1UM5H

Catalytic antibody 21h3 with alcohol substrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
217
structure length
217
Chain Sequence
VQLQQSGPVLVKPGGSVKMSCKASEYTLTSYLFQWVKQKSGQGLEWIGYIYPYNGGTRYNEKFRGKATLTSDKSSNTAYLELSSLTSEDSAVYYCARSSMSDPGANWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 21H3 L chain
publication title Structural Studies of an Efficient Catalytic Antibody Operating by Ping-Pong and Induced Fit Mechanisms
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 39
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1um5H02
5I1LB 1D5IH 4Z0XA 5JIPA 5B39B 2X2YA 2FSEB 4WCYH 2X40A 2G5BA 3MA9L 5F44A 2BSED 4S1RL 1FVCB 3X11A 3BZFA 3DVFA 3QCTL 4C4KT 4GLRH 1IC7H 2PCPA 3S8WA 4PJDE 4UT6L 3AY4A 4CJ1A 2VC2L 1IQDA 3L3GA 3BPCA 2ARJA 2AV7B 3IU3B 5DD6A 1F42A 43C9A 3GBNL 4J7RA 3QDGD 2YPVL 1UWGH 2XXCB 4YJZL 4OD2A 1JWUB 1DR9A 4LU5L 4PGZA 1H3PH 1ORSA 4ZXBA 1VKXB 3QAZB 4FMFA 4LKCA 4FS0A 5IQ9B 5C0RH 1OP9A 1HXYA 3VWKD 5AUMB 1AGCB 4WFGD 4F2MB 4PJDB 1ZT4A 1L6ZA 1MEXH 4EDXA 4OFIA 2YD3A 3P3YA 3P4NB 4NN6B 1IAKA 2H6PB 4GUPA 4ZNEA 5IV2B 4MDIB 1SEQL 2WLZA 4NQXB 5C0BE 4UILL 3ZE2F 2FX8H 3EIFA 4HGWA 3W0WA 3S98A 1G7HB 5F96L 3FB8B 3MFGB 35C8H 4JQVA 5I19L 5DJ2B 4XNZC 5JORB 3TV3L 2Q7YA 2LVCA 2OR7A 4K3EL 5GS2H 2BY3A 4P9HC 2VRAA 4JDTL 1EERB 3P40A 1NKOA 4FZ8H 3TPUB 1U8HB 3RWGB 3DI2B 2BVTA 3C8DA 5DJCB 2VDOH 5C0BB 4AK1A 4X6EA 4R2GD 2ATPB 5GRJL 1T1XB 2P46B 5FDWB 4JREB 4KK6C 3SKMB 5C71A 4X80L 5E1AB 2FR4B 1RUQH 3RUGA 2EKSB 1D5BA 4NQDE 3MLVH 2F8VA 4LCCB 5HGBA 1JGDA 4U7MA 1CI5A 2DM7A 1ZLWH 3A67H 5T5NF 2GTZB 5BV7C 1Q9OB 3LZFH 4POUB 4XWOD 4YHIA 1PQZA 3QP3A 1C5DA 3GSVB 4Y4KD 4XHJC 5EUKB 1GPOH 1BFOA 5D5MB 3ZT5A 1IGML 1KCUH 1MFNA 4NQDB 5BJTA 4HKBB 2K1MA 4URTB 4JVUA 5J13C 4KK9C 1Q9KB 3PWPD 4J3XA 1WAAF 3QYCA 4MZ3A 5JOPE 2BNRE 3OR7B 4LHQB 3KPMB 3DPBA 1OGAB 5GS0D 3DHMA 5F88A 1HINH 5J12B 1A47A 3U46A 1SYVA 1OAXH 1DP0A 4L8BA 1NLDL 4QRUB 4RMWA 4UIMA 3P4OA 3VWJC 2VQ1B 4EZMA 5CEYB 1OTUC 1FGVL 3MA9H 5GZOC 1P2CB 2VXVL 2VIRB 4GMSL 3PL6C 4Q9RH 5KOMC 2BNRB 5TE7L 4H26A 1UG9A 3RL2A 4LLMB 3VE0B 1BF8A 3OZ9L 4UT6H 3OGCB 5IMOA 5AYQA 1RIVH 3IDXH 4XI5C 3EFDL 1B0RA 1V7NH 1YNLL 5CJ8A 4ISVA 2Q1EA 4OUOA 3CDFA 4D0BB 2ZOLA 4LU5H 4KJWD 1BVZA 1KEML 4HC1L 3RWEA 4P23B 4P5MB 4LNRB 3RHWK 3IDJB 4W6YB 5GZOD 5ANME 1NBYA 4JDVA 3TGXA 2BC4B 3PL6D 5JPMA 5I76B 4JFXB 5JW4N 4ONHB 1DCLA 1FAIL 2CO7B 2P8LB 1UACH 2VR4A 1MH5A 3RZCC 3AAZB 3IKCB 1BD2A 4GKNB 4XI5D 3RKPA 4PTTB 3U4EB 2V5MA 1P4IH 3B9KC 3L9RB 5I19H 3TBTA 4WW2A 4AIZA 3FFCA 5I8EB 4NO0A 3UBXG 5ANMB 4OLUH 3VJ6B 2HFFB 5FYKL 4JHAL 5IVXF 2PYEE 4YXKH 1IM9D 3LB6C 1UGNA 4Y16D 1TJHL 2VLRB 1HKLH 2QHLA 3VDAA 3NA9H 2V2XA 5HHME 1BJMA 1AGEA 1EK3A 3B9KD 4JY4A 4X80H 2R2BB 3RWHA 1K8IB 4JQIH 4HIHA 3EYFB 4HKJB 4K71B 2PYEB 5HHVL 1R3JA 2AERT 2VDLH 4JFFD 1DBML 1QLRA 4FQIH 4PV8A 3VRLE 1XIWB 1QHOA 1N64L 5HHMB 5HJ3B 5D6CA 4ZUSB 4MCYA 3W9DB 4O9HL 2EDYA 3LH2L 3MRKB 1WBYA 3MUY1 1IGMH 4EXKA 1RIUL 3C2AL 4H88H 2JCCF 2UUDH 1GGCL 4NZTL 4WU5A 3OJ2C 1A7NH 3OWEA 3NABH 4A2MA 3EJYC 1EMTH 5BVJB 3LEVL 3SY0A 4X9FA 5DRZA 1J0KA 4HUKB 3U30B 1E27A 3C5ZC 8CGTA 1C8PA 1FNLA 1PFCA 5DJ6B 3NCJH 1A02N 3QDJE 1W0VB 3WUWG 5KSVA 1JHTA 1FGVH 2BHZA 1YPZF 2YC1B 4OCYL 4XAKE 5F1NB 4YBLC 4GBXC 2H45A 4PLNC 4GMSH 3KJ6L 3BX7C 2FNBA 4MSWA 5JR1L 5TE7H 5EU5A 2NX5E 3BW9A 3EJZC 5AD0A 1DTUA 4GXUM 1IGJA 3UJTL 5JDJA 3MNZA 1IT9L 3D0VA 4KHXL 1ZWIA 4M1DL 3C5ZD 5L2KE 2X4QB 3QDJB 5CD3B 4YZFF 1W0YT 3ZSTA 3NIGE 4F57L 4BSVB 2YS4A 4F9PC 3MNVB 4GBXD 2GJ6A 3VU2A 5LGKA 4GKOA 3MLZL 4RISL 2NX5B 3CAFA 4WI7A 1FN4A 2EKJA 2H32H 4MQXC 4JFYA 3DLQR 2I9LA 1GC1L 1MREL 1QA9B 4U1NA 3C6LD 3P4MA 4LHUA 4M3KB 2AK4E 5GGRY 2WBJB 4FFZL 4FXKA 1BVKB 1RUMH 1HEZA 3F6IA 2DQCH 1EJOL 2A77L 2WQ8A 4TUOA 4YR6B 4NZUH 4G6JH 3SE8L 3WS6C 1AGFB 5L7XL 1FNGA 5FYKH 4JHAH 4KUCF 4ELKA 4QHNB 5J1TC 2PW1B 5M95B 1J87A 4R3SA 3VFUB 2A9NH 1AIFB 4LFHD 2VXSH 1ZVYA 1PKQE 4JM2B 1EXUA 2AK4B 5CP7B 5IESL 1SBBA 2QV2A 3FFDA 4NM4L 4V1DD 5IOPB 5INCB 1X5JA 3UZVB 2FX9H 2QJDA 4TOYL 1HWGB 2BVUA 1KN2L 3OL2A 1MUJA 4KROB 1S9WA 5GRVL 3WLBA 2GW5A 4P3DA 1WISA 1G6RB 3BI9X 3RKDD 5KSBA 3T0AA 3OB0K 5F9WC 3RUGF 1F11A 2AJSL 4QO1A 3BP7B 1MJUH 2HRPH 1PKQB 1DBMH 4KTYA 3VXME 1PY9A 1FVDB 3RWIA 4ZSOA 5IW6B 5ISZB 3NBNA 4O2CA 1R5VA 4U1LB 2FYYA 2VDRL 3LH2H 5DJ0A 2X1QA 5HI3C 3UTSE 4KDWA 4P48A 1WEJH 3ZKQD 3GSNH 1BWWA 1JZ7A 3WNNA 3ULUH 4K3GA 5FEBA 3H9ZA 3RDTA 2AEPL 4JHWL 3VXMB 3QEHA 3LEVH 3LMJH 5D71L 2H3NB 1LO3L 2I60L 3N85H 4QF1B 2IAMB 2ITCA 3UROR 1AKJD 3UTSB 4OJFH 1RHFA 4AM0B 1SJXA 3GSNA 3W81A 3MO1B 1KCVL 4XZUA 1DANU 2P5WD 1H8NA 1KCKA 2VL5A 3NAAL 5C0DA 1V8HA 2DD8H 3TO4A 4NJAL 1SM3L 2IANE 1NBZA 3ARZA 1X5LA 1KJMB 4P9ML 4OGYL 1IT9H 5I1AA 2X42A 5BOPA 3ARUA 2PR4L 4AY0A 2AJXH 4RQQB 2EYTA 3QQ9C 5BMFL 4HEME 3SQOH 3ARGC 1P4LB 2XI9A 3EYSL 2OBGA 4KMTH 4TULL 2OYPA 2MWCA 1FV1A 4MHHG 2RFXB 4A6YH 4RISH 2IANB 3I6LE 3MRRA 5F6HI 4DVRL 5TF1H 2FBJL 5DRXA 4KY1L 1KELL 2YUWA 1H15B 2YA2A 3GJFH 3L3IB 1XGYH 3BH9A 2GI7A 5IEHA 4Z9KB 4WNQA 5DMGD 1A21A 5KSUB 3MRQA 1EJOH 3VFSA 4OGZA 2O5XH 5F3BB 4U1KA 1HXMB 1CT8A 3ARGD 3O3AB 4WW2F 5DT1H 5AEAA 