1UM5H

Catalytic antibody 21h3 with alcohol substrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
VQLQQSGPVLVKPGGSVKMSCKASEYTLTSYLFQWVKQKSGQGLEWIGYIYPYNGGTRYNEKFRGKATLTSDKSSNTAYLELSSLTSEDSAVYYCARSSMSDPGANWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 21H3 L chain
publication title Structural Studies of an Efficient Catalytic Antibody Operating by Ping-Pong and Induced Fit Mechanisms
rcsb
source organism Mus musculus
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H02
2A74B 3S5LG 4RGMB 3TO4D 4PJ7B 5CSGA 1P4IL 5FKPA 4H26A 4CMHB 3CMOL 4CW1A 4WCYL 3TVMA 1OAUL 1IGYB 2NZIA 1YNKL 4Y5VB 4KQ4H 1A7NH 5SWZE 5JQHC 5TQ2L 3U7WL 2OM5A 1FNEB 5L6YL 3O2WH 3F12B 4KUZH 3SN6N 3DYMA 1ZMYA 4F3FA 3HNSH 3LN5A 4JGMA 1CGXA 3T3MF 3F58L 4NSKB 2RFXA 5C1MB 4MXVE 4QRRB 4YQXL 2G5BB 2ED9A 4LSQH 4ODVL 1MFEH 4W81A 2GT9B 3F7RA 3FQUA 4LLWB 4BH7B 5D5MA 3NCEB 2VLLB 3B2VL 2V2WB 2WZPD 4GS7B 4N0YL 4H8WH 5I1EH 4JFXA 1AI1H 4PY8I 5C09D 4PB0H 5L0QB 3HZVB 1UM4H 1DE4A 1EERB 4NQCA 4UBDC 4TYUA 4XNZC 1D5MB 3MLPA 2NY0B 4R90L 2Y23A 4ZUWB 5IB5B 2ZNXA 4NO3A 5HHQA 3LQMA 1KTLB 1WIUA 5EIIB 3SDDC 5J7CC 3VFTA 4OLVH 1AGDB 1HINL 1E6OH 2Q8BL 4ZUTB 2OTUA 5DYOA 2ITDB 4EUPB 3IXTB 4MNQA 4D94A 2GY5A 3QB7C 3PHOA 5A3ID 2PCPB 4G6ML 2NY1B 3DHMA 4UQ3A 5JW4R 3FRPG 1V7ML 1OB1A 1RJYB 5IJKC 2KDGA 5EO1A 4QEGA 4OSUH 3LB6C 8FABA 3WUWG 4KPHL 2DM2A 2B1AH 3QWOB 5SWSD 2QR0B 2AAVA 3BPNC 1EGJA 4WUUA 3H3KA 5CUSH 4ZTOL 3TF7C 3MRPB 4FQIL 1CWVA 4MDIB 4XPFL 4KRNA 3RRQA 1Q0YL 5JIKA 1DR9A 1QBLL 1OM3H 5LBSH 3UC0H 3RGVD 2FATH 3BVNB 4JM2C 2DQGL 1MY5A 4YPGA 5F7DB 5HGDB 5C6TL 4EI5C 2IBGA 2P8PB 2F53B 2PYEB 5FV2A 5J9PA 5ICXB 4IRJB 1YUHB 2XZAL 3QQ4A 4UT7H 1M6OA 3SQOH 3FFDB 3WHXA 3JV6B 4NPYA 3QUKA 3UTTD 1FLTX 3NPSB 4LNRB 4NNXA 4XVTL 1FO0H 5KS9A 3EJZC 3BD3A 5FXCH 1BOYA 5DXWA 2JB6B 3LIZL 4FXKA 4QHNB 3OB8A 2FSEA 4N9OB 5DEFA 4OCLC 4Z7UF 1FVDB 2W65B 4O9HH 3CVIH 1RK0A 1JI1A 5E9DE 3T2NL 1G9EA 3MRKB 4KY1L 4XXCC 3HZYA 3VW3L 3E0GA 4H5SA 4HV8B 4XTRC 4LAJH 1A9BB 2A6JB 2IH1A 3QEQB 4PLOB 4RISH 3G6JF 3R0NA 1T2QH 4UIKL 1FHGA 5FKAA 1G7QB 3T8XB 2YD7A 4Q9CA 3SDDA 4V2CB 5L8LB 3RNKA 1XAUA 3ZE2F 1S9XB 2G5RA 4JFDB 3BPOB 2R39A 1A3LL 4L8CA 1NH6A 5ILTL 3WS6C 1XT5A 5C0DA 2IPKA 3NZHH 2BC4B 4E41B 4R4BB 3TBWB 3T04D 2QHLA 5IJKA 2VO5A 4PG9B 5DJAB 1LNUB 4IBLT 4KI5D 4GMTH 5HHXH 1FZOA 1OAZH 2C1PB 3F7YA 1FJ1B 1NCWL 3MLVL 4FABH 1CZ8H 5CJ8A 3I9GL 4MQ7A 4MCYA 4NO5A 4G9DB 4Z77B 2UWEF 1LO3L 1D5ZA 4JM2A 2BSTB 3NCMA 3WIHH 3O3AA 5K33A 4EI5A 1T22A 4YNYA 1NLDL 3SKJH 1R3HB 4DN4H 3BIBX 1CFVH 1ZANL 2EE3A 2X1QA 4Y4FB 4ZPVB 4U1IA 4S2SB 3KS0H 1Q0XH 2JIXA 3SDAC 5JXED 4N5ED 5KVDL 5FYJD 3MOBL 1HNGA 1KNOB 5C0FB 5MEPA 4LPWA 3OAZK 5J12B 3V5KA 4JAMA 2XQBL 1X5IA 4J1UA 5I74B 1FNAA 4CJ0A 2MQ3A 1MJ8L 1HYSD 3LHPL 2G60H 4PRDA 4XXCA 3RA7H 4UUJB 2B4CH 2YZ1A 4HK3J 1DBBL 1SM3H 2BOBB 2I60L 5LWYH 4HZLA 2GITA 5KVGL 2H45A 4PRHB 4NN5B 4Z7WE 3RIAF 4EEEA 4OCMC 1DQDH 1NCNA 3VH8B 5J6HA 2R56H 5JHDD 1OP3H 4AEHH 4EIZC 1QFWI 2X42A 4PGBA 4A2LA 2DKSA 1N3NB 4NGHH 4O5LH 2ZUVA 2EYRA 3IFOA 3SE3C 3PP3K 3WSQL 3O2VH 3B9EA 3WS6A 3ULVF 4S1RL 3QDGA 4DUVA 1RZ7H 4K3EH 1DBKL 2BSED 3UZVB 2QHRL 3LKNB 1YMMD 1YMHB 3LQAC 2MCG1 3D0VB 3L3GA 3QDAA 1A6ZB 5EU4A 1RUML 1SEQL 3BGAA 3AM8C 4UOJA 4NC1E 1FC1A 2W59A 1PLGH 1YA5A 4F7PA 4ZQKB 4GXVL 5IFJB 3ESUF 1JWMB 4OCRH 5DK2A 4ZFOA 3MRDA 4I48A 4IRSD 3ZT7A 3QRGL 1S7SA 1J0YA 1XF4B 4QWWD 1T2JA 4R2GD 2G75B 4ZTPH 3GMMB 1IAOB 1JIBA 5HHMD 4OZFA 4R4NC 1NC2D 2FH8A 3SDAA 1O0VA 2AVGA 3ARSA 3MBEB 1K4CB 5I19L 4NQEA 1XF2A 5F9AC 1QFWM 2X4OA 1I8KB 3MQIA 1MAKA 1P1ZB 1MVFA 1P2CB 4G6KL 4JPVL 1J1XL 5ITBL 4ELMF 5LAXB 3VXTA 5I30H 4TOYL 2DQTH 1CQYA 1XGUB 4NYLA 5E8OB 2YPLA 1ADQL 2ITCB 2DD8L 4YHZH 3U79A 1UQSB 3GHBL 5DJXA 2ESVA 3SE3A 3PDGA 5HYSG 3C8KA 1X5LA 1YEEL 2WBJD 4TRPL 1E0OB 1RAMA 5L8JB 3ARXA 4F80A 3VA2C 4N90E 3BZFA 5C0BA 2F19L 3NIDF 5IGXH 3VGAB 4NFBA 5GGUB 1T6WA 3AM8A 1AHWC 3HCVA 4Y19E 4PJ5E 2HLAB 4XCYB 5J1AB 4OD2A 5EOQL 1C1EL 1NGZA 2GTWB 4D9LH 1QSED 3RWHB 2C4FU 5JNYB 3QJHA 1KCSH 3KHOA 3PQYB 5CIPH 3C5ZD 4OFYA 4Y4KC 2AJUL 5EBMA 1QG3A 4NQDE 3BUTA 1JPSH 2HN7B 4YHML 5D1ZC 1T5WB 1KJVA 4D2NA 5ESQB 1GAFH 1UCTA 1XF5B 2Z91A 4HS8L 1A02N 1DUZA 2GIYA 4EBQH 2Z92A 1PW3A 3X3GL 3TLRA 4CN4A 1S7XA 1RY7B 1RZJL 3VFGH 4G6AC 3MRBB 1ZGLP 2O5YL 4YDKL 1BX2B 3CUPB 5IW6A 4NQXB 1CFSB 1V3MA 4LFHD 3VFMA 1VENA 4M7JL 15C8H 1WZKA 2FGWH 4P2RB 4JO2L 1RJZB 5I8CA 3ARDB 5EZLA 1JHLH 1S9YA 3HI6L 1VFAA 2CIKA 5CSBA 1NL0L 5J13B 3KYNA 5EUOF 4BQ6A 3DMMB 5C0NC 2VLJE 5CEZE 4L8DA 5H35A 1U36A 2HVJB 3FZUC 4HIXL 1NBVH 1E4XI 1T04A 2ADJB 3IDIB 1AHWA 4N8VA 5AZ2H 4Z7VF 3BHBA 5A16A 3QQ9C 2WMPA 4P23B 5JOFA 4U7KA 3GMLB 1WC7A 3DXAB 1H3GA 2HJLB 3RI5F 4DK6A 4HUVB 3FHAA 4Y4KA 5DMIH 1F45A 2ICCA 1T1XB 5IROC 3UAJD 2DTML 1MCPH 4TTGA 2QQLL 4HJJL 5D1ZA 4G80B 4QRPA 4I77H 3RUGF 4QOKD 1GGIH 4GKZA 4O2FB 1K2DA 3ZYJA 1MLCA 2ZPKH 2FEDC 5DMKB 5EZOL 3GSNB 1X7QA 2YSSA 4F57H 1XGTA 3BIKB 3X12B 2R4RL 1A3RL 2IEPA 4M1GH 1NGQH 3I50L 3U83A 1ES0A 3BP7B 4H88L 3IFPB 4JPWH 3ARGD 4PP1D 3AS3A 3IDGB 1OCWH 2YD8A 4LU5H 3VDAA 1EZVY 5IB4A 4P4KD 1G1CA 4XNXH 3PHQB 1JV5B 3PWUA 