4JY4B

Crystal structure of human fab pgt121, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
232
structure length
232
Chain Sequence
QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broadly neutralizing antibody PGT121 allosterically modulates CD4 binding via recognition of the HIV-1 gp120 V3 base and multiple surrounding glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PGT121 heavy chain
total genus 45
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4B01
1DL7L 2IGFH 1HXYA 3MCLL 4UZGA 5E0QA 3CVHL 3N1MC 4NZRL 4LSQL 1ES0B 1MPAH 4FTVA 1I9JL 4D9QD 3T4AB 1IC1A 2B1AH 3BESR 1T83C 3G6DL 4ZAKD 1RVFH 2NY5L 4KHTH 1DQQA 3ILQC 4ELMB 2D3VA 4LPWA 4NHCH 2ADIB 1XGQB 4NNYB 1IKFH 3MRBB 2X44D 3ULVE 3LAFA 1YN7B 5F7DB 4JDVB 3MNWB 2P43B 3GM0A 3SGJC 1G1CA 4LAQL 2XTJB 3PGCA 5DRWB 1FV1A 5D2NC 4E41B 3HG1A 4NFCA 4PJXE 5BV7C 1P69B 5AAMA 3KNBA 1OP5K 2VAAA 4YBHA 1QLRA 1FG2A 1S9WA 4LSDA 3RTQC 2DJSA 4PIRF 1JZ2A 4HUUB 3BXNA 3HI6L 4RGMB 5DS8A 3WFZA 3W2DL 3ZSSA 3GMRA 1CFTA 5I66B 1YMMD 4MAYD 2FYYA 3GSVB 3PIQA 3UTZB 1JHLL 1ULVA 4D2NA 1NBVL 1DQJB 4UBDC 2R15A 3MBEA 5ITBH 1T22A 3AS0A 1MLBB 3I6KA 1OTSC 3O11B 3ET9F 2KKQA 1GGYA 3LS5L 2PXYC 2YHGA 2YC1A 2ITCA 4XVTL 3IJYA 1S7TA 5HD8D 1VEMA 1FVDB 4PJ9D 3L5JA 1YEIL 4PJIB 3VXPA 3A67L 5BV7H 4NHUA 2XZQL 4RIRB 4U7SA 2B2XH 1MQKH 4D8PA 4ODXB 4F2MB 4CMMB 4HT1H 5HI3C 2NMSA 3PL6D 2IMNA 4U1KB 5D72H 3SCMB 15C8L 4Z0BL 2LAGB 5I1AA 4K3DL 3RZCA 2ICEB 4GS7C 3BGMB 4OTXL 5E6ID 5IG7B 5F1SA 3SY0A 4TUJA 4QXUL 1MHCA 4Z8FH 5I9QC 3BP4B 5GS2D 2VAAB 4PJGF 3SDCB 4DZBA 3BKYH 5FYKE 2EH7L 2Q8AL 3MRCA 3HC0B 4PJ9B 1JWSA 2AK4A 1MCPH 1JK8A 3UTTD 1RUPL 5CILH 2EDRA 2NLJB 1MJ7H 1XGUA 3FONB 4GFTB 1KCVL 4HQQL 4PJ9A 4PBVC 3CCHB 4Q6IC 5L2JA 3NTCH 3U7AA 1FVEB 4NNXB 3SCMD 4P99A 4TTDD 2X70B 5I8CB 1P7QD 1UVQA 1RK1B 3CX2A 4N0UB 4PREA 3L3OB 3GO1L 4M7LL 1KJ2L 1TCMA 4OCSH 2DYPA 4J23A 1H5BA 1FORH 3D85B 3QXWA 2X1WL 3MACH 2VDPH 2Y6SD 3VRIA 4OAWA 4ONFH 1CXIA 3RZWA 3TO4A 5D1QC 3DLQR 3BEWB 3B43A 4JHZA 4MAYA 1ZLWK 1EHXA 4KRPC 3I2CL 4WI4A 5JHDA 1JFQH 1K5NA 2Z92A 2ZCHL 1FO0H 1N4XL 1ZVHA 3DURB 5HDBF 1KT2B 3K2UH 4KKLD 5C0DA 1A4KB 3GGWA 1K2DA 4YDIH 5D7LE 3ARDC 1W72L 2C1OA 1CQYA 4MQXD 3LS4H 1GRWA 2CRYA 3HAEA 3WFHA 1MI5A 3PL6C 4TVPH 3RUGF 2NY4C 3I6GA 1SJHA 3PJSA 3IF1A 5DR5H 1U3JA 3N1FC 2QQNL 3HG1D 3O11A 4DVRL 1HKFA 1QSZA 3A6OA 5TDPB 3EGSB 4G7VL 3TPUB 2CH8A 5ID0A 3W5MA 3VXRE 4XCNA 4H8WL 1FNEB 2LTQC 3MCKA 3FQUA 4YUEL 3BP7B 4M00A 2A9MH 5KS9E 2VLJE 5D5ME 2UUDK 4L1DA 4DGYL 1ZTXH 1JYVA 5F89B 2BOBA 5SV3A 1KLUA 4WFFD 5BV7B 1MJUH 4ZUUB 4G8EB 1MH5B 3HCVB 3TWCH 1EGJA 5DJAB 3KNBB 1UJ3C 4XPAH 5IMMA 5EORH 4RWYL 1B4JH 5CZVL 1QBAA 1RJLB 1VGKA 1FO0A 3JV4A 3BI9X 4XCYA 5C0FA 3ROLA 1J1PL 3MOQA 3QUXA 4LKXA 2HA1A 2VUOA 3EAKA 5F21B 4MJID 3U0WH 5E94B 4QF1A 4GKSB 5E7FA 1ZA3A 3MGTB 1ZLUH 1BREA 2CLVA 1N64H 4TPRL 2BERA 2P7TA 3CVHB 1SY6H 1NANI 1IT9L 2G5RA 4ZXBC 5DSCA 4QCIA 4YFEA 4ZXBA 4IRZH 3ES6B 4OLEA 2GT9B 3V4PH 1JPFB 3ZDXF 1JIBA 5C86A 2AJZB 5HI5C 2OZ4H 1VFBA 5C0ND 2YPKB 4OZHB 3F7YA 4XPHL 1LEKA 3TGXA 1C7TA 4D3CH 5EBMB 5IKCA 1S8DA 4WI8A 1IC4L 1QFOA 3CVHA 3SE8H 4XVUD 1HHHB 2FWOB 4BFEA 3GDBA 3BVNB 2VE6A 3I85A 1MEXL 1Q9KA 4P49A 2R69H 4HZAA 4MVBC 2BXYA 3QEHB 5FB8A 4H8WC 3MUGA 4CVUA 3UBXG 3CLEH 3NGBC 4WTWA 1AKJD 5D1XA 1IAIH 1HI6A 4Y5XC 5ERWB 3DVNB 3GI8H 4IM8A 4JREC 4P5TB 5IROA 3WV0A 2NX5E 2LFGA 5GS0C 3QDJA 2EO9A 1D5MA 5MI0B 5KSUA 4W4OA 3T04D 4CN6A 2X42A 1T2QH 2A9NL 1WWCA 4P2QA 1LK2B 5LWYH 3VFRA 4F7EA 3R0MA 4ORGA 3MPCA 4JFDA 2EDXA 4PV9B 3RX5A 3TJHD 3MODL 3O45B 3V7AG 5GXBB 4PJCB 1S7SA 3L5WB 4QHKJ 4M62L 1UWEL 5DJ6B 1AO7A 1F2QA 4A6YA 3D39A 5DD0L 1RHHA 1L9MA 2AV7B 4QOKA 2OR7A 5F97E 1IAIM 4BH7A 1EAJA 3SGDH 2XACC 1NFDB 1EBPA 3QIWD 4M43H 4X6EA 5BZDA 5EUOF 2NY7H 4TQEH 3VCLB 5L2KD 2V2XB 5JOFA 3WFBL 5MHSE 1DLFH 2WANA 4ZG1A 5CP3H 4N9GA 4WEMB 4L4VD 3BPNB 2AEPL 2PW1A 4MB5A 2QL1A 4HWEL 3B5HA 2VLKA 3V6ZB 5DMKB 1AQDB 5DGQA 1RPQA 4P23D 2EIEA 1GOGA 3ARUA 5C08B 3C2SA 4R2GB 2VXVL 3ZE1E 4HV8B 3UO1L 5FAAA 4KDTC 4NGHH 2CR3A 2N1KA 5F7EL 5B38G 4CNIA 1UWEH 4X9IA 3GRWL 1UM6L 2LAAA 4G6FD 5GSRB 1XH3B 4UV7H 1W72H 3GBML 1MCBA 1VB9A 4Z5RB 2HH0L 3QO1A 5MEQB 3TH3T 2IQ9H 4OBSA 1HINH 4JKKA 3DX6A 2Y36H 4Y16D 4PGDA 5F93C 3SDAA 4XVSH 4JDVA 4A6YH 1MVUA 2DLIA 5FK9B 4LIQL 3HC4L 1N5YH 2D7TH 4L3EE 3T8XA 1REIA 3OSKA 1M7IA 4XNUL 4K2UH 3IETB 4CAGA 5I15L 4QOKD 5C0RL 5F44A 2F53A 5EOTB 4KQ3L 3U1SL 2D9CA 3S98A 2NY2D 1SBBA 5CSZB 5FECB 1NUNB 2P24A 4P9MH 1HWHB 4LF3B 2YD6A 3MFFA 4U6TA 5ALCL 2NY3C 4P2OD 1HHKB 4FTVB 3DMMD 3VXUA 1A6UL 3RHWK 2DQCL 4PR5B 4XB8A 2AJVH 1U58B 5EOCJ 3TO2A 5FO9A 5JIKA 2V2XA 3RY6A 4WUUE 2NY1D 5E95B 2YRZA 3VH8B 3QPQD 5ICXB 5E99H 1MLBA 4Y19B 3IDXH 2DTMH 3MV01 4GW5A 1NCDH 2AEWA 5BVPL 5D96C 1LMKA 4LCWB 3TV3H 1MHEB 5DEFA 3ZSTA 3QO0B 5JR1L 1NBVH 1NPUA 3B9KA 4Y5XB 4IRSC 2A0LD 2FJGB 5JO5A 1CICA 2C3VA 1RZ8A 3UBXB 1D6EA 4QXUH 4I2XB 3GSUB 4P46A 3S36X 3WD5L 3HNSL 5DZLA 3TVMD 4HF5L 3M8OL 4XCCL 4U31A 3MRMB 1YQVL 1SEQH 4QXGL 4XNXL 4LCCB 1DBJH 1D9KB 1MREH 3GUTB 1NAML 1TPXB 2I26N 3IAPA 5T1LB 2BNRE 1R0AH 1KACB 3FT2B 5INCB 4XNZC 1FBIH 2GJ6A 