2NY7L 3L1OH 2FB4L 3BIBX 2C4FU 5L7XH 5ESQA 4K7PX 4XWGH 3S35H 4TSBH 3MJ9L 2O5ZL 3O9WB 3H3PH 4NT6B 1NDMB 5ESVB 4C83B 5FGCE 5DYOA 5B38G 2QBWA 2QADB 3GJFA 5GSRB 4XVTL 4NCDA 5CWSB 1KFAL 1EVUA 4YAQA 5AG8A 5INDA 4N1HB 3LN4B 5IHLB 4TOYH 5CILH 1I7RB 1MNUL 2F5AL 3DGGB 1LK2B 1RZIA 1YA5A 3VCLB 3TIDA 4QRSA 5D2NE 1UYWL 2IBGA 3S36H 3D2UD 4NKOB 5AAWA 2AJSH 5FGCB 5D7LA 4G80A 4QGTA 3MOQA 4WY7L 5MEOA 4XMPL 2YR3A 5TH2A 4X7EC 4JY6B 1M71B 3UC0L 1FSKC 1I3GH 1NAMB 1HH6A 5ID1A 4U05A 3VXRA 4GMTL 4YHYC 1B4RA 4LCWD 3BZ4B 1S9YB 3DX7A 3BE1H 3P11L 3MYJB 4HUUA 5D2NB 3ULVE 3U9PH 3LKSB 4M61B 1UCBH 2AEPH 2AKRB 4JHWH 3MLTB 4LRNL 4MAUL 4LP5A 3O45B 3IS1X 4KI5D 4QOKA 1B0GA 3UDWA 1WITA 3VXUA 5C0AA 1LO5B 5HHXL 3WN5B 4RFOL 1UZ8B 1R24A 3MCLH 1NGPL 5I66A 5TE6L 1KCVH 2HG5A 2AEQH 3MYZA 5C3TA 1J11A 5D8JL 3GIZH 4JO1L 3QRFM 2OZ4L 1NGWA 2ID5A 3IFNH 4OI8A 4KKCC 4K9EL 4ZO8A 1CFSB 3UTPE 1JK8A 3NTCH 3O6FD 3OXRA 5BMFH 4JRXD 3RJDA 4KRPB 4KKAC 3GK8H 4KKBC 4R96A 1KBGL 2D7MA 1OB1B 3KYKL 3HG1A 1P84K 3KPTA 1MSPA 4HJJH 3IVKB 3BGFC 1EA9C 4AQ1B 5DC0A 1EO5A 1LGVA 2V2WB 4CU6A 3O2DH 4HK0B 1RZ8B 4DVRH 2FBJH 5EDXA 3LRSB 4KY1H 1G7JB 1NCCH 1JN6B 1KELH 3C09C 2ZUYA 3MV8D 3SGJC 2OK0L 3ME0A 1D9KB 2IALA 1OW0C 5ADOH 1AD0B 5FKAA 4PBVC 1DN2A 3FB6A 3QHZL 3EO1B 5HHNA 1FJ1B 3O2DA 2O5ZH 4OCMC 1OTTC 1KPUA 1A6UL 4M3JA 3IXAA 1AJ7L 4NGHH 5BZDA 2G2RA 4LCYA 2CUMA 3L3JB 3KNBB 2PTUA 4YEEA 3EO9L 4PD4K 3WMSA 4RAHA 3SBWC 4UT7L 4MD0B 3SN6N 1QUNA 1KLGB 5IM7B 2CIIA 3K2UL 1QRND 4QTHA 3CVHL 1G0YR 5KSBF 2DQUL 1T80A 1S9KC 3TZVA 3X3FL 2CKNA 1OTTD 1MF2L 2Y23A 3MLUL 5C0EA 3NZ8B 3T65B 4EVNA 5IFJB 3MODH 3HUJF 4GH7B 1XR8A 3MRGB 3QDGE 5HYFA 2AV1B 1I7TA 1WIOA 1Y18B 3S5LB 1CZ8H 3MRCB 4HGMA 2EO9A 2BSSA 2VUOA 1X6LA 3WHE1 2VXUL 4WFGE 4F7TA 4UOW0 2PUQT 4MZ2A 4Z78A 2DM4A 1GH7A 3U79A 2D7PA 3GI9L 2R15A 3QDGB 1HOCB 4KK8C 2EC9T 3C5SB 3EOBB 3MJ6A 1DBAH 4H5SA 5C0CA 3QUMB 4IMLA 1H3TA 1K4CB 4Q7DA 1N0XL 4M48H 1NGPH 5F7LB 1PDKA 2J8UF 2C3VB 2BSRA 3BKYH 1II4E 3QIWA 2AW2A 4Y19E 4CVXB 1KIPB 2AS5M 1XF1A 1NL0H 4UV7L 3GM8A 1CDYA 4HPYL 4G9DA 1KN4H 4HHAB 1I8MB 4N8PA 4HUXB 4KK8D 2WMPA 4HIJB 1R3HA 4ZFOA 5IK3B 3F6LA 5CSZA 3RVWC 4H0HB 3L5HA 1GGUA 1N8ZA 2I5YL 2XT1B 4RIRA 3GEWB 5D7KD 2CLRB 2DYPB 4Y19B 4R8WL 5IT2L 2UVFA 1KIQA 4IHOA 4F7EA 4R2GB 2QQKL 4ZUVB 4M93C 3FQTA 1FRGH 3GBML 1FIGH 4XPAL 5FCUL 4ZFGH 1D6VL 3HC4L 2R56H 4XNZB 3T08A 2JB6A 1MFCH 3TA3C 3RVWD 4B53A 1WF5A 5ALBH 4MA3B 2FJGB 5IW1A 3PWPE 2DBJA 1SYSA 3GRWH 4XMLL 4LSSH 1YMME 3R4DA 1JNLL 2XKSA 1LE5B 3WJJC 1C5CH 4JEGB 1FFRA 3WDJA 1WVZA 1TPXB 4KZDH 4KJQC 4K3JH 3TP4A 3TA3D 2R1XB 1JL8A 2Q8BH 3CVHH 2VABB 3GRWA 3PWPB 1MELA 2FIRT 4K94L 5GGTL 3X3FH 4Z0BH 3ARBA 3G08A 2MQCA 1I7ZA 3KPRD 5IFAL 4PTUB 5DJYB 3OX8A 4PREA 2FEEL 3MRBA 5BV7B 2RIKA 4XBGA 5B4MD 3TT3H 4ETQB 3KHQA 2UWEF 2R2HB 3C8KB 4YC2C 1CBVL 3VXTB 1KB5B 4KJQD 5DK2B 3V5KB 1T0MB 3RPKA 1GGBH 3G5VB 5C0GB 2VLMD 1MJ7L 5D9SB 5BO1L 3EYVA 1HDMA 5J13B 3TN0D 3LEYH 2FZ3A 2A6IA 1M6OB 3EO0B 5CP3H 1MJJB 4QRPA 5CJXC 1U8KB 1J9CT 3JV4B 3L7EA 4OQTL 1OAQL 1QLEL 3DO7A 1RZ7L 1JZ4A 4WENB 5KAQG 1R3LB 1J1XL 2YD9A 4IS6B 3UTTA 2I24N 3K4AA 2G9HA 4I4WA 4Q9QH 4RAUA 5DHYB 4RGMC 1S3KL 3VWJB 4UMGA 1NGZA 4PJIF 3H9YA 1JP5A 4LSDA 4NKMB 3PL6B 2VAJA 1A6VL 1NGYA 4QXGL 5CP3A 3RY6A 4JAMB 1FP5A 3BPNC 4MDJA 3BEWB 4GG8A 1Z6JT 2NY2C 1CFNA 1HQRB 1ND0B 2W91A 3OKNA 4JPKH 3WL9B 2MCG1 1KPRB 1MJ8L 2A38A 4QWWC 4X98B 5L9DH 1U9KA 1X44A 2E8ZA 4DK3A 1WFUA 1UB6A 3GMMB 4ZDHA 5B38A 1INEL 1ZA6A 2HT3D 3GUTA 3QUXC 4L4TE 4JHBA 4RGOL 1IM9B 3R8QA 4Y16B 4JFFE 5IWLA 3P73B 1CXEA 4X5WA 5E2WL 1LE9B 2NY2D 5I8CB 4ODUA 4BH8A 1ITCA 3B9KB 3GBLA 5FDYA 3MOBL 1D6VH 1KLUA 4LVEA 4M03A 3QWQB 1KC5L 3L3KA 3KXFA 1JMXA 4L4TB 1VENA 4JFFB 3IETB 4IRSC 1DEEA 1I1YB 5KG9B 2A74B 1QFWH 3U4BL 5IIEA 2PXYD 5A1AA 2ZJSL 4OZIB 5FM5M 2AQ2A 3CFKA 3MBEC 4LARL 4D2NA 3WD5L 2EDFA 3ALPA 3L3HB 4K94H 3DYMA 1YNTB 3V6BR 1HHJA 4I8DA 1IGYA 4YH6A 4BZ2H 3O3EA 5HPMB 5IFAH 1XFPA 3BH8B 4OB5L 3WV0A 3O3UN 5GS0L 2H41A 3KLAB 5I9QB 4YXHL 4QYOA 2HAZA 3D69B 1DQLH 1P1ZA 5HBBA 3HNSL 3N1GC 1RZFL 1U6AH 4LFHG 3ARVA 5T1DH 3C60D 5GGUA 5I75B 2WUCL 1CBVH 4MAYA 4ZOAA 3H3KA 2VLJD 3I75B 1KB5L 3O11A 5E99L 5GIRA 1MJ7H 3PHOB 1S7VA 5C8JB 4K8RD 4LGSB 4G6AD 2DBLH 3GSXB 3BP6A 4U1IA 2CGRH 3GMOB 4Z8FL 4FNLH 1OAQH 3BWAA 4EEEA 2UY7A 5J9PB 5SV4A 2ARWA 4RFNC 3C5ZB 4JO3H 5HDOA 5IVZB 1S3KH 3AXLA 2IWGA 3CIQA 2BHUA 4QEGA 5F7KC 3V8OA 2Q3AA 4YBLB 5EBMB 1QSEA 4GBXB 1JI1A 5DHVB 3OAYK 2CRZA 4LEXH 3P0VH 5EO0B 5HHOA 3C6LB 1PVHA 1DSFH 3RI5K 3CDGB 2P45B 4FQPA 4P2OC 4V1DE 2MCPH 3IXTA 2EIEA 3MV7A 2ATKA 4JZOB 2Z31D 1HI6A 3B9AA 2WIIA 1HZHL 3A6CH 3JWOC 3HZVA 5E9DD 5CHNA 4KTDH 3MGTB 4LPVA 1G7PA 3PIQA 4I0PD 4XNQA 5HDBF 3RWDA 3EDFA 1F6FB 1NUFA 4JFPA 3MREB 3NCCB 5E2WH 3ZDYF 3B43A 4V1DB 4C59B 3U7AA 3QXAA 2AXGB 4L8CB 3MOBH 4NWUH 4XTRD 4F7PA 4ELMA 3HE7C 1ZLSL 4FXGA 3K80A 4NUJB 5TQ0L 3O3BB 2F5BH 1QFHA 1EGJA 3TWCL 4OV5A 4IBLT 3NA4A 4N0FB 4PRPA 1LK3L 4LCIH 3P77B 3QH3B 2D3VA 3JUYA 2XIDA 4JFOB 4GW4B 4LMQI 4WI3A 1G7QA 4QXUL 2ILLA 2R1YA 1GZPA 4BQ8A 1YUHA 5BVPH 1RFDL 4IOIB 3Q6FA 4XPGL 4O2FB 5IMMA 3EDKA 4N0YL 5FM8A 3GIVB 1A6PA 3BGAA 2X7LB 