3WLWD 4UILL 3P73A 4AT6B 1AGBA 5ERWA 5I8KH 3VFUB 3PL6C 4PJAF 1YJDC 4ZG1A 1GGBH 1IZJA 3BKMH 1DEEB 1T21B 2LVEA 3T3PE 3ALWA 2FL5A 3UTSA 2XN9D 5I1IL 4EI6B 1U8LB 2GJ6A 3CDGA 1KC5L 4MXWH 1JGLL 4FNLH 4F7CB 1DLFL 5JOEA 3W0WB 3NACH 2X89A 4KMQA 1S9KC 1PG7L 3QUMH 2BX5A 5E8EB 4PBVC 2PO6C 3GJFB 3HPLB 1TIUA 3GSUA 4XCEB 2FBJH 1KTDB 2FNBA 3LKSA 4NP4H 3BH9A 5IROA 8CGTA 4ELKB 4PJBE 3V4VL 1KGCE 5D7JB 2AABH 1ZWIA 3E2HB 5J3HD 2D03H 2HJFB 4H1LA 3LD8B 5AEAA 3QXVA 3A6CL 4QRTA 3GHEL 3KLHC 5TF0A 1XGQB 4NM8H 4P2OD 2YXMA 4RNRA 1INEL 1RIVH 5GS0H 2DQHH 1JPGB 1M7DB 4XPTH 4OZIE 3H9HB 4JB9H 3O6FC 3DBXB 5FUZL 4Z18A 2BJMH 5D1QA 4LFHG 1AO7E 5BCAA 3SE9H 1I7UB 4Q74A 5EOCH 2BNRA 5JORA 1HQ4B 4PJHF 3U6RA 3PL6A 4GW4A 4PUBL 4CN1A 3L5JA 3BQUB 1LE9A 2VLKA 4FQ1H 4YO0A 4MSWA 2BCKB 5D93C 1OP9A 1YPZF 3S34L 3KYMA 4Z7UA 4YZFF 5C9JA 3RI5K 4PS4L 2E9JA 5I0DA 1C5CH 5F89B 2OP4H 3NGBC 4PV8B 1XCTB 1I8IA 5ABDE 4DUWA 1EGJL 3MRFB 3FT4B 1N5AA 2CMRL 3TH3T 3VWJC 4GT7A 3G6JA 1JF1B 2VDNL 2PO6A 4JHBA 1CFNA 3VGFA 1UWXK 1F8TH 5BS0A 2RB8A 3QFDB 5JZ7C 2Z35B 5CINL 3EHBD 3MLRH 1XR8A 5GRVK 3TBSB 4M00A 1HOCA 4P5TD 4R26L 1P4IH 4WGVB 3ULVC 4GLRI 3NTCL 4EJ1C 5FEBA 1OAUH 1UZ6F 1YNKH 5FM8A 4KKAC 3N85H 2CO7B 4V1DD 3U7WH 2YWZA 2W0FB 5JOPD 4MGXA 1Y18B 4XH2A 1EO8L 1CLCA 3FONA 3O6FA 4YR6B 3JTSB 3WYRA 1SYSA 1BJ1J 2ZG2A 3OG6B 4RGOL 1GC1H 1UM5H 2UWEA 2NXYC 1IC1A 1YNTB 5D7LA 2X6MA 4ZFFB 3L9RB 4HT1H 1UVQB 4CN6A 1WTGT 4HUXB 1LQSR 3P77B 3GKWL 5BO1L 5E56A 4URTB 3R06B 4G7YH 4WHYH 4PBXA 4YQXH 1U3HC 3JBG7 3MGAA 4ODVH 4PGCA 3ULSB 2FEEI 1MLBA 5KJRL 4WDIA 5T3XD 4I2XB 1VADB 4OBRA 4ZD3L 2DICA 5T1KD 3QUYB 4HBCL 3G5ZB 5CJOL 2DI9A 4HCRL 4I18B 3OJDB 3GM0A 3VWKB 2V2XB 5ISZB 2NY2B 3VCLB 1T1ZB 3MRRA 2F8XC 2VMFA 3VWJA 5DRZA 1JN6A 4YFDB 1LEIB 4XP1L 4NZUL 2AXHA 4G6JL 2JLLA 3MRHA 3FQRB 4R90H 5SWZD 5FKPB 2VZTA 3QH3B 3RVXC 2Z9TA 5DRXA 4DKFL 3TVMB 1HINH 4LLDB 1I1AD 1CN4A 4K8RD 5CP7A 4WFGE 4G6MH 4KK8C 3U9PH 1CR9H 4KQ3L 3O6MH 1P4LA 3VD4A 2NXZD 1WWBX 5J6GA 3HR5A 1TETL 1ZTXL 3UP1A 4N1HB 3HE6C 4NNYA 1H3VA 4ZPTA 3ZKXB 3B3IA 4HIHA 3P0GB 3K2MC 32C2B 43CAB 3BW9B 2J4WH 3CU1A 3WS3B 2E7LC 5HDBE 5E1AA 4FQIH 5DURD 3FB7A 2LAAA 1HH6A 3UTZB 2WLZA 4U7MA 3MJ7B 1U3HA 2DQGH 4X5XB 5C6TH 3DRTA 1LO4L 1HILB 1PAMA 2AK1L 5D5MB 4WI3A 3QG7L 1JGDA 3E6HA 1JGVH 2FCBA 1NDMA 4XVTH 2XQYG 1KIRB 1Q9KB 2Y7QB 4XAKD 1MHEB 3RQ3A 3WEXB 4KGLA 1MVUA 3LIZH 4JFXB 3FO9B 4M3KB 4EXKA 5T3ZL 4ELMA 1NJ9A 5DRWA 2BRRL 5B4MC 5KBNC 2R23A 4PRIB 2AQ1A 3F7QA 3T2NH 2GQHA 4YX2L 1FSKC 3SEPA 2ZCHL 4ZFOL 3OAYH 2B2XH 1U9KA 4NO3B 1MIEL 2X1OA 3UX9B 2C26A 1J88A 4R7NB 2FGZA 4OZHB 3BWUC 4ZFZA 3ZDZF 3MLUL 1CTNA 4G43A 3MV9B 1BHGA 3LKRB 4MNQB 3IAGC 4HUNB 1A3LH 4X6BA 1RMFL 5D7IB 1RZ8B 4JPIB 5TQ0L 4UQ3B 2B5IB 1BFTA 5ILTH 1OB1B 3QNXA 5L2JB 3PDOA 5F88B 3QCUH 3HE6A 3H9SB 3PG2A 3T1FA 4TSAL 3QA3B 4KGJA 2NW3A 2VXTL 1S3KL 5MEOA 4WUUB 1NGWA 2HJKB 2AK4E 4ONFL 5EU6A 3NFNB 5IQ9B 1NCWH 2DYPA 1LDPH 2E7LA 3I9GH 1PFCA 5BRZB 1G6RA 1BGXL 2Q86B 1LO3H 1NBZA 3C5JB 4ZAKC 3RGHA 5IB3A 1NLDH 4ZOBA 2DTSA 1ZANH 3F7VA 4U1HB 4NUJA 4OLXH 5E9DD 3EO9L 4FXKB 2YD1A 2AEQL 1T89C 5DEFB 4Z76B 1ITBB 1J0KA 4K2UL 4PJCB 2R29L 3AU1B 1YEHL 3QEHB 4H25B 1PEWA 3QJFB 3U4BL 4A6YA 4WU7A 1MJ8H 1K9TA 1FVCB 3LHPH 4HSQA 4H5SB 1CFQB 4HIEB 5DSCB 2BVPB 5T33L 2I60H 4XX1E 5E2UL 2BOCA 4FFVC 4FQCL 3FQWA 4F7TA 2VQTA 2WQ8A 3SDCD 4M61A 3GMOB 4LQFH 4GW5A 3LEYL 1IGTB 4CU8A 5F6IC 4ZSOE 4NQSB 3C6LC 4YLQT 1FO0B 2QSQA 2W9EH 4S1RH 5IHUL 3IJSB 1AGFA 2QHRH 3RWCB 5T1LB 5FOBA 1V8HA 4Z7VA 3L3JB 2Q87A 2JCCE 2M8XA 2DDQH 1SEQH 5I9QC 1DBMH 4Q0XH 1II4E 3FB5B 2EDOA 4NO5B 2B39A 1IGJA 3LMJL 4CRPA 4MX7A 2VDQH 4GXVH 3SY0A 5JPMA 1XCQA 1DUYA 4EI5B 5I0ZA 1YEGL 4ZAKA 5E00A 3FB8A 1WZ1H 2PN5A 1WLHA 3QRGH 4TNVK 3GMRA 4C54A 3RUGA 4QHMA 1XZ0B 3D0LA 1T5XA 1JRHL 5MHSD 3CFEB 4QRRD 3GBLA 3RDTA 1NAMA 2YUWA 4PJEE 3V6FA 3HS0A 3NZ8A 1E27A 5I19H 4Z0XA 3CLEH 3DUSB 2C3WA 3V5KB 1F90L 1PBYA 2EECA 4HKZA 4YGVA 3O41A 4E0RB 2DL2A 2APBA 3SJVA 4G6KH 4D0BA 4JPVH 1J1XH 5ITBH 1GXEA 3AVEA 4XXDB 4DGYH 1S7VB 4K3HA 4LHUD 1CLZH 1MCDA 1I1RA 3ULUH 5FA3A 5GS1B 1ADQH 4U33A 5L88L 4PGBB 3VGBA 3QDJB 2EYTB 2EYRB 3GHBH 5EZIL 5AAWA 5KSBF 3UPRA 4FZEH 2P48B 5D4QA 3C6LA 4LVHC 1NCAL 1YEJH 1J05B 3HG1B 3C6SB 4NQCE 4QXTB 2UYLA 4I8DA 5ALBH 2YMXL 3HPJB 3CPLA 2H32A 4GUPB 5EU4B 1PY4A 4LKXB 5L2KB 3KPLA 1OGAA 4MD4B 3U48A 5FO9A 4MA1B 1VA9A 4F7PB 5HGAB 4YDVB 5EOQH 1C1EH 3MRDB 3IDJA 2C4XA 4G9FA 3LS4H 1ZLVH 3BKYL 4KKLD 2X09A 4LGPB 1J18A 4C57C 5I1HL 1FN4A 1NFIA 3Q2CA 2HMIC 1A6UH 1E28A 4OGXL 2R2BB 1BQHG 1S5IL 2DQIH 5E8PA 5INCA 4YHMH 1JPST 3NIGE 3L3OB 2XTJC 2D31A 1U2HA 2PYED 1NFDB 3NOIA 4WUUE 2H41A 2X4OB 1G7HB 4MA3A 3JTTB 2YUZA 1RZJH 2J8UE 2K9UA 2O5YH 4PRPB 5DD5L 3LS5H 5HY9A 4C56B 2ZCLL 1JL8A 3CFKA 1VSCA 5KS9E 4M7JH 4X4YB 1L9NA 2K7PA 2O5ZH 4JO2H 3QPXL 5F7WC 3C8KB 4N90D 5MERA 3BZDA 1NMCC 5DGRA 1NL0H 3QEQD 5F7FA 4ISVA 3QG6B 2LABA 5ADPL 3DX6A 4HC1A 4Y19D 3QHZL 4DK3A 3EGSA 2DMKA 1PYWA 2KPNA 4HIXH 5C0BB 1T20A 3MRCB 2PTTA 1IC7H 5K9KA 1G7LA 2DWDA 4OCYH 2ATKA 3VJ6A 4Z7QF 4MZ3A 2XWJB 3THML 5I15L 4HWBH 1NGZB 4NQDD 3DSNA 4FFWD 3QIBC 2EH7L 4XZUA 1UA6L 4YWGL 2HG5A 2X7LB 