4V1DB 3IDNA 3GB7A 2MFNA 3CU1A 2ZSVB 5K9OB 3MJ8B 1WZKA 3ARPA 4UIKH 4HUXA 1RIUL 3HB3D 4DJMA 3RPIB 2X1QA 3G08B 3C6LB 1H3TA 4OQTH 1OOAA 1IAOB 1NFDA 2HKHL 5FA3A 1JGUH 4XC1H 2LTQB 3T4AA 1ZWIA 1I3VA 5HYJE 1CL7H 1ZEAL 3MV8E 32C2B 3IJSB 2O5XH 4WEBH 3I3BA 2BFVH 3OJ2C 2NXZB 1JNLH 4QO1A 2IWGA 2XA8L 1KLGB 5CD5C 2VDLL 4WO4C 1I1AD 3D5OF 5SWQA 1EEYA 4CW1B 1U8PB 5EBLB 3WSQH 1KV3A 1DBKH 2GHWB 3JXAA 1KENL 3MLSL 3JVGC 3QRGH 1J1OL 3CZJA 4PJ7F 2Y7QA 1JPTL 3BDYL 3O2DA 4C4KT 2AV1B 2LU7A 3BRFA 2JK5A 4GRLB 5GGUB 1FBIL 2VXUL 1XF2A 4O5LH 2B1AL 1FDLH 1SBSH 3C08H 1QRND 5DO2C 1FG9C 1FFPB 4K8RC 3RGHA 1DQTA 3KPSD 4QXTB 4NN6C 5CKGA 1MHPL 3SDDA 3O9WC 3K1DA 4S1QL 4YDLB 2X4QB 5IESH 1BX2A 5E2WL 1HSAA 1I7ZA 4U2ZA 3O2VH 3AY4C 5D7KD 5J13C 3MSPA 3VFPB 5IKCB 1YN6B 2NY6D 2P5EB 3E3QE 1F2XK 3IU4H 4J12A 1QYGH 3OPZH 5BRZA 3BOVA 1HOCA 4UOW1 1UM4H 2NR6D 2Y23A 5B21A 1T0MB 2AEQH 1QBLL 5GSVB 1SYVB 4KVNL 4LHUB 5T5NG 4Q9RL 3KPTA 4UB0L 2EKSB 1J1XL 1RULH 4XCYB 1BIIB 2O61B 3NABL 1YYMH 5BMFL 4LLVB 4I0CC 4Y5VC 4P23B 1J86A 3EUUA 4MX7B 5ECJE 3GMRB 4LLMB 3V7AE 1FRGH 1NCUA 4S10A 1C5DA 4H0HB 4PY8J 1IE5A 1F8TH 1QPXA 4D0BB 4WFED 5CWSA 4UBDD 5DYOB 5C3LD 1WICA 4KTEH 4KZEH 3EJYC 1WZLA 3RUGE 5EU6E 3S88H 4N8VG 3S4SG 5DJ2A 3W11D 4ZYKB 2BVYA 1MIEH 2RHEA 2H32H 1Q38A 2XN9E 4UQ2B 3ULSA 3WMSA 5DD3H 2XNAB 1KJVA 4HGWA 3O8XD 4RMVA 2QV2A 3Q6GL 3ROOA 4RAHA 4GJTB 5CSBA 2HN7B 5JOPE 4TSAL 5D7SH 2FJHA 2DDQH 2RB8A 1QZ1A 1T0MA 4LSVH 4XNZB 5DMJB 4Z7OE 3PXJA 2WLZA 3GK8H 4XT1C 5C0JB 4R0LB 5CJ8A 2W0FA 1VEPA 4AL8L 1CGVA 5MEOB 4U1KA 4UTAH 3L6FB 2C7UB 1K5NB 4KAQH 5J6HA 4F9LC 1FNFA 4LSUH 2FGWL 1U93A 4YHLL 1F6LL 1U36A 1YNLH 2EYSB 4QYOB 1U8OB 2XTLA 3QPXH 1A14L 2Y5TA 5SX5K 2X4QA 4NJ9L 4ZSOB 4PB9L 2NNAA 1TTGA 5BZWA 1B6UA 4U49A 4H5SA 4PJDF 2MOVA 5FYKD 2RFXA 3QXAA 1VFAB 2NY7L 1LHZA 3HRPA 4JPVH 5IP4A 1NLBL 1E6OH 1EVUA 4M93B 4OGXL 4BSVB 3L3GB 2NYYD 1CWVA 4OGAD 1QSFB 5IM7A 4YX2H 4DKFL 4YLQT 4K7PH 1GYAA 3K80A 4TUOA 1CFTB 1KOAA 4WW1A 2ICWA 1UEMA 4Y4KB 3NCEB 4OLWL 2OR9H 4U3CA 2I9LA 5ANME 1MCJA 2PTTA 4GLRI 4ISVB 4TUJB 4EDXB 2D4DA 3WEXA 4OZGA 1X6NA 4F8TA 3H3KA 3MCKB 2GUOB 4OLZH 3QEQB 2J88L 3EYQC 5BQ7A 3MRQA 5LQBH 4PRNB 4PJIA 3L9RA 2MKLC 3IDYB 5F7YC 4WUUA 4DAGL 1KPVA 2EH8L 2WBWB 1XGTA 5D96B 5HHNB 4DKEH 2VDOH 4XPGH 4QRRE 2ZCLH 4CJ0A 3L3HA 1H3XA 1VHPA 4OJFH 1WFUA 4V2BA 2YUVA 3ETBF 1RSFA 4DN4L 2YN5A 4K9EH 5IMOB 3QB7C 4NQXB 1X4YA 1F6AB 3Q1SH 2A77H 2MNUA 4HIXL 4OZHE 5CLTA 5I66A 2H2PC 3TA3C 4NQEE 4PJ9C 2VR9A 1R3IL 1E4WL 1JL8A 1MJJB 4EXPX 3MJ9H 5IT2H 1YYLL 1RZFH 1U8KA 4QHMB 2AJSL 4OV5B 3MFGB 5C09A 3X14A 3MREA 1D9KC 5D70L 1NMBH 5CHNB 2EDLA 4G9FE 1GPOH 3OJVC 3GBNH 1K4CA 1QLFA 4EI5C 3MNVA 4H20L 3ZKQD 5HYFA 4CU8A 1GZPA 1ZHLB 4U6YA 5B39B 3FFDB 2W60A 3QP3A 4O2EB 4X6FB 3I9GL 3EO0B 4PJEB 1MWAH 2H1PH 4WV1C 4MAUH 1LE5A 1IEHA 3BD3A 4HUWA 5EC2B 4J3UA 3C2AL 3ZO0A 3EYVB 3QXDA 2APTA 1CBVH 4JB9L 3FCTB 3JWNC 4R26L 3ARDB 3D18B 4E0RA 2V2TA 4HJ0C 1NAMA 2VXSL 5FCSH 4IBLT 2NY4B 3BH8A 4N1CA 4XXCC 1V3MA 5EUKA 2YS4A 1AR1D 4R0LC 3LN9A 3P4NA 2VL4A 2BY1A 2CIKB 4BELD 1A0QL 5IR1A 5D70H 5EOQL 1OM3H 2BXZA 3CDFA 4NKMA 1NBQA 1B90A 3PGDB 3LN5B 3UTPE 3P9MB 4V1DA 2H2PD 2ZUQB 3RNKA 1IGFH 1CDHA 1X4ZA 5EU7C 5FM5O 4YGVA 2XFXA 1BOGB 2HP4A 4IJ3C 4L4VB 4JGJA 2PCPA 3JWDL 5CKAA 3GMOB 5I30L 3KLHC 3GMLB 5CEYB 1KJ3L 3FZUD 4LPVA 2NY4D 1I9EA 4PV8B 3VFWA 4XMLH 4L8DA 5ALBH 4K07A 2Y07L 1I7RA 3C8KA 5JO5B 4D3CL 3MRJB 5EN2B 5EC1B 4PJFF 4OF7A 4TUKH 3SOBH 3JWOH 4Y4KC 3MLZH 1E28B 1EA9C 2JCCF 3MZTA 4TTDC 3ARGD 5KJRL 4JPIA 1S3KH 12E8L 4MNHB 2QEJA 4OGXH 3VDCA 1ZHNB 5FKPA 4RFOH 1T1ZB 3LDBC 3C6LA 3DUSB 3C08L 3VCLA 5I1GL 4H25B 3RWCB 1RULL 1D5ZB 3SKJH 2DQIL 5DJYA 2RAMA 2ZSVA 5H94B 3AUVA 4P23C 5EIIA 4XX1E 4IMLB 3THML 2FEDC 2VR5A 4OM0H 2PYEE 4ORZC 4S0SD 3MV9D 5FV1L 4NZTL 3QDME 3IU3B 3MLUH 3VG9B 3SN6N 1IM3B 35C8H 1C16B 1W8NA 2ICWI 2DQJH 5B3JE 3CFJB 4EXKA 2QADD 5DQDH 1G1YA 2R4SL 5ANMA 4XZUA 3DGGA 4JZJA 2X89D 5HDLA 3MRPA 2IPUG 2BCKA 4DFIA 3IS1X 2Z0BA 1UKSA 1CDCA 4PJIF 4UUJB 4JB9H 1O5DT 4PRDA 3KPRB 5T33L 2BOCA 4PB0L 2DOCA 4DN3H 5I75B 2VLKE 4UTAL 1KB9K 3MRRA 1MRDL 4RMQA 1CD8A 3HS0A 2F58H 2CDEB 5MENA 1YQ2A 4MCZA 2BNRB 2DJ4A 3MRKA 3MNVB 5CEXA 1NEZA 5FHBH 5E00B 5EULV 3IVKB 2DDQL 5I8KL 1JWMB 2A74B 2ZJSL 1OARH 5I1DA 1S7RA 2B0SH 4XP6L 2ZG3A 2P49B 3MLXH 1AXSB 3TO2B 1A1NA 4XP5H 2GFBB 3QEQD 1N6QH 2OI9C 2AJSH 2E6JA 5I8OL 3HC3L 1AJ7H 1XGYH 3PWLB 4LRIA 2IALB 5HJ3A 3U4BL 5KVGL 4MQXC 4TULL 2CK0L 1QFWL 3OXSA 1I7TA 2P8MA 2DMKA 3W9DA 5L7XL 3VDAA 3RIAF 4GMTL 3SJVA 5GISL 5GGTH 3H8NA 1P4BH 1Q9LA 2DQEH 4UU9A 1FZKB 4Z7UA 1EK3A 1E0OB 5FIEA 4LSPH 4WTZG 5D7KE 3KJ4B 4HAFA 5TE6L 2NTFA 2FX9L 5ILTL 4L4JA 1WCBB 4NQCD 4LGSB 3DROB 4Y2DA 1SJVA 2CDGB 4DCQB 1RY7B 4KC3B 4L5FH 3D9AL 3IKKA 4OZGB 2FD6H 5J1AB 1FNSL 4YFLI 5HYSA 4X6CB 5HHPA 3AFLA 4H1LB 4JQXA 2GTZA 2ZKHL 1Q1JL 1TIUA 1KXVC 4OJFL 2WQRA 5HYSB 5F9JA 4PV8A 3QEQE 3FQUB 3HMXA 5IJVA 2JIXD 2DWEA 3I75B 3P73A 2GITA 4JFQA 2X9WA 1TTFA 2Y06L 4NZUH 5SWZD 5E5UB 1FZOB 4G9FA 3ARGA 1VFAA 2P42B 4Y4FA 4PP2A 3JBG7 3VFSA 1NCWH 4QHLA 3IF1B 3FRPG 2NY3B 4QRPD 3OGCA 4WWID 3ZTJH 3FN3A 3SJVE 4WI6A 3QIUC 4JO1H 