4JY4B

Crystal structure of human fab pgt121, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
232
structure length
232
Chain Sequence
QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PGT121 heavy chain
publication title Broadly neutralizing antibody PGT121 allosterically modulates CD4 binding via recognition of the HIV-1 gp120 V3 base and multiple surrounding glycans.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4B01
3P73A 4GRLA 3RDTC 1U92B 3KPNA 5E0QA 4XI5D 1U41A 1ZT7B 4RNRA 4W4OA 5DRWA 3RWDA 1YY8A 2VLMD 1KF9B 5A16A 1PJ9A 1OW0A 1QHPA 3IDNB 3WEXB 3WHXA 3QQ4B 1HSBA 1KB5A 2HT3C 3UPRB 4FQHA 1NBQA 3GMPB 2WINA 4ELKB 4HLJA 1IC7L 3IFLH 1U3ZA 4P3DB 5D70H 1KACB 3CUPB 1XH3B 3QSKB 2Q8BH 3IF1A 2XZAL 4J4PA 1C5CH 2VDKL 1RZFH 1A1MB 3LD8B 3UJJL 1EZVX 2GT9A 4JFDB 5DEGA 4IIQB 5T1DL 2FEEL 3DUSA 3KPSB 3CLEH 1XCQA 3FO9A 3UZEA 1DBKH 5GGRB 1U8HB 3KPRA 2BSSB 3NA9L 2BZDA 4EUPB 1AKJA 1S78D 2QQLL 4HUVB 5A2LH 3SDCC 4X98B 1GGTA 5HYSB 3HNVL 2Z4QA 3ZT6A 2W1NA 1U8MA 3MBEC 4JRYB 1MCPH 2PO6B 4GXUN 1UB5A 3WIIL 1SYVB 5HGHA 3NACL 4Y8AA 4KKBD 3QDMA 1GGIL 4NZTH 4XXCC 1S9XB 1ADQL 2ICCA 2JJWA 3I2CL 1HOCB 1F2QA 3MLWL 1BLNA 4HBQA 4EDXA 4TVPD 5HVHB 4UT7L 1CD1A 1DUZA 1FG2A 2DQUL 3TZVA 4EXPX 3JWDL 4XCNA 4KMTH 4LOUD 4MNGA 2G5BB 1EH9A 1WUNT 5J1SC 2NXZD 1WSST 3PWUA 1BQHG 5BZDA 4KTDH 2E27H 1C1EL 4YGAB 2AXHA 1IGIL 3GSQB 2VO5A 4ELMB 4ODVL 5GSVB 1QLRA 4ZTOH 1N59B 4PJ9C 2FD6H 1MOEA 3IJYA 5D2LA 4ZUTA 1Q72H 3RY4A 4UU9A 2EXWC 5DD1H 3QZWB 5IHBA 2D7QA 2M8XA 2B5IC 1S7TB 2EDXA 5EFIB 1S9YB 3EYQC 2VDLH 4R2GC 4I4WB 4M6ML 4YZFE 1S78C 4QF1B 2ZCHH 4JQIH 1BP3B 3Q3GB 4XGZB 5J11C 1FSKC 1N6VA 5TF0A 2ZCLL 5BXFB 4PTUB 4OD3H 3MTRA 3AAZA 1D6VH 5I76B 2EE6A 3RUGE 4KKBC 4LCUA 3RKDC 4PGEA 1UYWH 2VDQL 3ARFB 3RIAF 5ISZA 3V0VB 1MQKL 4Q9CA 3LQMA 4OQTH 1QZ1A 3BWUC 4PRIA 2NXZC 1A1NA 2X4OA 4NKQB 3ZDXE 5CIPB 1WC7A 4FQ2H 5BRZE 3MV8E 5DHVA 4BFBD 5ECJE 2OX5A 3G5ZA 3VXME 3F6LA 5MHSD 3UTQB 2P8MA 1L6XA 1JP5A 4WV1C 1KCVL 2YC1A 3X3FL 3RWEB 4N5UA 1G6RL 2C4FT 1JF6A 1FG9C 2EDQA 4QOKD 1BBDH 3OR7A 3FQNB 3GSUA 2X9YA 2YMXL 4LKCB 2ZUTA 1UCTA 2CK0L 4ETQA 4HKBB 2CDFB 1WBYB 4F15C 1A21A 3N0PB 2BNQB 2ADIB 3RWIB 1UB6A 5E8NA 3RVTD 2UVEA 3V0WL 5EUKA 4Y2OA 2JIXB 3CPLB 2HJLB 1MI5E 1OM3H 4KZDL 3PJSB 4C55A 4ENEC 5MEPA 4KQ3L 2EICA 3K46A 5GRVK 1BBJA 4ZS6D 2F74B 5E94A 4G9FE 4NNYA 3GMNB 4L8DB 3ES6A 4O2CB 4KK9D 2MKWA 3B2UC 3NCFB 3X11A 5LGKA 3ZKSD 3HRZA 2HA1A 4OCXL 5D7LD 1D3CA 3Q48A 5F7NC 4NFDA 4RMUA 2AJYH 5FHAH 3VXSD 2EIZB 1VFBA 1U8IB 4HUWA 2ESVD 3BJ91 4BUHA 1PSKH 3WIHH 4LCIH 1HSAA 3KPOB 2HFGL 5F70A 5LGHH 2Z31A 4LVOC 4Y5VC 2GJ6D 1CDIA 3WFBH 1T1XA 1KJ2H 4YFEA 2P46B 4G8GA 5SWQA 4GQ9L 1DN2A 5IW3A 1JRHH 1NGWB 1F58L 3SDAA 4ALAH 4D0DA 4AT6B 1JNNH 4MXVF 1QSEB 5MENA 3EDDA 2HLFD 3D69A 3SKMB 5C0CD 5KSUA 4MX7B 2AW2A 5GRWA 4YO0B 3BYYA 2X9WA 1N6UA 4MJ6B 4ZFGH 1N6QH 3RVXC 4Z7OE 4PGCB 3M8OH 4WU5B 3GSNB 2VLRA 3P9LA 3L3DB 5I1LA 1N5YH 3MXWH 3BDYL 3ETBF 4Y19D 4NO0B 1Q9OB 2BSTA 2FIKB 5DA0B 4K71B 4NHCL 3SDXB 2IANA 3R0NA 3MRMB 3HMXA 4WWID 1LP9A 2G2RA 4YPGB 4JG1L 4JHBA 4LP4A 1CG9A 4RIRA 5D7JC 1N64H 2LTQC 1A7BA 2WUBH 2FH6A 4U6XA 3L5WA 4GKOA 4PJCB 1DBAL 5JXED 4Y4HC 5EORL 3PWPE 1MCRA 1AGEA 4NN6C 3PHQA 4RAVA 4AYFA 2P7TB 3B9VA 4XHQA 3V79C 4OFPA 5ALCH 3U7WH 2HLFC 3N1GC 5HDQH 2VC2H 4PRDA 5JA9A 4OI9A 5I30L 2C3GA 3D85A 1S7WA 5E5UB 3VCLA 1M7XA 5C07B 3KPLB 3G5XA 5KTEL 4M61B 4N8CL 3MREB 1CD9B 4YC2C 1FCCA 5BS0B 4LLDB 4GW1B 2VTFA 4V1DE 3VXRD 4UOW0 5ADPH 1RZJL 3FFCE 4E0RB 4GUPA 5C2BH 4HPOH 3ARQA 4P2RA 4NKIL 4ZUUA 3CSYB 4GAGL 1PYWB 2R0KH 3INUL 3N1FC 5EPMB 3EAKA 3G6DH 5LWYL 5ID1B 4HIXH 1U3HB 5TFSL 1F3DH 1MFBH 3OGCA 3VRJB 3V5KB 5GSRA 2VWEE 4JFZL 3O41B 4G3YL 2HP4A 4OKVB 3VWKA 3C8HA 3O9WA 1NCAH 4L3CB 5I2IA 1GHFH 4HZLB 4R9HA 1KN4L 5IBLD 2EDTA 4XNQA 1NJ9A 4H0IA 3IDIA 1H3XA 2W60B 4Y2DD 2FYYA 2XY2A 1JYXA 1XR9A 1FDLH 1R24A 3FFDA 4PLKD 1SJHA 1Q1JH 3DV6B 3EYVA 3TO4A 1FCGA 3QI9A 4UQ3A 1FZJA 4U33A 4TUJA 1LEIB 2FJGA 3KS0J 2DLEA 4QRTA 3O8XA 2ADFH 3DTXB 2BNRA 2XQYG 1AD0B 4EI5A 3DO3A 1U3JA 3K1KC 3PV6A 3SO5A 4NUGH 4XPHH 4PRHD 1V3LA 3MCKB 1YEIL 1ORSA 2C7UB 2NMSA 4XCEB 4K7FA 2FL5A 4UDTA 3ARYA 3OGOE 2AEQH 1HH9A 5IKCA 4MVBC 1MJUL 5I15H 3QXDA 4Q6IB 4J3TA 4Q0XH 4ZXBC 2GAZB 5IW1A 1JF1A 2CLVA 4JY4B 1TJIH 1VGEL 1B0RB 4PY8I 4ODHL 1ZMYA 1ORQA 4LRIA 3DBXA 1I75A 4HX1A 1ZVYA 3VJ6B 5E5MB 4PLKC 4RGOL 1IGCH 2CH8A 5AG9A 4MAYC 5CIPH 2DL2A 3HE6A 4GKZA 1A7QL 3LKOB 3QUYA 1WT5A 4QYOA 3MGOB 3PGCA 1RZIA 3BN9D 4XVTL 3GBNL 4LDEB 4W81A 2VQ1B 2JELL 4M1DL 5IG7B 2NY3D 4P9HH 4C83A 1A9BA 4MNQB 3MLPA 1T20B 2VISA 5GGUA 3V6FA 3UZQA 1KXTB 1TXKA 4OZGB 1OGAD 3HE7D 1BF8A 4LNVA 4MXWL 1EHAA 1MREL 3EFFA 3CFDB 1C5DA 4N9OB 2QHRH 3ZE2F 4EBQH 1E6OH 2APTA 1WQVT 3SE3C 4Z78A 3QAZC 4G6JH 4M00A 4NDMA 4QHUA 4HKJA 5JXAH 2QQNL 1YEEL 2UWEE 5FKPA 4AEIH 3R06A 1DFBL 1YNLH 2PTTB 1KYOJ 2P43B 1EDQA 3QRGL 4Y0GA 5GGQH 1TDQA 2J8UA 4DEPC 3ZTJG 1RIUH 3LEVH 3J8F7 1XGTA 4YXHL 4PJGB 3S34L 4GFTB 1WVZA 1OWRM 3H9SD 5EO9A 3L1OH 1T83A 3AVEA 4X6CE 4RAUB 2H32B 4MDJA 2ARJA 1XF3B 4NN5B 5J13B 2JKXA 2W9LA 1H5BA 1C5BL 4QHLB 2X4UB 3RNQB 4DOHE 3BX7C 