4Y5XC 5GQBA 2VWEE 4BZ2L 2V17H 5D1XC 5TFSL 1YJDL 3OR6B 3LCYA 3PE9A 5I73C 2QL1A 1MFBL 2X4RB 3S96B 2E9WA 2QQLH 3EOTL 3ARBD 4RMVA 5EZOH 1SQ2N 3MUY1 4HH8A 2R4RH 1A3RH 2Q7YB 3K2UL 3RY4A 1OAYL 4RDQG 3BE1H 1JZ4A 1ZT7A 2H26B 4H88H 2BVEA 1QQDB 2OL3L 2EC9T 2V7HA 1FFOA 1YNLH 4CGTA 1CE1L 1I75A 5JW3H 4ODHL 1UADC 5CEZD 4TVPL 5FO8A 3KXFA 2GSGB 1S9YB 1VFAB 2YKLL 1ACYL 5CIPB 2JK5A 5KSAB 5HI4C 4HIIA 4D9RE 4NCC1 1TTGA 2VN7A 3ES6A 1FC2D 4TSCH 5J4MA 4C4KT 2P5EA 4NWUH 5I66B 1TVDA 1Z3GH 1J87A 4N0UA 5I1IH 1T04B 2IADA 3WN5B 4EUPG 1FYTA 1KC5H 5D72H 1FYHB 3MREA 3BHBB 1JGLH 3Q6GL 1AGCA 2DBLL 5CD3A 1PG7H 3KLAA 3ZHDA 3QIBA 5EU3A 3MRIA 3RWIB 3IKKA 1YY9D 2WWKT 4Y5XA 5D1XA 1JP5A 4I0PC 3QDGE 5IMKA 3DRQB 3TJHC 2JJUA 1SBSL 5EH1A 4YHIB 1F4YL 4HS6A 4F37K 5D1ZB 4CAGA 2XNAB 2AI0L 4FQPA 3V4VH 4GKZB 2H6PA 4OF3A 1MHHB 4P2QB 3IF1A 1X7QB 3A6CH 4ZYKA 3GHEH 3V9FA 2A83B 4XWOD 1DSFH 2EKSA 4CVZA 1FCGA 2GI7A 1P7HL 4JFYA 3ETBF 1INEH 2R0ZL 1CG9B 2APXA 2FO1A 2G9HA 4PREA 3IDMB 3UPCA 5IP4A 1WJ3A 2IF7A 1I7TB 3PXJA 3FMGL 1CYGA 5JO5B 3P73B 3ULVL 2F54A 3QZWG 4NQEE 1RQ5A 1SYVB 4WTZA 2IAMC 2DM3A 4MJ5A 2JJVA 2VXQL 3RVTC 1MWAA 2H9GA 3W9EA 5GGVL 5DC0A 5GRYA 4HK0B 1TJHH 3MJ6A 2KKQA 3S34H 4QGYA 2P7TB 1YY8B 4RAUA 1IGCL 1T66D 2DQEL 4XBGA 4PS4H 3WBDA 3S3SA 2YPLE 2YUVA 1FGVL 4LLUA 1QBML 5IMMB 1BVKB 1MHPH 3M8OL 2NMSA 3BZEB 2ESVE 1U8HA 5EULV 1FDLH 4MD0B 1U8OA 1EJOL 2VDNH 4I0PA 3EOYG 1QLRA 4R8WL 2Q76A 3D39E 3NCYP 5CINH 3EJYD 4KTYA 1G0XA 1F5WA 1A1MB 1QA9B 5EU5A 4R26H 5DJ6B 1ZWIB 3QXUA 5FDWA 1M71B 1LEGA 1BZ9A 3NTCH 5BOZG 4BFIB 4K07A 1I85C 4MAUL 3WFHB 3OKYA 2XWBA 1FGNH 2VAJA 1NGYB 3MJ8A 2GTZB 1WEJL 1HXYB 3C8DA 4O58H 2GHWB 1KJMB 3WO4C 3FQNB 1MIML 4U6YB 5E2WL 2PYFA 1T0PB 3UTQA 4JEGB 4JZJC 4M4PA 4APQD 4OUUA 3QXTA 2E6PA 3U6RB 1ZEAL 3PIQA 5AYUL 3TBTA 2IAMA 5BO1H 1BWWA 3FRPA 4GRWF 2VLKB 3CFIC 1NGPL 3D25A 5KJRH 3VH8G 5DF0A 5JPNB 1B0WA 3KYMB 2OI9B 1JTTA 3EIFA 4Z7UB 3WUWA 4HBCH 5C9JB 5DEGB 3RBGA 3GI8H 4HCRH 2Q8AL 5E08L 4BQBA 2CKBL 3I3EA 1I8IB 1U8NB 1LE5A 1FNFA 1N5AB 4X83A 2X41A 3VXRB 4XP1H 1CFNB 2NY6B 5HHPA 4G6JH 1H15B 4MB3A 3LH2L 4AG4H 1XR8B 2ARJB 2LV4A 4IS6B 3X13A 4WJ5B 4KKBD 4B50A 3U7YL 5DMGD 1J7VR 3AB0C 4DKFH 2VR9A 3LKPA 4EXPX 1I85A 2K3TA 4BSWB 4JG0H 1JPFA 3IFNH 2CLVA 5DVMA 2I07B 3BJ91 4A6YL 1D6EA 1TETH 2ZUQC 4XH2B 4ZNEE 1CE6A 1EUTA 1NDGB 3WE6A 4TPRL 4NFCA 2A2QT 2UWEB 2W1NA 3VFOB 5H8DA 1QUNA 3GBML 5FYKL 4JZJA 3MO1A 4QRPE 1HDMB 3FOMA 2DQJL 4MD5B 2VB5A 1CI5A 1MCFA 1PKQA 3O4LE 4KXZI 5CD5C 1QFOA 2CLZA 1MLBB 1UXWA 4NFDA 3V0VA 1K6QL 4MAYC 2AK1H 4QXGL 2EZ0C 2WUBL 4QTHA 3MNWA 4C59B 3T3ME 2YWYA 1JNHB 3TCLA 1BOGA 4L3EB 5I71C 5D9SB 4LP4A 2P8MB 4NT6A 5T3ZH 3VWJB 4XNMA 3UO1L 5KZCD 1JN6B 4Q9QH 5FB8A 2IFGA 1AD0B 3O8XD 2L7JA 5DHYA 7FABL 4KAQL 3UPAA 4XHJC 5GRJL 2HTLC 1KG0B 3IB4A 1T3FB 1RUPL 2PF6A 3W0WD 3UJJH 1MIEH 5KSBA 6FABL 3MRLA 5E24E 3UTSE 3CCHB 1OQOA 4BZ1L 5B22A 3BPCA 1NEZB 1S78D 2GJ6E 1CGTA 3MLUH 5CJQL 1NAML 4FG6D 5GRVL 1RMFH 4FQXC 1ZGLA 1OTSC 5TQ0H 4N0FB 4BFBD 5IMLB 1BVLB 1J9CT 7CGTA 3MGTA 5DI8A 3EAKA 2BXZA 3HR5B 4O00A 1U58A 4OI9A 4WY7L 3VFRA 2Z31D 3B3IB 4I1NB 5HYQB 3QI9C 5C07A 3PWVA 3SQBA 3T0VA 4X6FA 5FV1L 3SE8H 4HXAH 2R1YA 1HH6B 1MY7A 4DZ8A 5HYFA 1BGXH 4J2XA 3DRTB 4J23A 5MENA 2WLYA 1Z9SA 2WUCL 1X5FA 4MAYA 2HT2D 1VFBA 1M7IA 4G6FB 2O93L 3QIWB 1KJ2L 3OV6A 2PTVA 3VG9C 1W72H 3EO9H 4L4VB 4PR5B 4CVXA 2NLJB 1PX4A 1KN4L 4RMWA 1NJ9B 3MRMB 5DRWB 3DV6A 1KV3A 2R23B 3OR7A 4XPGL 5IIEA 2BNRE 1EHXA 4MLIA 3VRJA 4X8JB 2R29H 1YEHH 2HP4A 3U4BH 3SGKC 4HPOL 4OTXL 3P4OB 4U3CA 5T33H 1G84A 3KGRA 4NO2A 2XI9A 5EWIH 2FJFB 3UTTA 4FQCH 5B3JF 1KTKE 4OLUL 1JGEB 1X5JA 4JO1L 3LEYH 1NLBH 4G3YH 3EO1A 3D5OF 3EZJB 2NNAB 4FQXA 4GG6F 3TPUB 4JJ5B 4LHQB 2CD0A 4RAVB 1UACL 2Y36L 3AAZA 4LKCB 5IHUH 3G6JE 5HD8D 3HE6B 5KSVB 4G8FA 1L4IA 4MCZA 5BS0E 2NW3B 3ZE2E 3QI9A 3AXLA 5MEOB 5EU6B 4TVPE 2DYPB 2BVQA 5T5FL 1N7ML 4LBEB 2ZSWA 3MMEB 1G6RB 4HJ0C 1KLUB 1X5XA 3LMJH 2WIIA 4HKXA 2NZ9D 1PY9A 4NM4L 1YEGH 5IF0A 2DQDL 4P5MA 3CJJA 4ZUUA 3TA3B 4NUJB 3SPVA 5AZEL 1WAAA 3QEUA 25C8L 5IB2A 1JRHH 5IUSA 3EYVA 1U8KA 3CSBA 2ICWJ 5D7LE 2QADB 5ANMA 1MI5B 4LOUD 2IJ0C 2XZZA 3TN0D 1FBIH 3QUYD 1LP9F 4PJ8D 3SGKA 1SVCP 1N4XL 2FIKA 3VWKD 4PGZA 1I1YB 3O2DL 4UV4H 1MFDL 1ZLWK 4LDLB 5TH2A 4M61B 4LDOB 4GW5B 5EUOB 5L88H 1NAKL 5GRWA 2X44D 5KVMC 3VI3F 3FL7A 3P4MB 5EZIH 1YZZA 3BFOA 4U1SB 4IJ3B 3KJ4C 1NCAH 3IJHA 3EYUL 2D3VA 3EYSL 3P30L 1T83C 2CDEA 4LCWE 5BV7H 3L3KB 5IK3B 4Z7VB 1EZVX 4JVWA 5DUBA 3X11A 3TVMD 3GZKA 2BHYA 4B7IA 2YMXH 5CGYC 1IVLA 2NQCA 4OLZH 2LU7A 1MREL 2QKIB 4TUKL 5IHBA 1BZQK 1UB5B 3ULVE 2CUMA 2HVKB 4JLRA 2VDLL 3SY0B 1CXFA 1XCQB 3KYKH 5HHVL 1WIOA 1WZMA 5CSZA 4Y16C 3BKYH 3DI2B 3RUGB 1BM3L 4JE4B 3VMOA 4YIQA 4HGWA 3TNNA 3WNOA 4M7LT 4HF5L 2Y06H 4QCIA 4OGXH 3T0EA 5B21A 1IL1B 1T6VN 3FKUS 1SMAA 3BXNB 3GBNH 4HXBH 4KDVA 5FGCB 3HS0B 4HLJA 1OVZA 3MROB 3KPNB 3R0MA 4UMGA 4LF3B 5IHZA 4HKZB 4PV9B 4N8CH 3QHFL 4YGVB 3O41B 5IVOA 4R3SA 2XQYK 3K4DA 4OV6F 3SGDH 1D5BA 3ZKND 4TULL 4XBEL 5DD5H 5FA3B 5CBAB 1JWUA 2ZCLH 3BN9C 1LDSA 3S4SG 3KPRA 4PJAB 4NQCD 4WO4B 35C8H 2BNQA 1UWGL 4M5YH 2E27L 5F6IB 3QPXH 3C6LB 