1UM5H

Catalytic antibody 21h3 with alcohol substrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
b'VQLQQSGPVLVKPGGSVKMSCKASEYTLTSYLFQWVKQKSGQGLEWIGYIYPYNGGTRYNEKFRGKATLTSDKSSNTAYLELSSLTSEDSAVYYCARSSMSDPGANWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 21H3 L chain
publication title Structural Studies of an Efficient Catalytic Antibody Operating by Ping-Pong and Induced Fit Mechanisms
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H02
5L8LB 1IM9A 1EERB 4PUBL 2B8OT 1OW0A 2D0HA 4AEHH 2BVQB 3V52L 2MCG1 3Q5TA 4I8DA 2PXYC 1E4WH 3VXME 2YOCA 4X99B 1J1XH 3CAFA 3N0PB 1QG3A 5D8JH 2B2XH 3DLQR 2QQNL 4X6EA 4OZHB 3CD4A 4S0TD 4HKJA 4UDUB 1MHCA 3GJEA 2EDEA 3OKKB 5KN5B 1MNUL 4KJPC 5DTFB 3CX5J 4KDTC 2ITCB 3JUZA 4OFYA 3HAEB 3OAZH 3LIZL 1QSFE 4UV4H 5DK2B 2R1WB 4WWID 4OAWA 4PJEF 1S7TA 2PW2B 2K1MA 4N9GB 4WO4D 3QO1B 1CXIA 1ED3A 3IXTA 4XMPH 5LQBL 1A6WL 1G9NH 3SKMB 3MRQA 2D7TH 1ITBB 4RGND 4OLVH 2B4CL 4KJWD 5IR1B 4Y8AA 4TSCL 4MSWB 2A6JA 3GHEH 5BRZD 1AD9A 4M9PA 3IGAB 3MOQA 4JRYA 1OLLA 1UA6L 5D7KE 1S7UA 5C09A 1EUUA 2NY3C 3E6HB 3AS0A 4TULL 4S1DD 4RAHA 5D7IA 4ZSOE 4LRIA 3AVEA 1WFUA 5CJXC 3T0XA 5T5NG 2BVQA 1ACYH 4UAOC 2HKHH 2BY0A 3EJJX 4U3CA 5J57B 4N8VA 4X99A 5ERWB 3RIAF 4RFEB 3FO2A 5DDHB 5L2KD 4DJMA 4LLVB 1F3DJ 3QG6A 3DTXB 5HVHC 1HKLL 1OP5H 4OZHA 1NGPH 4Z7UB 1V3JA 4UDUA 2VN4A 3OKKA 5F7LB 5HDQL 5KN5A 5EC1B 3SDYH 1AO7B 3S37L 5KOVC 4PJIB 3GSUB 5SX4I 3KPQA 2H26A 1H0DB 1LQSR 4LCWE 4BSVA 2FX7H 4R8WH 4N9GA 9CGTA 3MV01 4UIKH 4Y2DC 2V2WB 3QO1A 1Q72L 5CD5D 1RU9L 4P2QA 2Q3ZA 2VDPL 1I7RB 4OFIA 4M6NL 5CEZE 5IR1A 3VW3H 1F2QA 2BSTB 5I76A 4L3EE 4MSWA 1FJ1B 4HG4K 5F7DB 3J8F7 5J7CC 2BZDA 3TF7C 4XAWL 3G6JF 5I71B 5DJDB 2QADB 2XZAL 1ZTXH 4MXWH 2HTKC 5DD1H 2Y1VA 4Y19A 4GKNB 2E6JA 4OZGE 1IC5L 4XBPA 2ZJSH 2DDQL 3VI3E 4NKIH 5F93C 4OGAC 5ERWA 1EFXA 4RFEA 4U31A 4LSUL 4PJBB 4LLVA 2HWZH 2V7HB 4NFCA 3KS0H 2V9RA 1I1AD 3K8MA 1BFVH 5E56A 4HLJA 3F6LA 5EC1A 1AO7A 1FZKA 2ZCLL 3QA3A 5EB9A 3RGHA 5ALCH 3GB7A 3HC4H 1T03H 5FYKL 3SY0A 1JGUL 5B8CC 2V2WA 3SGEI 2AVGA 1S9VA 1I7RA 1TDQA 3QDJB 4Q9QL 1CXHA 4XCFH 5DRXB 1BJ8A 3CLFH 1TNMA 4OF8A 5F7DA 3TIDB 5ISZE 4MA8H 1OM3H 4D94A 2X70B 4C4KT 5FEBA 2DD8L 5JW4N 4D9RD 5I30L 2KQNA 1KCVL 4XPFH 5DJDA 4F9PC 1P5VA 3PWLB 1OAQL 5DJ0B 3DX8B 4GKNA 4N8CL 4MAYD 3WJLC 1KGCE 1N6VA 2DKMA 5E94B 2YXMA 2Z8WC 5ILTL 3VXTB 4CW1B 2X4PA 3NCYS 2H2SD 3C08L 3MLUH 4HJ0C 1XH3B 5I66B 5CMAB 2V7HA 2JJTC 3PGDB 1IC7H 4U6YB 4X9HA 4XHQA 4YXLL 2B20A 1NCNA 4FFVD 5C08D 1BFOB 4DCQB 4XB7A 5EU6B 4AJ0A 1MCRA 2P49B 3MREA 3VXRD 4A2MA 3FN0L 2EDNA 3HS0B 3WXVH 1HDMB 3ILPB 3CDGB 3DVGB 1NGQH 3TPKA 5L7XH 5DMIH 3QIUD 4GRMB 4UAOB 3D87B 2B0SH 5CP3A 3QDJA 5DRXA 3MJGX 3TBVB 3IRZA 1N4XH 1FAKT 1NMCC 2D7MA 3V6FB 3DUSA 3EFDL 4KXZI 4PJ5E 4PJXB 4HUXB 4KDTA 4GUPB 4X98A 5JTWA 4NHCL 3SCMD 3PWLA 4PJAE 4LLYB 4ONFH 5HDBE 4XVSL 4YQXH 4R4NC 5DJ0A 2VITB 3WKNA 1CFVL 4OV5B 4Y7MA 2W9LA 2Z8RA 5E94A 1KF9B 1CL7L 1E0OB 2AJSL 2X9XA 1MRFL 4JZOB 3LAFA 4NZJA 2CIKB 4KK6C 1ZLSL 3VXTA 4CW1A 4Z7QE 3QXWA 3GI9H 3SDCB 5CMAA 1MY7A 2JJVA 1A3QA 3PGDA 4HJGB 3QIBC 1ADQA 1BFOA 4B5EA 1FH5L 3LY6A 5EBGA 3O2VL 3QHFH 1IGYB 3OJDB 3VGFA 4FXLA 5FOJA 1EEYB 4J3WA 5I17B 1HDMA 4S1QH 4Q9RL 3ILPA 3CDGA 3DVGA 4FQJH 2ICES 4KMQA 5CJXA 5JA8B 1NJ9B 4OI9A 4U49A 1OTUC 1ZANH 2ENSA 4YZFE 3LRGA 3S3JA 4GG8B 3EOBB 3D85D 2XKSA 4L4TE 1F11B 2ADGB 3V6FA 3T65B 4FQ1L 3RX8A 1LE5B 4HUXA 3BO8B 4K71B 3FFCE 1WT5C 5C6TL 1KXVC 4LLYA 3TT1H 1IEAB 2DYPD 1MAKA 1WUNT 5EIQA 1FZOA 1WK0A 4OV5A 3C5ZB 2RJMA 5KAQF 3SOBH 2AV1B 2J8UA 4JZOA 4Y2DA 3LS4L 3JWOL 5B8CB 2VJXA 1ODAA 1NC4B 1NGWB 2X6MA 1IQWH 3SDCA 4Z7WF 4R9HA 3Q1SL 4HJGA 1XCQA 3RGVD 5IGXH 2R4RH 3L9RA 4JFEB 2FD6H 4M7JH 1IGYA 3VDAA 2A9MH 3WYRA 4LK4A 5IB3B 1EHLH 2FCBA 4O5LH 1EEYA 4U1NA 5I17A 2HTLC 2X40A 1JZ3A 3TYGH 4P9HL 4JHAL 1BVZA 3H9SD 3S88L 3K0WA 4L8DB 1NJ9A 4NQEB 1WBYB 5IW6B 4HS6B 1JMXA 3KPSE 1L0XA 4MNGB 3H3BC 3MUHL 1MIEH 3QPQC 4M48L 1F11A 3CFCH 1FHGA 4NQSB 5F7KC 3FQTA 3T65A 1BF8A 1R3IH 1SVZA 4XC1H 5CGTA 4JQIL 3OKYA 5GRXG 1C08B 1ONQB 3WHXB 5FUCC 4PJDE 1UCBH 2EYTA 5A43C 4YWGH 2YHGA 2V7NB 3MJ9H 5FKPB 5I74C 2AJVL 4JFQB 1U93B 4K9EH 3VXOB 4FG6D 5B8CA 1WWWX 3QEUB 2BNRA 1NC4A 1NGWA 1MHPH 3FQXB 4TUKL 5IW3A 1U8KB 3DVIA 4OGZA 1YN7B 5DC0A 5FK9A 3ARSA 1P84K 1I9JH 4WEBH 5T3XH 4JPIB 4JFEA 1NMCB 1VADA 1YMHB 3VFWB 3WHE0 2FBJL 2WUCL 1F3DH 3UTSD 1CU4H 3A6BL 3TYFB 4F9PA 3TBWA 1A7QL 1YNLL 1X4XA 3QEQE 5FF6B 3WJLA 2C4FU 1NUFA 3N85H 3I6LD 1WBYA 1JWSA 4MNGA 4ISVB 2JJTA 2DM7A 2QTEA 3QIBB 4IIQC 4NQSA 5JOPD 4YDVB 4EDWH 2AP2A 3FT3B 4P4RA 4LASH 2QHRH 2P5WE 5E2JA 4G6ML 4PY8I 1VGKB 3VFTB 2HT2C 3N1QC 3Q3GB 3G04B 1DJSA 4IBLT 2V7NA 3VRIB 4YHIA 5CLWA 1KPUB 2XTJB 5HI5D 1BBDL 2DLFH 4TNVF 1DSFH 2I60H 4CJ0A 4JFQA 5LQBH 3VXOA 3F12B 3RUGF 3QEUA 5DHVH 2DQEL 4K55A 1U8KA 3QUKB 2CDFB 1YN7A 3SE9L 2J8HA 1UA6H 1TLKA 4JPIA 4NP4L 3L3GA 3HMWL 2HYMA 3VFWA 3WV0A 1JPST 3DURB 3IKCB 1FL3B 3TYFA 4YPGB 35C8H 5FF6A 5F3BB 3DXAD 4U1MB 1X6LA 1HZHL 4X83A 1BM3H 1DVFB 1NCBH 1S7XB 1H8OA 3LQMA 5EBMB 5EOTA 1XF3B 1DQLH 1HKLH 1H9VA 3MRPA 3QIBA 5HDQH 4R4FL 2P5EB 1I75A 5I75B 1TITA 