5E8DL 4HK3J 2E6QA 2NZ9C 5KSVA 3BD5A 4I3RL 4O58H 2QSTA 4PUBL 2MHAB 3GMQB 1F4AA 5MHSD 2F19L 1RUKH 4RGNE 1A7OL 4ELKA 2GIYA 1INEH 1IAMA 4CVXB 3GMQA 5IWLA 2ZKHH 4YE4L 4OZIF 1IAKA 4JHAL 3BHBA 1KC5H 5L6YL 1LDPH 3KHOA 1JF1B 1NFIA 2VLJA 4OLXL 5C0BE 1EJ6A 2NY3D 4QRPB 1MRCH 1LO5A 3NAAH 4PJIE 4Z95H 3OB0H 3NIFE 3TH2T 3SDXE 1UG9A 5CMAA 4P46C 3ULSB 4F7MB 2NLJA 4HHAB 2VTFA 2DM2A 4MB4A 5DTFB 2E9WA 4M3JA 1CG9A 1URLA 3QNXB 4NCDA 3F5WA 3BUYB 4Z9KB 4EI6B 1MF2L 3TJHC 4MNGB 4PJ5B 4AM0A 4DGIL 3L3JA 2EE6A 4K3EL 3EYSL 2ICCA 4BKLA 5I1JL 2HJKB 3FQWA 4DUWA 1MHCB 4HGMA 4B41A 4ENED 3IFLL 2C5DC 5DJCB 4WW2B 4GRWE 4DVBA 1DUYA 2YK1H 7FABL 3EIFA 5DA0B 3VA2C 3P11H 1LEKB 3F7YB 1A6WH 4LLDA 3MV8A 1FNEA 5ACLA 4RCAA 5KSBE 5DXWA 3C6LC 3QIWC 3D6GA 1HSBA 3QDMA 1NFDE 5I76B 3LD8C 3X3FL 5I71B 2DQFA 5C0GB 4UTBL 2NY2C 1FFOB 5HHXH 1JI2A 1MI5B 3D3VA 4MZ3A 4PTUA 3OZ9H 2VIRB 2AXFB 1YYLH 3GSOA 4PJCF 1AR1C 3TZVC 3RGVC 3V5DB 1SEBA 4PP2B 3MV7E 1T04A 4W70A 1D7FA 5ACMA 2DQTH 1T22B 12E8H 2DQFB 4YFLF 4NC1E 2DMCA 5INDA 4RGMC 1GGIH 3P0YH 3VRIB 2Q76A 2QADB 4L9LA 2VKWA 4HS3B 1BFVH 2J7LA 2Z9TA 2XZCL 4JFEA 4O00A 1NJ9B 2BNUA 3FO1A 5IFHL 3ARDA 1IFHL 1VFMA 1PLGL 3L3OA 2FL5A 3CX5K 1RUAH 3QCUL 4XPHH 5EUOB 4ZUUA 1XR9B 3CUPB 1GXEA 4LBEB 1XF5B 5F89A 2AABL 3TBTA 1DVFD 2BVEA 3VFMB 5MERB 4O2FA 3KPRD 5IJKA 3MRFB 1A4JB 4OFPA 2EE3A 2R2CA 3PF2A 2PXYB 5DI8A 5B8CC 1ODAA 5CSGA 1HQRB 4P2RE 4NT6B 2IPTL 5BVJA 3NVQA 5H2BB 1KJMA 3RNQB 1RUAL 3QCUH 3WO3B 4N0RA 1IBGL 1OAYL 2VLLB 3WFEH 5IQ7L 5CMAB 1HNGA 4HC1L 4KKAC 3I6GB 3RDTD 2N7BA 2HWZH 5SX4I 1IAII 1HYSC 5EZIH 4QRRB 3GGWB 2R29H 1ACYH 1PJ9A 1B2WL 3O6FC 1C1EH 4HKZA 1NCTA 1XZ0B 3EYFA 3BEWA 2ZG2A 1NAMB 1OD9A 4D8PB 5T5FL 3ZKXC 4F2MA 3KYMA 1FDLL 1XAUA 3DGCR 1YY8A 1LILA 5IHZA 3FFCD 1BLNB 5IOPA 4Y5VB 5K9KA 5GS1A 4BSWB 2GQHA 5IV2B 1CGSH 3TIEA 3EOTH 4HKXA 3VJ6A 1G7LB 1X5GA 3RZCC 2AS5M 3OBAA 4G5ZH 1ZA3B 1CD9B 4YQXH 4Y2DC 5JXED 5BRZE 3RIFK 1JUFB 2P5WE 4FZEH 3V0WL 4CVZA 4PJEA 1WZ1L 1TZIB 1Z5LA 5JUEL 1Q0XL 1RJLA 1VGKB 4Y1AA 1MFCL 1V7NL 3BZFA 4X6DE 5D1ZB 5E56A 3KPOA 4L8SB 3QEQA 4MB3A 2DI8A 5E7BA 1BZ9B 2H6PB 1NGXB 3QQ9D 4XP6H 4UTBH 2EXWD 2CRIA 1DANT 5IBUB 1XMWA 1I8KA 2UYLB 3HAEH 5J6GB 5C09B 1ZA6A 5IF0B 4XP5L 3MRLA 5MEPB 4I3SL 3T08A 4KK5D 1U3HB 4XZUB 5FHAL 5IG7A 1LQSR 3GSNA 3IGAA 3A0OA 2XZAH 2KZ1B 2LV4A 3JV6B 3BZFB 3OKLB 4MDIB 3T0ED 4B7LA 4WJ5B 4E5XA 1UFUA 3KDMA 2FSEA 3HB3C 2H2SC 2HLFD 3ZE1F 5J7CC 1Q9WB 4W4OC 2BJMH 1ZMYA 2ZSWA 4PJ8B 4IMLA 1OTUD 1KIPA 1S7UB 3OQ3B 5TE4L 1DBBH 5CJOL 3MYJB 2CPCA 5I71C 4BH8A 4EN3C 3REVA 3N85H 3S36H 4LDLB 4RBPH 3BQUA 4NFBA 3O9WA 5E6IC 4KKLC 2WUBH 2FSEB 3RZCD 4OI7A 1I1AC 3GO1H 4WJ5A 4MD0B 1Y6NR 5D9SB 1A3LL 5FGCB 4P4RB 4DW2H 5DJ6A 2Z91A 4U1SA 5JORB 2F53B 5EOTA 4F8QA 1OAYH 1OCWL 2WBJD 1U91B 4YNYB 1OLZA 4MWFA 1SY6L 3MROA 4ZUVA 2ESVA 4KI5F 5J6GA 4RQQA 4R90L 4KMLB 2VDML 4PG9B 5E8OB 5ICZA 4JO4L 4G6FB 5E00A 1T7WA 4IOFD 3CNKA 4LLQA 3GMOA 1G7IA 4NRXB 2P4AB 4LCIL 4JHWL 3KYOA 5ESAB 1FGVH 3O9WD 4XVJL 2AJ3A 3W0WB 4N0YL 2Y7QB 2A6IB 3CGTA 1NEUA 4Z76B 1YA5A 1PY4A 5F7HA 4QNPF 4N90E 2VWEC 2LE9A 7CGTA 5LAXA 2Q7YB 4OCWL 5IQ9B 2E7LA 3QAZB 1WGOA 2B2XL 2ZZUT 3TN0D 1CE1L 1DZBA 5CEZL 4DKFH 1SBSL 3STLA 1H0DA 3RI5F 2EC9U 4MD0A 1SHMA 4XAKD 3WSQL 4AH2A 3OKDA 4N68A 3VFOB 4CN1A 3VXPB 2ZCKL 1X5HA 3WLBA 5B3NA 3ZKXB 4ETQB 1KXQE 3A6CH 4XMKH 3KLHD 5K9OA 5DRZB 4WWKA 1MCNA 1CLCA 1WAAA 1UCBL 4QTIL 4ZOEA 4XVTH 3QRFM 1IM9B 1FAKT 2YSSB 3AM8C 3NPSB 1CBVL 3AM8A 1VADA 3KDMB 3X17A 4XWOC 4NUGH 4I1NB 1V7ML 2H3NB 4NSKB 3GKWL 4PJCA 1Z9MA 4R8WL 4WV1A 3V4UH 1OSZA 3MLTA 1CXFA 4FXGB 4MD4A 1EFXD 4GW4B 4ODWB 4WW2A 2P1YA 4WW2C 4WCYL 5D1ZC 2CGRL 3HKFA 3IFLH 1RZ8B 3UBXA 4PJHA 2HMID 1G0YR 3PV6A 1LK3H 4UDUA 4KZDH 3NN8A 5FYJE 3R1GL 3N0PB 1ZVYA 2GJ6D 5F9WB 1QNZH 1FFNB 1ZS8B 4GXUN 3FL7A 2DKMA 4U1LA 1KTDA 3MJ7A 3ZKSD 4PG9A 1QRNE 1U8QB 3F7QA 4ZOCA 5EO0B 2X40A 2FNBA 3OKOB 4HG4J 2VDKL 4UB0H 4BQCA 1H3GA 2CO6B 5FYLD 4AEHH 3D25B 4EIGB 1U91A 4JCLA 2DN7A 1HHJA 2BZDA 4FQXB 4M48H 4DN3L 1JE6A 2J6EH 3SEPA 3C8DA 2DIJA 2Y5EA 3IDUA 5ESQA 3HE7C 2ZG1A 4K3JL 4CN4A 1TVHB 2HFGL 3D0LB 2F54E 3BYYA 3OJMB 3QHFH 1RZJH 2MHAA 1N2RA 2C3WA 4NQDA 4KI1A 4POZD 3DXAA 4YK4B 1JGEA 1T0PB 1IBGH 5EFIA 2R9HD 3MV8B 3O3EB 4U7KA 4GG6B 1Q72L 1HSAB 3G5XB 4X7SH 5FGCE 2HRPH 4X7CC 1KCUL 2EDQA 4JJ5A 2A6KA 4ZS7H 1ND0B 3TCXA 2DM7A 3GNML 4OCRH 5GQBA 4P9HL 4AJ0A 4G7YH 5SWZA 4PRBB 4I13B 1YJDC 4QXWA 3O81A 4I9WD 3FT2A 1UH4A 3ZDZF 1T20A 1T03H 1ZHKB 1NL0H 2HFEB 1IC7H 4EI5D 3QI9B 4X80H 5A2KH 1MSPA 4YO0B 3THMH 4G9DB 3BJLA 4PJDB 4H1LA 4PJDE 4HULB 5DF0A 3DRTB 3KPLB 5F9OL 5SWSE 1MAKA 2VH5H 2FZ3A 2UWEE 1T3FA 4G6ML 4G8GE 1HH6A 4LHQB 4XP4L 2C4FU 4KFZC 3BPLC 1WSST 3QAZC 3HUJB 2EYTB 4EVNB 4JFOB 4LNRB 4Z18A 4F7CA 2W0LA 4JKMA 4D0CB 2VL5B 4AT6A 5DJZB 1GGIL 2YXFA 5H37G 2VERN 5DQ9A 1JHKL 4L8CB 1ONQA 1I8IA 3QQ3A 5IFHH 3SJVD 2ESVE 5D8JL 2H32B 2ZJSH 4Z77B 5TFSH 1KJVB 5I18L 2VO5A 2KL6A 1UH3A 2ZUSA 2X6MA 1D3CA 4RGNB 5D6DC 3NPSC 3DYPA 1RUML 3DV4B 4KAQL 2ZUWA 3QDAA 2LABA 4ERSL 3C5ZC 4JHBA 3KPQA 2J8UA 1FLRL 3IS0X 4K8RH 1SY6A 3BRGC 1QEWB 3OAUH 3IAGC 2V5RA 5L88H 3VXOA 4EEEA 1DLFL 4QXTA 5KVEH 