4YHLL 3JUZA 1DVFC 4ELME 5DJ8B 5ADPH 2UYLB 3QHZH 5SWQA 1NFKA 2H32B 3ROOA 4QF1A 4MNQD 2Y25A 2I9LB 3CH1B 5I9QB 4UAOC 5C92A 3THMH 1MPAL 1IAMA 4XGZA 3QT2A 3IDJB 2EH7H 4YWGH 2PW1B 1MCQA 1PSKH 4Y16A 4ZUVA 3FT2A 2YPKB 1U93A 4YXHL 5C0JA 3NIDE 1FN4B 1MWAL 4WUUD 4YXKL 4TSBH 2NY5L 4ONHA 1A6AA 3TJEL 3KR3L 3ALPA 1A4JB 1MFBH 1Z6JT 4P49A 4YHKH 5BRZD 1KB9J 4DZBA 1KEGL 3RTQC 3GSQA 2EE6A 1A1OB 4PJGF 2R2EA 4TNWK 5EU6E 1P6FA 2NY7L 3AS1A 4XX1G 3QDMA 2VTFA 5J89A 3LZFL 4MJ6A 3K2UH 5BQ7A 1OAYH 4BH8A 4KVNL 4WFHE 2OL3H 3QNYB 5K59F 2I9TA 2W9DL 2EYSA 5CEYA 1CE1H 5K9QG 4PJHB 2ZOLB 3G6DL 4UBDD 4TVPH 4YBLB 1HK6A 1KB9K 3PWJA 5CEXB 3RFZC 5MERB 4GKSB 5DZOA 1Y0LB 3KHQA 1YPZB 1ACYH 2HFFA 4FP8H 4LCUA 4HFWA 1DVFA 3VXMA 4ISVB 5MEQB 3L3HA 1O7SA 4HKJA 3SDDD 5FIEA 1PYWB 5BXFA 4OM0L 5EO9A 3T4YB 3WL9A 3VRIB 3WCYA 1T20B 2VLRB 3MCKA 4B41A 3KPSA 1NCCL 3VXQA 1G7LB 4UDUA 4KV5F 3S35H 4K9EH 3Q6GH 5FYKE 1B4RA 2DBLH 3LB6D 4XZUB 2P24A 4OAWA 3QUZC 4KFZC 1U95A 4NKDA 2Y07L 1IEAB 5ACZA 5TDNA 1AXSA 4Y1AB 4JRYB 3MRQB 3TP4A 3Q5OA 3ZDYF 4R7DB 2XXCB 3VXNA 5C2BL 1XIWC 5CWSB 3MNVA 3RTQA 1JPTL 2AI0H 4JM2D 3B8YA 5JUEH 4EI5D 3VD9A 1MH5A 4P48A 4WNQB 3MRGB 3MLYL 3MLWH 3TM6A 1HHHA 3U46B 1VPOL 3EJZD 4MLSA 3WNLA 2JIXD 4EN3C 4IM8A 4U1LA 2ZUTA 5F7UA 4R9HA 5C8JB 4HH9A 2R0ZH 1QYGL 2ENSA 5FYJU 1FFOB 1FLRH 4QHUA 5GISL 3KPPA 1NPUA 2EDNA 2IGFL 4LCYB 5HVHC 3TYFA 4D9RD 5DUPL 2EICA 3KXFB 5FO8B 3FMGH 4LHJB 1RHFA 2DBJA 1C16A 4XTRD 3RZWA 4PRBA 2DAVA 3O4OB 5CP3A 2GY7B 2NW2A 1H3UA 5A1AA 5DK0A 1P5VA 2RGSA 4PJFF 5GGVH 5F7KC 4RRPG 1F02I 3SJVE 2UVFA 1AQKL 1EHNA 2IADB 4QRUA 4P59L 2ZUSA 5LGHH 3EFDL 4LVEA 3OZ9L 2FD6L 3QDGD 4OV5A 3MRNA 1FGVH 3AS2A 3KLAB 2YA2A 3TWCH 5IBLC 5KSUA 1QBMH 4JRWA 1I3GL 1MJ7L 3QIBB 1H8OA 3MRIB 5F1IA 3QUZA 1QHOA 5ID1B 2NY4C 4KVCL 3CLFL 2VQ1B 2NYYC 3BKJH 3HE7C 2LTQB 4R8WH 1XIWA 1ZS8A 4Y2OA 4G8IA 5CS7A 2ADGB 1JMXA 1UYWL 3OWEA 1JVKA 3KJ6H 3BJLA 2VAAB 3IF1B 5TF1H 4MMXC 2PETA 2ZP0T 3UYPA 3JV4A 1OGAE 4UQ2A 4DOHE 2BNUB 4QHKJ 3F5WB 5I1GL 1PZUB 5CJ5A 3SDAD 4MAUH 4EN3A 1MCWW 3QXAA 4TN9A 2KQNA 4J6RL 4G9FE 1N2RB 4QRQA 1WEJH 4NQED 3QIUC 2ADIB 2FR4A 5JHLL 5I16B 3BDXA 2OSLA 4NQTA 2W9LA 3KPOA 3BMVA 3UXFA 1HH9A 4Y4HB 5IV2A 5M95B 1HSBB 5ENWA 1ZEAH 5AYUH 3RVWC 3PDDA 2YPLD 3U30C 3LPWA 3W9EB 1NGPH 2B1HL 4UDTB 4ODSL 3J8F7 3QXWA 2YD2A 4XPAH 4U6VL 2ESVD 4PGJA 4K7PY 3RWDB 3F8UB 1FNHA 1TTFA 2CKBH 1D9KB 1H5BB 3FO0H 1R5VA 1U8OB 3EFFA 4X7CC 5C0BD 3HC3L 1KB5A 3G08A 3EYOB 4P5KA 2I5YL 5D96B 4W68A 1J11A 4YZFE 2D7QA 3LH2H 5CZXC 4BELD 3HE7A 3BP6A 1J0JA 1FG2A 5CBEA 5HGBA 2HKFL 3HRZA 3BD4A 4GG6A 1DCLA 1M1SA 4GAGL 5C0AA 4OFYD 1R3JB 4R4ND 5F9JA 3I85A 2LAGB 5LCVH 3SKMA 1ZKAA 5KTEH 5JIHA 1D3CA 4HX1A 3MJ8B 1JI2A 2FO4B 2WBWB 1FP5A 3LN4B 3QIUA 4TPRH 5F6HI 1DQTA 3PABA 1SVZA 4P5TA 3ARFB 3FAWA 1ORQB 3GBMH 4JFEE 3AREB 2XTJE 3IDXH 3TBTB 2R0KH 2X2YA 3Q5TA 3IT8D 5LJYH 1ZVYA 1UM6L 4XCCL 4LASL 3OMZA 1K6QH 1BD2B 4QXGH 1OF2A 3UJIL 1K3IA 3CGTA 5I76A 2NTFA 5I6XB 3LQZA 5F44A 1F2QA 3ME0A 3PV6A 4F9LC 5IHLB 4WIQA 1E4JA 1LP9A 3PWNA 2X4QB 3HAEH 5C0EA 1EO5A 3IVKA 4MQSB 3SBWC 3G6AB 5F97E 3TO2B 5HJ3A 3MZGB 3BX7C 5GRJH 3H7LA 4FQQA 4X9GA 1J8HA 1F4AA 5KOMC 1RUPH 2J7LA 1F4WL 2P5EE 4NHCL 3VE0B 1G7JB 4KC3B 1H3PH 2OJEB 4J8RA 4N0UE 5GGTA 5FHAH 1FYTE 1UWXH 1H0DB 1BBJA 4Y4KD 1RUKL 2CLVB 3OHXA 4ODUB 4OZFG 5DD6B 2PUQT 4LVNB 5D1ZD 1MJUL 3G9AB 5GSRA 4NN7C 4QRPD 4LMQI 4NKMA 3WE6B 5DWUL 5J11C 2DI7A 4F15B 3HNTL 5ICYA 4NQVA 4P46C 1RZKC 4G5ZL 1AY1L 5B38B 2NCMA 3MV8B 2FYYA 4JZJB 4G6AD 1EFQA 3WLBA 1T7ZA 4BKLA 2MHAA 2W0LA 1PKQB 1QSFB 2E7MA 2D4DA 3K1DA 3B8SA 4L4TA 4WTXA 5FYJL 2DQUL 4MDJB 2WUCH 4UU9A 2LVCA 1INDH 4PYGA 5SV3A 2QQQA 1KJ2H 3BD5A 3FCTA 2X4PA 3V7AE 4F9LA 4LLMB 5CMAB 3TZVB 3MOQA 5C0ND 4YDJB 3SBWA 3NN8A 1KN4H 1KBGL 3FZUD 1ZSDA 5HHOB 1CCZA 2F54E 5FB8B 1RZKH 3UTSD 1P6AB 2VZ3A 2EDWA 2GJ6D 5KN5B 3CSPA 3SKUD 4TVSa 4OTXH 2X89D 4DKEL 1OLLA 4IHOB 5KSBB 3QQ9D 1R3LA 3O6LH 4LIQE 3ARRA 4NIKB 5CFHA 1RZIA 3OXSA 1A2YA 1QNZH 4OLUH 3OGCA 3JWNC 4M43L 3JXAA 3RWEA 5INDB 4KTEL 4NO0B 5DQ9A 4M48H 4X6DA 3TBVA 3U36B 3VXUA 1UACH 2Y36H 4RGNC 5IBTL 4OFIA 5FK9B 2ZUQB 4OJFL 2GW5A 4XAWH 5E6IC 1IT9L 2FEDD 1HHJA 5ALCH 4YAQA 5IEHA 2VH5H 4Z5RA 3ZDZE 4WENB 5C07B 4MS8C 3TCXA 4PRAA 5FO7B 3HMXA 2BSSB 3PWVB 5KG9B 4L29A 4P46A 3MLSL 4NUGH 4WI4A 3RWJB 3PWPB 1N7MH 3I2CH 4DZ8B 2OTWA 5D6DC 4L8BB 3VFPB 4MZ2A 1L7IL 1DFBL 1YYLL 1VFBB 4JKMA 2DQDH 4PJGA 3X14B 2BVYA 2XY1A 2BNRD 1D5XB 2EIDA 4WFEE 5AZEH 2IG2L 3HC0A 4Y5VC 3PL6D 3VFSA 2YA1A 2VLKD 3RPIB 4F2MB 1S7RA 2HRPL 1G7MB 4ZFGL 3O3DB 1NQBA 4K3GA 4JKPL 3DVGA 4QTIL 3PGDA 4N0CC 1BQLL 2HWZH 2SEBA 1J5OL 4CNIB 1MAJA 4N8VG 1G7IA 3O2DH 5EN2A 5C0GA 1MFDH 1NGXB 1A22B 1Z5LB 5CHNA 1NEUA 2NY3B 2PO6D 4MJIA 1JNLL 4MA8L 2DB8A 4ENED 5E6ZA 4HK3N 1FZKB 1HEZB 2HLFC 4XP6L 1L0QA 3RHWF 3D85A 4Z78A 1W72B 3AAZB 3IRPX 5E5MA 1R24A 3EYSH 1QR1B 3P30H 3L3DA 3MTRA 3ARYA 5E6IA 5DZNA 3X3FH 2IALA 1GZPA 3BGMA 1FIGH 4XC3L 3QI9B 2ZCKL 4E5XA 3KLHD 3IKCA 3ZHKA 1R3IL 3DOSA 1JFQL 3QQ3A 3D1MC 1MREH 4UT9H 5H94B 1GZQA 2CH8A 5L0QC 5F7MC 2YN3A 4G8GA 2VDLH 1T1YB 1QEWB 4HKXB 5D6DA 4MQTB 2HA1A 3O6FD 1ZHLB 5HHVH 3V0AC 