1A2YA 2WLYA 4G43A 4G8FB 3CU1A 4K07A 3V4PH 3MLSH 5GHWH 1MFCH 3VFTA 3Q3GA 3MOBL 3G04A 3FJTA 4NN5C 4MNQE 2OJEB 2IH1B 4ZFFB 5IVZB 3VRIA 3L95A 4JHBA 4HS3B 1K8IA 1T83A 1GGIH 2QQKL 2AEWA 4NKQB 3ULSB 3MRRA 4D9LL 4F7TB 2OL3A 1D9KC 3WN5B 5LGKA 2ZNXA 3QUKA 2VZOA 2CDFA 3VXMD 5FGCB 3MCLH 3S5LA 1JVKA 3TCXA 1A6PA 3UAJC 2ZUWA 4Z5RB 3L7FB 5FHBL 3LKRB 3VI4F 4YBQC 4W6YB 2D7PA 5KW9L 3DURA 1FL3A 4RA0C 4X7TB 4IRJC 3ZE1E 4YPGA 3WUZA 2X4SB 2PYEE 1ZHLB 4JDVB 5F3BA 3CCHB 2BSSB 1IC5H 1MJUL 4U1MA 5E6IC 4YHML 2QEJA 3HNVH 1DVFA 1S7XA 2OQJA 3MJ8B 1MRDL 1QZ1A 4Y4HC 5EBMA 2V5MA 4HT1L 3VCLB 3HAEH 4TVPE 5CIPB 3NBNA 4I2XE 1CK0L 1ZWIB 3ULUL 3U0PB 3FN9A 5F9JB 1V7ML 3N9GL 5EWIL 4ETYA 3VWJB 4G8FA 4WY7H 5D7KD 1N7ML 3MRDA 4N68A 3OR7A 2HKFL 3PP3K 2I24N 2OJEA 2IH1A 4ZFFA 1H3TA 5FHAL 3PGFH 5IVZA 4U0RC 3UROR 4C83B 1ZHNA 3ULSA 4OLUL 2AI0H 2N7BA 3IRPX 2F8XC 1KEML 3BEWA 1J8HE 2X42A 3ALXA 5D6CB 1HYSC 4Z5RA 4IIQB 3L7FA 1ZLWH 4XP6H 1NBZA 4DN4L 5C0BB 3WFDL 4X7TA 4PYHA 3TT3H 1QQDB 3BESR 1MI5D 1FSKB 1XCTA 4JDVA 4OJFH 2BSSA 1OTSC 2IFFH 4LCWD 1Z9SA 4JHWL 3SKOA 3MJ8A 2ZNWA 4MZ3A 3HC0B 4W6WB 4RGOL 3MRCB 4YXLH 2EH7L 1JNHA 1NEZA 1H3UA 3EAKA 1E4KA 1I3GH 2AXGB 1P4LB 1ZWIA 3R06B 4IRSC 4TTDD 3CFKA 5F9JA 4L3ED 3GBLA 4LSVL 2SEBA 2WBJB 3C6LB 4F15B 2GITB 3UMTA 4UQ2B 3RKDD 1MVFA 4LBEA 1QUNA 1A0QL 4RGMB 1MCIA 4EJ1C 1DEEB 3ULVE 4C83A 2VDQL 4K8RC 4S1SL 2CXKA 4C4KO 4NWTH 1RIVL 1P4BH 4QOKB 1CLOL 1AXIB 2V2XB 1IGTB 3VRLE 4CGTA 3MLTB 5I1GH 5D6CA 4XNQA 4ZFOL 4IIQA 1KN2L 2R69H 1D5MA 1FGVL 4KDVA 1CXEA 5C0BA 5BV7B 1BGXL 3EYUL 4JO4H 2BHYA 3DO7B 1CFVH 1UACL 1QQDA 3FONB 1TQBB 2GTZB 2D0GA 3WFBH 3CGTA 5TQ0H 1WEJH 4NO2B 2FECI 1CDGA 3GIZL 3QUMB 2R8SL 4GAJL 1FNGB 3X13B 3HC0A 1NUDA 4LMQE 4NKOB 5I0DA 4BUGA 1EEUA 5HGDB 4NO0D 3BUYB 3GJFK 4OKVB 4I18C 4HC1L 2YD5A 3TO2A 3GBNH 1P4LA 4QXWA 3QRGL 4UTBL 2A0LC 5ISZD 2FB4H 2WBJA 3C6LA 2GITA 4UQ2A 1G1CA 2PNDA 2D7NA 2F54B 1JV5A 2D0FA 5CP3H 3U0WH 5KTEH 3OV6A 4GMSL 1KGCD 2UV3A 3WNNA 3S8WA 1MJJA 1UH2A 2DQHL 2V2XA 1NLDL 4Y4HB 1IGTA 2EDQA 3T3PE 3MLTA 1EEZB 1P1ZB 2IBZX 4CKVX 5EUOF 4M43H 5F9DC 1CXKA 1KJMA 5JMOC 4Y4KB 4GQPH 2GJ6D 2WUBH 2AW2A 4NUGH 4NO3B 5IMMB 1U0QA 3WS6A 3FONA 4G80B 2GTZA 3WMSA 1X3DA 4R90L 2O5YL 3LS4H 3EYSL 4U0RB 3LKPB 4OZIE 1ADQH 1PG7W 1FNGA 1LD9B 3X13A 5EZJA 4NKOA 4LIQL 3OGOE 3O9WD 1D9KA 3BUYA 1AE6H 4OKVA 3F7PC 2PO6C 1OAUH 1YN6B 5D7LE 3LHPL 5DO2D 1LWRA 5KANI 5CSGA 1PG7X 1RI8A 4PJEB 3D39D 4PJ5D 4LOUC 3WUWB 1JFQL 3T0AA 4KKNA 4QT5A 4HUNB 2PYFB 2DRUA 1MEXL 3IVKB 4TSAL 2CKBL 2DIAA 1QR1B 1CQYA 1MCEA 3B9DA 4Y4HA 1LO2L 3DUUB 1EEZA 1P1ZA 3S98A 4AQOA 4PYGA 3FL7A 2NXZC 1K2DB 1MQKL 3O4LE 4Y4KA 4GG6A 2J88L 3D2UB 4IRSB 4JY5H 5JPNB 1T66C 1L7IL 3QI9B 4NO3A 1OB1A 5IMMA 3QUML 5IHBA 4I0PC 4F57H 2VMFA 4U3HA 3MV8A 3V0WH 1M05B 3C09C 1J0KA 3LKPA 3PP4H 1E4XL 3FOLB 3QZWG 5HDOA 3TJHD 2FHBA 2XZQL 3QDME 4GLRI 1K6QL 1A6ZB 5E00A 1NKOA 3RI5K 3PJSA 3RJDA 3TO4D 4XNZC 4L4TD 5D7JD 4O58H 4PRIB 4ZD3H 4PJEA 3MBEB 5KJRL 4RAUB 3B3IB 2UWEE 3FFCD 1A5FH 4OGXH 3WSQL 4KI5D 2B1AH 4KROB 1KN4H 4KVCH 3IVKA 3AAZB 4F8QA 4LHQB 3TNMA 1QR1A 1YEJL 4MYWB 4DUXA 1SQ2N 5DUPL 1YJDL 3DUUA 4GW5A 2OMBA 1G7QB 3VXPA 5C6PB 4I48B 2G60H 4KTEH 1K2DA 4PB0L 3G6JB 2Q20A 3D2UA 4JN1H 4IRSA 4ZNCD 5JPNA 3WFEH 1DBKL 3QI9A 1T0PB 5JO5A 2XN9D 3U2SB 2X1QA 4NN7C 1F42A 3ARYA 4HIHA 1JZ8A 2Q7YB 3DVFA 1SBSH 2VH5H 3VXSE 1M05A 3ARED 4EN3B 3WLWD 3QHZL 3FOLA 4YFLI 3LV3B 5C0RL 3JTTA 5F44A 4X9FA 5GGQH 3VGAB 4R0LB 4J1UA 1F4XH 1A6ZA 2Q8BL 15C8H 3KPPB 3O3BB 4OQTL 1EPFA 4ZPTB 3MSPA 2XV6B 2ZUSA 4JLRB 4WUUB 4PRIA 5BJTB 3GBML 1WIPA 2CO7B 1LEIB 3D0VA 4RAUA 5K59E 2NY6B 2R0LL 4LVNC 4ONGH 4PG9B 4S1RH 2B4CC 1Q0YH 2EDFA 4TOYL 3W0WD 5D5MA 1M7DA 3QDAA 1QRNA 4Q74A 2K3TA 1QBBA 2XKNA 2WIIB 5LVEA 1G7QA 1T3FB 3JUYA 4I48A 4I18A 4ODSL 4R4FH 2Q6WB 4KUCF 2A9NH 3S7GA 4B7IA 2F53E 1RK1B 1J10A 2ICCA 5DK0B 5HGBB 2DJSA 3UTPE 1UADC 2IC2A 3GMRB 4G8GE 3U2SA 1WFOA 3T0WA 2ADFL 1FNAA 2Q7YA 1GRWA 4NQCD 1CN4A 4LU5L 3QEQD 3TNNB 1S7SB 1OQXA 3LV3A 5DD6B 3W9DA 1B6DA 1J86A 5GS3A 2ZWLT 3MV9E 3BKYL 1VFUA 4MD4B 3TWCH 5GZOD 5INDB 1YC8A 2JIXD 3ROLB 5IOPB 4GSDL 4LP5A 4ZPTA 1O7SA 4JLRA 2R2BA 1YMMB 4GJTB 1QP1A 4R96B 3HE6B 1LEIA 3G5VB 4I0PB 1MJUH 2EIBA 4JAMA 1U42A 3ZYZA 4LPCA 4PG9A 5FA3B 3O0RL 4M6ML 1RZIB 2DBJA 5DJ8B 5KSBA 1N0LA 3NA9H 5AYQA 2WIIA 1T3FA 3UJTH 5IVNA 1FZJB 2R0ZL 1I8LC 2PO6A 3SQBA 1RK1A 5FFLA 3LS5L 5HGBA 2A6IB 1N5YL 2NY1D 5DYOA 3ZKXC 4JANA 3GMRA 2J5LB 1QFWM 4M1DL 5C07A 1XMWA 4BM7A 2OL3H 3BZFB 3TJEH 5GGVY 5JDSB 4DZ8B 2ZG3A 5LAXA 5CD3B 5HD8D 3ESUF 1S7SA 5E5MB 5IVXF 4OCNC 1CD8A 3CLEL 4LARL 4M7LL 5DD6A 5CFHA 1KCUL 5ESQB 3QR2A 2X4NA 4YAQB 3ZKQD 5CZKA 5INDA 5GJTH 1IAII 3T2OA 1CLZL 3P9MB 1KEGH 5MERB 5IOPA 4X7DC 2H45A 3BFOA 1YMMA 3NAAL 4R96A 1WF5A 3G5VA 2YXFA 4I0PA 2FZ3A 1VFBB 4MNQD 1R3LB 2C1PB 1FN4A 4J4PC 4JKPH 5FA3A 2XA8L 1RZIA 5GS0C 5DJ8A 3P30L 1AKJB 2X4QB 2CDGB 5L88L 3UBXI 4JPKL 5ACMA 3HKFA 3GSOB 5L9DL 1J12A 5HYSG 2XNAA 3RHWF 3F7VB 2EZ0D 3T04D 4LSVH 5ENWA 1LE9B 2DQFB 3DGCR 2A6IA 3IDYC 1OAKL 1IAIM 5E2VL 1CFBA 1SY6L 3N1GC 3W81A 4FQHA 3BZFA 3QUZC 2R2CA 5JDSA 4DZ8A 1DTUA 2VDQH 4OZFA 1OP5K 5C0JB 