4M61B 1CXHA 3D3VD 1G84A 5JW3L 5MEND 1G0DA 1C5BL 3QNXA 1MHHA 2VLMD 3TIDB 3MRCB 4OCLC 4JGUA 4GXUM 5D71L 3LKPB 5GGUA 2BSSB 5IT2L 4OD2B 5IB4A 3SDCA 2EKSA 4OF8A 5DEZA 3QXAB 5D5MA 4JFDD 1W2KT 5BXFA 4HXBL 2EH7H 2FWOA 4LLUB 5D7LB 4M3KB 5CAYB 2EE2A 3SY0B 1ZLSH 2R8SH 3T0AA 5B4MC 4PJAA 3EDDA 1TDQA 2R23B 4L29A 4JFEB 5IMKB 1JPSL 4RBPK 5IOPB 4XVJH 1RZKH 3KLSA 4F7PB 3EYUL 4RRPG 3REWA 4F9PC 2VJXA 3VGEA 4WIQA 3GI8L 5HSFA 1RQ5A 3P0VL 4PRPB 4Y1AE 4NFDA 5IVZB 2NX5D 1J11A 4WU7A 5I17A 1Y0LB 4MA7H 5KSVB 3UJJL 4TOYL 1G6RH 2DQGL 5D7LA 2CRZA 3E2HC 4GAGL 1INDL 4N5EC 2YKLL 3RDTA 1YEFH 4PJBF 4IRSD 4NN6B 2D03H 2X1OA 4WO4D 1S9YB 3M1BB 4K55A 1FGVL 1T4KB 3VXTA 1JZ4A 3O6LH 3S4SB 5C0IA 5CBEB 5IIEA 5E5MB 3UEZA 3F58H 1CDGA 1OAXH 3AVEA 5GGRB 4K3HA 4G8EA 2G9HA 4ZNEA 3N50A 5FUOL 4M6AA 1C8PA 1A4JA 3G5VB 3V95A 3LB6C 2ARWA 3HZMA 4CW1A 1PX4A 4LPYA 1Z2KA 1OAKH 2JKXA 4MJIA 2W1NA 3EDJA 4XCNB 5KS9A 4J3TA 4R90H 5GIRA 1H9VA 1XEDA 3F5WB 3QIUB 4R6UA 4HZLA 3V6OC 2HJFA 3GBMH 3WFCH 1MFEL 1RJZB 2ARJQ 1FHGA 2X4UB 3QSKB 1BJ1H 3LH2L 2A9ML 2YKLH 4JRXA 3BP5B 4OSUH 1FN4A 1FNGB 1F4HA 4MD5A 1I7UB 2DQUH 3C9NB 4NQVB 4DW2L 2IH3B 4IMKA 2VZTA 2OP4H 1BJ8A 2VDLH 4HXAL 1K2DB 1INQA 1NBYB 4LHUA 5JA8B 4MD5B 5J3HD 2JCCB 4PR5A 4MA1B 3LEVH 5IB2B 5C0GA 1CU4L 1ZVSA 4L4TA 3BGAA 1OPGH 5DMIH 4XPTL 4XAWL 5L9DL 2AJZA 5EZOH 4WDIA 1JHTA 3L5HA 5IMLB 5EU4B 4LKCA 4BFIB 3FO2A 1QLEL 4PLKC 2IAMC 1KTKE 3T0VA 2IAMA 3MV7A 2XQBL 1QPPA 1J8HB 1EHAA 4YBLB 1JNHA 4HF5H 4XCCH 5D2LE 5I8CA 5HYSG 4DKAA 4RNRB 3L5IA 4OFYD 2A83B 3LEVL 2IH1B 3P77A 3QDJB 3QIBC 2CUMA 43C9A 3L3JB 4KTDL 1JZ7A 1NAMH 1GHFL 2M8XA 4WI5A 4LLAA 4YBQD 1KJ2H 2MMXA 2XTJD 2AXGB 6CGTA 1R3HA 4GSDL 4JHAH 5GRJL 5DQDL 3CXHJ 2IADB 1OLLA 4YC2C 1CGSL 5E4EB 2AK4E 4YHOH 4JE4B 4X4ME 3FN0L 4HK0B 1Z3GH 3KYKH 4OIBA 1T7VA 1XIWB 5C9JA 5C0AB 3V0WH 4KY1L 5L0QB 5BOZG 5BS0B 4ZFOB 4Z95L 1DR9A 5A43C 5EU5A 4WENB 1ZOXA 4KTYA 1AY1L 3TZVB 5DJXB 5F6IB 5HHQA 2AK4D 4F15C 1S7XA 3ZHLA 1XGRA 5HBBA 3RIFF 5EH1A 1JTTA 1A64A 2FO4B 3UMTA 5IW1B 3BKYL 1ZGLB 5DJ8B 2ZUUA 1HKLH 1BQLH 1NKOA 3QA3A 4H25A 1L7TH 2DAVA 1WTLA 4X6EB 4OZIA 4M8VA 5DZNA 4HMEA 3KS0H 2R9HC 1II4E 2JJTC 4Z7QE 4PRNA 4CKVX 5MP6H 3P9WB 3R0NA 5E4IA 3FO9A 3MLZL 1KCSL 4HPOL 3JV6A 1SJEB 3CK0L 5DURB 4OIIH 3KYNA 4Y4HD 3PDGA 5GSRA 2WBJB 3S35H 3LPFA 4DTGH 2HT3C 3ARBA 3VMPA 1QTYT 2MQ0A 1LP9E 3SDAD 2KH2B 3NH7L 2P48B 4DUVA 1HK6A 3AREA 3RWIB 4NRXA 4P2RB 3MRHB 2H26B 2XFXB 1OWWA 5L7XH 1TZIA 4J1UA 3RY5A 2C1PA 4OZGF 3CSYB 4XNQB 4O02H 4X6DA 4YXKL 3RWGB 5HPMB 1N59A 3QHFL 3WE6A 2NW3A 4KWUA 5F7EH 3KPRA 2XQYK 5D7JA 3E3QC 3WNOA 3RPKA 2OK0L 1P7QB 3RNKB 3UPCA 2IFGA 5EUOE 1M1SA 1Q9KB 1T80A 1X5IA 4HJJL 1ZANL 2NY5C 3PP4L 5HGDB 4NKMB 3VDBA 3K4AA 5AG8A 1C08B 3ZDZE 2OS7A 2XN9A 1CDUA 2GJ6E 3SO5A 3TBWB 5D71H 4OI8A 3P4OA 1NLBH 3MV9B 4X6DF 3C60A 3BW9B 3B3IA 4QLRA 1C08A 2OL3L 5HJ3B 1AJ7L 1XGYL 3BZ4A 2GUOA 3MFFB 5C7XH 5EU6A 2KUTA 3RUGA 1B9ZA 3ZHKA 4TULH 5L88L 1QFWI 4P46D 6FABH 3NFSL 5DRXB 5ETUA 2GSIA 4NUJB 2YC1B 3RWCA 1KBGH 1JYXA 5GGSY 3VFNA 3TA3D 3AAZA 2AXJA 2HG5B 3UTQB 4X4XB 4QTHA 3NBNA 4IRJC 2FJFB 3I2CH 2W0KA 5CBAA 4QT5B 4M6MH 1MPAL 1T20B 2W07A 4J4PD 5GJSH 2GTWB 1IQWL 1A9BA 4UT6L 1F00I 1VENA 4LSTH 1EAPB 5FB8B 1RFDH 4N0UE 3PQYA 2W9LA 3NZHH 4OFYA 1QLEH 4BA8A 4QTIH 4UQ3B 2BSED 1T0NB 4LP4A 1MFDH 2AVGA 1V7NH 4DKEL 4I2XE 2E9BA 5ISZD 1K6QL 4EJ1C 1LE9B 3EOAA 5D72L 4EN3B 4NBXB 3CAFA 1PGRB 1XIWC 2F54B 3DETC 4NQCE 5J0BA 1PQZA 5D1XD 1FIGL 2PETA 5E6IB 1NFKA 4Z7NF 3CK0H 4HUVA 4FOMA 4OUUA 4MZ2A 5F8QC 1IVLA 3QCTL 5ICYA 3H9HB 1WAAE 5JOPD 4TUKL 4QOKE 3SOBL 2HT4D 2RIKA 2JLLA 3QG6B 4YHYB 4ZUSA 5IB3A 5EIVA 5HHOE 3I3EA 4RGOL 2EYRA 1OTUC 2E7LC 1NCBL 1YDPA 5HYQA 4FQJL 3QCTH 1YEKL 3UDWC 2NY1C 5C07B 1J7VR 2Y36L 3FB5A 4UDUB 1HH6B 4OCYH 1F90L 4ONHA 3SKJL 4R3SB 3C09B 5A2JH 1EAPA 3ELAT 3HE6A 2OXHA 4PJBE 5DD6A 3EKCA 4PJXA 2NCMA 3CZFA 3L7EB 4U1JA 3A67H 3NMEA 4YHKH 4MQSB 3PWVB 3VRJB 1CTNA 3VXTB 1FVCA 1KYOJ 3E8UH 2XWBA 5F71A 1XIWD 5B38B 4X98B 3KPMA 5IW3A 4KTDH 1X7QB 2D7PA 4Y89A 3GSRA 2A6DA 2FCBA 3ZMRA 5L2KE 4LKCB 4DK3A 3KWWB 5EU3A 4L3CA 4DGYH 3VXSE 4ZAKC 3WFDL 5ITFA 3UYRH 4KZDL 3WYRA 3O3EA 5FO7B 3U48A 2Z93A 3ZKNC 4XGZA 4MAYB 2P47B 5HD8C 1WFTA 3VI3E 2F9BT 1CVRA 3K4ZA 4PS4L 1TETH 2K7QA 3X3GL 3U46B 1KPUA 4NKDB 5M7QA 5FDWB 1MCKA 3OGCB 3BP5A 4GBXA 4KK6D 5A2IH 1U6AL 3VRLE 4HEPG 4HDIA 1U41A 2UWEF 3SDXF 5L2JB 3HZKB 3TNNB 5T1KD 1FFOA 1N0LA 5HTSA 3RNQA 5AD0B 5T1DH 5IB4B 5DD0H 2FEEL 2Q8BH 3H3PH 3C2AH 3CZFB 3KR3H 1FAIL 4QXGH 1NGZA 3D69A 3OKKA 3QUMH 1E27A 4IRJB 2MQ3A 3HZMB 2QHLA 4IOFC 4XWOD 5DJCA 1JF5A 3ARWA 4ZPTA 3CFEA 5D2LF 3VXOB 4X6CA 5HHPB 3NABH 2G60L 5D6DA 3RWHB 4PJCE 2ZCLL 5C07A 4GXVL 2IEPA 1KCSH 4LLMA 4W68A 1H8NA 1OTSD 3QR2A 3OKKB 2P44B 4PGEA 5E2VL 3RBSA 3PGCB 4LLVA 4YWGL 1KTRL 4OLXH 1MI5E 3RDTB 3UROR 3OG6B 4Q9RH 1L7TL 4X99B 1F8TL 1FVDA 4KGLA 1S5IH 4YK4C 2PR4L 4A2MA 1VKXA 2NY6C 5T3ZL 3BEVB 5GSVA 3KPSA 3MR9A 1S7WA 3WXVL 1BHGA 2DM4A 3LZFH 4JY5H 3C60C 3TV3L 3LEYH 3T65B 5I2IB 5EA0H 3REWB 1RZGA 4AT6B 4F7PA 1DBML 1Q8MA 2FYYB 1L7IL 1PBYA 4A6YL 2XWTA 4L3CB 4JM4H 1H5BB 4LOUC 5C0JA 3ME0A 4BK5A 2AJXH 2FDBP 4M1DH 1MCRA 