4UV4L 3WD5H 5IKCB 4OFYD 1DBBL 2LTQC 4ZTPL 1CF8H 1TTGA 1T1YA 5E94A 2GHWB 3E0GA 1TZHB 1WZKA 2DLFL 2ZUSA 1UWEL 3R0NA 2HRLA 2GSGA 1QFUH 3H42L 3EGSB 4YXHH 3OKLA 3SDXE 3RNQB 1AHWC 4F7CA 3QUZC 3X14A 2BRRL 5FGBA 1OVZA 3DVGA 3KYOB 3VFNB 3VXSA 2R29H 1GAFH 5AZEH 4H8WC 2DQHL 1V05A 4YWGL 5J6GB 3QEGH 2BZDA 1TVHB 3RGVC 1IAIH 2ZCLH 1IGIH 2MPAL 3IDNB 5E6YA 3SJVD 4Z8FH 1YEKL 1A1NB 1K5NA 3B3IB 3SDXB 3JV0A 2X4TA 5I1KL 3E8UL 2WBKA 3H9SE 3L3OA 4NZRH 4NIKB 3PDOA 4JPVL 3QUZD 1ZGLM 5ABDE 4YDLC 3CVIL 3TFKD 2H8PA 2EIBA 4RWYH 5K93A 3OAZK 4DVBA 4QRRA 1UEMA 3UPAA 2DDQL 1BWMA 2LQRA 3WHXA 3RGVD 3BT2L 4JFEA 1IQWH 3QUKA 3IDIA 4X7FC 2O5YH 5C6TL 1NEZG 1T2JA 3H9SB 1I85C 1EUUA 4OZHA 1J0JA 1WWAX 2CR6A 4ZAKA 4S1QH 3E3QC 2NPLX 3N1FC 3X3GL 1HZHH 3ARGB 3O8XA 3VH8G 4JG0L 5FYKU 1JPSL 3O6KL 4HFUL 1DE4A 2GTWA 3GMQA 2X5PA 4UI2A 3BN3B 4FOMA 5EO1B 2SEBA 4ZYKA 3VFWA 1JPST 1HQ4B 3S36X 3ARED 1RK1B 1YEGH 5J1AB 5DURD 3U36B 1CICC 4CJ0A 1J18A 4Q9CA 2IBZX 1LP9E 1A6TB 5C0JB 1TVDA 3D0LB 3ZKSD 4YBHA 1M4KA 1WZ1H 5DSCA 4CADA 2FO4B 1LK3H 3CFEB 3O2VL 5I1IH 2ZCKH 3KPOA 1NSNH 4G8GE 1SMAA 4Q6IA 2DLIA 2OTWB 4XPGH 1LP9B 1KENL 3IFPB 5FHAL 5E7FA 4N0YH 5MEND 4PJFE 1JF1B 1OAUH 2FWOB 4UV4H 3T3PF 5DJAA 3WCYA 1G0DA 3GKWH 3NIFF 4KVNH 5GGSY 3V0WL 3QWOB 2R2EA 1QVOB 4YXLL 2HA1A 3H2WA 2UVEA 2B1AH 1D5MB 3K74B 4OLWH 1FSKB 4XHQA 5CGYC 5EOTA 3V8CA 4YHYB 4RCAA 4JRXE 5CIPH 4PJFB 3FAWA 1J1OH 3S96A 2B39A 1J8HD 3S4SB 1A5FH 1DQQB 1CDUA 4JLRB 4KQ3H 3NFPA 4MXQC 1EEUA 1RUKH 2ZKHH 4OGAD 4JANB 1OAKL 3Q2CA 2MPAH 2P8MA 2OLDA 1U8MB 3H0TA 4FN0A 3TYGL 3HC3L 3T0EC 2MKLC 1INQB 5E1HB 4D9LL 5B3JF 1NFKA 4E41D 5IMKB 3WUZA 1T2QL 3O6FB 5F7FA 4JPVH 1S7TB 4JRXB 4GG6F 3ARDA 4QHLA 1A7QL 1MQKL 4F9LA 3HI1B 1JTPA 5A16B 4LSRL 2DKMA 5EN2A 2C4XA 5E6IC 3LPGA 3F12B 3U0PB 1DBJL 1YECL 3BT2H 4HG4J 1U93B 4LLUA 5B8CA 5AZ2H 1G0XA 3T0ED 2GFBA 3IRPX 5C6TH 3T2NL 1CIUA 5F1KC 3STZA 5I2IB 1EFQA 1AXTH 4KRMB 3CUPA 1RZKL 5C07D 4HMEA 4CU7A 4MJ5B 4E42A 5FUOL 1XGPA 4JG0H 1EH9A 1QRNE 3BGFB 2H9GB 1OWWA 3SKOA 5E6ID 5BS0D 5HYQA 5GS1C 3CK0L 1N5AA 4ZFFB 4XNXH 3PNWB 3DBXA 4BQ9A 4W6XB 3PJSA 2BFVH 1TETL 4PJ9D 4JB9L 2VQTA 4PGCB 3C09B 4PBXA 4Q2ZB 2B4CC 4WJ5B 1FNEB 4WEUD 4FMKA 4G43A 5BZWA 1QRNB 2DTML 3RL1A 2XWBB 1VADA 4GRMA 1F97A 1FCGA 4D0CA 4PY8I 3O2VH 4AH2A 4GKZA 1BZ9B 5DD0L 2DQDL 1HE7A 1NBVL 2E7CA 5I1CL 5ERWA 2P8PA 4OUUA 1QTYT 4IRJD 2YPKB 1T89A 1KENH 2DLTA 3QA3A 5JDSB 3K46A 2P1YA 3SDCC 4E5XB 2PO6D 3VXQA 1PG7H 1ZT7B 5A2FA 3D39A 4PG9B 1ZGLA 1T0PB 1JV5A 2O61B 3P9MB 4UUJA 4B5EA 1LILA 4F33B 2FJFB 2HTKC 5EO9B 4HXAH 5EU6A 1NDGB 3VFMA 5DJDA 1D5ZA 3TVMC 3SDCD 3DX8A 4HF5L 1MAML 1CE6B 5AAMA 5KSAD 5E8PA 5F7UA 5D7KE 1OSPL 2XKNA 5CINL 4M43H 4PJ8D 3PGCB 1MOEA 3RTQC 2W92A 2FECL 5EBWA 1JHKL 4MWFB 3TBYA 3TYGH 1Q0YH 1KIRA 2A6KA 1S7XA 3V6OC 2YWZA 1J0HA 1FPTL 5J6HB 4WI6A 5CBEB 2FX7L 1F90L 3BKCH 1XT5A 2N4IA 3QEQA 4KRNA 1DFBL 4M7KL 2Y06L 3RPIB 4IOFC 2WSKA 4LSQL 4Q97A 5GPRA 4XP5H 1R5IB 4OGXL 1CGTA 1OARH 1I1CA 1WGOA 1DBJH 3RTQD 1FE8H 3PWJB 2FL5B 4H20L 5IG7B 1FFNA 1FZOA 1A9BB 2ZZUT 1VGEH 3EBAA 3T2NH 1IZKA 2IBBA 3IB4A 1MCOL 1VFAA 1RZKH 4OZHF 3VMNA 5DMIL 1WBZA 1IGCL 1WC7A 3QHFL 5ITBL 3LOWA 3DX9A 4TUJB 3CFCL 1IKFL 4P2CG 3CH1B 2E3VA 3R1GL 1SJVA 1ZMYA 2HFEA 3S88L 3KPRE 2QSCH 4GW1A 4MA1B 3I6GA 2IFFH 4JB9H 4WO4A 1I8IB 4M93B 4IDLA 4UTBH 3WFCL 1IC4L 1TLKA 2EO1A 2LVEA 1RHHB 3V7AE 3TA3B 3ZKMD 4OLYH 1CXHA 2DTMH 3PHQB 2VLME 4YHNA 1ZOXA 1H8OA 2ZNXA 1A4KA 4IRZH 3KPRB 1HSAB 4D3CH 1LEIB 1ORQB 3T4AB 4J3UA 3FO1B 2VZ3A 5DD5H 4S1DC 1VPOL 3CD4A 3QJHB 5K59E 1CLZH 4YDKH 3OKMB 3T2PA 2FSEA 2NY0C 1ZEAH 3G04B 4BSWB 2Z35A 1VFMA 5E8DL 1A3LH 1QBML 2F8XC 5HVWA 3RY4A 1FVCA 3EOTH 1O0VA 4N8VG 2I27N 2AGJH 1E6OL 2EDWA 3EDJA 2VLKA 2Y9RT 4KMQA 3NH7L 3IU3A 1QKZH 3I2CL 4PJXE 2FLRT 4NQED 1RD6A 1CE1H 4HC1A 4S1DD 1JWUA 2Y4SA 1U8JA 2XA8L 2N1KA 1VKXA 4G7YL 5SX5K 4YC2B 1T21A 1A8JH 4M6ML 5FXCH 2XZQH 3FOMA 4RMQA 4PJDA 1W0WA 1RJLB 4R0LC 2CDEA 1F13A 1OSPH 1YNKL 3IDYB 3JUZA 3P4NA 4ONGL 2JELL 1JFQL 5IV2A 4HH9A 1NFDE 1YQ2A 1A6WL 1OF2B 4PJXB 5GGRA 3VH8A 4PB9L 1G7HA 3FB8A 3L3DB 3MRMB 1H3VA 5DJ2A 5JORA 3MUHL 2Y06H 3UZEA 3BDYH 4LSQH 4RGMB 2NCMA 3B2VL 3GSWB 3FONA 1U8HA 3RWGA 3WNKA 5F9JA 1KCSL 1MVFA 2GEEA 1NFDB 4N8CH 3BESR 3RA7L 2ATPA 4H20H 1TDQA 3BPNB 4NQSB 1T1WA 1G7IB 5HDQH 2NY2B 3PGDB 4EUPG 1CFTB 3WLWD 3BQUC 3F7VB 3R0MA 1YEIH 4Y5XC 2YRZA 3SKMA 3ZE0F 1LD9B 4TSCL 4ZPVA 5E1AA 4CKVX 2FR4A 3VRJA 1IBGH 3ET9F 4OF3A 3NZHL 2YZ8A 3WNLA 5ITBH 4LCCA 2EIZB 4JRYD 1BBJB 3DNKA 4EI5C 3OMZA 4LLQA 1PW3A 3ARRA 1FG9C 3QUXB 4KVCL 3LY6A 3FCTB 2GTZA 3S88H 2KZWA 2JB5H 3ELAT 2MFNA 1NCBL 5GGVY 1Q9OA 2I9TA 4OIIL 4JY5L 4Y2DC 4NOBA 2PXYB 3DTXA 3EHBD 1ZHNB 3BQUD 4L9LC 5H2BB 4Z7VE 5HI5C 5E00B 2OTPA 1P7QA 1JGEB 4HFWA 4NQDA 1DQDL 4HKBA 1NMAH 4NHUA 3JTSA 2VLJE 1QSFD 3KPMA 3LS4L 4JKMA 3CNKA 1VFBB 1MY7A 1V7MH 3OAYH 5DLML 4IMKA 1XZ0B 3THMH 4LQFH 5FIEA 4Z7VB 3T3ME 2VERN 4NWTL 3C08H 3BYYA 4NYLB 5CEYA 3C60B 5EZJB 5HI5D 1P2CA 2VIRA 3VFOB 1A7OH 1AP2B 3MBEB 1BX2A 2VLJB 4FP8L 4APQD 5EFIA 5TPWL 2ED8A 2HWZL 3QQ4B 1ZXQA 3IAGC 4ODXB 5MEQA 4LLDA 2DI9A 4D0BA 1T83C 1I7UB 5GSVB 1P69B 4P5MA 4LNRA 1AQDB 3IDJA 