2P5WE 1CGSL 4MZ3A 4KTEL 4NP4H 1J88A 4ZPVB 4Z7WE 4HWZA 4YHMH 5D1XA 4DFIA 1KLUA 4WRLA 2J1KA 2PXYA 3JVGA 4FXKB 5F3HB 5E2TH 1VFAA 4KV5F 1MLCB 5CGYD 3PWVA 2WLYA 3VRLE 2F5BL 1RJLB 4JG0H 1X6LA 4PJBE 3BVNA 1S7XA 4HQQL 5E6ID 4J6RL 4FXLA 5I71B 3HB3D 1GGCH 4TQEH 2XYCA 1EHLL 4NWTL 3LV3B 1ZA3B 5IMOB 1YUHA 3RWFA 1HXYA 2F53E 5D7KD 2BMKA 5FO7B 3SCMB 4QRRA 1SMAA 3U46A 4PYGA 2R0LL 1ZLWK 5AZ2L 1VHPA 1KLFA 3FO0H 4KJYB 5FOBA 5SWZA 1G7MB 3MLTB 4YHYB 2BNUA 4XWOC 1CGXA 5LG1A 2GK0B 4GSDL 4NO2A 4G80A 3WFEH 4TULL 3WFZA 3M1BB 3DMMA 5IHUH 1FFPA 2GHWB 4JY5L 3UJTH 2R23B 4JO2H 3DSFH 1KIQA 4K3GA 2AAVA 5C08E 2K7PA 3CLFH 3GMMA 3QEQE 5T3ZH 5EO1B 1CGWA 2UUDK 3LKQB 3MYZA 3O4LD 4JGUA 1YY9D 5E6IC 4P2OD 5HHOA 5DGRA 3GMQA 3HB3C 5B8CB 1R3HA 5F96L 2W9DH 4OQTA 4ZYKB 3U6RB 4PJHB 2DWDB 4CMHB 1IAIH 5ESVB 3ROLB 1M71B 4MYWB 2IPTH 5DR5L 3WSQH 1F8TH 2PETA 2GSIB 1TFHA 5L2KD 1F2XK 2V9QA 3FQXA 4AMKH 1AGFB 3L7FB 3MO1A 4S1RL 1T3FB 3UTOA 4NGHH 4O4YL 3E6HB 3P4MA 3LKSB 1G7HB 4NNPL 4D9RD 1HKFA 3V9FA 3WDJA 4HHAB 2Q3ZA 3V6OA 2UYLB 4HXBH 1KPUB 2YA2A 3MLSL 1XGQA 6FABL 1OGTB 1TVDA 1AO7D 3GSWA 4A6YA 2J8HA 1NGQH 1V7MH 3L3OA 4DGYH 5IB1A 4WTZG 3S4SA 3T3ME 1MFAH 5L88H 1DL7H 1A7NL 3MROB 3QUMH 3SJVA 2E9JA 4YX2H 2HMIC 3FONB 1YY9C 2QEJA 4P2OC 1RZGA 2VB5A 1HILA 5I1GH 1MCBA 5ESAA 5HYFA 4MA1B 2D7MA 2N7AA 4JQVA 1A6WH 1JZ3A 4Y5XC 1WLHA 3CVHB 2F19L 4RFNC 3UDWC 5KG9B 1TNMA 4R0LA 3GK8L 4XP1H 4PV8B 4WI5A 3T2NL 2AK1H 2IH3A 5CCKL 1C08B 4F7TA 4U2YA 1JPGA 4FQCL 2O93L 2R0ZH 5DMGD 5AYUL 3WIHA 4U6VH 2WBJD 3IS0X 4JJ5B 5KOVC 5J6GB 1RUQH 1GGBL 4N8PA 1SBSL 1A7OL 2UZIL 3TYFB 4YDVA 4P4RB 3QPXH 1KJ2A 3UO1L 4HS6B 4NRXA 4WUUA 2Y6SD 5D1QD 1RJZB 1XGUA 1MFEH 4EQ2A 2XRAH 1KFAL 3IDMA 4E41D 1WWWX 5KJRL 3MV7D 1LWRA 3TYGH 4R97B 1I9JH 5TDPB 3BP7B 5DRXB 3VE0A 4U7KA 4R96B 1CR9L 3D0LA 2PKDA 1A6UH 2XKNB 1JYNA 2J4WH 1M1SA 2XI9A 3VFTB 4Q9RL 1KEGH 4FABL 3VWJA 5JW4N 2FO1A 4IDJH 3MCG1 4ERSH 4F7CA 4YBQD 1HH6A 1BQHB 1WAAA 3F5WB 2CXKA 2OR9H 1XFPA 3LEXA 3KLHD 5EC1A 1KUMA 4QRPE 3HS0A 2DBJA 2VXSH 4JPWH 1WBXB 4LSDA 5FFLA 2D4FA 1XF4A 1M4KA 5FA4B 2C5DC 3IU3B 4G8IB 2HTLD 2X05A 1Z5LA 1W0WB 8FABA 4S1QL 4F7EA 4GKNB 4KHTH 5D1ZD 1QR1A 4LRNH 5KS9F 2EIBA 2ZNWA 3LVEA 5FGBA 3IRZA 4OLYL 4HG4K 2RJMA 2WBKA 3IFOB 3H0TA 2VZSA 5CBAA 35C8H 3MNVB 4WW2B 3P30L 4X9FA 5IP4A 1CZ8H 3OKNB 5DJ6B 1P5UA 3NFSL 4HUNB 1KC5H 3GJEA 1F90H 4ONOA 1SJXA 2H32H 2R2HB 3T0WA 1FRGH 2RGSA 2HYMA 1WISA 4HS8H 4NUJA 5E99H 2YKLL 5C6WH 2DB8A 4YBQC 3IT8D 1MHHA 1PDKA 3MCLL 5KN5B 5BV7L 4GQPH 3TPUA 1YYMH 4X99B 5H2BA 4POYA 4GMTH 3T08A 4D0BA 1QACA 4LIQL 1KT2B 2JCCF 2NTFB 4CJ0A 1DQTA 1AXSB 3MUGA 5MERB 1LQSR 2N56A 4IIQC 3NA4A 43CAA 2A9ML 2HTLC 3BN3B 4GBXA 5DUBA 2DKMA 3GIVA 2ZSWB 1ACZA 3JWDC 3ULVF 5GGVH 5IWLA 4LFHG 1JMZA 2NY7L 2AEPH 5F1IB 5DRNB 3QIUA 1LO2L 3T2QA 4PJXE 2VLJD 5L2JB 2PO6C 5HYJD 3OZ9H 3FAXA 5FYKD 2P5EE 5DQDL 1FN4A 4LPYA 2BXYA 2A6IB 3WN5A 3LKPB 2R29L 4IRZH 5HI3D 4G6KH 4YHZH 5HVHC 3CFJA 3MRPA 4OZHF 3KPRE 4RGND 1MCJA 5EIIB 1NFDF 5GZNC 3JTSB 3LMJL 4TVPH 4Y2DB 3U4EA 2FJFB 3QFJB 2CMRL 1OQOA 4NQEB 5H37G 2IPKA 1KELL 1S3KL 2EH7H 2DQCL 3K8KA 3QQ9D 4IOSD 3HLAB 1J1XL 3LCYA 3RGVD 4Z8FH 1CICD 3RJQB 1ERNA 4AIZB 3HI6H 4R4FH 1NEZA 2UY6A 3DXAA 4O2FB 5I75C 3BE1H 4YE4H 3ARXA 2WIIA 1OTUD 4HGKC 5FO8B 3QIWB 1RZ8A 2X4QA 3QFDA 1CFVH 3O6FD 4PV9A 1L0QA 1MJJA 2DMCA 1JN6A 1NGZA 5I16B 3IGAB 3MRDB 4JJHA 1PG7L 5EZIH 4NKDB 2VKXA 5E24E 2ICWA 2PR4H 4DVRH 3QUXA 4RFEB 3TN0A 1BZ7B 3LRGA 3VI3F 1G7IB 1U58B 4LAQL 4U1MB 1QFUL 4NT6B 1HNGA 5ITFA 1JV5B 3IVKB 15C8L 2DMBA 2MNUA 3CFIC 4C56D 4LDLB 3MNWB 1CXKA 1J05B 2EYSA 4X6EA 5TDOA 3BZDA 1Y18A 5DRZA 3QQ9C 4FQ1H 4C4KO 5D5ME 3RI5F 3RGVC 4ORZC 1MCNA 2YD7A 3KJ6H 4XHJC 1CICC 3CH1B 4M5YL 5D6CB 4H1LG 2DJUA 4Z9KB 4A2LA 5ICZA 3EO9H 2OS7A 4PP1D 3T77B 3MRBB 5I74B 4HEPG 5I6XB 4AL8H 3BWAB 1PKOA 1RIHH 2YUZA 1OGAB 5HD8D 1A6TB 3MLXH 1NMBL 4LP5A 4JO3H 1UJTA 2P8LA 4NRYB 3RAJH 2XWJB 1DQLL 3FQTA 1J87A 3BZ4B 3D39A 4Y4FB 3REWB 2HKFH 1A64A 4IOFC 1QO3A 3T65B 2WIMA 1AHWA 4I3SL 5CD3B 3ZMRA 2FHCA 1YEFH 2B4CL 3QUZA 4U7MA 5J3HC 4HULB 1QBMH 3JWNC 3MR9A 4X5XB 3A67H 3U36A 4M6OH 4ZS7H 1NC2A 2AKRB 4U1NB 1U91A 3OKLA 1KJMA 4K3DL 3SBWA 5DYOB 1BFTA 3GBLA 4KQ4H 2X6MA 5L7XH 1RZKH 4QXTB 1UM4L 4UDUB 3H6JA 3LQZB 4S1SL 4PP1C 5KW9L 3C9NA 2ZPKL 3UTTD 4NRZA 2NY2D 1NSNL 2XA8H 3MRRA 5C1MB 2A0LD 1VADA 1LNUB 2CLZA 5JZ7C 2N7BA 4DGVL 4FFZH 3O3AA 5HD8C 4PS4H 3QIBB 1NAMA 1OQXA 3FCTB 2J6EH 3P77A 2HVKA 3TPKA 1T2XA 2R1XB 2XFXA 1Q9WA 2BSRB 1XF2B 4OLUH 3VXPA 2AV1A 1DLHA 3QHZL 4K71C 3W5MA 1PZ5B 4GW4A 4JKLA 1BQUA 5I1CH 4HIJA 3MODL 1S9WB 5HDLA 3RHWK 5F1NB 1HEZB 5MI0B 4AEHH 2YPLD 1MPAH 2ZJSH 1HDMB 3DRQB 1RZJC 4M8VA 4OFKA 1OVZA 2D31B 4U1KA 4ZUVA 3I6KA 4WFEE 2A6KA 1T0NB 5IB4B 2AJSL 4X4ME 3RWHA 1S7QB 1MHCA 3TBVA 4M6AA 3L6FB 1J8HD 5LBSH 4KDTA 3TH3T 3E6FB 4MAUL 1U8LB 3F7QA 3D48R 3GSXA 1XGPA 3TVMD 3ULUL 4XBEH 2QR0A 4EN3A 1FYTA 4IS6A 2UV3A 3O4LB 4JVWA 4LCWA 4O02L 3D2UD 3U0WL 3IKCB 3ULUF 5KVFL 1EEQA 2E6PA 4OSUL 2FATH 4DQOH 1U3HC 4QCIA 2OZ4L 2R4RH 1DE4A 2F5AH 4PJ7B 3CNKA 2JJTA 4G8FB 1YEKH 3QUMA 1KPRB 5IJKA 1ZOXA 2EDOA 5L2KB 1CL7I 2VLKA 4HK3J 1O5DT 3TJEH 