1X5AA 2NY0C 4D9QE 2A74A 3BISA 5D7LD 4FTVA 3OB0K 4PJ7A 4M9PA 4PRNB 1BM3H 1ORSA 4HF5H 1B90A 1OGTB 4GAYA 3EYVB 2EEAA 2P5WB 4Y5VA 5GZOC 5GZNC 1P7KB 2Q6WB 2YUXA 4G8EA 2NY1C 1FNEA 2XZQH 2IANB 3QHFH 1R5WB 3F12A 3HKFA 2OXHA 3VXOB 2FIKB 4Q97A 1I1FB 5D2NC 5C08B 2R9HC 2DLHA 4RSVA 5FUOL 4L3ED 4TULH 4TTDC 4X4XB 3CFDB 3TGXA 2PR4L 3VWJD 4GBXB 2AV7B 2G5BA 2E27H 4PJ9B 5JZ7D 4PJFA 1BLNA 1ZVHA 2BRQA 2GT9A 3KWWB 4IRJC 4LLWA 1AXTL 4BH7A 2WW8A 2CDEB 1XEDA 3H7BB 2VLLA 2XZCL 2BMKB 4XP4L 3ULVD 3NPSC 1BEYL 2V2WA 2VERN 4H1LG 1F6LL 2UV3A 2O61B 3RJQB 4KKAD 5D71H 4NOFA 2PXYB 1JZ8A 4JY5H 4XP9H 1YEKH 5EB9A 3QUXB 3WD5H 2YS4A 3LY6A 4RCAA 5LQBL 1MPAH 3PNWB 5CSZB 3UTPD 1D5MA 1FFPB 4ZUWA 5IB5A 4X5LA 3OQ3B 2NXYD 4YXHH 5GGRB 4YIQB 5EIIA 4QCIB 4K3DL 1AGDA 1MFCL 1GL4B 2NY5H 5CJBA 4ZUTA 3KDMA 3BPOC 1CDCA 2ITDA 4GQPH 2R0LL 1ZAGA 4ESKA 4EUPA 3IXTA 1KEGH 1U3HD 3T65B 5BV7B 2PCPA 5AWNL 3HUJF 3MA9L 2X40A 3V4UL 2YPVL 3MYJB 3MA7B 3LZFH 2OQJA 1OSZA 2HH0L 2J3SA 5ADOL 3WNNA 4KVNH 4B7LA 4RA0C 2EO9A 5MENE 5D2NA 1FL6A 3QWOA 3HNVL 1JWUB 2W9DH 1MRFL 1KCUH 1AFVL 1GSMA 4BUHA 3MRPA 4MDIA 1F58L 2VRAA 3G6DH 1T03L 1F3JA 3BVNA 4YHOL 4OGYL 5F7DA 4XB7A 5HGDA 2IQAA 2P8PA 2F53A 2PYEA 2EDBA 5ICXA 1WBZB 1YUHA 4IRJA 3SOBH 3Q48A 3FFDA 3JV6A 4Y4FC 3RVXD 3Q1SL 4LNRA 2WP3T 2A9ML 3QNZA 1FNSH 4QF1B 3OF6A 2DQFB 2LE9A 4NRZB 2JB6A 5F70A 4QHNA 1VERA 3UMTA 1CBVL 1NCCH 1TPXC 4KK8D 1F6AB 1FVDA 2W65A 3DTXB 3UTTE 3OJMB 5I1AB 5I74C 3EJJX 3HE6D 3VFVA 3WIFA 3MRKA 4YHPB 4HV8A 3FT2B 3PF2A 4XCNA 1A9BA 1AD9B 1U93B 5DJ0A 2A6JA 5EUKB 3HA0A 1RURH 1Z2KA 4NN5C 4PBWD 1G7QA 1EPFA 2Y07H 1HWGB 5EU6D 4WVRA 2DYPD 4HEME 4ONHB 1FFRA 3MOAH 1S9XA 4DZBB 5C2BH 1A64A 4JFDA 4KKNA 2YD5A 3H3PL 4UOW0 4WFHD 5AD0A 4OD3L 1KTRL 2YK1L 1TZHB 5HGGS 4G42B 4E41A 1BIIB 3TBWA 1X3DA 3CNKA 1VPOH 2XPGB 4PG9A 5DJAA 1LNUA 2DJUA 1QFWL 1X44A 2RCSH 4JDZB 3MUHL 1AJ7L 2NPLX 1KB5L 2V5MA 1FJ1A 1QYGH 4DGVL 2EYSB 5CEYB 5GISH 2IGFH 3MJ9A 3BPLC 2VZUA 1MQ8A 4HMDA 3LDBB 5B4MD 3QP3A 1WAAE 4POZC 1RJLA 4GRWB 4G9DA 5DUMH 2RAMA 5DVKA 4NC2B 5C7XL 2BSTA 5BMFL 4HFWB 1WWCA 5ANME 3ZYIA 3BO8B 1R3HA 1T0MB 4JKKA 4HKJB 4JCMA 4Y4FA 3S7GA 4ZPVA 3JWDL 3N9GH 4W6YB 5BXFB 4S2SA 5FYKD 4QT5B 4XNQB 1A7PL 1NEZG 3ZTJG 3VXQB 4FQ2L 4WV1B 4P59H 2BFVL 3MBEC 3GJFK 4UAOB 1KNOA 3OZ9H 3ILPB 4S1QL 5E2JA 4XBPA 5JW5A 4UUJA 2BOBA 1U95B 3IDNB 2P45B 1AE6H 4PRHA 5TDNB 3CLFH 3GSOB 1EK3A 3VH8A 3BDYL 3I02B 3VXNB 1NCDL 5F1NB 1N3NA 5FFLA 3REWB 2R1WB 1QKZH 4ZAKD 1LK3L 5TE7L 1CD8A 3GJEB 4OCXH 5FDYA 4O4YL 3LKNA 4U1LB 3V52L 1YMHA 2ZSVB 4HH9B 2ICES 3D0VA 3RDTD 4J6RH 1BPVA 3VGAC 1A6ZA 3GRWH 2UVEA 5T3XL 1Z9OA 1DBJL 5IFAL 5JHLH 6CGTA 4KDWA 3T0EE 3FFCB 4ZQKA 4WFFD 1ZA3B 5IFJA 3H0TB 3I6GB 1JWMA 3SJVD 4O02L 4DQOL 3OG4B 2EC9U 4FFVD 4KRPB 1XF4A 2G75A 1IAOA 1JWSB 3RX5A 1KCVH 2JTDA 3WXVH 5DQDH 1EFXB 4CU7A 3RNQA 4U6VH 4ODTH 3A67L 4QRUB 4FXLA 2IQ9L 3C6LD 3MBEA 1K4CA 1KCRL 3ZE0E 4OV5B 5HHME 1RU9L 2V7NB 2MCPL 1RD6A 2N7BA 3KPRE 1I8KA 3OKDB 1MF2L 4JFFB 4XPHH 1DLHB 1P1ZA 2BNQE 4UTAH 1P2CA 3RGVC 1U8JB 1JNNL 2MQCA 5LAXA 4K8RL 2XV6B 4HZAA 2I5YH 1S7TB 5E8OA 2CRYA 1OGAD 2ITCA 1A5FL 2HKFH 4PLNC 1UQSA 2A77H 3RU8L 3ARDC 2GUOB 5J13C 1QRNA 1RVFH 5ESAB 4G9FD 4AMKH 3N0PB 4OZHF 3TH2T 1FE8L 5L7XL 3DMMC 3O3UN 2QV2A 4LLVA 4EN3B 5D7IF 4DW2H 2OR8A 2VXUL 1IAKB 5I1DB 2CJUL 4L9DA 1WK0A 1FNLA 4QRQB 4FQLL 4P3DB 5GGUA 2EDDA 2FR4B 4ZOEA 3UYOD 5JLZB 2OSLB 2HLAA 4NHUA 4XCYA 5J1AA 1J86A 3IU4H 4P23C 1RUQL 2GTWA 1S7WB 3MFGB 1OAKL 1E4XL 5JNYA 4POUB 5ENWB 3GUTB 5JA9A 3PQYA 4IOSD 2Y4SA 2VXSL 3QDME 4I4WB 1UM6H 4XCCH 4LASH 4OZGF 1UH3A 3ZE1E 1SY6A 2HN7A 2DJ4A 2XKSA 1T5WA 1XF5A 4QLRA 1BF2A 3HMXL 5DJYB 4JM4L 4D8PA 2GJJA 5DHVH 4FXGB 3ZYZA 3ECBB 3MRBA 2VLRD 2NY4B 5HI3C 4AH2A 3VXME 1BX2A 3CUPA 3NBNA 1FH5L 3WFEL 2HT3C 1CFSA 1FG2B 2B7DT 4HPYL 2AJXH 1V3JA 4P2RA 3T0BA 4NHCH 3S37L 1RJZA 3ARDA 1G9NC 3KPSE 1P7QB 4BUGA 5C0AB 4HUMB 4K71C 3DMMA 3JWOH 2HMID 2R2HB 4JZNB 1IGML 3VRLF 4QY8B 2HVJA 4OGZA 1PD6A 4NZTL 2CKBB 5HHNB 1N8ZB 2XTJD 1NCBH 3IDIA 5HYJB 5BZDB 3PABB 3MXVH 1TQBB 3MLZL 5DHXB 3NFPA 2X4SA 4GXUN 3V8CA 4RBPH 1CS6A 1NANH 4G5ZH 4P23A 1AY1H 1CF8L 4XMKL 4DN3H 3T0WA 1B4JL 1C5DB 3MV11 4IOFC 1G9NH 3DXAA 5MI0B 2MWCA 5FYJH 1DQQB 3K4AA 4XMLL 1JYWA 4RWYL 1T1XA 2DQUH 3DO7B 1OF2B 1OLZA 3KXFD 5JW4Q 2UZIL 5I76B 5D7JC 3LQZB 4G80A 3E2HC 2D9QB 3LD8C 4O2FA 1XR9A 2G2RA 4K7PL 5DMKA 4J3OC 1LP9B 2B8OT 5EPMB 3X12A 4NZRL 1H3TA 43C9B 3QWRA 1OQXA 1IKNC 2P5ED 3O3EB 1KBGH 2XOTA 3BP7A 3IFPA 3DLQR 4DCQB 3IDGA 1EBPA 1FYTD 2X4UA 3WFBL 5IWLC 4RFNB 4DKEH 1KSRA 1JV5A 3QFJB 4D3CL 3DETC 4H20H 5EBGA 4MJ2A 3QIBD 1JJUA 4J8RB 4PJDF 4AT6A 1BAFL 5D1XD 3K8MA 1BBJB 1MNUL 3BQUC 4JY4B 4KTEH 3CSGA 3O9WC 4EZMA 1X9QA 1DEEA 1T21A 5IB1B 3OJ2C 4J4PC 5IBTH 5HVFB 4OJFH 3S98A 4EI6A 1U8LA 3ESVF 4ZODA 5JQ6L 4Y2DB 1N64L 1IT9H 3HAEB 2ICEB 1MCRA 4RWHA 3W0WA 4NQVB 5EBLB 1ZXQA 2W0KA 1CLYL 3MLSH 2XN9E 1ITCA 2OYPA 5E8EA 2ZKHL 4LCIH 4W6WB 3FQTB 1QPXA 3TT3H 1EMTH 4WWKB 3GJFA 1KYOJ 3HPLA 3TH4T 2AEWA 4XCEA 1KTDA 1L7IH 1A7RL 1DFBH 3TC9A 4I3GA 3K8LA 4ELKA 4ZO8A 5D7JA 2F54D 3HUJA 3FCTB 2X4PB 4L3CA 3M45A 4LVOB 5HI4D 2Z93A 4PP2B 1DN0B 2VOTA 5FM5M 