5CD3A 1RZJL 2NY7L 5E5MA 4Z7WB 4HIEB 4YXKH 5T33L 4N0CC 3NTCL 5CZXD 4YAQA 1YA5A 4LVHB 1KN2H 4Z7VF 1EZVX 5L0QC 5HJ3B 1FGVH 5AZ2H 4G9FE 3CFEB 2XICA 4YC2C 1UACH 3AU1A 3H2WA 4JG0H 3ARFC 4NRZB 1YYML 3AB0C 3FQNB 4C57C 4HBQA 1VFBA 3BGAA 1R3LA 3GIZH 3O4OC 4U7SA 4XWGH 2E7LA 1WAAF 2C1PA 3P0YH 4KRPD 4QRRE 3THML 2YZ8A 4JFDB 1RURL 1D6EA 4WCYH 5FB8B 1AKJA 2X4QA 2CDGA 2CO6B 2P44B 2A73B 3ARBB 3GSOA 4LLUB 3BPNC 4NBXB 3OR6B 4Y16C 4F9LC 3VMPA 3QRGH 5F1KC 3F7VA 3CNKA 3V8CA 2FR4A 5H2BB 3DSNA 2DQFA 2YPVH 1ZGLP 1AFVH 3NIDF 3D3VB 5DFTA 3GMMB 5ESAB 5SWSB 1W72B 4HPYH 4XBEH 1N26A 1GOGA 1D6VL 5C0JA 3V4VH 4QTIH 5T5FH 1UZ6F 2EC9T 1OD7A 1WQVT 4L5FL 4FQXD 3TV3H 1SJXA 4HIEA 1MFDL 1V3KA 1I7ZA 1V05A 3ES6A 5ECJE 5C09E 1UH4A 4UT9L 1CGSH 3O6FB 1GGTA 1ZEAL 4GBXD 5HJ3A 4J3OC 4PJGF 3OB0H 1N64L 2VLME 4KKAC 3RKPA 3ZKXB 3DARA 4R90H 1PKQB 1FDLH 2Z31C 2XRAH 1S7QB 4OTXL 4RMSA 5GGSY 2V6HA 2OP4H 4HMDA 5T3ZL 3ULVD 1Y6KR 3HNTL 5FB8A 4OZHE 5JQHC 1P7HL 2VL5B 2A73A 3ARBA 3KPRA 1F6AB 1IILE 3OR6A 5LKNA 1K5NB 4WJ5B 4YHZL 4FQCH 5FUZH 1HCVA 4P2OC 3P40A 5H2BA 1I3VA 3D3VA 3L3IB 4OCRH 3RZCB 3GMMA 4P5KB 5ESAA 1W72A 1X5FA 2NR6D 1N0XH 1WZKA 3BHBB 1LK3L 4ZUVB 4EUPG 3JWOC 3STZA 2CJUL 4O4YL 5E2TH 3HR6A 3RUGB 1JI2A 4KKBC 3LCYA 3CVHB 3C5SB 2XQBH 4POZD 1IM3B 1AQDB 4LNVA 3I6KB 4UOW0 5IQ9A 3GSQB 4GXVL 1VCAA 5BV7H 2FATH 4UQ3B 5IM7B 4AIOA 4LSTH 4HHAB 3GIVB 3SDDC 1I8LA 5EU3B 3U9PL 3L7EB 4K3EL 4YBLC 3PQYD 3X3GL 3QUMH 4TYUA 4P9HC 4XVTL 3P77B 1PKQA 1FFOB 1F4WL 2JB5H 3QUZB 3TFKD 3S97C 1MIML 4NFBA 3R0NA 1T0NA 1WVZA 4Z7UE 1CVSC 4YHOL 4ZUSB 4PGDB 1FG2B 1K5NA 5DXWA 2JTDA 1A6TB 4PJIE 3HR5B 5KVMC 1VA9A 4YHPB 1MHHB 2R39A 5L0QB 3L3IA 7CGTA 3RZCA 3VXUB 1MCBA 4P5KA 4KFZC 4YC2B 4ZUVA 4HQQH 1X5IA 1OVZA 5IWLC 5FA4B 3ZDXF 3JVGC 3O4OB 3CVHA 3C5SA 1ULVA 4YXHH 1IM3A 2Z35B 1AQDA 1NL0H 3GSQA 4OI8A 4OF0A 4G3YL 4K94C 4M3JA 5C9KA 4UQ3A 5IM7A 3SQOL 4HHAA 2DBLH 4U1SB 5EU3A 2YRLA 3L3OB 1INEL 5D7LD 3O6KH 5C0AD 3B4NA 3PL6C 3RIFK 3CXHJ 1FAIH 4P59L 3P77A 1FFOA 3KR3H 3QUZA 5C86A 1DBBL 5B3JE 4PJBE 4OBSA 4HCRA 3UTTB 1Q1JL 4LNRB 1KNOB 1QOKA 2CLVB 4ZS6C 4C59B 4ZUSA 2CLZA 1FG2A 2G5RA 3SGJC 5C1MB 5JR1L 4ODHH 1UWGL 3HAEG 1ZT7B 5FDWB 3HR5A 3IFNL 1QKZL 2ZUYA 4NKMB 4YHPA 3MROA 4TSBL 1NCCL 4OLXH 3BEVA 1K3ZA 2HLAB 3DVNB 1KENH 1OCWH 3ARFA 3GMOB 4UILH 1DFBH 3B5TA 1NCWL 5CS7A 4OD2B 5ID0A 4LSQL 4XPBH 2Z35A 4XXDB 3DECA 1XGPA 1F58L 1TZIA 4MJ5B 3GI8L 1JI1A 1KIRB 2WNGA 4M4RA 4XP5L 1KLFA 1TVHB 4JCLA 4F9LA 4CMMA 1BZQK 3O3DA 1LVEA 2OR7A 4U1SA 4BQ9A 3CX5K 4P2OB 5EU7E 4H1LB 1EJ6A 4DKFH 1UXSB 5JIKA 3LEXA 4TUOB 1S7WB 3DV6B 4UUJB 3VFMB 1B2WL 3FB7A 2XQYK 2IFGA 1XGUA 3EO1A 3UTTA 5IKCB 2H9GB 3BKYH 3HLAB 5KSAD 1S3KL 4LNRA 2YD4A 2CLVA 5SWQA 1KFAL 3BE1H 1A9BB 2Y06L 5EU6E 5D6DC 4HIIB 1MFEH 1CLYL 1ZT7A 5DK3A 5FDWA 4RRPG 1T2QH 4NKMA 5I0ZA 1MFBL 1T6VN 1OARH 3VD5A 4WI2A 4DQOH 1JNLL 2VXUL 1EV2E 3P73A 4WWKB 3B2VH 3LPFA 4YBLB 5GGVL 3HB3D 3DVNA 3GMOA 1TETH 3UC0H 3D0LB 5JQ6L 4K3GA 4DGYH 4UBDC 2VISA 2D7QA 3NIGE 4OD2A 5IK3A 3VXSD 1N6QH 3INUH 1JRHL 4XXDA 4OUUA 2DMKA 1CGYA 2N56A 4MJ5A 2FNBA 1KIRA 5ELIA 5ADPH 3MUZ1 4JO3L 4PJXE 4J23A 2XG4A 2W1NA 5E9DA 1M6OA 5DI8B 4P2OA 4H1LA 3BP4B 1ZGLB 3E3QE 1IGIL 1DLFL 1NFDA 3QUYD 1UXSA 1QYGL 2O26U 3S35X 4MVBD 3MYJB 4TUOA 4PB9L 3ZSTA 1S7WA 3DV6A 4UUJA 5HVGB 1JP5A 2YSSB 4XT1C 3TBYB 2QKIB 2VQUA 2DJ4A 3JV6A 1UJ3C 4HX1B 1H3XA 2JCCF 5IKCA 4ESKA 1KCUH 2EXYD 1JIBA 1HXYB 2H9GA 3HLAA 1YEKH 1KXTB 5I8EA 4R7DB 4L8BB 1A9BA 1T1WA 5D9SB 1MRCH 4HIIA 1I9RL 3NGBC 4IOIB 4I77H 3SDDA 1JF5A 3VWKC 5LWYL 2VZTA 5DR5H 2VYRE 4G7VH 5IT2H 1OPGH 1S8DB 4WWKA 1A3LL 1UJTA 4EQ2A 3A0OA 3PL6B 3ARGD 3HUJA 4PRPB 3D0LA 4G8GD 4AG4H 1ZHKB 2R4SH 5GJSL 4XPHH 3SE8H 1UVQA 3FCTA 4S2SB 5L88H 1BQUA 1R3JB 4C56A 2KL6A 5EUOB 1DQJB 4ALAL 3B8SA 2NYYD 3MV9D 2FLRT 1XGRB 5DI8A 1ZGLA 3BP4A 5E2VH 2DQTL 5EULV 3V6OE 4YFLF 5EIVA 3MRMB 3RI5F 3MYJA 1D5ZB 3F6IA 1BZ7A 3ARDC 5LGHL 2YSSA 2NY7H 3TBYA 3BN9D 3JVGA 2QKIA 3QJHB 1HIMH 1S9YB 4GAYB 4PRAB 1HXYA 1WBZB 5IESH 5KS9F 1CDUA 4AH2B 5HGAB 3L3KB 4R7DA 4JFEE 1U8LB 1AGCB 2EYRB 3MLVL 2IAMC 4IOIA 2Y23A 1JF1B 2VDKL 5DD0L 1HWGB 2NY2D 2XZZA 1S8DA 3OTTA 5GRJH 1XT5A 3PL6A 1PDKA 5IW1A 3RWCB 4JB9H 4FFWD 4PRPA 4NQEE 4FZEL 4NGHH 3OQ3B 1ZHKA 4P4KB 4MNGE 5BO1H 1U3HB 4XMLL 1WCBB 4S2SA 2P24A 1R3JA 4LCUB 1DQJA 1I8IB 2F5BH 5LBSH 1I3UA 3QWRA 1Z6JT 3W5MA 1FVEB 3SGJA 1XGRA 5K9OA 4LRNL 1RZKL 4IOFC 3DJ9A 3DRQB 4OZFH 5DSCB 2BNUB 5D4QA 4M03A 3MRMA 4M7KH 1D5ZA 2VLRD 3EGSB 3FZUD 4R4BB 1IEBB 4Y4FD 5BXFB 3QJHA 5E8DL 5JORB 4IDJL 4GAYA 1DBML 4HUWB 3LQZA 4PRAA 4ORGB 2R56H 5DC9B 2NMSA 1WBZA 2JELL 5HGAA 2BNQB 1DP0A 3L3KA 4NCC2 3TA3C 1AGCA 2EYRA 4CBPA 4WW1A 1TCRB 1G6RB 4P99A 3BX7C 1JF1A 3WLBA 2FJGB 4MMZC 1AR2A 3D9AL 3RL2B 2IQAA 4JG1H 3RWCA 4BFBD 3BKMH 1LDPH 2AEQL 3N50A 4P2RB 1MFAL 4JKMA 4XTRD 3QIWC 5FYJU 1U3HA 1WCBA 4JFOB 2H1PL 3O6MH 5I1KH 1ZLWK 4LCUA 1URLA 1I8IA 2GFBB 3FHAA 2J1KA 4MA3A 1OT1A 4O2FB 4GQ9H 3HRZA 2AQ3A 4LLDB 4X6DA 5D6DA 3V6ZA 2P8PB 3EHBC 1YY8B 3PWVA 3DRQA 5DSCA 3BKJH 1G7HB 3HE7D 4JKWA 4Z8FL 5E99H 3OMZA 4G9FD 2XTJE 5C7XL 2DM4A 5F9AC 1CDIA 5C0EA 1IM9D 1IFHL 1UM5L 2YBRA 4PRBB 