1XT5A 4HFUL 3VFMB 4MCYB 1I9IL 4TN9A 1SY6H 2NTSP 4JFFE 1ZGLB 2OP4L 5C0RH 1WITA 3E0GA 4HIHA 1PKQE 1XCTA 1JGLH 3OAZH 2BRRL 2JJUA 3FAWA 4F7MB 5C71A 3EDKA 3MGAA 4ZTPH 4KDVA 3MYJA 3IDXH 2J88H 4R90L 5K9JH 3OG6B 4OZIA 1MFDH 2VZOA 4L8CA 3G08A 3VW3H 1RUPH 4PY7B 4NPYB 5FF6A 4XMPH 5GS1B 1K2DB 5D71L 4LSTL 1U8KB 2H2PD 4LK4A 3MACL 4RMWA 1KB9J 1AJ7H 5D6DA 1UACH 5L0QB 3GHBL 4X83A 2RR3A 3BQUA 2AXGA 4UZGA 1A2YA 5BJTB 1D5BA 3VXTA 1QSFD 2OK0L 2PYEE 1TJHH 5GIRA 3BW9B 4KH2A 2LVEA 1JGDA 5ILTL 4R6UA 5F9AC 5D7IB 2GJJA 4FG6D 4Q6IC 3RDTA 3FB6B 5C0BB 2DJSA 2GFBB 3QHFH 1DVFB 4Z95L 4IRSD 4KI5F 4KKCC 5IHZA 5ICXA 3CXHK 4I0PD 4YHOL 2DQEH 5HI5D 4KY1L 3L3IA 5JHDA 3MNZA 1W72H 4X6DF 2AVGA 5JORB 5D1QB 5C6PB 5I1IL 3G5VB 1ZWIB 3V0AC 3B9DA 1INQA 3OKDB 3EYFA 1UWXH 4Q7DA 5GRYA 2BFVL 3MV7B 3NH7H 3O11B 2IALB 3OKKB 4W68A 3U7YL 3HZKA 3BAEH 5FYJU 1W0VA 5JDSB 3IETB 1RUAH 4MD0B 4ESKA 3VG9C 3PQYD 4X6BA 3BSZH 4FP8H 2BHZA 5I17B 5I19L 1AC6A 2C4XA 3WD5L 2YPKB 4CMMB 4M5ZH 1FP5A 5J12C 1J8KA 4Y1AB 3FO1B 2ZUYA 4XP9L 4ODSL 3BJLA 4CGTA 4F80A 4M8QA 2MCPL 3SDCA 5DQ9B 1CLCA 2VLLA 3QJHA 4MWFA 4L1HA 3DETC 3OJVC 1EO8L 1A7PH 1J18A 1T66D 2H8PB 2WWKO 4PR5A 2X4RB 3VFUA 4Z7VA 4JRXE 4XP6H 2EEDA 4WHCA 5H8DA 1BM3L 4JM2D 1CLYH 5DD0H 5HHPB 1LK3L 1Z0MA 5J13C 1J1PH 3K81A 4UI2A 3IFNL 1AGDA 5DI8A 2DQHL 4XBGB 1OP3H 1FL3A 4PJ9A 2Z91B 3LS4H 3RZCB 1K4CB 3O6KH 3TWCL 4QT5A 2AGJL 2QSCL 3NOIA 2X41A 1GOHA 4LSQH 1DN0A 3PABA 4GT7A 3N85L 4I77L 2VAAA 1EMTL 4RA0C 3BHBB 3CCHB 1AGBB 2PW1A 4NJAL 1X5AA 4CJ1A 4W4NA 1R3IH 2V5MA 3JV4A 5HHQA 5E8OB 1WZ1L 4YXKL 5IK3A 5IOPB 4GRWB 5I71C 2CIIA 1OL0A 4NSKA 3PDOA 1T66C 1WJ3A 2H6PB 1ODAA 4ZG1A 4CW1B 1FO0L 5CILL 4BJLA 3SCMC 2EE3A 5DJCA 4ZFZB 3MJ9H 3MOAL 1BJMA 1EHNA 3P2TA 4PB9H 3QWRA 1T5WB 4NN7B 3HUJB 3KLDA 3FN0L 2ZKHH 5E2UH 1RUKL 3NCJH 3QYCA 3UYRH 4FNLH 1YPZA 1AQKH 1J0HA 4E9LA 2YK1H 4TUKL 3ILQC 2V5RA 1B0GB 3LRSA 4RGNB 2VL5B 4JZJC 4PJEE 4U31A 5JQ6H 1DQML 3GHEL 3IDUA 1BJ1H 4XWGL 4AK1A 3A6BH 4I5BA 4YBHA 3B83A 3HCVB 1A8JH 1UADC 1PAMA 1PQZA 3T1FA 4YHLL 43C9A 4X4ZA 1HN1A 4OD2B 5TDNA 1NDGB 3NZ8A 5I1AB 4XVSH 4NYLA 4YBLC 4WHTB 3DWTA 2NW2A 1FLRL 2FWOA 4L8BA 3BKJL 1RULL 4LU5L 4LLQA 4QLRA 4Y8DC 1ZANL 1B2WH 1OAUH 4KUCD 4CMHC 5GGSY 3C2AL 3RWCA 2DI9A 5IVXB 1F4AA 3FOLA 1EAPA 3C5ZB 1FYHB 4R4BB 2O5YL 2NY6B 3O6FB 5IEKB 4XXDB 2HJFB 1G9NC 1H3PL 4YQXL 5TPWH 5J57B 1QRNE 3MV9E 1D7FA 1UJ3B 1HHHA 1QNZH 2NZ9D 4ZFFA 3K2UL 3MGTA 4PJFA 25C8H 5INCA 4Z5RB 4G6FB 4EI6B 4XTRC 4H25A 4EVNB 4QOKA 3G04B 4Y5YB 1JPTL 5E2JA 4NM8H 1RMFL 1RK1B 2GUOA 2VXTH 1UM5L 3CGTA 4NQCE 4QGYA 1LP9F 4XP5L 2F58H 4OM0H 5JLZB 4LCCC 4N8VA 5JDJA 2DMKA 2ICEB 4M03A 1UZ8B 4MA1C 3NN8A 4P9ML 4BFIA 4GAYA 1QSVA 4KK6D 2P48B 5DVMA 1FLTX 2R2CA 4OCLC 1JTPA 2DYPB 5JA8B 2G75B 1TZHB 4M3JA 3KPPA 4P5TD 3DI3B 2AK4E 1D5IL 4Q9BA 3PP3H 3ZE0F 3FRPG 5D7LA 1ZT1B 4TNVK 5IV2A 2CPCA 2FO4B 4L3ED 3VXSA 2YXFA 3HPLB 3TM6A 2X4PB 3EO1B 5BO1L 3Q6FB 3OMZA 3PL6C 3VFRA 2ESVA 1MNUH 5D7JA 1I9RH 1U8PB 2Z35A 4NZRL 4MNHA 4UILL 3W11C 1JZ6A 2GJ6A 3DRTA 5F7HA 1NCTA 3RA7L 2MHAB 4E42B 4RWYL 1IC7H 1JHTA 4PJ8D 4Y4HA 5IGXH 1F02I 1NCDL 5DC0A 3U82B 1HXMA 1YDPA 4LPXA 4MJ5B 3UTSE 3ULVD 3IFPB 1V3MA 3VFGL 2XZAH 4CVZA 5C0CA 2J6EA 2VDKH 1ZKAA 1XZ0A 2AQ3A 1FVDA 3UJJH 3GDBA 4NQUA 4WEBL 5T1DH 4PGZA 3S36L 3RWJA 2MOVA 3H7BB 3WDIA 2IPUK 3QNXA 3UTTB 5K9KB 4OCRH 4QY8A 1Z9MA 4Y19A 2JK5B 1BAFL 3NA9H 4XMLL 3HG1D 4L5FL 5IF0B 1NCCH 1XF5A 2PCPA 4OT1L 2JB5L 1KTDB 3O2DH 1WFTA 4OLVL 4XNXH 3HNVH 4GW5A 4K3JL 5DUML 2QTEA 1IC4L 3DYOA 1ZVHA 3WIIH 2BY3A 4F2MB 3NACH 4XRCA 5GRVL 1AY1H 1ND0A 5D2NC 4ZAKB 3MLWH 5BV7C 5CEXB 4NKMA 2DQUH 1IKNC 4LSSL 4PJ8C 5JXEA 1BQLL 2CUHA 3JWDH 3G6JE 3WV0A 5HTSA 5HDBF 4WW2C 4MMZC 1GYAA 2XN9D 3IDGA 2YPLB 5C0IB 1C1EH 3O6LL 2IQ9L 1ZS8B 4Q9QL 1U9KA 4ODVH 3ARWA 4IRJC 2AI0L 3L3GA 1DSFL 1NKOA 4KK5C 1DBBL 1CFQB 3FKUS 3I75A 4OCMC 3V4VL 2MQ0A 5I1DA 4MD4B 1GZQB 1C8PA 4NBZB 3NTCL 3VXRA 4NO3B 1F6FB 1T22B 2XPGA 2W91A 4YIQB 4M6MH 3ZL4H 4NWUL 2C4FU 5C0FA 3MRFB 1J8HB 3STZB 3BPNC 2EO9A 2FR4B 2ZCLH 5DZLA 4U6HA 1IT9L 3S37X 3TVMB 3GSRA 1MRCL 1R3LA 4H1LB 3HZMA 2L0DA 3VFSB 2BDNL 4JFDE 1SY6A 2IAMB 3NIDE 4HKZB 3D2UB 4M1GL 3KPSE 2I5YL 5IB2B 1VACB 2R9HC 3ORJA 2HN7B 1F11B 1WEJH 5DK2B 1T1WB 4CVXA 4JRYE 3X3FH 1NFKA 3BPOC 5FYKH 2RIKA 4PRPB 1G6RH 2R2BA 3KNBA 4LSUH 5LQBH 1K8DA 4MQ7B 2E7HA 1T0PB 4OLWL 2YMXH 5I0ZA 4YDJA 1IEAA 1I1CA 3QA3B 3MX0A 3V0WH 4AJ0A 4PRHA 4QHMA 3DX7A 4J3WA 2SEBB 1CQKA 8CGTA 3P0VL 3E8UL 4KQ3H 1CWVA 4ELME 5IMMA 1N0XL 3LSOB 4HS3B 3MA7A 4N0UA 2O5XL 1KLGA 1PLGL 5EZOL 2YSSA 1NGPL 2QHLA 3FB5B 2IADB 5FECA 1W72A 2CKBA 3KJ4C 4H8WL 5GRJH 2X2YA 5E2VL 5EO0B 1RJYA 2JF1A 2DF3A 4I2XA 4U6YB 3AB0C 5FCUH 1CFSA 4LLVB 4J3XA 4POZC 1P7KB 4GG6A 1I9EA 1G7QA 1RQ5A 5A2IH 1G84A 5I8CB 2FEDC 4LMQE 4FTVA 3B2VL 4IRSB 1AIFB 5J9PB 2CR6A 4I0PB 2YD1A 3GMOA 3SE4C 1DR9A 3C08L 3RUGF 3OWEA 1R3JB 3ARBD 2Q7YA 3DSNA 5CSBA 1VCAA 5F7WC 1MI5B 3T4AB 5JIHA 2EKSA 4HKXA 2VKWA 3STLA 3T8XA 1NMCB 3KYOA 4KROD 5E8EA 1N0LA 2CRMA 4G9FB 4N0YL 5CKAA 3RKPA 1PEZA 1L6ZA 3ZDXF 1YQVL 2B4CC 1IJ9A 3PQYB 2Q76B 4HJ0D 3T0ED 3BDYH 5I74C 4BZ1L 5E03A 3T0XA 4LBEA 5CZKA 