5ELIA 3QI9D 1A2YB 2BC4A 4M6MH 2H2SD 4HQQL 5E9DE 5I76A 2NR6C 3HPLB 4JFXA 3JV5A 3LKQA 2Z8RA 3O0RL 2P8LA 4XBPB 3AAZA 3O3DA 4PTTA 1B9ZA 5EOQH 1FO0B 3RIFK 3U4EA 4Y5YA 2AJZA 2CK0H 5C3LD 2W1NA 3AM8C 1U8NB 4Y4HC 1M7DB 4RFNB 2Z31B 3ABZA 4R7NA 5I8EA 1KEGL 3FAXA 4LSPL 3NPSC 4DCQB 4KH2A 5E9DB 1BFVL 5C9JB 4L9DA 2EEBA 1I1AD 4QHMB 4I0PB 2MNUA 1INDL 5K9OB 3MRJA 4YEFA 3BD4A 4XAWH 5KZCD 1L7TH 4I18A 2FIKA 1FYTD 3RA7H 2QQQA 4JO2L 4KAQL 1QEWA 4DAGL 1ONQA 3MUJA 2Q86A 5I1HH 4TSCH 1N2RB 2R2BA 1Z9SA 5DI8B 2GJJA 2V17H 4MYWB 4HKJA 4DZ8B 2IH3B 4JJ5B 4M9OA 3ARWA 3D9AL 1KTLA 4XMKH 1JZ5A 1EBAA 3HMXH 1XIWA 1P9MA 3CZFB 2Y72A 4U6VH 3K7UA 4HS3B 5L6YH 4ZUSA 3W9DA 2QSQA 2NW2B 5F1IB 4TSAH 3MRKA 1KTDB 4G8FB 1RUPL 4PGJA 4UQ2A 3SHSA 1YJDC 4Y5VC 2XZZA 3QUYC 1Z3GL 3HMXA 1ZVSB 1XR9B 2OR8A 4RA0C 3OAZH 2VH5L 1IEBA 3SJVE 3QZWB 5EC2B 2F54D 4LHJB 2DIJA 5ESAA 3DRQB 1X5KA 5DJ6A 2J6EA 4NWTH 1W0VA 3MXVL 5CCKH 3GMLB 1EHAA 2YC1A 5DQJB 3V4UL 4HDIB 1UWXH 2X4UB 4EDWH 4R97C 4EBQH 4J4PC 4ORZC 3Q1SL 3C9NB 2ADFL 3QUYD 2YOCA 3WIHL 1U0QA 4L4VD 4NKQB 2L4OA 4K8RL 4DGIH 1T7XA 3SJVB 3H8NA 4TUKL 4NHCH 5D7IE 2B0SH 4LBEA 2O93L 2CXKA 1PLGL 5DJXB 3ZT7A 5EZOL 5JXAH 2X4QA 3QDJA 5CD3A 2QQNL 3QUZB 5EU7C 4NPYB 1N7MH 4DUXA 4Q0XL 4YFEA 2NY3C 3IJHB 3WE6B 4J4PD 2P24B 2WP3T 3DGCR 2CKBB 1IKNA 4PJDF 3IJYB 1M05B 1QA9A 3RGVB 4H25B 4Z7UA 4C56D 3IDMB 5D7IB 3EYOB 2AXFA 4JGMA 5DK3A 1N5YL 2NNAB 2VLLA 4O2EA 2X6MA 1FO0L 5L2KA 5FUCC 3MR9B 1G9MH 1KJ2L 4EN3C 3DYOA 1QYGH 3LIZL 1AGFA 1S5HB 2W59A 3E3QE 5EC1B 1BFVH 3MACH 2PW1A 2GK2A 2DWEA 1C5BL 2NY3D 3PGFL 4JG1H 2V7NB 3VFUA 5JHDD 4HJ0C 3AUVA 1A14L 3FQRB 1QG3A 1T20B 2YUZA 4JM2A 3BP4A 1GIGL 2AK4A 1K8DB 4V2BA 4U1JB 4YX2L 3SGDH 4FFYH 5IOPA 5DMKB 4OCSL 5D1ZC 3SO3C 2YKLL 3AREB 1PBYA 4DAGH 3DX6B 4DKEL 1H3WM 2BDNH 3BO8B 4PJBE 5HI4C 4EN3D 4FZEL 1DEDA 1G6RA 3OKEA 1KGCD 4JN1L 5CZXC 3U2SB 3EAKA 4EQ3A 4M7ZC 5HTSA 5IB3B 3UJJL 2KBGA 4MA8L 3OGOE 3JWOL 4OKVB 3BP7A 1QFOA 1PKQA 3RU8L 4BFBD 2DIAA 5HY9B 5FOBA 1FVDA 1WIPA 4YHML 1MCLA 2ADGB 4GAYB 2GUOB 3SCMC 4HPOL 4MJ4A 5D1ZD 4NUGL 1VHPA 4Z7WA 3D25A 4U1LA 4W70A 1QO3B 4N8VA 4PJBB 1CICB 4GJTB 4UT9L 5HI4D 5F7YC 1RUPH 3HLAB 4MJID 5FA3A 1J8HE 1Z3GH 2X10A 4NN7C 5IBTL 4WWKC 5C2UB 3T77B 2H3NA 4YHLL 3TO2B 4JZNB 3FTGB 2IAMA 3SCMD 1P7HL 3UTSA 1B0WA 4E41E 4AL8L 4UTAL 1J8HB 1N3NB 1CLYH 2Z8SA 4U6XA 3WEXB 4U1GC 4MD5A 3K1DA 3RWCB 1MCEA 2OZ4A 5FO7B 3BIKB 4U2YA 2NXYC 4NNPL 5IB2B 1KJMA 1MCPH 4EUPH 3T2QA 1FVEB 4TUKH 4FTVD 4GAGL 4PGDA 2Y7QB 3T0EE 4E41B 5EZOH 3V6ZA 4GXVL 5ADPL 4G6KL 2QQNH 3M17A 2YN3A 2ARJQ 5EUOE 1ZE3C 4HXBL 1SEBB 4GAFB 5DZLA 3EKCA 2RFXA 1EJ6A 5IBUG 3VXNB 4HV8B 2R69L 4EUPA 4WEMB 2NXYD 1H15A 3L3IA 4XPTL 1F58H 1L7IH 1WK0A 3T0EB 2R1WA 2VDPH 5IQ7L 2KDGA 5ACZA 3HE6C 3LRHA 5F3BA 3MNWB 4MCZA 1KJ2H 1HXMA 2IQAA 3WKML 5C07B 3I02B 1A6ZB 1NGXA 3BMVA 3U7WL 2X4RB 3KR3L 3CC5A 1OL0A 4JFDA 4JDZB 1IGFL 3PGFH 4NT6A 4HWBH 1DL7L 1NDMA 5ESVA 1MFEH 2VAAA 4C83A 5E6IB 1JPTH 1A14H 2IQ9L 3DRTB 5JHLL 5GSRA 1T03H 4YX2H 4X99A 4L8SC 2DN7A 4UU9B 5CWSA 1EAPB 1I4FA 3EW3B 4PJ9B 3B9VA 1NMBH 2XNAB 3DGGA 3OBAA 1JVKA 4LGPB 4YO0B 1UB5A 4GRWE 1CLCA 1N4XL 2I26N 2IF7A 5IROA 3UJJH 3KYAA 4NJ9L 1QR1B 5HGAB 3DVNB 1BREA 1MRDH 3QO1B 4OZ4B 4JR9H 3MLRL 4GXUN 3RU8H 5GS1B 4JY6A 3TYFB 1M71A 2ED9A 2UZYB 1NAMA 1PG7X 3BJ91 3JXAA 3FT3B 1XF3B 4OCXH 3V0VB 5K9QG 1S8DB 2Q3ZA 3BZ4A 3V4PL 3GSRA 1JNNL 3MYJA 4I48B 4LLWA 5D2NA 4GRWB 1U58A 1I8KB 3U1SH 4OCLC 3LKSA 3M1BA 5IBTH 2AKRA 2Y5EA 4PR5B 1AI1L 1D6EB 3GGWB 3VRLF 3U0TA 3ILPB 3DSFH 4YHLH 3QIUA 1MI5D 3ESUF 1OD7A 4HS6A 3REVB 5E95B 1EIBA 1RJZB 5L88H 3WN5A 3RWJB 4P57B 1Y0LA 5D7SH 4HK3J 4M7JH 5I0ZA 3SDCB 3W0WD 4KKLC 2AI0L 1A4JB 2Y07L 1QRKA 1PG7W 4EKXA 3NFNB 4PJ8B 2JJSC 4NNPH 2V2TB 1GL4B 3MZGB 2EDBA 1MFBL 2HN7A 4OAWA 5KANG 3V6OE 4ERSL 1YN7B 1OB1A 3HI6L 4ZS6C 2ESVD 1Z0MA 2D7QA 2Y1VA 2N7BA 2FD6L 3O4OC 5EIIB 2OQJA 4U6YB 4CW1B 4KKLD 1IM3B 1ZHLB 2J8OA 4HK0A 5D4QA 5GS2D 4G6ML 1RZ8A 5ACLA 2F53E 3BAEH 1G7JA 1JN6A 3RTQB 1UM4H 1JI2A 3JV6B 1X5HA 4XPTH 4Z7UF 3QDHA 2HFGL 4JFHD 3TF7C 1KPVB 5GRYA 2Z92B 2R23B 5CUSH 1D9KA 1H5BA 4ORGB 1CR9L 3SDAC 1HIMH 3NIGF 3HPJB 3E6HA 1CYGA 4Z95H 3FOLB 3U7WH 1AGDB 1FJ1A 3KR3H 1X5AA 2BVOB 4ONFL 1FH5H 2VDQL 5ICXA 5GJTH 4LAQH 2F53B 2IQ9H 1D5XB 1T0NB 4JM2F 2V9RA 1WZMA 1WCBA 3REWB 2C7UB 1MHEB 5D1XC 5D70H 2BCKB 2HP4A 4MD0A 4X4XB 4P59L 3OJDB 5GHWL 5I18H 1B4JL 3CPLB 1OD9A 2A83B 2XKUA 2X4SB 5SX5H 3O2WH 1UFUA 3LKPB 3VGDA 1YEHL 3W82A 4G8EA 3NZ8A 3QG7H 2EZ0D 4NN5C 4XBEH 1F8TL 3WXVH 1CTNA 4M00A 5D2LA 5CZKA 1CFBA 1DBKL 1DUYA 3V4VH 3PP4L 1Y18A 3FQXB 4MJ2A 3V4PH 4F58L 3TBVA 2B4CL 2WWKT 3S5LA 1FBIH 1PYWA 1JNNH 2XFXA 1RZJH 4OTXL 3H6JA 1U3ZA 2FJHB 1PZUB 2IPTH 4QRTB 4LVOC 1F2QA 3NIDE 1HNFA 3KGRA 2EH7L 5DRNA 4HKZB 4TRPL 4OLZL 4OT1L 3S3SA 5ICYB 4DFHA 3UYRH 3HC0B 1C1EL 2H2PC 3C5SA 3PABA 4OCRL 2V9TA 3CCHB 3QUMA 2NY0B 5BXFB 1BD2D 5GRUL 1TCRA 1ZS8A 2L7UA 5ENWB 1U95A 3ZL4L 5J7CC 5KJRL 4M6OH 4I2XE 1NAKH 3FMGL 1BEYH 4KZEL 4R7DA 3FFCD 2NY1C 4NO0D 1KIPA 4F3FB 5E4IA 3KJ4C 4EIGB 5I16B 2CR3A 4HHAA 1I8MA 4HUXA 3HNTL 2H2PD 3S34H 3UXFA 5IK3A 4AG4H 3SE4C 2WAHA 4EJ1C 2R0WL 4TQEH 3W9EB 4I2XB 