3NN8B 4GJTB 1ZSDB 1IKNA 1A4KA 1JPGA 1NFDF 1IGIL 1M7DA 2HRPH 4ZFGH 3G04A 3H9HA 1KYOK 3K4ZA 3DBXA 4FA8A 5IWLA 1J5OH 1U41A 3SKOA 3UBXA 1RZIB 1FV1B 5DLML 1HHIA 3P9MA 4ORGB 1MOEA 1EDQA 3G5YB 4I0PD 3L7FA 3TJHD 4F8TA 1JNLH 1EA9C 4MA8H 3BQUA 1CICB 4UOW1 2VITA 3O9WA 2BCKA 2F8OA 4OF7A 2C3GA 4J4PA 5F3BB 4I18C 1QHPA 5B3JE 1J0ZA 4PRAB 5F89A 2ZCKH 4PV8A 1JRHI 2NY2C 2WWMC 1CXLA 3MRFA 2HTKC 4JQVC 3FT4A 4GG6E 1U8PA 1DL7L 2HKHL 2MOVA 4WFED 5LGJB 1F4XL 4LLYA 1ZK9A 3G5XB 2VNCA 3QFDA 3TBSA 3KS0J 2BERA 1A8JH 1KOAA 2Y72A 1OARH 2IAMD 3L5XH 3BRFA 4OUOA 3RVTD 1B88A 2QJDA 1X5HA 1ZLUK 4R0LB 3B9VA 5J8OA 3I6LD 2W0FA 1IFHL 1Y18A 4MA7L 3VU2A 1FORH 4XRCB 1G0YR 3FOLB 5JTWA 4YR6A 3JTSA 4V1DE 2VZSA 5BW7C 3SDXB 2VZ1A 1YNTA 1B2WL 2AGJL 5DTFB 4ZFFA 3L9RA 3STZB 2VR5A 4HUXA 3P77A 3R06A 1V5JA 1AKJA 5F1OB 3PGFH 1J8KA 3BP5B 3MV7A 4P57B 3ULSA 4Z78B 1DANT 1AXTH 4I2XA 1VADA 3KG5A 3IU3B 3ALXA 3QUYA 3B43A 5E6IB 2VISB 4XP4H 4GAJH 5IVZB 1GZPB 4I18A 4WEBL 3OJDA 3QO1B 4OZ4B 1J8HE 1XGYL 2ZZUT 2V2XA 5ISZA 1EXUB 2YRZA 1WFOA 4D9QD 3MJ9L 1OP3K 4JQVA 1KLFA 4BQ8A 1IM9B 2VDOL 4IRZL 4BSVA 4G8GB 3BP4B 3SCMB 1BWMA 5LQBH 1JZ5A 3ARVA 3ZKQD 3ZHLA 3C9NB 4N9GB 1X5KA 4Q9RL 2E9BA 3V7AG 1LEKB 2N1KA 3FQRA 5AUMB 4FTVB 4ETQB 4KJWC 1ORSB 3QH3A 5GRUL 4K3DH 5DFVC 1TXKA 4GAYB 1EAPB 2L7UA 4LLDA 3H42L 2R0LH 4G8EB 5TDOB 4WTZG 2B5IC 1TQCB 4ODXB 5CEZL 4YE4L 2YPVH 4H8WC 1N6QL 1AC0A 1KJ3L 4L4TE 2HH0H 1YECL 2DLGA 1IKFL 5BW7A 32C2A 3S37X 3INUL 3BW9A 43CAA 3CFBB 3N1FC 2F5BH 3HNVH 1XGPA 3WS3A 1MRFH 1AFVH 1F58H 1YEFL 4WRLA 2Y9RT 3K3QA 3UTZA 3MJ7A 4PJFB 4X5XA 1BLNB 1ZLSL 1L7TH 5KVFH 1HILA 1B0GA 1GGCL 4Z7WF 2EH8L 3Q1SH 4XNYH 3VXSB 2A9MH 1KIRA 1Q9KA 2Y7QA 4UI2A 5I2IB 1MHEA 3WEXA 3FO9A 1RZGB 1VCAA 4K94L 1QZ1A 3QXDB 4C58B 1DQML 4PJXB 4PRIA 4L3AA 1FZMB 4XAKE 3U4EB 5DJ2B 4P9HL 3HFMH 1C7TA 4U1JB 3HLAB 3GI9H 5C07D 4X6DE 5LXGH 3VXUE 4OGAC 3D87B 1NKRA 4R7NA 1F42A 4RRPA 4K7PX 5ELIA 4E9LA 1CGUA 1A14L 4OZHA 4JO3H 3DJ9A 3AY4C 3KDMB 3RZCC 1ONQB 3FO2A 2VDKH 3LKRA 3MV9A 1RJCA 3OL2A 5CD5D 1ZVSB 5D7IA 1RZ8A 4JPIA 5MEND 4MAYD 4U1NA 4FHBD 4OD3H 1HIMH 5L2JA 2EZ0D 3BIAX 4WI2A 2YK1H 5F88A 3DURB 5I1JL 3WDHA 2EDLA 1LK2B 1OSZB 2OQJB 3H9SA 3V4PL 3QA3A 5D2NB 1FL6B 1AJ7H 3U1SH 4U6XB 1V3LA 2X70B 1Q9WB 2HJKA 5IQ9A 4PJGE 1CDGA 3NFNA 5F8RC 2EIBA 1R6VA 4ONOA 5BRZA 1KENL 3BEWA 1F3JB 4XHJD 2Q86A 3RVUC 2HTLD 3D3VB 2IQAB 4KK6C 5C7XH 3C5JA 4OZGA 5BMFH 3GMPB 2YD6A 1S7QB 5K59E 2BXYA 3JWDH 3P4LA 4U1HA 3QNZB 2EC8A 4NJ9H 3C08H 3IGAB 3K0WA 4NRYB 2V2TA 3MRJB 2AQ2A 4FQXD 1SJVA 1OTSD 4Z76A 2BFVH 5C3TA 4S1QH 4PJCA 4X6CE 3VFVB 3AU1A 3QEHA 3WIFB 4H25A 3QJFA 1CLOL 1FVCA 2VL4A 4MJIE 4CKVX 5CLWA 4XCNB 1CFQA 4HIEA 5DSCA 5IM7B 5DJ0B 2BVPA 3QI9D 2Z8RA 4JZOB 3MACL 1RFDL 3NCCB 4RGNE 3OKEB 5GS1C 3CIQA 4X0KB 4WHCA 1NCDH 1J1PL 3GMOA 5B38G 3AY4A 3RZCA 3OX8A 4LK4A 4JDTL 4IEFB 2HFEB 1IGTA 5AD0B 5E0QA 4NQSA 1FO0A 5DD0L 1CK0L 3IJSA 5ETUB 4RAHA 3QCTL 4GRMB 1NUGA 1FPTH 3RWCA 5C0RL 5T1LA 3V52H 1T7VA 3L3JA 1SEBA 1QPPA 4PJ7E 3RWFA 3BRDA 1RJLB 2B4CC 1I9IH 1NBYB 3FB5A 5T3XH 1DBJH 1HWHB 1TJGH 4HHAB 4MA1C 4BK4A 3BKCL 1ROWA 1IQWH 4HUUB 5C08D 1MRDL 1TNNA 4OQTL 3MCLL 4LAQL 3MUGB 1XZ0A 5GS3A 1FIEA 5AG8A 1HNFA 1HZHL 4X7SL 3CFEA 2DQCH 4X99B 3A67H 1TPXB 1KXVC 4OCNC 4HWUA 3DUSA 4M1DH 1RU9H 4MYWB 4WI9A 2E6JA 5A2KH 2HAZA 4XBPB 5JW5B 2EXYC 4E0RA 1MF2H 3HI5H 1KIUA 3CVHL 5IG7B 5MHSE 4QRRE 4XC1L 1ND0B 1OWRM 1N59B 2WAHA 1JNNH 4XXDA 4PJFE 3REVA 1S7VA 2VDML 4LLQB 4K8RH 4P2CG 4RQQB 5GS1A 1EHLL 1WICA 1A5FH 3WIHA 3QDJA 1BFOA 1G9MH 4HJ0D 2C3HA 2EYTA 5EFIB 3RU8H 2Z0BA 4ZMAT 2Z8WC 1OPGL 4JRXB 3GSNL 4GOSA 3CH8A 2QTEA 2CDFB 1J05A 3HG1A 1CDHA 3C6SA 4QXTA 3T0ED 5EOTB 3HPJA 2VXUH 2I26N 5GRXG 2EKJA 2FHCA 1KCLA 4GUPA 5SX5K 4J3XA 1UWEL 2A9NL 3BPLB 4J3UA 4FQLH 4M1CC 4LKXA 2QQKH 5L2KA 4MD4A 1Q9OB 4U1MA 5HYEA 3ZO0A 5FYLE 5HGAA 1MRCL 4YDVA 3C60C 3AS0A 3P9LA 4R96A 2D9CA 3PV7A 2VN4A 4YGAB 3U0WL 4O2EB 3DSFL 3DECA 2VXSH 3KPRD 2R2BA 3GSRB 4LSRL 3RNQB 2BNQD 1LVEA 2EDFA 4Q6YA 1NUNB 3L3OA 1I7ZA 2FJGB 3OGOE 1NFDA 4JM4H 1G7HA 5IKCB 4NRXA 5IBUB 3JTTA 5IJVA 2MJWA 5CGYD 2NR6C 2F53E 2PYEE 5GIRB 4S1DC 3T3PF 2WIMA 4PRPA 4C56A 1FH5H 3WFEH 1M05B 4X4YA 3MUZ1 5GJSH 3P0VL 4R4FL 5ACLA 1QRNB 4Y16D 2WK2A 5D2LB 5KSAC 5C09B 3QG6A 3T2QA 2OX5A 5FGRA 4OCSL 4LLVB 3DYOA 4KUCF 1B3JA 2J8OA 3LEVH 3MRCA 2AERT 4XPBL 1VDGA 4NZTH 3QEQE 4PJBF 1UJ3C 3L6FB 3WN5C 4GAFB 3RKDC 2XWJA 4NHUB 3MLZH 3QDMD 5TE4L 1CU4L 3QEGL 4JFDE 3C60A 1TZGH 3QPQC 2A38A 3NFSL 1CF8H 3ILQC 2X7LA 1DN2A 3RIFF 2CGRL 4M7LL 5C2UB 1B4JH 3NA9L 3MX0A 4J3WA 5E8DL 4JPKL 4OZIF 2ARJQ 3OR6A 1MCHA 2VZVA 3BN9D 3GFUA 1OD9A 4E41E 3BOVA 4XMLH 5F6HJ 3P40A 2X4RA 3S96A 4Z7OE 3ZT5A 3DWTA 3RIAK 2HYMA 5E8NB 5SWSB 5F8QC 3UJTL 2B0SL 1DVFD 3VXMD 4D8PB 2XRAL 1H8NA 5DJZB 4NZRH 2Q7YA 1MQKL 3RGVB 1FFNB 5I75B 2H26A 1QQDA 4DGIL 4AH2B 3KPSD 3G5VB 3BGFB 4NDMB 1YC8A 3GEWB 1XH3A 5D7SL 5GJTL 2XKNA 3WFBH 5CZVL 5GHWL 4FZ8L 1KN2H 4D3CH 3DPBA 2GSGA 4EDWH 3N1MC 3FTGB 1IEHA 5CIPA 2OZ4L 5KSAA 3JZ7A 5IOPB 4JN2A 4EOWL 1MNUH 3Q6FB 2HRLA 4XVSL 4N0RA 5C0CB 3RTQD 1MCWM 3GB7A 5I66A 5DHVB 1UJ3A 3WN5A 4PRHE 1W0VB 5EZJB 5DJCB 3V0WL 2C3XA 