1IEBA 4R4BA 5ESVA 1MJ8H 5CKGA 1MJ7L 2B5IC 2VXTH 5BXFA 5ITBH 4BFIB 5JORA 1NANH 4HUWA 25C8L 4QTHA 4CU8A 4QRRD 4FZ8L 2BNQA 3MGOA 1O7VA 1U91A 3EOYG 1G6RA 1IQDA 1OOAA 1G0XA 5HI4C 2YWZA 3RA7H 1G0YR 4OFYD 2P46B 2W9EL 2Y36L 3RL2A 2VERN 5DFVC 4UNVA 4DUWA 1WITA 3L3JA 1A7RH 1Z3GL 4XPGL 3T2NH 3UPRB 4JFOA 4ODBD 2FX8L 5DVNA 5J8OA 3ARVA 5GRZA 3CMOH 5IHUL 2P5EE 4O2FA 3KXFA 4LDOB 1W72H 4RFNB 4Z95L 4LLDA 2P8PA 1YY8A 3U7WL 5C09D 3LD8B 4QRTB 2NX5A 5HI3C 3BIAX 3VWKA 1T1YB 2VLMD 4GRLC 1V5JA 5EPMB 3WKML 3HG1E 4AL8L 2QR0B 4K7FA 5IF0B 2G2RA 4G9DA 4PRBA 1ZHBB 4I3RL 4LLAA 3F8UB 4N0UB 3H42H 2VOTA 4KUZH 2VDNL 3VFUB 2CMRL 1KBGH 4RQQB 5DUML 2BOCB 1GHFL 2A1WH 2DI8A 4P3DA 5LCVH 4MDJB 4P59H 1OGAB 5DRWB 1NSNL 4NKDB 3KLHD 4HG4J 2BFVH 4JZJC 1C5CH 1GCFA 1AHWB 1FYTB 1YJDC 4OUOA 4P3WA 4P2QD 4OIBA 1GAFL 3EYOB 4M6OH 3ARPA 2FBOJ 1QSZA 3ILQC 2JJUA 3G5YB 3HZYB 3O3AA 4GKZB 1AGBB 1P4IL 2ESVB 4P23C 4UZGA 4QRTA 1JWUB 1D5IH 1MF2L 2EIDA 4U2YA 3CVHH 1A4JB 4YHYB 3MUGA 3T8XB 1T22B 5EPMA 5JW3H 5GS0H 4Y19D 4W68A 1ZHBA 2YD6A 5IVXB 5K93A 1T21B 5DVLA 1EXUB 1P9MA 4JFZL 4N0UA 2OXHA 3QIWB 2CPCA 2ZSVB 2Q87A 3M07A 1ERNA 1QBAA 1I1FA 3RX5A 3C5JB 4CNIB 2BXYA 4LQ1A 1DE4B 1T6WA 4RQQA 5FV2A 2CUMA 3QFJB 1CFNB 3WFHB 1AO7D 4D3CL 4Y5VB 4MA1C 4MDJA 3WO3B 1OGAA 3IU4L 4HCRH 4XPAL 3ZKND 4NKDA 1XF5B 3LN5B 4N5UA 2CK0H 3GRWA 5HYIA 1FYTA 1OL0A 4PS4H 1YQ2A 4QRQB 5TE4L 5IB4A 2YD8A 4N8PA 3EYOA 3E1F1 3PABB 4LIQE 2WBWB 2Y4SA 2B7DT 4NQUA 3MLRL 2DKUA 3TA3A 3G5YA 3HZYA 2AJUL 1EMTH 4QEGA 1AGBA 1S78D 1JNLH 1U8HB 1A4JA 2QADD 1VPOH 3MRNA 3T8XA 5JQ6H 4UINH 2OR9L 3TVMC 2UZXB 1T21A 4QOKE 1EXUA 3OJ2C 1JRHH 1NCAH 5IFJB 3OBAA 3QIWA 1BQLH 2ZSVA 3QCVH 3ZHDA 1QTYT 3EO0B 5M94B 4APQC 3C5JA 3F5WB 5E1AB 3P0VL 4Z7VB 5DHXB 4JO3H 4CNIA 2VXVH 1CFNA 2J2ZA 5I1HL 3GKWL 1YNTB 4TN9A 3VD7A 1JJUA 4HF5H 2GW5A 4PGCB 1XF5A 4ZYKA 2XY2A 3LN5A 1CDJA 4MQ7B 4PJCA 4G5ZH 3CK0L 1PSKL 5F88B 5TFSH 4X6CE 3VU2A 1PYWB 3LN9A 5DEGA 1MPAL 4PJFF 3QXTA 4PJHF 4QRQA 1VKXB 2OK0L 3L5IA 3QDJD 5J4MA 2Z93B 5C6WH 5GSVB 4LCIL 1Z9LA 2X44D 4NDMB 1I9RH 5ADOL 2R2EA 4XVJL 4DWHA 3BRDA 4KJPD 1U8HA 2F54E 2AK4B 1SBBA 4PLJC 4JY6B 3BGFC 3PDDA 5EZOL 2Y5EA 4NUJB 5IFJA 3H9ZA 2FHFA 2Q86B 5ANMB 5BZDB 2WP3T 3EO0A 2VC2H 4H1LH 5E1AA 3F5WA 2FGWL 4Z7VA 3BN3B 2GCYB 4Z7OF 4PJGB 1A1OB 3SHSA 5EU6D 1RIHL 3MGTB 2VUYA 1KLGB 1CICB 4JGMA 1OAZL 2P45B 4L9LC 1WAAA 4MQ7A 2NXYC 3VFPB 3OKDA 3TIEB 2E6QA 4YEFA 4XCNB 1PYWA 5HYQB 1UM4L 1VKXA 3DMMB 1U8IB 1NCUA 4LAJH 3SE3A 4JREB 5L8JB 1XR9B 3BKCH 2Z93A 4PBXA 1ZAGA 5E4EC 4NDMA 2W65B 3B9KC 3V4UH 4XRCB 5GPRA 4PJEE 1BOYA 1HH6B 5DD0H 1ZA3B 4G7YH 3DX7B 2AK4A 4I3GA 4JY6A 4FABH 4NIKB 1MCSA 1ORQB 2IH3B 4HULB 2YPLB 2A38A 4RDQF 12E8H 2EDRA 1GPOH 4NUJA 4XMLH 1D3CA 3WIFA 4JM2C 2XWBB 2Q86A 1RZ8B 5ANMA 5BZDA 3QQ4B 1JYWA 3MYZA 3SDCD 4RMQA 1XF2A 4NYLA 2BSRB 2GCYA 4PJGA 1T2XA 1A1OA 3G5ZB 2XKUA 1RZKH 4EI6B 4HBCL 3RVXC 3MV7B 4P23A 2O5XH 3MGTA 3S9DB 5FAAA 4XVUD 1FIGL 1CICA 3RX7A 5E08H 2E9BA 3JZ7A 3RWDB 3U1SL 5SX4H 2R0KL 3FQUB 3NZHL 3TIEA 2W9DH 2IALA 5HYQA 2GJ6B 4L4VA 4P57B 5I1JL 4K94H 2R1YA 1U8IA 1BWMA 3PHOB 4OGAD 4U1GC 2NW2B 1FO0L 3ARQA 4HWZB 2ERJC 3MRHB 4APQB 5E6YA 5EOCL 3BD5A 3T2QA 3T0EC 4XRCA 3OZ9H 5D1XC 4PV8B 1J1PL 4MJ2A 1ZA3A 1KJVB 3E8UH 5D72L 2C5DC 4UIMA 4NNYB 3O41B 2QQLL 3W2DH 1ORQA 3GGWB 2IH3A 2IANA 1P84J 3C5ZD 2YPLA 4M93B 1TVDA 5F7FA 1BAFL 1DQDH 4JQVC 4UOW1 4WHTA 5C9JB 2XWBA 1NC4D 3QQ4A 3IYLW 3LZFL 2BSRA 3G6JE 3BGMB 4W4OC 3QQ9C 1F3RB 4JFED 3U9UB 4EI6A 5ALBL 1TPXB 3MXVL 3MV7A 4MGXA 4P48A 1G7IB 5MENB 2GJZB 5I8CB 3KYKL 4LPWA 4X8XA 3RWDA 1TVBA 4DGIL 3IFPB 3TVMA 3IKKA 4FQLH 3O11B 4NQED 2BHUA 1AGDB 1RK0B 1HSBA 4AENA 3PHOA 3U36A 4Z6AT 2NW2A 4JO1L 1KJ3L 3EJYC 5ACZA 4HJ0D 4HWZA 4JHZA 4OI7A 1LDSA 4X7SL 3RPIB 4APQA 4PP2B 4A6YL 3TZVC 4WUUE 3O6LH 4XC3L 1OGTB 4YR6B 3WUWG 1JZ7A 1AGEA 1AC6A 1JHKH 4LEXL 2GAZB 3GGWA 3TP4A 6FABL 3T08A 1MAML 2VDOH 3S6CA 4K7PX 5C9JA 32C2B 2EC9U 5CGYD 4MZ2A 3BGMA 5E0QA 1NCTA 1DQML 3BQUC 3C6SB 3U9UA 5KVDL 5TPWL 3VFGH 1OAYH 5E4IA 4Q2ZB 3ALWA 3NCJL 2PTTB 3RWIB 3ZT7A 1TTUA 1G7IA 5IB1B 3QXVA 3WKMH 4AL8H 4NZRL 4R4ND 4X80L 3O11A 5HHOE 4K2UL 4NO5B 4WU5B 4NJAL 1G6RH 4P5TC 1I9IL 3ZKMD 4G6AC 3RPIA 3AMLA 3QIBD 5FO8A 3NCYP 1FNHA 1AXTH 1YMME 2C26A 2DL2A 4QXGH 4PBVC 1PG7H 2VIRB 3HI6L 4KXZH 2A77H 1NSNH 4HXBH 1YECL 2Q3AA 2GAZA 2R9HD 4XGZB 1DLHA 4Y1AB 2XTJD 5CCKH 1AJ7L 1AQKH 2CLRB 1MH5B 4MQTB 2NQCA 5D1ZC 3FQWA 2V5SA 4DAGL 1UXWB 3Q6GL 4N5ED 1OTUD 32C2A 4URTB 2VQ1B 4KQ3H 3RZWA 4KZEH 4L8CB 2ERJB 1P4IH 4ORZC 3B9KA 3T0EB 1JL8A 5D1XB 1S5IH 4QXUH 2PTTA 2UYLB 2Y6SC 1N59B 2VNCA 3R8BB 4OF6A 4ZTPL 3RVTD 5D70H 4U3XA 2JCCB 1DVFD 1W0VB 4NO5A 4WU5A 1NGXB 5E7FA 1U8NB 4JM2A 1HHIA 4NCDA 1DEDA 2P5ED 4UV7H 3FOMB 1BWWA 1HOCB 1S7RB 1BJ1J 2VIRA 1JPGA 4XPAH 4HSQA 4XGZA 3F58H 1A7BA 4DOHB 2CLRA 3W5NA 4MJ4A 3LEYH 4ONOA 5TE4H 5A2IH 1UXWA 5BS0E 1YNKH 1I1CA 2QLVB 2VQ1A 5J6HB 1QLEL 5IEKB 1JNNH 4L8CA 2VABA 1RHHB 4OSUL 3T0EA 3EDJA 1ZMYA 5D1XA 2ENYA 4JE4B 5KSVB 5JW5A 1H5BC 2ZOKA 3OAYK 1N59A 1Q0XL 3Q0HA 2P1YA 5DMGD 3MA9L 4XP9L 3MO1B 4U1LB 1FZMB 2FWOB 3HI5H 2Z8VC 4Z7WE 2DLTA 1HQ4B 3DRTB 3LPWA 2H32A 2JCCA 