3G6JA 2FD6H 2DWDB 4R4BB 3BHBB 2DYPA 4PJ7E 1J0IA 3Q6GL 4Y19A 1ED3B 1WBXB 3VFPB 2NY1D 4ODTH 4PJHE 4QXWA 3HB3C 1A7RH 1XGQA 1AY1H 4ZUVA 2GQHA 2K3TA 3T4YA 3ES6B 4FHBD 4UQ3A 4YGAB 4NM8L 4QHUB 4EI6B 4RX4D 4YHKH 3FN0L 4MA3A 4N0CC 1X5GA 5EBLB 4AEFA 1J12A 4ONFH 4K7FB 4PJ7B 1QSFE 3X17A 2ENYA 1BFTA 1KJVB 3ARFA 4XX1E 4PJHB 2W9LA 5EZIL 1U8LB 1VFOA 1LE5A 1C08B 1T1ZB 4MVBD 4HBQA 3WSQL 3O81A 5BV7H 5IJVB 3BQUB 4OQ1A 3LQMA 1I9IH 4OZGE 3SGEI 2R1XA 4JVPA 1B4JH 2VABA 6CGTA 1YMHB 1RI8A 4XP1H 1QSFB 3U7YL 1XGRA 1YMMA 1CL7H 1FORH 5DJYA 3GB7B 3MZTA 4WTZG 2WLYA 4MMZC 2IEPA 2R2HA 3C8KA 1WTLA 4L9LB 1YZZA 3VXTA 1KB5A 5LGHH 5DK2A 4OZGB 4G3YL 3V5KA 3ZDXE 3QG6A 3G5VA 2D7NA 1VACA 5D9SA 2BNQA 1CU4L 3VFTA 4RAVB 4M1CC 3MPCA 4APQB 3MLYL 1T2XA 1M6OA 1MJJA 4F37K 4JVWA 3JV4A 3PQYE 3MRPA 2YHGA 4OLZH 3QCVL 4HZAA 4QT5A 2GJ6D 1R3LA 4K07A 1PY4A 3ZZ1A 4IS6A 1VFUA 5DHYA 1MLBB 3VWJA 4LHUD 3MLPA 5GRUH 5F8RC 3ZL4H 3QI9B 2EDOA 5TQ2L 3ZTNL 4XC1L 3ULVF 3PL6A 1MCDA 4ZUTB 1TJIL 1ULVA 4DN4H 4KZEH 1ZHBA 1KULA 5CJQH 1HHIB 4QKXB 3DO3A 1HILB 5FHBL 3BEWA 3QFDB 1FIEA 1TMCB 2W65B 4GQ9L 1HQRA 4OM1L 1ND0A 5CGTA 3WL9A 2B1HH 3HNTH 4MNHB 4GW5B 4AIOA 5EZLB 1ROWA 4P3CL 3X12B 3QCUL 4NNXB 3GMMA 1B90A 4PP2A 2UYLB 2EDRA 4JREC 3HKFA 4NRZB 2CLVB 1I1AB 2D03H 3RVVC 5HGDA 5EOCL 3Q3GB 4E0RB 1MWAB 1G84A 1NC2A 1FL5B 5KZCB 5SWSE 1LEKB 3RZCA 1DQJB 4FQHB 1I3RA 1T3FB 4X5XB 2MHAB 1KXVC 3B9KA 4NM8H 1FFQA 4Y4HB 2ENSA 2YPLD 3G5YA 4U1HB 4LF3B 4XNYH 1C16B 3NPSB 4WRLA 5K9QI 1A9EA 4L4TA 3KWWB 3OKDA 2FDBP 3PV7A 4YDJB 3RVVD 3A6BH 3ULUC 5SWSB 2CRYA 1OLLA 2A74A 2DQIL 5DS8B 4MXWL 4TTDC 1KYOK 3CZJA 3N9GH 2XN9D 4KGLA 5H94B 3RDTD 1H9VA 4I1NB 5T3XE 2F54E 2RCSH 4EQ2A 1Z5LB 1Q94B 4PJGA 5K9KB 1XF5B 5IJKC 1IC5L 4O58L 5F1OB 1MFDL 3L3HA 3O6ML 4AMKL 2CQVA 5HPMA 3BH8A 2D0FA 4L4VE 3ULUD 1S7RB 1KJ3H 3EYQD 3D69A 1X4XA 4TTDD 2GYSA 1F6AB 2F54B 4HT1H 5ALCL 2V7HA 2APWA 5D2LF 1CFQB 3KVQA 3I75A 4Z7QE 4MQ7B 4Y5VB 3U0WL 3IFLL 3QUYB 4EOWL 4P23C 5SV3A 2X1WL 4KV5E 4L4VB 4WU7A 1XCQB 1S78C 3N1QC 2OI9B 5J9PA 3TJHD 2AJYH 5CJOL 4P2QD 3C5ZA 5FUZH 5DGRA 2CSPA 1K4DB 5IVZA 3UAJD 1SJEB 5CD5C 1JYXA 1NC4B 1NCWL 1EUTA 5EU7E 5TQ2H 3ZTNH 4GBXA 3U83A 1VESA 5F9OL 5DHVA 4R97B 2R0KL 1JHLL 1JRHH 5JXEC 4RRPG 5JHDE 3VGEA 3WO3B 5HVHC 1YN6B 3F65A 3G9AB 1K2DB 5EO0A 1S78D 5EULV 4HCRH 1RJYB 4OM1H 4KQ4L 4Y7MA 1OGTB 4OSUL 1CDCA 3TH2T 4MX7A 5FUCE 1AR2A 4K3DH 1F4HA 4XRCB 2CDFB 4F9PA 1KGCE 3BD5A 1AC0A 3G6JF 2NY3B 1REIA 5JHDB 4YQXH 2EEAA 2Z9TA 4MLIA 1AGBB 4S0SD 3MREA 4HCRA 1MWAL 4DKFL 3IFOA 1RMFH 1T04A 4V1DA 2I07A 4K71C 4Z18A 2C4FT 3TIEB 1UXWB 5D7LD 1TJGL 3QPXL 4P3WA 5E2UH 3UJIH 4EN3B 2BOCA 4YLQT 4N5UA 2AAVA 4U1SA 3G5ZB 4NUJA 3O3BA 2Y6SD 5D1QC 3VXRD 3T0DA 5CJ5A 1CIDA 3IS0X 2WZPD 4N0FA 3P77A 5DTFA 2BRQA 5FA4B 4JFOA 1OCWL 4L8DA 4U4BA 1UXSB 4IOIA 5D1ZB 3SO3B 4DKAA 5FB8B 2MQ3A 1A1OB 4KFZC 5DR5L 1E28B 2DAVA 1MCQA 3GIVA 4QOKD 2X7LA 2FEDD 3VXUD 4DJMA 5C0AD 4UDTA 4QY8A 1MFDH 4J23A 5IUSA 2W07A 1DLFL 5DGQA 3CFBB 1DQTA 2QR0B 2HJFB 4MB5A 3VFRB 4LDEB 4M8QB 5M7QA 1U8OB 1IL1A 3SCMB 2YA0A 5IVXE 5SWZA 2GAZA 4YBQD 4PG2C 2Z0BA 2DQTH 1FFOB 2H1PH 4WTXA 4G6FD 1PKOA 3F7YB 3KYOA 4D9QD 2QHRH 3QQ3A 1EEZB 3L7FB 2APVA 3U0WH 1B2WL 3DWTA 1TVHA 1YJDL 2ADJB 4NN7B 3IDNA 3HG1D 3BFOA 2FATH 1A1NA 3B3IA 3SDXA 3UZQA 1EHLL 4PY7B 4J8RB 3MJ8B 1T7WA 5IVXB 2HTLC 2MJWA 4HJGB 3M8OL 2HH0H 3RIFF 3KG5A 1RZGA 1GVIA 1CXKA 3N50A 4P46C 4C57C 3BN9C 5F9OH 2R0KH 2XZAL 3FQWB 2XOTA 3FQUA 4FQ2L 4OLEA 2NXYB 3VI3E 5HYJE 3NN8A 3H9SA 4XCNA 1T5XB 2HTLD 5GGVL 3CX5K 2XWJA 3ARGA 5J57B 3OAUH 3HCVB 2DJ4A 3VG0H 3OXSB 4Z7OE 4Q74A 3QXTA 5HVFB 2JIXB 4WDIB 5I74B 5HYJB 5DQDH 5EWIH 3TH3T 5MI0C 3TZVD 3U36A 1TJGH 3QPXH 3IDGB 2CRMA 1A6TA 2VSDA 4XP4L 5C0JA 3D0LA 1L0QA 5SWQB 4H0GA 3FO2A 4WTZA 2FO4A 3CFEA 2G5BB 3LQZA 4PIRF 4K23L 3BZFB 4YDIL 4OI9A 4WIQA 5T1LA 4L8SB 4I3RL 1UH2A 2IG2L 4X8JB 5T33L 2E7LC 1MI5E 2YXMA 2OTWA 1AR1D 1QNZL 1OQXA 3UMTA 1UC6A 3IFPA 1ES0B 1IQDB 3BPCB 1FZKB 2ARJB 1JF1A 2AJVH 1N6VA 1PSKH 43C9B 4PJGF 3INUL 1LMKA 15C8L 3I6KB 3W0WE 1DUZA 5JMRA 4QXTB 3QWOA 5C0CD 1ORSB 1QVOA 4DTGH 4X6DE 1YYLH 4LKCB 4L3ED 2BX5A 1D5MA 4G8GA 4KJYA 4BQBA 4JHZA 1MI5B 1JGUH 3D18A 1H3GA 3QIWD 1ZT4B 5LCVL 1AD9B 3EUUA 4KXZI 3VRIA 4J3OC 4R4FL 4D94A 1ETZA 1IAKB 2ICWJ 4M4RA 3CJJA 4PJFA 4U1MA 2ICCA 2FECI 1OAZL 1RY7B 2ESVE 2J7LA 5D7JA 3S4SA 3W0WB 1DQQA 3OHXB 1QZ1A 1W72H 1B2WH 4JANA 2VXQL 4X6DB 3QXDB 1J05A 3MX0A 1LO4L 1U8MA 2G60L 1INQA 5I1EL 1NCUA 2HLFD 5IMKA 5LGJB 3B4NA 1GRWA 2DF3A 4XCFL 2OP4H 4YHOL 2D7TL 4JRXA 3IYLW 4X6EB 2ESVB 5CMAB 3HI1A 1EVTC 4PJ5D 5A16A 1W72A 4G7VL 3B83A 3WFDL 3IGAB 1JPFB 1Q8MA 3U0PA 1U93A 5KVEL 2GY7B 3PP3K 4Y1AA 1ACYL 3ARBC 5E08L 1JGDB 1CVSC 1D3CA 3MTRA 2HT2C 5E8EA 3HR5B 3AS1A 4R26H 4BH7A 4ENEC 5JIIA 4LOUC 4UNTA 2H9GA 2R4RL 2K9UA 4X6CE 1C5DB 1O5DT 3KPNB 4F8TA 4ZFFA 4J6RL 5FECA 4XVJH 2HJKA 3PNWA 3W5NA 2JJVA 5KVDL 1U41A 5DZNA 4NC0B 3ARBD 4WJ5A 3QEUA 3NACH 3SGJA 1FNEA 4DOHE 2NLJA 5F88B 3P30H 1OW0A 4XP4H 4ENED 3PE9A 1QRNA 4LOUD 3QPQD 2XWBA 1RURH 2XY2A 1HN1A 4L5FH 4X5LA 2ZWLT 3GHEL 4JFZH 3LN9A 3UCRA 4H26B 1WV7T 3ZKND 1BAFH 4DOHB 5D1XB 5IMOB 4QRPD 5JDSA 4N68A 5J4MA 