1JHLL 4JFPA 4P2QD 1IZKA 3WCYA 4JG1H 2BNQE 2I60L 2VDNL 3BEVA 4MS8D 2IBGA 4Y4FC 1AGCB 4OCNC 5IVZA 1BD2D 3H9SA 3B6SA 3VFNA 3GNML 4D8PA 1EXUA 1CXHA 1QFHA 1DBAH 2D7PA 5EORH 3RX8A 3SKNB 5D9SB 1WF5A 1QFWH 3O4OC 4OIIL 5BOZG 2Z8RA 3H7LA 3HZVA 3NIGE 2GW5A 3PGDA 5GS0D 5I30H 5T5NF 1UQSB 2X7LB 4OF0A 4JM2B 4JDVA 4TSAH 1N5AA 3P4NA 3T0EC 4N1EA 4I0KA 2AEIT 2CLRB 3IXTB 1TTGA 3LAFA 3CJJA 4J3SA 5E6IA 3EYOA 4GAGH 2CDEB 4WU7B 2AJVL 1VA9A 3SPVB 1QSEE 4MS8C 5TFSH 3DVGA 3I84A 1QKZL 4JFZH 1TVBB 2CQVA 2JB6B 4G3YH 3QXUA 3DV4A 5C0AD 3ARGC 5KVGL 1F3DJ 5EC2A 1VSCA 5CEYB 4K9EL 4U1IA 5IFJA 5SX4I 4LLMB 1OTTD 5DJZB 1KN4H 3IXAA 4O51A 4Z7OF 1XR8A 3O2WL 4V2BA 3BKYH 2EDRA 2W0LA 3SDXE 1AD9A 4M7ZC 3ZKMD 1HHGA 1I3RB 3MOBL 3ULUC 1FORL 4OZFB 3P0YL 2NXYD 1NCBL 4ACPA 4FQXB 5IROC 3S96B 4X4YB 4P5KB 1OAQL 1IAKA 2GIYA 3FT3B 1S9KC 2R0WH 5DT1L 1INDL 4PJCE 4YGVA 3PG2A 1TZIA 3RFZC 4P2OA 3RIAK 5EBMA 4J4PD 5FDWA 4JFYB 5KSBA 2ERJC 1YEIH 4JLRB 1EEZA 2EIEA 3N1PC 2D0FA 1PY4A 3UDWA 5L6YL 2K3TA 4DKFH 1RZ7L 1UXSA 4X8JA 5C07E 1FL5A 2K7QA 3KPMA 4QRSB 1IQWL 5CD5D 4LEXL 2DQTH 1OTTC 2FX7H 1X5JA 5BS0E 1G9MH 4HPYL 5C0JB 1KNOB 2GSGB 4XH2A 5SWSD 2Y36L 1S7RA 5HGDB 4EOWL 3FQRA 3TA3C 3MJ8B 2F54B 4GAJH 4X5WA 1OAKH 1WWAX 4UIKL 4RGOH 5T1MB 2NXYC 1MCQA 4PTTA 1OF2B 3D3VB 3D0VA 3DGGB 3DPBA 5LXGL 5DVKA 1A0QL 5EUOA 12E8H 1KJVB 4JANA 2W9EL 2JJSC 4H88H 2WQRA 3TZVD 3BGMA 1QEWA 4DKDC 4M1DH 1MWAB 1MUJB 1N2RB 4KI5C 4BH8A 4M7KH 1HE7A 5FA3B 1YMHA 1BEYH 2IG2L 1A6VL 1I8LC 4JO4L 4YR6B 1OSZB 4N9GB 3VG0H 4M1CD 4MXWH 1MREH 2FBOJ 4KJWC 3L7EB 4ZUSB 3F7VA 2I9LA 1P84J 2HG5A 4I48B 2CRZA 1A47A 4EQ3A 1RU9L 3EO0A 3C2SA 5IVNA 4G42B 2MQ3A 2FGZA 5E8DL 2QQNH 1YEEH 1U8OA 2WBJA 3BZEB 1DFBH 5DMIL 3FHAA 3QRGH 3ME0A 1EZVY 1IGTB 3FOMA 3WUWB 4YXHH 5AZEL 5JNYA 3PF2A 1YNTA 4OD1L 4E41A 2APBA 2DQDL 1DVFC 3WO3B 1ZTXH 3VXQB 1RK0B 4L9LC 3JWOL 1B88A 3OB8A 3QDJA 3QO0A 1EO5A 2P24B 1MCIA 3FT2B 1CL7L 5B39A 2VOTA 4QHNB 3CUPA 1Y0LA 3GRWL 1MCWM 3JZ7A 4LARL 1EEUA 3TIDA 3ZDZE 3KXFA 3AY4C 3LQAL 3VMNA 5J6HB 3RGHA 2YHGA 4ZNCD 3QNYB 3VGAC 1WBZB 3H9HB 3LKNB 5E9DB 2EYRA 5CINL 1UEYA 1ADQA 1R3KA 3W9DA 1AE6L 4O58L 1K6QL 4MNQE 4K7PX 1NKRA 3WKML 5D1ZA 5IJVB 2ATKB 1OP9A 4OZGE 4P46B 4FA8A 2DICA 2R0LH 5AZ2H 5D7SL 1S8DB 2FCBA 4PJ5D 1QFPA 4AZ8A 4DOHB 3DX8B 1CVSC 2EECA 2I07A 4GSDH 5C9JB 2X4SA 4Z0BH 5I8KL 4HH9A 4RX4D 1HQRB 5D96B 5DLMH 3RTQB 4TULH 1DDHB 4YEEA 3V7AE 2Q6WB 2UWEF 1FNEB 2FJHB 3OV6A 4JY5H 1KN2L 3ARDD 5H94A 3HNSH 4WI6A 5F72S 4PJBB 5IQ7H 4LLUB 2VYRE 3PWJB 1UC6A 1JZ8A 4G8GD 4WDIA 4EIGB 5F8QC 3GEWB 2YEZA 5I1KH 4XPBL 2HVJA 4X6CF 5MEND 1XEDA 4L4JA 3PHOB 3QCTL 2NX5D 4WFFD 2P49B 5F96H 4BK5A 1IQDA 3SEPA 2AXJA 3B5TA 4NQXA 5GGTL 5C0DA 1FIEA 1YN7B 4JQXA 4UV4L 5HGAA 3TESA 2FX9L 1TCRB 2VLRD 4Z7WF 4O00A 2VLJA 4I0CC 4WI8A 1YECL 3U79A 1QTYT 5HYJA 4KKAD 5IFAL 4RQQA 4S1RH 3TV3L 4B0MM 1G6RA 3VRLF 5TH2A 4M7LT 2BVTA 5AUMA 1RAMA 2XWBB 1JNLH 4QRQB 3LN9A 5ID0A 3EJZC 3ARDC 3K1DA 3QR2A 5C08B 4MJID 1JHKL 3OXSB 1JL8A 1UCBH 3LB6D 3GI9H 1BOYA 5I73B 2COQA 1YEGL 3FRUA 4L4VD 4WENB 4DKEH 1ZHNB 3ABZA 2X1WL 2YPVL 2ZG2A 1GPOL 4KRPC 3TNNB 3DOSA 5E1HB 2A2QT 1U36A 1JK8A 4PJDB 4HFWA 4U05A 3RGVA 4I3RH 1CICA 1I7UB 2F19H 4KVCL 3W0WB 5C0GB 3KYAA 3BPCB 2VDRL 1DEEA 4JKPH 4OTXL 4WI2A 5CCKH 2QL1A 2HT4D 3I50L 3OJDB 3S5LB 3FT4A 4FQCH 2X1XR 5DD6B 4KUZH 5AYUH 4JZNA 3WNOA 4P2RD 2DBLL 3WS3B 3TBTA 2VITB 4YDKL 3UO1H 5DGQA 1FJ1A 3C5ZC 5KAQG 1I1AD 5FK9B 1T2JA 2NY6C 1KFAH 5DFTA 2LV4A 3FO2B 1B4JL 3KLAA 4HIEB 2VERN 5I8OH 4XPGL 2CDGA 2WUCH 4OCSH 1UVQA 3UP1A 1H3GA 4JKKA 4C56A 4ZDHB 3KHQA 1UJ3C 1JPFB 1CR9H 2ED8A 2EYTB 4J23A 4Z0XB 3MRJA 4Q9RH 3AM8A 3ZTNL 4FABH 3KG5A 1MWAH 1VERA 4Y5YC 3ARBB 5DZNA 5L8LB 3X3GL 4WI9A 3VXUD 4KPHL 3QI9D 1KGCD 4OGAD 2HT4C 1JRHI 4P3CL 4LCYB 3O8XD 3D18A 3WNKA 3LH2H 2BNRD 2AEWA 5MHSE 2GJZB 4YHPB 4EI5D 1UA6L 4M7JL 3SQOL 2R2EB 3MRCB 4PJFE 3T3MF 4MXQC 2LAAA 3B9AA 3CC5A 3VFOA 5MEOA 5J1AA 1Z3GH 4S1QH 1NBVH 1MCWW 4PJIF 1I1AC 1CE6A 4QOKE 4TYUA 4QRUB 4OLYH 3KYKL 3T3PF 1R5WA 2NY5H 4JFEA 5CWSA 5JW3L 1ZHKB 4LLYB 3HC3H 5L8JB 3MLZH 1QG3A 1GSMA 4Z7UB 3DHJA 3KYMB 5A2KH 4IJ3C 5JO5A 5EOQL 3QEUA 3ZSTA 3U2SA 4OLZL 1ZLUK 2XQBL 3TF7C 2YKLH 4XZUB 5F9JA 2XNAB 1H8NA 5BZWB 2ZOLB 4GOSA 2LE9A 2VH5L 1A9EB 2RFXB 2AQ1A 1J0KA 1DQQA 1NDMB 2C3VA 3QUYD 5F9DC 1WWCA 3VFPA 5BV7H 3V5HB 1XAUA 2LQRA 4LGRB 4S2SB 2AJ3B 1H3UA 3WO4B 4Y7MA 3ULVH 3VXSE 5I66B 3N1QC 4RBPK 2W65A 5FYJD 3OR6B 2A9MH 5CJXC 4R7NB 3V52L 1FVCA 4LF3B 3LN5B 3MRKB 3HZYA 1FNLA 3EOBB 3BIKA 4HK0B 4QHKI 1JZ4A 3SHSA 3VFWA 3OAYK 4HUXB 5DHYA 1T4KB 4P4KC 5K9OB 5F88B 5GS2D 5IB5A 5EBLB 5LVEA 1LO2H 2FHFA 2CIKA 4PGDA 1T80A 2OJZL 2E7LC 3V5DB 5DQDH 4PBWD 1CFTA 4GXVL 2R29H 1KCSL 1NLBL 1U8QB 1VFMA 4HZLA 3TGXA 3P73B 4GRLB 1GZPA 1OSPL 3KPNB 1FZMA 1KPVB 3LMJH 4M6NH 3UTPE 1T0MA 3IKKA 4B53A 1KG0A 5BVPL 4RNRB 2CMRH 5DRWB 3S4SG 4EXKA 3RWDB 3KPQA 4MA8L 1S3KH 1O7SA 1WIUA 3QWOA 5A16B 4YJZL 3Q1SH 3IDYB 2DQCH 3WHXB 2DLFL 1HSBB 1KB5B 4XAKD 3SGDI 2P8PA 4FQHB 1ED3A 1A02N 4LVHB 5ITBH 1Q9LA 2ITDA 1O7VA 5D1XD 4RMQA 2DQJL 2PXYD 1F4HA 2DTML 1K9TA 1IM9A 2XKSA 3IF1B 3D9AL 5DMKA 5B4MD 1JNHA 2H1PL 4JAMA 