1KUMA 3WCYA 1TFHA 4XWOD 1W0VA 1PEZA 5KS9B 3SE4C 2NY1B 4BZ2H 1FG9C 4JQVA 1U8NA 2A83B 3P0VH 4ETQB 1ROWA 4N0YH 2BVPB 4Y2OA 5AYUL 2E9JA 1CIDA 3FOMA 3WXWH 3BQUB 1VENA 4FTVE 5ICZB 1HOCA 3VGGA 5CINL 4K3JL 3VWJD 4XX1E 4LSPH 3GRWH 2EC8A 3C2SA 4NT6B 4AT6B 3WDHA 1T2JA 3MFFA 4LSSH 3TN0B 4LMQI 3BPCB 4JFDE 2X89D 4OCXL 1TQCC 4WO4C 3MGAA 1MCPH 1RUKH 1SM3L 3O45B 1F6FB 4X8JB 4OT1L 5IEKA 4FNLH 4P5TB 4EI5B 5CAYB 4KJWC 1JGLH 4HIXH 1GC1H 3BJLA 3BZDA 3MACL 1F8TH 3JSSA 1B0GB 5SWSE 1SMOA 5KSVA 3GEWB 3QUXB 5C0BD 2NY5L 1Z9MA 4S1DC 2HT2D 2AJYL 4NC2B 3LKSB 4LSDA 3MO1A 5GGRY 4AMKL 5CKAA 2FWOA 3DRTA 1J0IA 1HQ4A 2ARJQ 4QNPF 2FHCA 3RNKB 1A7NL 1I1YB 3U4BL 2VLJB 4FQ2L 4UTAL 4Y0GA 5HGGS 4DN3L 5KS9A 1UG9A 3I02B 2A83A 2OTWA 5IBTH 2MHAB 1EAPB 4EKXA 2M26A 3S34L 5IV2B 2BVPA 3RWFB 1JN6B 1UEMA 3A6OA 4LGPB 3BQUA 3VI3F 4KMTH 5ICZA 1XFPA 5JUEL 4WHYG 1G7LA 2WBJD 3C6LD 1PKQE 4NT6A 2ORBL 3TCLB 3ZKSD 5I15H 4AT6A 3IF1A 5T1DL 2HN7B 3BPCA 3HMXL 4YDJB 1ZVSB 2N1KA 3AS2A 2EECA 1QVOB 4QOKD 3UYPA 1XF4A 4M5ZL 3O45A 4X8JA 1A7PH 2BP3A 1LK2B 4P5TA 1Q9WB 4DEPB 3WD5L 4EI5A 1IRAY 4H0GA 3Q2CA 1EK3A 2MKLC 4H5SB 1MVUB 1GIGH 2O61B 1B0GA 4ZODA 4ENED 4RIRB 2C3XA 5KAQG 2GTWA 2PW1B 5HHQA 4UT7L 3QUXA 1F90L 5C0CB 5FYLL 3BP6A 2WP3O 3RUGE 4WTZA 2DI9A 4P3CH 3S35L 3RPKA 3SJVB 2DKSA 5B3NA 1I1YA 5J1SC 2VLJA 2I9LB 4HV8B 1CTNA 1OTTD 1U2CA 3I02A 5D1ZA 3QDGB 1D9KD 2MHAA 3K2MC 3G6DH 1HSAA 1JN6A 1QSVA 3GSNB 3UAJD 5FO7B 2HFEA 4LPTA 1I1AC 4OB5H 3KWWA 4XX1G 3OAUH 1FIGH 5KVEH 3GUTA 4D9QE 5C71A 3GNMH 4KVNL 3TCLA 5D7SH 1YEHL 3HC3H 3JWDC 5AZEH 1YEGL 1R6VA 2HN7A 1Z0NA 4KZDH 4JO2L 1ZVSA 5EZIL 1AP2B 1WZMA 1VESA 1QVOA 1HQRB 4WNQB 3TPUB 2WWKO 4Y4HD 4M5YL 1L4IA 1F45A 4DTGH 1LNUB 2MPAH 1NKRA 5IJVA 4ZTOH 1FIEA 5TJWK 4Y4KD 3LSOA 3VXUE 2ATKA 1J7VR 1QFWL 5C0CA 4LP4A 4YHKL 3BD4A 4H25B 3QT2A 2E7BA 4MB4A 3SJVA 3MV8D 1X5ZA 5E8PA 5ID1B 4MAYC 5LGJB 2AJZA 3O8XC 2I9LA 1TQCB 3REWB 4IS6B 1EDQA 1TENA 2IPUK 2R0WH 3GO1H 3QAZC 3QDGA 1HNGA 4OM1L 4WUKL 4NZDA 1JHTB 4IDLA 4LKXB 3UO1H 2LVCA 5FO7A 2IMNA 4CUCA 4NOFA 4RGNE 2J8UF 4NRYB 5FGBC 1KTDA 3UBXA 4IRZL 4JVUA 3PDGA 4HLZH 3QP3A 2EKJA 3OB8A 3UTTE 3T1FB 4U7MA 1IGCL 4QLRA 4X9GA 3TPUA 4GAGH 1V8HA 3RDTB 1KCRL 1EGJA 1RZ7H 4X7SH 3NPSB 4HFUH 1MUJB 1LNUA 4OF7A 4JGUA 1XGYL 3QRFM 3PWUB 4Q6IB 5EA0L 4ZDHB 3D2UD 4IRSD 3FB6B 5F9OL 3WFCH 4L4JA 4LVOB 3QI9D 5JOFB 2HH0L 4N9OB 4LEXH 3UCRA 3GFUA 3SCMC 2NY0C 4H25A 4KAQL 4JFXA 1MAMH 4HUUB 4DFHA 5LGJA 2VXQL 5D1QB 2X10A 3KDMB 2C3GA 4HXAL 3REWA 4WO4A 1Q38A 3GSNL 1JPTH 2BRQA 5DGRA 2ICEB 3R8QA 3U7YH 1JHTA 3IDJB 4POUB 1WFNA 4AEIH 2D9QB 3VE0B 3BP7B 4AEHL 1T89C 6CGTA 2MJWA 3WO4B 5H94B 4PRID 5CSBA 1E4WL 3MBED 5EN2B 3MJ6A 4NRYA 1J1XL 1IT9L 1RFDH 1I7UB 4ZO7A 2B2XL 4YDIH 3V7AE 1YQVH 1MY5A 1WZLA 2HLFD 2VTFA 4KDWA 4KROD 4R26H 3T1FA 1BJ1H 4PTUA 2X41A 1A9EB 5F72S 1T1ZB 3MA7A 4GXUM 5I19H 3MNWB 1MUJA 4UV4L 4YHLH 4WU7A 3PWUA 1CG9A 1N3NB 4XBGB 4ZDHA 3FB6A 2A0LD 5AAWA 4Y5XB 5JOFA 2HRPL 1G9NL 1IAKB 1G7JB 2D7TL 2R29H 4OLVL 4JR9H 4KTYA 3MRFB 2WIMA 4HUUA 2J4WH 4EN3D 3GHEL 2N7AA 3KDMA 3Q6GH 1SJHA 8FABB 3D69A 4Q58C 2D2OA 4D0DA 2ICEA 1F6LL 1FV1B 3C8HA 3DROA 3IDJA 1BD2B 5FKAB 3ZMRA 3RGVC 4NC1C 4K23H 3U48A 3BP7A 3VE0A 1ACYL 4EDXA 2HKHL 3REVA 5HHVH 2ILLA 4X4YA 5EN2A 3STLB 4BFGA 5GGSB 1I7UA 1GOFA 5I18H 2NY6D 1FBIH 2EXWC 4PJFB 4PJHB 3H3KA 4I0CC 4QRPB 1A9EA 3O8XB 1T1XB 5K9QG 4X5XB 3ZE2F 2HFFA 5CJOH 1RD6A 2FX7L 2R23B 3DYPA 3IDXH 3FO0H 1N3NA 3JXAA 3MLPA 4W6XB 4XBGA 4YE4H 3RY6A 4UIKL 3BH8B 5B39B 4D0CB 4ZNEA 4PRPE 4HS8H 1G7JA 3CXHK 1FVDB 2M2DA 4H8WC 2B39A 5I16B 3ZE0F 3VW3L 3MRFA 3VXRE 1P2CB 4DW2L 4KWUA 3PGCB 2WLZA 2H3NB 5EUOE 5F7NC 8FABA 1V3MA 5CEXB 4ZXBB 1KJ2B 1ZTXL 4MXWL 1FV1A 5DD1L 1W0WB 1DUZB 4H1LG 2APWA 4LEOB 4E42B 1LO3H 4LCYB 2ZJSL 1A14H 4NKIL 3C8KB 4CMHC 3STLA 1YMMD 5GGSA 3MA9H 3HE6D 1H3VA 2HWZL 5CHNB 3V7AG 4I0PD 2NY0B 2J12B 4PJ9B 1N2RA 1BFVL 5EG6C 4NM8H 3T1WA 3UTQB 2AQ1A 3O8XA 1T1XA 1UQSA 5J9PB 4D0BB 2J3SA 5ALCL 4BQ6A 3HC4L 4X5XA 5JHDB 1T03L 2CR6A 2YN3A 2M8XA 1T4KA 4XMKH 5C08A 1HKFA 3BH8A 1NLBH 4HKXB 5B39A 4D0CA 5J13C 3P4MA 3T0DA 5FGBA 3OX8B 4XCFL 1IGMH 5GGUB 3CLFL 3PGCA 5HI5C 1OM3L 2H3NA 3JWNC 3ZL4H 2AXFB 1VACB 4X6FB 4M62L 5DJXA 4OT1H 4XPFL 5CEXA 1H3PH 4ZXBA 5I6XB 3CUPA 3MACH 1W0WA 1DUZA 4GLRH 4LEOA 1P53A 3OPZH 1JTPA 1LO5B 1MCLA 4LCYA 4NWUH 1H3GA 2MKWA 4ZFZB 4PJ9A 1A7NH 2RGSA 4FQ2H 3NN8A 1RHFA 4ODTH 3UTQA 5HHXH 4CDHA 2MQ3A 1QLRB 4KH2A 3LDBB 2BNQE 5B38A 4TNVK 2CIIB 5DGQA 3ZE1F 4D0BA 3OKMB 1AKJD 1J5OH 3S34H 5D2NB 2E3VA 5JHDA 3WXVL 1U41A 4PRHB 1VEMA 1IAOB 1NGQL 4X4XA 5L7XL 2R1XB 4TQEH 4HKXA 5DMIL 4MCYB 2B0SL 4IMLB 3OX8A 3C60B 5EO9B 4P2RE 3HMXH 3EYVB 5GGUA 2HMIC 2LU7A 4WEMB 1N4XL 1KB5B 4OFVA 4WW2C 3EZ8A 2WM0A 1WWBX 3FO1B 1I1RA 4ONFL 1YUHB 3FHQA 4JRXB 3V6BR 1UM6H 1K9TA 3D85A 1LO5A 2OTUB 1D5XB 5FYLH 3MMEA 1KTLA 5SWZB 3GI9L 4B0MM 3C9NB 3PE9A 1N8ZB 3QNYB 1Q9LB 2PR4L 4ELMA 3ARZA 1KLUA 3FT4B 3B6SB 4JFDD 3QHFL 1QLRA 1AR1C 3KVQA 3N06B 5D93C 7FABH 2CIIA 5D2NA 3ARBD 2ARJA 3WEXA 2I27N 5DUBB 4S1QL 4Y4FB 4PRHA 4UDTA 4FQJL 4UB0H 5F6HJ 3RGVA 4WFFD 1B6UA 3D3VD 3MZGB 2VAAA 4IMLA 1ZANL 5SWSD 4EBQH 1OSPH 