3SGKC 2Q20A 1WT5A 1UVQB 1MFNA 3QZWA 2FLBT 2XKSA 3T0WA 3NIDF 5BW7A 4P57A 4P5KB 1YY9D 2IBZX 3ROOB 1NDGB 1EHLL 1N59B 2P5WD 4PRAA 4KPHL 3HG1B 5T3XE 5ACZA 4I48A 5DRWA 3WS6A 1D6VL 4HHAA 4ZYKA 5DC9B 1OP3K 3DRQA 4NQCA 1TJHH 3RY4A 3T3MF 4LSSL 4I0PB 3MBXL 4WI3A 3BPLB 1GAFL 1XGPA 1QFUL 4PS4H 2VC2L 3G6JA 4X7SL 3OHXB 4EUPB 3FOMA 2GCYA 1FL5A 1ZT1B 3D9AH 3HPLB 4LBEA 2WUBL 2EDDA 1DFBH 1DN0B 2D9QB 3UO1H 3ZTJG 5FYJL 2PYEB 1NDMB 1U8LA 2OR8A 3KYAA 2Y5TB 4WDIB 2CUIA 4KKBD 2Z91B 4I18A 4FQLH 4NO5B 4XRCA 2CIIA 4HKZB 4Q97A 3LCYA 4ALAL 1ZWIB 4M6NH 2X9XA 2VSCA 4RIRA 4Q9QH 2APWA 1JRHH 1YUHB 5BO1L 3TEUA 2D7OA 4HAGA 1RFDL 1U95B 1NBYA 5DLML 4OZFG 4MMZC 4R0LA 2FX8L 1P84J 2KQMA 3QYCA 4PG2C 5BZDB 4G3YL 4M5YH 3IJYB 3WXWL 4O4YL 4KMQA 4OB5H 1T2QL 3MYJA 3IDMA 5CGYC 4M62H 4KI5D 1BVKA 1P7QA 4C83A 3QFJA 3VD7A 1KYOK 5H2BA 1HOCB 3BPOB 5TE7L 1JZ6A 1NUDA 4MNQD 5I1CL 1MNUL 2OLDA 5E08H 1W8OA 1QQDB 1SMAA 1FC1A 1AE6L 3GSVA 1N5AA 3UTZA 3SBWC 3T1FA 3PWUA 4PV9A 1OARL 3A6CL 5C0CE 3VWJD 2V2WB 1PW3A 3IFOB 2BVOB 4N1EA 1WBXA 3QCVL 1FYTB 1XF5A 1QKZH 3OF6D 2R39A 4U4BA 5EUOA 3ARBB 3IXTA 2AJUH 4D0BA 2B7DT 3CX5J 1CLOL 1S78D 3CSBA 1Q9OA 3MGOA 3WIIL 3X11A 3ZE0E 3B5TA 2DTML 1YEKH 2Q86B 1FGNL 4S1SH 1CF8L 4WHDA 1JMZA 4OTXH 1WFNA 3CVIL 4FQIL 3VW3L 1J1XH 1MCLA 2YPVL 5HVHB 4XP1H 1LP9A 2HJLA 3R8BB 4KKCD 5C70A 3MRPB 5EO9B 4IIQC 1U95A 3PHSA 5D1XC 3H42H 5BS0E 1I7TB 2P8MB 1HZHL 4GUPA 3QHZL 1D5BB 3EYOB 1JHTB 1RUPH 1U8JB 4NRYA 1A1OA 2C26A 2GT9A 1Z6JT 3EYOA 4EBQL 2E8ZA 2CLZB 4YGAB 3UZEA 1P2CB 3M07A 4HMCA 4HXBH 3SE9L 2W59A 4DOHE 4K7PL 2JB6B 5GJSL 5KW9H 4KK9C 5D1QA 3K74B 4LLYA 4K2UL 4G8GD 4I5BB 5IBTH 3T09A 1CDIA 1FO0B 5ALCH 2J8HA 1WITA 4U2YA 3CDCA 4PGDB 1Q72H 3FFDA 5C0EA 1IGCH 1G7QA 4OZGE 1NDGA 3MGOB 5JDJA 5I74B 1CR9H 4PPTA 1E28A 4ZTOL 1HKLL 3GSUA 3QDHA 1RJYA 5F96L 2IH1A 2JELL 4TVPL 1JGUL 4Z7UF 1P7KB 3LPWA 1TZGL 3HR5B 4JN1H 2DQEL 1VDGA 5TH2B 3JV5A 2XZZA 5DR5L 5JORA 3T1FB 5CGTA 3GSWB 4HFWB 2VLRA 1EJOH 2X4TB 1FPTH 3ES6A 1BOGA 4JFPA 4Z7WF 4P9HC 1HCVA 1JP5A 1M05B 5KVDH 4TNVK 5EO9A 3TYFA 2YMXH 3NCYP 3UTSD 4L3EB 3ARVA 3LRSB 4B5EA 1BMGA 5KN5B 3WIHA 3ZKND 5T1DL 1A6WL 1W72B 3R06B 1F45A 1S7UA 5DJZA 1JNJA 4G8IA 5T5NF 4MNHA 3HUJF 3O0RH 1JPGA 4LEXH 5I1EH 1BAFL 4FN0A 1MIMH 1EEZA 4P2YA 3WHE0 1NEZG 4EOWL 2Y4SA 4JY6B 1JGLL 4A6YB 2DWEB 3SDAC 1Q9OB 2DL2A 5EU5B 3ARXA 5A16A 3U0PA 2Z8SA 3EFFB 4HX1B 4KRMB 3RVWD 1T1YB 1S7QA 4UINL 1FL3B 1I7RB 2R0WL 4KHTL 2YEZA 4QHUA 1CICD 5CUSH 2R1YB 1F4YL 1QHOA 4MQ7A 4Y19D 2EXWC 4U1NB 2HLAA 4HC1A 3RDTC 3Q3GA 3VFTB 2OTPA 2DIAA 1QBLH 3PP3K 1ZHLA 4J6RL 4ACPA 3QUKB 1PG7L 4RQQB 3QNYA 15C8H 4LIQE 4Z0BH 4G6AC 2BNQB 1FZKA 3UTSE 4LLYB 3QQNA 3ARGC 1PZ5A 4X7TA 1HHHA 4LHUG 4PJ7E 2I5YL 2VE6B 3Q1SL 3CFKB 3UPAA 1DP0A 1FLTX 4OLUH 3W9DB 3FQRA 4QGTA 4X9BA 3F12A 3DMMC 3TYGL 1JGEB 1BD2B 4JQVA 4NBZB 4NC0B 4F3FA 1O0VA 5LGHH 4NO3A 4P2OA 2VXUH 3H3BC 2VXTH 4ZO9A 1M71A 2PYFA 3LSOA 5J3HC 3X12B 4XAKE 4N5ED 4PJAB 5KSBA 1ETZA 2HWZL 3H0TB 1HHJB 3TCLB 3H9SE 1WIOA 5C9KA 4YJZL 4U1IB 4GKNB 5ITBL 4OD3H 4M6OL 1I8LA 2HN7A 5I1GH 3GHBL 2ZSWB 4PJ8A 3I6KB 3NACL 1B4JL 5CZVH 2WSKA 5CD5D 5E2WH 5TE4H 4YXLL 2A1WH 2YD4A 2X4OA 4ZQKA 2VYRE 3PHQB 4XVUC 1UB6B 3UTTE 3MLYH 3MRRB 4KK5C 2VLME 4U6YB 5B39A 1R5VA 2VDKH 5DJ0A 1LO0H 3Q3GB 4ZTPH 1KB9J 4K23L 5IJVB 1UXWA 4JG0H 4AENB 4HCRH 4UILL 2XTJC 1T3FB 4GKZA 5JIIA 1P4BL 4JO2H 1YNLL 2YPLB 3G04A 5ADPH 3U36A 5I1AB 4K8RD 2ITDA 1LD9A 3RBGA 4LVNC 5IVXF 2QR0A 1UM6H 2DQTL 4RSVA 3O0RL 5A16B 4P23A 4Z78B 2IJ0C 4J3WA 4KDTA 4JM2D 4WGWB 3VFUB 3DO7A 5INDB 2J5LC 3LY6A 2EZ0C 1JGVL 4K71B 1KJ2A 2B1HH 4GBXB 3HZKA 3TNNA 4C83B 2H32A 3GJEA 2C1OB 3ZHDA 3OXRA 3MGAA 4ELMA 2QSQA 4PYGA 2VZSA 3SJVB 4XXDA 3M45A 3MX0A 3ULVL 4QKXB 4QRTA 3SPVA 3D85D 3LHPH 3IDGB 1SMOA 4NO3B 4P2OB 5HYJD 2VWEE 4XGZB 4XPBH 1GGBL 3FRUB 4JAMB 4JG0L 2P5ED 4Q0XL 3Q6GH 5L8KB 1EO7A 3D0LA 4E9LA 3IAQA 3VFPA 2EYTA 1VSCA 5E8PA 4I18B 2A6JB 1BECA 1BBDH 2DYPB 5FUOH 4JM2B 5CJQH 4NNPH 3G5ZB 4EUPG 3ULUC 3QFJE 4M7ZC 1NC2B 2QLVB 4U6HA 2FZ3B 4I3SH 4RRPA 5D2NA 4DVBB 3WS6C 3O6MH 3FAWA 1S7RB 2E27L 1TXKA 5B38A 1BVLA 2WINA 4Z7WA 4LVOC 4NYLB 1BIHA 2X4RB 1ZT4B 2F19H 1CFVL 4GKOA 3LOWA 3AS1A 5E99L 1YEFL 5I9QB 1UWGL 5I1KH 5DQJA 4H88H 4ZFGH 5JHDD 4G6JH 1FFNA 1X3DA 5BVPH 4UI2A 3DSFH 3QHTC 1JWSB 2ZPKL 3JV0A 2Z8WC 4POYA 4U1GC 1NMCC 4IOIB 2Y6SC 1LDPL 1WUNT 3T0XA 5DZOA 2DYPD 1IGJB 1KELH 4W81A 1Q0YL 2ZUYA 4P2QE 5GS0H 3LKNB 4U1HB 4S1DC 3WDIA 1ZK9A 2IC2A 5I73B 3G5XA 1U8OA 3SCMA 1OT2A 4GAGH 5FM5M 4OZFB 4Y16C 1A5FH 1JZ5A 4PG2A 1P84K 2IBZY 4HFUL 4FQ2L 5DUBA 4Y5YC 2YPKA 1PYWA 3IDGA 4ZUSB 3V5DA 4XMLL 3GJFB 1YNKL 1ZXQA 5KANG 2BVQA 3UJIL 1BIIA 2O61A 1AXIB 3RPIA 3FQNB 2GJZA 4W6WB 5T1KA 3HE7D 4NKOB 1LNUB 2IPKA 3SQOH 5EO0A 1ONQB 4JO4H 3FQNA 5D7IE 5KVMC 2QQKH 1HSBB 2YD8A 2VL5A 3STBA 3QUYD 4NOBA 1KN4H 2R56L 5HI4D 3MRQB 3SQBA 5TQ2H 4LLDB 3FQXA 4X6BB 3B83A 1RZKC 1BJ1J 2ATKA 4JKWA 2OL3B 4ZFZA 1X5AA 3ZL4L 1FC2D 1JGVH 3OR6B 3B8SA 5DJAA 4I4WA 1K8IB 3S34H 7FABH 2K1MA 1G7HB 1WEJH 4NPYA 2V7HA 5D7IB 5GS2H 3VD4A 2AKRB 2Y25A 3QRGL 3IT8D 5FO8B 2VR4A 4KHXH 3ZT6A 5EOCH 3MOAL 3WNLA 1BJMA 4TUOB 1OT1A 3FQXB 4X6BA 