3CFDA 4E5XA 4I13B 1C7TA 2F58H 4X4YA 7FABH 4M62H 1ZT7A 15C8H 1A3RL 2WV3A 4KK5C 4NQCE 1D5IL 3UTTD 2ZOLB 4NP4H 5MP6H 3IKKA 3CDCA 4WCYL 3RWEB 2O61A 5KVGH 1NANH 3P9MA 5DUML 1NBYB 2FJFA 4JDVB 3E2HC 1DDHA 5EO9A 4NN5B 1IC7L 5BRZE 3CSGA 3K4ZA 2D4DA 5KN5B 3VD4A 4RRPA 5H35B 2ZUVA 3SDDC 1UWGL 4MXVE 4ZTOH 3IJSB 1H3PL 2VXQH 3EDDA 4NO0B 4OFVA 1YQVL 4WFED 3CXDH 3RJQB 3B9DA 3SDXF 2WANA 2X70A 5C0NC 5MHSD 4BFIA 1MEXL 3PWVB 3RPIA 2FH6A 4UZGA 1HK6A 4E9LA 1BHGA 2FX8L 2V2XB 2VTFA 3FKUS 4MNQD 1R5IA 4KJPC 3ZO0A 1Z9MA 4Y4FC 35C8L 1E4XH 12E8L 4AEHH 4WUUA 2NY1B 1HCFX 3PWJA 1KCLA 1LQSR 2FL5A 4HIHB 3NCBB 2GITB 1A9BA 1NEUA 4KPHH 4FZ8L 3KJ4B 1M7XA 1TXKA 1R3JB 5C0ND 1QLRB 4FABL 3NCMA 2VDOL 4N5EC 4XPBH 4XPFH 2R4RH 4YHZL 4Y4FD 4MA7H 3EZ8A 1RUQL 4K94C 1JBJA 3MLVL 4LVNC 2CXGA 3HNVL 1KACB 3PWUA 3KYMA 3OPZL 3W39A 3ILQC 3A67L 3SY0B 3TA3A 4M8VA 4IOSD 3LZFL 1E27B 1LEIA 1GPOL 4LCUB 3HZMA 4MAYD 4BELD 1JHTB 5KSVB 1B6UA 4HUNB 3QJHA 3WJJA 2GJ6E 3OKMA 5EU5B 2KQMA 2VXTH 1ZLUK 2BVQA 4HX1A 1BLNB 2B20A 1IGJB 1HINL 1LP9F 1EHXA 3D0VB 1ZLVK 1ZWIB 1A3RH 1U42A 1YEJL 1YPZA 1WICA 5DUMH 5ECJE 3VWKC 1QSED 4Q9RL 1MHCB 2GJ6B 1ITBB 4Y2OA 4LSVL 1FN4B 4XPHH 4JFYB 2I9LB 5B3NA 1RIVL 2HKFH 1UCTA 3IDXL 1V7NL 4LHUB 4FXKB 4PJFF 1HEZB 3U9UB 2IH1A 3MV7D 4YHPA 5EU3B 1TENA 5FYKE 1FNGB 5CJXA 1YQVH 1OF2A 3MRMA 2H32B 4X9BA 3AROA 4J3SA 1UACL 2HFTA 3AFLA 3AU1B 3W11D 4M4PA 4R2GC 1WLHA 3FFDB 4ZSOE 3QNXB 5MERA 2YPLE 5D93C 1PZ5B 4D0DA 1P4IL 2VDMH 5A2JH 5I15H 12E8H 1FL6A 5D6DC 4P3DB 1IE5A 4OLUL 4KDTC 1JTOA 4NQSA 4PPTA 5E7BA 2CMRH 1Q9WA 3PGDA 1CFTA 1F11B 3KS0H 1TFHA 2XN9E 1LD9A 4YXKL 4FABH 2Q6WA 1HKLL 1KLFA 1NFIA 4ZSOB 3QULB 4FFWC 4GSDH 2YPLB 3NA9L 4XWOC 1BBJA 4O2CB 1R5VB 3C5JB 1YC8A 5HD8C 3CSYA 1TPXC 4Y4KC 4YHZH 4WGVB 2FYYB 3QUXA 3FCTA 1UVQB 3MA7A 2CK2A 5D5ME 4JQIL 2LE9A 3V79C 3ULUE 5TF0A 3HNVH 3ARYA 1P7KB 2KUTA 4PLKC 2XN9B 4LDLB 1ZHNA 2Z8WC 1UM5H 1X5FA 3OPZH 5GS0C 2VDLL 3B5TA 3S6CA 4CNIB 1OGAE 2JK5A 5CEXB 4FQIL 1JGEA 4HUVB 1CXIA 4OD1H 5DF0A 1UJ3C 4P99A 4FFWD 2HKHL 4K2UH 2NY5L 4DN3H 4R90L 5F9DC 5A2LH 5HD8D 1BQLH 3GSNB 4IRSA 5L8JB 3VXSD 4H88L 4XZUB 2VL5B 2NY4D 5SX4I 1XZ0A 3ZDZE 5KW9H 1AFVH 1A7NL 2XY1A 4PLKD 4ZQKB 4Z7VA 4P2QE 1J5OH 4NYLA 1NBZB 3NABL 5EZJA 1EMTL 3HZYB 4NKDB 2ZUUA 5E8OA 3MBEA 4HZLA 3WIHA 5DZOA 5DUBB 3VXOB 1A64A 4KJWC 5EA0H 1TITA 2DM3A 1JMZA 3NCJL 1YEJH 3MV9D 2XACC 4YDVA 1FV1B 1QBBA 4QRRD 5GQBA 4LSVH 3MRRB 4P2QB 3BPOB 43CAB 3MRHA 3MRFB 4UINL 3HAEG 5DRXB 5I1GL 3QT2A 1JPGA 2V5SA 3MRQB 4ZAKD 4XBPA 1GXEA 2QL1A 1CT8B 3O8XD 1EAJA 3BUTA 1QQDB 5IB5B 5GGQH 1FO0A 5ESQB 4A6YB 1JCKA 4D9RD 1KCRL 1U8NA 1P4BH 4Y16C 4MJ6A 4DCQA 2VLRE 3I9GH 5ITFA 5E9DA 5C9JA 4YAQB 1RUML 4QHMA 3CLFL 3EOAA 2DQCL 3D5OF 4MMXC 4OM0H 4NQVB 3VXRE 2YUXA 5KS9A 1MIEH 2CDGB 4NZUL 4G6JL 3OKKB 1RZIB 4JKPH 5HVHB 3H9HB 4P2OA 1TTFA 4XGZA 2A9NL 1BBDH 2VXSL 5EORH 5EOCJ 3V7MA 1JWSA 2NZ9C 4KKNA 3DV4B 3V9FA 1T7VA 4DZ8A 4QOKE 1H0DB 4JJ5A 2FX9L 3VXRB 1QOKA 1SBSH 5LWYH 2YEZB 3DX7B 5DEZA 2GJZA 4ODSL 3CZFA 3FO9B 4HUUB 1ZA3B 4J1UA 4HS3A 4NFDA 5DC9B 2W60A 2NW2A 1TVBA 1G7MA 4OIAA 1MJUL 4G8FA 2HRPL 5E5UB 1IZJA 2DKUA 5I9QC 5HGHB 2NZ9D 4JPWH 4QOKB 4D9QE 5J3HD 2HKHH 1DQML 3HE7A 4OFYA 3WIIL 3NCFB 5C0AB 4CU8A 2NY5H 4R90H 1ZVSA 3ARDC 5D1QB 5I75C 3RVTD 1R24B 3FJTA 1WEJL 4F9LC 4FQQB 5I66B 3HG1E 3GSNL 3QZWA 2BERA 2HG5B 4HSQA 3ULUL 1NPUA 4F37F 2VE6A 1SY6H 1F4XH 3DRQA 2AK1H 2QTEA 3LMJL 4G6FB 5I8KH 5JLZA 5DQJA 5KVMC 3N85L 4I5BA 4ZUWA 4NFCA 5JPNA 3UBXB 4N9OB 3GMPB 1JK8B 3C9NA 2N7AA 2YBRB 4LSUL 4H8WH 4OJFL 3ARDD 3BDXA 2CKBH 3C87A 4R96B 4WFFD 3SJVA 3HG1B 1QBAA 5TGBB 1SY6A 2WUBL 2BY0A 3KLDA 1KUMA 5DJXA 5K59F 5GISH 1AHWA 2Z93B 2DD8L 5J1SC 3QUZA 4UINH 5I1GH 3C6LC 1TQCC 1LVEA 2EDDA 2EDQA 2R8SH 3VFGH 1I75A 3GDBA 3IJHA 4ZPTB 2AJXL 2P24A 2CKBA 3IJYA 4FQXA 2XTLA 3SQOL 1X7QB 3K1KC 4CBPA 3RGVA 1MCWW 3OR6A 4KMTL 4KMLB 1I1FB 3IDMA 5FKAB 3GI8H 5FFLA 5HHNB 1CDJA 1KNOA 4PJXF 4A6YL 1KCRH 4M5ZL 4BA8A 3MCKB 3IXAB 5TF1L 1S7SA 3PF2A 5TDPB 5AYUH 4LCYB 5BZDB 1S5HA 2NYYD 3F7PC 1RUAL 2DKSA 5EC1A 3LV3A 1XGYL 4ZOEA 2BVEA 4P46B 2MKWA 3CLFH 4HWZB 3PWNB 1T89C 2V7NA 1BF2A 2O5XL 1I9EA 3OJVC 1T20A 2P5ED 3FQRA 1QLFB 5JO5B 1K8DA 5DT1L 5FO8B 3L1OL 3RKDC 4N9GA 1NFDF 2WNGA 1E4WH 4XWGL 3S35L 4TSBL 2R0LH 3TZVB 1I85A 3DX6A 3H3PL 4XXCC 3BO8A 3U2SA 5T3ZL 5C0EB 3WUWB 5ISZE 5IB3A 2EXYD 2H26A 1XR8B 4OKVA 5CILL 4BQCA 5BW7A 1J1PH 4CVZA 5C0CE 5HY9A 4KDVA 4ODSH 4OZFG 2ADGA 5LXGH 5DFWH 4L3EE 4Y8AA 1FLTX 3KLHD 3U6RA 4UDUB 3S36L 5MI0B 1QO3A 3BXNB 1CICA 5C08D 3ETBF 4Z78B 1NGQH 2YK1H 1W8OA 3HUJA 1I3GL 4HEPG 4I3SH 4QGYA 5IFHH 1ZANH 5IHBA 4L3CB 1DQMH 5EU6D 3WIIH 4PRHA 2YUVA 5TDNB 1MCBA 4H5SB 5C0CB 1BVLA 4JZJC 3LSOB 3CH8A 3BE1L 1S7WB 4L3EB 2BSRB 3PP3H 3U9PL 1UCBL 1CDBA 4Z7VF 5KTEH 2GK0A 2ICEB 4LPCA 3ZDYE 5E8NA 3HA0A 2F19H 3QDAA 4G9DB 1TNMA 3IT8D 4PJ5E 3QEQD 3RWCA 3RQ3A 1SVZA 1R3HB 4LSUH 1EBPA 3BIKA 5FO7A 5CSZB 3RIAK 5EIQA 3MCLL 2J8UA 4AEEA 1FVEA 1N8ZB 4PGBB 1YEDA 2AEQL 2WUBH 4RIRB 3W2DH 4LLAA 5FYJL 3GIZL 3T3MF 4Z76A 3DXAA 1SEBA 3IFNL 4IHOB 5A2KH 4Z77A 2EYSB 5JA8B 4PJ5B 1RZKC 5DMGC 3NTCL 2VYRE 4RGNC 3VXNA 1E6JH 3HR6A 1TZGH 2HVJB 2JB6B 