4IJ3B 43CAB 3EYVA 4PR5A 3NH7H 1A6UH 3C8DA 3UTSE 1FC2D 1G9ML 5DA4A 4M5YH 1C5BH 2GT9A 5H37H 2JE8A 1FGNH 4JRXA 3O6FD 4ZMAT 3VFNA 1CE1H 2D9CA 3RTQC 3RWGB 2AK1H 4JY4B 4PD4K 3HZKB 1D5XA 4YHKH 4FMKA 5SWZA 1IQWL 3NIFE 4RFOH 3BYTA 4BQBA 1N8ZA 3DX6B 3QNYA 1Q9LA 2AEPH 5IGXL 1EIBA 1X4YA 2PUQT 4M7JL 2A9ML 1KIUA 1T5XB 1EHLL 3BPOC 4O5LL 2ADIB 5DUBA 3ZHKA 1NAMA 1XEDA 4CVWA 3ZTNH 1LILA 4TTDC 3NFNB 1Z5LA 2R2HB 3RZCD 3O81A 2BY2A 5EZLB 5J11C 1JPFB 1FYTE 1MIEL 43CAA 1NCDH 1CL7I 4HKJB 2P8MA 3CFCL 2AGJL 1MHCB 1A7OH 1NMBH 4NQVB 3GMQB 4UOJA 1R3IL 1J88A 4NFDA 5F7YC 4ODXB 3NFSH 4XC1L 5MEQA 1IKNC 5IMOB 4OAWB 5D71H 3DXAE 1TNNA 4G8IA 2DM3A 2ESVE 1MQ8A 1UCBL 4GKSB 4YWGL 3D1MC 3MJ9L 2VZSA 2ZG2A 1IAIH 3RWGA 2YUZA 4K9EL 4F7EB 3HZKA 1J87A 1MHPL 2E9WA 5IVXE 4D9QD 3QUZD 5KVGH 3DX6A 3BDBA 4JRYB 1I9JL 4WEBL 5T3XL 4LHJB 4ZAKC 3RU8H 3GSNH 43C9A 4GG6F 2ITDB 2ZKHH 1CU4L 1CFSB 5D7IB 2RHEA 4ZO6A 5FM5O 2DTSA 3QFJE 2ADIA 4HWBA 3G5XA 3FRPG 4X7EC 1M71B 2D4FA 4OGYH 3NFNA 4N8VB 2FEDD 3N85L 2R2HA 3FO2B 1IT9H 5EZLA 3VXUD 3MBXH 3BSZH 4JFYB 1JPFA 5I1CH 3QG6B 4P5MB 2CR3A 4GH7B 4S0SD 5J12C 3VJ6B 4NQVA 1QSFB 4EDWL 3GMQA 2H41A 4RA3A 2IGFH 2KDGA 1VFAB 4LASL 2QHRL 1X5KA 3MXWH 4ODXA 1BFTA 3GSXB 3KPQB 3JTSA 5D93B 3QCTH 2H26B 1TJHH 4I13B 5IMOA 4BSVB 4F2MB 1INQB 3MQIA 5LXGH 4GKSA 1H15B 1M7XA 2DLFL 3ARUA 5DEFB 3TLRA 1DSFL 2I60L 4F7EA 2B1HH 5DEZA 2HRPH 4P2QB 3KHOA 1JPSH 1QSEB 3VDBA 4NRXB 2CGRH 5F7WC 5I76B 3I6GB 2BJMH 1WLHA 4IMKC 4BKLB 5I1LB 1EH9A 1LO0H 3UTTD 3NACH 4ZSOB 1HNFA 4WW2A 5TGBB 2X5PA 4Z7VE 2ITDA 2VB5A 1KULA 2EH8H 3O9WC 3CFDA 1CFSA 2VDMH 4Y19B 35C8L 3JV4B 4FFYH 4KK8D 4XBPB 1M71A 5A40E 2JJSA 3M1BB 1BM3L 1EFXB 1BP3B 1NCBL 2EDHA 3RTQB 4LL9A 1WAAE 4JFYA 4WI4A 1DQLL 4P5MA 1YEEH 3VJ6A 4EIZC 3MLYH 1QSFA 3M8OH 5KVFH 1VFAA 1R0AH 1FZKB 4M7LT 3QA3B 1R3HB 3GSXA 1MI5E 1GH7A 3GB7B 3V4PL 2UWEF 3MLSL 5GHWL 1MFCL 2I9TB 2EICA 3LN4A 4F2MA 1INQA 3SY0B 1RZGB 2NY4B 1H15A 4JPVH 1LO4H 1EBPA 5DEFA 1CR9H 4P2OD 5K9KB 1GGIL 5HHNA 2OJZH 2YA2A 5GGTA 1S9VB 1QSEA 3F7RA 2ZCHH 5J11B 4NRXA 5D5MF 3MCLL 3P3YA 2YS4A 4DW2H 5CGMA 1ZGLM 3I6GA 2MCPH 1FNFA 4BKLA 5I1LA 1CLCA 3R1GH 4PBWD 3ZTJH 2L7UA 4KPHH 4ZSOA 3J7HA 2ZPKH 1SEBB 4LAQH 5TGBA 1KIQB 3RNQB 4Y89A 3JV4A 2AABH 1FNLA 1M7IB 3TO4C 1RAMA 2WBKA 4NM4H 2X4PB 3M1BA 3HNVL 3RTQA 4WWKD 2EE2A 1R5VB 3U4AA 2OBGA 5KBNC 5CJQH 1U2HA 4M02A 3GSVB 3MREB 3RY4A 3GMLB 4LCWA 4U6VH 4ZAKB 1OAXL 1R3HA 2DQGL 4WY7L 1VEPA 4CU6A 5J56B 3VGDA 5K59F 2I9TA 3LMJH 3M17B 2OSLA 1RZGA 3MJ7B 3PGFL 1LHZA 1JNJA 5K9KA 2EIZB 3H6JA 2I5YH 2PXYB 3EYFB 2AI0L 2GUOB 5KSBF 3I84A 1F3JB 1J05B 3DUSB 3AREC 3O3EA 3WLWC 5FYKU 4M62H 3SPVB 1SEBA 1KIQA 1PBYA 2FSEB 4QY8A 4X98B 4XP6L 4OZGA 3RNQA 4OCSH 1LP9E 3TT3L 4X5WB 1ZSDA 3V2AR 3MV7E 1QO3B 4OJFL 4M4PA 1M7IA 2IFFL 3ZYOA 5KOMC 2CRIA 1DANT 3PL6D 1CWVA 1R5VA 5F1IB 4M6AA 3B2UD 4PRPD 2GJ6E 4DK6A 2QJDA 5FYJH 3NFPB 2BVEA 1I3GL 2HVJB 2EYSB 2J6EA 1IC1A 2VR5A 3GSVA 1E6JH 3QFDB 4Q9BA 5DD5H 1F97A 3GMLA 4ZAKA 4UT6H 1XF1A 2NY3B 3VH8B 4Y5YC 2BOBB 3LB6C 2YD3A 3M17A 4G6FB 3MJ7A 1F4HA 2NY5C 1UFUA 4RAVB 2EIZA 5IB5B 2D7OA 2PXYA 3EYFA 4NWTL 1P4BL 2GUOA 2FX9H 1NUNB 4O2EB 1FNSH 1MLBB 4MHHG 1F3JA 5HVHB 3GSRB 3SKNA 4ODWA 1J05A 5I1GL 3KYMB 1KJ2H 3D39E 3HZVB 4J8RB 2R69L 3SPVA 3EYQD 2FSEA 4ODVH 4JO4L 1MLCA 4X5WA 1FZOB 3MLXH 1FRGH 4Y88A 5GZOC 4EQ3A 4KKLC 1QO3A 2H6PB 2J8UB 3WFBL 1T20A 5TQ0L 1WEJL 4HH8A 4Y2DB 3IDNB 5MENE 4L8SC 4V1DB 3SEPA 5F1IA 1HXMB 5AWNH 1XCQB 1DN2A 2PR4H 3UJJH 3NFPA 3L9RB 2HVJA 3GBNL 2EYSA 4P4KD 4IMKA 3QFDA 3RRQA 1U3HD 5MI0C 3VH8A 2FB4L 4U1NB 4HGMA 2BOBA 4UI2A 3U0WL 4BFEA 1B0WA 5K9JH 5TDOB 4RAVA 5KTEL 3QXDB 5IB5A 3QEGH 2ZCKL 2F8VA 3S37X 1J18A 4O2EA 5DT1H 1MLBA 2DMCA 2EDJA 3GKZA 4O2CA 5DFWH 4WGVB 3GSRA 5FCUH 5KSUB 4M43L 3PWNB 3KYMA 3FQTB 3HZVA 4PJAA 4HJJH 2ID5A 4UBDD 5BZWB 4J8RA 1G9MH 3V5HA 2WUBL 1T7VA 3NABH 1EO7A 1WV7T 4NUGL 2QSCH 4KI5E 4F33A 1J0HA 2E8YA 2BNQD 2EYTB 1W8NA 5DJYB 5E1HB 1A47A 2H6PA 3ESVF 2CD0A 3IDNA 1AY1H 4JEGB 4KRNA 1ADQL 5ICXB 2BNRB 1A3RH 1YEDB 4V1DA 4KY1H 2MWCA 4LFHG 2Z9TA 1Q9KB 1AE6L 1HXMA 5FK9B 1HINH 1P7KA 3OKEA 4KV5E 1OAUL 2HJFB 4P2RD 1VADB 3PDOB 1OP3K 2XN9E 5IMKB 2HT3D 1RUPH 5GRVK 5C0DA 3TBWB 2V17H 2HG5B 5A16B 3DV4B 1NUGA 3KPSB 5EO0A 2EZ0C 5TDOA 3QXDA 3TO4A 4CJ1A 5HVWA 4L4TA 1KB5H 5HGHB 4XZUB 3NZ8B 1JWSB 4Y1AE 4WV1C 3WDJA 2AGJH 1IEHA 5KSUA 3PWNA 4P4RB 5BZWA 3MNZB 5MHSD 3JV0A 3F7QA 1K4DB 4JY5L 2DQDH 4C54A 1BREA 5CZXC 4F57L 5DJYA 2CK2A 4YHIB 1YPZF 3EJZC 4KHXH 3V0WL 3W0WE 5FGSA 4E5XA 1GL4B 1GVIA 4H8WH 4ERSH 3PP4L 2UY7A 5ICXA 3RHWK 1L6ZA 3QXUA 1YEDA 5B4MC 3D5OF 5BVPH 1Q9KA 4RCAA 4PLKD 2HJFA 3PDOA 3L3GB 3AREA 1ETZB 4KRPC 5IMKA 4R97C 1NAMH 1TJGL 4O58L 1GZPB 2J8OA 4ZD3L 5IBLD 4NQCE 3OXSB 4KUCD 3FAXA 2HG5A 5A16A 3DV4A 1A5FL 4OGXL 2B1AL 3KPSA 1HHGB 3QXAB 1KN4L 1QNZH 4KVCL 3LQAH 3ZSSA 3UZVB 5EOTB 5I1EH 1EJOH 5HGHA 4XZUA 3NZ8A 5J3HC 5TF1H 3VRJB 4DOHE 1PEWA 3MRPB 3DHJA 3OKLA 2P5WB 2G60L 4KTEL 3VD9A 2XZCH 3KGRA 4U05A 4JPWH 3T2PA 3UPCA 3MNZA 1A2YB 2ZUXA 4G43B 4JN1L 1QBMH 2Q76B 1K4DA 1GOHA 5DWUH 2WZPD 3WFEL 1A6VH 2G75A 5MI0B 1WCQA 4HFWB 3A6CH 3MR9A 4KK5D 3L95B 1SBSL 1JHLH 