2AJYH 2OMNA 5HHOB 3QJFA 3UPRB 5TJWK 1JK8B 5JDSB 4OD1L 1M7DB 4TSCL 4FMKA 5EWIL 3P3YA 1IGIH 4HIIB 4MAYC 1BVLB 2WINB 4K7PX 3GI9H 1H3PL 3L3IB 3W39B 4MWFB 1BWMA 5D2NB 4HCRL 4UILH 4HH9B 1BD2D 1BLNA 1MCCA 2DTSA 4H8WH 5BRZB 1VPOH 3I9GH 1PYWB 2KZWA 5FOBA 3CFCH 5ADPL 4BQBA 4P48A 4HJGB 3VXRA 3QI9D 3RFZC 5F1IB 1TCRB 4YFDB 1A9EA 3QDGD 4RFEB 3BIBX 3MXWL 4HW6A 2W38A 4FFZH 2ZCHH 2MWCA 1ED3A 4KTEL 4KZEL 4GT7A 3HNSH 3LKOA 1CDBA 4I18C 2E6PA 3LMJH 5IQ9A 3K8KA 3DYMA 5SWSA 1UZ6E 1S5IL 3TYGH 5F9OH 1I9JH 5IBLC 2F5AH 2IADA 4X6DB 4NQCB 1AP2B 4MJ6B 3RVWC 1MQ8A 2P45B 2IG2H 1QSEA 1SJXA 3EOTL 1A3QA 3HMWL 3K2MC 5C0CD 1QYGL 4JVWA 5HHVL 5C71A 5DK2A 4JRYD 3RI5K 5DYOA 3ALXA 4GAYA 3VGAB 4U1GB 2AEQL 1NAKH 4JZNA 4BZ2H 4YDKH 5EU4A 4BFIA 1BZ9A 2H6PA 3QUML 2E7BA 2PW1B 2RCSH 3V52L 1EXUA 1FJ1B 3DXAE 4Q7DA 1HQ4B 4XPAL 3SE8L 1NGPL 3OWEA 5DUPH 4PJGA 4X83A 2R0ZL 1W72A 2I07A 2WK2A 4D9RE 3RAJL 1IZKA 3C9NA 3D3VB 1H5BC 4BH7B 4X0KA 5HYJB 3EFDH 2B4CC 3VGBA 5HPMA 1S7XB 3CSYA 3FQTA 5EDXA 4U0RC 3VXNB 3BAEL 5ABDE 1FJ1A 2M26A 3GSWA 5CJ5A 3RY6C 2VZOA 2B5IC 5C6TH 1VFOA 3LKQA 3O2DL 4F3FB 2AW2A 1BGXH 3ARFB 1MELA 4OD1H 4FQHB 5CSZA 5FECA 2XT1B 3U36B 4JFDB 5JXEC 4Z7VB 4MA8L 2FGWH 2WLYA 3CFDB 5C7XL 1J0IA 1S7VB 1T21A 3B8YA 3G6AB 3VGGA 5IF0A 1JV5A 3TN0B 1KULA 4JFDE 2UYLA 3MRLB 3GFUA 4NJ9H 4OQTL 5DRNA 1NCCL 5DK2B 4KRPB 3FT3B 3UTSA 4AL8H 1F42A 4JQVC 1NEZB 4XCFL 5DD1H 2FX7H 5F7FA 5FYKU 2AEPH 2CO7B 1ZLSL 2R8SL 4HIEA 2VQ1A 3CH1B 4CMHC 4LCWD 5F70A 2O5XL 4WEBL 1J88A 1N0XH 1PZUB 2V17L 1HI6B 1HH9B 5D4QA 2NXYD 2I25N 4Y8DC 5CBAB 4LSPL 3MRNB 4L4VA 4F7TB 2Y9RT 4JG1L 3U4EA 5JW5A 4GG8B 1I9IH 4PY8I 4X7DC 1RIHL 2OJEB 4KVCH 5KG9A 4P2OC 5T33H 2JB6A 5LG1A 1ERNA 5F72S 5JZ7C 3O8XA 1JZ8A 3ARRA 3AROA 2UZIH 3BE1H 3VXSB 1HILB 5IR1B 2ATPA 1VFBB 5CILL 3EJZD 2YD1A 4N9GB 5EUKB 4XP9L 3M8OH 1AO7D 1D6VH 3D2UA 3S3JA 1EZVY 1MI5D 4N8CL 1I1YA 1FYHB 5C0AA 3MLXL 4M7LH 2BMKA 5C0BB 3R06A 4B0MM 4ZFFA 4TYUA 4H1LH 5HVGB 4MJ5A 3QUZB 1T1ZA 1OB1A 3BO8A 2GAZA 2VDPL 4NQVA 2GJ6B 4JRXE 3MOBL 1GC1C 5I6XC 2KDGA 1P6AB 1MJ7L 1A6UH 4NT6A 43CAA 1EO5A 3AREB 2GK2A 4WUKL 3FHAA 1KELL 3MRJA 5EN2A 3H7BB 1A7OH 4UNTA 4TRPL 1JPSH 3IDXL 1J8HE 5SWSD 4AIZA 4Z8FL 2KBGA 3MV7B 1TJGL 2C3VB 4IIQA 3FMGL 4IRJA 4Y19E 4BFBD 1KLGA 1TQCC 3B9KB 4Y5XA 5I0DA 5HHOD 2PO6B 5TDNA 1G7MA 1AC6A 3UZQA 1KGCE 2X05A 3IJSA 4DN4H 3O41B 1BQUA 3B9VA 4ONGH 1QBML 2XZQH 4GLRH 3DUUB 5IB5B 3ULVC 1C5CH 4PBWD 1ZLVK 3F7VB 4M03A 3UZVB 4GW5B 4ZXBD 3NGBB 4P3CL 1W0WB 4DFHA 2G75B 2RJMA 3STZB 3HZYA 4LAJH 1WBZA 4GO6B 4GXVH 4HLZH 4LQ1A 4V1DE 3GB7B 3S7GA 1U8NA 3WIIH 1OQXA 3C5SA 5TQ0H 4RWYH 4PGBA 2AJUL 4PRIB 3S3PA 4OUUB 2FIKB 2EDJA 1CE6B 2G5BB 3F6IA 2BY2A 4P5MA 4F80A 4GG6E 3N9GL 4PJ5D 5CGYD 4KI5C 5I1HH 2VDNL 1WWAX 1NUFA 3FFCB 5LCVL 4OZFA 4JG1H 1CGTA 1DDHA 4O51B 3TBVB 1JTPA 4KJWD 4HWZB 3ARFC 3LKRA 1W0VA 3HRZA 4HS8H 4FQ1H 1VPOL 3WN5A 1ZSDB 2AJYL 3WN5C 2J8UF 3L5XL 2APXA 3NA9H 4HIJB 2DQHH 4PJ5A 5DJ0B 2BJML 2O5ZL 4LCWA 2C4FT 4EDWH 1A0QH 4R4BB 3F8UB 2OP4L 5DWUL 3T2OA 4LFHD 4GRLA 3FT4B 4MXWL 3MRIB 3FB6A 1S78C 4I77H 4ZUWB 1A14H 4JPKL 4KKBC 3L3DA 4JZJB 2YPLE 1SQ2N 4U1IA 4XHJC 2BMKB 4MA8H 1LGVA 1NLDL 1UYWH 3N9GH 3S35L 1X4XA 3NCMA 2O5YH 4R2GC 5C08A 1HHKA 3MLVL 2Q3ZA 3T0EB 1R3IH 1HXMA 2R2BA 3FHQA 4YDLC 1TVHA 3MMEB 1SEQL 4IS6B 2AJXL 1HILA 2OCFD 5J13B 2NY0D 3TFKC 4PJ8D 1OSPL 3HNTL 4ZNCD 5HVWA 2ENYA 1A22B 1GVIA 1NAKL 1WIUA 4XXDB 5FA4A 3NZ8A 5LWYL 1UT9A 3F7PC 2VIRA 3DX8A 4HCRA 3QQ3B 1P4LB 3BIKB 4LVHC 4S2SB 4KPHH 4ZAKA 1PDKA 2QKIB 2CKBH 2WZPD 1PY9A 5KSAD 3LZFL 4D9LL 4PD4K 4QRUB 3NTCL 4F37K 5FKAA 3PIQB 2H45A 3D39E 2ZOLB 4OLUL 4ODSH 5TDNB 2Q7NA 4ONGL 4MQ7B 1UWXK 1NFDF 5K93A 3RAJH 3WJJC 4KVNH 5HDBE 5F9JB 3W11C 2X2YA 4KY1H 1S3KL 2QTEA 4NWUL 4I2XA 5CINL 3TT1L 1D6EB 4G9DA 4EUPA 2QSCH 2AI0L 4LPCA 1U2CA 3NIDE 4PJDA 2R69L 5KSBF 1ORSA 1WK0A 2DQDH 2YRLA 3OAZK 1I8LC 4HS6A 1LEIA 2ORBL 4FG6C 4QTHB 3DROA 1JPGB 4J3OC 4NQED 2PO6C 1JJUA 1E6JH 1BQLL 5HYJA 4HLZG 4MJIE 4Y19A 1ZSDA 3MLWH 4NNYA 5BZWB 1T1XB 3DBXA 4JJ5B 1CIUA 1EPFA 1CFNA 4RISH 4JFXA 3WLBB 1UZ6F 1VEOA 3NZ8B 1N8ZB 4P2CG 5EZLB 2B5IB 3TNMA 3VE0B 4WU7B 5I17B 4J3XA 1KPRA 1HINL 4S1RH 4MA3A 3D1MC 4R7NB 4WCYH 2HAZA 2EDEA 1NCNA 4NO5A 5FOBB 3N1PC 4LIQH 4KROB 1YPZA 1Z9OA 3ZE2F 3DYOA 1SYSB 1YNTA 3GSRB 1BBJA 3BKJL 1UXSA 1C7SA 3P0GB 1GL4B 3UX9B 2FX7L 2X70A 1WF5A 3WNPA 5GRVL 2WV3A 1K9TA 3HNVL 5FYKL 1CN4A 4M1GH 5D5MB 5AZ2H 4HGWB 5H37H 3ULVF 4AEIL 1F5WA 1NLDH 1UYWL 5DUMH 1JRHI 3U4EB 5JW5B 2J4WL 4MDJA 3MBEB 3BD4A 4JFFB 3M17B 3L7EA 4U1JB 1OTTC 1X5KA 2ZUXA 4APQB 3V5HB 5IHUL 4OM1L 4M61A 1A8JH 1KNOB 3ISWA 3SQOL 1JVKA 1TVDA 4YNYA 4XTRC 5EPMB 2FEEI 2GEEA 1FG2B 2NXYC 2JIXB 1S7VA 1FFRA 5I8EB 4KKAD 3NACH 1TCRA 4RX4A 1LO0L 3FO2B 5TQ2L 3DPBA 3VXUE 4EI5A 1G9MC 4PGJA 1S9VA 1NANH 1CR9L 4FFYH 5ID0B 2CJUH 1IGYB 3QULA 5E2TL 1JF6A 5TDPA 2NTFB 4F57H 4ZXBB 1IKNC 3ECBB 2OSLA 3CDGB 3CH8A 3WIFB 2L4OA 3QUYC 3SKUD 3QFDA 3DJ9A 2CLRA 3W39A 3WFHB 1BP3B 4JRYE 4WUUB 3FMGH 1FZJB 1OW0C 4QRRD 1BF2A 3CFIC 1RAMA 2VISB 4L8CA 2F58L 1EUTA 1A6AA 1M05A 4XNXH 3QULB 3K8MA 1IZJA 1VACA 3E6FB 1J5OL 2F8VA 4JKLA 5FCUL 5IMMB 5GRXG 1BQSA 