4KJQD 2GT9B 2X1OA 3BO8A 5JOFA 5DEGB 4UIMA 3M45A 5A3ID 3DUSB 4Q6YA 1CF8L 2VDOL 1XCQB 3FO9B 4RSVA 4QTIL 1BVKA 1KB5L 4GMSL 3KPRB 4KZEL 1AKJB 1VEOA 4DAGL 5DJXA 1D6EA 5BRZD 5AD0A 4QRRD 4L8SA 1JJUA 4KVNL 3VXMD 1QFUH 2Z4QB 1KBGL 1U8MB 5EOCH 2H9GA 2H2SD 4APQD 3BGFB 1UB5B 3ZT5A 3CXHJ 2HFTA 1OLLA 2NY4D 5HGHB 1JFQH 1LO0L 3QDMB 5FV2A 5T33L 1F3JA 1P69B 4W70A 4PJXF 1BLNB 1PG7X 1CD1B 1DUZB 1FG2B 3RHWF 3TZVB 2B2XL 4YXLL 3GBML 1VFOA 4XCNB 1P4LA 4MNGB 2HWZL 4H8WC 1CU4L 3LRHA 3MJ7A 3SKJH 3PWUB 3AXLA 3RL2A 2MJWA 5BZDB 1OOAA 5DURB 2B7DT 1YMMA 3OJMB 2M26A 3U9PL 1QLRB 4PG2A 3WUZA 3IJYB 5D2LB 5CJ8A 4ZUTB 3QFJE 3MPCA 4NQEE 4UU9B 1QSFA 4DKAA 5A3IC 4Z7QE 1TCMA 3RVUC 9CGTA 3EJJX 2XTJB 3X13A 4F9PC 2FLRT 3IYLW 1CLZL 2B4CH 5C09D 4Z7NE 5DTFA 4RDQG 1QLEH 1DBML 2H2SC 3QHTC 4APQC 3BKCL 3AAZB 4U1HA 5KSAD 1TQCB 2NY4C 2VMFA 3UZVB 2OJEA 5MEQA 4LCUB 1F4WH 4K3DH 1IBGL 4PGEB 1IKFL 1RUML 1ACYL 5ISZB 2JE8A 1HINL 1UM4H 1ETZA 1VPOL 2ZUUA 1MCLA 1FH5L 4S1SH 1A7RH 4PRIB 1A1NB 2X4OB 5KW9H 4EIZC 1MHPL 2ZPKH 1WC7B 5HI4D 1NSNH 2EDNA 2VN7A 4QKXB 5DHVB 2WLZA 3G5ZB 5T1LD 2P8MB 1UGNA 3RNKA 3SJVD 2YC1B 2YD3A 4GG8A 3MA9L 4NJ9L 3ZKXC 3F58L 2Z9TA 3OR7B 1MVUA 3EKCA 3GSUB 3HN3A 4K2UH 4ETQB 5JTWA 1MIML 5D5MF 4TOYL 1UB6B 5E8NB 1EUTA 4U6TA 4WWKC 5EUKB 2YD8A 4H20L 3MODH 4ZUWA 1TLKA 1W0YT 3IJSA 4HJJL 4JFHD 4LLWA 5TE6H 1CVRA 2CO7B 1FIGL 3ESVF 5MEPB 4S0SD 1BBJB 2QADD 5E94B 2D7OA 2OR7A 4NNYB 1OGAE 2CKNA 4R26H 2Q86A 3ES6B 3PWPD 3X11B 3HRZB 4WUUD 1G7MA 3X14A 1NMAH 4URTB 5HHMD 3ZYJA 1LK2A 4C59B 2DQFA 2KZ1B 3MLVL 2W07A 4O5LH 2AJSH 3B43A 4DZBA 3UCRA 1VFBB 3N50A 3V8CA 2OXGA 4HUWB 4UTBH 5BVJA 2NNAA 2X1PA 2VRAA 4JZJA 1VDGA 1HSAB 4MAUH 5GS0H 2Z31B 1H3VA 3KGRA 4K9EC 1T1XB 3H9SE 3LDBB 3QDGA 1JGEA 4G8GB 1F13A 5SWQB 2GI7A 3HC0A 1QOKA 4JGJA 4UMGA 4PG9B 1NEZG 4JRWA 3SDAB 4D0DB 5MENB 2Y07L 3D69B 5F6IC 4XVUC 4HSQA 5E5RB 4HGWA 4QGTA 4M62L 2AJZA 5KSUB 1K8IA 3IJHA 1AQDA 1K3ZA 1OCWL 5I1LB 2P44B 1IAII 2BSTB 4ODTL 4HFUH 4NOFA 2IANB 1I9IH 1T03H 1T3FA 2G2RB 1LO5A 2Y25A 4RCAA 1I3UA 3SO3B 1CG9B 3ILPA 4RIRB 4P48A 4GKSA 4JM4H 2XOTA 1MSPA 5D7KE 5ESQA 4U6XB 3L5WB 5AWNL 4Z6AT 1AGEB 4UNUA 1RPQA 3PHQB 4RAVB 3HNTL 4LSTH 3C6LD 4LCCA 3VDAA 2X40A 3MACH 4PRDB 2R1WA 4B7IA 4PJAF 2VUYA 3GHBH 3D85B 4N0CC 5GRUL 2VWEC 3A0OA 1S7WB 3VCLB 2DDQL 1NC4D 2NY0D 4WY7L 1PFCA 1V5JA 3ZTJH 1EBAA 3QULB 3G5XB 4C4KT 5ILTH 1EFQA 2J5LB 4UAOC 5DO2C 3RBSA 4UQ2A 3N9GL 2HKHH 3PP4L 1C08A 1CS6A 2XIDA 1JGUL 2BY0A 3CMOH 3MLUH 3OL2A 4GUPB 2R69L 1PG7W 2UZYB 2HRPL 4ZUUB 4YHOH 3FHQA 1ZHBA 4NKOA 3O4LE 1EFXA 3QIUD 4KY1H 1KJ3L 3U0PA 3PL6A 3QNZA 3QEGL 3OGCB 5GSRB 3WXWL 5I1HL 1MF2L 1UH2A 2YUWA 3VWKB 2BFVH 4BH7A 5FUOL 3O9WB 5I2IB 1CFBA 1U6AL 3GGWA 3U7YH 4FFVC 5FOJA 4BM7A 3DI2B 3H42H 4PJ7E 5I8EA 1ZGLM 1XGYL 5KS9A 3C8DA 4XNQB 1NJ9B 5L2KE 1QVOB 3EZJB 5C0ND 3IDIB 3MLYL 5I19H 2FYYB 1XR9B 1R24B 2YOCA 4GH7B 3FFDB 2O5ZL 2V17L 3SDDD 2Q1EA 1SJHB 3EYVB 3TO4B 1X5LA 4UQ3B 3QI9B 3MBXL 1FZJB 4TUJB 1T7VA 2FJGB 4XP9H 1AO7E 1H0DA 3F5WA 4P5TA 3RU8H 4QRTB 3O8XB 3FQUB 3JWOC 3OB0H 5FO9A 2BNRB 4K3EL 3Q2CA 4EI5B 4YK4B 3BIBX 2YN3A 4NNXA 3EOTL 3PV6B 3ZE1E 1A14L 3LHPL 1GAFH 2FGWH 2JCCA 1ORSB 4R4ND 4N68A 5L9DH 3CIQA 1EO8H 4KXZH 4K7FB 2FL5B 1MIEL 2BCKA 4UDTB 5D2NA 1HH9B 5IKCB 4CRPA 3QXDB 3LQAC 1IKNA 4EZMA 4PJ8A 4Q74A 4NHUA 3L5JA 2F8VA 2FX8L 5IW1B 1JF1B 2CLVB 4IMLA 3G6AA 5D7IE 5DC4B 1F6AA 3G9AB 3QUXD 5C0BE 1ORQB 2DQHH 5CS7A 3DBXB 4IRJA 3Q6GH 4HX1B 2A6JA 2LFGA 3P3YA 2AXFA 4W6WB 5FHBL 3SDDC 2IMMA 2QSCH 2Y5TA 3HE6B 2H3NA 4GKZB 3QUYB 4QYOB 4I77H 2KQNA 3PGCB 3VFVA 4AQ1B 1RZIB 1Q8MA 5HY9A 1CDJA 1NANH 3O3BA 3HG1A 1OD9A 5A2FA 3MV7E 4OZHA 1JNJA 4NJAH 5GZOD 5C0EA 4C83B 1NFDA 1A9BB 1WZ1H 4YXKH 5JOEA 2VISB 2AABL 3OXRA 5GGUB 3V6FB 1B9ZA 4R4NC 4WI3A 2F53D 4CN1A 1FO0H 4KMQA 3EFFB 3SKOA 3ZHLA 1C5DB 5DJYA 4Y1AE 5F89A 4Z78B 3H2WA 2D7TH 4QHUB 4NDMB 4HKJB 4L4TD 2XN9A 3L5XL 5FKPB 4ZNEE 3QUZD 2XQYK 3R06B 1NLDH 5D96C 4ODXA 3C60C 3RTQC 4TUKH 2J8UB 1XGTB 5MP6L 1K3IA 1EEYA 2VDML 4X80L 1DQMH 3GHEH 4LHUD 5EO9B 4XWGH 3NGBC 4HUUA 3QEQD 4MDJB 2ARJB 3T4YA 1QSZA 1H5BB 3W39A 4YHLH 4S0TD 1BJ1J 4H5SA 1H9VA 5LKNA 1D5XA 1RHHA 4I9WD 4R7DA 1JUFA 1CN4A 2YZ1A 1Z6JT 4HWZB 3BKJH 1RULH 1YEDA 4LU5H 5D1XB 3WIFA 1KLUB 3NPSB 2PXYB 1ZANH 1TVHA 1VFAB 2VDPH 2ZG3A 3M07A 3O0RH 3PWVB 4MQSB 4Y16C 1K85A 2Q8BL 1LO4H 1BIIA 4UTAH 3MXVL 1C5CL 3A6OA 4CN4A 3BVNB 3LS5H 1H3PH 1S7XB 3R0MA 4YQXH 1Q0YH 4OI7A 1DJSA 3HPJB 2HFEA 3QG7L 4LNRA 4LGPB 1DBKL 2GY5A 5GXBB 1YUHB 3RWFB 4GRWE 5KZCD 4AIOA 3UPCA 1HXYB 5DVLA 1HNFA 2BMKB 3HMXH 4QRRB 5J0BA 5DJ8A 3U46B 3SE4A 1JPTH 3BOVA 5I73C 1RMFH 3OPZH 5SWZB 5FOBB 3BD5A 2BNUB 3OJ2C 5H35A 5CBEA 4ZOAA 3TH4T 1HI6A 4NO2B 4G80B 2X1QA 4NZTL 3HUJE 4U4BA 5FYKE 1YJDC 3DMMB 2X10A 2NYYC 1T1ZA 3ARVA 1FFPB 1RHFA 2NY1C 3V7AG 4KMTL 5F9OL 1DANU 3TCLA 4RGNE 1KIQB 4QXUL 3QEHA 3QPQD 2E27L 2BY1A 3GMMB 3DUHA 4EN3D 3JV5A 3RY5A 4PJEF 3MRIA 1NBZA 5T1KA 5HHOB 2ZCKL 3GMQB 5IMLA 5BO1H 3HHRB 1CT8A 1R3HB 3NMEA 3RL1A 4F3FA 1I1FA 1FZKA 2VDLL 4P23D 3EUUA 4ZPTA 4F8QA 2ZCHL 1U93A 1D5MA 3BDXA 4JQIL 1CXLA 4G8EA 2CUMA 1NCDH 4LHQB 1HQ4A 3O45A 5IVXE 2WWMC 3VFGH 