2VH5L 3LRHA 1K8IB 5TE6H 3MRRB 1A64A 2IPKB 2OL3B 3SKUD 4CDGC 4K3DH 1GGBH 1OGAD 4WFED 3S5LB 5FYLE 1MHEA 2ICWI 5E8NB 4Z18A 5GGQL 4DK3A 3VA2C 5DMJB 1F4XL 1FYTD 2ZUQC 15C8L 1ETZA 3IFLH 3U83A 4HGKC 1MWAB 3EO9H 4YDKL 2E27L 1GZPA 3ULVC 1UEYA 2H2PD 3OXSA 5EO1A 4MCZB 4AEEA 1OLZA 2GHWB 5HYEA 3BAEH 3CVIH 1HHGA 2ESVD 2G9HA 3QXAA 2OQJB 3L3DA 4ONGL 4S1RL 1Q0YL 1RUQH 4XP4H 5CZVL 2IADA 3VRJA 2EE6A 2NR6C 1U8JB 4G42B 4J7RA 2P5WA 1E4XI 3QQNA 1G7MB 3DX9A 2A9NL 4HAGA 4K7PH 3QIWD 2Q76A 3MRDB 4POZC 3OR7B 3P9LB 3IJSB 4HFWA 2LTQC 1CT8B 3RVWD 1UENA 2YK1H 4LHUB 4WFHE 4NN6C 3QFJD 1W2KT 4NJ9H 1ZHNB 1TZHB 2IPKA 3B9EA 2CRYA 3BEWB 3W39A 2PTUA 5E8NA 2VLJE 2VWEE 3P11H 3TWCL 3NCCB 4FFZH 4BELD 5DMKA 3QNZB 2HRLA 1MWAA 1QHPA 1UZ8B 2YD2A 1NBZB 2PYEB 4U7KA 5JNYB 1DQTA 1IGFH 1WT5A 3BIKA 1KG0A 4MCZA 2DLIA 1XCTB 1T7XA 2LQRA 3BT2H 5CP7B 5B3JF 1EA9C 4JFHE 4YH6A 3SKOB 5I74B 5IFHH 1WIOA 1PZUB 2YA1A 1E6OH 2OXGA 3NA9L 3H3PL 1U8JA 4G42A 1JNHB 1NEZB 1RZFH 5TQ2L 3UJTL 4QWWC 4JCMA 2DQUH 2VZUA 3B5HA 1G7MA 3CFKB 3HZMB 3GDBA 5IHZA 1OAXH 2SEBB 2DQGH 4YX2H 5DVKA 3OHXA 1FNEB 3VGEA 4LBEB 3P9LA 3IJSA 2AXJA 1R3KA 1CT8A 5GGTH 2OL3L 4LHUA 3TJEL 2EEAA 5CJBA 5GRYA 2OZ4A 1TZHA 1J8HB 2AS5M 3SJVE 3MV11 2AJ3B 4XPTH 2RCSH 1F13A 4XNQB 3T3MF 2FH8A 5GJTL 2C1OB 1KEGL 3QDGE 1D5MB 3QNZA 1UZ8A 3HNSH 3WIHA 3X11A 2PYEA 5JNYA 1NFDF 5A2FA 2HJLB 1FLRH 1NDGB 1AH1A 5CP7A 4V2BA 2Z0BA 5DZOA 3CXDL 4JKPL 1BOGA 1WGOA 2DWDB 2AK4D 4QHLA 3S36H 4EZMA 4ZG1A 2XFXB 5CUSH 1U8OB 5F71A 4OM0H 3TO2B 3GMNB 4JJHA 3BW9A 4G6KH 1ITCA 1SYSA 5JXAH 3HZMA 4GRWF 2ZUQB 2VDRH 2ADJB 1NDMB 1EVTC 2BRRH 1SJEA 1ZKAA 5CEZH 4HMCA 1FNEA 1CIUA 2DB8A 4XNYH 1CDBA 1MOEA 4IHOA 3BUTA 1JV5B 4M7ZC 3MNVB 5GISH 3ILQD 5DMYA 3HUJF 3IU3B 1T04B 4P23D 1J8HA 5DZLA 1MJJB 1OF2A 1CICD 4OLWH 4YXKL 1WWCA 2AJ3A 2P8LB 3X3FH 1NAKH 1KJMB 4JFPB 4QXTA 2C1OA 5TE7H 3QPXH 4R2GC 3EW3B 2MMXA 3QG7H 3DMMD 3GZKA 5AZ2L 2FDBP 4MXVF 1PX4A 3DPBA 3O2WH 5KSAC 2XACC 4JG0L 4NN5B 2HJLA 1NDGA 4JM4H 1TTFA 4NN6B 1CBVH 4XWGL 1L0YA 3P0YL 5EZJB 2DWDA 3LEVH 3O2DA 1FFRA 2J6EH 1MCOH 1D9KB 5D2LE 4WCYL 2XFXA 5J0BA 1VSCA 2EDXA 1U8OA 1E27B 1KCLA 1Q9OA 2HT4C 2YPLD 3F62A 3GMNA 4O51B 1W8OA 1RJZA 3PQYE 3FTGB 1F2XK 2DF3A 2ADJA 1NDMA 3E6FB 2YPVL 3I3BA 1AFVL 1FL6B 4IRJB 5GRWA 3VGBA 4QT5B 1OWWA 3MNVA 4HPYL 4XBEL 4F80A 1TZGH 4IM8A 2EDKA 3IU3A 1T04A 2ZCKH 4QTIL 1PY4A 3MV7D 5E6IB 5T5FL 3V4VL 3QUYC 3TV3L 3WBDA 4TNWF 4I3SH 2IBGA 4MVBC 2P8LA 4LFHD 1XGQA 4JFPA 1FFNA 2UY6A 1CGSL 5CWSB 4GG6B 5GQBA 4MS8C 1RUAH 1OB1B 4ZUWA 2NZIA 1RMFH 5MEOB 1YEIH 2EXYC 2I07B 3VG9C 4OD3H 4APQD 2F8OA 2DS4A 4XNUH 1FDLL 1IZKA 3MV8B 4CN6A 2OCFD 2XRAL 5J89A 4ZFGH 1AC0A 4H0HB 2OP4L 2X4UA 3UYRH 1E27A 4S11A 2D31B 3IFOA 4X5LA 2JLLA 4O51A 5E00B 3ARGC 3HFMH 3PJSB 5C0AE 2GY7B 3FTGA 4FQCL 1S9XB 5FUZL 3E6FA 5JHLH 3SDXF 4OCRL 1FL6A 4IRJA 5F9WC 4XH2B 1N0XL 5HHMB 2IPTH 5E2TL 5IIEB 1PKOA 3TNMB 5CJ5A 5E6IA 5AD0A 2XQBL 1R24B 4F58H 1JMZA 3ARTA 5MEND 3O4LB 4GW5B 5L6YH 5GZND 3VXPB 1NBYB 3BISA 1NPUA 5BV7L 2FATL 2XPGB 5CWSA 4LSTL 3BN9C 4X6DF 3CSPA 3BPLC 5JO5B 5MEOA 1BD2E 2I07A 4OZIA 4HIHB 1BVKB 3HHRB 2JB5L 1RULH 3KLAB 5F8RC 1PQZB 2AJXH 3MRJB 4M7ZB 3UPAA 5IB2A 4LLMB 3QDMB 4HH9B 4JJ5B 5F21B 3CPLA 3JTTB 3D25B 2NY2C 5HYJB 4PJFE 1B90A 4PJHE 2D31A 1WWAX 3HPJB 4J1UB 4KKCD 4UU9B 4L3CB 4QRPE 3S4SG 4KJYB 1MREH 1S9XA 1DBAH 1TJGH 4R2GB 1S7VB 3EKCA 5FYJE 3STBA 3OKOA 4FQIH 3D0VB 4XH2A 4ZUUB 2X1PA 5K33A 4HQQL 3B9KD 3V9FA 5IIEA 5GGRA 4NNPL 3ARXA 2XWTA 1FORL 1IAMA 1CGWA 5D5MB 1M7DB 1QRNB 1R24A 4YXHL 3O4LA 2XKNB 1NL0L 1X5HA 4I18B 1NBYA 3DYMA 2XPGA 4MJIB 1CI5A 1XAUA 1EO8H 4FQQA 1QFOA 3ULUF 5SV3A 2DBLL 2KZ1B 3O6KL 3ZTJG 2E5EA 1FAIL 5FUOH 1BVKA 2KPNA 3KLAA 3KR3L 1K85A 1PQZA 3MLZH 3MRJA 3P2TA 4MJ6A 1RVFH 4LLMA 3QDMA 4HH9A 2XYCA 4JJ5A 4YDLC 3W9DB 2X2YA 3D25A 5HYJA 4JN2B 1FFQA 3HPJA 4UU9A 4OLYH 4L3CA 3K4DA 4Y1AD 4KJYA 4ODHL 1NANI 3RQ3A 4YDKH 2E27H 4XTRC 2UWEA 1S7VA 2C3HA 2R2BB 2VSDA 4YIQB 2A74B 4NNXA 4AIZB 3QNXB 4OLXL 1AGFB 1IC4H 4MX7A 4JAMB 1KENL 1OCWL 4ZUUA 4UILL 1AIFB 1DFBL 1IKFH 3T0ED 5FO9B 5D1XD 4MAUH 5CZVH 5KSBB 5HYSB 4XPBL 4ODUA 5DURB 2YC1A 2F53B 2QSQA 5D96C 1T5WA 1KXQE 2PO6B 5A1AA 4MJIA 1PLGL 1FE8H 5DYOB 4DKFL 3WNPA 4JANB 1FCGA 4J6RL 5C07B 1HI6A 4OD1H 4OLZH 5I1IH 2X9WA 3ZT5A 3QQ9D 2X1WL 1KCKA 5LAXB 4QHNA 3CSBA 4AQ1B 2C9AA 2DMBA 4JN2A 2X4NB 4FS0A 5IP4A 2EKSB 3BE1L 1KIPB 1MFEL 2NXZB 2ZUTA 5HVFB 2DQCL 2QQQA 1RUMH 3L1OH 5D2NE 1T2QL 4PGBB 1OARL 4DQOL 5A2JH 5EBWA 4YIQA 2A74A 3E0GA 3QNXA 4AIZA 4PRHE 3B2VL 3EJYD 1AGFA 2FZ3B 3WNOA 1TETL 3UC0L 1AIFA 5EORH 2F19H 3C09B 5FO9A 4DGYL 1FN4B 2FGZA 4TRPH 5HYSA 1N6QL 3INUL 3H3PH 5GSRB 3IDUA 2F53A 1MSPA 5TQ2H 4Q6YA 5I2IB 2VL4A 2DWEB 1IJ9A 5ADPL 2XNAB 1K4CB 4B7LA 5FYLD 5ENWB 3ARGA 4G8GA 4XNZB 2AQ2A 2ZG1A 4OFKA 1HYRC 4FQHB 1H8NA 2A2QT 1BIIB 3SKJL 4LQFL 4OZFB 4NZUH 3BQUD 5SWZE 1BMGA 3MLWH 2IG2H 2ARWA 1MWAH 4E0RB 4PRDB 1YEKL 2EKSA 3L5WA 4RISH 3TN0D 3KLHC 3V0VA 1KIPA 1MRCL 1JYVA 4J3TA 1P5UA 5EUKA 3U79A 4I77L 3KJ4C 3PIQB 5T3XE 4DKDC 4PGBA 5DR5L 2VLRE 4G7VL 3AU1B 5IT2L 2DICA 1OPGL 4P5TD 4EI5D 1SVCP 4EXPX 4NN7B 4Q0XL 4AG4L 4LSRH 2R4SL 3CXDH 