LP9A 1QLEL 4Y2DC 1OTSC 1AQKL 4M7KL 2YC1B 3RZCD 2WLYA 1URLA 4X6DF 5EBWA 3WFDH 3MA9H 3K81A 1CD8A 5ECJE 3Q5YA 4PRPE 1UYWH 4LAQL 3GJFH 5IESH 4KKCD 1EMTH 1B3JA 4F7EB 1A1NA 2EYSB 3UTTD 4OJFL 4NYLA 3KJ6L 3DRTB 4U6YA 5HDBF 1C12A 5FYKL 3RVTC 5C2BH 3S34H 5E9DE 3RPKA 4UT9L 5BO1H 3RDTC 4ZO7A 5ETUA 3O9WD 5H35B 2F54D 3TNNA 5I1CH 2HVKA 4HAGA 3FT3B 4K9EH 5BQ7B 3MNWB 1U8QB 5KN5A 2QQLL 4PJBE 1V5JA 5FYJE 2O5XH 1F6LL 1HKFA 3SDAD 4N1HB 3R4DA 1K4DB 4U1IA 4ZMAT 1CDIA 2APBA 4AYFA 3MACH 2R0KL 3BX7C 1U8PA 3UO1H 4LPTA 3LS5L 4WW1B 1KJVB 2PYEA 5HI5C 3DVGB 1A21A 3GMMB 3FRPA 2YPLE 5JXAH 1P6FA 3B43A 4HGWA 1KG0B 1TQCC 4WI4A 4HWUA 1FNHA 5DQ9A 2XKNA 3VRLE 3V6FB 2EC9U 1LEIA 2AXGA 3LN9A 3NIFE 2R0WH 1ZHLB 3BN9C 5CCKL 4WO4B 2J8UE 1QLFB 1REIA 1V3JA 4JZJC 1Q9WA 2ZSWB 4CNIB 3NGBB 1S7XA 4K8RH 4I13B 2VDLL 1NQBA 5LAXA 1MF2H 3ROOA 2PXYB 3F12B 4QKXB 4XHJD 4NQEE 5JNYA 1RK0B 2PYFA 1F02I 1MLCB 3I3EA 1RUPH 1QPXA 1I8MA 5T1LB 5ADOH 3FO0H 5A43C 5F9JB 3KYKL 1KB5B 2RFXA 4JRXE 3S98A 2FLBT 2CMRH 3PHOB 5DK0B 1KBGH 5FM4A 1QEWA 1NGXB 2R2EB 1CFNA 2WMPA 4WFHD 4YUEL 4MA3A 1AGFB 5AG9A 5JW4Q 4Y8DC 3T08A 3MRNA 5TFSL 4FQPA 3PHQA 1RUAH 2OZ4H 3HMXL 3BEWA 2XV6B 3VI4E 3EO9L 2EKSA 4PJCB 1U9KA 4J4PD 1AO7B 3RI5K 3MFFB 5LBSH 5LGHH 5LKNA 5C0CA 1ZVYA 4JRYD 5FDYA 4F9PC 1NGQL 2IBZY 5ACMA 4BSVB 4X5WB 1L0XA 4YHYB 1M7DA 4NUGH 2NTSP 1T21B 5FIEA 4X4ME 4ZNCD 2FECI 3ZKNC 4NNPL 4RCAA 1U3HB 4GAGH 4QRPD 4ZFFB 4LEOA 4MZ3A 5ID1B 4YWGL 1A6UL 3MR9B 4POUB 1AXTH 1IGJB 3V6OC 2Y06L 4L9DA 5GGTH 2EO1A 5I9QC 4OCWH 3K2UL 2JIXA 1MHPH 2A6IB 3KYMA 3O3BA 5HI4D 5DVLA 4QXUL 4GW1A 1BZ9B 3FRUA 1K6QL 5GRUH 5B8CB 1VFBA 4UV7L 2E6QA 2FCBA 4OGAD 1WCBB 4CMHB 2J8HA 4K94L 4NQCA 4S1SL 4OLUL 3JVGC 3V6ZA 2GTZA 2P5WE 3UX9B 4GRLA 4PY8I 4BFGA 3HMWL 3VXQB 1FAIL 3LY6A 1LDSA 4QY8A 5DUPH 4JPWL 1TTFA 3RTQC 1JGEB 3IDJA 4N68A 3QJHB 5FYJH 4B53A 3DTXA 4LNVA 5I15L 1IKFH 3RWCB 3EO0A 5BMFL 3KPPA 4HJ0D 2IQAB 5D7SH 2W9LA 1TZIA 3QO0A 3QNYA 2YPKB 3H9SD 4Y7MA 2H2SC 2R1WA 4YPGB 3V5KB 4JQIL 5EU7E 5SWZE 4S2SB 4CBPA 2VABA 3DJ9A 3DOSA 4RDQG 1BIIB 4G8FA 4MA8H 3LOWA 1ETZA 1BGXL 1QRKA 4NP4L 3VXRA 1BZQK 1N6UA 2FATH 5FO7B 3L3DA 1XEDA 1LILA 2BMKA 2HTKC 2ESVD 3QUXB 4GXVH 1LO2L 1T7YA 4F33A 1X5HA 5I1LB 3G6DL 4LHUG 3JZ7A 4O2FB 3T2QA 1QRND 5AYUL 1U91A 3B6SA 3M45A 3QIUD 3FT2B 1ZWIB 2HLAB 1LO3L 1V05A 4PJXB 4IS6B 2KZ1B 4FQLL 