3U30B 3FQXB 3MO1B 3GMRA 2J3SA 2R15A 3B5GA 4OFYA 5D93C 1AR2A 4WIQA 3P4MB 1KEMH 4ORGA 4CL7A 2WP3O 2W0FA 3LIZL 4OCYL 4WJ5A 4HCRL 4XP4H 4WEBH 4M9OA 4Y4KD 3S36H 2W0KA 1XGQB 3LQZA 4NCDA 2ORBL 3GSWB 4OQTL 4BELD 3WFCL 4A6YB 3PXJA 1CI5A 3T0EA 3L3OB 4G9DA 5IB1B 1BAFH 2IQAA 4QRPD 3QPQC 3S4SB 3P4OA 4HMDA 4OT1H 3SJVB 2YUXA 3BUYA 3BT2L 4P2QA 3P40A 1RZGB 1HILB 5ESAB 1XF1A 3B9KD 1IC4H 5DFWH 2LU4A 4U3XA 3TBYA 3BQUD 3DVNA 1BBDL 3SGJA 1XF2A 1BD2A 3K80A 2V7NA 5HHXH 3VD7A 4R0LB 3ARGA 2OLDA 3EDFA 1N26A 4F7PA 2IH3B 3SQBA 5T5FH 5EDXA 4F7TB 1JPGB 4HF5H 2QADB 2IQ9H 3DIFA 4Q9QH 1C16A 3CDCA 4YDVB 1KJ2B 5CP7A 1DBBH 4NRXB 4WUUB 3L3JA 3ZYIA 3MMEA 4Y4KC 1XGUB 3CX5J 5IROA 5HHMB 3IDMB 2QJDA 5CEZE 3NTCH 2OCFD 4L29A 4WGVB 2O61A 1G0DA 2AJYL 5FHAL 3AROA 2FBJL 3G5YA 2B8OT 2OZ4A 3D0LB 4U0QB 3WNPA 1TPXB 4OB5L 5TE4L 1N7ML 5IUSA 1IT9H 5LGHL 4PD4K 4IOIA 3VWJB 1A4KA 3ZZ1A 4F7CB 1NCWL 2B20A 4U2ZA 5DJAA 5C0AA 5FYJH 3ARED 1HH6B 1JRHL 1TNNA 1IC5H 4M1GH 3LEXB 2I5YH 1CDUA 3BKMH 5EC1B 2IFGA 3UTTE 4QTHA 3HS0B 4P57A 4MDIA 3NPZB 1Y6NR 3SDCD 3JUZA 1XF4B 5GS2H 2KZWA 3TA3A 3MBED 1XIWD 4ZFGL 5JIKA 1I8IA 1Z5LB 1N3NA 4P59H 1N5YL 3BZFA 3CD4A 8FABB 3MXWL 4F7EB 5JW4Q 4WW1A 4DCQA 1QR1B 3MZGB 5HGBB 5LCVH 3ZYZA 2HAZA 2JJSA 4OLWH 3H0TB 5ALBL 5CBAB 1QLFA 2QSTA 1OD7A 4OF5A 4QNPE 4OLXL 5EZLA 2VIRA 1NBYA 4N8VG 3GJEB 1I8LA 1N64L 5C8JA 3G6JF 2Z8SA 1U8JB 2YPLE 4PJ9D 4NUJB 3E8UH 5CSGA 4X6DA 4JB9H 4MQXD 2EXWD 3CU7A 1TIUA 3ULSA 1MHHB 3AREC 1BWWA 4JVUA 5IHLB 5EZOH 4YHKH 3TPUB 5ALCL 2XZCL 5H2BB 3U7WL 1EBPA 3EYQD 4R2GD 1T7XA 5HDQL 2VC2L 5E56A 2IGFL 5SWSA 5E2VH 3MUGB 1KXQE 5HVFB 1J8HE 1XIWC 43CAB 1P1ZA 4HWEH 4GBXB 3I6GA 3C09C 5DUBB 3GIVB 3HC4H 2HRLA 3JXAA 4JPKH 2CJUL 2RB8A 3RKDD 3B2VH 4KRNA 5EU6A 5C2BL 1L7TL 2VXVL 3C08H 3FJTA 1AP2A 2WNGA 3QIUB 4L9LA 2WM0A 4OBSA 4MHHI 1FPTL 3QWRD 3S37L 1C7SA 2BVOA 3NIDF 1MFBL 1FN4B 2OTUA 3WN5B 2BVPA 4PUBH 4N0YH 4XC1L 4JKMA 4MQXC 3CFJB 3MRPB 5LGJA 3WNLA 2FZ3A 4DK6A 3AY4A 5EN2A 2EC9T 4PRPE 1UKSA 3U4EB 1WCBA 4BZ1H 4B7LA 2IPKB 1JHLH 3CU1A 3GIZH 3VXNA 1BVLA 2X4TA 1Q1JL 4AH2A 4JFOA 1TQBC 1RI8A 5E7BA 2OM5A 4ENED 3QH3A 3GSVA 4HIIA 4YNYA 1NEZB 2ADFL 2PW2A 3DXAB 3GNMH 2WIIB 3B2UD 3TO2A 1RZ8B 2X4QB 3QFDB 5CZXC 4ZO7A 4ELMF 4XPHL 4PV9B 1MJJB 3GSOA 4OIIH 1FBIL 1NGZB 2X4NA 5D8JL 2AEQL 3RVWC 5I18H 2G9HA 1V3KA 5HBBA 5I15L 3EOAA 5HHPA 1RVFL 3EFDL 2ICWB 3QUXB 3OHXA 3TN0B 4JR9H 1V3JA 5ITFB 2DN7A 1NGXA 2PNDA 1X6NA 2CRIA 1FO0A 2EYSB 4X6EB 1T1YA 5TDOB 5DRZB 1Y18B 4A6YH 2AJVH 1IGCL 3RIFK 1LDSA 3G9VA 4J3VA 2OYPA 1PY9A 5J06A 4BUGA 5ICZB 3RVXD 4P9HL 5KVGH 4N90D 4PJ5A 4K9EH 2ITCA 3PQYE 4DTGL 1E4JA 3DVFA 4OF8A 4TSCL 2NQCA 4FZEH 3O2WH 4RX4A 3FQTB 2A83A 3D39B 2CSPA 4NQDA 4U7SA 5C6TL 2QHRL 4WFED 5D7JD 1QO3B 3ARDA 1NCBH 3OAUH 1AHWB 1EAJA 3P11L 3QUZB 1OAQH 4AEIL 1VKXA 1KOAA 1JZ2A 1INDH 2YBRA 3MR9B 4Y4HD 1ZA6A 3U36B 4A2MA 1P2CA 4BKLA 1NC2B 3LEVL 1U91B 3OKLB 1KJMB 2Z93B 2NX5A 5F7YC 4LSPL 5TE7H 2BC4A 4PRAA 4RGMC 1BX2A 1RZ7H 3MFFA 1Q9KB 3T0DA 3HMWL 4MHHG 5HHVL 3C9NB 4U1JA 3RWGA 4NRZB 3MRRB 4LEXH 3QCUL 1VADB 4HPYH 2CLZB 4NP4L 4O9HL 2LU3A 3O3AB 4JPIA 2OTPA 5ACZA 4YHML 2EDLA 3GI8H 4U1LA 1NAMB 1J0IA 2Q87A 3P77B 5E2TL 2HVKB 2ADGA 2DOCA 2XFXB 4YFLF 5D72L 1Q9WB 3SE9H 3C5ZA 5DS8A 3VXPB 2AV1B 4MJIA 1DLHB 4JFFD 2V7HA 4GW4B 1A0QH 5FV1L 3DROA 1ZLWH 1NGYA 2W9EH 4HIJB 1EERB 3GSNL 4L4VA 3K2MC 4Q2ZA 4KJPC 1D9KD 4JY6A 1BGXL 5K93A 1I7RA 2B1HL 1A6VH 1MRDH 4JO4H 4OF3A 4PGBA 3L3KA 1FV1A 2ID5A 2VE6A 1RFDH 2IFFL 4U1KB 4ZUVB 3I6KB 1LD9A 3SDXF 1P6AB 2A6KB 7FABH 2Q3AA 4XCFL 3WFEL 3RWHB 1MHCB 3NIFE 3TBVB 5E8DH 2UUDH 3RX5A 3S8WA 4MB5A 2PYED 3GKWL 4GS7B 5DMIH 5DK0A 2FSEA 3UJTL 4DJMA 1ZGLP 3K7UA 3GSXB 3SY0A 1XGPB 4PRBA 4XNYL 3U4BL 2OL3H 4PJCF 2QR0B 1I1AA 4EN3B 1FYTB 5IIEA 3FB8A 5AZEH 4IS6B 4X4XA 4OD1H 4ODBD 2DQDH 4MVBD 3BIAX 3TNMA 4LCWB 1L0XA 1MVFA 1KENH 1CD8A 3DNKA 5IR1A 4JHAH 4ZXBD 1TTFA 5F7LB 4NBYB 3V4UL 3C5SB 1D9KC 3EO1A 1E4XH 2Y23A 1S7VA 4KFZC 2BOBA 3MRGA 1A1OA 4QCIB 2GTZA 5ANMA 1HKLH 1YNKH 5GQBA 4B41A 1IAIL 1DE4B 4J8RA 3L3HA 3VWKC 4N5EC 1HCVA 4AQOA 1KCUL 4EDWH 2IPTL 3QUMB 2F54E 3VXUA 4MAYD 2VLKB 5F3BA 3GJFK 1QBBA 3RPIA 3BPLC 3D3VE 2MPAL 2VZ1A 4HIHB 1XCTB 4IHOA 1DQJA 4MLIA 5CINH 3VH8A 3R8QA 1AE6H 3MYJB 1PX4A 5CJXA 4O58H 4HW6A 4OZIB 2FEEI 2B39A 3WKMH 4L8CB 3G08B 2E9WA 4DZ8A 1N8ZA 5FF6B 3S7GA 3QCVL 4ZOBA 5CSZA 4P4KA 5DDHA 4YK4C 4YX2L 1QFOA 5D7SH 3CFBA 1FNGA 4OM1H 5I1GL 1E4WL 2PTVA 3DX9A 2E7LA 3BQUB 2AXGB 4MSWA 4PBVC 1A2YB 1D5BB 5GGRY 3VXTB 5I8KH 3K4ZA 5GIRB 1GC1L 4HD9A 1JGDB 1WFNA 2QKIA 5BMFL 3HAEH 4ZOCA 1Q0XL 1OTSC 3RDTB 1KN2H 3VGFA 4NQSA 1P7QD 4FTVD 5IHZB 5TQ0L 1Y6KR 5ICXB 2EDBA 3UYPA 4U6VL 1BZ9A 2Z92A 1RUQL 5JHDB 3MNZB 2ZSVA 3EDEA 4L3EE 2GK2A 3BMVA 4XPBH 4DGIH 1MCEA 1QBLH 2HT2D 4FXGA 5KSVA 5JMOC 1INQB 3QCTH 3EYFB 2XRAL 4MD4A 3CK0H 3HZKB 3TBWA 4XCYA 1J5OH 5DUPH 3MRFA 5C92A 1EHXA 4X6BB 2JJVA 3ULVE 3UXFA 2OQJA 2HH0L 1A6UL 4PREA 5GISH 3QG6A 3W81A 5CHNA 1YECH 5IFAH 1IAMA 4BYHA 3ZDZF 3UEZA 5E9DE 3D5OF 4OAWA 3K4AA 4QO1A 2OR9L 5IFHL 1J9CT 1QYGH 1M7IA 2P42B 2C1PA 5CAYB 4M8QB 1KYOK 3GUTA 3HG1E 4H26A 3SDCB 2ZUQC 1IM3A 1K5NA 4U3CA 2VLLB 