4PJCF 4WFHD 4XPHL 3SE8L 3I50H 3QUXD 1D6EB 4YBHA 5JXED 1Z0MA 3PXJA 1HHHB 4RDQG 2Z4QB 5GSRA 3NCEB 5I2IA 3ZZ1A 2DWEA 1K4CA 3BYYA 2VLJD 2YKLH 2FR4B 4RNRA 4E9LA 2XI9A 3MRGA 4EUPB 4B41A 4H26A 4QRSB 2OZ4H 1M1SA 1BIIA 4HWEH 3QQ3B 4LVNB 5JW4R 4JKKA 1YZZA 4AY0A 4JFHD 3K46A 3PF2A 1QD0A 1HIML 3KPOA 1I7ZB 1ZS8B 2Y6SD 5IESL 3ES6B 3VXQA 3WIHH 4PRDA 4E0RA 1UH3A 3ZKNC 1NFKA 4U1HB 3RAJH 1JRHI 2A6KA 3ISWA 4ZUTB 3PIQA 4BYHA 3DHMA 1BQSA 5GRJL 1A6AB 4TVPH 1KT2B 4F37K 4JB9L 4M1CC 4X6CF 4NGHL 5DJAB 3MC0A 3JBG7 2D03H 1S78C 5BO1L 2FJHB 4M1GH 5C0CD 1HHHA 5I71C 2Z4QA 1MCJA 2F5BL 3KPRB 2QADC 3KYNA 5LBSL 3UJIH 2VXSH 3SJVD 2YPKB 2JK5B 5EC2A 2XQYG 2DL9A 3MODH 1G9EA 4KTDH 5DLMH 1PZ5B 4ZOEA 4EUPA 2Y72A 4QF1B 4QRSA 3QDGD 3K4ZA 5J1AA 2V2TA 1YPZB 5HTSA 4M7KL 5SV4A 3Q48A 3STZB 2FEEL 3QQ3A 3QB7C 5MP6H 5JLZB 1ZS8A 2R56L 4G6JH 5IQ9B 4B53A 4JRYE 3DWTA 3QCUH 1DANU 4U1HA 1Q94A 2KBGA 5F70A 1PGRB 1J1OL 5HXMA 1INDH 4ZUTA 4XNXH 5D7IE 1SEQH 1KCSH 4KHTH 4E41B 3O2DH 1A6AA 4QRRA 4JG1L 3BRGC 1KT2A 3BKML 1LDPL 5DJAA 4ZOCA 1BQHB 2FJHA 1T0NB 3R4DA 3O6ML 5E2UH 5I1KL 1T7YA 5EU7C 3BZEA 4AZ8A 2YPKA 4GQ9L 3SGKC 3ULVH 2JK5A 4O9HH 1PZ5A 3CZFB 3KJ4B 4PP1C 4QF1A 1J8KA 3BKJL 3GK8H 1YPZA 5E99L 3MPCA 3P4OB 3DSFH 4P2QE 1MJ8L 4WHCA 2VXTL 1QSEE 4PV9B 5ITBL 1RJLA 1KYOJ 2LAGB 4N1EA 2FLBT 5DQ9A 5JLZA 3U6RB 1O0VA 4X0KB 2BDNH 5EBLA 1A21A 2CRMA 3DGGB 4OBRA 1XR8A 4L9DA 3WHE1 2CH8A 1WC7B 1HILB 4OKDA 4DVRL 3RA7L 4WIQA 3IDYB 4WHDA 4Y19E 3RDTD 2OS7A 4E41A 4UMGA 3ROOB 2KKQA 2DAVA 2PTVA 1A7RL 2KUTA 1J9CT 4CVZB 3OAYH 2X05A 2BY1A 3T2NL 1BQHA 4OFPA 3VMOA 5INCB 5BMFH 5DTFA 2ITCA 4U6TA 3HAEA 3CMOL 2CLZB 3E3QC 5DK2A 2R1WA 4PLOB 1AO7E 1W72L 3ARRA 5D1QD 2PW2A 3ZLQC 3CZFA 4KQ4H 4HEME 3MROB 1RV6X 5IMLB 5H35B 1T0MB 3SDCC 1UKSA 3BEVB 3SKMA 1VGEH 3ARFB 3P4OA 1CGXA 3SO3C 2EDOA 1JZ5A 3AB0B 2C3VB 4NNPH 1FORH 3IGAA 4PV9A 4J4PA 5ID0B 2APVA 4QNPE 3H42L 1XGPB 1IVLA 3DI3B 3U6RA 1TZIB 2GIYA 1X5GA 3BWUC 5E2WH 4KUZL 4KK9D 4X0KA 4XVUC 3E6HA 1M4KA 3DGGA 5F3HB 3BPNB 1DN0B 4Y16B 1U6AH 4CMMB 3O3DB 1KBGL 1WC7A 4MA7H 1HILA 3DETD 4NC0B 2IBZY 2A1WL 5LCVL 4MNHB 5DDHA 3ROOA 5T1KB 3LEXB 3DTXA 3FB7B 2AV7B 2BFVL 4N8VG 3HN3A 4CVZA 4ZOBA 1C5CL 4RX4A 4Z7UA 3CDCA 5IFAH 2P4AB 1HE7A 1XGUB 3EO1B 5INCA 3BMVA 4K71C 4M6OL 5SWQB 3R0MA 4PJIA 3GSUA 4RRPA 1WZ1L 4H88H 1Y18B 5J1TC 1H0DA 3V6OC 3BDYH 3C5ZC 3CFJB 3UZQA 3VFSB 5BVJB 2XIDA 3RFZC 1KACB 3WJJC 1D5IL 3P73B 5IMLA 5H35A 1T0MA 4Z0BL 5IUSA 3CVHL 5DF0A 1GJIA 1BD2D 2F15A 1NC2B 4H20H 2Z31B 5GS0L 5JW3L 2BSTA 1CZ8H 2VISB 2C3VA 1FJ1A 3IT8D 4BZ1H 3TGXA 3QDJE 5IK3B 1UYWH 1AI1H 1NMAH 4OUUB 1U8PB 3WIIH 3DOSA 5F3HA 2CKNA 1PY9A 1DN0A 1PLGH 4Y16A 5E9DB 1M6OB 4QRPD 3O8XD 3BXNB 1NFDB 4J6RH 2NNAB 1ZT4B 1RIUH 4MNHA 5FYJD 4K8RH 5DD3H 4HCRL 4PJBA 5T1KA 2DLEA 1OSZB 2AV7A 2CK0L 4WI8A 4WI3A 1JYNA 4PS4L 3JV6B 4ONHB 4PRNB 5I8EB 5F7EL 1T1WB 4JM2F 4EOWH 1Y18A 4GRWB 3H9HB 3CFJA 4YFDB 2DQCH 5EOQH 3VFSA 3WL9B 5BVJA 3IJHB 3SDDB 2YMXH 2WK2A 1EMTL 4DGVH 1ZVYA 3VMNA 1JYXA 2LU3A 4ZXBD 1VPOL 4HUMB 5CGYC 3LRSB 3BRFA 3HUJB 1NC2A 2Z31A 2VDLH 4UINL 2DQIH 4XI5D 3TIDA 3P4LA 1UVQB 3FCTB 1NCAL 4GMTH 2X70A 1G7PB 4C56B 1U8PA 1BQLL 3ZYIA 4NZTH 3QCVL 4XP1H 2NY0D 1TMCB 4PJ9D 3DX8A 3SGKA 4AIXA 2VXVL 4Z7NF 5JIHA 3BXNA 4MD0B 2NNAA 1ZT4A 4HF5L 5CILL 3ZKMC 2J8UE 5I66A 1XH3A 5JHDD 3SKJH 1BZ7B 4EVNB 4LQFH 1OSZA 2WQRA 4JDTH 4U6YA 3SO3B 1V7NH 4G5ZL 2Y07H 4OF3A 4V1DE 5TFSL 2V5YA 4DCQA 4ONHA 5EU6A 4PRNA 5IVOA 3ULUC 2VN7A 2EDDA 4JQXC 2R9HC 3HS0A 3H9HA 3WL9A 2AERT 2XTJC 3BJ91 3IJHA 1F00I 2IQ9H 1JBJA 1T83C 4HAFA 3HRPA 4GRMA 4QHMB 4N5EC 3QSKB 5IW1B 3LRSA 3GM0A 4FP8H 4X6BB 4Q0XH 1QA9B 5BOPA 2YWYA 3TBVA 2AAVA 4X4MA 2F5AH 2WMPA 1G7PA 2P24B 3PV7A 4X7FC 4PJXA 3X12B 1QBLH 4GUPA 3EOTH 2VC2L 3ZDYE 3ALPA 4O02H 3RVTC 2F58L 4NCC1 2VITA 5K9OB 5T1LB 1DVFC 2G5BB 4MD0A 2CIKA 1F4YH 2VAJA 4EVNA 4GOSA 1FQ9C 4PRHD 2BNRE 5IWLA 5I75C 1L7TH 3LQZB 3OJDA 4RMUA 2VUOA 4IEFB 1YYLH 3C60D 3BKCL 4NQDB 4WW1B 3K74B 1RY7B 2EXWD 3V4UL 4N0RA 3SDXB 3VH8G 3WLBB 1NBVH 1BF2A 1BJMA 4PD4J 3SDAC 1GYAA 4G7YL 3MRBB 4QHMA 3WN5C 2VO5A 3SO5A 2OM5A 4FABL 2IQAB 4OIIH 4X6BA 5DRZB 2DQJH 4JRXD 1QA9A 4GG8A 3EOBA 2ADGA 5F1NB 12E8L 1GPOL 1MCDA 3GHBL 2XXCB 5DQDL 1KC5H 1C1EH 3AY4C 2HFGH 1I7TB 1LE5A 2LFGA 5SWZD 3X12A 3BO8A 4MA3B 5DMGC 1NFIB 3HRZB 5BOZG 1IEAA 2W38A 4X6DB 3V6ZB 3V6OA 3C5ZA 4PGJA 5T1LA 3PWVB 2AV1A 2G5BA 4XWOC 4XAKE 1EFQA 2O5XL 3WJJA 2WWMD 4DKEH 1GGCH 5T3XD 3ET9F 1QFUH 5C0EB 5E08L 2YBRB 5ESVB 1CD0A 4FXGB 1E4KC 1TJIH 5KZCB 3MRLB 2W9DL 3VWJC 4QTHB 4K94L 1ACZA 5F96H 2EE3A 5IB3A 3W11D 3MGOB 4NQDA 1U91B 3RVUD 4PUBH 1J1OH 1IQDB 2NLJB 3OZ9L 3SDXA 3V52H 3ZE2E 2NZ9D 4PGEB 5DA0B 3RWEB 3E8UL 4L8DA 3LKNB 4NQEA 3MRBA 1CGUA 4HUKB 5IW6A 4HS6A 2HJKB 3L3JB 2GJJA 5DRZA 2QQNH 3W2DL 1PW3A 3ME0A 3C2AL 4U6HB 4F8TA 2RAMA 3ZE0E 5F1NA 1MNUH 1DQDL 1UJ3B 1I7TA 2PKDA 3LIZH 4EUPH 1NFIA 5BQ7B 3KXFB 4YK4C 5EU5B 1C08A 1ONQA 1FSKC 3WHXA 2X7LB 3KJ6L 5FKPA 3NGBB 4Q9CA 2NX5B 3VWKB 1U93A 1A6WH 3IDMB 3FQXA 2B4CH 4HW6A 4K7FB 2G2RB 4G9DB 4TSCH 4FXGA 3EIFA 1UWEL 1QHOA 1G1YA 3MRLA 3RVVC 3K8LA 4FQLL 5IQ7L 1YMHA 4JFFB 2NW3B 1MCKA 2WBJC 3C6LC 4TULH