2L0DA 4XRCB 1OP5H 2VZVA 5ITFB 3VXSA 1E6JL 3CMOH 4UMGA 2EEBA 2PR4H 2PYEA 2VN7A 1AHWC 4H0IA 3I3DA 1DSFL 3DX9A 3C6SB 4OLVH 4FQIH 1S9WB 4O58L 4XH2A 2J88H 4JO3L 1FFQA 1CLZL 2AJ3B 3W0WA 4I3GA 4UT9H 2NY6B 3MRNA 4F7TA 1QBMH 3ZE0F 1AQKL 4PTTA 3HHRB 2P8LA 4ZUTA 1X5ZA 2JK5B 1RURH 1G7IB 2AK4B 5AD0A 4KMTH 2A83A 3ARTA 3K8LA 4RNRA 4P57B 4I5BA 2R0WH 4IOSD 4OKVB 1OGAB 1TFHA 2BVPA 4UOJA 4Z7UE 4X5XB 1BAFH 4U1SB 3CXDL 4KI5E 1MCOL 1YY8B 1G9NL 5DT1H 3KYMB 5TF0A 2F8OA 5J6HB 2GY5A 3VXUD 2LVCA 3HFMH 1QSFE 5DWUH 1CFVH 3LQMA 2OTWB 4NO2A 2CIIB 3D18A 1MRFH 4CDGC 4LU5H 4MNQA 2V2TB 4NKIL 3BQUB 4HWBH 3BSZL 3IFPB 1FZJA 1JWUA 2BVPB 1MHPH 4OM1H 5EOCL 1G0XA 3IETA 4ZOAA 4WI7A 3RKDC 5GGTA 5TF1L 1MLCB 5IGXL 5GZND 3GI9L 2DLHA 4FQLL 2OYPA 1D9KA 4RGND 3GIZL 3QIUA 4OF5A 1HNFA 1Y6MR 2BVUA 2F54A 4PJAF 2WNGA 5HHXL 3X11B 3PL6B 4PJXB 3GSNB 5DMIL 2C3HA 4Z7VE 1U3HA 1DVFB 2NW2B 2Z8VC 1A7PL 3WEXB 4GQ9H 5FXCH 4OV5A 3VXMA 5DRNB 1U8KB 1I8KB 2QQKL 1Y18A 3MREB 1JV5B 2GJJA 3PV6B 4WY7H 3TN0A 3ZYJA 4ZMAT 3T0EC 4K94C 3VI4E 2A1WL 3V5HA 5D7JD 1MFBH 3EZJB 4S0TD 3AY4A 1MRFL 1SJEA 5CGMA 2VXTL 1XCQA 5FGRA 3V8CA 3KPOB 4L8SA 5AZ2L 2F74B 4S1DD 3BIAX 5KW9L 2FEDD 2FIRT 3CFBB 4LCUB 5E8EB 3RTQA 3AU1A 3FQTB 3S34L 1WZMA 1JUFA 2VDNH 2P5WA 1KCVH 1UJTA 4FNLH 3CD4A 1AH1A 5GGQH 1NCDL 3WS3A 5J57B 4JM4L 2GSIB 5DJ8A 3IFNL 1KFAH 2P5WB 3DECA 5IVXB 4JO3H 5IFAH 3EO9L 5C3TA 3SKOB 1KJ2B 4LOUD 4M1CC 3OKDB 4Q58C 5KVFL 1FL6A 3ARBC 1RIVH 3ORJA 5CS7A 4NZDA 1I1RA 3OKEB 2BRRL 3LKSB 5J1TC 2VZ3A 1R3JA 4Z7WE 3VD5A 1OVZA 4NN7C 2HYMA 4FP8L 1K4DA 4KRNA 4XPFH 3T8XB 2EDNA 3GSXB 5IK3A 4S11A 3JTTA 5DMGD 5T3XH 3KPMB 1GIGL 2NW2A 4WHYH 1DBAH 5ISZB 1AHWB 1CFQB 3L1OH 5ISZE 1A7RH 3RWDB 3V4VL 5KSUB 4Z76A 4K94H 4I9WE 3WUWG 1IGFL 5F7WC 3VGAC 5FUZL 3V5KA 2ERJB 4JM2F 3QXUA 1CK0L 4NYLA 2XWJB 3H3PL 1YJDL 4N1HB 4R96A 3SGJA 2BY0A 1OSPH 4HKBB 3EYQD 3VGFA 2DJUA 4QHMA 3I50L 1R5IA 5BV7L 5EU6B 5CEZE 1YMME 3GSQB 4Q0XH 1DLHB 5H8DA 4JM2A 1UA6L 1QKZL 1Q94B 4QHNA 4QRSA 1CGYA 4ERSH 3TBWA 4KU1A 2X4PB 3WBDA 4PRIA 5TE7H 4IHOA 3OKMA 3CFKA 3FN9A 4ODTH 1S9XA 3MQIA 4YHPB 1I8IB 5LGKA 1YMHA 5I74C 3HMXH 4PY7B 3MBEC 2GJZB 4MSWA 3V2AR 1I9RL 3D3VE 3DUUA 4JO2L 5IB5A 3L3KA 3PWVA 1J05B 3VRJA 4DZ8A 4YHML 1JYWA 3RTQB 4FFYL 1P5UA 1FPTL 4KJYB 5AG9A 3GUTA 4GRLD 1HDMB 4NP4H 3O4LA 4PGEB 2HLAB 3MNZB 5DLMH 4EN3A 1RK0B 4ZD3L 5A3ID 1UB5A 2FH8A 4C56A 5IBLD 2YMXL 3G04B 1IEBB 3AS3A 2WP3O 3WKML 5TFSL 2R4SH 3PG2A 1DE4A 1I1AA 2YPLA 4RDQF 3OKNB 1IGJA 1T1YA 3PQYB 1PVHA 4PJHB 3BSZH 4ZUWA 3V6FB 3MRDB 5DDHA 1FFPA 2R0LL 3BFOA 2GTWA 2SEBA 3NCJH 3PWPE 1A6TA 1RK0A 4FTVD 3HI1B 1CZ8H 2K9UA 3QWRA 4WGVB 4MX7A 4QRUA 1YNKH 2H3NA 3ESUF 4E41A 2J4WH 2L7JA 3FAXA 1D5IH 2EO1A 4JR9L 1BGXL 2CR6A 1TQBC 2RQ8A 3BIKA 1F90H 2G2RA 1ZAGA 3O6KL 4HDIB 1JF1A 4FZEL 1CD1A 4HJ0D 3UJTH 2A6KB 4NCC1 1T5XB 1RI8A 1H3VA 1S5HB 4RAVB 3VXUB 1DQQB 3V6BR 2X41A 1PAMA 3QUZC 1KGCD 4YZFE 4IHOB 1OAUH 1HXMB 5CEZH 1E4XH 2VSDA 5ESQB 2AXHA 4MS8D 4J6RH 4JVUA 1BOYA 2YPVH 1MCEA 3I02A 3TO4D 4ZFGL 4XNUH 1DLHA 1T5XA 3SGEH 1MCSA 4Z0XB 3UTPD 2JE8A 2G75A 4Q6IB 3FZUC 1ITCA 4Z7OF 4OBRA 4HMDA 1FZOA 4G9FB 2A0LC 5CEZD 2ICWJ 2EICA 3DNKA 3C5ZD 3ARGB 3MRKB 3P0VH 2Z31A 1PKQA 3KVQA 4MXQC 3GSNL 4ZODA 3PDDA 1TQCB 3I75A 3P73B 2DQGH 1CLYL 5AZEH 4MJIB 1NBZA 1GZQB 1T89C 2AV1A 3G9VA 3OKNA 1ZT4A 1T89A 3BMWA 4CU7A 2XQYG 5KANI 1MCWW 2XKUA 2J6EL 1J8HA 3DGGB 2ADGA 3EFFA 3BP4A 1FP5A 5HYIA 2IANE 4UAOB 3DV4A 4OLYL 2H9GA 3KPNA 3W82A 2DICA 3SDCD 1YPZB 1V3JA 5E8PB 5I1CH 5HXMA 1OW0A 2X09A 1MFCH 1KPRB 4FFZL 3P30L 5E6YA 4Z77A 3U4AA 4GQ9L 4JFHD 1SEBB 4S2SA 4XCEA 1CFNB 5I75C 3O4OC 4NO0D 5C0AE 4PJFB 3DWTA 3ULUH 1JPST 4OIAA 2X4SB 4Y16A 1HHGA 1MWAA 4TNWF 3GIZH 3CSGA 1CDYA 4LARH 4MXVE 3KHQA 5CZKA 5JNYA 1B0GB 3HLAA 2XZAL 4JFOA 1DVFC 5F96H 3MO1B 3TJEH 3NFNB 4DGIH 1BD2A 2K3TA 3U6RB 4QNPE 2R23A 3B2VL 3QEGL 1AXSA 4HXAH 4BQ9A 3S5LA 3U83A 4FFWC 3IDJA 5TQ0L 3G6DH 3NCFB 4YO0A 1OWRM 1NBZB 3VFGL 3RHWF 1CD0A 1HHIB 3U0TA 2R2HA 5GGRY 3DRQB 3PWUB 3NPZB 1OAQL 5IEHB 5F1NA 5I1HL 3WL9B 1MAJA 5D1ZD 5SX4H 4NDMA 1L7IH 1F4WH 1R3HB 2UUDH 2FB4L 4HIEB 1GGUA 5A1AA 4Z7VF 5LGHL 4DGVH 4HBQA 4BQ8A 3QIWA 4BK4A 3PGDA 1A7RL 4JM2C 1MUJB 1RUQH 2ENSA 1XGQA 2NR6C 1WC7B 4WHTA 4FXKB 5EA0L 1T6WA 3S6CA 3OKEA 5IVZA 2CD0A 4AQ1B 2PF6A 1AIFB 2DLFH 4QWWD 4MNQB 3SKMB 3OJDA 2QSCL 3RWJA 1BFVL 2BSTB 3WD5H 4HJGA 1KB5B 1QVOA 1RZGB 2R0KL 3PWPA 5E1HB 1WBYB 3QWQB 3VXNA 4XHJD 4Y2DD 1FNLA 4N8PA 1B0GA 2FGZA 3OJDB 3RWJB 5IROC 3VWJB 1GCFA 2AABH 3WJJA 3O6FB 1RMFL 1N8ZA 2PTVA 5CD3A 4YHNA 3O2VL 5KTEH 5CUSL 2HJLB 4JR9H 5C0NC 3EO1B 5C0CA 1T1XA 3L7FB 2X9YA 5JLZA 1BQHA 4OD2A 4R4FL 2QHRH 4P2RD 2FR4A 1DBBL 5JDSA 4Y4FB 4HKJA 3RVVC 4XTRD 2OX5A 5JIHA 3CH1A 2HJFB 1AKJA 2VQ1B 2VLRB 3HUJA 5IEHA 2CUHA 1QLFB 4FRWA 1ORSB 1JGLH 4IMKC 5HPOA 3K0WA 2YBRA 4F7EB 4L8SC 2UWEA 4I4WB 4F58H 2DLEA 2VDRL 2V2WA 2WWMD 1GZQA 1YZZA 3ARFA 1N5AB 2VABB 5K9JH 2BY3A 4PRIE 4WHCA 2UY7A 4FQCH 1KBGL 3EGSA 1C16A 5IIEB 4JPVL 4G8FB 2YUZA 4X7EC 3VXRD 1NC2D 4W6XB 3QCVH 4RZCB 4N0CC 2JCCA 4X6CF 3B9AA 4QWWC 5FHBL 3VXQB 2ED9A 2XPGB 5KBNC 5D1QB 1Y6KR 1AR2A 4YHNB 4M7LT 1ED3B 4YHIA 4FQCL 3HE6C 3DURA 