1ONQA 3HI1A 3QJHB 3SGEH 4XWOD 5DK2A 2YPVH 1PGRB 1QRKA 1R0AL 2HT2C 2A6DA 3PNWA 4K7PL 1FNSH 4KHTL 5JW5A 4TUOA 4PR5B 1UM6H 3GM0A 1M05A 4RMVA 3VFUB 4Z7VB 1IFHH 1OY3B 1ZHLA 3WDHA 4OKDA 2FECL 3ECBA 2VDRH 3MRNB 35C8L 1G7LA 1CZ8L 4OTXH 1AGDB 4OZ4A 3I50H 1FL3B 3RUGA 2XN9E 3ARRA 4UOJA 5EZJA 1SYSA 4PJ9B 1QQDA 1BFVH 3T2PA 4HS8L 4RMRA 1CXFA 1KCKA 4QT5B 4PJGF 4P5MA 3JVGC 4WO4C 1DN0B 2O26U 3PABB 4YDKH 2VAAB 4JHWL 2P1YA 1C12A 3ZDYE 1II4E 1N4XL 3C6SA 3MV8A 5BRZA 2PW1B 1B4JH 1NAMH 1FSKB 3JV4B 3VXMA 5HHQB 3MV9D 5J11B 4XPGH 4LSRL 2MCG1 3VU2A 3CAFA 4FMKA 5IK3B 2PYFA 4FQQA 1XMWA 4APQA 1F4YH 4I18C 1NEUA 4FQLL 4NZUL 2CIIB 4PP2A 4NSKB 3PDOB 3GJFA 1RIVH 1JGVH 2E6QA 5GGVL 4M02A 3ZTNH 1AXTH 5DJCB 2AEPL 2KBGA 1NFIA 2NXZB 4KPHH 4G7VL 5HYQA 4KHXL 1SMOA 1Z0NA 3OZ9L 1YPZB 4P3CH 4HLZH 5F44A 4IRZL 1MY7A 1DBJH 2IBZX 4G6KL 2HMID 4YHZL 4M7JH 4OLEA 4JCMA 1KIRA 4WHDA 3F7RA 1BZQK 5TQ2L 3ZKNC 5IW6A 4XPFL 1IEBA 5ETUA 5GJSH 4I5BB 1MRFL 4PJDE 3T1FB 1PQZB 4K94L 4FHBD 3W0WE 5C09A 43C9B 5C7XL 5TDNB 4J7RA 3NZ8B 2QQQA 1Z9SA 3KYKH 4WWKA 4NYLB 1QA9A 3LPGA 5KSAA 4I3GA 2FWOB 4Z8FL 4L8BB 4ZODA 1KIPA 2OTWA 1CLOL 2OBGA 4R4FL 4LLQB 4H0GA 2J8OA 3RWCB 3CFKA 1JTOA 3BE1L 5DF0A 4YE4L 3FOLB 1EAPB 2IWGA 3UTSD 2VH5H 4ISVA 4YLQT 3SKNA 5I9QB 5EU3B 1CFVL 4PRNA 2AJUH 5EZIL 3CZFA 5T1LA 4POUB 1QFWI 2Q8AH 1HHHB 5DMYA 1WZLA 3E2HB 2QQKH 1I7TA 4HT1L 4ZFFB 3MGTB 4PJFB 5KVEL 1G9NL 1QUNA 3V6OC 5INCB 4PJHF 1P4BH 4H25B 4LVOB 3RP1A 1SM3H 3L9RB 4QOKB 3RRQA 2MFNA 3ZLQC 3WE6A 5B3JE 2GUOB 3QJFA 4H0HB 4OUUA 5B22A 4RWHA 2OXHA 3AS2A 4N8VB 2D7NA 1JZ5A 2Y9RT 2CGRH 1FE8L 4FQ1L 1LE9A 1WIOA 2OJZH 3NN8B 2HFFA 4BFIB 4ZO6A 1ZLVK 3JV0A 4GAYB 2VAJA 3TIEA 4GXVH 3EO9L 4R0LC 3PWPA 1KCSH 1NLBH 3KPPB 5GHWL 5CJBA 3W5NA 4UB0H 2HLAA 3CVHL 4AL8L 4PYHA 5D7LB 2DI7A 1RIHL 5TF1H 5BVPH 4GJTB 2GTWA 1G7PA 2X70A 3VXSB 5DQJA 4MA8H 2BP3A 2GCYA 2C3XA 3VFRB 2ESVB 5D7JB 3QDJD 1S9VA 2HKFL 2Z35B 2FDBP 4M93C 1MFCH 4F37K 4MNHB 4V1DA 2GJ6B 3DRTB 1WGOA 3FN9A 1CK0L 3FFCA 4Z7UE 1JHTB 3FT3A 4Y4HB 1CFNA 1QBML 4NN6B 1HXMB 1YDPB 3A67L 2DTMH 2Z8WC 4F9LA 4M6OL 1UZ6E 4RFOL 4CVZB 1E28A 5C0CB 3KXFD 2H1PH 4OGYH 1XZ0B 2VQUA 4IDLA 1ZLSH 1FVDB 1X44A 1RZKL 2A73A 3QQ3A 4JFDD 3CFEA 1CF8H 4HV8A 3RWJB 1WV7T 3KPSD 4TNWK 4QTIH 4YC2B 5ACMA 1E27A 3QNXB 2GITA 4QY8B 5T3XE 4MD5A 4Y19B 4KZEH 2XA8L 1XGRA 4DAGH 2DIBA 4OGXH 4XPTL 1XF5B 2PCPB 4FFZL 5JPMA 1NUFA 2VR4A 4KVNH 4GW5B 5HSFA 5C70A 4CN6A 4JRYD 2PO6D 4JREB 1I8MB 4MB4A 2XY1A 4ONFH 4XRCB 1LO0H 3M17A 5EOCJ 5T33H 5FM4A 3LOWA 3MRHA 4OLUL 1ND0B 2VR9A 1EIBA 2GQHA 4NKMB 2NW3A 1H8SA 4YXLH 2B2XH 1I1YA 3NFNA 3THMH 5I1CL 2HWZH 4F33A 1BFSA 5JPNA 1FFOA 3C6LA 3O6MH 3IDGB 5GZND 4AEHL 5TJWK 3L3GB 4YR6A 2OL3A 2ZJSL 5DXWA 4XAWL 1CDYA 3LD8C 2E8YA 1NC4A 1A6AA 1AC0A 5CFHA 3L95A 3I75B 5I1DB 3P9WB 1EJ6A 4M7LL 4EKXA 3EYSH 3VXRB 3MUHL 3MFGB 5DSCA 2XPGB 2OSLA 4AEFA 1CCZA 2DIAA 4WW2F 2A74A 5C0FB 3JTTA 3KVQA 4X9IA 3B3IA 1K4DA 1DBMH 4U6HB 5E08L 3MC0A 3GSRB 4AY0A 5E00A 1OAZH 1R3LB 3KWWA 4WHYH 4XBEL 1S5IH 3HZMB 1IKFH 3PIQA 3RX7A 1ACYH 4YDLB 5IWLC 4OF6A 2ADJA 3ARFD 1HINH 3NCYP 4ONGH 4K7PY 3TFKD 1VPOH 2MMXA 3H3PL 1MHPH 3VGBA 4KTYA 4DQOL 1Z9LA 4AG4L 2R4RL 4PLNC 4JDTH 5TGBA 3SDDA 4LAJH 4CVXB 3ARZA 2BJML 2Z0BA 5FYLE 1SEQH 4YAQA 4WGWB 4NJ9H 2R2BB 3KNBB 1K8DB 1FQ9C 3F58H 1VENA 3QDME 4HC1L 4XHJD 5J6HA 5C0RL 2UWEA 5KOMC 5F7KC 4O2EA 4WCYH 5E4EB 4UT6H 3WYRA 1LO3H 1IEAB 4YDJB 1JGLL 1LEKA 1A6ZA 2EZ0C 4RISL 4MNGE 4FQJH 2BNQD 2BOCA 4ZTPL 4H20H 4PRHB 4QHMB 3DX7B 4HJJH 3HTLX 3UAJC 3HAEA 2JIXD 4LHJB 1JWUA 4ZQKA 5IMMB 2HJKA 1MCSA 4X6CA 3BD4A 4BZ2H 3VW3L 5D2LE 1S7UB 3MA7B 4N0UB 1KLGB 1VB9A 5AEAA 3ARFC 2YSSB 3TFKC 5GGVY 3VXOA 4C58B 4IOFD 3KPTA 3QAZB 5FECB 4BQ9A 1W72B 1AJ7L 2P5WA 1DLFH 2X5PA 3DX8A 2XTJE 4XNMA 4Z7QF 1RJYB 3KDMA 4I2XB 5J3HD 3MLVH 1CFSB 4D94A 1EGJL 3PWNA 4Z7WA 1TJHL 4GG6B 3C60A 5IMKA 1M6OA 4DEPB 5GGTA 1G7QB 3GO1L 3HR5A 1LEGA 4CVUA 4CNIA 2KQMA 4JHZA 4Z7NF 1QHOA 4FTVB 3QHFL 4P9HC 3TN0C 1ZSDA 3GMOB 5E8PA 1DP0A 1G7JA 5EBWA 5ISZE 2Q7YB 2NY3B 4QWWD 2Y07H 2X89D 4B5EA 2QSVA 3BDBA 4PRIE 2EKSB 4HKXB 3STLB 3T8XB 3PGFL 5E8EB 3KYOB 5JZ7D 2F53A 3NH7L 3HE7B 3BAEL 1LE5A 1X4YA 1P7HL 3EDJA 4Y16A 5DD3L 2ZUWA 1OCWH 4DWHA 4MCZA 3BSZL 4LBEB 3ALXA 4NO0D 1YC8A 4L4TA 3OF6D 4U1SA 4M5ZL 3K3QA 5FUZL 4Z77B 3D25A 1IL1A 4JFPB 2VABA 4XCCH 1X7QA 3GB7A 2F8XC 3BEVB 4JFED 1GVIA 1T6WA 5IVZB 4LHUA 3H9SB 3B6SB 3VFNB 3HA0A 1R5VA 1AHWC 4D8PB 1EXUB 2BHUA 3QEQA 3IDJA 2Y1VA 4RZCA 1A3LH 5EBGA 4TTDD 4MMXC 5AWNH 4X7SL 4UBDC 3HNTH 1U2CA 1ZHNA 3CDGA 4QWWC 5J4MA 3BH9A 3NAAL 1FL6A 2FH8A 4K23L 1M7DA 3HZVB 3FB7A 3PGDB 5GRUH 3S6CA 4Z76A 4XP6L 5IQ9A 2DDQH 1I7UA 5C0GA 4WY7H 4JDVB 1HHJA 3P4NB 5DD0L 3VGGA 5C07D 5HYEA 3SDYL 5IM7A 1JWSA 2R1YB 1J1PL 4HAGA 4JGMA 3EYUH 5BS0D 3PP4H 1JGUH 3CVIL 4XT1C 3LS4L 4ZO8A 3A6CL 4G8GE 2HRPH 4UINL 3EYOB 5E6IB 4S11A 2DKSA 2I9TA 1JMXA 5FKAA 4LSQL 5MENE 1LILA 3DVGB 3MRLA 3QEGH 4WFFE 3WXWH 1U3HD 4F58H 3DV4B 4EJ1C 1U6AH 4LDOB 5EC2B 5IFJB 4U1IB 4TTDC 4PJIA 4X7EC 4ZDHA 1XGYH 3IXAB 2VLRE 5FDYA 4P3WA 4O51B 1XR8B 3VI4E 3MLYH 2IANE 5FGCE 1AD9B 5C9KA 4FFYL 1LP9E 1HHGB 2O5ZH 2A9NH 3WL9A 