3NFPB 1FFQA 2X4SB 2EDTA 2VL5B 5HYSB 3VFNB 1CLYH 1GOGA 1JK8B 3RWIA 5IVXB 2XY2A 2XWTB 4G7VH 2J6EH 4LARH 3DRQA 4WI5A 4KKCC 4QYOB 4NC1C 1A0QL 2VXVL 4YHIA 5EU7C 2XNAA 2BK8A 3L5HA 1HN1A 4LRNL 4NNPH 1MHHA 1XR9B 2G2RB 3BESR 4P2QA 2XYCA 4PJIB 4LPVA 3EZ8A 2A83A 2DLFH 4AQOA 5DO2C 1EFXD 4UINL 3TEUA 3G9VA 5I18L 1CG9A 4YFLF 3IDMA 5BVPH 4X7EC 2X4UB 3VI4F 3PWLA 1I7TA 1AP2A 2HFGH 4LL9A 4U49A 4UT6H 5JO5A 1RPQA 5DLMH 3QUZD 3Q5YA 4K71B 3JVGC 4PLKD 1SYVA 4Z7WA 3IS0X 4NWTL 1UJTA 1ODAA 2CR6A 4IDJL 1WSST 4ZUSB 1XIWD 3EDDA 4OF0A 4HK0A 2FHBA 2P7TA 2OI9C 1A6VL 1YY8A 1MCLA 4TQEL 1W0YT 5F3HB 3V5DB 3QCVL 5JHDB 2YD3A 2IH3B 5GS0C 4WW2B 1X4YA 5IMMA 1BVKA 4EN3D 3BZEA 1I3VA 4MD0A 4OLWL 1DL7H 2HKHH 2NY6C 2DWEB 3UTOA 4FN0A 1F4XH 2IMMA 2E7CA 3ULUF 1YMMB 1TNMA 1A1MA 1QA9A 2R0WH 5DJ6A 2CIIB 3HUJB 1M71A 4L3CB 4XWGH 2WQRA 3GSWB 1J12A 2Z93B 5FM4A 2JJTC 4DKDC 4LSUH 4AL8L 4HS3B 4BFIA 1RIHH 1HXMB 1MEXH 2QEJA 4C4KO 3WFHA 1A4KB 3DIFB 3RL1B 3CFJB 3G04B 1E6JH 4IRSB 1Q1JH 4NOBA 1NGYA 3EYQC 2GTZA 4RFEB 1KACB 1HXYA 3PQYE 3QUMA 3VXPB 1KJMA 3SKOB 3FQNA 5L8KB 3STBA 4PY7A 5IBLD 4U6YA 3UBXB 1X4ZA 1HHIB 3P9MB 1MFEL 2DLIA 2FHFA 4RMUA 5EBWA 2QSCH 3E3QE 4IIQB 2NY4D 3JVGA 4I3SL 4WWID 3L7FB 3LVEA 2NYYD 4XVJH 4MB4A 2VITB 3HE7D 3O9WB 1TCRB 2YD9A 5JPNA 4H8WL 3T2OA 5I1EL 1AI1L 4JREB 5DEGA 1QLFB 1P7QD 3MLTA 5C0AD 2FX7L 4PB0L 1U8NA 1G7PA 2QBWA 4I5BB 1IC5L 4P2RE 1HI6A 1YEIL 1U8PB 2VDOH 3P3YA 3VXRA 4LLYB 1GC1C 2WBJB 2VC2L 1CL7L 1H15A 1U3JA 2VKXA 3QIUD 4K3JL 3I75B 1WF5A 4KROC 2ARJA 4PJ5A 2Y6SC 4OLVL 4IS6A 5HBBA 1E6OL 3ISWA 3VG0L 4WJ5A 3CMOH 5GRUH 2GYSA 4WCYH 3RAJL 2JJTA 2Y5TB 3ARZA 3RVWD 4JFPB 3GSXB 2GJZA 5TQ2H 2A73B 2X1XR 4BSWA 4OSUL 3VGHA 4IMKC 5L6YH 2I07A 1EHAA 1QSEB 5CEZH 2WM0A 3BEVB 5DA0B 5F7EL 3OKLA 1FQ9C 2ZNWA 5HGHB 1NDGA 3DXAE 3T0DA 1HCFX 1IKFH 3VA6A 1P69B 3VFOA 1ZOXA 1OM3L 3A6OA 4UIMA 3CC5B 3F58H 1HDMA 3P4NB 3GDBA 4MD5A 4UT7L 3SQOL 3WV0A 1AKJB 1YEFH 3HZKA 1CGWA 3D18B 1OL0A 3ARUA 3MV7B 5CZXD 1J8HD 2AXFB 1FO0L 1ZLSH 5I1LA 4GG8B 1GGCH 3B2VH 3MR9B 3QIWC 2EH8H 3HZMB 4N0YH 1UGNA 4HG4J 1JNHA 3CVIL 3F6IA 3X17A 1E4KC 2VLJA 4L3EA 5D9SA 4MWFB 4BSVB 2P8MA 4K94H 3N50A 1DQMH 3ELAT 1FNGA 4GW1B 4OFDA 1AD0A 4RISL 1T2QL 4M8VA 2CQVA 4P9HH 1KG0A 1T3FA 1IGFL 4DFIA 3S36X 3CCHA 1NEZA 1RZFL 2Q8BH 2V5TA 4MNGB 4Q2ZB 1OD7A 4HG4K 4L4TD 1JHTB 3W0WE 4RZCA 4N0FA 5IMLA 1BVLA 3OB0H 1V7MH 5HHXL 1OAZL 2JF1A 5I1JH 4ZO7A 4U6HB 4YBQC 5LVEA 1AR1C 1O7VA 5DVOA 3V4PH 1Q72L 5DJDB 2VQUA 5HYQA 4KPHH 4FABL 4D0CB 2YN5A 4K55A 1XGPB 2AXGB 4PJEF 4ACPA 1UXSA 4ZTOH 4QOKB 3WIHL 3WFCL 4XPFH 1Q0YH 3MBXL 1QBLH 3SKJL 1KENH 2PW2B 2GK2A 4M62L 1CFVL 5IW3A 4BA8A 4KZDL 5TGBA 1I7RA 2XZAH 1B0GB 1MCEA 1QD0A 3QIWA 3ARGB 2P8LA 3TA3C 4J3SA 1MFNA 5IQ7L 1GGTA 4NBXB 4S0SD 3QHTC 4P4KB 4L4VA 4PR5A 1HYRC 4L4JA 3FN0L 2NLJA 1DQLL 2ORBL 1I3RA 1E4KA 1BZ7A 4M03A 2BVOB 5A2FA 3BN3B 2G60L 4S10A 2QADC 3RA7L 3MRMA 3VXUD 2B4CL 3GSVB 4L1DA 4X8JA 3KNBB 4KY1H 4ZDHB 4F8QA 1XGRB 1DQDL 3VW3H 4X7DC 1T80A 3P4OA 3T2PA 2CUIA 4P46D 5GS2D 1HKFA 4UIKH 5DFWH 1RFDH 2FJFA 3PGCB 3DUUA 2O5XL 1JGEA 1J1PH 3FO2B 1U91B 4PGDB 4JDTH 4K3EL 2NNAA 4U1NB 3TPUA 4JJ5A 4IJ3C 1N5YL 4RAVA 5FUCE 4PJBA 2EIZB 4LKCA 5KSVA 4Z6AT 3QCTH 4P0DA 3MGOB 2YC1B 4OF5A 5C0RH 2IMNA 2R1XB 4M93B 1M4KA 1JMZA 1KXQE 1PLGL 3B5GA 4HDIB 3MLVH 4GMSL 4OCRL 3U82B 4LBEA 3BEWB 3MMEA 1KLUA 2JJSC 1IEBB 1CIDA 4ZTPL 4OZGB 5B8CC 3BKCH 3EYFA 1IAIL 4WHTA 3QAZB 4BYHA 1K4DA 2J8UF 4AIOA 4OKDA 3CD4A 2VIRB 1R5IB 3MCLH 4OQTH 4S1SL 3TA3A 3TYGL 3V7MA 3LQAL 4MJID 5C6PB 1OTTC 2V2TB 5HPMA 4X7SH 1A6WL 2XIDA 5KVDH 3MOBH 3D85D 5ICZB 4RGND 1MI5A 2XQBH 5GGSB 4N68A 5E6ID 3CVHH 2M2DA 4KI1A 4XC1H 2Q7NA 4MS8D 1DBBH 5I17B 4NBYB 3HAEG 1I1YA 1F3DH 2VDMH 5KVGH 4I2XE 3D48R 2P4AB 4AY0A 5KANI 2C7UA 4G8GD 4J3VA 1CD1A 3OX8B 5EUOA 3RZCB 1YN6B 2JJWA 2ERJB 4WO4C 4U1KA 3P4MA 3RWGB 1K3ZA 4RMQA 5ISZE 3K8KA 3WSQH 2MFNA 4U1SA 1LGVA 3TNMB 3GSNH 2ZWLT 4LEXL 4FTVD 2OJZL 5SX4H 1BF8A 1QVOA 2CLRB 1DBKH 3L3KA 5IGXL 2O26U 5IK3A 3B6SB 3NCBB 1BQSA 1A7QL 1SEBB 1ZT1B 2VE6B 1JYNA 1RUMH 2QKIA 1UWEH 2A6IB 3RWFB 1WTLA 3O11B 1UB5A 4OB5L 2HVKA 5IEKB 1MRCH 2JJSA 5J1SC 2JB5L 1BMGA 4N0CD 4HULB 3ULUC 4X80L 1D6VL 3FRUA 4D0DA 2QSTA 3EBAA 3TBYB 2AKRA 3U0WH 4WEMB 3DSFH 1GAFL 1IL1A 3BXNA 4LSRH 1T89A 1YEDB 2HLFD 3MROA 3KPNA 3R8QA 2YBRB 4LF3A 2Q20A 4PV9A 2MSPA 3ORJA 3HB3C 2RBLA 2AP2A 1CGYA 4ODWA 3REVB 3ZTNL 15C8L 4QHLB 2BDNL 4TOYH 4PJDB 2ID5A 2XTLA 5D5ME 2Y1VA 5CBAA 5T1KB 1ZT4B 5FF6B 1VGEL 1JHLL 2DD8H 1BFOB 4PJAA 3DUHA 1BIHA 4WO4A 4YBLC 4Q6IC 5TDPB 1GGYA 2NY0D 4M9OA 4ETYA 1YEEH 3LKOB 4TRPH 5DJ8A 4OCSH 4PRIE 2FJHB 2GK0A 5FYLD 4M6ML 4AM0B 5AZ2L 5GZOD 4XNUL 5GZND 2I9LA 2F19H 5SWZB 1GJIA 4XPBH 2NY1D 3CH1A 3KYAA 4MNHB 2GCYB 2VUOA 1F13A 1VESA 2IPTL 4U1MB 1CGVA 1GRWA 1RZJC 4OZHE 2CK2A 3GKZA 1I1AB 1Z9LA 3MV9E 4MNQE 3P9LB 4M02A 4R96B 3NFSH 1K8IB 2PW1A 4DVRL 5D7IE 2CGRH 2R9HD 2YPKA 1ADQA 4M7LH 5IW1B 3NA9H 4TTDD 2AJUH 4I77L 4F33B 3WFZA 3ABZA 3H9SE 1CXHA 4ZXBC 3T0XA 1A4JA 4UV7L 1I7ZB 4M1GL 5H2BB 5JMOC 3NPZB 1A1OA 2F53D 3UJTH 4HS8H 4IRJD 2XRAH 5DURB 3X3GH 1CT8A 4NRXB 5K9OB 4TUJB 5BRZE 4U3XA 5IJVB 1OT1A 3OF6D 