3GK8L 3RY5A 4HJJL 5J56B 4ZO9A 3T0EA 1BIIA 4ZD3H 1SYSB 3DMMC 3O2DL 3P0YL 4M5ZH 3MNWA 4F80A 2Q8AH 5EUOA 2B2XH 1NQBA 5C6WH 4LPWA 1NCCL 4M6AA 1RUAH 4WO4D 4DGVH 1BJ1H 3AVEA 3B8YA 2X4PA 2BY1A 1S7QB 2VO5A 3V6FB 3ZE1F 4YUEH 4RGND 2PKDA 3DRTA 5ADOL 5KS9F 4UU9A 1EAPA 1UADC 2A9MH 2W9DH 3HRPA 1U92B 1U8PA 4TNWK 5C7XH 2XNAA 5GRXG 3ARBB 3DMMD 5CSBA 2VDNH 2ZPKH 5DD3H 1FC1A 4NGHL 3D3VA 4QRPE 4UBDD 5T3ZH 3OX8B 4GRWH 5HGAA 3D1MC 3QRGL 2W9EH 5DRWB 4HIEB 3QO1A 4LQ1A 3UTTE 1QR4A 3MBXH 2B5IC 5GS1A 3TYFA 1I9JH 3CVHB 2XZCL 3FT3A 2FLBT 3KPQA 1XF3A 1Z2KA 3EYVB 1HDMB 1OP3H 3V0VA 3HAEH 1S8DA 3VGBA 3BISA 4M02A 1CK0H 4YPGA 2VLKD 3H7BB 4QRPB 1RIHH 3CGTA 4I48A 3DO7B 4KI5C 3MODL 2A6JA 3D87B 1CFVH 3FL7A 2UWEA 3UTTB 2YSSA 2ZCHH 4I4WB 1VGKB 3MMEB 2E9IA 4RAUB 1D6EA 4OD3L 4AZ8A 1NGZB 1CCZA 1CZ8L 4RBPK 3HAEA 3QIBC 2OM5A 1TQBB 1NGYB 1LEGB 4WTWA 4HGKC 3CSPA 4NO5A 1CWVA 5FKPB 4P57A 3RWJA 2X9WA 1ZAGA 4MDJB 3MGOB 4RMUA 3SDCA 4GG8B 3OKNB 1CFNB 1Q72H 1A4JA 3X13A 4MNQE 3O6FC 3NFNA 3GO1H 1DBAL 2D0HA 4N90E 2CO6B 4ZFOL 4M48L 1UB6B 4PJIA 4MQTB 4ZDHB 5B38B 3KPPB 3QISA 1G9NH 3Q5YA 1MCWM 4PRAA 3E2HB 3QIBD 1R5WB 3BKYL 1BECA 2NTFA 3GUTB 1QD0A 3QJFA 3T09A 5FYJH 2D4FA 3TVMA 4DWHA 4LLYA 3VXPB 1NL0L 3FO0H 3RX7A 1KN4L 4MNQB 1QSZA 4CW1A 2J88H 1IM3A 4ODUB 1ZHLA 3MJ7A 3SDDB 4BH8B 1S7UA 4J2XA 1ERNA 1JNHB 1KLUB 3BGMA 4NO2A 4M7LL 2EDTA 1I1RA 5F7DA 3RTQA 4Z6AT 3JV6A 2VR5A 5D7IF 3NIFE 3V6OA 2R23A 3P0YH 4CN4A 1R3KB 1UA6H 1ZLUH 4DEPC 3FOLA 4X83A 5IIEB 4RSVA 3QQNA 4XH2B 1FRGL 1MPAL 1FIGL 4Y4FB 4ZFGL 2F53A 1P7QD 2R56L 1D5XA 3ISWA 1MFCL 2D9CA 3CFKB 4NQDD 3ZTJG 3T0VA 5ALBL 2VB5A 2ZUTA 5JW4Q 3REWA 2C7UA 1MHEA 4B41A 3GRWL 5ICZB 1HHJB 2BCKA 1IGYB 1ZTXL 3O3EB 4LSSL 4UB0L 1G7LB 4HUWB 3OJDA 4JM4L 1XF2B 1XCTA 2A83A 2YD1A 4FQLH 4ZNCD 1C5CL 4NCC1 6FABL 1FZJA 3QRGH 1GGTA 3IU4H 3RAJH 4KZDL 1DVFC 5LQBH 4MAYB 5IR1B 4K3JL 1ZLWK 2XZCH 5GIRB 2Q8BL 3NCYP 4LVNB 1CTOA 1QSEE 1Q38A 2R4SH 4Z0BL 4UNUA 4HUMB 3BP6B 3FB5B 4YK4C 1I3UA 4U1IB 4PJBF 1EFXB 2NTSP 3F62A 3JWNC 5T5FH 3VA2C 4QRTA 2F15A 4OF7A 5HHPB 3TT3L 4XB7A 3MV7E 3DIFB 4HKZA 4OD3H 1DVFD 3AXLB 4AJ0A 1GGBL 5ICYA 4OLXH 4HD9A 1QSEB 4DGYH 1J10A 3CCHA 3LEYL 5BXFA 4I18C 1T7ZA 3S37H 4GOSA 3IXTB 1JGVL 4FFVD 3MV7B 3S9DB 4Q9QL 4F3FA 2EDLA 4ELME 5I16A 3MLSH 2EDXA 3VWKB 1G7PB 3L5XH 3PIQB 4XNQB 3OB8A 3MROB 3WIFA 5JOFA 2C26A 3W9EA 4I2XA 1Y6KR 1DLHB 2DMKA 4R4BA 4JPKL 4H1LB 3BHBA 3VFVB 4DW2H 1P5VA 3HRZA 4OZFH 5J0BA 2OX5A 3FHQA 1F4YH 4R0LA 4M7LH 1TZIA 1UZ6E 3VFPA 5L9DL 4S0TD 4F7PB 4ELMB 3OKYA 4PJCE 2AABH 3TNNA 4FXGB 2BSTA 5C70A 3ES6A 3EDEA 1FG2B 4OV5B 4W6WB 3GSQA 1Q9LA 3CDYA 5EUOF 4MA1C 5HHMD 4U7KA 1G7QB 4OIBA 5EBLA 1IGTB 4OZFA 1GZPB 4K7FA 1YUHB 5D93B 2XRAH 5DXWA 3Q6FB 2YMXL 5TDOB 5JUEH 1MPAH 1KJVA 3QFJD 1A7PH 5IMMB 1U8LA 4PJCB 1RVFH 2J3SA 1T1ZA 1SJHB 3DSNA 5IJVA 3BQUA 4Y5XA 3WFZA 1ZTXH 1MHPH 2CLZA 3U48A 4UB0H 4QRQA 4XCEB 3OJMB 1I8LA 3ESVF 1QFWL 4JM4H 5AWNH 5HXMA 3BVNA 3ALWA 1QSFA 2HVKB 5B4MC 6FABH 5CJBA 4OFDA 1U3HC 1ZSDB 3X14B 3I50H 1UT9A 2GT9B 4EI5A 4Y4KB 3CFJB 4G9FD 3MV9E 3DVGB 1MIMH 3GB7A 2NY4B 3B5GA 3TN0C 4Y2DA 1DZBA 1FLRH 4L9LA 4BZ2L 1ZV5A 2BK8A 1K5NB 5JNYB 1HSBA 2X4TB 5CAYB 1DQLL 1UJ3B 4GRWF 4LASL 4RAVA 2VKXA 3QDJD 1U6AL 1U3HD 5T1DL 5C0FA 3MV9B 4HBCH 4XAKD 3GSOA 4O51B 1A0QH 2HLAA 3F7QA 2H8PB 4CN6A 3A0OA 3MLXL 4NRYA 3MRLA 4QRRB 3IDYC 4D9RE 5T1KA 2DBLL 4NBXB 5A3IC 1T66C 4YE4H 4ODWA 2CGRL 2CIKA 4FNLL 2GCYA 4N1CA 2E27H 5L2KD 1Y6MR 3CXHJ 1FL3A 1JGVH 4JO3L 2GIYA 1HHIA 4OI7A 3DETC 2V9QA 3PQYA 3QXUA 1HILA 4K3HA 2UZIH 3O8XB 3QFDA 2EH8H 3U82B 5E2TH 1BQHG 2HT3C 4GW5A 2Y5TB 4JM2D 5JW4R 1DE4B 3JZ7A 4LEXL 3T8XA 2E9WA 4M1GH 5A3ID 1T66D 3P0VL 1S5IH 2UYLA 4ZYKB 2NW3A 1DSFL 4G5ZH 2CLVA 3DUSB 2MCPL 4LIQH 4ZG1A 1X3DA 4E0RA 1U3JA 2ORBH 4LPTA 4WW1A 4KROD 3DETD 4PRIA 3A6CL 1KB9J 4FQHA 3VD7A 4PP1D 3TCXA 4KTDL 1U3YA 5DEGB 5DSCB 3AM8A 4Y4HA 1EGJL 2VZTA 5DMYA 2CPCA 3KPOB 4LF3A 1C16A 3WO4C 3ZHLA 2PXYC 3FRUB 2VITB 3KWWA 2YMXH 5SWSA 4OZIE 4WEBH 4NWUL 5DS8A 2A1WH 4BZYA 2P4AB 2F5BL 3V0AC 5T3XH 1Z5LA 2R2EB 3SKJH 2JE8A 4LCIL 4Y89A 1XGUB 1MHHB 5LKNA 4B7IA 2R9HC 2P44B 5BVPL 4B0MM 1HHGA 1WWWX 3C60C 4Z5RB 1VEMA 3OKOB 4IDJL 2V5TA 4WGWB 4WFFE 3S96B 3SPVA 3V5HB 1CF8L 4AENA 4K8RC 5FM5O 2F54A 2QLVB 4G6AC 2YD4A 4PRNB 1UM6H 2P8MB 1JGLL 1QFUL 3H0TB 2C3GA 4LASH 2R9HD 4MQ7A 4Y5VA 1IAMA 3QUYA 5CIPB 4L4VA 3ARDB 4GAJL 1DN0B 1FNFA 2XWTB 2X1XR 2R29L 5DQ9B 2EE6A 1GAFL 3O41A 4OLVL 5AZEL 4LRIC 5EN2B 5LAXB 1CGWA 3VGAB 3MLXH 3QEGL 4P5TC 1IAIL 1K4DA 5GXBB 2ZCLL 1IGIL 1SJEA 1NC4A 4LLUB 5J11C 1BJ8A 3BMWA 2R0ZL 5ETUA 4DQOH 5CBAA 4NZRL 3B6SA 4J4PA 3ZTJH 4GG6A 3NIDF 4UOW1 2BNUB 2Z31C 5KVFH 4PRDB 4R9HA 1YN6A 2P5EE 4XP6L 4E42B 5A43C 1XGPB 5K9JH 2F9BT 4RWYL 3HS0A 3UTQB 4JFDD 4Q58C 3I6LD 4I0PC 3SKOB 5HYQB 4X7CC 3OB0H 2QADD 1N5AB 1LO2H 4P5TD 1IQWL 3DBXB 4XRCA 1TQCB 2CDFA 2O5YL 3GZKA 5JHDA 1JZ8A 4PRBA 4S1QL 4XTRC 3QNYB 2P5EB 2RQ8A 1T4KB 5LJYH 2BOBA 5IHZB 3JTTA 1BZ7A 2DI7A 4RNRB 3TIEA 1UXWA 3MRIB 4D8PB 2EYRB 4WHCA 4GRMB 4X4ME 2W38A 1EGJH 4EN3A 4AH2B 3V5DB 4GKZB 5C08E 3FQNB 2G75A 2HJLB 4WI8A 3LQAH 2XG4A 4L29A 1YEGL 2A73B 1IAOA 2DQGH 1YYMH 4F15C 