2NLJB 1S9VA 3QA3B 4PJ5D 3BIAX 4X9FA 2HFGH 4LHUD 1CK0L 1EGJL 3EYVB 5D72H 3VG0L 4TVPD 1KCSH 3DHJA 5GRJH 3K8LA 3DUSB 3RP1A 1H8OA 1W8OA 5TH2B 2V5MA 3ULUF 4QF1B 3L5WA 4X7TB 1IEAB 5KSBF 1V8HA 4FXKB 4YBLB 3LN4A 3GM8A 5SX5K 2EO9A 3TA3C 3BDXA 1S78C 3WFEL 4YHZL 3HG1E 2A73B 3ZSSA 3ELAT 3O2VH 3S8WA 1NBYA 2FLRT 3MJGX 5L2KA 1TPXC 3QEQD 1ZLSH 4XNUL 2DLTA 4MNQA 5DQJA 2VLKE 5DJXB 5DMJB 2Q86B 4P3DA 5ICYB 1PW3A 2I5YH 4U6TA 3HI6H 3P30H 2OK0L 4YHML 2E7MA 3BEVB 2PW1A 3KS0H 2AQ1A 4EUPB 3CZJA 1GZPB 1N4XL 5EIVA 5EULV 3TH4T 5D4QA 4OCMC 2OR9H 3GSUA 1R6VA 4H0GA 2GK0B 5KVMC 4YEEA 4DN4H 1A7BA 3CCHB 4FTVB 4MJ6A 2NXYB 4OV5B 4JY6B 1OP5K 4V1DD 1KIPB 3KYNB 5MEPA 3G08A 1XGQB 1F3JA 1ZA6A 3GMPB 1MRCL 2VLRE 1IAIM 1HEZB 1HSAB 2JKXA 2R4RH 5C09E 2CUMA 3TBWA 3LKNB 3DI3B 3NA4A 3HE6C 3X12B 1P2CB 1WWBX 1MCWM 5AWNH 4Z7UB 3E0GA 1J86A 3OTTA 3WIHA 3SOBL 3RPIB 2YHGA 4HPYH 3WFDL 1MRDH 3MA9L 1NMCC 4XI5C 5A1AA 5J11B 3IFOB 1FO0B 4CVXA 3TC9A 2E7HA 1UYWL 5IESL 4ELMF 3EYSH 5DHVB 1EMTL 4Q74A 3LQZB 4PD4J 1S3KH 3T0EC 3SKOB 4LDEB 5IVZB 2VLME 2EDLA 4MAYA 5C2BL 2ED7A 2D0FA 5D2LE 4OD3H 5BO1L 4PRIE 1JP5A 1JNHB 4NUJA 4Y16C 5LVEA 1IEBB 4YGVA 1Z5LA 5I1CL 4GKOA 1IQDB 4KFZC 4K9EL 1A64A 3GUTA 1IGFH 4U6VH 2YR3A 1LO4L 5F88B 4RGMB 2O5XL 3UTQB 1IT9H 4W4OC 4PB9H 2J2ZA 2C7UB 1EHAA 4KRMB 1JHLL 1JGLH 4PTTB 3STBA 2GTWA 3MACL 5K9OB 2CLVB 3UO1L 4G80B 3AREC 3QH3A 4UAOB 1QR1A 4N90E 1ACZA 1S7RA 3OKOA 5DRNB 12E8H 1E28B 2FX9H 3U36B 1W0YT 4U6XB 5JXAL 5E7BA 3IVKA 2ZOKB 3Q6FB 3OB8A 4KRPD 5F9AC 1DVFD 5D7JC 1YDPA 2R0WL 5DJCB 1NFIA 3BMWA 4AIZB 1BD2A 2AVGA 2APTA 3RQ3A 3FO1B 1OGTB 2XKUA 3C60D 2QV2A 3D85B 3DYPA 4PJIA 3D39B 4KKLD 1QLRB 4P59H 4K8RL 3AAZA 5FOBA 2DQTH 3RWJB 3EOYG 3RZCC 1E4KC 1MF2L 1CICC 1FG9C 3EOTH 1PQZB 4ZOAA 2ZPKH 1JGDB 1CE1H 4JDZB 1KB9K 1AD0B 3S4SA 2QADD 1RUPL 2AJVH 5ADOL 3VFOB 3K80A 4I77H 4AT6B 3FN9A 1B90A 1FNLA 3WLWD 2CMRL 1KBGL 4PGJA 4LARH 3BPNC 4PJ8D 4M62H 1SYSA 4DKFH 4U3HA 3GMRA 2AV7A 3C5JA 1RUAL 5GPRA 3V0VA 1SJXA 2OZ4L 2XNAA 3MUGB 3BISA 4KVCL 3UP1A 4L4TE 3SDAC 5F7MC 2WP3O 2WM0A 4HPOH 5LBSL 5LGHL 1NJ9A 1CD1B 3O6MH 3O41B 1ERNA 1S7SB 1P4LB 4MDJB 4D3CH 3L6FB 1MSPA 1F11A 3O3AA 4U0RB 4GMSH 2P42B 1UT9A 3LCYA 4JM2A 2B0SH 4NUGL 3SGDI 3C9NB 1GL4B 5FYLH 1HXYB 4GAGL 2VNCA 3RNKB 1AXTL 5F96H 5AAWA 3NFPB 2FO1A 4XB8A 2G75B 4L8DB 5GGTL 2NY4C 3G6JA 1QSFE 4JO2H