4CL7A 5LKNA 3HI5L 4LDOB 2IAMD 4PGCA 2HFFA 2YOCA 4NO2B 4PRPA 1LWRA 1I1FA 2OTWA 1AO7B 2AP2A 5TGBB 4TSCH 2X4TA 3TZVD 1GJIA 4JFYA 1IJ9A 1T1WB 3E8UL 1N0XL 1FIEA 3HI6H 5KSAC 4HUNB 4EDXA 1ZANH 4FXKA 1F02I 1I4FB 5E8DH 5HI4C 4LHUD 3CXDH 1T5WB 4C56D 3EYVA 3QXDB 5BW7C 3QIWB 2ZCKH 4R9HA 2B0SL 3KXFD 3BGFC 1RJYB 2GK0B 1A1MA 1AXTH 1ZLVH 4R4ND 5T1LD 3B5GA 3VG0L 3DVNA 2JJUA 1VESA 3L3GA 2VITB 3RL2B 5E8OA 4P3CH 3JVGA 1K4CB 5ACZB 3MXVL 3VD3A 4HIJA 1KN4L 4Y4HB 2CRMA 5SWSB 1MH5A 3HCVA 3IRPX 1MCFA 4JY4B 4N0FA 3SKNA 3QJHA 1ZE3C 3MZGB 3UJIH 4ELMF 3FB5B 2FL5B 4M6OH 4JDTH 1I8MB 5EIQA 2J6EA 4F9LA 3ZKMC 1OTTD 5EBMA 3QUYB 1T66D 4C56B 1YECL 1T2JA 4HS3A 1LEGA 2CMRL 4HGKC 4HT1L 1V3KA 4OLVL 2HFTA 1TJGH 4KK8D 4O2CA 3LKQB 4NQXA 2LU3A 3CMOL 3QUMA 2D03L 1F6AA 1J12A 3TPUA 1X5YA 4XNYH 5TE6H 1U8JA 4NRYB 1P1ZB 5FFLA 3RGVD 3O8XB 4QRPE 4FFVD 3VG9C 3CLFL 4LQFL 4IRSA 2FB4H 3TBYA 1EIBA 2UZYB 2MSPA 2BC4A 2FD6L 1KIPB 4KV5F 4DQOH 1QHPA 3IKCA 2AQ3A 3MJ7B 3ILQD 4H88L 3F7VA 4ZS6C 3MCG1 2R1XA 3EO0A 4GAJH 1U3YA 1NC4A 3MV8D 1JTOA 2MPAH 1DQDH 3L95B 5IEKB 3GMMB 4FZ8L 1AD0B 5D7JC 1NMAH 4UAOC 4LCCC 1CF8H 1AGBB 1SVZA 2OTUA 4NNPL 4Z6AT 1MCDA 1T21B 2V7NA 3CFDA 3BT2H 4J4PC 2CXKA 2MQCA 3G5YB 2BVOA 4KV5E 4FXGA 4IOIA 4L8DB 3TA3B 5J1AA 1D5MB 3MV7D 3O4LE 4XP9H 1P4IL 2XXCB 3GKWH 1V5JA 3INUL 3TH4T 4PP1C 2HKHH 4DCQA 2D7QA 1Z5LB 5GGVL 4YHZL 4FQQB 1YN7A 5F7DA 5KVDL 3AAZB 4NOFA 1QSVA 4M1CD 2W9EL 1DBKL 3D48R 3QFJD 1OP3H 3TVMC 2DI9A 4JDZB 5FDYA 2XA8H 2YA2A 3QXTA 2VN4A 2Z4QB 1K4DB 2Z8RA 4LEXL 3E0GA 2P8PB 5KSBB 1UCTA 3BN3B 2PYFB 3LSOB 1ZLUK 3KG5A 4JRXD 4WY7L 3SGDI 2X4PA 1J10A 5FO7A 1UM5H 2XN9B 1U8MA 4YEFA 3EOAB 3BH8B 3F62A 1KIRA 1XF4A 5JXAL 3VWKC 4PJBA 4MAUL 3DV6A 4OCNC 3CMGA 5JXEA 5EO1A 3DRTA 2E8YA 2X4NB 4ELME 1U3HD 4OCWH 1CGUA 3BPNC 1VKXB 4G43B 4R96B 4XNQA 3SE3C 5CP7A 4M43L 2HFEA 2D0FA 1TZGH 4JN1L 4U1LB 3V5KB 3ZDXE 2VLRD 1IL1B 4KUZL 4R4BA 3TIDA 3DSNA 2FJFA 1GC1H 3VMOA 5SWZB 3OPZL 5KTEL 5DD6B 2E7CA 2V7NB 1NGPH 3MA7B 5DHYA 1T6VN 2NXZD 4OFVA 1SVCP 4PP1D 4PGZA 1DE4B 1I1AB 4M8QA 5D5MF 3GJFK 2OZ4L 2HRLA 4OQ1A 3Q6FA 1NL0L 2Q1EA 3UP1A 4MD4B 4GG6A 3MV9E 2W0PA 1IC4H 32C2A 2EYRB 4X80L 4M1DL 3JWDH 2IPTH 2X4OB 4ZQKB 1J05A 3OAZH 4DZ8B 1RZIB 3QZWG 4LPTA 3RVTD 3VG0H 3DX8B 4TRPH 2OQJA 5D1QD 1DJSA 3LIZL 4ESKA 3BJ91 5FA4B 3BN9C 1PG7H 2ITCB 4DGVL 3AREC 3KLDA 3KPSB 2V9RA 1TZHB 4LPXA 5FUZH 2EXYD 5DQ9B 3VWKD 4HPYH 1LO2H 3HMWH 1YEEH 5CIPH 3ARDD 3VFUA 3DO7B 4YWGH 3LDBB 1RZ7L 3PWLA 4JZOB 5FGBA 4OF6A 4KQ3H 3ESVF 3FN0H 2QR0B 1H0DB 2Y72A 3W0WD 2NX5B 5GZNC 4P46B 1RZJL 1I3GL 1G7MB 2C9AA 3KWWA 5EU3B 3NZHL 4D94A 5EZJB 1PSKL 5FHAH 4RGNC 1NH6A 5I1DB 3UAJD 2HKFL 1OM3L 3LHPL 4HLJA 4JPWL 3DI2B 3FB6B 5FEBA 3ULVH 3W81A 3OV6A 4GAFB 2VDQH 5DHYB 4NM4H 3H2WA 3C8HA 4HWEH 5DEFB 1YPZE 3C5ZB 5ENWB 3LMJL 3BPCB 4GW1B 1OY3B 2FX8H 5DQJB 1AD9B 3B6SA 1FZMB 1KUMA 5E8NA 2Y1VA 4OZHF 2B8OT 5CJOH 4L3AA 5JXAH 4PRBA 1G9MH 2BSRB 2E27H 2YUXA 2XY2A 3C5JA 3ILPB 2ADIA 4H26A 4GMSH 2IPKB 4O2FB 1F3JA 4PB0H 4O9HH 2C3XA 4Q2ZA 1A2YB 5JW3H 5EO1B 1IM9D 2EC9T 3RVXD 2ICEA 3Q48A 3G5ZA 2H8PA 4JFEE 3DX7A 3K81A 4P4KA 1J9CT 1EFXA 1GHFH 2NZIA 3SGEI 1IC5L 3RVUC 3ARED 1N2RB 4NQDB 3RGVB 3FRUA 2VC2H 1F3DJ 1OAZL 1EFXB 1WJ3A 1IAOA 3RKDD 4JPWH 1T04B 1I3RB 1MY5A 4GMSL 1UJ3B 4P59L 2W0FB 4LSSH 3WUZA 3LKNA 4XB7A 5KAQF 3ARBD 4BZYA 4POZC 1X7QA 3HTLX 1BM3L 1CE1H 1JHKH 4JANA 5F7MC 4OSUL 3RX8A 1RZJC 1OGTB 1N7ML 5FUCC 1QFPA 3PGFH 5FYJH 2DKUA 4C58B 1A02N 1KCRH 1X5JA 3UAJC 4LCCA 2Z35A 2AXGA 5B39G 4Z78A 1EV2E 4JFFE 4LQFH 2FATL 4OFDA 3IXTB 5TDOA 4FQXC 5FO8A 4NC1C 3RRQA 5DS8B 1J0YA 4U6XA 1WBXB 3FQWB 3KJ4C 25C8L 4OCSL 2YRPA 2D7MA 3SO3C 5FYJD 4XWGH 1K8IA 4X5WB 1TQBB 4UT7H 1YEDA 3BUYA 1CDJA 2WM0A 4YDJA 3F58L 5H35B 2ATKB 1KIUA 2MPAL 4MDJB 4PJXF 4RMWA 1BFOA 1QACA 3QWOA 4FXLA 4C59B 5IMOA 3L7FA 3WJLC 1A3LH 2O26U 4TNWK 3EO1A 1BQHB 2BNQD 2UV3A 3B4NA 1INDH 3WIHL 5DK0A 1LO5B 4WU5B 3L3HB 5DVKA 2VLJB 1RU9H 4R97C 4JRXB 3D2UB 3GRWH 1YEGL 4HKXB 1Q9WA 4NM8L 5HYEA 3MA9L 3ULUF 4WFHE 5E9DA 4PFEA 4S1QH 1AGCA 1WBYA 3GHEH 4WUKH 4WEUD 3PWPB 2AGJH 1C5BH 4PJ5E 5JQHC 4EI5B 5DMGC 1R5WB 1A7PH 1A6ZA 2B4CL 5BS0A 1NDMA 1U8LB 4LEOA 5IVOA 4B7IA 5EBWA 1LEGB 3T3PE 1RD6A 4JRYB 2AQ2A 4JZNB 1TTUA 1HEZA 3O3DA 1DANU 3OHXA 4GAYB 3O3AA 2FECI 4TSAH 4NKQB 3U7WL 3X3GH 4OZFH 3ARSA 1KNOA 4HIHB 2W92A 5GS3A 1FH5L 1BD2E 2ICWB 5LXGH 5GS0D 5TF1H 4DVRH 4GG6F 2PUQT 2GITB 4HS6B 1LEIB 3M17A 1IMHC 5I1EL 5DD5L 3FT3A 3UTSB 1HQRA 2BNQE 4LRIC 1RVFL 2NY5H 2VKXA 3O3AB 4X9GA 3OTTA 4LLWA 1JNHB 4YEEA 1GGBH 1CL7L 2AERT 1OGAD 3O6FA 2UVFA 5C09E 3IDIB 1IKFL 1SYSA 2FHCA 3I6LE 4FABH 4PJ8C 2X1PA 3I6LD 4HG4K 4MXVF 2HKFH 4L9LB 1XZ0A 2AK1L 3EYFB 4ZTOH 3S37X 3DO3A 3VXRB 3T65A 5I2IA 5B4MD 4JAMA 1MWAB 1VACB 3QDGE 5I1JH 4GBXD 5JHLL 4HD9A 2EDBA 1IEAB 5JR1H 5IHBA 1BVKB 1WC7A 2P7TB 4G6MH 1J87A 4YHIB 1MCQA 3MUJA 3RVVD 1YEJH 4GH7B 5D2LA 2JELH 4APQC 3QUXB 4LKXB 5LJYH 4RFNB 5IW1A 2IFFL 3MRGA 1HQ4A 1JGDA 5GHWL 2BSSA 2EIBA 4P3WA 5DUPL 1MVFA 3OKLA 3MLUL 1MFEH 4V2CB 5LQBL 2XOTA 3PABB 5J9PB 1C5CL 1WVZA 1LO3L 2VAJA 2EEAA 4U0QB 5CIPB 5DT1L 5FYLL 5D7LD 1A21A 5DGRA 3G5VA 1XR9A 3CUPA 2ESVD