2V17H 4P2CG 3MJ9L 3EGSA 4J12A 3S97C 1NUDA 2APVA 7CGTA 2LVCA 3MBXH 3AMLA 3BP6A 1IAKB 1MLBA 4X7DC 5E2UL 3UYRL 4X0KA 1T04A 4K3EH 4TVSa 4YGVB 2B1AH 2YK1L 1TZIB 1IM9D 4P2OB 3LHPH 4GS7C 5EBMB 5FDWB 5KSBB 3JUYA 2FRGP 1EEZB 5SX5K 32C2A 4P23A 3A6BL 1MIEH 1BECA 2C1OA 1UXSB 3UTZA 1I3GL 4X8JB 1MEXL 4XPAL 1FL5B 3GMLA 3KPMB 3V4PL 4XVSL 2Y72A 4BSWA 4XH2B 1Q94A 4AM0A 4KKCD 1S7RB 3FQRB 4P2RE 1B2WL 1IRAY 3H9ZA 3OKEA 4AENA 4X5WB 2Y5EA 1JZ7A 1FAIL 4YDIH 4Y4KA 1AO7B 4QXWA 4PTTB 4OI8A 1A9EA 5IJKC 1JWMA 3D0VB 3S88L 3IRPX 3IU4L 5EUOB 3FTGA 4JANB 4QRPA 5FGRA 3QDAA 5TPWL 4X7FC 1QEWB 3QXAA 2EDKA 3PHSA 1OP5K 4BH8B 1GC1C 2AABH 3B9KA 1YMMD 1YMHB 4DVBA 3DJ9A 1G1YA 4PJ7F 3Q0HA 3U9UA 2ARJQ 4FQPA 1B90A 1T5XA 2V2WA 4NM8L 3S35X 1A5FL 5DVNA 3F7VB 1KB9K 2I9LB 1X3DA 4I8DA 5GJTL 1P5VA 4OM0L 4OZFG 3EO0B 5HJ3A 5D6DC 1UKTA 1VGKA 1IGFL 1T21A 1U8OB 2WBJB 2BNRE 2IMNA 2AV7B 5CUSL 1EV2E 2CKBH 2G60H 1JI2A 3DETD 5MP6H 3FOMB 2VDMH 4X80H 4CDGC 1YEJL 5JNYB 4FZ8L 4JFXA 3TT3L 3SE8L 3ZE1F 1OARL 1YNTB 4E41B 3D6GA 4B50A 3JV6A 2NLJB 1KPVA 2M2DA 3H3KA 1TTUA 3QDJB 1MNUL 1X5YA 1I9RL 3QO0B 5F7DA 4OIAA 3DHMA 2MKLC 5B39B 5D7IF 1MH5A 3RVVD 1B6UA 1YEHH 5IGXL 3AREA 1Y0LB 4UUJA 4OV5A 1S7SA 1V8HA 3OKOA 4PJXA 3TIDB 3KXFB 3MXVH 1FC2D 3UJIH 1CDCA 2P5EA 1AI1L 1TETL 3AU1A 5F7FA 2EYRB 3F12A 3WJLC 5ADOH 1MELA 1R3KB 3MBEA 1XIWA 3W9DB 3ZYOA 2MTPA 3QG7H 5FYJE 4WEMB 2W0PA 3SGKC 4OCRL 5D1ZB 4HWBL 4XXCA 4XI5C 3SCMD 5HYIA 1NCCL 1G9EA 2EDWA 3O2DL 4XNXL 3BGAA 4M48L 4YHIA 2A77H 5M94B 5J56B 4GLRH 4NN5C 4DN3L 2EEBA 2I07B 1FZOA 3VMPA 2X4SB 5FIEA 1NUNB 4HH9B 1AY1L 2W59A 3U0TA 5K59E 4XNUL 3RVVC 1CXIA 3ILQD 1MCOL 3RZWA 1B0WA 5F9OH 4LQFH 2J8UE 5H94B 1LHZA 4HWNA 3I3DA 4QXUH 1TMCB 3WUWG 3QDGD 1OAXL 2Y7QA 4WDIB 2YEZB 3AC0A 2L7JA 3WLBA 2HVJB 2IJ0C 3QXVA 4ONHA 5EU4A 2ZCKH 4R3SB 5F1OB 2V5SA 5IB3A 5F8RC 1NL0H 1U95A 4XAKE 2M1KA 1IQDB 4MA3A 3S3PA 1DCLA 4NQXB 5ENWA 3ZL4L 5C0DB 1MAJA 5HGAB 5I75B 3TBSA 2F8OA 1RJCA 3OX8A 4ODWA 5B3NA 2H45A 2VLJB 4OV6F 4YHYC 5HYJB 4RQQB 5D5MA 1OPGH 1G6RB 1OB1A 1IGYB 5TH2B 2R56L 5DMJB 5AUMB 1G0XA 4XC3H 3LIZH 4OCYH 1T7ZA 4WV1A 4HCRH 5ID0B 1BMGA 4LOUC 4K94C 2ORBH 3WFCH 4XTRD 1J0YA 4OCWL 2X42A 3NCMA 4J1UA 4QRRE 5FUCE 2YD5A 4GRWF 3FRUB 3QO1A 1R5IA 1WEJL 4JO1L 1HHKA 2BSED 5ICYA 5SWZE 3BT2H 5FYKL 1JK8B 1S5HA 4HBCL 4HFWB 3ARTA 4X6FB 3RGVB 5B8CC 1CICB 1H15A 2KL6A 4LSUL 5LQBL 2KDGA 5EU7E 4Q97A 1DEEB 2DQGH 4D9LL 2V2XA 3HUJF 1IGMH 5FCSH 2EH8L 1HIMH 4LGSB 3TC9A 3MUY1 4ZFOB 1I7ZA 2Q7NA 3FT4B 4MZ2A 1AH1A 4JZNB 2VZUA 5HPMA 1E6JH 2AJXL 1BREA 1EFXD 5JIPA 3TBTB 3I9GL 4LEOA 1JE6A 3PL6D 4HXAL 4WEUD 5HHOE 1FJ1B 3U48A 4NM4H 4ODUA 4Y5VA 5I9QC 3KLAB 3W11D 5GRJL 3C5JA 2FLBT 1A3RL 2CDGB 1UVQB 5FCUL 5C09E 1B3JA 4C56B 4YHNA 2FBJH 1FVEA 4ZFOL 4XBPA 3E2HC 4D3CL 2B0SH 4OB5H 2IH1A 5TE4H 1N7MH 4K07A 1ZE3C 3MRJB 5EA0L 3ARUA 5IVXF 3EZ8A 2DAVA 4XVJH 1NCWH 4YWGL 3DUUA 4PG9A 3BEWA 4KRLB 3V6OE 3WS6C 3RVTC 1CE1L 4K8RL 3CFCL 3D18B 4OGZA 4OF7A 5IT2L 4ZS6C 3LPWA 2EE9A 1GXEA 3SJVE 1HK6A 5IEHA 4WNQB 4PJAA 4KK9C 3CC5B 3VFOB 5MEOB 5J1AB 2RQ8A 1CE6B 2VXUL 3UTPD 2DM2A 1U3YA 4X4MA 2DRUA 1F97A 5ALBH 1R5WB 4YEFA 1FGNL 4JFEB 5CWSB 4JN2A 4R97C 5EULV 4OLXH 1IGJB 4ZMAT 1RZKC 4TSBL 4JFHE 3BH8A 1F5WA 3V6ZA 5JO5B 2YRZA 3QEUB 4IRJD 3S5LG 3U2SB 2YA1A 1RURL 4KK5D 1DANT 5F9JB 2XG4A 5CJOL 4PFEA 5M7QA 5CEZL 1DQQB 4WUUE 2C3VB 4XNZB 1QFWL 3VFPB 2NY2B 2XZCH 5HHME 2IGFH 3DX6A 5F9WB 2H26A 2EC9U 2QQLH 1U0QA 5DK3A 2YD4A 4RMSA 4JZOA 2W65B 4TSAL 3QULA 1X4XA 5CMAA 2KPNA 1FVCB 1I4FA 4HZAA 3HZYB 2CJUH 2CUIA 4NQVA 5JIIA 3BIKB 1GGIH 4JFFA 3VD3A 1ADQH 2BVYA 3I2CH 5DHYB 3VFWB 1L7TH 3W2DL 2VXVH 3RIFF 1PKQA 4UT7H 5IB5B 3I02B 1D9KA 1WAAE 1VEPA 2CIKB 4PGDB 1FPTH 4EUPH 2PTUA 2R9HD 3S37H 4JREC 4JFQA 5DJDA 3VGDA 4D0CA 1CFTB 1IGIH 4NCC2 2CD0A 1I8KA 2MSPA 4XC1H 4C57C 4G43A 5JXEC 5JR1L 1GZPB 3K8MA 1U2HA 2X9XA 4HJGA 1FZMB 1T0MB 1KG0B 1QVOA 1X5FA 3BKYL 3KPQB 3I85A 3QFJD 3BP4A 4NQED 3QWOB 4FN0A 3KYNA 3SGDH 2PYEA 5FGSA 3UC0L 1HHIA 3O2VL 5LJYH 2P8PB 2WP3T 1CIDA 1ED3B 4JCLA 4QNPF 3ARSA 1P53A 1Q9LB 2ITDB 2R0WL 3T04D 3FQUA 2VDQH 3B5HA 1IM9B 1MCKA 1BOGA 5DMKB 1JNHB 1MQKH 4ZXBA 4JAMB 3PWLA 2RCSL 3QIWD 4JPVL 3BO8B 1FBIH 1R6VA 5JOFB 3CSPA 4UIMB 5D8JH 4DKFL 4POZD 3VD5A 3O3DA 4YDLC 1BVKB 4KXZI 1MCCA 1KCVH 5INDA 1CDHA 1RVFH 3EFDH 4MAYA 5HHNA 1KTKE 2DQTL 5DJXB 2FX7L 1D6EB 2FEDD 1G9ML 1SJVA 5AD0B 5IBLC 4L8SB 1FFNA 3PUCA 1PZUB 4Y2DC 2H9GB 2CK0H 4PGJA 1BFOA 4GAJL 1OAKL 4ZSOA 2AQ2A 5CGMA 4NIKB 3P9MA 1F3JB 3V7MA 1KULA 2ARWA 3W9EA 4KZDH 3LN4A 1NCUA 3F65A 12E8L 2E6JA 4H88L 4BSVA 1P4LB 3VG9B 3MJ7B 5E4EC 3AXLB 3RL2B 3X17A 1DUYA 1NANI 4CKVX 1ZT4A 1YMMB 4MJ2A 3SE3A 4M7KL 3F7YA 3UBXA 4DTGH 3V6BR 4IMKC 1BEYL 2LABA 4OCXH 3QIWC 4TSCH 5J12B 3VG0L 2NZIA 4NBXB 1QSFB 4JRXA 2WANA 2BVQA 5T1KD 4EEEA 4NCC1 4G6ML 4YZFF 5C6TH 1ES0A 1KXVC 1JVKA 4Y4FD 3X13B 1KSRA 1P7QA 2HFGH 3QDHA 1MHEA 3P11H 4HAFA 5DTFB 2DTSA 3DXAE 2X44D 3OKYA 4GQ9H 4U1HB 1F58H 2OJEB 5MEQB 1L7IL 4OFYD 1EVTC 4LSPH 1BF2A 1ETZB 3BN9C 1ZTXL 5DHXB 2Z8VC 5B38A 1YN6A 3HMWH 5HHVH 2NY3C 2DQIL 2E8ZA 3O3EA 3FQWA 5FB8A 3QCUH 3ELAT 5I6XC 2ATPA 4O9HH 4NHCH 3RNKB <