1ADQH 3QXWA 3LPFA 3ROOB 2ZUXA 4PJHF 2NY6C 4CMHC 1UXSA 5D1ZA 5FOJA 4XVUC 1WZ1L 5FB8A 1E4KA 4KU1A 1A1OA 1NBQA 4NC1E 1JV5B 3NOIA 1E28A 3GHBH 5C08B 5I1IL 2ZCKL 3QIUD 1BOYA 2VISB 5C1MB 1RK0A 1NSNL 3C2SA 5GRVK 1ADQA 1GHFH 5EU6B 3OF6A 3QEQE 1KF9B 5DJDB 1D5ZB 2OL3H 4JGJA 5E2VH 4IDJH 2QR0A 2HJFA 3VFRA 2XQYK 1OAUL 4M8QA 4UIKH 1U8OA 2NY6D 3SCMA 3GKWL 3VD3A 4KVNL 4LLVA 2P5WE 4XVUD 4DZBB 1PJ9A 1FFOA 3Q48A 5EBWB 1JGLH 1OHQA 1KIRB 2A6KB 2B1AL 1S7XB 3HMWH 4OLWL 4U3CA 5FYLH 3TBSB 1FNSH 3QEQB 2OL3A 3VMPA 4CGTA 1AKJB 4RWHA 1HHHB 4GAJH 4WWKA 4JZJB 3TFKC 1J1OL 5B39G 4OLVH 4J8RA 3MJ8A 1A5FL 3BRDA 3MV11 2P5WB 4KQ3L 4HJGA 1RUKL 2ZKHL 3RRQA 1CGUA 1OQOA 3ZDXF 2IPKA 1FZOB 3L5WB 4C4KO 2R0ZH 3SKUD 4YNYA 1YEFL 2DJUA 5E5MA 3L5JA 1WTGT 1LNUA 5E70A 4RGNE 3T0WA 4HWEH 2VZSA 1WBZB 4NZJA 5DO2D 4P4KC 4XP6H 2OCFD 1SMOA 1KG0A 2FH8A 2VUYA 3DX9B 1FNAA 1T5XA 1FDLH 2HFEB 1GZQA 2KKQA 5IW3A 4XXDB 4TVPH 4GW1B 4MQSB 1AXSA 5AZ2L 3S35X 4HG4K 3GMRA 2E8YA 3AREC 3I6GB 2ITDB 3HCVA 4WO4B 3L95B 1AXTL 1YDPB 4RGNB 1U8QA 2JIXA 1ZK9A 5HYJA 4P4KD 5JW5A 3LDBB 1MAKA 3IDGA 4F7MB 3DMMB 3HE6A 4U31A 4XNXL 2VLKE 1EV2E 1V3LA 2BFVL 5TE4H 3G5XA 3KDMA 2BXYA 2Z91B 3F58H 3FT2B 1WFTA 1IVLA 2Z35B 1RZJC 2VQUA 2QKIB 4LCWE 3E6FB 1K3IA 1MRFH 4GO6B 5F72S 3WFBH 1CD8A 4L8SA 3AS3A 1S9XB 4P2RD 4X8JA 5EPMB 4XNMB 3D2UB 2PYFB 2VLKB 1R3IH 1ES0A 1AO7A 1FZKA 3QO0B 4ODVH 1BQUA 3ZHDA 1CVRA 3I6KA 3O6LH 4KI5E 5I1JH 4QXTA 1U8JB 4GLRI 4PYGA 4LCWB 2VJXA 1T21B 2B5IB 1OAYH 5FV1L 3FT4A 2Z4QA 1MI5A 3FOMB 5F7NC 1PG7L 1W0WB 1EZVY 4G8IB 1AD9A 4KUZL 1N0LA 1NEZB 4OGAC 2CDEB 1XF4B 1QBLH 4NO3A 4HH9B 5J89A 5GGRB 3MLWH 3VH8B 3BIAX 2EICA 3CLEH 5LBSH 1CN4A 3OHXA 3BUYA 4HXAL 3LKRA 4X6DA 1BQHA 3QXDA 1EO8H 5IB4A 4O5LH 1EO7A 3FONB 5LGJA 2DYPD 4HWUA 3QIBB 3ARFC 4LPXA 2X41A 4Y19D 1F02I 4X7TA 3RZWA 5F9JB 5ILTH 4M43L 3JVGC 4TNVF 3LKOB 5TFSH 2ESVA 5CMAA 1Q0YL 1T1WB 4Z7QF 3IGAA 1Q1JH 3BKCL 1JPFA 1YEFH 4X0KB 3MV8E 1JUFB 4N1EA 4ZPVB 4CL7A 4KV5F 3VRJB 2JJSA 3HZKB 1C7SA 3MUZ1 2ICES 4XP5L 4BYHA 3IF1A 2C1PB 4LLQB 1OARL 3ARFD 5BQ7A 3QDMD 2DQFA 3HR5A 1FE8L 4BUGA 4PJ9C 2I9TB 1OSZA 4PYHA 1MCRA 1VGEL 3KYNA 5CEZH 3DTXB 3KPNA 3MV8B 5GS3A 4KK6D 3WFEH 2D31A 4BFEA 3IAQA 5GZNC 1P7QB 4HFWB 3F8UB 3TLRA 2UZXB 1KXTB 3JTSB 4NHUB 3RX8A 2ZG2A 3SE9H 3MQIA 1RQ5A 1YMMD 1K9TA 2GY5A 5C09A 3GJEA 5EU4B 3V52H 2QSCL 1JYNA 3SDAA 4HIXL 5IB1B 2A6DB 4DEPB 3GSUB 2IFFL 4X6CA 2UV3A 4UTBL 4IRJC 4QCIB 4XHJD 1BGXL 5I1DB 3VW3L 1EX0A 2B8OT 2ZOKB 3L6FA 5GZND 2PO6C 4S1RH 1BX2B 5IEKB 3WJLC 2BNQD 4KK9D 3QCTH 4OLYL 2RR3A 4GKSB 5D1XA 5EFIB 2VC2H 4IRZL 2J2ZA 4D3CL 3P9WB 2XQYG 5MEQB 4LLDB 2X44D 3GBNH 5DD5L 2YPVH 1CLZL 4YDKL 1HH9A 1NCNA 1ZEAL 1CGYA 3OTTA 3VWJD 3WBDA 1A3LL 1OTUD 5C0IA 1DVFB 3S37X 3O4LA 4JKWA 3EOTL 5E4EC 3RIAF 5KSAC 2AGJL 3LKQB 2VWEE 2X4NB 4KUZH 4PJ8C 3KPSA 5DFTA 5KN5A 3O3DB 1SEQH 4YK4B 4UILH 1Y6NR 5H35A 1QKZL 3BP5A 4Y5YB 2AJZB 1KSRA 4NQCA 3UTZA 3M07A 5F96H 1CE1L 2WINB 3IJSA 3TV3H 3LHPL 4R7NB 2LU4A 4K3EH 4JDTH 4XP9L 2FCBA 3OG4B 4BZ1L 2COQA 2XZQL 5E2JA 2DQJL 2DLGA 5BRZA 3PWVA 3MRJB 4Y0GA 1NC2D 1MRCL 1U8IA 2WQRA 5FYJU 3RZCD 4I18B 2FIKB 1T6WA 5GRJH 4P49A 1QEWB 4KC3B 2ZSWA 4FQCL 2FGWL 1ONQB 1L0YA 2Q86B 1RJCA 3QFJE 2DICA 4NDMA 5T1MA 3BDYL 2GITA 4MD4B 3ALXA 4L4TD 3N1MC 5C86A 1KTLB 3LB6D 4RX4A 4N8CL 2D2OA 4YIQA 4TNWF 3SE4A 3ROLB 5HDQL 1YEIL 4DUWA 4GRLC 3QFJB 1YY8B 2Q76B 1IBGL 4JPIA 2C5DC 4G9FE 4YGVA 3ZKMC 4UQ2B 3VI3F 5DK0A 3UPRA 1FFPA 3FN3A 5FO9A 1B6DA 2JB5L 2R2CA 1IEBB 3K8LA 4HIXH 1KT2B 5F97E 3LD8B 2APFA 1NLDH 5ESAB 2OSLA 4GRLD 1BGXH 4LCUA 4X6FA 4Z7OF 3VW3H 2JJTC 4G9FB 1NMAL 2VXVH 3I3DA 3OZ9H 3STLB 1BLNA 3EJYD 3EFDH 4ZOBA 4Z7UE 1YNLH 1V7ML 4LBEB 25C8L 2IADB 3MUGA 3THML 5I1LA 4LQFL 5B39A 1KEMH 1U3HB 3C08L 1EEYB 4HC1H 1A7OL 5F3HB 4JE4B 1WT5A 1MHCA 4PJEE 1KIUA 1FAIH 3TN0B 3EJZD 1VEPA 5F89B 4OF6A 4Z7UB 2AV7A 1PX4A 2AXFB 1JZ2A 1GGYA 2VLLB 4XCYB 3U9UA 4O2EB 5L2KB 3C6SB 5JIKA 1NJ9B 3VI4E 3LHPH 5EU3A 4X6DF 1JZ3A 5IQ9A 4PJEB 4XP9H 4BZ1H 5AUMA 1AGCA 2DQJH 2DWEB 2H32A 4F2MA 2IC2A 1MRCH 4MQXD 5ICXB 1TJHH 3AU1A 3BP4B 2H6PA 4MDIA 4ZO6A 4NQXA 5EOQL 3QNXA 3SE3A 3LAFA 1PZ5A 2CK0L 2GKIA 3BOVA 3WLWC 4FQCH 2FGWH 4Z7WE 4C54A 4MS8C 3L5IA 3OKEB 2WWMC 5DD1L 2UY6A 3TPUA 4X8XA 5HHVH 4I0KA 1QSVA 5DJCA 4XAWL 5FOBB 5C0BA 1L7TL 1N26A 3QULA 2YPLA 1MVUB 1N64H 1T1XA 1UQSB 3C5JA 5FDWA 4Z7WB 3D25B 3EHBC 4O9HH 3ORJA 3WHE0 4WV1C 4N8VB 5I1HL 2EDKA 5FF6B 4MS8D 1UVQA 1RIUH 3C2AH 3R8BB 2EKSA 3AC0A 2V17L 3GNML 3WS3B 1GGCH 2WWMD 1P7KA 4NZTH 5FA3B 1CGSL 2XN9A 2ZNWA 3JWDL 4XMKL 4CNIA 1MAJA 5CEXA 5JA9A 3HMXL 4HUVA 1OT1A 1FGNL 4U6VL 2E9JA 1LDSA 3WO4B 5SWZD 3PHSA 5L6YL 3GSVA 4TSAL 4X6CF 1HYRC 5EUKA 2XV6B 2W0FB 4WUKL 4BM7A 5HI3D 2X89A 4C55A 5D5MA 4JQXC 5DVLA 2J6EL 4OCYH 4HKXB 1N59B 3KJ6H 4NC2B 1Q9KA 1BPVA 5JR1H 1AC6A 4U6XB 4APQC 3OR7A 4MD5B 4ZQKA 1OGAA 1T5WB 3RVUC 3HZYA 4NKDA 3UJTH 3PV6B 4KHXH 4JKLA 4PGDB 1UKQA 5DUBA 3VXOA 25C8H 1CDHA 4JKKA 4M1DH 5IJKA 2PTVA 4QRUA 5F8QC 3V6ZB 3STBA 1IEAB 4GS7C 2VQ1A 2OXGA 3M17B 4ZUUB 5CCKL 3QI9C 4F57H 4EDWL 2H2SC 3SEPA 1VERA 2BNRA 2VOTA 4KGJA 4EBQL 2C1OB 3MLZH 4MB3A 4JFDE 4LLMA 1U36A 3VE0A 4P2QA 4U3XA 43CAA