4YH6A 3QNYA 4N5UA 4ZOAA 4YDKH 2VSDA 3QULB 3GGWA 5GJTH 1DQJB 4PJHA 2ZOLA 1GIGL 5CZVH 1WFTA 4PD4J 2DLTA 3DVNA 5CEXA 1Y6NR 4GKSA 3HI6H 1Y0LA 2VLMD 4JR9L 1GGBL 1NANI 1YPZA 2F74B 2OZ4H 3BKML 2QQNL 3O4OC 5MEQA 4ALAL 4EOWH 4PJCE 5DMYA 3T4YA 4XVSH 4JFDD 3VRIA 4HW6A 4PFEA 2VLRA 1GH7A 3MODL 1OTUC 4HBQA 2IC2A 3V0WH 4AIZA 4E41D 3N1PC 3C60B 4EVNB 4PD4K 1Q9LA 2JE8A 1B9ZA 5JR1L 1ZA6A 1R3KA 4OCWL 2H1PL 4NP4L 2FX8L 1VEMA 1IEAA 4Y1AA 2AK4A 2ZOKB 3MRQA 4JRYA 2D03L 4R7DA 2LTQC 4ZXBA 5CWSA 2DTMH 2VSCA 4HJJH 1Z9MA 3WKML 4JANB 4LRNH 3LN9A 4HJGA 1OAXL 4NM8L 4RFOL 4F58L 1MSPA 2WNGA 4WNQA 1RIVL 3MRGA 5FYKU 4Y4FD 1F11A 2VR4A 2FECL 3U46A 3I50H 4JB9L 4UINH 5C8JA 1KPRB 1W0WB 1FZJA 4YDLB 4CL7A 4U31A 5LGKA 1SJXA 1BQHB 1XH3B 4HIJB 4HWBA 4LCYA 2XKNB 2EDRA 3SE9L 2RR3A 4LGRB 5E9DB 4UILH 5ITFB 3UZEA 4Y4HC 1N6UA 1WV7T 3ROLB 4JN2B 4PRHD 3UBXI 4KRMB 4FFYL 2FH6A 3LRSB 1U92B 3N1GC 3GB7B 2D0HA 1UJ3B 4Q9BA 1WZLA 3GIVB 1DLFH 4QGTA 3BT2L 3STLB 4Z7NF 1T7WA 1D9KC 1H5BC 4I0KA 3QDJE 2R4SL 1S5HB 3MLRL 4OLWH 5ID1A 2VQ1A 5D96C 1WIPA 5FA4A 3HG1E 4P2YA 3W5MA 4POZD 2UZXB 2ADGA 3NMEA 5CJXC 3N85L 2VAAA 3U0PB 3BWAB 2XG5A 1FL3A 4AL8H 5L2KE 1MCOL 3WXWL 4FQHB 2BNUA 1EJ6A 3F5WA 2DM4A 1GYAA 1QLEL 1GC1L 1UM5L 4PJEA 1N2RA 5FGBC 3RY5A 3MBED 3CZJA 3PWLB 4IMLA 3T09A 2ADIA 4HT1L 5FUZH 5I16A 1AP2B 3F7PC 4G7YL 3ARFC 4Y4HA 3O81A 3AREC 1MCJA 2FLRT 4Z7WB 4I3SH 1HSBA 1NFDE 4PUBH 1HCVA 2VYRE 4JN1L 5HSFA 4PTUB 4UDTA 5EO0A 5FHBL 4TUOB 4NCC2 4BK5A 4LHUB 1KIPB 1QRND 5I6XC 3OXRB 3RWDA 4PRPE 4C56E 1KUMA 5T5NF 2W91A 2FX7H 1D9KA 1H5BA 4CJ1A 1EGJH 4KXZH 3B9KC 1KT2A 1IC5H 4ONGL 2CMRH 1N26A 1YEIH 3MC0A 3FAXA 3UEZA 1CVRA 3EYOA 4Y5YB 2VC2H 1CL7H 4MQXC 4K3JH 3EOAB 1A1NB 5F7NC 4AK1A 2M26A 3VG0H 1IM3B 5C0BE 5CJXA 2YEZB 3K81A 5BVJB 3T77B 2VWEC 4FOMA 3RAJH 3U9PL 3LV3A 1CR9L 3O6ML 3UCRA 3PQYD 5DDHB 2R8SL 1YDPB 3RY6C 1R3JA 3BSZL 4YUEL 3P0YL 4LVNC 1C12A 2FO4A 5F7EH 5FGBA 1QSVA 2J4WL 3QUMB 4GRLC 1EO8H 3M17B 1A6TB 3LN4A 3O45B 2A6KB 4RGOH 4PY7B 4F15C 1TITA 3V6ZA 3ARFA 1ORQA 2I24N 5HDQL 3WNKA 5EBWB 5BJTB 3WKNA 3AREA 3IETB 2J8UA 3GKWH 1X4XA 1T1WA 3GM8A 1QACA 5J57B 1JGVL 1NMAL 4P2RD 1VFUA 1A3QA 1BD2A 4ZD3H 3ARDD 3BZ4B 5CJOH 1VKXA 2IBZY 3E6FB 2CSPA 4YFEA 3MLTB 1PDKA 2VDPL 1WCQA 3EKCA 3TZVC 1G7PB 3V2AR 1VGKB 3DMMD 3IAPA 2X4QA 1CXEA 3B9KA 1HI6B 1WBXB 3G6AA 4XB8A 3QZWB 4C55A 5C0CD 4HFUL 4POYA 3TO2A 2B2XL 1G6RL 2OK0L 4NZUH 5ECJE 3ARTA 4E42B 1WWAX 4Y19B 4PJ5B 4V2BA 5GGRY 3VFWB 3RVVD 3OKNA 1IGFH 1EEYA 4P23D 3VE0A 4XHQA 1G7JA 3TIDB 2OJEA 1PQZB 1RZFH 2OMNA 2EO1A 1H0DA 3DXAD 4KU1A 2FLBT 2GJZB 3RY6A 3QCUL 4NQDB 5E95B 5AYQA 4KQ3H 4ODUA 1MHCB 4HCRA 5DD6A 1DDHB 1ZTXH 3OKLB 5H37G 4GRLA 1TTUA 4LEOB 1JZ7A 3IFLL 1Q72H 4LPCA 1LDPL 1VHPA 1ZHBB 1ZLUH 2F5AL 1N0XL 3UDWC 3QWRD 5B38A 2ICWI 3MV8A 4UIMB 1M7XA 2V9QA 5IBUG 3WFCH 5HI3D 4P2QE 1JUFB 1DBAL 3ARBB 3HZKB 4HUWB 3MBXH 4LLAA 4U1GC 5KANG 1QSFA 4M62H 2HT3D 4UTBL 1AC6A 4KZDH 4Y8AA 1LO4H 5I1LB 4OLXL 3WIIL 5IVNA 4MDJA 3VGGA 3QG7H 2ZUXA 1CFTB 3VDCA 1VEOA 5DS8B 4X5WB 5IQ7H 2P43B 4LLMA 3T4AB 1UEMA 3O3BB 5CMAA 3TZVA 3FN0H 2VLJB 2ORBH 1DQLH 4YDJA 1SJHB 3LKQB 2KL6A 1FNGB 1DANU 2BRRH 5HHOA 3M1BA 2DN7A 4YX2H 4KROB 5KN5A 2ZCHH 4M6AA 2C5DC 1PKOA 1TVHA 4LQFL 4IHOA 2X1WL 1WITA 3KPMB 4OZFH 2ADFL 2H2PC 4PY8J 1KPVB 1P9MC 2O5XH 1QP1A 4IOFD 1SBBA 2NY3C 2W9EL 2BVTA 3WUZA 1A21A 5AAMA 1PGRB 3O0RL 4RZCB 5INDA 1KLGA 4NO0A 1A7OL 3U36A 1N5YH 1RK1A 1UB6B 5D7JD 3C5SB 5FK9A 2E7BA 1E4WL 1RHHA 2DDQL 4TSAH 1X6NA 1DBML 4PPTA 3I6KA 4Q0XL 5D7KD 5FO7A 2VXTH 3EDJA 1S3KH 2BSSA 5KG9A 3CXHJ 3UDWA 5EU7E 2VDQL 1UXSB 4ONFH 4GMSH 2YRPA 4WTWA 3RWJA 2W60B 3PWPA 4KMLB 1WZ1L 3TESA 4L8BA 3VFPA 5TGBB 1A9EB 1I7RB 1CGSL 1IAIH 3DETD 1L0YA 2P8LB 3X14A 5B39B 1VEPA 4S1SH 3QISA 3TYGH 3W9DB 3LQAH 1D5XA 2GSIB 3CLEL 4DVBB 1HQRA 2AEQH 1I3RB 1BZ7B 3BQUD 1A6WH 3RPIA 3CXHK 4F2MA 3O9WD 4K2UH 4J4PD 1G7MA 4DGYL 4GKOA 3O3DA 1CLZL 5FGSA 3WMSA 5L9DL 3ULUL 2VLKE 4CNIA 2ED8A 1UZ8B 5FM5O 5E2UH 5FAAA 3B5HA 5FECA 1IBGL 4JG1L 3DUUB 4FZEL 4Z7UE 1NGXA 1P9MA 3OKOB 1T0NB 1Z5LA 4GBXC 4Y7MA 1YEJL 4PJ9C 1FZKA 1HEZA 4FRWA 5EC2B 3D39A 4CVWA 2AJVL 4LEXH 4PJBB 1W72A 5ALBL 3W82A 2OJZH 1QR1A 2UZYB 3VXRE 4MJ4A 3DV4A 2EE9A 1A7QH 2CDGA 2OR9L 1C5BL 2PXYC 1UCBL 3QUXC 3MLXL 5H94A 4J3TA 4OB5H 4OZIB 1KEML 3LS4L 2D0GA 5HI5C 1T1YA 1QEWA 2A1WL 3IJYB 3OKMB 2JB5H 1ZHLA 3TIEA 3EYFB 3W11D 1A6UL 4WHTB 4ORZC 1D6VH 4X80H 1K4DB 2Q1EA 2DIBA 2DQIL 1A6PA 1MJJB 1AO7B 4HC1L 4PRNA 3VMNA 2APWA 2I27N 1U6AL 2H2SC 2ENYA 1OGTA 1WCBB 5HPMB 1AKJD 1GVIA 2P5WA 4F7EB 2UWEE 1P7KA 2V5YA 3MV7D 2Q6WA 5BV7C 3KPQB 1O5DT 4P4RA 3B9DA 1F90H 4APQB 4HWZA 3I84A 1VACA 2IANA 1R5WA 3LS5L 2J8HA 4L8SB 3VXOA 1Q94A 1CDIA 1I1FA 5ISZD 5C08A 3ZTNH 2BDNH 2NY2D 4KH2A 3SKNA 2WWMD 2O5ZL 2HTKD 4X4XA 3CFDA 5IR1B 1VGEH 1LILA 2C7UB 1CD1B 4GBXA 4U7SA 4U1KB 2AV7A 4PJ9A 5GRZA 3VDBA 4L3EE 5GGVY 3KWWA 3UYRL 2C3VA 3BUYB 1QVOB 1P4BL 3H7BA 2BMKA 2QSVA 1IC7L 4KHXL 2LU3A 4M6MH 4OCYL 1ED3B 3R1GL 2O61A 2JELL 3SO3B 5IMOB 2D7PA 4XNUH 2PXYA 4HWBL 2R2CA 4F7MB 3QUXA 2X9WA 3CVHB 2IPTH 1F2XK 1IQDB 4O51B 2V17L 1YN7B 4KJQC 4EDXA 2HFTA 4ZNEA 4YHYC 3Q3GB 3PNWA 5B8CB </